1C2KA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 48
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2kA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2kA02
1BRCE 2YOLA 2WPJS 3OX7U 3UTUH 1SOTA 1YC0A 1OYTH 1C2FA 3TH4H 1BIOA 1SGTA 1WCZA 2C3SA 1SGYE 2ZHFH 5G4BA 1NESE 1ZPZA 4BAHB 1EZQA 1HIAA 2RG3A 3M5LA 2CXVA 2ZU2A 1ZLRA 1OWDA 1AQ7A 1PJPA 2UWLA 2W5EA 1A3EH 1FIWA 3LGTA 3EE0B 1GBFA 3OSYA 4O3UA 3EDXB 1TGTA 3HK6B 2BLWA 2SGAA 3MMGA 4K1SA 3MNSA 3P8FA 5DP9A 1BTYA 2P59A 3ATKA 1UCYE 3E3TA 1HAPH 1G36A 1N1LA 3QTOH 2XYAA 1YPEH 2XWAA 5T6GA 5HM9A 5HGGA 4DVAU 1BOQA 1PFXC 1PPHE 1O3FA 1TNIA 3PV4A 3RU4T 1OWJA 1YKTA 3AVZA 1QA0A 3I29A 2BOHB 2OC8A 3UWIA 1KYNA 1V2VT 4TPYA 3GDUA 3RMLH 2V6NA 1A5IA 1F92A 1W12U 1C1WH 1K1LA 1C2KA 1TOCB 3MU8A 4YZUA 1YBWA 1G3BA 1MKXK 4Y0YE 1P8VC 3RXMA 3TJUA 1C1RA 1DT2A 1WYKA 3M3TA 3V7TA 1HYLA 3QZQA 3CS7A 1PYTD 2GZ9A 4GHTA 2H6MA 2D8WA 1C1SA 1GHXH 2PV9B 1A3BH 3RXAA 1GBCA 1WU1A 1GJBB 1O2GH 3WY8A 1O3BA 1AIXH 4ZAEA 2D1JA 3UIRA 1GMCG 4CRDA 2FMJA 1GBHA 5DP3A 4DY7B 2VWMA 2WPIS 1O3DA 3BTFE 2PKSC 3PROA 3VGCC 1O2JA 1SI5H 1F0TA 4I8HA 4U32A 1V2WT 1TQ7B 4AGKA 1NRSH 5A8XA 2NU1E 1O5FH 3PMJA 3K9XB 1C5NH 4DG4A 1O2NA 3U8OH 1NY22 4K69A 1QA7A 1F5KU 2ZDNA 1C2MA 4IGDA 4X1SU 1T7CA 2FODA 4ABDA 1ZRKA 2ZNKH 3QLPH 3PM3A 3STJA 2P3FH 1JRSA 1OWHA 1FN6A 2A32A 3ENSB 2OP9A 2QV1A 3FVFB 1P3EA 1FZZA 1TBZH 3RXQA 3AAVA 4OS7A 1O5CB 4Q7XA 1FPCH 1BRAA 2AS9A 2Z9GA 4IC5A 4DGJA 2ZGXH 2Z94A 2J34A 3GICB 1SGRE 2ZCLP 4FUIA 5C2ZA 1QCPA 4YLUA 3SBKA 5EPYA 4GLYA 1ZJKA 1Z71A 1UVPA 1GBEA 4X8UH 3LOXA 4ABIA 5E0GA 2TPIZ 6GCHF 1GGDC 4BAOB 1AB9B 1DUEA 4X8SH 1A1RA 2BD8A 3O8CA 1EZUC 1FLEE 1EXFA 4X1QU 3TK9A 2VU8E 4AB8A 1K1IA 3K2UA 1IOEA 2OTVA 2O8WA 3LIWA 3OYPA 4ESTE 5FCKA 2KAIB 2WUBA 1ZYOA 3VEQB 3SQEE 1DY8A 1SHHB 1IQFA 2D26C 2OC0A 1O2UA 1E0FD 5A2MH 1FUJA 1YCPK 1HB0B 4GUXA 4E05H 3AW1A 2PSXA 5EQRA 4HGCA 1RJXB 1XUGA 3NKKA 2Z9KA 4ZKRU 1BJUA 1DLEA 2F91A 2P93A 3MOCA 2QCYA 4A7IB 2AGEX 1FAKH 1DFPA 1BZXE 3SU4A 2VVUA 4ZMAH 1EPTC 4O97A 1UTLM 3TITA 3SU1A 8KME2 2A4RA 1WAYB 1NFXA 3TK5A 5BRRE 5JB8S 3A8CA 2VH0A 4KTSA 1P11E 5ETXA 3PYHA 4D7FA 1S0QA 1BRUP 4KELA 2TBSA 3KCGH 1ZTKA 2VGCB 4ZKOU 2A4OA 3M35A 4JYUH 3ZV8A 5JBAS 2ZECA 1FN8A 2BVSH 1V3XA 1NC6A 1TNGA 4X1NU 2AYWA 3A84A 5A0CA 1C5QA 2FESH 3LH1A 4X8VH 1Z7KA 2VNTA 5ESTE 5JBTA 1EJAA 1QJ6B 1O2RA 1LPKB 4XE4A 1EPTA 1Y3WA 2FI3E 3OU0A 1LVYA 2Y82A 1QL7A 3ZVGA 3ESTA 3SHAH 1E34B 1P2OA 4Q7ZA 1EJNA 4RKJB 2FTMA 1JRTA 2O8LA 1SFIA 4NSVA 3T5FH 2BX4A 1BMNH 2WPKS 4D76A 3GY4A 1ID5H 2ALVA 2FS8A 4AOQA 5PTPA 2ZGHA 1J17T 5EU8A 1SQTA 1EB2A 1EASA 1TGCA 4H6SB 1F5RA 1SLUB 1Y5AT 1PYTC 1EZXC 1S83A 1T8LA 1D3DB 2SNWA 1D3TB 4DURA 4XDEA 1TPSA 1C2LA 1OKXA 1C5RA 1SGFA 4WWYA 4BNRA 5K0HA 4Y79A 1IQEA 2ZHQH 1TPAE 5AVDA 4ZHMU 1IQJA 1MTWA 2BY8X 2XBYA 1GCTB 1V2RT 3Q3XA 3ZZ4A 1O2YA 1ZMLA 2GP9B 1CGJE 3TK6A 1SLWB 2BY7X 1V2UT 2XC5A 7ESTE 1FI8A 3NZIA 1PQAA 3O8RA 1MBMA 2ESTE 4AZ2B 2ODQA 1KY9A 4H42U 7KMEH 1Q3XA 4IMZA 4MPXA 1UK3A 2WYGA 1WQVH 1UJ1A 2XBVA 1VCWA 3QZRA 2THFB 1HAIH 4MLFB 1C5ZB 4K60A 1O5AB 1TGBA 2VJ1A 2HALA 3ZVCA 3ZVBA 1PQ8A 1TX7A 4NG9H 4NIYA 1UHBB 1AVWA 4ISIH 1AE5A 1QNJA 3L3TA 3F6UH 1TMUH 2QXJA 3HPTB 4CRBA 4ZXXH 1EAIA 2RDLA 2JH0D 1GI9B 2I6QA 1LHCH 4OGYA 4X2XA 3GCHB 3DD2H 2J4IA 3E90B 2G4UA 1T8NA 3PB1E 1P9UA 4A5TS 3ZVFA 3E0PB 4Y11E 4ISOA 1P10A 2F9BH 2SFAA 3MNCA 3P8GA 2YNAA 3H5CB 1C2DA 1QBVH 4JCNA 3UQVA 5FXLA 1V2MT 1ZGIA 3A8AA 1PQ7A 2BY6X 1QBOA 1A5GH 3SUGA 3RXEA 1YPHC 1GI8B 3GISB 1NFUA 4X6PA 1GJ8B 2C8ZB 5C5OA 1ZHMA 3U8RH 2QC2A 4FU8A 1HXFH 1HAZB 2BXTH 3TNTA 2JH6D 2AIPA 3MO6A 3M5NA 1HGTH 4YO9A 3TLOA 1TWXB 3LJJA 1KXAA 5SGAE 3RC6A 1O2KA 1PQ5A 1MTVA 5BPEA 3TJVA 4YOGA 4MPWA 2H5DA 2GTBA 1MZDA 1GDUA 3SU6A 1QURH 2Z9JA 2BTCE 1ABIH 1RXPA 2ZO3H 4Y10E 1ELCA 1Y3YA 2UWPA 1C5UA 5F6MA 2PUQH 2FTLE 1AB9C 5EQQA 1O2SA 3UY9A 1S84A 5DK1A 1ARCA 2G4TA 5E0HA 1TRYA 2QY0B 4FUBA 9ESTA 1O38A 3RXDA 2A5IA 2UUYA 1WSSH 2Z3CA 5EXLA 1DXPA 1YGCH 1ZTLA 1FPHH 2XW9A 1HJAB 4B76A 2ZTZA 3MU0A 4Q7YA 3SGAE 3ZVEA 1T4UH 1Z6EA 2SNVA 2RCEA 1G9IE 1TX6A 4ZH8A 2BDIA 3GDSA 4DJZB 3P70B 2OINA 3ZZ5A 4WF8A 5A8ZA 6GCHG 1C1NA 3BN9A 2Z9LA 1V2ST 3M7TA 2R3YA 1GMHF 5HM2A 1K21H 1H8IH 4U2WA 5T3HA 3FP6E 2A1DB 3A8BA 1ELFA 2FYQA 5DJ7A 3U8TH 3VB7A 3ATIA 8GCHF 2NWNA 4JK6A 4NFEA 4SGBE 5GXPA 3KL6A 4OS1A 3IWMA 1MUEB 1EJMA 5C3NA 1HDTH 1C4Y2 1DY9A 4NZLA 4U01A 5C5NA 4AX9H 1O36A 1TAWA 1VJAU 4GAWA 2KAIA 1FY1A 1P9SA 4UE7H 1GBLA 3SNCA 2VWOA 5FBEA 2XBWA 3FZDA 1D6WA 3E16B 4BAQB 1TE0A 1ANDA 2HVXA 4CR9A 1YPGH 1QB6A 1SLVB 2VGCC 2B0FA 2V3OH 2HWLB 1YCPM 3STIA 2C4FH 3SV6A 3M3SA 1ZSLA 3S9CA 4WMEA 1L4DA 1LO6A 1THSH 3BTME 1JIMA 3URDA 1G37A 4QT8C 4IS5A 1C2EA 2A7HA 3SJ9A 4CRFA 2GGVB 5JPMH 1MCVA 2VIDA 3GDVA 4UFFH 1P01A 1D6RA 3SZNA 3FP7E 4FU9A 3LGYA 2ZG0H 4MNYA 1GL1A 1DWBH 1O2OA 3RDZA 1TFXA 3P8NA 1GBIA 1Z8GA 3PTNA 4UEHH 3FZZA 3RP2A 3RXPA 2Y7XA 3LT3A 1G30B 4UDWH 2ZA5A 4I31A 4UFGH 3LPRA 2W26A 1O37A 2DE9A 2P16A 2Y5FA 2ZU1A 1BTHH 3A89A 3M3VA 5F8ZA 3NPSA 1KXEA 5FBIA 1MD8A 1T4VH 5J4SA 3BSQA 1EAXA 2BDBA 1VITG 3ITIA 3O8BA 4NCYA 1GCTC 1AHTH 2ZCHP 4AYVB 2FXRA 1GJ5H 2H1UA 1HCGA 2BHGA 2Y7ZA 2R0LA 3SNEA 3MYWA 2A2QH 1FY8E 1OWEA 1ZR0A 3ODDA 6ESTA 1AGJA 1O2XA 1SFQB 3L6PA 4HTCH 3EA8A 4CRAA 2G5VA 1XVMA 1MD7A 1IQHA 2F9VA 2PW8H 3MNXA 4SGAE 4ABGA 3GY6A 2XC4A 1TNHA 3KNXA 4XOJA 1GBMA 1HAYB 2VWNA 1GHBG 1Z1JA 3ATLA 2P94A 1IQNA 1KTSB 1B0EA 3GCHC 4CH8B 1FY4A 1TQ0B 2BDAA 3SGQE 4OS6A 1DITH 3MO3A 1H9HE 1TX8A 4FVBA 4D9QA 3QX5H 1QL9A 1TLDA 1W2KH 1GVZA 2BB4A 2GKVE 1MQ5A 1LVBA 5GJ4B 1XUFA 4B2BA 1H9IE 3QK1A 3H7TA 2TGDA 1CT0E 1IQLA 1XKAC 2QA9E 2BDYA 1VZQH 3S7KB 4K5ZA 1GCDA 1GBTA 2ZFFH 4JMYA 4WY3A 1ETTH 1XKBC 5GCHG 2GX4A 3A86A 3T62A 3K65B 2A7JA 1OPHB 3MHWU 1BTZA 5DP5A 1LDTT 5EODA 5I46H 1EP5A 1O35A 1P2KA 3A7YA 5C67A 1F0SA 2H9TH 1SGQE 1IQMA 2F9PA 1P3CA 1ZHPA 4ABAA 3UREA 4RKOB 5JB9S 1O3HA 2FIRH 5TCCA 2J2UA 4A6LA 1K1NA 3TJOA 1MBQA 2P3UB 5IYTA 4AB9A 1V2OT 4X6MA 1HNEE 2ANMH 2ANYA 3IITA 1W14U 3BTKE 3E1XB 1CSOE 4OS5A 3LGUA 2V0BA 1F7ZA 1HBTH 4X8TH 4MQAA 2ZEBA 1W7XH 5IDKA 1AUTC 1QRZA 2BQ6B 3Q00A 1CA0B 1NO9H 3TH2H 2A4QA 3BIVH 1MMJN 2OD3B 2JKHA 1P02A 1AY6H 4ZHAA 2CHAB 3RU4D 2W3KA 4X6OA 1PPCE 4UONA 1N8OB 1C5PA 1O2PA 4DCDA 5CE1A 1JIRA 1HJAC 5C20A 5DP6A 1EKBB 3F68H 1OP8A 1VGCB 4GPGA 4WMDA 1TNJA 2ZKSA 3PMBB 2OQ5A 3RM0H 3ZVDA 4OGXA 5FPSA 1YLDA 2TGAA 3VB5A 2EI7A 1Z8IB 1GJ9B 3LONA 1UMAH 1GJDB 3IG6B 3SJ8A 5ABWA 2PGQB 1QQUA 1O2WA 3UPEA 3G01A 1G3DA 1MU8B 2AGGX 4JK5A 3ZZ6A 1CHOG 3Q76A 2BLOA 2ZU3A 1CU1A 4INKA 1O2HA 1V2LT 3EYDA 3RC5A 2GCHF 5AFYH 1BTWA 5TCAA 1MKWH 3LU9B 2HGTH 2BVXH 2PKAA 4Q2KA 4CRGA 2GV7A 2F9UA 1UTOA 2NU2E 3N7OA 1GHVH 2NU4E 2HOBA 2AERH 5AFZH 1LHFH 1W0ZU 2ANKH 2BY9X 2GDEH 1P57B 1RIWB 2J94A 1EOJA 2Y5HA 3U1JB 3GY7A 3VXEH 9LPRA 1ZGVA 1MTNB 1MAXA 4Y8ZA 2F3CE 1HAOH 1GVKB 4WH6A 1ELBA 1LHDH 3CS0A 2ZFPH 4J1YA 4MPUA 1HV7A 1PPBH 3SU0A 3RMMH 3ZZ9A 4GVUA 3MO9A 1C2IA 2EC9H 1GVLA 2VIVA 4Y71A 1NFYA 1DSTA 2A4GA 1T8MA 1QRXA 1JOUB 1GMDF 1Z6JH 3B23B 3C1KA 4XFQA 3TVJB 3CP7A 3GCNA 2GT8A 3QO6A 4FUGA 2RA3A 3A8DA 7GCHF 1BBRK 1WTHD 1O2MA 5H4IB 2VIOA 2GCTB 2WPMS 2ZQ2A 1GI1A 5C1UA 4BXWA 1DWEH 1YPKH 1Y59T 4BANB 1C1PA 3P17H 2XBXA 5FPTA 3QGJA 1Z8JB 5JYIA 1D3QB 1K2I1 3PO1B 4NZQA 1GI7B 1C2JA 2J95A 1SGPE 4ABHA 3KQEA 4Y7AA 1A0HB 2PTCE 5L6NH 2TRMA 3GYLB 3A82A 4MNVA 2FOBA 2ZHWH 1K1JA 4BAMB 2BM2A 2EI6A 2FEQH 1YM0A 2C8WB 1BDAA 1SB1H 2ZF0H 3VB6A 2QN5T 1RD3B 3QDZB 1ZOMA 2STBE 3NCLA 1OX1A 1V2KT 1P12E 1WQSA 2A0QB 2AIQA 1ZSJA 4A1VA 1H9LB 1GHAF 2ZHEH 2LPRA 2PUXB 1DX5M 2G51A 3MU5A 4H4FA 1LCYA 4RSPA 1KDQB 1CT2E 1SGNE 3KEEA 1LPZB 1D3PB 2BZ6H 5FX6A 4A1XA 1C1MA 3FFGA 1C4V2 3D49H 3S7HB 2XXLA 3SV8A 1TRNA 2UWOA 3EA7A 1Z8RA 1NU7B 3GCTG 2TGPZ 1WTGH 3QTVH 4X1RU 2QIQA 3GY8A 1C2HA 2CJIA 1GHYH 1W3CA 1VCPA 2QXGA 5B6OA 1AKSB 2BD7A 4ABEA 1MZAA 1LVMA 2V35A 4D8NA 3RMOH 1UVUH 2UUJB 1O3JA 4X6NA 2B5TB 2R2MB 3LGWA 1JXPA 3QUMP 2PWXA 4U30A 3SJKA 1Q2WA 2FOMB 1ANEA 2F9NA 1QIXB 5F03A 2ZFQH 3FAOA 1HRTH 3BIUH 2H5CA 3ATMA 4YLQH 1NS3A 3ELAH 3V12A 1TA2A 2O8MA 1C5MD 2FWWA 2PFEA 2BXUH 1IQGA 3RXLA 3LGVA 2Q6GA 1SC8U 2IN2A 2ZC9H 3F1SB 2ILNA 1OYQA 4I32A 1CA0C 1OP0A 3A7TA 3U9AH 1O2QA 4CBNA 4INLA 2CHAC 2OUAA 1QBNA 3C27B 3RXOA 1BRBE 1ELDE 5FX5A 3SO3A 1N8OC 2QXHA 2IPHA 1FXYA 4LZ1H 2ZP0H 5DKMA 1BT7A 1UVTH 3SNAA 1BHXF 1VGCC 1F0RA 1OOKB 4B1TA 4KKDA 3SGBE 1N6XA 3SU5A 1CGHA 1G32B 1WUNH 1AD8H 3ZYDA 4X2VA 4CRCA 2XTTB 2QF0A 3GY2A 3PWBA 4LOYH 1ESAA 2R2WU 1QR3E 3LC3A 3TJNA 4LXBH 3ZYEA 4GCHF 2ZTXA 1LKBA 3PMAB 1UO6A 1ZHRA 1ZSKA 5GIBA 1GBDA 1TABE 1BTPA 2J38A 2QYIA 3ZZ7A 1S81A 1THRH 1ARBA 1HAHH 5C1XA 2WV4A 2C90B 1GI0A 4NA8A 3PMHB 3S69A 4DW2U 1NM6A 1HFDA 4Z6AH 1ELTA 4XBBA 2VB0A 2BMGB 5LPEA 2FOFA 3T28A 1B5GH 1RIWC 3BV9B 3UOUA 4CR5A 3RXUA 2H9EH 2CF8H 7LPRA 1C5OH 4BTIB 2F83A 2O9QA 3SQHE 2BD5A 2ODPA 2XRCA 4NSYA 1MTNC 3MH5A 4K8BA 5LPFA 2GCHG 5DP8A 3JZ1B 1OWKA 4WMFA 1UTNA 2BY5X 1IQKA 1YPHE 3T27A 3K6ZA 4IC6A 2AH4X 1OP2A 3SNDA 1UVSH 1AN1E 1AU8A 1EZSC 2ZDKA 1MTUA 3MTYA 4XSKU 2Y81A 3M61U 3A87A 1H8DH 1L2EA 1XXDA 2FO9A 2GCTC 3VPKA 1SQOA 5GPIB 1GDQA 3QGNB 1UK4A 1K28D 3TU7H 2VIQA 5FHTA 2HNTF 3URCA 3RXKA 2DUCA 2EA3A 2P95A 4NFFA 3E91A 5DP7A 2H9HA 2QXIA 3R3GB 1KIGH 3PO1C 4WXIA 4I33A 2Z3DA 1P05A 4WVPE 4LK4A 1O3GA 3BEIB 2PHBA 1QQ4A 3BF6H 3F9EA 1NTPA 3U98H 2ZU5A 3V3MA 4Y8YA 3F9FA 3LGIA 4R8TB 1E35B 4E7RG 4NA9H 2FPZA 3ZVAA 1IHTH 2ZPQA 4X2WA 2HPPH 1V2JT 2ZHDA 2P3TB 1NROH 3AAUA 4FXGH 4NIWA 1HXEH 4IBLH 4HI3A 3P6ZB 1BBRE 5C1YA 1TPPA 3PTBA 1XUJA 1QJ1B 1W8BH 4UFEH 3DFJA 1GMCF 2UUFB 2TGTA 3RLWH 4DIIH 2XCNA 1GHWH 1K1MA 1ZPCA 3SU2A 1TNKA 3W95A 3M7QA 1OS8A 4ABJA 2A5AA 4K1EA 3OTJE 1K22H 1F0UA 2O8TA 1O3IA 1ZMNA 1P03A 2OXSA 1DOJA 3DA9B 2BYAX 2ZFSA 1K1OA 1V6DA 2HLCA 4WH8A 1PPZA 4I8JA 4IMQA 1O2TA 3EGKH 2CN0H 2QGRA 1DM4B 2BOKA 4YOJA 2BVRH 1KDQA 3OY5U 4JZFH 4ZXYH 1ESTA 1TYNA 2A7CA 2VVVA 3UFAA 2BDGA 3SW2B 2AMQA 4K8YA 1EX3A 4B73A 3S9AA 4B74A 1KXBA 3A7XA 1T8OA 1N6YA 3TPIZ 3TNSA 2ZIQH 1O5BB 1GI3A 2D2DA 3B9FH 3JZ2B 1CA8B 2R0KA 1C1OA 1SGCA 2FZZA 1VITH 1YLCA 2JH5D 3RXBA 1EOLA 2SGEE 1QY6A 2ZI2H 3AW0A 4D9RA 3F9GA 4JZ1A 3Q3KA 2ANWA 1UVOA 3E8LA 3CENA 3FP8E 4Y8XA 1GI5A 5E2PA 4ZHLU 3RXJA 4JYVH 3O8DA 1XMNB 2P8OB 5EQSA 3SJOA 2WPHS 1LMWB 1WV7H 1SPJA 1SMFE 1XM1A 1A4WH 1LQEA 5GDSH 1BJVA 1O2LA 1A0JA 5JBCS 5HYOA 1B0FA 1W13U 3W94A 3SNBA 1TB6H 3I78A 1L1GA 3SUFA 3AASA 2GZ7A 6LPRA 3LKWA 2A31A 4YT6H 1O2ZA 4AG1A 3MNBA 2C93B 5DGJA 3SI3H 1J16A 3RXFA 3LDXH 1NPMA 4TYDA 3B8JA 1HJ9A 1P09A 1GBAA 1YCPH 2I6SA 1SQAA 1V2TT 2ZDVH 4BXSA 1EAWA 1KTTB 3LJOA 4Q80A 5EW2H 1QTFA 3DFLA 1O3PB 1W7GH 2HNTE 2B8OH 1ETRH 2OQUA 3A83A 1S82A 1DWDH 1VCQA 1NZQH 1GBJA 4HZHA 3NK8A 1BUIA 4VGCB 1EAUA 1RFNA 2SGQE 5FPYA 1G2MA 4AG2A 1C5SA 3A7ZA 3UUZA 4GCHG 1F5LA 3BTDE 1P2QA 3KQDA 3VFEA 3KQCA 3A88A 1H4WA 1GJ7B 4THNH 2Q1JA 3RMNH 1O3AA 1UHBA 1G3EA 1THPB 1QL8A 1MH0A 3RXCA 1QRWA 1IAUA 4WJG2 3BTGE 1JMOH 3MH6A 4B75A 1MTSA 4YM9A 1O3NA 1SOZA 1GI2A 1J14A 2FOCA 1KLIH 3P92A 2FI5E 2VIWA 2WYJA 1O5EH 5CMXH 5FCRA 1SGDE 4I7YH 4FUJA 1O3OA 1W10U 2ZFTA 2OCVB 2FDAA 3D65E 1KSNA 1IQIA 2Q6FA 1INCA 1XUHA 1L1NA 1KXCA 3U69H 2OBOA 5EXMA 3P8OA 3MFJA 2AMDA 3DUXH 2PGBB 1AZ8A 1GG6B 4I8LA 5EXNA 1QHRB 1ESBA 2XCFA 4AGJA 1YPMH 4F4OC 1KLTA 4BOHA 3SU3A 1CO7E 1GHZA 2B7DH 4JZIA 3KN2A 4ABBA 2ZGCA 4IW4E 1QGFA 1Q31A 2ZGBH 3V13A 2ZTYA 4ABFA 1QB9A 4UD9H 4AYYB 5LPRA 2R3UA 4FU7A 4M7GA 1RTFB 1AFEH 1O5DH 3ATWA 1BMLA 1FJSA 1V2QT 3A7WA 4KTUA 3U1IB 1GDNA 5JDUB 1C9TA 1OWIA 1XVOA 2VINA 1O3CA 2BLVA 2YNBA 3KGPA 4CH2B 1RTLA 1XXFA 3NXPA 4Y6DA 1O2IA 3HK3B 2G00A 1DLKB 2FM2A 4OS4A 2BD3A 4O03A 4UFDH 4K3JA 1PPEE 4E7NA 2AMPA 4TWYA 1GMHG 3KQBA 3ODFA 1BB0B 4IN2A 8ESTE 1CQQA 2BZAA 5DO4H 1UCYH 2SGFE 2G5NA 2BD9A 2ODYB 8GCHG 1Y3XA 4INHA 3VB4A 1XX9A 3GOVB 3A81A 1DWCH 1O3EA 3D62A 5T6DA 3UOPA 3RXHA 2GDDA 1GBBA 2Z9IA 2XC0A 3GY5A 4ZKNU 3BG4B 3EAJA 4DOQA 1SGEE 1CVWH 4JZDH 3Q77A 1CBWB 4YT7H 4A1TA 4DT7B 1D4PB 1ELEE 2G52A 4YOIA 1ANCA 2BQWB 1O3LA 4GSOA 3BTTE 1PPGE 4PROA 3RXGA 3RXSA 1AVGH 4X0WU 1LTOA 2WV5A 1DS2E 2C8YB 3BTEE 1MQ6A 2BD2A 1P2MA 1C1QA 5E0JA 3ZZ8A 2GD4B 1SR5C 1TGSZ 2Z6BD 3L33A 1GJ4H 4KP0A 1FV9A 3T25A 5JBBS 4HFPB 2BDHA 4CHAB 4O3TA 2GV6A 2FOAA 3RXTA 2FOEA 1NT1A 1T31A 2GZ8A 2ZPSA 1NU9A 1V2PT 1LPGB 1ZPBA 1AUJA 4NGAH 1E36B 2P8OC 1TNLA 1WBGB 4MPVA 1GJAB 1W11U 3SOSA 4CBOA 2BQ7B 2CMYA 3F9HA 1TGNA 1V2NT 2FLRH 4A92A 2BD4A 2ZDLA 1K9OE 3TGIE 4ASHA 3SN8A 2J92A 4MNXA 1A61H 1BMAA 3MU1A 4B2AA 1UTJA 1U6QA 2WPLS 1HJ8A 1TALA 1HAVB 4R0IA 1Y3VA 2Z7FE 2R9PA 1NRRH 1GI6A 1HUTH 1Y5BT 3BTHE 2FP7B 3RXIA 2FOHA 4IN1A 2Z3EA 3SORA 3UNQA 2AGIX 2GT7A 4MNWA 1UTQA 3UWJH 4TPIZ 5DP4A 5F8XA 3DHKH 3HKIB 1MU6B 4VGCC 3SI4H 4FVDA 4MVNA 3H7OA 2A2XH 2JETB 5TJXA 1Z1IA 1ANBA 1AO5A 1LVOA 1UTPA 1C1TA 1EB1H 1BMMH 6CHAB 1FAXA 1S5SA 2ZZUH 3BTWE 1TBRH 1AWFH 1XUIA 3V0XA 1SVPA 2IOTA 1SSXA 1BHXB 1CE5A 2LNCA 5E8EH 3GCOA 3RU4E 1E38B 2HPQH 4AFZA 1A0LA 2ZPRA 2ZQ1A 1FIZA 3ZZDA 2M5TA 1O3KA 1FNIA 5EW1H 4JZEH 2NU3E 4WXVA 5K7RA 2FI4E 1ABJH 1RGQA 5LH8A 1LHGH 3DT0H 5E2OA 1GG6C 3NUMA 1C5YB 2EEKA 3A7VA 1J15A 1SLXB 3SV9A 1VITF 3K6YA 1TPOA 1A2CH 3A85A 2BX3A 1O32A 1DE7H 3HGPA 3QWCH 2ZFRH 5CHAB 1YYY1 3RLYH 2EI8A 1P2JA 5DG6A 3M7UA 4KTCA 4YESB 1P0SH 1AI8H 1W0YH 1CHGA 2G55A 5A0AE 1GWAA 1C5VA 3LH3A 3MH4A 5L2ZH 1S6HA 3I77A 3RXVA 1DDJA 3ZZ3A 1P04A 1HAXB 1ETSH 2FX4A 4TY6A 2ZDMA 4GHQA 1C5LH 2ZGJA 1GHBF 4K1TA 1QB1A 1SBWA 1M9UA 2BDCA 1O39A 2PSYA 1C2GA 2PTNA 2FLBH 1BA8B 3LC5A 4XBCA 2H2ZA 1A7SA 5ESBA 1ACBE 1MAYA 3UNSA 1IHSH 2O8UA 3QN7A 2ZWLH 2GMTB 1O0DH 3BTQE 3SUEA 1MKWK 1C4U2 3SJIA 3MU4A 1DPOA 1L4ZA 4NA7A 1EP6A 3M5OA 4NIXA 2AEIH 3ZZBA 1AMHA 1SGFG 5GWZA 3S9BA 4MG3A 5GCHF 1HIAB 4ZKSU 1SGIB 1J9CH 2A45B 3SV7A 1D9IA 1UCYK 3M5MA 1FY3A 3KHVA 4Z0KA 3TGJE 4F49A 2CV3A 4Y76A 1AFQB 1C5TA 3BG4C 4Y0ZE 4X1PU 1GBKA 1AE8H 1CGIE 1P2IA 1ORFA 1K1PA 2Y6TA 1CBWC 4ZROA 4FUCA 3PLPA 4LZ4B 1NFWA 2ULLA 5DPAA 1SHYA 2V3HH 1KLJH 1PPFE 2HRVA 1DUAA 2TIOA 2STAE 1S6FA 1TA6A 2OBQA 4CHAC 1AWHB 1MCTA 4FUFA 2VH6A 2ZU4A 4JYTA 3P95A 3TH3H 1C1UH 3UR6A 1TMTH 1TBQH 4AFSA 1C9PA 4MDSA 2IJOB 1ZRBA 3SHCH 2PR3A 2W7UA 2A5KA 1GMDG 4KGAA 2WUCA 1QJ7B 4RN6A 1BTUA 7GCHG 1DVAH 1LHEH 1F2SE 4Y7BA 2XNIA 3T2NA 1OXGA 3UNRA 2B9LA 1DANH 3RXRA 2OC1A 3KIDU 3VXFH 1EUFA 5AHGH 4O9VA 3PLKA 1UTKA 4ZUHA 2SGPE 3UQOA 3EQ0H 2Y80A 2VIPA 1RRKA 5J4QA 1WOFA 2ZDAH 1CHOF 2CGAA 2PKAB 1TIOA 1O33A 1BTXA 1MKXH 5L2YH 1VJ9U 3BG8A 4B71A 3RM2H 4ISNA 4H6TA 1XUKA 3MWIU 1BITA 1KXFA 1KXDA 1Y8TA 1C1VH 1G3CA 2BLQA 2J9NA 4BTTB 5L30H 5A8YA 2W3IA 2K1QA 4NIVA 1RS0A 3GYMA 2PLXA 2DE8A 2Y5GA 1O34A 3RC4A 5FAHA 4BAKB 4ISLA 3Q3YA 1O2VA 1GHAG 1S0RA 3TGKE 2FX6A 1G2LA 2W7SA 1TONA 2JETC 1VR1H 1O3MA 1LKAA 1A5HA 3TIUA 1HAVA 4TWWA 2ASUB 3HGNA 6CHAC 3R0FA 3S0NA 1YF4A 1FY5A 1HAGE 2PKSB 1BQYA 3MH7A 3VGCB 4AORA 2RA0A 3BEUA 1NN6A 3A80A 2GVFA 1C5WB 2G8TA 1FMGA 1B7XB 1JBUH 2WINI 1AZZA 4K2YA 1OSSA 5AF9H 3M37A 5HMAA 2AFQB 4OS2A 1J8AA 4ISHH 1P2NA 2NU0E 1HPGA 1X7AC 4FUHA 1ELVA 2OC7A 1JWTA 3E0NB 5I25A 1DICA 3OY6U 1NRPH 2UUKB 1S85A 5A09A 5EG4A 3UR9A 1AKSA 3PWCA 1O31A 1BBRH 1FONA 1UTMA 1ZMJA 2Q6DA 1GJ6A 2FYRA 1O30A 2QF3A 2XWBI 1EATA 2F9OA 3KF2A 1ELAA 2QAAA 4XBDA 3HATH 4NWLA 2VWLA 4MTBA 1ZJDA 4CREA 5CHAC 2CF9H 1E37B 1DXWA 3D23A 1GPZA 3M36A 1FDPA 4AN7A 1L0ZA 1GGDB 1Y5UT 4I8KA 1SG8B 3SV2H 1HLTH 2VVCA 1L1JA 1UK2A 1GL0E 3EA9A 2OLGA 1ZZZA 1H1BA 1ELGA 4E06H 1TOMH 4FUEA 1YP9A 4X2YA 4YTAA 4NWKA 2G81E 5EOKA 1YPJH 3HKJB 1NRNH 3MI4A 1RTKA 4B2CA 1O5GH 5F8TA 4DIHH 3FANA 2ZCKP 1EQ9A 1TRMA 2FS9A 3BEFB 5LGOA 1T32A 1LQDB 1CT4E 1A46H 3GCTF 1ZTJA 1NRQH 2GMTC 3GY3A 4D7GA 4AFUA 5A0BA 5T6FA 2FOGA 3VB3A 1P06A 1Y3UA 1BCUH 4I8GA 1TMBH 2ALPA 5HXFA 1EPTB 2HNTC 1DSUA 1QFKH 3T29A 4TY7A 2C8XB 3PLBA 3RUOA 3SUDA 4AFQA 4BTUB 5EGMA 1AFQC 4FUDA 4J2YB 3ZZAA 2SGDE 1YPLH 3ZZCA 1C5XB 3E6PH 3ZV9A 1FQ3A 8LPRA 3T26A 3NWUA 1SL3A 1AVXA 5EPNA 1GJCB 1GI4A
chains in the Genus database with same CATH superfamily
1BRCE 2YOLA 2WPJS 3OX7U 3UTUH 1SOTA 1YC0A 5CDFE 1OYTH 1C2FA 3TH4H 1BIOA 1SGTA 1WCZA 2C3SA 1SGYE 2ZHFH 5G4BA 1NESE 1ZPZA 4BAHB 1EZQA 3PV2A 1HIAA 2RG3A 3M5LA 2CXVA 2ZU2A 1ZLRA 1OWDA 1AQ7A 1PJPA 2UWLA 2W5EA 1A3EH 1FIWA 3LGTA 3EE0B 1GBFA 3OSYA 4O3UA 3EDXB 1TGTA 3HK6B 2BLWA 2SGAA 3MMGA 4K1SA 3MNSA 3P8FA 5DP9A 1BTYA 2P59A 3ATKA 1UCYE 3E3TA 1HAPH 1G36A 1N1LA 3QTOH 2XYAA 1YPEH 5EJ1A 2XWAA 5T6GA 5HM9A 5HGGA 4DVAU 1BOQA 1PFXC 1PPHE 1O3FA 1TNIA 3PV4A 3N99A 3RU4T 1OWJA 1YKTA 3AVZA 1QA0A 3I29A 2BOHB 2KM0A 2OC8A 3UWIA 1KYNA 1V2VT 4TPYA 3GDUA 3RMLH 3PRDA 2V6NA 1A5IA 1F92A 1W12U 1C1WH 1K1LA 1C2KA 1TOCB 3MU8A 4YZUA 1YBWA 1G3BA 1MKXK 4Y0YE 4HG6A 1P8VC 3RXMA 3TJUA 1C1RA 1DT2A 1WYKA 3M3TA 3V7TA 1HYLA 3QZQA 3CS7A 1PYTD 2GZ9A 1FX0B 4GHTA 2H6MA 2D8WA 1C1SA 1GHXH 2PV9B 1A3BH 1SKYE 3RXAA 1GBCA 1WU1A 1GJBB 1O2GH 3WY8A 1O3BA 1AIXH 4ZAEA 2D1JA 3UIRA 1GMCG 4CRDA 2FMJA 1GBHA 5DP3A 4DY7B 2VWMA 2WPIS 1O3DA 3BTFE 1W0KD 2PKSC 3PROA 3VGCC 1O2JA 1SI5H 1K0HA 1F0TA 4I8HA 4U32A 1V2WT 1TQ7B 4AGKA 1NRSH 5A8XA 3DSPA 2NU1E 1O5FH 3PMJA 3K9XB 1C5NH 2L6OA 4DG4A 1O2NA 3U8OH 4F48B 1NY22 4K69A 1QA7A 1F5KU 2ZDNA 1C2MA 4IGDA 4X1SU 1T7CA 2FODA 4ABDA 1ZRKA 2ZNKH 5EJLA 3QLPH 3PM3A 3STJA 2P3FH 1JRSA 1OWHA 1FN6A 2A32A 3ENSB 2OP9A 2QV1A 3FVFB 1P3EA 1FZZA 1TBZH 3RXQA 3AAVA 4OS7A 1O5CB 4Q7XA 1FPCH 1BRAA 2AS9A 2Z9GA 4IC5A 1SQRA 4DGJA 2ZGXH 2Z94A 2J34A 3GICB 1SGRE 2ZCLP 4FUIA 5C2ZA 1QCPA 2V3MA 4YLUA 3SBKA 5EPYA 4GLYA 1ZJKA 1Z71A 1UVPA 1GBEA 4X8UH 3LOXA 4ABIA 5E0GA 2TPIZ 6GCHF 4ACBA 1GGDC 2AHME 1AB9B 4BAOB 1DUEA 4X8SH 1A1RA 2BD8A 3O8CA 1EZUC 1FLEE 1EXFA 4X1QU 3TK9A 2VU8E 4AB8A 1K1IA 3K2UA 1IOEA 2OTVA 5T1VA 2O8WA 3LIWA 3OYPA 4ESTE 5FCKA 2KAIB 2WUBA 2YMSB 1ZYOA 3VEQB 3SQEE 1DY8A 1SHHB 1IQFA 2D26C 2OC0A 3FKSD 1O2UA 5C0TA 1E0FD 5A2MH 1FUJA 1YCPK 1HB0B 4GUXA 4E05H 3AW1A 2PSXA 5EQRA 4HGCA 5EIYA 1RJXB 1XUGA 3NKKA 2Z9KA 4ZKRU 1BJUA 1DLEA 2F91A 2P93A 3MOCA 2QCYA 4A7IB 2AGEX 1FAKH 1E79D 1DFPA 1BZXE 3DCLA 3SU4A 2VVUA 4ZMAH 1EPTC 4O97A 1UTLM 3TITA 3SU1A 8KME2 2A4RA 1WAYB 1NFXA 3TK5A 5BRRE 5JB8S 3A8CA 2VH0A 2YMSD 4KTSA 1P11E 5ETXA 3PYHA 4D7FA 1S0QA 1BRUP 4KELA 2TBSA 3KCGH 1ZTKA 2VGCB 4ZKOU 2A4OA 3M35A 4JYUH 3ZV8A 5JBAS 2ZECA 1FN8A 2BVSH 4RI0A 1V3XA 1NC6A 1TNGA 4X1NU 2AYWA 3A84A 5A0CA 1C5QA 2FESH 3LH1A 4X8VH 1Z7KA 2VNTA 5ESTE 5JBTA 1EJAA 1QJ6B 1O2RA 1LPKB 4XE4A 5HIZA 1EPTA 1Y3WA 1H8HD 2FI3E 3OU0A 5IK2D 1LVYA 2Y82A 1QL7A 4TT3D 3ZVGA 3ESTA 3SHAH 1E34B 1P2OA 4Q7ZA 1EJNA 4RKJB 2FTMA 1JRTA 2O8LA 1SFIA 4NSVA 3T5FH 3OEHD 2BX4A 1BMNH 2WPKS 4D76A 3GY4A 1ID5H 2ALVA 2FS8A 4AOQA 5PTPA 5HKKD 2ZGHA 1J17T 5EU8A 1SQTA 1EB2A 1EASA 1TGCA 4H6SB 1F5RA 1SLUB 1Y5AT 1PYTC 1EZXC 1S83A 1T8LA 1D3DB 2SNWA 1D3TB 4DURA 4XDEA 1TPSA 2XOKD 1C2LA 3F0PA 1OKXA 1C5RA 1SGFA 4WWYA 4BNRA 5K0HA 4Y79A 1IQEA 2ZHQH 1TPAE 5AVDA 4ZHMU 1IQJA 1MTWA 2BY8X 2XBYA 1GCTB 1V2RT 3Q3XA 1YWUA 1O2YA 1ZMLA 3ZZ4A 2GP9B 1CGJE 3TK6A 1SLWB 2BY7X 1V2UT 2XC5A 7ESTE 1FI8A 3NZIA 1PQAA 3O8RA 1MBMA 1EFRD 2ESTE 4AZ2B 2ODQA 2KX4A 1KY9A 4H42U 7KMEH 1Q3XA 4IMZA 4MPXA 1UK3A 2WYGA 1WQVH 1UJ1A 2XBVA 1VCWA 3QZRA 2THFB 1HAIH 4MLFB 1C5ZB 4K60A 1O5AB 1TGBA 2VJ1A 2HALA 3ZVCA 3ZVBA 1PQ8A 1TX7A 4NG9H 4NIYA 1UHBB 1AVWA 4ISIH 1AE5A 1QNJA 3L3TA 3F6UH 1TMUH 2QXJA 3HPTB 4CRBA 4ZXXH 1EAIA 2RDLA 2JH0D 3PRBA 1GI9B 2I6QA 1LHCH 4OGYA 4X2XA 3GCHB 3DD2H 2J4IA 3E90B 2G4UA 1T8NA 3PB1E 1P9UA 4A5TS 3ZVFA 3E0PB 4Y11E 4ISOA 1P10A 2F9BH 2SFAA 3MNCA 3P8GA 2YNAA 3H5CB 1C2DA 1QBVH 4JCNA 3UQVA 5FXLA 1V2MT 1ZGIA 3A8AA 1PQ7A 2BY6X 1QBOA 1A5GH 3SUGA 3RXEA 1YPHC 1GI8B 3GISB 1NFUA 4X6PA 1GJ8B 2C8ZB 5C5OA 1ZHMA 3U8RH 2QC2A 2W6ID 4FU8A 1HXFH 1HAZB 2BXTH 3TNTA 2JH6D 2AIPA 2QF5A 3MO6A 3M5NA 1HGTH 4YO9A 3TLOA 1TWXB 3LJJA 1KXAA 5SGAE 3RC6A 1O2KA 1PQ5A 1MTVA 5BPEA 3TJVA 4YOGA 4MPWA 2H5DA 5F53A 2GTBA 1MZDA 1GDUA 3SU6A 1QURH 2Z9JA 2BTCE 1ABIH 1RXPA 2ZO3H 4Y10E 1ELCA 1Y3YA 2UWPA 1C5UA 5F6MA 2PUQH 2FTLE 1AB9C 5EQQA 1O2SA 3UY9A 1S84A 2JIZD 5DK1A 1ARCA 2WHXA 2G4TA 5E0HA 1TRYA 2QY0B 4FUBA 9ESTA 1O38A 3RXDA 2A5IA 2UUYA 1WSSH 2Z3CA 5EXLA 1DXPA 1YGCH 1ZTLA 1FPHH 2XW9A 1HJAB 4B76A 2ZTZA 3MU0A 2YMSC 4Q7YA 3SGAE 3ZVEA 1T4UH 1Z6EA 2SNVA 2RCEA 4FOUC 1G9IE 1TX6A 4ZH8A 2BDIA 3GDSA 4DJZB 3P70B 2OINA 3ZZ5A 4WF8A 5A8ZA 6GCHG 1C1NA 3BN9A 2Z9LA 1V2ST 3M7TA 2R3YA 1GMHF 5HM2A 1K21H 1H8IH 4U2WA 5T3HA 3FP6E 2A1DB 3A8BA 1ELFA 2FYQA 5DJ7A 3U8TH 3VB7A 1YY3A 3ATIA 8GCHF 2NWNA 4JK6A 4NFEA 4SGBE 5GXPA 3KL6A 4OS1A 3IWMA 1MUEB 1EJMA 5C3NA 1HDTH 1C4Y2 1DY9A 4NZLA 4U01A 5C5NA 4AX9H 1O36A 1TAWA 1VJAU 4GAWA 2KAIA 1FY1A 1P9SA 4UE7H 1GBLA 3SNCA 2VWOA 5FBEA 2XBWA 3FZDA 1D6WA 3E16B 4BAQB 5B6LA 2QE7D 1TE0A 1ANDA 2HVXA 4CR9A 1YPGH 1QB6A 1SLVB 2VGCC 2B0FA 2V3OH 2HWLB 1YCPM 3STIA 2C4FH 3SV6A 2EQNA 3M3SA 1ZSLA 3S9CA 2EY4C 1L4DA 4WMEA 1LO6A 1THSH 3BTME 1JIMA 3URDA 1G37A 4QT8C 4IS5A 1C2EA 2A7HA 3SJ9A 4CRFA 2GGVB 5JPMH 1MCVA 2VIDA 3GDVA 4UFFH 1P01A 3UB0A 1D6RA 3SZNA 3FP7E 4FU9A 3LGYA 2ZG0H 4MNYA 1GL1A 1DWBH 1O2OA 3RDZA 1TFXA 3P8NA 1GBIA 1Z8GA 2M2AA 3PTNA 4UEHH 3FZZA 3RP2A 3RXPA 2Y7XA 3LT3A 1G30B 5DSFA 4UDWH 2ZA5A 4I31A 4UFGH 3LPRA 2W26A 2GJGA 1O37A 2DE9A 2P16A 2Y5FA 4Q4LA 2ZU1A 1BTHH 3A89A 3M3VA 3AK5A 5F8ZA 3NPSA 1KXEA 5FBIA 1MD8A 1T4VH 5J4SA 4RT0A 3BSQA 1EAXA 2BDBA 1VITG 3ITIA 3O8BA 4NCYA 1GCTC 1AHTH 2ZCHP 4AYVB 2FXRA 1GJ5H 2H1UA 1HCGA 2BHGA 2Y7ZA 2R0LA 3SNEA 3MYWA 2A2QH 1FY8E 1OWEA 1ZR0A 3ODDA 6ESTA 1AGJA 1O2XA 1SFQB 3L6PA 4HTCH 3EA8A 4CRAA 2G5VA 1XVMA 1MD7A 1IQHA 2F9VA 2PW8H 3MNXA 2WZQA 4SGAE 4ABGA 3GY6A 2XC4A 1TNHA 3KNXA 4XOJA 1GBMA 1HAYB 2VWNA 1GHBG 1Z1JA 3ATLA 2P94A 1IQNA 1KTSB 1B0EA 3GCHC 4CH8B 1FY4A 1TQ0B 2BDAA 3OAAD 3SGQE 4OS6A 1DITH 3MO3A 1H9HE 1TX8A 4FVBA 4D9QA 3QX5H 3F2FA 1QL9A 1TLDA 1W2KH 1GVZA 2BB4A 2GKVE 1MQ5A 1LVBA 5GJ4B 1XUFA 4B2BA 1H9IE 5KGOA 3QK1A 3H7TA 1W0JD 2TGDA 1CT0E 1IQLA 1XKAC 2QA9E 2BDYA 1VZQH 3S7KB 4K5ZA 1GCDA 1GBTA 5EJZA 2F4LA 2ZFFH 4JMYA 4WY3A 2F43B 1ETTH 1XKBC 5GCHG 2GX4A 3A86A 3T62A 3K65B 2A7JA 1OPHB 3MHWU 1BTZA 5DP5A 1LDTT 5EODA 5I46H 1EP5A 1O35A 1P2KA 3A7YA 5C67A 1F0SA 4B6FA 2H9TH 1SGQE 1IQMA 2F9PA 1P3CA 1ZHPA 4ABAA 3UREA 4RKOB 5JB9S 1O3HA 2FIRH 5TCCA 2J2UA 4A6LA 1K1NA 3FOAA 3TJOA 1MBQA 2K0QA 2P3UB 5IYTA 4AB9A 1V2OT 4X6MA 1HNEE 2ANMH 2ANYA 3IITA 1W14U 3BTKE 3E1XB 1CSOE 4OS5A 3LGUA 2V0BA 1F7ZA 1HBTH 4F55A 4X8TH 4MQAA 2ZEBA 1W7XH 5IDKA 1AUTC 1QRZA 2BQ6B 3Q00A 1CA0B 1NO9H 3TH2H 2A4QA 3BIVH 1MMJN 2OD3B 2JKHA 1P02A 1AY6H 4ZHAA 2CHAB 3RU4D 2W3KA 4X6OA 1PPCE 4UONA 1N8OB 1C5PA 1O2PA 4DCDA 5CE1A 1JIRA 1HJAC 3F2HA 5C20A 5DP6A 1EKBB 3F68H 1OP8A 1VGCB 4GPGA 4WMDA 1TNJA 2ZKSA 3PMBB 2OQ5A 3RM0H 5C17A 3ZVDA 4OGXA 5FPSA 1YLDA 2TGAA 3VB5A 2EI7A 1Z8IB 1GJ9B 3LONA 1UMAH 1GJDB 3IG6B 3SJ8A 5ABWA 5KEDA 2PGQB 1UW7A 1QQUA 1O2WA 3UPEA 3G01A 1G3DA 1MU8B 2AGGX 4JK5A 3ZZ6A 1CHOG 3Q76A 2BLOA 2JDID 2ZU3A 1CU1A 4INKA 1O2HA 1V2LT 3EYDA 3RC5A 2GCHF 5AFYH 1BTWA 5TCAA 1MKWH 3LU9B 2HGTH 2BVXH 2PKAA 4Q2KA 4CRGA 2GV7A 2F9UA 1UTOA 2NU2E 3N7OA 1GHVH 2NU4E 2V7QD 4Z1MD 2HOBA 2AERH 5AFZH 1LHFH 1S6LA 1W0ZU 2ANKH 2BY9X 2GDEH 1P57B 1RIWB 2J94A 1EOJA 2Y5HA 3U1JB 3GY7A 3VXEH 9LPRA 1ZGVA 1MTNB 1MAXA 4Y8ZA 2F3CE 1HAOH 1GVKB 4WH6A 1ELBA 1LHDH 3CS0A 2ZFPH 4J1YA 4MPUA 1HV7A 3N7DA 1PPBH 3KYFA 3SU0A 3RMMH 3ZZ9A 4GVUA 3MO9A 1C2IA 2EC9H 1GVLA 2VIVA 4Y71A 1NFYA 1DSTA 2A4GA 1T8MA 1QRXA 1JOUB 1GMDF 1Z6JH 3B23B 3C1KA 4XFQA 3TVJB 3CP7A 2J98B 3GCNA 2IPQX 2GT8A 3QO6A 4FUGA 2RA3A 3A8DA 7GCHF 1BBRK 2KCPA 1WTHD 1O2MA 5H4IB 2VIOA 2GCTB 2WPMS 2ZQ2A 3VG8A 1GI1A 5C1UA 4BXWA 1DWEH 1YPKH 1Y59T 4BANB 1C1PA 3P17H 2XBXA 5FPTA 3QGJA 1Z8JB 5JYIA 1D3QB 1K2I1 3OEED 2J97A 3PO1B 4NZQA 1GI7B 1C2JA 2J95A 1SGPE 4ABHA 3KQEA 4Y7AA 1A0HB 2PTCE 5L6NH 2TRMA 3GYLB 3A82A 4MNVA 2FOBA 2ZHWH 1K1JA 4BAMB 2BM2A 2EI6A 2FEQH 1YM0A 2C8WB 1BDAA 1SB1H 2ZF0H 3VB6A 2QN5T 1RD3B 3QDZB 1ZOMA 2STBE 3NCLA 1OX1A 1V2KT 1NBMD 1P12E 1WQSA 2A0QB 2AIQA 1ZSJA 4A1VA 1H9LB 2LP6A 1GHAF 2ZHEH 2LPRA 2PUXB 1DX5M 2G51A 3MU5A 4H4FA 1LCYA 4RSPA 1KDQB 2WSSD 1CT2E 1SGNE 3KEEA 1LPZB 1D3PB 2BZ6H 5FX6A 4A1XA 1C1MA 3FFGA 1C4V2 3D49H 3S7HB 2XXLA 3SV8A 2VBCA 1TRNA 2UWOA 3EA7A 1Z8RA 1NU7B 3GCTG 2TGPZ 1MABB 1WTGH 3QTVH 4X1RU 2QIQA 3GY8A 1C2HA 2CJIA 1GHYH 3F0OA 1W3CA 1VCPA 2QXGA 5B6OA 1AKSB 2BD7A 4ABEA 1MZAA 1LVMA 2V35A 4D8NA 3RMOH 1UVUH 2UUJB 1O3JA 4X6NA 2B5TB 2R2MB 2QF4A 3LGWA 1JXPA 3QUMP 2PWXA 4U30A 3SJKA 1Q2WA 2FOMB 1ANEA 2F9NA 4AC9A 1QIXB 5F03A 2ZFQH 3FAOA 1HRTH 3BIUH 2H5CA 3ATMA 3KYGA 2J5UA 4YLQH 1NS3A 3ELAH 3V12A 1TA2A 2O8MA 1C5MD 2FWWA 2PFEA 2BXUH 1IQGA 3RXLA 3LGVA 2Q6GA 1SC8U 2IN2A 2ZC9H 3F1SB 2ILNA 1OYQA 3H09A 4I32A 1CA0C 1OP0A 3A7TA 3OFND 3U9AH 1O2QA 4CBNA 4INLA 2CHAC 2OUAA 1QBNA 3C27B 3RXOA 1BRBE 1ELDE 5FX5A 3SO3A 1N8OC 2QXHA 2IPHA 1FXYA 4LZ1H 2ZP0H 5DKMA 1BT7A 1UVTH 3SNAA 1BHXF 1VGCC 1F0RA 1OOKB 2LELA 4B1TA 4KKDA 3SGBE 1N6XA 3SU5A 1CGHA 1G32B 1WUNH 1AD8H 3ZYDA 4X2VA 4CRCA 2XTTB 2QF0A 3GY2A 3PWBA 4LOYH 1ESAA 2R2WU 1QR3E 4RT1A 3LC3A 3TJNA 4LXBH 3ZYEA 4ZCNA 4GCHF 1OHHD 2ZTXA 1LKBA 3PMAB 1UO6A 1ZHRA 1ZSKA 5GIBA 1GBDA 3SZEA 1TABE 1BTPA 2J38A 2QYIA 3ZZ7A 1S81A 1THRH 1ARBA 1HAHH 4M9FA 5C1XA 2WV4A 2C90B 1GI0A 2L74A 4NA8A 3PMHB 3S69A 4DW2U 1NM6A 1HFDA 4Z6AH 1ELTA 4XBBA 2VB0A 2BMGB 5LPEA 2FOFA 3T28A 1B5GH 1RIWC 3BV9B 3UOUA 4CR5A 3RXUA 2H9EH 2CF8H 7LPRA 1C5OH 4BTIB 2F83A 2O9QA 3SQHE 2BD5A 2ODPA 2XRCA 4NSYA 1MTNC 3MH5A 4K8BA 5LPFA 2GCHG 5DP8A 3JZ1B 1OWKA 4WMFA 1UTNA 2BY5X 1IQKA 1YPHE 3T27A 3K6ZA 4IC6A 2AH4X 1OP2A 3SNDA 1UVSH 1AN1E 1AU8A 1EZSC 2ZDKA 1MTUA 3MTYA 4XSKU 2Y81A 3M61U 3A87A 1H8DH 1L2EA 1XXDA 2FO9A 2GCTC 3VPKA 1SQOA 5GPIB 1GDQA 3QGNB 1UK4A 2JJ1D 1K28D 3TU7H 2VIQA 5FHTA 2HNTF 3URCA 3RXKA 2DUCA 2EA3A 2P95A 4NFFA 3E91A 2K8IA 5DP7A 2H9HA 2QXIA 3R3GB 1KIGH 3PO1C 4WXIA 4I33A 2Z3DA 1P05A 4WVPE 4LK4A 4YXWD 2HLDD 1O3GA 3BEIB 2PHBA 1QQ4A 3BF6H 3F9EA 1NTPA 3U98H 2ZU5A 2J98A 4Y8YA 3V3MA 3F9FA 3LGIA 4R8TB 1E35B 4E7RG 4NA9H 2FPZA 3DSOA 3ZVAA 1IHTH 2ZPQA 4X2WA 2HPPH 1V2JT 2ZHDA 2P3TB 1NROH 3AAUA 4FXGH 4NIWA 1HXEH 4IBLH 4HI3A 1WDIA 3F2GA 3P6ZB 1BBRE 5C1YA 1TPPA 3PTBA 1XUJA 1QJ1B 1W8BH 4UFEH 3DFJA 1GMCF 2UUFB 2TGTA 3RLWH 4DIIH 2XCNA 1GHWH 1K1MA 1ZPCA 3SU2A 1TNKA 3W95A 3M7QA 1OS8A 4ABJA 2A5AA 4K1EA 3OTJE 1K22H 1F0UA 2O8TA 1O3IA 1ZMNA 1P03A 2OXSA 1DOJA 3DA9B 2BYAX 2ZFSA 1K1OA 2CK3D 1V6DA 2HLCA 4WH8A 1PPZA 4I8JA 4I86A 4IMQA 1O2TA 3EGKH 2CN0H 2QGRA 1DM4B 2BOKA 4YOJA 2BVRH 1KDQA 3OY5U 4JZFH 4ZXYH 1ESTA 1TYNA 2A7CA 2VVVA 3UFAA 1WXRA 2BDGA 1E1RD 3SW2B 2AMQA 4K8YA 1EX3A 4B73A 3S9AA 4B74A 1KXBA 3A7XA 1T8OA 1N6YA 3TPIZ 3TNSA 2WPDD 2ZIQH 1O5BB 1GI3A 2D2DA 3B9FH 3JZ2B 1CA8B 2R0KA 1C1OA 1SGCA 2FZZA 1VITH 1YLCA 2JH5D 3RXBA 1EOLA 2SGEE 1QY6A 2ZI2H 3AW0A 4D9RA 3F9GA 4JZ1A 3Q3KA 2ANWA 1UVOA 3E8LA 2XNDD 3CENA 3FP8E 4Y8XA 1GI5A 5E2PA 4ZHLU 3RXJA 4JYVH 3O8DA 1XMNB 2P8OB 5EQSA 3SJOA 2WPHS 1LMWB 1WV7H 1SPJA 1SMFE 1XM1A 1A4WH 1LQEA 5GDSH 1BJVA 1O2LA 1A0JA 5JBCS 5HYOA 1B0FA 1W13U 3W94A 3PV5A 3SNBA 1TB6H 3I78A 1L1GA 3SUFA 3AASA 2GZ7A 6LPRA 3LKWA 3N7EA 2A31A 4YT6H 1O2ZA 4AG1A 3MNBA 2C93B 5DGJA 3SI3H 1J16A 3RXFA 3LDXH 1NPMA 4TYDA 3B8JA 1HJ9A 1P09A 1GBAA 1YCPH 2I6SA 2RDEA 1SQAA 1V2TT 2ZDVH 4BXSA 1EAWA 1KTTB 3LJOA 4Q80A 5EW2H 1QTFA 3DFLA 1O3PB 1W7GH 2HNTE 1KMHB 2B8OH 1ETRH 2OQUA 3A83A 1S82A 1DWDH 1VCQA 1NZQH 1GBJA 4HZHA 3NK8A 1BUIA 4VGCB 1EAUA 1RFNA 2SGQE 5FPYA 1G2MA 4AG2A 3W1EA 1C5SA 3A7ZA 3UUZA 4GCHG 1F5LA 2KCYA 3BTDE 2OK5A 1P2QA 3KQDA 3VFEA 3KQCA 1QZ8A 1H4WA 3A88A 1GJ7B 4THNH 2Q1JA 3RMNH 5FL7D 1O3AA 1UHBA 1G3EA 1THPB 4B6EA 1QL8A 1MH0A 3RXCA 1QRWA 1IAUA 4WJG2 3BTGE 1JMOH 3MH6A 4B75A 1MTSA 4YM9A 1O3NA 1SOZA 3UAIC 1GI2A 1J14A 2FOCA 1KLIH 3P92A 2FI5E 2VIWA 2WYJA 1O5EH 5CMXH 5FCRA 1SGDE 4I7YH 4FUJA 1O3OA 1W10U 2ZFTA 2OCVB 2FDAA 3D65E 1KSNA 1IQIA 2Q6FA 3F3BA 1INCA 1XUHA 1L1NA 1KXCA 3U69H 2OBOA 5EXMA 3P8OA 3MFJA 2AMDA 3DUXH 2PGBB 1AZ8A 1GG6B 4I8LA 5EXNA 1QHRB 1ESBA 1COWD 2XCFA 3WW7A 1YPMH 4AGJA 1VKYA 4F4OC 1KLTA 4BOHA 3SU3A 1CO7E 1GHZA 2B7DH 4JZIA 3KN2A 4ABBA 2ZGCA 4IW4E 1QGFA 1Q31A 4TSFD 2ZGBH 3V13A 2ZTYA 4ABFA 1QB9A 4UD9H 4AYYB 5LPRA 2R3UA 3KQ5A 4FU7A 4M7GA 1RTFB 1AFEH 1O5DH 3ATWA 1BMLA 1FJSA 1V2QT 3A7WA 4KTUA 3U1IB 1GDNA 5JDUB 1C9TA 1OWIA 1XVOA 2VINA 1O3CA 2BLVA 2YNBA 3KGPA 4CH2B 1RTLA 1XXFA 3NXPA 4Y6DA 1O2IA 3HK3B 2G00A 1DLKB 2FM2A 2KZ4A 2BD3A 4O03A 4OS4A 4UFDH 2JJ2D 4K3JA 1PPEE 4E7NA 2AMPA 3ZIAD 4TWYA 1GMHG 3KQBA 3ODFA 1BB0B 4IN2A 8ESTE 1CQQA 2BZAA 5DO4H 1UCYH 2SGFE 2G5NA 2BD9A 2ODYB 8GCHG 2PP6A 1Y3XA 4INHA 3VB4A 1XX9A 3GOVB 3A81A 1DWCH 1O3EA 1YLNA 3D62A 5T6DA 3UOPA 3RXHA 2GDDA 1GBBA 2Z9IA 2XC0A 3GY5A 4ZKNU 3BG4B 3EAJA 4DOQA 1SGEE 1CVWH 4JZDH 3Q77A 1CBWB 4YT7H 4A1TA 4DT7B 1D4PB 1ELEE 2G52A 4YOIA 1ANCA 2BQWB 1O3LA 4GSOA 3BTTE 1PPGE 3FO8D 4PROA 3RXGA 3RXSA 1AVGH 4X0WU 5C0UA 1LTOA 2WV5A 1DS2E 2C8YB 3BTEE 1MQ6A 2BD2A 1P2MA 1C1QA 5E0JA 3ZZ8A 2GD4B 1SR5C 1TGSZ 2Z6BD 3L33A 1GJ4H 4KP0A 1FV9A 3T25A 5JBBS 4HFPB 2BDHA 4CHAB 4O3TA 2RFKC 2GV6A 2FOAA 3RXTA 2FOEA 1NT1A 1T31A 2GZ8A 2ZPSA 1NU9A 1V2PT 1LPGB 1ZPBA 1AUJA 4NGAH 1E36B 2P8OC 3SYJA 5KECA 1TNLA 1WBGB 4MPVA 1GJAB 1W11U 3SOSA 4CBOA 2BQ7B 2CMYA 2KCOA 3F9HA 1TGNA 1V2NT 2FLRH 4A92A 2HVYB 2BD4A 2ZDLA 1K9OE 3TGIE 4ASHA 3SN8A 2J92A 4MNXA 1A61H 1BMAA 3MU1A 4B2AA 1UTJA 1U6QA 2WPLS 1HJ8A 1TALA 1HAVB 4R0IA 1Y3VA 2Z7FE 2R9PA 1NRRH 1GI6A 1HUTH 1Y5BT 3BTHE 2FP7B 3RXIA 2FOHA 4IN1A 2Z3EA 3SORA 3UNQA 5GNDA 2AGIX 2GT7A 4MNWA 1UTQA 3UWJH 4TPIZ 5DP4A 5F8XA 3DHKH 3HKIB 1MU6B 4VGCC 3SI4H 4FVDA 4MVNA 3H7OA 2A2XH 2JETB 5TJXA 1Z1IA 3NRLA 4Q63A 1ANBA 1AO5A 1LVOA 1UTPA 1C1TA 1EB1H 1BMMH 6CHAB 1FAXA 1S5SA 2ZZUH 3BTWE 1TBRH 1AWFH 1XUIA 3V0XA 1SVPA 2IOTA 1SSXA 1BHXB 1CE5A 2LNCA 5E8EH 3GCOA 3RU4E 1E38B 2HPQH 4AFZA 1A0LA 2ZPRA 2ZQ1A 1FIZA 3ZZDA 2M5TA 5C94A 1O3KA 1FNIA 5EW1H 4JZEH 2NU3E 4WXVA 5K7RA 2FI4E 1ABJH 1RGQA 5LH8A 1LHGH 3DT0H 5E2OA 1GG6C 3NUMA 1C5YB 2EEKA 3U28C 3A7VA 1J15A 1SLXB 3SV9A 1VITF 3K6YA 1TPOA 1A2CH 3A85A 2BX3A 1O32A 1DE7H 3HGPA 3QWCH 2ZFRH 5CHAB 1YYY1 3RLYH 2EI8A 2KFWA 1P2JA 5DG6A 3M7UA 4KTCA 4YESB 1P0SH 4P02A 1AI8H 1W0YH 1CHGA 2G55A 5A0AE 1GWAA 1C5VA 3LH3A 3MH4A 5L2ZH 1S6HA 3I77A 3RXVA 1DDJA 3ZZ3A 1P04A 1HAXB 1ETSH 2FX4A 4TY6A 2ZDMA 4GHQA 1C5LH 2ZGJA 1GHBF 4K1TA 1QB1A 1SBWA 1M9UA 2BDCA 1O39A 2PSYA 1C2GA 2PTNA 2FLBH 1BA8B 4OM9A 3LC5A 4XBCA 2H2ZA 4XD7D 1A7SA 5ESBA 1ACBE 1MAYA 4XRNA 3UNSA 1IHSH 2O8UA 3FN8A 3QN7A 2ZWLH 2GMTB 1O0DH 3BTQE 3SUEA 1BMFD 1MKWK 1C4U2 3SJIA 5DN6D 3MU4A 1DPOA 1L4ZA 4NA7A 1EP6A 3M5OA 4NIXA 2AEIH 3ZZBA 1AMHA 1SGFG 5GWZA 3S9BA 4MG3A 5GCHF 1HIAB 4ZKSU 1SGIB 1J9CH 2A45B 3SV7A 1D9IA 1UCYK 3M5MA 1FY3A 3KHVA 4Z0KA 3TGJE 4F49A 2CV3A 4Y76A 1AFQB 1C5TA 3BG4C 3WWBA 4Y0ZE 4X1PU 1GBKA 1AE8H 1CGIE 1P2IA 1ORFA 1K1PA 2Y6TA 1CBWC 4ZROA 4P00A 4DT4A 4FUCA 3PLPA 4LZ4B 1NFWA 2ULLA 5DPAA 1SHYA 2V3HH 1KLJH 1PPFE 2HRVA 1DUAA 2TIOA 2STAE 1S6FA 1TA6A 2OBQA 4CHAC 1AWHB 1MCTA 4FUFA 2VH6A 1E1QD 2ZU4A 4JYTA 3P95A 3TH3H 1C1UH 3UR6A 1TMTH 1NBME 1TBQH 4AFSA 1C9PA 4MDSA 2IJOB 1ZRBA 3SHCH 2PR3A 4ACAA 2W7UA 2A5KA 1GMDG 4KGAA 2WUCA 3MQKC 1QJ7B 4RN6A 1BTUA 7GCHG 1DVAH 1LHEH 1F2SE 4Y7BA 2XNIA 3T2NA 1OXGA 3UNRA 2B9LA 1DANH 3RXRA 2OC1A 3KIDU 4FETA 3VXFH 1EUFA 5AHGH 4O9VA 3PLKA 1UTKA 4ZUHA 2SGPE 3UQOA 3EQ0H 2KCAA 2Y80A 2VIPA 1RRKA 5J4QA 1WOFA 2ZDAH 1CHOF 2CGAA 2PKAB 1TIOA 4ASUD 1O33A 1BTXA 1MKXH 5L2YH 1VJ9U 3BG8A 3WWFA 4B71A 3RM2H 4ISNA 4H6TA 1XUKA 3MWIU 1BITA 1KXFA 1KXDA 1Y8TA 1C1VH 1G3CA 2BLQA 2J9NA 4BTTB 5L30H 5A8YA 2W3IA 3DSGA 2K1QA 4NIVA 1RS0A 3OE7D 3GYMA 2WV9A 2PLXA 2DE8A 2Y5GA 1O34A 3RC4A 5FAHA 4BAKB 4ISLA 3Q3YA 1O2VA 1GHAG 1S0RA 3TGKE 2FX6A 1G2LA 2W7SA 1TONA 3GS9A 2JETC 1VR1H 1O3MA 1LKAA 1A5HA 1H8ED 3TIUA 1HAVA 3EE7A 4TWWA 2ASUB 3HGNA 6CHAC 3R0FA 3S0NA 1YF4A 1FY5A 1HAGE 5CHBA 2PKSB 1BQYA 3MH7A 3VGCB 4AORA 2RA0A 3BEUA 1NN6A 3A80A 2GVFA 1C5WB 2G8TA 1FMGA 1B7XB 1JBUH 2WINI 1AZZA 4K2YA 1OSSA 5AF9H 3M37A 5HMAA 2AFQB 4OS2A 1J8AA 4ISHH 1P2NA 2NU0E 1HPGA 1X7AC 4FUHA 1ELVA 2OC7A 1JWTA 3E0NB 5I25A 1DICA 3OY6U 1NRPH 2UUKB 1S85A 5A09A 5EG4A 3UR9A 1AKSA 3PWCA 1O31A 1BBRH 1FONA 1UTMA 1ZMJA 2Q6DA 1GJ6A 2FYRA 1O30A 2QF3A 2XWBI 1EATA 2F9OA 3KF2A 1ELAA 2QAAA 4XBDA 3HATH 4NWLA 2VWLA 4MTBA 1ZJDA 4CREA 5CHAC 2CF9H 5HIYA 1E37B 1DXWA 3D23A 1GPZA 3M36A 1FDPA 4AN7A 1L0ZA 1GGDB 1Y5UT 4I8KA 1SG8B 3SV2H 1HLTH 2VVCA 1L1JA 1UK2A 1GL0E 3EA9A 2OLGA 1ZZZA 1H1BA 1ELGA 4E06H 1TOMH 4FUEA 1YP9A 4X2YA 4YTAA 4NWKA 2G81E 5EOKA 1YPJH 3HKJB 1NRNH 3CNRA 3MI4A 1RTKA 4B2CA 1O5GH 5F8TA 4DIHH 3FANA 2ZCKP 1EQ9A 1TRMA 2FS9A 3BEFB 5LGOA 1T32A 1LQDB 1CT4E 1A46H 3GCTF 1ZTJA 1NRQH 2GMTC 3GY3A 4D7GA 4AFUA 2W6JD 5A0BA 5T6FA 2FOGA 3VB3A 1P06A 1Y3UA 1BCUH 4I8GA 1TMBH 2ALPA 2IJD1 5HXFA 1EPTB 2HNTC 1DSUA 1QFKH 3T29A 4TY7A 2C8XB 3PLBA 3RUOA 3SUDA 4AFQA 4BTUB 5EGMA 1AFQC 4FUDA 4J2YB 3ZZAA 2SGDE 1YPLH 3ZZCA 1C5XB 2KR7A 3E6PH 3ZV9A 1FQ3A 3OTPA 8LPRA 3T26A 3NWUA 1SL3A 1AVXA 5EPNA 1GJCB 1GI4A
chains in the Genus database with same CATH topology
1BRCE 2YOLA 2WPJS 3OX7U 3UTUH 1SOTA 1YC0A 1OYTH 1C2FA 3TH4H 1BIOA 1SGTA 1WCZA 2C3SA 1SGYE 2ZHFH 5G4BA 1NESE 1ZPZA 4BAHB 1EZQA 1HIAA 2RG3A 3M5LA 2CXVA 2ZU2A 1ZLRA 1OWDA 1AQ7A 1PJPA 2UWLA 2W5EA 1A3EH 1FIWA 3LGTA 3EE0B 1GBFA 3OSYA 4O3UA 3EDXB 1TGTA 3HK6B 2BLWA 2SGAA 3MMGA 4K1SA 3MNSA 3P8FA 5DP9A 1BTYA 2P59A 3ATKA 1UCYE 3E3TA 1HAPH 1G36A 1N1LA 3QTOH 2XYAA 1YPEH 2XWAA 5T6GA 5HM9A 5HGGA 4DVAU 1BOQA 1PFXC 1PPHE 1O3FA 1TNIA 3PV4A 3RU4T 1OWJA 1YKTA 3AVZA 1QA0A 3I29A 2BOHB 2OC8A 3UWIA 1KYNA 1V2VT 4TPYA 3GDUA 3RMLH 2V6NA 1A5IA 1F92A 1W12U 1C1WH 1K1LA 1C2KA 1TOCB 3MU8A 4YZUA 1YBWA 1G3BA 1MKXK 4Y0YE 1P8VC 3RXMA 3TJUA 1C1RA 1DT2A 1WYKA 3M3TA 3V7TA 1HYLA 3QZQA 3CS7A 1PYTD 2GZ9A 4GHTA 2H6MA 2D8WA 1C1SA 1GHXH 2PV9B 1A3BH 3RXAA 1GBCA 1WU1A 1GJBB 1O2GH 3WY8A 1O3BA 1AIXH 4ZAEA 2D1JA 3UIRA 1GMCG 4CRDA 2FMJA 1GBHA 5DP3A 4DY7B 2VWMA 2WPIS 1O3DA 3BTFE 2PKSC 3PROA 3VGCC 1O2JA 1SI5H 1F0TA 4I8HA 4U32A 1V2WT 1TQ7B 4AGKA 1NRSH 5A8XA 2NU1E 1O5FH 3PMJA 3K9XB 1C5NH 4DG4A 1O2NA 3U8OH 1NY22 4K69A 1QA7A 1F5KU 2ZDNA 1C2MA 4IGDA 4X1SU 1T7CA 2FODA 4ABDA 1ZRKA 2ZNKH 3QLPH 3PM3A 3STJA 2P3FH 1JRSA 1OWHA 1FN6A 2A32A 3ENSB 2OP9A 2QV1A 3FVFB 1P3EA 1FZZA 1TBZH 3RXQA 3AAVA 4OS7A 1O5CB 4Q7XA 1FPCH 1BRAA 2AS9A 2Z9GA 4IC5A 4DGJA 2ZGXH 2Z94A 2J34A 3GICB 1SGRE 2ZCLP 4FUIA 5C2ZA 1QCPA 4YLUA 3SBKA 5EPYA 4GLYA 1ZJKA 1Z71A 1UVPA 1GBEA 4X8UH 3LOXA 4ABIA 5E0GA 2TPIZ 6GCHF 1GGDC 4BAOB 1AB9B 1DUEA 4X8SH 1A1RA 2BD8A 3O8CA 1EZUC 1FLEE 1EXFA 4X1QU 3TK9A 2VU8E 4AB8A 1K1IA 3K2UA 1IOEA 2OTVA 2O8WA 3LIWA 3OYPA 4ESTE 5FCKA 2KAIB 2WUBA 1ZYOA 3VEQB 3SQEE 1DY8A 1SHHB 1IQFA 2D26C 2OC0A 1O2UA 1E0FD 5A2MH 1FUJA 1YCPK 1HB0B 4GUXA 4E05H 3AW1A 2PSXA 5EQRA 4HGCA 1RJXB 1XUGA 3NKKA 2Z9KA 4ZKRU 1BJUA 1DLEA 2F91A 2P93A 3MOCA 2QCYA 4A7IB 2AGEX 1FAKH 1DFPA 1BZXE 3SU4A 2VVUA 4ZMAH 1EPTC 4O97A 1UTLM 3TITA 3SU1A 8KME2 2A4RA 1WAYB 1NFXA 3TK5A 5BRRE 5JB8S 3A8CA 2VH0A 4KTSA 1P11E 5ETXA 3PYHA 4D7FA 1S0QA 1BRUP 4KELA 2TBSA 3KCGH 1ZTKA 2VGCB 4ZKOU 2A4OA 3M35A 4JYUH 3ZV8A 5JBAS 2ZECA 1FN8A 2BVSH 1V3XA 1NC6A 1TNGA 4X1NU 2AYWA 3A84A 5A0CA 1C5QA 2FESH 3LH1A 4X8VH 1Z7KA 2VNTA 5ESTE 5JBTA 1EJAA 1QJ6B 1O2RA 1LPKB 4XE4A 1EPTA 1Y3WA 2FI3E 3OU0A 1LVYA 2Y82A 1QL7A 3ZVGA 3ESTA 3SHAH 1E34B 1P2OA 4Q7ZA 1EJNA 4RKJB 2FTMA 1JRTA 2O8LA 1SFIA 4NSVA 3T5FH 2BX4A 1BMNH 2WPKS 4D76A 3GY4A 1ID5H 2ALVA 2FS8A 4AOQA 5PTPA 2ZGHA 1J17T 5EU8A 1SQTA 1EB2A 1EASA 1TGCA 4H6SB 1F5RA 1SLUB 1Y5AT 1PYTC 1EZXC 1S83A 1T8LA 1D3DB 2SNWA 1D3TB 4DURA 4XDEA 1TPSA 1C2LA 1OKXA 1C5RA 1SGFA 4WWYA 4BNRA 5K0HA 4Y79A 1IQEA 2ZHQH 1TPAE 5AVDA 4ZHMU 1IQJA 1MTWA 2BY8X 2XBYA 1GCTB 1V2RT 3Q3XA 3ZZ4A 1O2YA 1ZMLA 2GP9B 1CGJE 3TK6A 1SLWB 2BY7X 1V2UT 2XC5A 7ESTE 1FI8A 3NZIA 1PQAA 3O8RA 1MBMA 2ESTE 4AZ2B 2ODQA 1KY9A 4H42U 7KMEH 1Q3XA 4IMZA 4MPXA 1UK3A 2WYGA 1WQVH 1UJ1A 2XBVA 1VCWA 3QZRA 2THFB 1HAIH 4MLFB 1C5ZB 4K60A 1O5AB 1TGBA 2VJ1A 2HALA 3ZVCA 3ZVBA 1PQ8A 1TX7A 4NG9H 4NIYA 1UHBB 1AVWA 4ISIH 1AE5A 1QNJA 3L3TA 3F6UH 1TMUH 2QXJA 3HPTB 4CRBA 4ZXXH 1EAIA 2RDLA 2JH0D 1GI9B 2I6QA 1LHCH 4OGYA 4X2XA 3GCHB 3DD2H 2J4IA 3E90B 2G4UA 1T8NA 3PB1E 1P9UA 4A5TS 3ZVFA 3E0PB 4Y11E 4ISOA 1P10A 2F9BH 2SFAA 3MNCA 3P8GA 2YNAA 3H5CB 1C2DA 1QBVH 4JCNA 3UQVA 5FXLA 1V2MT 1ZGIA 3A8AA 1PQ7A 2BY6X 1QBOA 1A5GH 3SUGA 3RXEA 1YPHC 1GI8B 3GISB 1NFUA 4X6PA 1GJ8B 2C8ZB 5C5OA 1ZHMA 3U8RH 2QC2A 4FU8A 1HXFH 1HAZB 2BXTH 3TNTA 2JH6D 2AIPA 3MO6A 3M5NA 1HGTH 4YO9A 3TLOA 1TWXB 3LJJA 1KXAA 5SGAE 3RC6A 1O2KA 1PQ5A 1MTVA 5BPEA 3TJVA 4YOGA 4MPWA 2H5DA 2GTBA 1MZDA 1GDUA 3SU6A 1QURH 2Z9JA 2BTCE 1ABIH 1RXPA 2ZO3H 4Y10E 1ELCA 1Y3YA 2UWPA 1C5UA 5F6MA 2PUQH 2FTLE 1AB9C 5EQQA 1O2SA 3UY9A 1S84A 5DK1A 1ARCA 2G4TA 5E0HA 1TRYA 2QY0B 4FUBA 9ESTA 1O38A 3RXDA 2A5IA 2UUYA 1WSSH 2Z3CA 5EXLA 1DXPA 1YGCH 1ZTLA 1FPHH 2XW9A 1HJAB 4B76A 2ZTZA 3MU0A 4Q7YA 3SGAE 3ZVEA 1T4UH 1Z6EA 2SNVA 2RCEA 1G9IE 1TX6A 4ZH8A 2BDIA 3GDSA 4DJZB 3P70B 2OINA 3ZZ5A 4WF8A 5A8ZA 6GCHG 1C1NA 3BN9A 2Z9LA 1V2ST 3M7TA 2R3YA 1GMHF 5HM2A 1K21H 1H8IH 4U2WA 5T3HA 3FP6E 2A1DB 3A8BA 1ELFA 2FYQA 5DJ7A 3U8TH 3VB7A 3ATIA 8GCHF 2NWNA 4JK6A 4NFEA 4SGBE 5GXPA 3KL6A 4OS1A 3IWMA 1MUEB 1EJMA 5C3NA 1HDTH 1C4Y2 1DY9A 4NZLA 4U01A 5C5NA 4AX9H 1O36A 1TAWA 1VJAU 4GAWA 2KAIA 1FY1A 1P9SA 4UE7H 1GBLA 3SNCA 2VWOA 5FBEA 2XBWA 3FZDA 1D6WA 3E16B 4BAQB 1TE0A 1ANDA 2HVXA 4CR9A 1YPGH 1QB6A 1SLVB 2VGCC 2B0FA 2V3OH 2HWLB 1YCPM 3STIA 2C4FH 3SV6A 3M3SA 1ZSLA 3S9CA 4WMEA 1L4DA 1LO6A 1THSH 3BTME 1JIMA 3URDA 1G37A 4QT8C 4IS5A 1C2EA 2A7HA 3SJ9A 4CRFA 2GGVB 5JPMH 1MCVA 2VIDA 3GDVA 4UFFH 1P01A 1D6RA 3SZNA 3FP7E 4FU9A 3LGYA 2ZG0H 4MNYA 1GL1A 1DWBH 1O2OA 3RDZA 1TFXA 3P8NA 1GBIA 1Z8GA 3PTNA 4UEHH 3FZZA 3RP2A 3RXPA 2Y7XA 3LT3A 1G30B 4UDWH 2ZA5A 4I31A 4UFGH 3LPRA 2W26A 1O37A 2DE9A 2P16A 2Y5FA 2ZU1A 1BTHH 3A89A 3M3VA 5F8ZA 3NPSA 1KXEA 5FBIA 1MD8A 1T4VH 5J4SA 3BSQA 1EAXA 2BDBA 1VITG 3ITIA 3O8BA 4NCYA 1GCTC 1AHTH 2ZCHP 4AYVB 2FXRA 1GJ5H 2H1UA 1HCGA 2BHGA 2Y7ZA 2R0LA 3SNEA 3MYWA 2A2QH 1FY8E 1OWEA 1ZR0A 3ODDA 6ESTA 1AGJA 1O2XA 1SFQB 3L6PA 4HTCH 3EA8A 4CRAA 2G5VA 1XVMA 1MD7A 1IQHA 2F9VA 2PW8H 3MNXA 4SGAE 4ABGA 3GY6A 2XC4A 1TNHA 3KNXA 4XOJA 1GBMA 1HAYB 2VWNA 1GHBG 1Z1JA 3ATLA 2P94A 1IQNA 1KTSB 1B0EA 3GCHC 4CH8B 1FY4A 1TQ0B 2BDAA 3SGQE 4OS6A 1DITH 3MO3A 1H9HE 1TX8A 4FVBA 4D9QA 3QX5H 1QL9A 1TLDA 1W2KH 1GVZA 2BB4A 2GKVE 1MQ5A 1LVBA 5GJ4B 1XUFA 4B2BA 1H9IE 3QK1A 3H7TA 2TGDA 1CT0E 1IQLA 1XKAC 2QA9E 2BDYA 1VZQH 3S7KB 4K5ZA 1GCDA 1GBTA 2ZFFH 4JMYA 4WY3A 1ETTH 1XKBC 5GCHG 2GX4A 3A86A 3T62A 3K65B 2A7JA 1OPHB 3MHWU 1BTZA 5DP5A 1LDTT 5EODA 5I46H 1EP5A 1O35A 1P2KA 3A7YA 5C67A 1F0SA 2H9TH 1SGQE 1IQMA 2F9PA 1P3CA 1ZHPA 4ABAA 3UREA 4RKOB 5JB9S 1O3HA 2FIRH 5TCCA 2J2UA 4A6LA 1K1NA 3TJOA 1MBQA 2P3UB 5IYTA 4AB9A 1V2OT 4X6MA 1HNEE 2ANMH 2ANYA 3IITA 1W14U 3BTKE 3E1XB 1CSOE 4OS5A 3LGUA 2V0BA 1F7ZA 1HBTH 4X8TH 4MQAA 2ZEBA 1W7XH 5IDKA 1AUTC 1QRZA 2BQ6B 3Q00A 1CA0B 1NO9H 3TH2H 2A4QA 3BIVH 1MMJN 2OD3B 2JKHA 1P02A 1AY6H 4ZHAA 2CHAB 3RU4D 2W3KA 4X6OA 1PPCE 4UONA 1N8OB 1C5PA 1O2PA 4DCDA 5CE1A 1JIRA 1HJAC 5C20A 5DP6A 1EKBB 3F68H 1OP8A 1VGCB 4GPGA 4WMDA 1TNJA 2ZKSA 3PMBB 2OQ5A 3RM0H 3ZVDA 4OGXA 5FPSA 1YLDA 2TGAA 3VB5A 2EI7A 1Z8IB 1GJ9B 3LONA 1UMAH 1GJDB 3IG6B 3SJ8A 5ABWA 2PGQB 1QQUA 1O2WA 3UPEA 3G01A 1G3DA 1MU8B 2AGGX 4JK5A 3ZZ6A 1CHOG 3Q76A 2BLOA 2ZU3A 1CU1A 4INKA 1O2HA 1V2LT 3EYDA 3RC5A 2GCHF 5AFYH 1BTWA 5TCAA 1MKWH 3LU9B 2HGTH 2BVXH 2PKAA 4Q2KA 4CRGA 2GV7A 2F9UA 1UTOA 2NU2E 3N7OA 1GHVH 2NU4E 2HOBA 2AERH 5AFZH 1LHFH 1W0ZU 2ANKH 2BY9X 2GDEH 1P57B 1RIWB 2J94A 1EOJA 2Y5HA 3U1JB 3GY7A 3VXEH 9LPRA 1ZGVA 1MTNB 1MAXA 4Y8ZA 2F3CE 1HAOH 1GVKB 4WH6A 1ELBA 1LHDH 3CS0A 2ZFPH 4J1YA 4MPUA 1HV7A 1PPBH 3SU0A 3RMMH 3ZZ9A 4GVUA 3MO9A 1C2IA 2EC9H 1GVLA 2VIVA 4Y71A 1NFYA 1DSTA 2A4GA 1T8MA 1QRXA 1JOUB 1GMDF 1Z6JH 3B23B 3C1KA 4XFQA 3TVJB 3CP7A 3GCNA 2GT8A 3QO6A 4FUGA 2RA3A 3A8DA 7GCHF 1BBRK 1WTHD 1O2MA 5H4IB 2VIOA 2GCTB 2WPMS 2ZQ2A 1GI1A 5C1UA 4BXWA 1DWEH 1YPKH 1Y59T 4BANB 1C1PA 3P17H 2XBXA 5FPTA 3QGJA 1Z8JB 5JYIA 1D3QB 1K2I1 3PO1B 4NZQA 1GI7B 1C2JA 2J95A 1SGPE 4ABHA 3KQEA 4Y7AA 1A0HB 2PTCE 5L6NH 2TRMA 3GYLB 3A82A 4MNVA 2FOBA 2ZHWH 1K1JA 4BAMB 2BM2A 2EI6A 2FEQH 1YM0A 2C8WB 1BDAA 1SB1H 2ZF0H 3VB6A 2QN5T 1RD3B 3QDZB 1ZOMA 2STBE 3NCLA 1OX1A 1V2KT 1P12E 1WQSA 2A0QB 2AIQA 1ZSJA 4A1VA 1H9LB 1GHAF 2ZHEH 2LPRA 2PUXB 1DX5M 2G51A 3MU5A 4H4FA 1LCYA 4RSPA 1KDQB 1CT2E 1SGNE 3KEEA 1LPZB 1D3PB 2BZ6H 5FX6A 4A1XA 1C1MA 3FFGA 1C4V2 3D49H 3S7HB 2XXLA 3SV8A 1TRNA 2UWOA 3EA7A 1Z8RA 1NU7B 3GCTG 2TGPZ 1WTGH 3QTVH 4X1RU 2QIQA 3GY8A 1C2HA 2CJIA 1GHYH 1W3CA 1VCPA 2QXGA 5B6OA 1AKSB 2BD7A 4ABEA 1MZAA 1LVMA 2V35A 4D8NA 3RMOH 1UVUH 2UUJB 1O3JA 4X6NA 2B5TB 2R2MB 3LGWA 1JXPA 3QUMP 2PWXA 4U30A 3SJKA 1Q2WA 2FOMB 1ANEA 2F9NA 1QIXB 5F03A 2ZFQH 3FAOA 1HRTH 3BIUH 2H5CA 3ATMA 4YLQH 1NS3A 3ELAH 3V12A 1TA2A 2O8MA 1C5MD 2FWWA 2PFEA 2BXUH 1IQGA 3RXLA 3LGVA 2Q6GA 1SC8U 2IN2A 2ZC9H 3F1SB 2ILNA 1OYQA 4I32A 1CA0C 1OP0A 3A7TA 3U9AH 1O2QA 4CBNA 4INLA 2CHAC 2OUAA