1C2KA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 48
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2kA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2kA02
2IPHA 1NFYA 2AIPA 4CRAA 3RU4E 4MPVA 3ZVFA 1L0ZA 1DWDH 1O2HA 3W95A 1TRYA 4CBOA 2XWAA 4E06H 1C5NH 1OYTH 5DK1A 1PPZA 2FOGA 2GMTC 1BTYA 2ESTE 1XVMA 4HI3A 1BIOA 3TK9A 2FI4E 1ZPZA 5IDKA 1K28D 5C3NA 4HTCH 1LVOA 1YLCA 1LPKB 2BOKA 4GCHG 2VNTA 4SGAE 3S9AA 1GI9B 1SSXA 2F9VA 5T6FA 2FOMB 1V6DA 4DY7B 2Y7ZA 3UR9A 3E90B 1O0DH 2IJOB 1SLVB 1VGCC 4OGXA 1L1NA 4YOIA 2AGEX 1OS8A 2FS8A 1YPHE 2FOCA 1HJAB 1BTZA 1UTOA 1GJBB 3LPRA 1O2XA 2W5EA 1XUKA 3PV4A 3EGKH 1HDTH 3UQVA 4AYVB 1TGNA 3PWBA 1O2LA 3MWIU 4H6SB 1BMNH 3KL6A 4FU7A 1GDUA 1GI2A 1Y8TA 1C5MD 4XBDA 5GIBA 1VJAU 4BAMB 2O8MA 1C9PA 1JRSA 4NWKA 1GHZA 3SUGA 1TNHA 1C2MA 2BLQA 1BMAA 1O3JA 1XKBC 3D62A 2ZHWH 1KLTA 2VIQA 1GJ4H 1ZOMA 2XRCA 3TGJE 1TMTH 2FI5E 1PPCE 3O8BA 1XUGA 4XDEA 3ZVEA 1BITA 2QXHA 4BTTB 3SI3H 5FX6A 1GJ6A 4UEHH 3LT3A 1ZTLA 1HPGA 1O5CB 3I29A 3R3GB 2ZU2A 3LKWA 4OGYA 3PTBA 5GCHG 1P04A 1BT7A 2Q6DA 1WV7H 4I33A 1HIAB 3K65B 4WY3A 3RXDA 2QGRA 1DFPA 2GV7A 3QDZB 1AY6H 5AFYH 4RKOB 1BCUH 1O2NA 4UFEH 1EPTB 1XUIA 1P2MA 1NRPH 1SBWA 6CHAB 2BDBA 1A3BH 1PJPA 2QN5T 3ZZCA 3UPEA 1C5VA 1IQIA 2DE9A 2ZO3H 4DIIH 2ZA5A 1Y5AT 4B2AA 1G2LA 4K5ZA 4AG2A 2XW9A 1A1RA 1DT2A 1G37A 3Q76A 2FZZA 2BQWB 3KCGH 1GBHA 2ZQ1A 1MQ5A 3SV2H 3AAVA 2WUCA 4K60A 1ELTA 2FOBA 1O2WA 1P2NA 1CO7E 1TYNA 2JH0D 3FP6E 3AAUA 4D76A 3C1KA 1NROH 2R3YA 1S82A 4IC5A 4RSPA 2ZU4A 5DPAA 5T6DA 1ZMJA 1UTLM 1KYNA 1O3PB 2BDIA 2ZFQH 1V2JT 3ZVBA 1V2RT 2ILNA 1VCQA 3VB4A 1W14U 1A5IA 3SV6A 2RCEA 3TLOA 4GCHF 3GDUA 4BAQB 3NCLA 3K6YA 5C5NA 4Q7XA 4OS5A 2BVRH 1C2JA 1MD7A 3TVJB 2A7JA 1F2SE 1HIAA 4X2WA 4DOQA 3VB3A 2ZNKH 2ZGJA 3LGVA 2XCNA 1LMWB 1O37A 1ZTKA 1YBWA 1ZYOA 3MNXA 1TNIA 1EPTA 2FEQH 3VB5A 2H9HA 4MNWA 2W3KA 2QYIA 2JETC 1EUFA 2AH4X 2AEIH 1TALA 1RJXB 2ANWA 5FHTA 1A46H 3BTDE 1QL8A 4ISNA 4MPXA 3A83A 2FX4A 4BTUB 1C5QA 2AS9A 4FUGA 4KTCA 2BQ6B 2FLBH 1GBTA 3NKKA 3HKJB 4Q80A 1MCVA 2WPMS 2TGTA 2RA0A 1EP5A 3ODFA 2P16A 3ZZ8A 2A32A 1TOCB 3SGAE 1SR5C 1Z8RA 2VJ1A 3M3SA 1NFWA 5AFZH 3GY8A 1SOZA 1C4Y2 2PSXA 2PUXB 1O3EA 1QJ1B 3SN8A 3IG6B 3MH5A 4ZKNU 1CE5A 1O2MA 2P8OB 2VVUA 2BDHA 4CRDA 1HRTH 2AERH 3RXHA 1BTWA 1WQSA 3F9GA 2AYWA 1QBOA 1CHGA 4NA7A 1TGCA 2SGDE 3VGCC 3LGTA 2H5DA 4MPUA 3E3TA 1AKSA 1ZRBA 1ZGIA 3O8DA 3AVZA 2WPHS 1P06A 1O30A 2GZ9A 3T28A 5HYOA 1INCA 5E0GA 3RXQA 1P09A 3HGNA 3M7QA 4OS7A 2ZU5A 4CHAC 3HGPA 2QIQA 2BY7X 1HAZB 5C5OA 1BQYA 2GZ8A 1GHVH 1AWHB 1TAWA 1F5LA 1KSNA 3RLWH 1QB1A 1ZPBA 1O3HA 3SU5A 4ZHAA 3PO1C 3RXBA 1H4WA 3BN9A 4CRFA 3ZZDA 1L4ZA 2Z6BD 2FOAA 1GVZA 1O2UA 1P3EA 1DWEH 1BRUP 5TJXA 2H9EH 1AB9C 7GCHG 3F9FA 1SGRE 2VWLA 3SUDA 4SGBE 3TU7H 1O3OA 1FMGA 1MTVA 2FOEA 2YNAA 1C5UA 1G3BA 1UCYH 2V3HH 2H1UA 1OWJA 2VWOA 1V2NT 1DWBH 2C3SA 4WH8A 1GHYH 2VWNA 1ZZZA 2HLCA 2ZCHP 3MTYA 3HATH 3M5NA 2G4TA 3U9AH 2SGEE 1Z1JA 1HAIH 1OP0A 1TX8A 2WPLS 1TNKA 2GMTB 2ZPSA 4Y10E 5C1YA 4BOHA 1QL7A 1MTSA 1GJAB 1TNGA 1BRCE 2CV3A 2VVVA 3RXIA 4O97A 2V0BA 2BLOA 1G3DA 2BD3A 2ODYB 3TJVA 5AVDA 3UFAA 2PGQB 1JIRA 2HPQH 1GBEA 3SNBA 4X8TH 4NWLA 1VGCB 1OPHB 4BXWA 1HAGE 2XC5A 1S83A 3QUMP 3RC6A 1GJ7B 1K1NA 3BTFE 2ULLA 1LVMA 3EA7A 3GY3A 2Y82A 1BBRE 2P3UB 4ZAEA 3RMMH 2Y5GA 4IW4E 4XOJA 1RS0A 3M37A 1HXEH 1C1MA 1C2KA 1EOLA 2ZHFH 3HKIB 1O5GH 4Y7BA 3ZYEA 2OQUA 1XUFA 2F83A 2A2QH 2G52A 1Z8GA 7KMEH 1HAOH 1ZHPA 5JB8S 1FY1A 4YM9A 1UTJA 1ZSKA 2W7UA 2VIPA 1GJ9B 1RXPA 2UWOA 4JK6A 1UVTH 2FP7B 5DKMA 3A7VA 5CMXH 1JBUH 3PMHB 1P57B 3R0FA 4JK5A 1YPHC 2OC7A 1SLUB 2HWLB 3ZV9A 1VITG 1YPJH 1K1OA 1SGYE 1MTNC 2FMJA 5GPIB 3IITA 2J95A 4Q7YA 3M5OA 4FUEA 1GMHG 1ZPCA 2ZDNA 1ETTH 1SGCA 3ZZ6A 3Q00A 4NGAH 1BTPA 2PTCE 6LPRA 1Z7KA 1O2YA 1O3FA 1P9UA 3MI4A 3A8CA 4I8JA 1EJNA 5A0CA 2VVCA 3D49H 1GHBG 1O3KA 1CGJE 1GWAA 1V2ST 4ABAA 1A5GH 1YYY1 2KAIB 3E6PH 5J4SA 4DURA 1XM1A 3E8LA 3MO6A 5DP9A 6ESTA 3M36A 8GCHG 1DXWA 4ZKOU 5EODA 1O34A 5SGAE 5EG4A 2QAAA 5JBBS 1W7XH 5GJ4B 1W2KH 2ZFTA 1W13U 4TY6A 3A7WA 3A85A 1HB0B 1TGSZ 4Z0KA 3SOSA 1EB1H 4ABJA 4CH2B 1B5GH 1EASA 1F5KU 2Z9GA 4IBLH 3VFEA 1HXFH 1MU6B 3MO3A 1MCTA 1O3DA 1QRZA 3GY2A 6GCHG 3C27B 2Z9LA 3V3MA 1PQ8A 2FXRA 4ISLA 3IWMA 3BG8A 2BD7A 5E2PA 2ZGCA 1T8LA 1BMMH 1C9TA 4VGCC 4WVPE 1G32B 5LPFA 3TGIE 1BBRK 1TQ7B 3M61U 3DHKH 1C1UH 1GI6A 1V2QT 1GG6C 4Y0YE 3A89A 3U8TH 2BB4A 1ZSJA 4NIYA 5A0AE 1TFXA 2JETB 1G3CA 2P94A 5EQQA 3MO9A 1SG8B 1O3LA 5G4BA 1W3CA 2ANKH 1Y5UT 2SNWA 2A1DB 2ZFFH 1GMCG 3ODDA 1O3CA 1WU1A 3PWCA 1HYLA 1T4UH 4D7FA 1QBVH 5LPEA 2PWXA 1XUJA 1PPHE 2HNTE 4Y79A 1SGIB 2VWMA 1L2EA 4ZH8A 1GL0E 3DFJA 3GCHC 1RTLA 5EPYA 1YPKH 1U6QA 1C1VH 1YF4A 2FWWA 2CJIA 3TITA 3T29A 3A87A 2V35A 3EA8A 3T62A 2Y5FA 5CE1A 1TNJA 2C8WB 1MKXH 1RRKA 3RXEA 4ABBA 1SHHB 2GX4A 1C1WH 1C2EA 1NTPA 1NS3A 1VITF 3FAOA 2OCVB 3ZZAA 4BAOB 4DVAU 1UMAH 4IMZA 3TNSA 1DITH 1FY8E 1ETRH 2NWNA 3KEEA 1GMHF 1IQEA 1J9CH 1O2ZA 1GBCA 2G5VA 1WOFA 3RP2A 1P2KA 2OTVA 4WF8A 3Q3YA 1P2IA 2VH0A 1C1OA 1EXFA 3S69A 4YESB 1YPLH 1S5SA 5F6MA 4GUXA 3VGCB 1THRH 2XCFA 1P2OA 3U8OH 1GHBF 1L4DA 2BYAX 1P9SA 1EZSC 2ZCLP 2VU8E 4F49A 3SW2B 1GPZA 5I25A 1QHRB 4Q7ZA 3B8JA 1QRXA 4YO9A 5DJ7A 4GHQA 4CRBA 2O8TA 4XSKU 2Y80A 1O36A 1KDQA 1GJDB 2Z7FE 1UHBA 2Y6TA 4X6OA 1CHOG 2OXSA 3D65E 1GJCB 1UTKA 3PMJA 3STIA 4CHAB 4BXSA 3BTHE 1WSSH 2GP9B 3MH4A 3MU0A 1AUJA 1O38A 2BHGA 2OC1A 3QWCH 1FAKH 5LGOA 3FANA 3OY6U 1MTUA 4NIXA 4THNH 1NN6A 1WBGB 4ISHH 3UOPA 1MD8A 3PO1B 1HCGA 1YC0A 4CR5A 4E7RG 4NSYA 2VB0A 1AB9B 3FZDA 3D23A 4B2BA 1Y59T 1JOUB 1BTXA 4ZMAH 1G36A 1GBKA 1P01A 3GYMA 5A8XA 1O3BA 3SNDA 1YPGH 3ATMA 1QR3E 4K8YA 4ISOA 1P05A 5L2YH 3F6UH 2M5TA 2CMYA 1AWFH 1NFUA 4INLA 3P8FA 3UOUA 1KIGH 1BOQA 1WCZA 3SQEE 4AZ2B 4Y8YA 3SJOA 1H8IH 4U32A 4BANB 1GMCF 3GCNA 1QJ6B 1BDAA 2WUBA 2AIQA 3U8RH 4Y0ZE 3K2UA 4X1QU 3SJ8A 2G00A 2UUKB 1MAYA 4TPIZ 3STJA 1TPAE 1ESAA 2OD3B 2ASUB 2R9PA 2ZGHA 2P59A 3LC5A 3NZIA 1SGNE 4E7NA 4GVUA 4ABHA 1TRNA 4QT8C 1FAXA 2OQ5A 5A8ZA 1IQMA 1TB6H 1P12E 5CHAB 2XC4A 1GVKB 3A84A 1V2PT 1C5WB 4NSVA 2AFQB 3DT0H 1VCWA 3BTEE 3SORA 3ZZ5A 1TA6A 4DJZB 2OBQA 5FCKA 4FUFA 4ZHMU 1FIZA 1O2PA 1DUEA 2OBOA 4U2WA 1ANEA 1GGDC 1HLTH 4NA9H 1A7SA 4XE4A 1SGTA 1SGPE 2CF9H 4NFEA 1N6YA 1TBRH 1V2WT 4AFZA 1IQNA 1VJ9U 4XBCA 4A1XA 2EI7A 1LDTT 1EQ9A 4X1NU 1S6HA 1TPSA 2BTCE 1B0EA 4FXGH 5FPTA 5JBCS 1UJ1A 2QC2A 2HALA 1TABE 3UTUH 1A0HB 1CHOF 1MTNB 2XNIA 1GBFA 1Y3XA 2CHAC 3U69H 4DG4A 1THSH 1QBNA 1V2MT 2UWPA 3FFGA 3ELAH 1EAIA 1GBAA 1C5XB 3MYWA 1O3NA 3BTME 1NRSH 4RKJB 3TGKE 1O5AB 1W10U 2PTNA 1K1JA 3S9CA 3A8BA 3BSQA 1J8AA 2XWBI 3KN2A 2FOHA 3UIRA 3TK6A 2GD4B 1OXGA 3A88A 4YT7H 2PHBA 2UUFB 1THPB 2Z3CA 9LPRA 1JWTA 2V6NA 1IQFA 4K69A 5LPRA 4CREA 1C5LH 1P2QA 4X1SU 1TGTA 1A4WH 1UVSH 3ATKA 5E2OA 1D6WA 1HBTH 1UVOA 3P8OA 3WY8A 4X6NA 3P8NA 4I8HA 1GI3A 1T4VH 2O9QA 1AFQC 2GTBA 1ZLRA 4ZKRU 1UTQA 1GCTC 1ETSH 1ABJH 2ODPA 1W0YH 2XYAA 1YGCH 1Y5BT 3V7TA 1QGFA 2WV4A 4Y11E 3QTVH 4VGCB 1AKSB 3P8GA 3MH7A 1KY9A 2P93A 1BJUA 2LNCA 1NFXA 4Y7AA 3ZVDA 3NUMA 1E36B 1AU8A 1GG6B 1FN6A 2ZTYA 4TWYA 5T6GA 4CRGA 1CBWC 3SJ9A 4R0IA 3DA9B 3AW0A 3SNEA 4FUJA 5E8EH 5HMAA 1OWDA 2A7CA 1LVBA 2WPKS 1BMLA 1YPMH 1NESE 4CR9A 2BMGB 3PLPA 1GI0A 2FO9A 1AZZA 3GCHB 1MMJN 3HPTB 2I6SA 4NFFA 4BAKB 2CGAA 1OWIA 3KNXA 2OP9A 3PLKA 1KXEA 3ZZBA 1W12U 2D1JA 5GCHF 3SNAA 2ZI2H 4MQAA 2HRVA 4UE7H 2XC0A 4O3UA 1ESTA 3E91A 4A92A 1EX3A 2J92A 1C1RA 1C5YB 1SHYA 2P3FH 4WXVA 3LDXH 1DXPA 2UUJB 1CVWH 1MH0A 1Z1IA 3BEUA 3OYPA 4O3TA 1QJ7B 2TGDA 1NRRH 2QXJA 4JYVH 3FVFB 1RTKA 2ANYA 1MAXA 1ELAA 3L6PA 1DDJA 5FPSA 3E1XB 1TMUH 2PR3A 2G51A 3DFLA 1TNLA 1WYKA 2I6QA 2EEKA 2HNTC 2CN0H 2GT8A 3SHAH 1DICA 3SU2A 5EW2H 2STBE 2GVFA 2D26C 4AG1A 1JIMA 2BY9X 5DP3A 2RDLA 2ZP0H 3ZZ9A 1HJ8A 1QY6A 1Q3XA 2R0KA 4FUBA 3SI4H 4UD9H 3RM0H 4UONA 3G01A 3RXPA 3QLPH 3TJOA 2F9NA 1V2UT 2VH6A 3MNCA 2XBWA 2BD4A 1D3TB 1QA7A 1P3CA 1PYTC 3SUEA 3TIUA 3UY9A 2FIRH 1YCPH 3NPSA 1RD3B 1MBMA 2H9TH 2GCHG 2CXVA 1AGJA 1GI5A 1O31A 2A5AA 1FV9A 1AE8H 1FY3A 2EC9H 3A8DA 1P8VC 1E37B 4Y71A 4OS2A 2AMPA 1B7XB 2R3UA 5TCCA 5L6NH 4GSOA 1FN8A 3MHWU 1RIWC 1C4V2 1DUAA 5BRRE 2VGCC 1TGBA 2ZHDA 3RXOA 2A31A 5AF9H 3M3TA 2PKSC 2F91A 2F9BH 3LGUA 5C1XA 3CP7A 5I46H 1N8OC 1GVLA 2FM2A 1SQTA 3RXCA 2ZU3A 1ARCA 2D2DA 1LTOA 4AB9A 1BZXE 1ZJKA 1H9LB 2Z9IA 1MU8B 2A0QB 1G9IE 2ZQ2A 2RA3A 1KXAA 1EP6A 3Q3KA 2WV5A 4IN1A 4JCNA 1FLEE 2ZTXA 5T3HA 3GDSA 4A1VA 5JBTA 1RTFB 5J4QA 1ABIH 5CHAC 1ELFA 4RN6A 3RM2H 1MTWA 2QY0B 2ZGXH 4INKA 2W26A 1A0JA 2BQ7B 2ZZUH 3A86A 3OTJE 4AOQA 3MOCA 1Q31A 1BRAA 1GBJA 4YLUA 4TY7A 1TBQH 1F7ZA 2OC0A 1OP8A 1K9OE 3P6ZB 1TMBH 2Q6FA 2R2WU 2ZGBH 4B71A 3S9BA 1S81A 1OOKB 4K1SA 2W7SA 1V2OT 3A81A 3UWIA 1B0FA 3RXSA 3K6ZA 4X8VH 2Z9JA 1SGQE 5GWZA 4A5TS 3KQDA 1IAUA 2QF0A 2G55A 4FUCA 1GGDB 5EOKA 4I8GA 1Z8IB 4X2YA 1HAHH 2O8WA 1WAYB 1ZMLA 3I78A 2ANMH 4KP0A 2O8UA 2PKAB 4JYTA 5EU8A 4A1TA 1C1QA 4ASHA 4I7YH 1O2KA 3MNSA 3RU4D 3PM3A 1OWHA 1KTSB 1T31A 1YM0A 2H6MA 4NIVA 4YOJA 3BTKE 3KQEA 1TX7A 5FAHA 1O3AA 2A5IA 3SV9A 5LH8A 5JYIA 2J4IA 3VB6A 2G4UA 2C8XB 2BZAA 1MZDA 1GBDA 1UCYK 3MH6A 3SUFA 2CHAB 1O2OA 1QB6A 1T8NA 1E38B 4CH8B 1L1GA 2C90B 1C5SA 4YZUA 3T5FH 1OYQA 1WUNH 2NU0E 7GCHF 2GCHF 5JB9S 4MPWA 1QA0A 2ZFPH 5IYTA 2ZC9H 2R0LA 4MNYA 3GICB 3RXAA 1DSTA 2WPIS 1K21H 2JKHA 1YPEH 1J15A 2Q1JA 1UO6A 3GY7A 1O3GA 1X7AC 3JZ2B 1C2IA 2V3OH 1LKBA 3CENA 2ZDMA 1Z8JB 1IQJA 2ZDLA 2ZIQH 3F9EA 3RXGA 4X8SH 5EQRA 1GI1A 3SJIA 2XBVA 1GJ5H 1DWCH 1MUEB 2PKAA 2GZ7A 1V2VT 2Q6GA 5ABWA 3ZVAA 1TRMA 3H7TA 1AFQB 1GI8B 1MKWH 1SGFG 1ANBA 5DP6A 3RU4T 1XMNB 1AFEH 4ZHLU 1EB2A 1GJ8B 1GCTB 1T32A 3A8AA 1FPHH 2TRMA 4XBBA 1BB0B 1TE0A 1WTGH 3M5MA 5H4IB 5DGJA 2PLXA 1ZMNA 4CBNA 1KDQB 4K1TA 2C8YB 1PQAA 2QV1A 2EI8A 1UHBB 2R2MB 1CBWB 4MTBA 3MU5A 2AGGX 1DE7H 5ESTE 3EYDA 1C2GA 4BTIB 1SGEE 4MG3A 3E0PB 2J38A 2SGQE 1TIOA 3BEIB 1XX9A 1XVOA 1HNEE 3OSYA 3SV7A 1A5HA 1A3EH 2UUYA 1DSUA 3VPKA 2F9OA 4I31A 4ZXXH 2Z9KA 1YKTA 3LOXA 1ELBA 3RC4A 1EKBB 1HUTH 1UVPA 1TA2A 3AW1A 4ZXYH 4B75A 2ZTZA 1ZSLA 3SU3A 1C2DA 2FYRA 4UFDH 2A4RA 1FUJA 4JZDH 3LGIA 2H2ZA 3GOVB 1JMOH 4B76A 1BTUA 4LZ1H 1A2CH 2PFEA 1H9IE 1NZQH 1ZTJA 3P70B 4XFQA 8GCHF 2BXUH 1C1TA 1TPOA 5GDSH 1FPCH 1LHFH 5F8TA 4M7GA 3U1IB 3F9HA 1W8BH 3DUXH 2BD2A 1CSOE 4U30A 3NWUA 1SGFA 1IQLA 2WYJA 1K1PA 1OWEA 2FTMA 1HAXB 1AVGH 5EXLA 6GCHF 2C8ZB 1DLKB 4K3JA 2BDCA 5AHGH 4ZUHA 5FBEA 1NU9A 2J34A 5E0JA 1IQGA 1FNIA 1S0RA 2ZWLH 3M7TA 1NM6A 1SFIA 2ZDAH 3RXVA 2SNVA 4FVDA 1D3PB 3UNSA 3BTGE 3N7OA 4JYUH 4X2XA 5K7RA 3VXFH 4JZEH 3OU0A 4Y6DA 1P02A 1N6XA 3K9XB 5A2MH 3MU1A 1G30B 1NPMA 1TX6A 2FTLE 2GCTC 2Z3DA 4Y76A 1F0RA 1RIWB 1AVXA 1ESBA 4OS6A 2VGCB 3KQCA 2Y5HA 1C5TA 1SC8U 1BA8B 2PKSB 5JDUB 4CRCA 1MKXK 1N8OB 5JPMH 1V2LT 1QIXB 1QNJA 1Z71A 4DW2U 4KGAA 1AHTH 8KME2 2QXIA 2BM2A 4WXIA 2VIWA 2TGPZ 2ZHEH 2EI6A 1LVYA 1K1MA 1SB1H 1O5DH 1XUHA 1UVUH 1D6RA 1EAUA 1LKAA 2ZKSA 1PPBH 3P92A 1EZUC 1ELEE 2BVXH 4HFPB 1Z6EA 3A7YA 3GDVA 4WWYA 3RMNH 1Y3VA 3SV8A 1GBMA 1P0SH 2SGPE 1F0TA 1CA8B 3S7KB 3L33A 1O5BB 2NU3E 2HNTF 3ATIA 1DY8A 2VIDA 1AD8H 3QTOH 4J1YA 5F8XA 3RXKA 1SLXB 3BIVH 1TQ0B 4FUIA 2WPJS 3LJJA 4J2YB 3U98H 2VIOA 1MZAA 2B5TB 3A7XA 1C5OH 4X2VA 1NRNH 4B2CA 1GHXH 1CA0C 1PPFE 1S84A 3FP8E 2GKVE 3ZZ3A 1UK2A 1LHGH 3UNRA 3ZV8A 4AFQA 2NU1E 8LPRA 1O33A 1FY5A 1UK3A 5JBAS 3T2NA 3RMOH 4WMFA 3KIDU 1P03A 1NU7B 1UK4A 1KTTB 1O2JA 3UQOA 3ESTA 4A6LA 3BV9B 2ZPQA 3GY4A 1ZHMA 3OY5U 5HGGA 1O3IA 3M7UA 2AMDA 2UWLA 1C5ZB 3BG4C 2A45B 1QRWA 4UFGH 1BRBE 3TNTA 1LHEH 2G81E 1O2IA 2BX3A 4NA8A 1O3MA 4B74A 4H4FA 1H1BA 5EXMA 5EGMA 3M35A 1MBQA 4WMDA 2QA9E 1F5RA 3P95A 4ABFA 2TBSA 4U01A 3NK8A 5FBIA 4WH6A 4YLQH 1CGIE 1HAPH 1O2TA 2J2UA 3B9FH 3EE0B 2F3CE 2VINA 1O2VA 2ZDVH 3MU4A 4ABGA 3EAJA 1LPGB 3A7ZA 1S85A 1K22H 1FJSA 4LXBH 2F9UA 4B73A 3ZVCA 3W94A 5FX5A 1FIWA 4OS4A 3URCA 1C1PA 4GPGA 3UR6A 3L3TA 1AQ7A 4WJG2 2P95A 2Y81A 2BVSH 4NZQA 1JRTA 1BTHH 4D9RA 4JZIA 4TYDA 2ZPRA 1V2TT 3FZZA 1AO5A 5C20A 5PTPA 1RFNA 1KLIH 3LH3A 1ZHRA 2HPPH 4MVNA 2H5CA 9ESTA 5EW1H 2AMQA 2FODA 4YOGA 2PUQH 2ZFSA 5HM9A 1DX5M 2ALPA 3GY6A 5EXNA 3VB7A 4F4OC 4MNXA 4B1TA 3B23B 3RLYH 3LIWA 3LH1A 1O5FH 3MU8A 3Q3XA 1F92A 3E16B 2BY5X 5HM2A 2A4QA 1HAYB 4AN7A 1VR1H 3BTWE 3VEQB 1O2GH 1EATA 1SL3A 1AMHA 1ELVA 4O03A 3GYLB 3PB1E 1A61H 3LGYA 1L1JA 2GT7A 2A7HA 1ORFA 2FLRH 3PMBB 1GI4A 4K2YA 3PROA 1OP2A 3TJUA 1D9IA 2G5NA 2BOHB 2ZG0H 1SPJA 1XXDA 2JH5D 3SGBE 1E34B 3ZVGA 1EOJA 1CGHA 1KXFA 3RDZA 3O8CA 3KGPA 1ZR0A 2F9PA 1ZGVA 1J14A 4I32A 1DM4B 4OS1A 5L2ZH 5FCRA 2QCYA 2SGFE 2PV9B 3SQHE 1DS2E 3KF2A 3MNBA 1W0ZU 1Y3WA 3UNQA 1C5RA 2FS9A 4GLYA 1FZZA 2RG3A 3M3VA 4H6TA 4IGDA 3LC3A 4JZ1A 1D4PB 1IHTH 2ZFRH 3QO6A 2BXTH 3QGNB 4H42U 1W11U 3JZ1B 3PYHA 5ESBA 1BJVA 1IOEA 1QL9A 1QCPA 3QZRA 4DGJA 5DO4H 5DP7A 4INHA 4UDWH 4YTAA 1SGDE 1SOTA 4ZKSU 3LGWA 2SGAA 4FUHA 1GHAG 4DCDA 1S6FA 3CS7A 3RC5A 2FDAA 1SLWB 4WMEA 2XBXA 2G8TA 5ETXA 1Y3UA 3QZQA 2NU4E 4FU8A 3A80A 3QX5H 4I8LA 5B6OA 1ANCA 2BY8X 1AZ8A 1G3EA 1WTHD 3RXFA 1GDNA 3URDA 1AN1E 1YP9A 4GHTA 1C2HA 1DOJA 4AYYB 1LQDB 3ATWA 1A0LA 1HJ9A 1NT1A 4DT7B 3RXUA 4MNVA 1P11E 2BX4A 1UCYE 4I8KA 4PROA 1C5PA 1NC6A 2D8WA 2Z3EA 4ZROA 1NY22 2GGVB 3SJKA 2QXGA 1C4U2 1EAXA 2HVXA 2OC8A 5F03A 1V2KT 2C4FH 3ZZ7A 1FY4A 1SI5H 2FPZA 2IOTA 3OX7U 3BTQE 3MMGA 2GCTB 2A4GA 2K1QA 5L30H 2BDGA 2DUCA 4ABDA 1TBZH 4NG9H 1SQOA 4UFFH 1PYTD 4D9QA 2FX6A 1T7CA 2ALVA 1H8DH 1PQ5A 2BD9A 5DP5A 3TK5A 1ACBE 4X8UH 1BHXB 1HV7A 3O8RA 5HXFA 3RXTA 1K1LA 4X6PA 1KXDA 2ZCKP 3KQBA 2A5KA 5DG6A 3VXEH 1LCYA 2P3TB 3AASA 1TONA 1P2JA 4A7IB 3QK1A 3UWJH 2QF3A 3I77A 2TPIZ 2ZHQH 4TPYA 2BD5A 3H7OA 4YT6H 5A8YA 2HGTH 5FXLA 3RXRA 1HJAC 2GDDA 1C1SA 1XXFA 4AORA 2A2XH 2FESH 3P17H 3DD2H 4KELA 1T8MA 4KTUA 3UREA 4ABIA 3FP7E 1OSSA 1TOMH 1ZRKA 1G2MA 1M9UA 3ZYDA 4ABEA 1C2FA 1AI8H 2OINA 3RXMA 3SU6A 1LHCH 4BAHB 4JMYA 3M5LA 1E35B 2C93B 4KTSA 4D8NA 1GHAF 1CA0B 2BZ6H 2PW8H 2IN2A 3SU0A 3HK3B 1BBRH 1J16A 1HFDA 1HGTH 1F0SA 3RUOA 1AUTC 1YCPK 4LZ4B 4X1RU 1AVWA 5E0HA 1DLEA 2CF8H 3LU9B 4AGKA 4ESTE 3GY5A 1VITH 5K0HA 4AFUA 1GCDA 1TLDA 1T8OA 4E05H 3QGJA 3CS0A 3BIUH 4MDSA 1GHWH 3F68H 2TIOA 1QQUA 1GBLA 1GL1A 1FDPA 1NRQH 2PSYA 3BG4B 2O8LA 1CT2E 1EPTC 1C2LA 1SVPA 6CHAC 1DPOA 1O32A 2YOLA 1YLDA 5FPYA 2ZECA 2J9NA 2FOFA 2W3IA 5GXPA 1D3QB 3V13A 2ZF0H 4NCYA 4D7GA 1TWXB 2GV6A 4IN2A 4X1PU 4ISIH 5DP8A 2BLWA 1BHXF 2J94A 1QURH 2HOBA 1DVAH 3SBKA 1EZXC 1PPEE 5EPNA 1ZJDA 2ZEBA 3F1SB 1FXYA 3TH2H 3E0NB 3S7HB 1HAVB 3A7TA 3T26A 1F0UA 1GDQA 3ATLA 1UTPA 1JXPA 4NIWA 4AX9H 1N1LA 3GCTG 4DIHH 2A4OA 3NXPA 2ZU1A 2WINI 1K2I1 1GMDG 3SGQE 3SU4A 4LOYH 2BDAA 1CQQA 1DY9A 4MLFB 1AE5A 4X6MA 1SFQB 2AGIX 1K1IA 1FI8A 1KXCA 1QTFA 3PMAB 1KXBA 1FQ3A 1PPGE 3EDXB 1LQEA 3LJOA 4K8BA 1CU1A 1ELGA 2TGAA 5A0BA 2LPRA 2GDEH 1O2RA 4AB8A 4O9VA 5A09A 8ESTE 1Q2WA 1O5EH 1WQVH 4HZHA 3EQ0H 3Q77A 2YNBA 4R8TB 1QQ4A 5F8ZA 1RGQA 1YCPM 2XTTB 3KHVA 4Y8ZA 1IQHA 4KKDA 2Z94A 1J17T 1TPPA 3PTNA 3ZZ4A 1EZQA 4IS5A 2XXLA 2B0FA 1MQ6A 2STAE 1CT4E 2B9LA 3SU1A 3T25A 3A82A 2DE8A 2FYQA 1S0QA 2EA3A 5DP4A 2B8OH 3V12A 1ELCA 1HAVA 1KLJH 1CT0E 1ARBA 1GI7B 2NU2E 2PGBB 1VCPA 2KAIA 3TH3H 1PQ7A 3EA9A 3PLBA 1ELDE 1XKAC 1Z6JH 1IHSH 2ZDKA 2BLVA 2VIVA 2WYGA 4FVBA 2BD8A 1LHDH 3SO3A 1O35A 2ODQA 7ESTE 2FI3E 7LPRA 3GISB 1LO6A 1OX1A 5TCAA 3ITIA 1EJAA 3SNCA 1QB9A 4Z6AH 3QN7A 1SQAA 5C67A 2THFB 4JZFH 2P8OC 3TH4H 4AGJA 4HGCA 1SMFE 2BDYA 4GAWA 3BTTE 1V3XA 4X0WU 1IQKA 2B7DH 3GCOA 5BPEA 1ANDA 2XBYA 2OUAA 1QFKH 1GBIA 3UUZA 1EAWA 2Y7XA 1O2SA 1LPZB 2SFAA 1H9HE 1EJMA 3ENSB 1AIXH 4LK4A 5EQSA 3S0NA 3HK6B 4FU9A 1FONA 1ID5H 4FUDA 3SZNA 1MKWK 1O39A 3RXJA 1O2QA 3MFJA 3GCTF 1OWKA 1VZQH 1BUIA 1D3DB 1GBBA 3TPIZ 1UTNA 1GMDF 4Q2KA 1UTMA 4TWWA 4AFSA 1E0FD 3SHCH 3BEFB 1Y3YA 3U1JB 5C1UA 1PFXC 1OKXA 1DANH 2JH6D 3T27A 3V0XA 5C2ZA 3RMLH 1NO9H 1P10A 4K1EA 3TJNA 3BF6H 4BNRA 4NZLA 3H5CB 3LONA 4Y8XA 2OLGA 1W7GH 1C1NA 3RXLA 4IMQA 2BY6X 4IC6A
chains in the Genus database with same CATH superfamily
2IPHA 1KMHB 1NFYA 2AIPA 5IK2D 2JJ1D 4CRAA 3RU4E 4MPVA 3ZVFA 1L0ZA 1DWDH 4RT0A 1O2HA 3W95A 1TRYA 4CBOA 2XWAA 4E06H 1C5NH 1OYTH 5DK1A 1PPZA 2FOGA 2GMTC 1BTYA 2ESTE 1XVMA 4HI3A 1BIOA 3TK9A 2FI4E 1ZPZA 5IDKA 1K28D 5C3NA 4HTCH 1LVOA 1YLCA 1LPKB 2BOKA 4GCHG 2VNTA 4SGAE 3S9AA 3N7DA 1GI9B 1SSXA 2F9VA 5T6FA 3DSPA 2FOMB 1V6DA 4DY7B 2Y7ZA 3UR9A 3E90B 1O0DH 2IJOB 1SLVB 1VGCC 4OGXA 1L1NA 4YOIA 2AGEX 1OS8A 2FS8A 1YPHE 2FOCA 1HJAB 1BTZA 1UTOA 1GJBB 3LPRA 1O2XA 2W5EA 4F48B 2PP6A 1XUKA 3PV4A 3EGKH 1HDTH 3UQVA 4AYVB 1TGNA 3PWBA 1O2LA 3MWIU 4H6SB 1BMNH 3KL6A 4FU7A 1GDUA 1GI2A 1Y8TA 1C5MD 4XBDA 5GIBA 1VJAU 2KX4A 3NRLA 4BAMB 2O8MA 1C9PA 1JRSA 4NWKA 1GHZA 3SUGA 1TNHA 1C2MA 2BLQA 1BMAA 1O3JA 1XKBC 3D62A 2ZHWH 1KLTA 2VIQA 1GJ4H 1ZOMA 2XRCA 3TGJE 1TMTH 2FI5E 1PPCE 3O8BA 1XUGA 4XDEA 3ZVEA 1BITA 2QXHA 4BTTB 3PRBA 5KEDA 3SI3H 5FX6A 1GJ6A 4UEHH 3LT3A 1FX0B 1ZTLA 1HPGA 1O5CB 3I29A 3R3GB 2ZU2A 3LKWA 4OGYA 3PTBA 4XRNA 5GCHG 1P04A 1BT7A 2Q6DA 1WV7H 4I33A 1HIAB 3K65B 4WY3A 3RXDA 2QGRA 1DFPA 2GV7A 3QDZB 1AY6H 5AFYH 4RKOB 1BCUH 1O2NA 4UFEH 2KZ4A 1EPTB 1XUIA 1P2MA 1NRPH 1SBWA 6CHAB 2BDBA 1A3BH 1PJPA 2QN5T 3ZZCA 4I86A 3UPEA 1C5VA 1IQIA 5EJZA 2DE9A 2ZO3H 4DIIH 2ZA5A 1Y5AT 4B2AA 1G2LA 4K5ZA 4AG2A 2XW9A 1A1RA 1DT2A 1G37A 3Q76A 2FZZA 2BQWB 3KCGH 1GBHA 2ZQ1A 1MQ5A 3SV2H 3AAVA 2WUCA 4K60A 1ELTA 2FOBA 1O2WA 1P2NA 1CO7E 1TYNA 2JH0D 3FP6E 4XD7D 3AAUA 4D76A 3C1KA 1NROH 2R3YA 1S82A 4IC5A 4RSPA 2ZU4A 5DPAA 5T6DA 1ZMJA 1UTLM 4Q63A 1KYNA 3N99A 5C94A 1O3PB 2BDIA 2ZFQH 1V2JT 3ZVBA 1V2RT 2ILNA 1VCQA 3VB4A 3SZEA 1W14U 1A5IA 3SV6A 2RCEA 3TLOA 4GCHF 3GDUA 4BAQB 3NCLA 3K6YA 5C5NA 4Q7XA 4OS5A 2BVRH 1C2JA 1MD7A 5F53A 5DN6D 3TVJB 2A7JA 1F2SE 1HIAA 4X2WA 4DOQA 3VB3A 2ZNKH 2ZGJA 3LGVA 2XCNA 1LMWB 1O37A 1ZTKA 1YBWA 1ZYOA 3MNXA 1TNIA 2QF4A 1EPTA 2FEQH 3VB5A 2H9HA 4MNWA 2W3KA 2QYIA 2JETC 1EUFA 2AH4X 2AEIH 1TALA 1RJXB 2ANWA 5FHTA 1A46H 3BTDE 1QL8A 4ISNA 4MPXA 3A83A 2FX4A 4BTUB 1C5QA 2AS9A 4FUGA 4KTCA 2BQ6B 2FLBH 1GBTA 3NKKA 5KECA 3HKJB 4Q80A 1MCVA 2WPMS 2TGTA 2RA0A 1EP5A 3ODFA 2P16A 3ZZ8A 2A32A 1TOCB 3SGAE 1SR5C 1Z8RA 2VJ1A 1W0JD 1H8HD 3M3SA 1NFWA 5AFZH 3GY8A 3EE7A 1SOZA 1C4Y2 2PSXA 2PUXB 1O3EA 1QJ1B 3SN8A 2K8IA 3IG6B 3MH5A 4ZKNU 1CE5A 1O2MA 2P8OB 2VVUA 2BDHA 4CRDA 1HRTH 2AERH 3RXHA 1BTWA 1WQSA 3F9GA 2AYWA 1QBOA 2EQNA 1CHGA 4NA7A 1TGCA 2SGDE 3VGCC 3LGTA 2H5DA 4MPUA 3E3TA 1AKSA 1ZRBA 1ZGIA 3O8DA 3AVZA 2WPHS 1P06A 1O30A 2GZ9A 3T28A 5HYOA 1INCA 5E0GA 3RXQA 1P09A 3HGNA 3M7QA 4OS7A 2ZU5A 4CHAC 3HGPA 2QIQA 2BY7X 1HAZB 5C5OA 1BQYA 2GZ8A 1GHVH 1AWHB 1TAWA 1F5LA 1KSNA 3RLWH 1QB1A 1ZPBA 1O3HA 3SU5A 4ZHAA 4ASUD 3PO1C 3RXBA 1H4WA 4P02A 3BN9A 4CRFA 3ZZDA 1L4ZA 2Z6BD 2FOAA 5KGOA 1GVZA 1O2UA 1P3EA 1DWEH 1BRUP 5TJXA 2H9EH 1AB9C 7GCHG 3F9FA 1SGRE 2VWLA 3SUDA 4SGBE 3TU7H 1O3OA 1FMGA 1MTVA 2FOEA 2YNAA 1C5UA 1G3BA 1UCYH 2V3HH 3FN8A 2H1UA 1OWJA 2VWOA 1V2NT 1DWBH 2C3SA 4WH8A 1GHYH 2VWNA 1ZZZA 2HLCA 2ZCHP 4AC9A 3MTYA 3DCLA 3HATH 3M5NA 2G4TA 3U9AH 2SGEE 1Z1JA 1HAIH 1OP0A 1TX8A 2WPLS 1TNKA 2GMTB 2ZPSA 4Y10E 5C1YA 4BOHA 1QL7A 1MTSA 1GJAB 1TNGA 1BRCE 3OAAD 2CV3A 2VVVA 3RXIA 4O97A 2V0BA 2BLOA 2QF5A 1G3DA 2BD3A 2ODYB 3TJVA 5AVDA 3UFAA 2PGQB 1JIRA 2HPQH 1GBEA 3SNBA 4X8TH 4NWLA 1VGCB 1OPHB 4BXWA 1HAGE 2XC5A 1S83A 3QUMP 3RC6A 1GJ7B 1K1NA 3BTFE 2ULLA 1LVMA 3EA7A 3GY3A 2Y82A 1BBRE 2P3UB 4ZAEA 3RMMH 2Y5GA 4IW4E 4XOJA 1RS0A 3M37A 1HXEH 1C1MA 1C2KA 1EOLA 2ZHFH 3HKIB 1O5GH 4Y7BA 3ZYEA 2OQUA 1XUFA 2F83A 2A2QH 2G52A 1Z8GA 7KMEH 1HAOH 1ZHPA 5JB8S 1FY1A 4YM9A 1UTJA 1ZSKA 2W7UA 2VIPA 1GJ9B 1RXPA 2KR7A 2UWOA 4JK6A 1UVTH 2FP7B 5DKMA 3A7VA 5CMXH 1JBUH 3PMHB 1P57B 3R0FA 4JK5A 1YPHC 2OC7A 1SLUB 2HWLB 3ZV9A 1VITG 1YPJH 1K1OA 1SGYE 1MTNC 2FMJA 5GPIB 3IITA 2J95A 4Q7YA 1WXRA 3M5OA 4FUEA 1GMHG 1ZPCA 2ZDNA 1ETTH 1SGCA 3ZZ6A 3Q00A 4NGAH 1BTPA 2PTCE 6LPRA 1Z7KA 1O2YA 1BMFD 1O3FA 1P9UA 3MI4A 3A8CA 4I8JA 1YLNA 1EJNA 5A0CA 2VVCA 3D49H 3FO8D 4B6EA 1GHBG 1O3KA 1CGJE 1GWAA 1V2ST 4ABAA 1A5GH 1YYY1 2KAIB 3E6PH 5J4SA 4DURA 1XM1A 3E8LA 3MO6A 5DP9A 6ESTA 3M36A 8GCHG 1DXWA 4ZKOU 5EODA 1O34A 5SGAE 5EG4A 2QAAA 4ACAA 5JBBS 1W7XH 5GJ4B 1W2KH 2ZFTA 1W13U 4TY6A 3F2FA 3A7WA 3A85A 1HB0B 1TGSZ 4Z0KA 3SOSA 1EB1H 4ABJA 4CH2B 1B5GH 1EASA 1F5KU 2Z9GA 4IBLH 3VFEA 1HXFH 1MU6B 3MO3A 1MCTA 1O3DA 1QRZA 3GY2A 6GCHG 3C27B 2Z9LA 3V3MA 1PQ8A 2FXRA 4ISLA 3IWMA 3BG8A 2BD7A 5E2PA 2ZGCA 1T8LA 2M2AA 1BMMH 1C9TA 4VGCC 4WVPE 1G32B 5LPFA 2W6ID 3TGIE 1BBRK 1TQ7B 3M61U 3DHKH 1C1UH 1GI6A 1V2QT 2LP6A 1GG6C 2XNDD 4Y0YE 3A89A 3U8TH 2BB4A 1ZSJA 4NIYA 5A0AE 1TFXA 2JETB 1G3CA 2P94A 5EQQA 3MO9A 1SG8B 1O3LA 5G4BA 1W3CA 2ANKH 1Y5UT 2SNWA 2A1DB 2ZFFH 1GMCG 3ODDA 1O3CA 1WU1A 3PWCA 1HYLA 1T4UH 4D7FA 1QBVH 5LPEA 2PWXA 1XUJA 1PPHE 2HVYB 2HNTE 4Y79A 1SGIB 2VWMA 1L2EA 4ZH8A 1GL0E 3DFJA 3GCHC 1RTLA 5EPYA 1YPKH 1U6QA 1C1VH 1YF4A 2FWWA 2CJIA 3TITA 1H8ED 3T29A 3KQ5A 3A87A 2V35A 3EA8A 3T62A 2Y5FA 5CE1A 1TNJA 2C8WB 1MKXH 1RRKA 3RXEA 4ABBA 1SHHB 2GX4A 1C1WH 1C2EA 1NTPA 1NS3A 1VITF 3FAOA 2OCVB 4RT1A 3ZZAA 4BAOB 4DVAU 1UMAH 4IMZA 3TNSA 1DITH 1FY8E 1ETRH 2NWNA 3KEEA 1GMHF 1IQEA 1J9CH 1O2ZA 1GBCA 2G5VA 1WOFA 3RP2A 1P2KA 2OTVA 4WF8A 3Q3YA 1P2IA 2VH0A 1C1OA 1EXFA 3S69A 2KCOA 4YESB 1YPLH 1S5SA 5F6MA 2WSSD 4GUXA 3VGCB 1THRH 2XCFA 1P2OA 3U8OH 1GHBF 1L4DA 2BYAX 1P9SA 2J97A 1EZSC 2ZCLP 2VU8E 4F49A 3SW2B 1GPZA 5I25A 1QHRB 4Q7ZA 3B8JA 1QRXA 4YO9A 5DJ7A 3VG8A 4GHQA 4CRBA 2O8TA 4XSKU 2Y80A 1O36A 1KDQA 3OTPA 1GJDB 2Z7FE 1UHBA 2Y6TA 4X6OA 4Z1MD 1CHOG 2OXSA 3D65E 1GJCB 1UTKA 3PMJA 3STIA 4CHAB 3N7EA 4BXSA 3BTHE 1WSSH 2GP9B 3MH4A 3MU0A 1AUJA 1O38A 2BHGA 2OC1A 3QWCH 1FAKH 5LGOA 3FANA 3OY6U 1MTUA 4NIXA 4THNH 1NN6A 1WBGB 3CNRA 4ISHH 3UOPA 1MD8A 1K0HA 3PO1B 3WW7A 1HCGA 1YC0A 4CR5A 1S6LA 4E7RG 4NSYA 2VB0A 1AB9B 3FZDA 3D23A 4B2BA 1Y59T 1JOUB 1BTXA 4ZMAH 1G36A 1GBKA 1P01A 3GYMA 5A8XA 1O3BA 3SNDA 1YPGH 3ATMA 1QR3E 4K8YA 5EJ1A 4ISOA 1P05A 5L2YH 3F6UH 2M5TA 2CMYA 1AWFH 1NFUA 4INLA 3P8FA 3UOUA 1KIGH 1BOQA 1WCZA 3SQEE 4AZ2B 4Y8YA 3SJOA 1H8IH 4U32A 4BANB 1GMCF 3GCNA 1QJ6B 1BDAA 2WUBA 2AIQA 3U8RH 4Y0ZE 3K2UA 4X1QU 3SJ8A 2G00A 2UUKB 1MAYA 3DSGA 2L74A 4TPIZ 3STJA 1TPAE 1ESAA 2OD3B 2ASUB 2R9PA 2WHXA 2ZGHA 2P59A 3LC5A 3NZIA 1SGNE 3UB0A 4E7NA 4GVUA 4ABHA 2LELA 3PRDA 1TRNA 4QT8C 1FAXA 2OQ5A 5A8ZA 3FOAA 1IQMA 1TB6H 1P12E 5CHAB 2XC4A 1GVKB 3A84A 1V2PT 1C5WB 4NSVA 2AFQB 3DT0H 1VCWA 3BTEE 3SORA 3ZZ5A 1TA6A 4DJZB 2OBQA 4FOUC 5FCKA 4FUFA 4ZHMU 1FIZA 1O2PA 1DUEA 5HKKD 2OBOA 4U2WA 1ANEA 1GGDC 1HLTH 4NA9H 1A7SA 4XE4A 1SGTA 1SGPE 2CF9H 4NFEA 1N6YA 1TBRH 1V2WT 4AFZA 1IQNA 1VJ9U 4XBCA 4A1XA 2EI7A 1LDTT 1EQ9A 4X1NU 1S6HA 1TPSA 2BTCE 1B0EA 4FXGH 5FPTA 5JBCS 1UJ1A 5GNDA 2QC2A 2HALA 1TABE 3UTUH 1A0HB 1CHOF 1MTNB 2XNIA 1GBFA 1Y3XA 2CHAC 3U69H 4DG4A 1THSH 1QBNA 1V2MT 4RI0A 2UWPA 3FFGA 3ELAH 1EAIA 1GBAA 1C5XB 3MYWA 1O3NA 3BTME 1NRSH 4RKJB 3TGKE 1O5AB 2WPDD 1W10U 2PTNA 4TT3D 1K1JA 3S9CA 3A8BA 3BSQA 1J8AA 4TSFD 2XWBI 3KN2A 2FOHA 3OEHD 3UIRA 3TK6A 2GD4B 1OXGA 3A88A 4YT7H 5C17A 2PHBA 2UUFB 1THPB 2Z3CA 9LPRA 1JWTA 2V6NA 1IQFA 4K69A 2YMSD 4CREA 5LPRA 1C5LH 1P2QA 4X1SU 2HLDD 1TGTA 1A4WH 1UVSH 3ATKA 5E2OA 1D6WA 1HBTH 1UVOA 3P8OA 3OFND 3WY8A 4X6NA 3P8NA 3KYFA 4I8HA 1GI3A 2AHME 1T4VH 2O9QA 1AFQC 5T1VA 2GTBA 1ZLRA 4ZKRU 1UTQA 1GCTC 1ETSH 1ABJH 2ODPA 1W0YH 2XYAA 1YGCH 1Y5BT 3V7TA 1QGFA 2WV4A 4Y11E 3QTVH 4VGCB 1AKSB 3P8GA 3MH7A 1KY9A 2P93A 1BJUA 2LNCA 1NFXA 4Y7AA 3ZVDA 1SKYE 1E36B 3NUMA 1AU8A 1GG6B 1FN6A 2ZTYA 4TWYA 5T6GA 4CRGA 1CBWC 3SJ9A 4R0IA 3DA9B 3AW0A 3SNEA 3ZIAD 4FUJA 5E8EH 5HMAA 1OWDA 2A7CA 1LVBA 2WPKS 1BMLA 2K0QA 3GS9A 1YPMH 1NESE 4CR9A 2BMGB 2RDEA 3PLPA 1GI0A 2FO9A 1AZZA 3GCHB 1MMJN 3HPTB 2I6SA 4NFFA 4BAKB 2CGAA 1OWIA 3KNXA 2OP9A 3PLKA 1KXEA 3ZZBA 1W12U 2D1JA 5GCHF 3SNAA 2QE7D 2ZI2H 4MQAA 2HRVA 4UE7H 2XC0A 4O3UA 1ESTA 3E91A 4A92A 1EX3A 2J92A 1C1RA 1C5YB 1SHYA 2P3FH 4WXVA 3LDXH 1DXPA 2UUJB 1CVWH 1MH0A 1Z1IA 3BEUA 3OYPA 4O3TA 1QJ7B 2TGDA 1NRRH 2QXJA 4JYVH 3FVFB 1RTKA 2ANYA 1MAXA 1ELAA 3L6PA 1DDJA 5FPSA 3E1XB 1TMUH 2PR3A 2G51A 3DFLA 1TNLA 1WYKA 2I6QA 2EEKA 2HNTC 2CN0H 2GT8A 3SHAH 1DICA 2F4LA 3SU2A 2STBE 2GVFA 5EW2H 2D26C 4AG1A 1JIMA 2BY9X 5DP3A 2RDLA 2ZP0H 3ZZ9A 1HJ8A 1QY6A 1Q3XA 2R0KA 4FUBA 3SI4H 4UD9H 3RM0H 4UONA 3G01A 3RXPA 3QLPH 3TJOA 2F9NA 1V2UT 4HG6A 3WWBA 2VH6A 1NBMD 3MNCA 2XBWA 2BD4A 1D3TB 1QA7A 1P3CA 1PYTC 3SUEA 3TIUA 3UY9A 2FIRH 1YCPH 3NPSA 1RD3B 1MBMA 2H9TH 2GCHG 2CXVA 1AGJA 1GI5A 1O31A 2A5AA 1FV9A 1AE8H 1FY3A 2EC9H 3A8DA 1P8VC 1E37B 4Y71A 4OS2A 2AMPA 1B7XB 2R3UA 5TCCA 5L6NH 4GSOA 1FN8A 3MHWU 1RIWC 1C4V2 1DUAA 5BRRE 2VGCC 1TGBA 2ZHDA 3RXOA 2A31A 5AF9H 3M3TA 2PKSC 2F91A 2F9BH 3LGUA 5C1XA 3CP7A 5I46H 1N8OC 1GVLA 2FM2A 1SQTA 3RXCA 2ZU3A 3F0OA 3WWFA 1ARCA 2D2DA 1LTOA 4AB9A 1BZXE 1ZJKA 1H9LB 2Z9IA 1MU8B 2A0QB 1G9IE 2ZQ2A 2RA3A 1KXAA 1EP6A 3Q3KA 2WV5A 4IN1A 4JCNA 1FLEE 2ZTXA 5T3HA 3GDSA 4A1VA 5JBTA 1RTFB 5J4QA 1OHHD 1ABIH 5CHAC 1ELFA 4RN6A 3RM2H 1MTWA 2QY0B 2ZGXH 4INKA 2W26A 1A0JA 2BQ7B 2ZZUH 3A86A 3OTJE 4AOQA 3MOCA 1Q31A 1BRAA 1GBJA 2JDID 4YLUA 4TY7A 1TBQH 1F7ZA 2OC0A 1OP8A 1K9OE 3P6ZB 5C0TA 1TMBH 2Q6FA 2R2WU 2ZGBH 4B71A 3S9BA 1S81A 1OOKB 4K1SA 2W7SA 1V2OT 3A81A 3UWIA 1B0FA 3RXSA 3K6ZA 4X8VH 2Z9JA 1SGQE 5GWZA 4A5TS 3KQDA 1IAUA 2QF0A 2G55A 4FUCA 1GGDB 5CHBA 5EOKA 4I8GA 1Z8IB 4X2YA 1HAHH 2O8WA 1WAYB 1ZMLA 3I78A 2ANMH 4KP0A 2O8UA 2PKAB 4JYTA 5EU8A 4A1TA 1C1QA 4ASHA 4I7YH 1O2KA 3MNSA 3RU4D 3PM3A 1OWHA 1KTSB 1T31A 1YM0A 2H6MA 4NIVA 4YOJA 3BTKE 2CK3D 3KQEA 1TX7A 5FAHA 1O3AA 2A5IA 3SV9A 5LH8A 5JYIA 2J4IA 3VB6A 2L6OA 2G4UA 2C8XB 2BZAA 1MZDA 1GBDA 1UCYK 3MH6A 3SUFA 2CHAB 1O2OA 1QB6A 1T8NA 1E38B 4CH8B 4OM9A 1L1GA 2C90B 1C5SA 4YZUA 3T5FH 1OYQA 1WUNH 2NU0E 7GCHF 2GCHF 2V3MA 5JB9S 4MPWA 1QA0A 2ZFPH 5IYTA 2ZC9H 2R0LA 4MNYA 3GICB 3RXAA 1DSTA 2WPIS 1K21H 2JKHA 1YPEH 1J15A 2Q1JA 1UO6A 3GY7A 1O3GA 1X7AC 3JZ2B 4M9FA 1C2IA 2V3OH 1LKBA 4B6FA 3CENA 2ZDMA 1Z8JB 1IQJA 2IPQX 2ZDLA 2ZIQH 3F9EA 3RXGA 3AK5A 4X8SH 5EQRA 1GI1A 3SJIA 2XBVA 1GJ5H 1DWCH 1MUEB 2PKAA 2GZ7A 1V2VT 2Q6GA 5ABWA 3ZVAA 1TRMA 3H7TA 1AFQB 1GI8B 1MKWH 1SGFG 1ANBA 5DP6A 3RU4T 1XMNB 1AFEH 4ZHLU 1EB2A 1GJ8B 1GCTB 1T32A 3A8AA 1FPHH 2TRMA 4XBBA 2J98B 1BB0B 1TE0A 1WTGH 3M5MA 5H4IB 5DGJA 2PLXA 1ZMNA 4CBNA 1KDQB 4K1TA 2C8YB 1PQAA 2QV1A 2EI8A 1UHBB 2R2MB 1CBWB 4MTBA 3MU5A 2AGGX 1DE7H 5ESTE 3EYDA 1C2GA 4BTIB 1SGEE 1COWD 4MG3A 3E0PB 1E1QD 2J38A 2SGQE 1TIOA 3BEIB 1XX9A 1WDIA 1XVOA 1HNEE 3OSYA 3SV7A 1A5HA 1A3EH 2UUYA 1DSUA 3VPKA 2F9OA 3PV5A 4I31A 4ZXXH 2Z9KA 1YKTA 3LOXA 1ELBA 3RC4A 1EKBB 1HUTH 1UVPA 1TA2A 3AW1A 4ZXYH 4B75A 2ZTZA 1ZSLA 3SU3A 1C2DA 2FYRA 4UFDH 2A4RA 1FUJA 4JZDH 3LGIA 2H2ZA 3GOVB 1JMOH 4B76A 1BTUA 4LZ1H 2J98A 1A2CH 2PFEA 1H9IE 1NZQH 1ZTJA 3P70B 4XFQA 8GCHF 2BXUH 1C1TA 1TPOA 5GDSH 1FPCH 1LHFH 5F8TA 1EFRD 4M7GA 3U1IB 3F9HA 1W8BH 3DUXH 2BD2A 1CSOE 4U30A 3NWUA 1SGFA 1IQLA 2WYJA 1K1PA 1OWEA 2FTMA 1HAXB 1AVGH 4F55A 5EXLA 6GCHF 2C8ZB 1DLKB 4K3JA 2BDCA 5AHGH 4ZUHA 5FBEA 1NU9A 2J34A 5E0JA 1IQGA 1FNIA 1S0RA 2ZWLH 3M7TA 1NM6A 1SFIA 4ACBA 2ZDAH 3RXVA 2SNVA 4FVDA 1D3PB 2J5UA 3UNSA 3BTGE 3N7OA 4JYUH 4X2XA 5K7RA 1W0KD 3VXFH 4JZEH 3OU0A 4Y6DA 1P02A 1N6XA 3K9XB 5A2MH 3MU1A 1G30B 1NPMA 1TX6A 2FTLE 2GCTC 2Z3DA 4Y76A 1F0RA 1RIWB 1AVXA 1ESBA 5EJLA 4OS6A 2VGCB 3KQCA 2Y5HA 1C5TA 1SC8U 1BA8B 2PKSB 5JDUB 4CRCA 1MKXK 1N8OB 5JPMH 1V2LT 1QIXB 1QNJA 1Z71A 4DW2U 4KGAA 1AHTH 8KME2 2QXIA 2BM2A 4WXIA 2VIWA 2TGPZ 2ZHEH 2EI6A 1LVYA 1K1MA 1SB1H 1O5DH 1XUHA 1UVUH 1D6RA 1EAUA 1LKAA 2ZKSA 1PPBH 3P92A 1EZUC 1ELEE 2BVXH 4HFPB 1Z6EA 3A7YA 3GDVA 4WWYA 3RMNH 1UW7A 1Y3VA 3SV8A 5C0UA 1GBMA 1P0SH 2SGPE 1F0TA 1CA8B 3S7KB 3L33A 1O5BB 2NU3E 2HNTF 3ATIA 1DY8A 2VIDA 1AD8H 3QTOH 4J1YA 5F8XA 3RXKA 1SLXB 3BIVH 1TQ0B 4FUIA 2WPJS 3LJJA 4J2YB 3U98H 2VIOA 1MZAA 2B5TB 3A7XA 1C5OH 2XOKD 4X2VA 1NRNH 4B2CA 2GJGA 1GHXH 1CA0C 1PPFE 1S84A 3FP8E 2GKVE 3ZZ3A 1UK2A 1LHGH 3UNRA 3W1EA 5HIYA 5HIZA 1E1RD 3ZV8A 4AFQA 2NU1E 8LPRA 1O33A 1FY5A 1UK3A 2RFKC 5JBAS 3T2NA 3RMOH 4WMFA 3KIDU 1P03A 1NU7B 1UK4A 1KTTB 1O2JA 3UQOA 3ESTA 4A6LA 3BV9B 2ZPQA 3GY4A 1ZHMA 3OY5U 5HGGA 1O3IA 3M7UA 2AMDA 2UWLA 1C5ZB 3BG4C 2A45B 1QRWA 4UFGH 1BRBE 3TNTA 1LHEH 2G81E 1O2IA 2BX3A 4NA8A 1O3MA 4B74A 4H4FA 1H1BA 5EXMA 2YMSC 5EGMA 3M35A 1MBQA 2JJ2D 4WMDA 2QA9E 1F5RA 3P95A 4ABFA 2TBSA 4U01A 3NK8A 1SQRA 5FBIA 4WH6A 4YLQH 1CGIE 1HAPH 1O2TA 2J2UA 3B9FH 3EE0B 2F3CE 2VINA 1O2VA 2ZDVH 3MU4A 4ABGA 3EAJA 1LPGB 3A7ZA 1S85A 1K22H 1FJSA 4LXBH 2F9UA 4B73A 3ZVCA 3W94A 5FX5A 1FIWA 5FL7D 4OS4A 3URCA 1C1PA 4GPGA 3UR6A 3L3TA 1AQ7A 4WJG2 2P95A 2Y81A 2BVSH 4NZQA 1JRTA 1BTHH 4D9RA 4JZIA 4TYDA 2ZPRA 1V2TT 3FZZA 1AO5A 5C20A 5PTPA 1RFNA 1KLIH 3LH3A 1ZHRA 3PV2A 4P00A 2HPPH 4MVNA 2H5CA 9ESTA 5EW1H 2AMQA 2FODA 4YOGA 2PUQH 2ZFSA 3FKSD 5HM9A 1DX5M 2ALPA 3GY6A 5EXNA 3VB7A 4F4OC 4MNXA 4B1TA 3B23B 3RLYH 3LIWA 3LH1A 1O5FH 3MU8A 3Q3XA 1F92A 3E16B 2BY5X 5HM2A 2A4QA 1HAYB 4AN7A 1VR1H 3BTWE 3VEQB 1O2GH 1EATA 1SL3A 1AMHA 1ELVA 4O03A 3GYLB 3PB1E 1A61H 3LGYA 1L1JA 1MABB 2GT7A 2A7HA 1ORFA 2FLRH 2WV9A 1GI4A 3PMBB 4K2YA 3PROA 1OP2A 3TJUA 1D9IA 2G5NA 2BOHB 2ZG0H 1SPJA 1XXDA 2JH5D 3SGBE 1E34B 3U28C 3ZVGA 1EOJA 1CGHA 1KXFA 3RDZA 3O8CA 3KGPA 1ZR0A 2F9PA 1ZGVA 1J14A 4I32A 1DM4B 4OS1A 5L2ZH 5FCRA 2QCYA 2SGFE 2PV9B 3SQHE 1DS2E 3KF2A 3MNBA 1W0ZU 1Y3WA 3UNQA 5EIYA 1C5RA 2FS9A 4GLYA 1FZZA 2RG3A 3M3VA 4H6TA 4IGDA 3LC3A 4JZ1A 1D4PB 1IHTH 2ZFRH 2OK5A 3QO6A 2BXTH 3QGNB 4H42U 1W11U 3JZ1B 3PYHA 5ESBA 1BJVA 1IOEA 1QL9A 1QCPA 3QZRA 4DGJA 3SYJA 5DP7A 5DO4H 4INHA 1QZ8A 4UDWH 4YTAA 1SGDE 1SOTA 2JIZD 4ZKSU 3LGWA 2SGAA 4FUHA 1GHAG 2IJD1 4DCDA 1S6FA 3CS7A 3RC5A 2FDAA 1SLWB 4WMEA 2XBXA 2G8TA 5ETXA 1Y3UA 3QZQA 2NU4E 4FU8A 3A80A 3QX5H 4I8LA 5B6OA 1ANCA 2BY8X 1AZ8A 1G3EA 1WTHD 3RXFA 1GDNA 3URDA 1AN1E 1YP9A 4GHTA 1C2HA 1DOJA 4AYYB 1LQDB 3ATWA 1A0LA 1HJ9A 1NT1A 4DT7B 3RXUA 4MNVA 1P11E 2BX4A 1UCYE 4I8KA 4PROA 1C5PA 1NC6A 2D8WA 2Z3EA 4ZROA 1NY22 2GGVB 4FETA 3SJKA 1YY3A 2QXGA 1C4U2 1EAXA 2HVXA 2OC8A 5F03A 1V2KT 1VKYA 2C4FH 2EY4C 3ZZ7A 1FY4A 1SI5H 2FPZA 2IOTA 3OX7U 3BTQE 3H09A 3MMGA 2GCTB 2A4GA 2K1QA 5L30H 2BDGA 2DUCA 4ABDA 1TBZH 4NG9H 1SQOA 4UFFH 1PYTD 4D9QA 2FX6A 1T7CA 2ALVA 1H8DH 1PQ5A 2BD9A 5DP5A 3TK5A 1ACBE 4X8UH 1BHXB 1HV7A 3O8RA 5HXFA 3RXTA 1K1LA 4X6PA 1KXDA 2ZCKP 3KQBA 2A5KA 5DG6A 2KFWA 3VXEH 1LCYA 2P3TB 3AASA 1TONA 1P2JA 4A7IB 3QK1A 3UWJH 2QF3A 3I77A 2TPIZ 2ZHQH 4TPYA 2BD5A 3H7OA 4YT6H 5A8YA 2HGTH 5FXLA 3RXRA 1HJAC 2GDDA 1C1SA 1XXFA 4AORA 2A2XH 2FESH 3P17H 3F2HA 4KELA 3DD2H 1T8MA 4KTUA 3UREA 4ABIA 3MQKC 3FP7E 2KCPA 1OSSA 1TOMH 1ZRKA 1G2MA 1M9UA 3ZYDA 4ABEA 1C2FA 1AI8H 2OINA 3RXMA 3SU6A 1LHCH 4BAHB 4JMYA 3M5LA 1E35B 2C93B 4KTSA 4D8NA 1GHAF 1CA0B 2BZ6H 2KCYA 2PW8H 2IN2A 3SU0A 3HK3B 1BBRH 1J16A 1HFDA 1HGTH 1F0SA 3RUOA 3F3BA 1AUTC 1YCPK 4LZ4B 4X1RU 1AVWA 5E0HA 1DLEA 2CF8H 3LU9B 4AGKA 4ESTE 3GY5A 1VITH 5K0HA 4AFUA 1GCDA 1TLDA 1T8OA 4E05H 3QGJA 3CS0A 3BIUH 3KYGA 1GHWH 3F68H 4MDSA 2TIOA 1QQUA 1GBLA 1GL1A 1FDPA 1NRQH 2PSYA 3BG4B 2O8LA 1YWUA 1CT2E 1EPTC 1C2LA 1SVPA 6CHAC 1DPOA 1O32A 2YOLA 1YLDA 5FPYA 2ZECA 2J9NA 4YXWD 2FOFA 2W3IA 5GXPA 1D3QB 3V13A 2YMSB 2ZF0H 4NCYA 4D7GA 1TWXB 2GV6A 4IN2A 4X1PU 4ISIH 5DP8A 2BLWA 1BHXF 2J94A 1QURH 2HOBA 1DVAH 3SBKA 1EZXC 1PPEE 3F2GA 5EPNA 1ZJDA 2ZEBA 3F1SB 1FXYA 2F43B 3TH2H 3E0NB 3S7HB 1HAVB 3A7TA 3T26A 1F0UA 1GDQA 3ATLA 1UTPA 1JXPA 4NIWA 4AX9H 2WZQA 3OE7D 1N1LA 3GCTG 3UAIC 3F0PA 4DIHH 2A4OA 3NXPA 2KM0A 2ZU1A 2WINI 1K2I1 1GMDG 3SGQE 3SU4A 4LOYH 2BDAA 1CQQA 1DY9A 4MLFB 1AE5A 4X6MA 1SFQB 2AGIX 5B6LA 1K1IA 1FI8A 1KXCA 1QTFA 3PMAB 1KXBA 1FQ3A 1PPGE 2V7QD 3EDXB 1LQEA 3LJOA 4K8BA 1CU1A 2KCAA 1ELGA 2TGAA 5A0BA 4Q4LA 2LPRA 2GDEH 1O2RA 4AB8A 4O9VA 5A09A 5CDFE 8ESTE 1Q2WA 1O5EH 1WQVH 4HZHA 3EQ0H 3Q77A 2YNBA 4R8TB 1QQ4A 5F8ZA 1RGQA 1YCPM 2XTTB 3KHVA 4Y8ZA 1IQHA 4KKDA 2Z94A 1NBME 1J17T 1TPPA 3PTNA 3ZZ4A 1EZQA 4IS5A 2XXLA 2B0FA 1MQ6A 2STAE 1CT4E 2B9LA 3SU1A 3T25A 3A82A 2DE8A 2FYQA 1S0QA 2EA3A 5DP4A 2B8OH 3V12A 1ELCA 1HAVA 1KLJH 1CT0E 1ARBA 1GI7B 2NU2E 2PGBB 1VCPA 2KAIA 3TH3H 1PQ7A 3EA9A 3PLBA 1ELDE 1XKAC 1Z6JH 3OEED 1IHSH 2ZDKA 2BLVA 2VIVA 2WYGA 4FVBA 2BD8A 1LHDH 3SO3A 1O35A 2ODQA 7ESTE 2FI3E 7LPRA 3GISB 1LO6A 1OX1A 4ZCNA 5TCAA 3ITIA 2W6JD 1EJAA 3SNCA 1QB9A 4Z6AH 3QN7A 1SQAA 5C67A 2THFB 4JZFH 2P8OC 3TH4H 4AGJA 4HGCA 1SMFE 2BDYA 4GAWA 3BTTE 1V3XA 4X0WU 1IQKA 2B7DH 3GCOA 5BPEA 1ANDA 2XBYA 2OUAA 1QFKH 1GBIA 3UUZA 1EAWA 2Y7XA 1O2SA 1LPZB 2SFAA 1H9HE 1EJMA 3ENSB 1AIXH 4LK4A 5EQSA 3S0NA 3HK6B 4FU9A 1FONA 1E79D 1ID5H 4FUDA 3SZNA 1MKWK 1O39A 3RXJA 1O2QA 3MFJA 3GCTF 1OWKA 1VZQH 1BUIA 1D3DB 1GBBA 3TPIZ 4DT4A 1UTNA 1GMDF 4Q2KA 1UTMA 4TWWA 4AFSA 1E0FD 3SHCH 5DSFA 3BEFB 1Y3YA 3U1JB 2VBCA 5C1UA 1PFXC 1OKXA 1DANH 2JH6D 3DSOA 3T27A 3V0XA 5C2ZA 3RMLH 1NO9H 1P10A 4K1EA 3TJNA 3BF6H 4BNRA 4NZLA 3H5CB 3LONA 4Y8XA 2OLGA 1W7GH 1C1NA 3RXLA 4IMQA 2BY6X 4IC6A
chains in the Genus database with same CATH topology
2IPHA 1NFYA 2AIPA 4CRAA 3RU4E 4MPVA 3ZVFA 1L0ZA 1DWDH 1O2HA 3W95A 1TRYA 4CBOA 2XWAA 4E06H 1C5NH 1OYTH 5DK1A 1PPZA 2FOGA 2GMTC 1BTYA 2ESTE 1XVMA 4HI3A 1BIOA 3TK9A 2FI4E 1ZPZA 5IDKA 1K28D 5C3NA 4HTCH 1LVOA 1YLCA 1LPKB 2BOKA 4GCHG 2VNTA 4SGAE 3S9AA 1GI9B 1SSXA 2F9VA 5T6FA 2FOMB 1V6DA 4DY7B 2Y7ZA 3UR9A 3E90B 1O0DH 2IJOB 1SLVB 1VGCC 4OGXA 1L1NA 4YOIA 2AGEX 1OS8A 2FS8A 1YPHE 2FOCA 1HJAB 1BTZA 1UTOA 1GJBB 3LPRA 1O2XA 2W5EA 1XUKA 3PV4A 3EGKH 1HDTH 3UQVA 4AYVB 1TGNA 3PWBA 1O2LA 3MWIU 4H6SB 1BMNH 3KL6A 4FU7A 1GDUA 1GI2A 1Y8TA 1C5MD 4XBDA 5GIBA 1VJAU 4BAMB 2O8MA 1C9PA 1JRSA 4NWKA 1GHZA 3SUGA 1TNHA 1C2MA 2BLQA 1BMAA 1O3JA 1XKBC 3D62A 2ZHWH 1KLTA 2VIQA 1GJ4H 1ZOMA 2XRCA 3TGJE 1TMTH 2FI5E 1PPCE 3O8BA 1XUGA 4XDEA 3ZVEA 1BITA 2QXHA 4BTTB 3SI3H 5FX6A 1GJ6A 4UEHH 3LT3A 1ZTLA 1HPGA 1O5CB 3I29A 3R3GB 2ZU2A 3LKWA 4OGYA 3PTBA 5GCHG 1P04A 1BT7A 2Q6DA 1WV7H 4I33A 1HIAB 3K65B 4WY3A 3RXDA 2QGRA 1DFPA 2GV7A 3QDZB 1AY6H 5AFYH 4RKOB 1BCUH 1O2NA 4UFEH 1EPTB 1XUIA 1P2MA 1NRPH 1SBWA 6CHAB 2BDBA 1A3BH 1PJPA 2QN5T 3ZZCA 3UPEA 1C5VA 1IQIA 2DE9A 2ZO3H 4DIIH 2ZA5A 1Y5AT 4B2AA 1G2LA 4K5ZA 4AG2A 2XW9A 1A1RA 1DT2A 1G37A 3Q76A 2FZZA 2BQWB 3KCGH 1GBHA 2ZQ1A 1MQ5A 3SV2H 3AAVA 2WUCA 4K60A 1ELTA 2FOBA 1O2WA 1P2NA 1CO7E 1TYNA 2JH0D 3FP6E 3AAUA 4D76A 3C1KA 1NROH 2R3YA 1S82A 4IC5A 4RSPA 2ZU4A 5DPAA 5T6DA 1ZMJA 1UTLM 1KYNA 1O3PB 2BDIA 2ZFQH 1V2JT 3ZVBA 1V2RT 2ILNA 1VCQA 3VB4A 1W14U 1A5IA 3SV6A 2RCEA 3TLOA 4GCHF 3GDUA 4BAQB 3NCLA 3K6YA 5C5NA 4Q7XA 4OS5A 2BVRH 1C2JA 1MD7A 3TVJB 2A7JA 1F2SE 1HIAA 4X2WA 4DOQA 3VB3A 2ZNKH 2ZGJA 3LGVA 2XCNA 1LMWB 1O37A 1ZTKA 1YBWA 1ZYOA 3MNXA 1TNIA 1EPTA 2FEQH 3VB5A 2H9HA 4MNWA 2W3KA 2QYIA 2JETC 1EUFA 2AH4X 2AEIH 1TALA 1RJXB 2ANWA 5FHTA 1A46H 3BTDE 1QL8A 4ISNA 4MPXA 3A83A 2FX4A 4BTUB 1C5QA 2AS9A 4FUGA 4KTCA 2BQ6B 2FLBH 1GBTA 3NKKA 3HKJB 4Q80A 1MCVA 2WPMS 2TGTA 2RA0A 1EP5A 3ODFA 2P16A 3ZZ8A 2A32A 1TOCB 3SGAE 1SR5C 1Z8RA 2VJ1A 3M3SA 1NFWA 5AFZH 3GY8A 1SOZA 1C4Y2 2PSXA 2PUXB 1O3EA 1QJ1B 3SN8A 3IG6B 3MH5A 4ZKNU 1CE5A 1O2MA 2P8OB 2VVUA 2BDHA 4CRDA 1HRTH 2AERH 3RXHA 1BTWA 1WQSA 3F9GA 2AYWA 1QBOA 1CHGA 4NA7A 1TGCA 2SGDE 3VGCC 3LGTA 2H5DA 4MPUA 3E3TA 1AKSA 1ZRBA 1ZGIA 3O8DA 3AVZA 2WPHS 1P06A 1O30A 2GZ9A 3T28A 5HYOA 1INCA 5E0GA 3RXQA 1P09A 3HGNA 3M7QA 4OS7A 2ZU5A 4CHAC 3HGPA 2QIQA 2BY7X 1HAZB 5C5OA 1BQYA 2GZ8A 1GHVH 1AWHB 1TAWA 1F5LA 1KSNA 3RLWH 1QB1A 1ZPBA 1O3HA 3SU5A 4ZHAA 3PO1C 3RXBA 1H4WA 3BN9A 4CRFA 3ZZDA 1L4ZA 2Z6BD 2FOAA 1GVZA 1O2UA 1P3EA 1DWEH 1BRUP 5TJXA 2H9EH 1AB9C 7GCHG 3F9FA 1SGRE 2VWLA 3SUDA 4SGBE 3TU7H 1O3OA 1FMGA 1MTVA 2FOEA 2YNAA 1C5UA 1G3BA 1UCYH 2V3HH 2H1UA 1OWJA 2VWOA 1V2NT 1DWBH 2C3SA 4WH8A 1GHYH 2VWNA 1ZZZA 2HLCA 2ZCHP 3MTYA 3HATH 3M5NA 2G4TA 3U9AH 2SGEE 1Z1JA 1HAIH 1OP0A 1TX8A 2WPLS 1TNKA 2GMTB 2ZPSA 4Y10E 5C1YA 4BOHA 1QL7A 1MTSA 1GJAB 1TNGA 1BRCE 2CV3A 2VVVA 3RXIA 4O97A 2V0BA 2BLOA 1G3DA 2BD3A 2ODYB 3TJVA 5AVDA 3UFAA 2PGQB 1JIRA 2HPQH 1GBEA 3SNBA 4X8TH 4NWLA 1VGCB 1OPHB 4BXWA 1HAGE 2XC5A 1S83A 3QUMP 3RC6A 1GJ7B 1K1NA 3BTFE 2ULLA 1LVMA 3EA7A 3GY3A 2Y82A 1BBRE 2P3UB 4ZAEA 3RMMH 2Y5GA 4IW4E 4XOJA 1RS0A 3M37A 1HXEH 1C1MA 1C2KA 1EOLA 2ZHFH 3HKIB 1O5GH 4Y7BA 3ZYEA 2OQUA 1XUFA 2F83A 2A2QH 2G52A 1Z8GA 7KMEH 1HAOH 1ZHPA 5JB8S 1FY1A 4YM9A 1UTJA 1ZSKA 2W7UA 2VIPA 1GJ9B 1RXPA 2UWOA 4JK6A 1UVTH 2FP7B 5DKMA 3A7VA 5CMXH 1JBUH 3PMHB 1P57B 3R0FA 4JK5A 1YPHC 2OC7A 1SLUB 2HWLB 3ZV9A 1VITG 1YPJH 1K1OA 1SGYE 1MTNC 2FMJA 5GPIB 3IITA 2J95A 4Q7YA 3M5OA 4FUEA 1GMHG 1ZPCA 2ZDNA 1ETTH 1SGCA 3ZZ6A 3Q00A 4NGAH 1BTPA 2PTCE 6LPRA 1Z7KA 1O2YA 1O3FA 1P9UA 3MI4A 3A8CA 4I8JA 1EJNA 5A0CA 2VVCA 3D49H 1GHBG 1O3KA 1CGJE 1GWAA 1V2ST 4ABAA 1A5GH 1YYY1 2KAIB 3E6PH 5J4SA 4DURA 1XM1A 3E8LA 3MO6A 5DP9A 6ESTA 3M36A 8GCHG 1DXWA 4ZKOU 5EODA 1O34A 5SGAE 5EG4A 2QAAA 5JBBS 1W7XH 5GJ4B 1W2KH 2ZFTA 1W13U 4TY6A 3A7WA 3A85A 1HB0B 1TGSZ 4Z0KA 3SOSA 1EB1H 4ABJA 4CH2B 1B5GH 1EASA 1F5KU 2Z9GA 4IBLH 3VFEA 1HXFH 1MU6B 3MO3A 1MCTA 1O3DA 1QRZA 3GY2A 6GCHG 3C27B 2Z9LA 3V3MA 1PQ8A 2FXRA 4ISLA 3IWMA 3BG8A 2BD7A 5E2PA 2ZGCA 1T8LA 1BMMH 1C9TA 4VGCC 4WVPE 1G32B 5LPFA 3TGIE 1BBRK 1TQ7B 3M61U 3DHKH 1C1UH 1GI6A 1V2QT 1GG6C 4Y0YE 3A89A 3U8TH 2BB4A 1ZSJA 4NIYA 5A0AE 1TFXA 2JETB 1G3CA 2P94A 5EQQA 3MO9A 1SG8B 1O3LA 5G4BA 1W3CA 2ANKH 1Y5UT 2SNWA 2A1DB 2ZFFH 1GMCG 3ODDA 1O3CA 1WU1A 3PWCA 1HYLA 1T4UH 4D7FA 1QBVH 5LPEA 2PWXA 1XUJA 1PPHE 2HNTE 4Y79A 1SGIB 2VWMA 1L2EA 4ZH8A 1GL0E 3DFJA 3GCHC 1RTLA 5EPYA 1YPKH 1U6QA 1C1VH 1YF4A 2FWWA 2CJIA 3TITA 3T29A 3A87A 2V35A 3EA8A 3T62A 2Y5FA 5CE1A 1TNJA 2C8WB 1MKXH 1RRKA 3RXEA 4ABBA 1SHHB 2GX4A 1C1WH 1C2EA 1NTPA 1NS3A 1VITF 3FAOA 2OCVB 3ZZAA 4BAOB 4DVAU 1UMAH 4IMZA 3TNSA 1DITH 1FY8E 1ETRH 2NWNA 3KEEA 1GMHF 1IQEA 1J9CH 1O2ZA 1GBCA 2G5VA 1WOFA 3RP2A 1P2KA 2OTVA 4WF8A 3Q3YA 1P2IA 2VH0A 1C1OA 1EXFA 3S69A 4YESB 1YPLH 1S5SA 5F6MA 4GUXA 3VGCB 1THRH 2XCFA 1P2OA 3U8OH 1GHBF 1L4DA 2BYAX 1P9SA 1EZSC 2ZCLP 2VU8E 4F49A 3SW2B 1GPZA 5I25A 1QHRB 4Q7ZA 3B8JA 1QRXA 4YO9A 5DJ7A 4GHQA 4CRBA 2O8TA 4XSKU 2Y80A 1O36A 1KDQA 1GJDB 2Z7FE 1UHBA 2Y6TA 4X6OA 1CHOG 2OXSA 3D65E 1GJCB 1UTKA 3PMJA 3STIA 4CHAB 4BXSA 3BTHE 1WSSH 2GP9B 3MH4A 3MU0A 1AUJA 1O38A 2BHGA 2OC1A 3QWCH 1FAKH 5LGOA 3FANA 3OY6U 1MTUA 4NIXA 4THNH 1NN6A 1WBGB 4ISHH 3UOPA 1MD8A 3PO1B 1HCGA 1YC0A 4CR5A 4E7RG 4NSYA 2VB0A 1AB9B 3FZDA 3D23A 4B2BA 1Y59T 1JOUB 1BTXA 4ZMAH 1G36A 1GBKA 1P01A 3GYMA 5A8XA 1O3BA 3SNDA 1YPGH 3ATMA 1QR3E 4K8YA 4ISOA 1P05A 5L2YH 3F6UH 2M5TA 2CMYA 1AWFH 1NFUA 4INLA 3P8FA 3UOUA 1KIGH 1BOQA 1WCZA 3SQEE 4AZ2B 4Y8YA 3SJOA 1H8IH 4U32A 4BANB 1GMCF 3GCNA 1QJ6B 1BDAA 2WUBA 2AIQA 3U8RH 4Y0ZE 3K2UA 4X1QU 3SJ8A 2G00A 2UUKB 1MAYA 4TPIZ 3STJA 1TPAE 1ESAA 2OD3B 2ASUB 2R9PA 2ZGHA 2P59A 3LC5A 3NZIA 1SGNE 4E7NA 4GVUA 4ABHA 1TRNA 4QT8C 1FAXA 2OQ5A 5A8ZA 1IQMA 1TB6H 1P12E 5CHAB 2XC4A 1GVKB 3A84A 1V2PT 1C5WB 4NSVA 2AFQB 3DT0H 1VCWA 3BTEE 3SORA 3ZZ5A 1TA6A 4DJZB 2OBQA 5FCKA 4FUFA 4ZHMU 1FIZA 1O2PA 1DUEA 2OBOA 4U2WA 1ANEA 1GGDC 1HLTH 4NA9H 1A7SA 4XE4A 1SGTA 1SGPE 2CF9H 4NFEA 1N6YA 1TBRH 1V2WT 4AFZA 1IQNA 1VJ9U 4XBCA 4A1XA 2EI7A 1LDTT 1EQ9A 4X1NU 1S6HA 1TPSA 2BTCE 1B0EA 4FXGH 5FPTA 5JBCS 1UJ1A 2QC2A 2HALA 1TABE 3UTUH 1A0HB 1CHOF 1MTNB 2XNIA 1GBFA 1Y3XA 2CHAC 3U69H 4DG4A 1THSH 1QBNA 1V2MT 2UWPA 3FFGA 3ELAH 1EAIA 1GBAA 1C5XB 3MYWA 1O3NA 3BTME 1NRSH 4RKJB 3TGKE 1O5AB 1W10U 2PTNA 1K1JA 3S9CA 3A8BA 3BSQA 1J8AA 2XWBI 3KN2A 2FOHA 3UIRA 3TK6A 2GD4B 1OXGA 3A88A 4YT7H 2PHBA 2UUFB 1THPB 2Z3CA 9LPRA 1JWTA 2V6NA 1IQFA 4K69A 5LPRA 4CREA 1C5LH 1P2QA 4X1SU 1TGTA 1A4WH 1UVSH 3ATKA 5E2OA 1D6WA 1HBTH 1UVOA 3P8OA 3WY8A 4X6NA 3P8NA 4I8HA 1GI3A 1T4VH 2O9QA 1AFQC 2GTBA 1ZLRA 4ZKRU 1UTQA 1GCTC 1ETSH 1ABJH 2ODPA 1W0YH 2XYAA 1YGCH 1Y5BT 3V7TA 1QGFA 2WV4A 4Y11E 3QTVH 4VGCB 1AKSB 3P8GA 3MH7A 1KY9A 2P93A 1BJUA 2LNCA 1NFXA 4Y7AA 3ZVDA 3NUMA 1E36B 1AU8A 1GG6B 1FN6A 2ZTYA 4TWYA 5T6GA 4CRGA 1CBWC 3SJ9A 4R0IA 3DA9B 3AW0A 3SNEA 4FUJA 5E8EH 5HMAA 1OWDA 2A7CA 1LVBA 2WPKS 1BMLA 1YPMH 1NESE 4CR9A 2BMGB 3PLPA 1GI0A 2FO9A 1AZZA 3GCHB 1MMJN 3HPTB 2I6SA 4NFFA 4BAKB 2CGAA 1OWIA 3KNXA 2OP9A 3PLKA 1KXEA 3ZZBA 1W12U 2D1JA 5GCHF 3SNAA 2ZI2H 4MQAA 2HRVA 4UE7H 2XC0A 4O3UA 1ESTA 3E91A 4A92A 1EX3A 2J92A 1C1RA 1C5YB 1SHYA 2P3FH 4WXVA 3LDXH 1DXPA 2UUJB 1CVWH 1MH0A 1Z1IA 3BEUA 3OYPA 4O3TA 1QJ7B 2TGDA 1NRRH 2QXJA 4JYVH 3FVFB 1RTKA 2ANYA 1MAXA 1ELAA 3L6PA 1DDJA 5FPSA 3E1XB 1TMUH 2PR3A 2G51A 3DFLA 1TNLA 1WYKA 2I6QA 2EEKA 2HNTC 2CN0H 2GT8A 3SHAH 1DICA 3SU2A 5EW2H 2STBE 2GVFA 2D26C 4AG1A 1JIMA 2BY9X 5DP3A 2RDLA 2ZP0H 3ZZ9A 1HJ8A 1QY6A 1Q3XA 2R0KA 4FUBA 3SI4H 4UD9H 3RM0H 4UONA 3G01A 3RXPA 3QLPH 3TJOA 2F9NA 1V2UT 2VH6A 3MNCA 2XBWA 2BD4A 1D3TB 1QA7A 1P3CA 1PYTC 3SUEA 3TIUA 3UY9A 2FIRH 1YCPH 3NPSA 1RD3B 1MBMA 2H9TH 2GCHG 2CXVA 1AGJA 1GI5A 1O31A 2A5AA 1FV9A 1AE8H 1FY3A 2EC9H 3A8DA 1P8VC 1E37B 4Y71A 4OS2A 2AMPA 1B7XB 2R3UA 5TCCA 5L6NH 4GSOA 1FN8A 3MHWU 1RIWC 1C4V2 1DUAA 5BRRE 2VGCC 1TGBA 2ZHDA 3RXOA 2A31A 5AF9H 3M3TA 2PKSC 2F91A 2F9BH 3LGUA 5C1XA