1C2KA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
total genus 48
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2kA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2kA02
1GBIA 2AGGX 2TRMA 1AI8H 5LPRA 4Y11E 4MPWA 1GJCB 3RXVA 3P8FA 2VWMA 2Z9IA 1S6FA 1O2KA 5FX6A 1EQ9A 2AMQA 1QR3E 5FPTA 4ABHA 1C5NH 3SQHE 1YBWA 4MVNA 4AGJA 2G4TA 4UD9H 4Y71A 2D2DA 2GVFA 2ZHWH 1BHXF 1ESTA 2QCYA 1O5AB 2A4GA 2GP9B 1SGCA 1FN8A 5A0BA 3BIVH 3AAVA 2J95A 1TNGA 3H7OA 1GHXH 1K2I1 2VINA 2STBE 3MU5A 4FUCA 1EAIA 1AUTC 3H7TA 2R2WU 1A46H 1NU7B 2BB4A 1EP5A 4YOIA 2RA0A 5EXMA 1C1OA 3W95A 1IQIA 1HXFH 2R3YA 4BAKB 1BRCE 3ZZ7A 2GKVE 4ABGA 4DCDA 3C27B 1DWDH 1UCYH 1RFNA 1YCPM 2W26A 2V3HH 3LU9B 5DGJA 1BUIA 1W14U 1J16A 5AFZH 3ZZBA 2DE8A 1P0SH 5DP4A 3O8BA 4DG4A 1V2KT 4BXWA 1F0TA 1FPHH 3GCHC 3RXOA 5C67A 1C5QA 1O2YA 3R3GB 2AH4X 1W12U 1FV9A 4NZQA 1TPOA 1NM6A 1MZDA 1ABJH 4X0WU 3JZ2B 1RD3B 1G3BA 1EAXA 2PTCE 2BY7X 3E90B 3GCHB 1QRWA 3LGIA 4TYDA 3MI4A 4UFEH 3ZZ3A 2Y81A 1DPOA 2QC2A 3LGYA 3UWJH 1MQ6A 5AF9H 1TBZH 1GHBG 2OCVB 3TNSA 3OY6U 2ZFQH 1A1RA 1G3EA 1UK2A 2VJ1A 2PGQB 3QWCH 2B5TB 1O2OA 1CT2E 2D8WA 3KF2A 1OWEA 3SU3A 2A4OA 2H5DA 3ATWA 3TJVA 5L30H 1T4VH 1Z1JA 1C5WB 3TH3H 3SU0A 1FZZA 4FVDA 3U9AH 1MKXK 2Z6BD 3A86A 4NSVA 5DP7A 1O2VA 4I7YH 1AZ8A 3OU0A 4RN6A 1C5RA 1TMBH 3GDUA 1BRAA 1OP0A 2F9VA 2BLVA 4X6PA 1GBKA 4WVPE 3S9CA 2WPIS 4KTSA 2ZQ1A 2BD7A 1EB1H 1K1NA 1QBNA 1RJXB 2GCHF 3ZV9A 2ZZUH 5GDSH 1DWCH 1A0HB 3A7VA 2ZHQH 1LDTT 2BX3A 3ZZDA 1XUFA 1ZTJA 3G01A 3KEEA 3T28A 3LH1A 4B1TA 1JIRA 2R3UA 4ISHH 4KTUA 1GBMA 3FP6E 2PUQH 2GDEH 3CS7A 5DP6A 2R9PA 2H6MA 5A8ZA 1AE8H 1HIAA 1O2XA 2G00A 3HGNA 3SNBA 4Y0ZE 1QCPA 1C9PA 1G3CA 1Y3YA 3MH7A 2Z3DA 4AGKA 5EOKA 1NESE 2C93B 2BY6X 5JYIA 2KAIA 4AYYB 4AFQA 1Z8GA 1GCTC 3Q3KA 1VJ9U 1ID5H 1BRUP 1V2OT 1EXFA 1T8NA 3KNXA 4GCHG 2A0QB 1NC6A 4NGAH 1PPEE 4D8NA 2SGFE 3TU7H 2ZFPH 4WH6A 3K65B 1JRTA 5FAHA 4NWKA 4X1PU 1GCTB 1VITH 1A3BH 1C2HA 3M5NA 1KLTA 1YKTA 1RXPA 4ZKSU 2G5VA 2QIQA 1GMHG 2UWPA 2ZDVH 1OX1A 1LO6A 2P3UB 2UUKB 4MPXA 3MHWU 3I29A 2FMJA 2FYRA 2UWLA 1VJAU 1FXYA 1ETSH 4BAMB 1KXBA 1DVAH 1SC8U 3SI3H 1TA2A 2FOEA 1C2IA 3QUMP 4IBLH 5LPEA 3D23A 5EXLA 4ISOA 1YCPK 1ELEE 3AW1A 2BVSH 1W10U 3PV4A 4NIXA 1J17T 3RXTA 1YPKH 5AVDA 2SGAA 1UTMA 3GCTF 2UUFB 3A8CA 3E16B 4JZFH 1Q3XA 2Y6TA 5FX5A 2QXGA 3TK5A 1CO7E 1WSSH 2HALA 3MNCA 2ZF0H 1EAUA 2CJIA 3LGTA 2XYAA 4X2WA 9LPRA 3RXDA 2KAIB 1J14A 3P95A 2P95A 1MTWA 1SHHB 2Y7XA 2A7HA 1TB6H 2O9QA 4ISNA 1V2UT 3L6PA 4KKDA 2ZU2A 3DD2H 3Q00A 2FO9A 1C5UA 4MPUA 3T5FH 4LXBH 3BEUA 4WXVA 4UFGH 2RCEA 5ABWA 4Q7YA 1SFQB 4INHA 1MTUA 2BVXH 3PMHB 2ZGHA 4B71A 1ZOMA 3PTNA 1SL3A 1OWKA 3EA9A 3TPIZ 1V2JT 1X7AC 4GVUA 2ZDLA 4Y7AA 1WU1A 2IJOB 1LKAA 3P70B 1C1VH 2ZPQA 1F5KU 2AGEX 1DWEH 4BTTB 4TPIZ 5DJ7A 2R0LA 3KN2A 1GBHA 3RC4A 1EOJA 1G2MA 1ELTA 1T8LA 3Q3YA 5DP8A 3PLKA 1A61H 4MNYA 1BTHH 5TCAA 1PPFE 1E37B 1BBRK 1TNLA 2ZDAH 2NU0E 1EATA 3SV2H 2THFB 5EQRA 1P57B 2ILNA 3M3VA 3SJ9A 1NPMA 4JZEH 3BTHE 4I8HA 1GBTA 3U69H 5EG4A 1YP9A 1HAVA 1GI1A 1OP8A 4OS7A 1NFYA 5B6OA 2NU4E 4UFDH 1NU9A 3LOXA 4WH8A 2EEKA 1P04A 3H5CB 4ESTE 1MKXH 3VB4A 2RDLA 2FX6A 1D4PB 1HJAC 2BM2A 2ZNKH 3M35A 4ZKRU 4B73A 1GBBA 3QO6A 1HAOH 3Q3XA 1FDPA 4KP0A 3AVZA 1AVXA 1TRMA 2V35A 2UUYA 3P8GA 1O5GH 2FI5E 1IHSH 3SGBE 3T2NA 5EQQA 1TRNA 1BMMH 1T8MA 1WOFA 1MCVA 2QF0A 2PSXA 3ATMA 1Z1IA 3MU1A 1PFXC 2OLGA 4GLYA 3ZVBA 2HNTF 3ZVGA 2QF3A 1HBTH 1ELAA 5L6NH 1F0UA 1DITH 2GCHG 4A6LA 1W11U 1ELCA 2ZCLP 5FCRA 4ABIA 1IQEA 1SLVB 4ABAA 3B23B 2BY8X 1XUIA 3MO9A 2Y5FA 1TALA 1Z6EA 1GI0A 1CA0B 1QTFA 3BTQE 1AWHB 2GDDA 1P09A 2BXTH 1QQ4A 2ZCHP 3ATIA 3STJA 2RG3A 1NS3A 1HAXB 1HYLA 1AO5A 3UQVA 2OTVA 1BTZA 1A2CH 5JPMH 1O3HA 4IMZA 1HAVB 1YPMH 1TAWA 1G32B 3PTBA 2GZ8A 1S6HA 2ZP0H 1GVLA 1EJMA 1ZMJA 2ZC9H 1SHYA 1K22H 1V2NT 1T4UH 1BA8B 5JBBS 3M61U 1MAXA 4K60A 2FX4A 1K9OE 1AE5A 4B75A 1C2FA 1O2QA 3A7TA 3K6ZA 1C5PA 1GDNA 1Y3WA 2RA3A 3PO1B 4OS4A 1D3TB 1QRZA 3OYPA 8GCHF 3ZYDA 1ANEA 2AERH 2W7UA 1FPCH 3BSQA 5EU8A 3QLPH 3A80A 1LMWB 2J4IA 2QYIA 2ZFRH 1O2WA 1WQSA 1HAYB 1QA0A 1W0ZU 1JOUB 4BAOB 4VGCC 5EXNA 3T29A 2IOTA 1C1MA 4FU7A 4AORA 1P01A 1UK3A 2TGAA 5JBAS 2XC0A 3R0FA 4D7FA 1UO6A 2P93A 4Y0YE 1TX8A 1TLDA 1UVUH 2AFQB 2ZDMA 3KCGH 3P92A 1QL7A 5DKMA 1KY9A 3GCTG 4VGCB 3FANA 2J2UA 3LJOA 1GPZA 1S85A 1EPTA 3KGPA 1FI8A 1BTUA 4A5TS 1AN1E 1DE7H 5A8XA 2FI3E 1XKAC 1HB0B 4FUHA 1HAIH 3E3TA 3O8DA 3SJIA 1NO9H 1Y3UA 3GY8A 3DHKH 1PQAA 1WYKA 2J92A 1QB9A 1MH0A 4OS2A 2LPRA 4ZUHA 3W94A 2FESH 3A82A 6LPRA 1KTTB 1O3MA 3A8DA 1P2IA 1O2TA 2VGCB 1L1NA 1CE5A 2ZGCA 3A7XA 3GY3A 2ZU3A 4F49A 1RS0A 1BHXB 2GTBA 3DA9B 1EZXC 3EDXB 1YPHC 2H1UA 2DUCA 1BDAA 1S0QA 1AVGH 1LCYA 2PR3A 3K2UA 2F91A 3S9AA 6CHAC 4M7GA 2VVUA 1A7SA 2W3KA 1N1LA 3ITIA 3LT3A 1SLWB 2V0BA 1NRRH 1MTVA 1SQAA 3KIDU 2Z9GA 4I31A 5AHGH 3BTME 3O8RA 1G30B 2CF9H 4Y7BA 1AFQC 1TE0A 1CT4E 2A2QH 1GMHF 1BBRH 3WY8A 1SOTA 4FUJA 6CHAB 1EPTC 3QK1A 1RGQA 1S82A 1DXWA 1OWJA 3LC3A 4BTUB 2QA9E 1O35A 4WWYA 3NXPA 2BD4A 1BT7A 1ZR0A 2BY9X 1QY6A 1DUAA 4K1EA 2BD5A 4E06H 4E7RG 1ANCA 1EPTB 1OKXA 3SW2B 2PTNA 4INLA 1K1MA 1XMNB 4I33A 1O32A 1AGJA 3U1JB 3RXUA 4I32A 1A3EH 4FUDA 4BXSA 2OP9A 1CU1A 1O2LA 2C8XB 1K21H 2JH5D 2BZAA 1AHTH 1CGHA 2QV1A 2M5TA 1K28D 2BHGA 1PPHE 2GX4A 2ZHEH 3QX5H 2W7SA 1FLEE 3B9FH 4AFZA 3E0PB 3OY5U 2ALVA 2OXSA 4ASHA 7KMEH 3TLOA 2SGQE 3KQCA 2OC0A 3DFLA 1KLJH 3URCA 1SQOA 2F83A 3U1IB 4WMFA 2FEQH 2YNBA 5K7RA 1HLTH 1HFDA 1TGTA 1HJ8A 3BV9B 3FFGA 1OSSA 1IHTH 3VB6A 9ESTA 3SNDA 2J38A 1QL8A 1B0FA 1C1PA 3NWUA 3SU6A 3PWBA 1QB1A 1TBRH 4FUEA 2HGTH 1PYTD 2VIDA 1D6RA 3E1XB 3F1SB 3SUGA 5EW2H 1Z8RA 1Q2WA 1ARCA 1HV7A 1P9UA 1C4Y2 4I8GA 4K69A 1INCA 1TOMH 1MCTA 2HNTE 1O2ZA 1FAKH 1HAGE 4MQAA 2QAAA 4WF8A 1UTQA 3EA8A 3EE0B 5T3HA 3MNXA 2OC1A 8LPRA 1ZSLA 2BMGB 1AWFH 5LPFA 1OXGA 1UTNA 3M5MA 2ASUB 5C5OA 3ZVDA 2R2MB 5E8EH 4Y8XA 3SJKA 3A84A 4XBCA 4Q80A 2ESTE 4DY7B 4FXGH 3SV9A 1GG6B 1Z8IB 2PHBA 5JB8S 2UWOA 4JYUH 1NRNH 2GZ9A 1OOKB 4YLUA 2BLWA 2AMPA 2FOBA 1JXPA 1ZLRA 3UWIA 5LGOA 2LNCA 1ZHRA 3PMJA 3KHVA 5C1UA 1W3CA 1SQTA 2STAE 1W0YH 4FUBA 2F9BH 8GCHG 4FU9A 1TMTH 5A0AE 4AN7A 5FCKA 1XKBC 5CE1A 1ESAA 4LZ1H 2ODPA 4BOHA 5T6FA 3UREA 4X6NA 1WAYB 1ACBE 1DSUA 2WYGA 3PYHA 1ETRH 1LPKB 2O8MA 4D9RA 1HCGA 2XBVA 2PFEA 1P2QA 1O2UA 2ZEBA 3A87A 1BMLA 5F8XA 2AEIH 1HAHH 3PB1E 3E8LA 3S69A 1C2KA 2VIPA 2XNIA 1J15A 1FY1A 5EGMA 1O3GA 4CBOA 3UQOA 1W8BH 1CGJE 2Y82A 2VH0A 4JMYA 5DO4H 1BTXA 1ZJDA 3VB5A 3VEQB 4CRDA 1AB9C 1D3DB 4AG1A 3ENSB 1ZZZA 3V3MA 3NPSA 5DP9A 4JYTA 2B9LA 3HK3B 1O3OA 4JYVH 4D9QA 1ZTLA 1E38B 1O5FH 2HWLB 1LHFH 3GDVA 2GZ7A 1AFEH 1UTPA 1XXFA 1AB9B 3GY7A 2WUCA 4NCYA 1L2EA 2PSYA 4X2XA 4YOJA 2FOAA 4FVBA 3BEIB 1RTFB 2XTTB 4I8LA 5C1XA 3CP7A 1C2LA 5FPYA 2PGBB 1MKWK 1QBVH 3HGPA 2FOHA 3GY6A 4BTIB 3IG6B 5L2ZH 3GISB 1V2ST 1GI7B 3RMLH 1SGQE 1TWXB 2SFAA 3SOSA 3UNQA 4WY3A 1B7XB 2FOMB 3QGNB 2PV9B 1W7GH 3BN9A 3FVFB 2FXRA 1C2EA 5HMAA 1BMNH 1NRSH 4NSYA 3LONA 1FUJA 4Z0KA 3SUDA 1CQQA 5E0JA 4YT6H 3FAOA 1SSXA 2EI7A 3ATKA 1QQUA 3NKKA 2QGRA 1ZRBA 1TX7A 1BJUA 1UVTH 4A1VA 4KGAA 4YO9A 3GYMA 5IDKA 4OGYA 2VVVA 1LVOA 6GCHF 1V2MT 1GHWH 2I6QA 4B74A 4JK6A 4RKOB 1P12E 1O3NA 2BX4A 1OYQA 1HAZB 1L4ZA 1KSNA 1SLUB 1VCPA 1WUNH 1F0RA 3D62A 1SVPA 2V6NA 1DOJA 4WXIA 1QIXB 2O8LA 4O3TA 4YTAA 5H4IB 2A5AA 3FP8E 1FY5A 4OS6A 1YPEH 2BDHA 4ABBA 3UIRA 3TH4H 1F5RA 4UEHH 4TWWA 3F6UH 1BITA 1IQKA 2TPIZ 4RKJB 2C8WB 6ESTA 1THPB 1ABIH 1EJNA 1EZSC 1KIGH 1ANBA 3GOVB 3RXJA 2Q6FA 4DIIH 4D76A 4NFEA 3DT0H 4X1SU 3TGKE 2SGDE 1O0DH 1YPLH 1TNHA 1W2KH 4H42U 4X1RU 2H9TH 2FDAA 3DFJA 1HNEE 3IWMA 2CV3A 3L3TA 3LGVA 3MH4A 1MUEB 1O2MA 1XXDA 4CBNA 1E34B 2QXJA 3L33A 3M7UA 4AB8A 2G52A 2JKHA 3RDZA 4LK4A 1Y59T 2OQ5A 3QGJA 1GBJA 1ETTH 2FM2A 1KTSB 2HNTC 5GPIB 2ZPSA 2BQ6B 2P16A 3TGIE 5JBCS 1GMDF 1ZSJA 1MTNB 3V0XA 3T27A 4XE4A 3PROA 1FAXA 1GJ7B 5FBEA 5DP3A 3RM0H 1O33A 1V3XA 5F6MA 5GJ4B 1PQ7A 4XOJA 5EW1H 1BMAA 1PYTC 1O5BB 5T6GA 2VNTA 3E0NB 1FY4A 1TA6A 1TIOA 1O37A 3RXIA 3VPKA 1VR1H 2ULLA 3HKIB 2IPHA 3CS0A 1QB6A 1DX5M 1LTOA 1ELBA 1DM4B 1O3EA 1ANDA 1B0EA 3SQEE 1P02A 4BAQB 1SGNE 3RXKA 3BTTE 3I78A 5SGAE 1P3CA 1ZHPA 1P3EA 4K1TA 1SGFG 1ZSKA 3RU4T 1VITF 1V6DA 4H6SB 3LJJA 1FIWA 1HUTH 3F9EA 2BQWB 1YYY1 1XUHA 1LPGB 1FN6A 2FS9A 3F9HA 4OGXA 4AZ2B 1GI3A 1V2TT 4IMQA 4ISLA 1PPZA 1GCDA 1QFKH 2JETC 2BD9A 1TYNA 3QZRA 2ZI2H 2A31A 1T7CA 1O3PB 3UTUH 3MU8A 1EX3A 1QJ7B 1GVZA 1C2GA 2A45B 3PMAB 5AFYH 3VFEA 4ZHMU 4CR5A 1WTHD 2BXUH 1KXDA 5F03A 2B0FA 3RXHA 4ABDA 3S0NA 5L2YH 3NZIA 3NCLA 2JETB 4NA8A 1C1NA 2G5NA 2P59A 2H2ZA 1UJ1A 1HJ9A 1O5EH 2OC8A 1SB1H 4YOGA 4CR9A 2YOLA 3SNCA 5C3NA 4DURA 2WV4A 4DIHH 1FY3A 2HPPH 4Q7ZA 4NA9H 3SJ8A 3EYDA 2D1JA 2VIVA 1CA0C 1SOZA 4XBDA 3VXEH 1CBWC 3A89A 2HVXA 3PLPA 1GJAB 1DXPA 4GAWA 7GCHF 1H9IE 4YLQH 2AS9A 3RXCA 5E0HA 1P2KA 1O3DA 3V13A 2XCFA 1HDTH 2ODQA 1ZTKA 1EP6A 1OWIA 1O31A 4A7IB 1CBWB 4NA7A 2W5EA 1QNJA 2XBWA 2BOHB 1MKWH 1BJVA 1NRQH 1SGEE 2O8WA 2EI6A 3UNRA 2FZZA 1H4WA 2WUBA 3A8BA 4IS5A 3ZZ4A 2SGEE 5I46H 1UTKA 4UDWH 2ZU4A 4AOQA 2A4QA 1TGSZ 3SV7A 2A7JA 1C2DA 1SR5C 1Y8TA 3F9GA 1DICA 1QL9A 2H9HA 4KTCA 3RXGA 1E36B 1LVBA 3K9XB 1S5SA 3PMBB 3T62A 3ZVEA 3PO1C 1AMHA 5EPYA 5F8ZA 2Z94A 2ZFSA 2PUXB 3RXQA 2P94A 1C1SA 1OP2A 3MU4A 4J2YB 3UPEA 2BLQA 3MH5A 1KXCA 2VVCA 3NK8A 4A1XA 1TONA 1XUJA 5DPAA 3TJOA 2BLOA 3A8AA 3ZV8A 1QHRB 3MO3A 3UR6A 1DT2A 2PW8H 2PKAA 2BVRH 6GCHG 3RXAA 4U2WA 4BAHB 1QGFA 1SGDE 1WTGH 1A5HA 3AW0A 4Z6AH 2FIRH 1QJ6B 4AFUA 3ODDA 2Z9LA 1ZMNA 2Z9JA 1O2RA 4R8TB 3ESTA 3BG4B 1SMFE 1BTYA 1O36A 1U6QA 1O38A 1G36A 4HI3A 4X8UH 5JB9S 1ARBA 3ZVFA 2ZECA 4INKA 2OUAA 1DSTA 1PPGE 1Y5BT 1CHGA 1N8OC 1SGYE 1ZGVA 2VGCC 3BTEE 4X2YA 4BANB 4CRCA 3V7TA 2OINA 3MO6A 1IQFA 2C8YB 2QN5T 1SLXB 2XW9A 1O2NA 3KQEA 2ZDNA 1QJ1B 3RLYH 1EAWA 2ZGJA 7LPRA 4ZAEA 1H1BA 1UHBA 3RXPA 5A2MH 1N8OB 1C1UH 2GGVB 5TJXA 1HAPH 1ELFA 2YNAA 1OWHA 2FODA 1GMDG 1YM0A 1AU8A 2B8OH 4GPGA 3UY9A 1O3FA 1ZPCA 1VGCC 1L1GA 2EA3A 2BDGA 1KXFA 3A85A 3BEFB 1MU6B 5A8YA 1YC0A 3A81A 1W13U 3F9FA 2PKAB 1P06A 5E2PA 4CRAA 1SFIA 5FXLA 1FNIA 4B2CA 4CREA 1BOQA 3LGWA 1VGCB 4FUIA 4X8VH 1Q31A 1IQNA 4O97A 1P10A 1NROH 3UR9A 2Z7FE 2GMTB 4IW4E 4I8JA 5GWZA 3BTWE 2FS8A 4CRFA 2SNVA 2GCTC 2A5IA 4O9VA 5C20A 3A7ZA 1SPJA 3SUEA 1GI8B 3BTGE 1GJ9B 2CXVA 1VITG 1GI2A 1UTJA 2NU2E 3QDZB 3SGQE 1TNIA 2WPKS 4LOYH 1O3IA 2ZWLH 1JMOH 1L0ZA 1RTLA 2PWXA 2FLBH 2F9OA 1BTWA 5HM2A 1IOEA 1NY22 1OS8A 3SHCH 3U98H 4DW2U 2GCTB 3MOCA 1C1RA 4JCNA 2FP7B 1THRH 4AB9A 3VB3A 2VWOA 1PQ8A 4IC5A 5A09A 1GBLA 1O34A 4UFFH 4ABEA 1MQ5A 1IQMA 4Y6DA 3EA7A 3KQBA 4NIWA 1GWAA 3TJUA 1C1QA 1UHBB 2BOKA 1P8VC 1NFWA 2ZTZA 3EGKH 1AZZA 1VCWA 3A88A 5GIBA 3RU4E 3SNAA 4NIVA 1ELVA 1P05A 1HRTH 4X1QU 5E0GA 1GJ6A 3LC5A 1XM1A 1DS2E 5ESTE 1KDQA 3LGUA 2CF8H 1V2QT 3ZVAA 2SGPE 2PKSC 3Q77A 3LPRA 1MU8B 1JWTA 3VXFH 1E35B 3DUXH 3SU2A 1EJAA 1ORFA 3ZZ9A 2Y5GA 3UOUA 2HRVA 4K3JA 2XWBI 1LQEA 2XWAA 3RXLA 1T32A 2A32A 2K1QA 3GY5A 2O8UA 2PKSB 7GCHG 2H5CA 1FQ3A 4Y8ZA 3M7TA 1O3JA 2FLRH 1TFXA 3GICB 1GJ5H 4JK5A 2EC9H 2Y5HA 1C5XB 1D3PB 5HYOA 3MH6A 3RXMA 1WV7H 4FUGA 2WYJA 1QA7A 1GG6C 1FONA 1AKSB 1LVMA 1MAYA 5J4SA 1G2LA 1S84A 1C1TA 2G8TA 2BD3A 4KELA 3FZDA 3P8OA 5K0HA 4AFSA 4MNXA 3BTDE 4TWYA 3SGAE 1GHZA 3I77A 3ZZ5A 2VIQA 4NZLA 3RLWH 2EI8A 5T6DA 4DJZB 4DT7B 1KYNA 1UK4A 1CHOG 3HK6B 1TMUH 1GL1A 3E6PH 2QY0B 1DWBH 4DOQA 4ZKNU 2FTLE 2VIOA 1P2OA 3SU4A 2C8ZB 2OC7A 4CH2B 4CRGA 3RXFA 2CGAA 3TVJB 4Q2KA 1UMAH 2ANYA 1LPZB 3SZNA 2I6SA 1KDQB 5FBIA 2Y80A 3MTYA 4GHTA 1T31A 2BQ7B 2GT8A 1UVOA 4NG9H 2F9PA 1JBUH 2CN0H 1EOLA 3EAJA 3HKJB 4IN1A 4JZDH 3BG8A 4ABFA 3RXSA 2WINI 1LVYA 1ZJKA 1H9LB 4ZROA 1C5OH 5JDUB 1V2LT 4IGDA 1GJ4H 1N6YA 2TGTA 3PM3A 2WPJS 1DDJA 3AAUA 1O2HA 1FIZA 1EASA 2ZIQH 2H9EH 1O2JA 2HLCA 2TGDA 5JBTA 1GDUA 1LQDB 1FJSA 4SGBE 1CSOE 3SV6A 3A7YA 4ZKOU 4PROA 4NWLA 2ZFTA 2XC4A 1TPPA 4QT8C 4XSKU 1K1PA 3SUFA 5EQSA 1DY8A 3SBKA 1B5GH 4XFQA 1F7ZA 3A7WA 2G4UA 1GBFA 2JH6D 3OSYA 1BTPA 4MNWA 1S0RA 1YF4A 1MD7A 1P9SA 4E7NA 4ZMAH 1XUKA 4HGCA 4YM9A 1GI4A 3M5LA 1XX9A 4X6OA 1CA8B 1K1OA 1KXEA 4TY7A 1GJ8B 3ZZ6A 2BYAX 1L1JA 3RC6A 3F68H 3D49H 4HZHA 2Z3CA 2C3SA 1TX6A 3HATH 3M36A 3RUOA 1QBOA 3MFJA 2VWNA 4H4FA 1RTKA 1SGRE 3TH2H 1WQVH 4YT7H 5F8TA 3N7OA 2P8OC 4O03A 4R0IA 2ZFFH 3TNTA 4ZHAA 1PPBH 1TGBA 1F92A 4ABJA 5DK1A 1KLIH 3FZZA 4ZXXH 1PPCE 2AIPA 5EPNA 4A1TA 3MNSA 1SGTA 1K1LA 1XUGA 3UOPA 2V3OH 1GBAA 1FMGA 2O8TA 1THSH 3RM2H 3M37A 2P8OB 4O3UA 1XVOA 1XVMA 3UNSA 1ELGA 2FWWA 3TITA 2BDBA 2OQUA 1NN6A 4GSOA 2CMYA 2VIWA 1IQLA 3BF6H 2ZCKP 5HM9A 2ZHDA 2VB0A 2AGIX 4DVAU 1GBEA 1O2PA 1TPAE 3TIUA 1YLCA 1GJDB 4Y8YA 1C1WH 3LKWA 3C1KA 2ZDKA 4J1YA 1DANH 1UVSH 1C5TA 1CVWH 5TCCA 4U30A 2ZTXA 1D9IA 1PQ5A 2FTMA 1HGTH 1OYTH 1ZMLA 2FOFA 4NFFA 1GHAF 1BRBE 3TK6A 1JRSA 3GDSA 1H8DH 1ZHMA 1HXEH 1OWDA 1Y3VA 5FHTA 3QN7A 3BTKE 3P8NA 3ZYEA 1O5DH 3ZVCA 1Z7KA 1MTNC 1EKBB 7ESTE 1TQ0B 1YGCH 1Z6JH 2OBQA 1UVPA 3VGCC 3IITA 2OBOA 1O3AA 4AYVB 1O3BA 1HIAB 1VCQA 4B2BA 2AMDA 3LIWA 3MMGA 2R0KA 2F9UA 1RIWC 4A92A 1ESBA 1GBCA 1V2WT 4K8BA 1GMCF 1OPHB 3VB7A 2DE9A 3M7QA 1ZRKA 4YESB 4D7GA 4CHAC 5GCHF 3VGCB 1E0FD 1P2NA 2SNWA 1N6XA 1IQGA 1S83A 2G51A 2GD4B 4THNH 1AQ7A 2A7CA 2WPLS 3MNBA 1NZQH 4JZIA 3ZZ8A 3V12A 1O39A 4K2YA 2NU3E 3URDA 1RIWB 3QTVH 5DG6A 3SI4H 1C5SA 3GYLB 4CHAB 1TBQH 1P11E 4K1SA 1TPSA 3RMNH 4XBBA 4SGAE 1EZUC 2QXIA 2ZKSA 3ZZCA 1FY8E 1J9CH 2ZGBH 4FU8A 4ZXYH 5A0CA 1IQJA 2ZA5A 1MD8A 4MG3A 1C5YB 1H9HE 3OTJE 4MTBA 1YPHE 1S81A 4Y79A 3SU5A 2TIOA 1VZQH 1JIMA 3GCOA 1C2MA 3KL6A 1AIXH 2BDIA 1ZGIA 1EB2A 2J9NA 1BBRE 1NT1A 1SG8B 2FI4E 4UONA 1BIOA 2ZTYA 3OX7U 1P2MA 2TBSA 2FPZA 2JH0D 3PLBA 3KQDA 5DP5A 1L4DA 4Y10E 3K6YA 2XC5A 2GV6A 1LHCH 1GBDA 3BTFE 1TABE 1BB0B 4H6TA 3ZZAA 1A0LA 4CH8B 1BQYA 1TGNA 1A0JA 3UUZA 2A2XH 3RC5A 3LH3A 4Y76A 1C5LH 4ZHLU 2OD3B 1UTOA 1TOCB 2QXHA 3B8JA 5BPEA 8KME2 3GCNA 3RMMH 1TQ7B 1BZXE 2Y7ZA 1G3DA 3RXBA 2ANKH 3EQ0H 3SORA 3CENA 1QURH 5PTPA 5I25A 5GXPA 4MPVA 3M5OA 2CHAC 3RP2A 2ZHFH 4IC6A 3TJNA 1HJAB 2GV7A 1AD8H 3A83A 4B2AA 1ZPBA 1TNJA 4Q7XA 3M3TA 3SN8A 4MNVA 4DGJA 3JZ1B 1GDQA 1P03A 3U8RH 2ZGXH 2CHAB 2ZU5A 4E05H 4X1NU 2P3TB 4U01A 2G81E 1TRYA 2F3CE 4OS1A 2P3FH 5FPSA 3S7KB 5BRRE 1G37A 4GUXA 2Q1JA 3MU0A 1C4U2 2A1DB 1TNKA 1CHOF 4AX9H 3GY2A 4MLFB 2BDCA 1C2JA 2XBXA 1A4WH 1C4V2 1GHVH 2VWLA 1QRXA 1UCYE 2C4FH 3Q76A 2BY5X 4XDEA 1YLDA 1DFPA 1C5MD 1UCYK 3LDXH 1A5GH 1K1IA 2D26C 1LHDH 3FP7E 1GI6A 3BIUH 3NUMA 1AUJA 1C9TA 2Q6DA 4X6MA 1MMJN 1TGCA 4ZH8A 3D65E 2GT7A 3AASA 5G4BA 3STIA 5E2OA 4UE7H 1LKBA 2F9NA 2UUJB 1MBQA 4I8KA 2BDAA 1CGIE 4K8YA 4RSPA 1EZQA 4LZ4B 3BG4C 1M9UA 4AG2A 2WV5A 2XXLA 4X2VA 2Q6GA 1Z8JB 1GHBF 3ODFA 1D3QB 4CRBA 8ESTE 1YPGH 2XBYA 4MDSA 1IAUA 1F5LA 1D6WA 3E91A 5C2ZA 3ATLA 1YCPH 4YZUA 2XRCA 3TGJE 1GL0E 1GJBB 1NFUA 1O2IA 3SO3A 2IN2A 1Z71A 2AYWA 2A4RA 1O5CB 3SJOA 3SV8A 2BDYA 1K1JA 2NWNA 3T26A 1AY6H 1DLKB 4NIYA 3U8TH 1GI9B 5CMXH 1GHAG 1SGFA 1J8AA 5CHAC 1O30A 4HFPB 3TK9A 1V2RT 1RRKA 4BNRA 1G9IE 2BTCE 3SNEA 1F2SE 3M3SA 5EODA 3P17H 1YPJH 1SBWA 1MZAA 4U32A 2J34A 3SU1A 4B76A 1O3LA 2B7DH 1CT0E 4WMEA 1WCZA 1W7XH 2PLXA 5CHAB 1MBMA 1HPGA 1DLEA 1C5ZB 2ANMH 2FYQA 3RXRA 3RXEA 2G55A 4TY6A 4IN2A 2NU1E 1IQHA 2C90B 1ZPZA 2ODYB 1GMCG 1MTSA 1H8IH 1NTPA 3GY4A 4WJG2 1O3CA 1ZYOA 2Z3EA 4X8TH 5GCHG 3MWIU 3QZQA 2ZQ2A 3T25A 4ISIH 2GMTC 1PJPA 2VH6A 3S9BA 1NFXA 2ALPA 1T8OA 5HXFA 3ELAH 3UFAA 2AIQA 1O2SA 4HTCH 5HGGA 1AVWA 1GGDC 1O2GH 2VU8E 5ETXA 1Y5AT 1KXAA 1GHYH 2BZ6H 2HPQH 5LH8A 1GVKB 4GCHF 1UTLM 2Z9KA 4GHQA 3RMOH 1NRPH 2BD2A 2ZPRA 2FOCA 3MYWA 1V2VT 4X8SH 4WMDA 3SHAH 2ZO3H 1DUEA 2ANWA 1GGDB 4TPYA 1DY9A 2WPHS 2HOBA 3QTOH 3U8OH 1V2PT 1SGPE 1SI5H 1AKSA 2W3IA 5C1YA 4OS5A 1ELDE 1LHGH 1SGIB 3RU4D 1LHEH 1EUFA 2FOGA 2ZG0H 4F4OC 2WPMS 5ESBA 3HPTB 4JZ1A 5IYTA 2BD8A 1O3KA 1Y5UT 1BCUH 1AFQB 1A5IA 4K5ZA 1P2JA 2TGPZ 2XCNA 3PWCA 2A5KA 1GI5A 5J4QA 2J94A 3P6ZB 1WBGB 4FUFA 5C5NA 2ZU1A 1Y3XA 1C5VA 3S7HB 3O8CA 1F0SA
chains in the Genus database with same CATH superfamily
1GBIA 2AGGX 2TRMA 1AI8H 1NBME 5LPRA 4Y11E 4MPWA 1GJCB 3RXVA 3P8FA 2VWMA 2KR7A 2Z9IA 1S6FA 1O2KA 5FX6A 1EQ9A 2AMQA 1QR3E 4TT3D 5FPTA 4ABHA 1C5NH 3SQHE 1YBWA 4MVNA 4AGJA 2G4TA 4UD9H 4Y71A 2D2DA 2GVFA 2ZHWH 1BHXF 1ESTA 2QCYA 1O5AB 2A4GA 2GP9B 1SGCA 1FN8A 5A0BA 3BIVH 3AAVA 2J95A 1TNGA 3H7OA 1GHXH 1K2I1 2VINA 2STBE 3MU5A 4FUCA 1EAIA 3DSGA 1AUTC 3H7TA 2R2WU 1A46H 1NU7B 2BB4A 5IK2D 1EP5A 4YOIA 2RA0A 5EXMA 1C1OA 3W95A 1IQIA 1HXFH 5KGOA 2R3YA 4BAKB 1WDIA 1BRCE 3ZZ7A 2GKVE 4ABGA 4DCDA 3C27B 1DWDH 1UCYH 1RFNA 1WXRA 1YCPM 2W26A 2V3HH 3LU9B 5DGJA 1BUIA 3SYJA 3CNRA 1W14U 1J16A 2K8IA 5AFZH 3ZZBA 2DE8A 1P0SH 5DP4A 3O8BA 4DG4A 1V2KT 4BXWA 1F0TA 1FPHH 3GCHC 2YMSB 3OAAD 3RXOA 5C67A 3PV5A 1C5QA 1O2YA 3R3GB 2AH4X 1W12U 2GJGA 1FV9A 4NZQA 1TPOA 1NM6A 1MZDA 1ABJH 4X0WU 2HVYB 3JZ2B 1RD3B 1G3BA 1EAXA 2PTCE 2BY7X 2M2AA 3E90B 3GCHB 3PV2A 1QRWA 3LGIA 4TYDA 3MI4A 4UFEH 3ZZ3A 2Y81A 1DPOA 2QC2A 3LGYA 3UWJH 1MQ6A 5AF9H 1TBZH 2JIZD 1GHBG 2OCVB 3TNSA 2KX4A 3OY6U 2ZFQH 1A1RA 1G3EA 1UK2A 2VJ1A 2PGQB 3QWCH 2B5TB 1O2OA 1CT2E 2D8WA 3KF2A 1OWEA 3SU3A 2A4OA 2H5DA 3ATWA 3TJVA 5L30H 1T4VH 1Z1JA 1C5WB 3TH3H 3SU0A 1FZZA 4FVDA 1YLNA 3U9AH 1MKXK 2Z6BD 3A86A 4NSVA 2KCAA 5DP7A 1O2VA 4I7YH 1AZ8A 3OU0A 4RN6A 1C5RA 1TMBH 3GDUA 1BRAA 1OP0A 2F9VA 2BLVA 4X6PA 1GBKA 4WVPE 3S9CA 2WPIS 1S6LA 4KTSA 2ZQ1A 2BD7A 1EB1H 1K1NA 1QBNA 1RJXB 4B6EA 2GCHF 3ZV9A 2ZZUH 1SKYE 5GDSH 1DWCH 1A0HB 2WZQA 3A7VA 2ZHQH 1LDTT 5C17A 2BX3A 3ZZDA 1XUFA 1ZTJA 3G01A 3KEEA 3T28A 3LH1A 4B1TA 1JIRA 1BMFD 2R3UA 5GNDA 1UW7A 4ISHH 4KTUA 1GBMA 3FP6E 2PUQH 2GDEH 3CS7A 5DP6A 2R9PA 2H6MA 5A8ZA 2EQNA 1AE8H 1HIAA 1O2XA 2G00A 3HGNA 3SNBA 4Y0ZE 1QCPA 1C9PA 1G3CA 1Y3YA 3MH7A 3FKSD 2Z3DA 4AGKA 5EOKA 1NESE 5C0UA 2C93B 5CDFE 2BY6X 5JYIA 2KAIA 4AYYB 4AFQA 1Z8GA 1GCTC 3Q3KA 1VJ9U 2IJD1 1ID5H 1BRUP 1V2OT 1EXFA 1T8NA 3KNXA 4GCHG 2A0QB 1NC6A 4NGAH 1PPEE 4D8NA 1E79D 2SGFE 3TU7H 2ZFPH 4WH6A 3K65B 1JRTA 5FAHA 4NWKA 4X1PU 1GCTB 1VITH 1A3BH 1C2HA 3M5NA 1KLTA 1YKTA 5EJLA 1RXPA 4ZKSU 2G5VA 2QIQA 1GMHG 2UWPA 2ZDVH 1OX1A 1LO6A 2P3UB 2UUKB 4MPXA 3F2GA 3MHWU 3I29A 2FMJA 2FYRA 2UWLA 1VJAU 3WWFA 1FXYA 5HIYA 1ETSH 4BAMB 1KXBA 1DVAH 1SC8U 3SI3H 1TA2A 2FOEA 5KECA 1C2IA 3QUMP 4IBLH 5LPEA 3D23A 2IPQX 5EXLA 3OEED 4ISOA 1YCPK 1ELEE 3AW1A 2KCYA 2BVSH 1W10U 3PV4A 4NIXA 1J17T 3RXTA 1YPKH 5AVDA 2SGAA 1UTMA 3GCTF 2UUFB 3A8CA 3E16B 4JZFH 1Q3XA 2Y6TA 5FX5A 2QXGA 3TK5A 1CO7E 1WSSH 2HALA 3MNCA 2ZF0H 1EAUA 2CJIA 3LGTA 2XYAA 4X2WA 9LPRA 3RXDA 2KAIB 5HIZA 1J14A 3P95A 2P95A 1MTWA 1SHHB 2Y7XA 2A7HA 1TB6H 2O9QA 4ISNA 1V2UT 3L6PA 4KKDA 2ZU2A 3DD2H 3Q00A 2FO9A 1C5UA 4MPUA 3T5FH 4LXBH 3BEUA 4WXVA 4UFGH 2RCEA 5ABWA 4Q7YA 1SFQB 4INHA 1MTUA 2BVXH 3PMHB 2ZGHA 4B71A 1ZOMA 3PTNA 1SL3A 1OWKA 3EA9A 3TPIZ 1V2JT 1X7AC 3UB0A 4GVUA 2ZDLA 4Y7AA 1WU1A 2IJOB 1LKAA 3P70B 2JJ1D 5DN6D 1C1VH 2ZPQA 1F5KU 2AGEX 1DWEH 4BTTB 4TPIZ 5DJ7A 2R0LA 3MQKC 3KN2A 1GBHA 3RC4A 1EOJA 1G2MA 1ELTA 1T8LA 4ZCNA 3Q3YA 5DP8A 2QE7D 3PLKA 1A61H 4MNYA 1BTHH 5TCAA 1PPFE 1E37B 1BBRK 1TNLA 2ZDAH 2NU0E 3OEHD 1EATA 3SV2H 2THFB 5EQRA 1P57B 2ILNA 3M3VA 3SJ9A 1NPMA 4JZEH 3BTHE 4Q4LA 4I8HA 1GBTA 3U69H 5EG4A 1YP9A 1HAVA 1GI1A 1OP8A 4OS7A 1NFYA 5B6OA 2NU4E 4UFDH 1NU9A 3LOXA 4WH8A 2EEKA 1P04A 3H5CB 4ESTE 1MKXH 2KZ4A 4XRNA 3VB4A 2RDLA 2FX6A 1D4PB 1HJAC 2BM2A 2ZNKH 3M35A 4ZKRU 4B73A 1GBBA 3QO6A 1HAOH 3FO8D 3Q3XA 1FDPA 4KP0A 3AVZA 1AVXA 1TRMA 2V35A 2UUYA 3P8GA 1O5GH 2FI5E 1IHSH 3SGBE 4FOUC 3T2NA 5EQQA 1TRNA 1BMMH 1T8MA 1WOFA 1MCVA 2QF0A 2PSXA 3ATMA 1Z1IA 3MU1A 1PFXC 2OLGA 4GLYA 3ZVBA 2HNTF 3ZVGA 2QF3A 1HBTH 1ELAA 5L6NH 1F0UA 1DITH 2GCHG 2YMSD 1W11U 1ELCA 2ZCLP 5FCRA 4A6LA 4ABIA 1IQEA 1SLVB 4ABAA 3B23B 2BY8X 1XUIA 3MO9A 2Y5FA 1TALA 1Z6EA 1GI0A 1CA0B 1QTFA 3BTQE 1AWHB 2GDDA 2QF5A 2QF4A 1P09A 2BXTH 1QQ4A 2ZCHP 3ATIA 3STJA 2RG3A 1NS3A 1HAXB 1VKYA 1HYLA 1AO5A 3UQVA 2OTVA 1BTZA 1A2CH 5JPMH 1O3HA 4IMZA 1HAVB 1YPMH 1TAWA 1G32B 3PTBA 2GZ8A 1S6HA 2ZP0H 1GVLA 1EJMA 1ZMJA 2ZC9H 1SHYA 1K22H 2OK5A 1V2NT 1T4UH 1BA8B 5JBBS 3M61U 1MAXA 4K60A 2FX4A 1K9OE 1AE5A 4B75A 1C2FA 1O2QA 3A7TA 3K6ZA 1C5PA 1GDNA 1Y3WA 2RA3A 3PO1B 4OS4A 1D3TB 1QRZA 3OYPA 8GCHF 3ZYDA 1FX0B 1ANEA 2AERH 2W7UA 1FPCH 3BSQA 5EU8A 3QLPH 3A80A 3H09A 1LMWB 2J4IA 2QYIA 2ZFRH 1O2WA 1WQSA 1HAYB 1QA0A 1W0ZU 1JOUB 4BAOB 4VGCC 5EXNA 3T29A 2IOTA 1C1MA 4FU7A 4AORA 1P01A 1UK3A 2TGAA 5JBAS 2XC0A 3R0FA 4D7FA 1UO6A 2P93A 4Y0YE 1TX8A 1TLDA 1UVUH 2AFQB 2ZDMA 3KCGH 3P92A 1QL7A 5DKMA 1KY9A 3GCTG 4VGCB 3FANA 2J2UA 3LJOA 1GPZA 1S85A 1EPTA 3KGPA 1FI8A 1BTUA 4A5TS 1AN1E 1DE7H 5A8XA 2FI3E 1XKAC 1HB0B 4FUHA 1HAIH 3E3TA 3O8DA 3SJIA 1NO9H 1Y3UA 3GY8A 3DHKH 1PQAA 1WYKA 2J92A 1QB9A 1MH0A 4OS2A 1COWD 2LPRA 4ZUHA 3W94A 1YY3A 2FESH 3A82A 6LPRA 1KTTB 1O3MA 3A8DA 1P2IA 1O2TA 2VGCB 1L1NA 1CE5A 2ZGCA 3W1EA 5F53A 3A7XA 3GY3A 2ZU3A 4F49A 1RS0A 1BHXB 2GTBA 3DA9B 1EZXC 3EDXB 1YPHC 2H1UA 2DUCA 1BDAA 1S0QA 1AVGH 3F2FA 1LCYA 2PR3A 3K2UA 2F91A 3S9AA 2JJ2D 6CHAC 4M7GA 2VVUA 1A7SA 2W3KA 1N1LA 3ITIA 3LT3A 1SLWB 2V0BA 1NRRH 1MTVA 1SQAA 3KIDU 2Z9GA 4I31A 5AHGH 3BTME 3O8RA 1G30B 2CF9H 4Y7BA 1AFQC 3WWBA 1TE0A 1CT4E 2A2QH 1GMHF 1BBRH 3WY8A 1SOTA 4FUJA 6CHAB 1EPTC 3QK1A 1RGQA 1S82A 1DXWA 1OWJA 3LC3A 4BTUB 2QA9E 1O35A 1NBMD 3NXPA 2BD4A 4WWYA 1BT7A 1ZR0A 2BY9X 3AK5A 1QY6A 1DUAA 4K1EA 2BD5A 4E06H 2F4LA 4E7RG 1ANCA 1EPTB 1OKXA 3SW2B 3SZEA 2PTNA 4INLA 1K1MA 1XMNB 4I33A 1O32A 1AGJA 3U1JB 3RXUA 4I32A 1A3EH 4FUDA 4BXSA 2OP9A 1CU1A 1O2LA 2C8XB 1K21H 2JH5D 2BZAA 1AHTH 1CGHA 2QV1A 2M5TA 1K28D 2BHGA 1PPHE 2GX4A 2ZHEH 3QX5H 2W7SA 1FLEE 3B9FH 4AFZA 3E0PB 3OY5U 2ALVA 2OXSA 4ASHA 7KMEH 3TLOA 2SGQE 3KQCA 2OC0A 3DFLA 1KLJH 3URCA 4ACAA 1SQOA 2F83A 3U1IB 4WMFA 2FEQH 2YNBA 5K7RA 1HLTH 1HFDA 1TGTA 1HJ8A 3BV9B 3FFGA 1OSSA 1IHTH 3VB6A 9ESTA 3SNDA 2J38A 1QL8A 1B0FA 1C1PA 3NWUA 3SU6A 3PWBA 1QB1A 1TBRH 4FUEA 2HGTH 2RDEA 1PYTD 2VIDA 1D6RA 3E1XB 3F1SB 3SUGA 5EW2H 1Z8RA 1Q2WA 1ARCA 1HV7A 1P9UA 1C4Y2 5CHBA 4I8GA 2YMSC 4K69A 1INCA 1TOMH 1MCTA 2HNTE 1O2ZA 1FAKH 1HAGE 4MQAA 2QAAA 4WF8A 1UTQA 3EA8A 3EE0B 5T3HA 3MNXA 2OC1A 8LPRA 1ZSLA 2BMGB 2KM0A 1AWFH 5LPFA 1OXGA 1UTNA 3M5MA 2ASUB 5C5OA 3ZVDA 2R2MB 5E8EH 4Y8XA 3SJKA 3A84A 4XBCA 4Q80A 2ESTE 4DY7B 3VG8A 3DCLA 4FXGH 1GG6B 3SV9A 1Z8IB 2PHBA 5JB8S 1EFRD 2UWOA 4JYUH 1NRNH 4ACBA 2GZ9A 1OOKB 4YLUA 2BLWA 2AMPA 2FOBA 1JXPA 1ZLRA 3UWIA 5LGOA 2LNCA 1ZHRA 3PMJA 3KHVA 5C1UA 1W3CA 1SQTA 2STAE 3PRBA 1W0YH 4FUBA 2F9BH 8GCHG 4FU9A 1TMTH 5A0AE 4AN7A 5FCKA 1XKBC 5CE1A 4DT4A 1ESAA 4LZ1H 2ODPA 4BOHA 5T6FA 3UREA 4X6NA 1WAYB 1ACBE 1DSUA 2WYGA 3PYHA 1ETRH 1LPKB 2O8MA 4D9RA 1HCGA 2XBVA 2PFEA 1P2QA 1O2UA 2ZEBA 3A87A 1BMLA 2WPDD 5F8XA 2AEIH 1HAHH 3PB1E 3E8LA 3S69A 1C2KA 4I86A 2VIPA 2XNIA 3N7DA 1J15A 1FY1A 5EGMA 1O3GA 4CBOA 3UQOA 1W8BH 1CGJE 2Y82A 2VH0A 4JMYA 5DO4H 3EE7A 1BTXA 1ZJDA 3VB5A 3VEQB 3NRLA 4CRDA 1AB9C 1D3DB 4AG1A 3ENSB 1ZZZA 3V3MA 3NPSA 5DP9A 4JYTA 2B9LA 3HK3B 4F55A 1O3OA 4JYVH 4D9QA 1ZTLA 1E38B 1O5FH 2HWLB 1LHFH 3GDVA 2GZ7A 1AFEH 1UTPA 1XXFA 1AB9B 3GY7A 4TSFD 2WUCA 4NCYA 1L2EA 2CK3D 2PSYA 4X2XA 4YOJA 2FOAA 4FVBA 3BEIB 1RTFB 2XTTB 4I8LA 2RFKC 5C1XA 3CP7A 1C2LA 5FPYA 2PGBB 1MKWK 1QBVH 3HGPA 2FOHA 3GY6A 4BTIB 3IG6B 5L2ZH 3GISB 1V2ST 1GI7B 3RMLH 1SGQE 1TWXB 2SFAA 3SOSA 3UNQA 4WY3A 1B7XB 2FOMB 3QGNB 2PV9B 1W7GH 3BN9A 3FVFB 2FXRA 1C2EA 5HMAA 1BMNH 1NRSH 4NSYA 3U28C 3LONA 1FUJA 4Z0KA 3SUDA 1CQQA 4YXWD 5E0JA 4YT6H 3FAOA 1SSXA 2EI7A 3ATKA 3KYGA 1QQUA 3NKKA 2QGRA 1ZRBA 1TX7A 1BJUA 1UVTH 4A1VA 4KGAA 4YO9A 3GYMA 5IDKA 4OGYA 2VVVA 1LVOA 6GCHF 1V2MT 1GHWH 1QZ8A 2I6QA 4B74A 4JK6A 4RKOB 1P12E 1O3NA 2BX4A 1OYQA 1HAZB 1L4ZA 1KSNA 1SLUB 1VCPA 1WUNH 1F0RA 3D62A 1SVPA 2V6NA 1DOJA 4WXIA 1QIXB 2O8LA 4O3TA 4YTAA 5H4IB 2A5AA 3FP8E 1W0KD 1FY5A 4OS6A 1YPEH 2BDHA 4ABBA 3UIRA 3TH4H 1F5RA 4UEHH 4TWWA 3F6UH 1BITA 1IQKA 1SQRA 2TPIZ 4RKJB 2C8WB 6ESTA 1THPB 1ABIH 2W6ID 1EJNA 1EZSC 1KIGH 1ANBA 3GOVB 3RXJA 2Q6FA 4DIIH 4D76A 4NFEA 3DT0H 4X1SU 3TGKE 2SGDE 1O0DH 1YPLH 1TNHA 1W2KH 4H42U 4X1RU 2H9TH 2FDAA 3DFJA 3F0OA 1HNEE 3IWMA 2CV3A 3L3TA 3LGVA 3MH4A 1MUEB 1O2MA 1XXDA 5C0TA 4CBNA 1E34B 2QXJA 3L33A 3M7UA 4AB8A 2G52A 2JKHA 3RDZA 4LK4A 1Y59T 2OQ5A 3QGJA 1GBJA 1ETTH 2FM2A 3F0PA 1KTSB 2HNTC 5GPIB 2ZPSA 2BQ6B 2P16A 3TGIE 5JBCS 1GMDF 1ZSJA 1MTNB 3V0XA 3T27A 4XE4A 3PROA 1FAXA 1GJ7B 5FBEA 5DP3A 3RM0H 1O33A 1V3XA 5F6MA 5GJ4B 1PQ7A 4XOJA 5EW1H 1BMAA 1PYTC 2KCPA 1O5BB 5T6GA 2VNTA 3E0NB 1FY4A 1TA6A 1TIOA 1O37A 3RXIA 3VPKA 1VR1H 2ULLA 3HKIB 2IPHA 3CS0A 1QB6A 1DX5M 1LTOA 1ELBA 1DM4B 1O3EA 1ANDA 1B0EA 3SQEE 1P02A 4BAQB 1SGNE 3RXKA 3BTTE 3I78A 5SGAE 1P3CA 1ZHPA 1P3EA 4K1TA 1SGFG 1ZSKA 3RU4T 1VITF 1V6DA 4H6SB 3LJJA 1FIWA 1HUTH 3F9EA 2BQWB 3KQ5A 1YYY1 1XUHA 1LPGB 1FN6A 2FS9A 3F9HA 4OGXA 4AZ2B 1GI3A 1V2TT 4IMQA 4ISLA 1PPZA 1GCDA 1QFKH 2JETC 2BD9A 1TYNA 4RT1A 3QZRA 2ZI2H 2A31A 1T7CA 5C94A 1O3PB 3UTUH 3MU8A 1EX3A 1QJ7B 1GVZA 1C2GA 2A45B 3PMAB 5AFYH 3VFEA 5HKKD 4ZHMU 4CR5A 5B6LA 1WTHD 2BXUH 1KXDA 5F03A 2B0FA 3RXHA 4ABDA 3S0NA 5L2YH 3NZIA 3NCLA 2JETB 4NA8A 1C1NA 2G5NA 2P59A 2H2ZA 1UJ1A 1HJ9A 1O5EH 2JDID 2OC8A 1SB1H 4YOGA 4CR9A 3ZIAD 2YOLA 4Q63A 3GS9A 1E1QD 3SNCA 5C3NA 4DURA 2WV4A 4DIHH 3PRDA 1FY3A 2HPPH 4Q7ZA 3UAIC 4NA9H 3SJ8A 3EYDA 2D1JA 2VIVA 5FL7D 1CA0C 1SOZA 4XBDA 3VXEH 1CBWC 3A89A 2WHXA 2HVXA 3PLPA 1GJAB 1DXPA 4GAWA 7GCHF 1H9IE 4YLQH 2AS9A 3RXCA 5E0HA 1P2KA 1O3DA 3V13A 2XCFA 1HDTH 2ODQA 1ZTKA 1EP6A 1OWIA 1O31A 4A7IB 1CBWB 4NA7A 2W5EA 1QNJA 2XBWA 2BOHB 1MKWH 1BJVA 1NRQH 1SGEE 2WV9A 2O8WA 2EI6A 3UNRA 2FZZA 1H4WA 2WUBA 3A8BA 4IS5A 3ZZ4A 2SGEE 5I46H 1UTKA 4UDWH 2ZU4A 4AOQA 2A4QA 1TGSZ 3SV7A 2A7JA 1Y8TA 1C2DA 1SR5C 3F9GA 1DICA 1QL9A 2H9HA 4KTCA 3RXGA 1E36B 1LVBA 2VBCA 3K9XB 1S5SA 3PMBB 3T62A 3ZVEA 3PO1C 1AMHA 5EPYA 5F8ZA 2Z94A 2ZFSA 2PUXB 3RXQA 2P94A 1C1SA 1OP2A 3MU4A 4J2YB 3UPEA 2BLQA 3MH5A 1KXCA 2VVCA 3NK8A 4A1XA 1TONA 3OFND 4M9FA 1XUJA 5DPAA 3TJOA 2BLOA 3A8AA 3ZV8A 1QHRB 3MO3A 3UR6A 1DT2A 2PW8H 2PKAA 2BVRH 6GCHG 3RXAA 4U2WA 4BAHB 1QGFA 1SGDE 1WTGH 1A5HA 3AW0A 4Z6AH 2FIRH 1QJ6B 4AFUA 3F2HA 3ODDA 2Z9LA 1ZMNA 2Z9JA 1O2RA 4R8TB 3ESTA 4B6FA 3BG4B 1SMFE 1BTYA 1O36A 1U6QA 1O38A 1G36A 4P00A 4HI3A 4X8UH 2L74A 1ARBA 5JB9S 3ZVFA 2ZECA 4INKA 2OUAA 1DSTA 1PPGE 1Y5BT 1CHGA 1N8OC 1SGYE 1ZGVA 2VGCC 3BTEE 4X2YA 4BANB 4CRCA 3V7TA 2OINA 3MO6A 1IQFA 2C8YB 2QN5T 1SLXB 2XW9A 1O2NA 3KQEA 3KYFA 2ZDNA 1QJ1B 3RLYH 1EAWA 2ZGJA 7LPRA 4ZAEA 1H1BA 1UHBA 3RXPA 5A2MH 1N8OB 1C1UH 2GGVB 5TJXA 1HAPH 1ELFA 2YNAA 1OWHA 2FODA 1GMDG 1YM0A 1AU8A 4F48B 2B8OH 4GPGA 4ASUD 3UY9A 1O3FA 1ZPCA 1VGCC 1L1GA 2EA3A 2BDGA 2EY4C 1KXFA 3A85A 3BEFB 4P02A 1MU6B 5A8YA 1YC0A 3A81A 1W13U 4RI0A 3F9FA 2PKAB 1P06A 5E2PA 4CRAA 1SFIA 5FXLA 1FNIA 4B2CA 4CREA 1BOQA 3LGWA 1VGCB 4FUIA 4X8VH 1Q31A 1IQNA 4O97A 1P10A 1NROH 3UR9A 2Z7FE 2GMTB 4IW4E 4I8JA 5GWZA 3BTWE 1H8ED 2FS8A 4CRFA 2SNVA 2GCTC 2A5IA 4O9VA 5C20A 3A7ZA 1SPJA 3SUEA 1GI8B 3BTGE 1GJ9B 2CXVA 1VITG 2F43B 1GI2A 1UTJA 2NU2E 3QDZB 3SGQE 1TNIA 2WPKS 4LOYH 4RT0A 1O3IA 2ZWLH 1JMOH 1L0ZA 1RTLA 2PWXA 2FLBH 2F9OA 1BTWA 5HM2A 1IOEA 1NY22 1OS8A 3SHCH 3U98H 4DW2U 2GCTB 3MOCA 1C1RA 4JCNA 2FP7B 1THRH 3DSOA 4AB9A 3VB3A 2VWOA 1PQ8A 4IC5A 5A09A 1GBLA 1O34A 4UFFH 4ABEA 1MQ5A 1IQMA 4Y6DA 3EA7A 3KQBA 4NIWA 1GWAA 3TJUA 1C1QA 1UHBB 2BOKA 1P8VC 1NFWA 2ZTZA 3EGKH 1AZZA 1VCWA 3A88A 2W6JD 5GIBA 3RU4E 3SNAA 4NIVA 1ELVA 1P05A 1HRTH 4X1QU 5E0GA 1GJ6A 3LC5A 1XM1A 1DS2E 5ESTE 1KDQA 3LGUA 2CF8H 1V2QT 3ZVAA 2SGPE 2PKSC 3Q77A 3LPRA 1MU8B 1JWTA 3VXFH 1E35B 3DUXH 3SU2A 1EJAA 1ORFA 3ZZ9A 2Y5GA 3UOUA 2HRVA 4K3JA 2XWBI 1LQEA 2XWAA 3RXLA 1T32A 2A32A 2K1QA 3GY5A 2O8UA 2PKSB 7GCHG 2H5CA 1FQ3A 4Y8ZA 3M7TA 1O3JA 2FLRH 1TFXA 3GICB 1GJ5H 4JK5A 3DSPA 2EC9H 2Y5HA 1C5XB 1D3PB 5HYOA 3MH6A 3RXMA 1WV7H 4FUGA 2WYJA 1QA7A 1GG6C 1FONA 1AKSB 1LVMA 1MAYA 5J4SA 1G2LA 1S84A 1C1TA 2G8TA 2BD3A 4KELA 3FZDA 3P8OA 5K0HA 4AFSA 4MNXA 2J98B 3BTDE 4TWYA 3SGAE 1GHZA 3I77A 3ZZ5A 2VIQA 4NZLA 3RLWH 2EI8A 5T6DA 4DJZB 4DT7B 1KYNA 1UK4A 1CHOG 3HK6B 1TMUH 1GL1A 3E6PH 2QY0B 1DWBH 4DOQA 4ZKNU 2FTLE 2VIOA 1P2OA 3SU4A 2C8ZB 2OC7A 4CH2B 4CRGA 3RXFA 2CGAA 3TVJB 4Q2KA 1UMAH 2ANYA 1LPZB 3SZNA 2I6SA 1KDQB 5FBIA 2Y80A 3MTYA 4GHTA 1T31A 2BQ7B 2GT8A 2WSSD 1UVOA 4NG9H 2F9PA 1JBUH 2CN0H 1EOLA 3EAJA 3HKJB 4IN1A 4JZDH 3BG8A 4ABFA 3RXSA 2WINI 1LVYA 1YWUA 1ZJKA 1H9LB 4ZROA 1C5OH 5JDUB 1V2LT 4IGDA 1GJ4H 1N6YA 2TGTA 3PM3A 2WPJS 1DDJA 3AAUA 1O2HA 1FIZA 1EASA 2ZIQH 2H9EH 1O2JA 2HLCA 2TGDA 5JBTA 1GDUA 1LQDB 1FJSA 4SGBE 1CSOE 2LELA 3SV6A 3A7YA 4OM9A 2XNDD 4ZKOU 4PROA 4NWLA 2ZFTA 2XC4A 1TPPA 4QT8C 4XSKU 1K1PA 3SUFA 5EQSA 1DY8A 3SBKA 2KCOA 1B5GH 4XFQA 1F7ZA 3A7WA 2G4UA 1GBFA 2JH6D 3OSYA 1BTPA 4MNWA 1S0RA 1YF4A 1MD7A 1P9SA 4E7NA 4ZMAH 1XUKA 4HGCA 4YM9A 1GI4A 3M5LA 1XX9A 4X6OA 1CA8B 1K1OA 1KXEA 4TY7A 1GJ8B 3ZZ6A 2BYAX 1L1JA 3RC6A 3F68H 3D49H 4HZHA 2Z3CA 2C3SA 1TX6A 3HATH 3M36A 3RUOA 1QBOA 3FN8A 3MFJA 2VWNA 4H4FA 1RTKA 1SGRE 3TH2H 1WQVH 4YT7H 5F8TA 3N7OA 2P8OC 4O03A 4R0IA 2ZFFH 3TNTA 4ZHAA 1PPBH 1TGBA 4FETA 1F92A 4ABJA 5DK1A 1KLIH 3FZZA 4ZXXH 1PPCE 2AIPA 5EPNA 4A1TA 3MNSA 1SGTA 1K1LA 1XUGA 3UOPA 2V3OH 1GBAA 1FMGA 2O8TA 1THSH 3RM2H 3M37A 2P8OB 4O3UA 1XVOA 1XVMA 3UNSA 1ELGA 2FWWA 3TITA 2BDBA 2OQUA 1NN6A 4GSOA 2CMYA 2VIWA 1IQLA 3BF6H 2ZCKP 5HM9A 2K0QA 2ZHDA 2VB0A 2AGIX 3WW7A 4DVAU 1GBEA 1O2PA 1TPAE 3TIUA 1YLCA 1GJDB 4Y8YA 1C1WH 3LKWA 3C1KA 2ZDKA 4J1YA 1DANH 1UVSH 1C5TA 1CVWH 5TCCA 4U30A 2ZTXA 1D9IA 1PQ5A 2FTMA 1HGTH 1OYTH 1ZMLA 1K0HA 2FOFA 4NFFA 1GHAF 1BRBE 3TK6A 1JRSA 3GDSA 1H8DH 1ZHMA 1HXEH 1OWDA 1Y3VA 5FHTA 3QN7A 3BTKE 3P8NA 3ZYEA 1O5DH 3ZVCA 1Z7KA 1MTNC 1EKBB 7ESTE 1TQ0B 1YGCH 1Z6JH 2OBQA 1UVPA 3VGCC 3IITA 2OBOA 1O3AA 4AYVB 1E1RD 1O3BA 1HIAB 1VCQA 4B2BA 2AMDA 3LIWA 3MMGA 2R0KA 2F9UA 1RIWC 4A92A 1ESBA 1GBCA 1V2WT 4K8BA 1GMCF 1OPHB 3VB7A 2DE9A 3M7QA 1W0JD 1ZRKA 4YESB 4D7GA 4CHAC 5GCHF 3VGCB 1E0FD 1P2NA 2SNWA 1N6XA 1IQGA 1S83A 2G51A 2GD4B 4THNH 1AQ7A 2A7CA 2WPLS 3MNBA 1NZQH 4JZIA 3ZZ8A 3V12A 1O39A 4K2YA 2NU3E 3URDA 1RIWB 3QTVH 5DG6A 5EJZA 3SI4H 1C5SA 2V3MA 3GYLB 4CHAB 1TBQH 1P11E 4K1SA 1TPSA 3RMNH 4XBBA 4SGAE 1EZUC 2QXIA 2ZKSA 3ZZCA 1FY8E 5EJ1A 1J9CH 2ZGBH 4FU8A 4ZXYH 5A0CA 1IQJA 2ZA5A 1MD8A 4MG3A 1C5YB 1H9HE 3OTJE 4MTBA 1YPHE 1S81A 4Y79A 5KEDA 3SU5A 2TIOA 1VZQH 1JIMA 3GCOA 1C2MA 3KL6A 1AIXH 2BDIA 1ZGIA 1EB2A 3OE7D 2J9NA 1BBRE 1NT1A 1SG8B 2FI4E 4UONA 1BIOA 2ZTYA 3OX7U 1P2MA 2TBSA 2FPZA 3OTPA 2JH0D 3PLBA 3KQDA 5DP5A 1L4DA 4Y10E 3K6YA 2XC5A 2GV6A 1LHCH 2J5UA 1GBDA 3BTFE 5T1VA 1TABE 1BB0B 4H6TA 3ZZAA 1A0LA 4CH8B 1BQYA 1TGNA 1A0JA 3UUZA 2A2XH 3RC5A 3LH3A 4Y76A 1C5LH 4ZHLU 2OD3B 1UTOA 3F3BA 1TOCB 2QXHA 3B8JA 5BPEA 8KME2 3GCNA 3RMMH 1TQ7B 1BZXE 2Y7ZA 1G3DA 3RXBA 2ANKH 3EQ0H 3SORA 3CENA 1QURH 5PTPA 5I25A 5GXPA 4MPVA 3M5OA 2CHAC 3RP2A 2ZHFH 4IC6A 3TJNA 1HJAB 2GV7A 1AD8H 3A83A 4B2AA 1ZPBA 1TNJA 4Q7XA 3M3TA 3SN8A 4MNVA 1KMHB 4DGJA 3JZ1B 1GDQA 1P03A 3U8RH 2ZGXH 2CHAB 2AHME 2ZU5A 4E05H 4X1NU 2P3TB 4U01A 2G81E 1TRYA 2F3CE 4OS1A 2P3FH 5FPSA 3S7KB 5BRRE 1G37A 4GUXA 2Q1JA 3MU0A 4AC9A 1C4U2 1H8HD 2A1DB 4HG6A 1TNKA 1CHOF 4AX9H 3GY2A 4MLFB 2BDCA 1C2JA 2XBXA 1A4WH 1C4V2 2HLDD 1GHVH 2VWLA 1QRXA 1UCYE 2C4FH 3Q76A 2BY5X 4XDEA 1YLDA 1DFPA 1C5MD 1UCYK 3LDXH 1A5GH 1K1IA 2D26C 2J97A 1LHDH 3FP7E 1GI6A 3BIUH 3NUMA 1AUJA 1C9TA 2Q6DA 4X6MA 1MMJN 1TGCA 4ZH8A 3D65E 2GT7A 3AASA 5G4BA 3STIA 5E2OA 4UE7H 1LKBA 2F9NA 2UUJB 1MBQA 4I8KA 2BDAA 1CGIE 4K8YA 4RSPA 1EZQA 4LZ4B 3BG4C 1M9UA 1OHHD 4AG2A 2WV5A 2XXLA 4X2VA 2Q6GA 1Z8JB 1GHBF 3ODFA 1D3QB 4CRBA 8ESTE 1YPGH 2XBYA 4MDSA 1IAUA 1F5LA 1D6WA 3E91A 5C2ZA 3ATLA 1YCPH 4YZUA 2XRCA 3TGJE 3N99A 1GL0E 1GJBB 1NFUA 1O2IA 3SO3A 2IN2A 1Z71A 2AYWA 2A4RA 5EIYA 1O5CB 3SJOA 3SV8A 2BDYA 1K1JA 2NWNA 3T26A 1AY6H 1DLKB 2V7QD 4NIYA 3U8TH 1GI9B 5CMXH 2KFWA 1GHAG 1SGFA 1J8AA 5CHAC 1O30A 4HFPB 3TK9A 1V2RT 1RRKA 2LP6A 4BNRA 1G9IE 2BTCE 3SNEA 1F2SE 3M3SA 5DSFA 5EODA 3P17H 1YPJH 1SBWA 1MZAA 4U32A 2J34A 3SU1A 4B76A 1O3LA 2B7DH 1CT0E 4WMEA 1WCZA 1W7XH 2PLXA 5CHAB 1MBMA 1HPGA 1DLEA 1C5ZB 2ANMH 2FYQA 3RXRA 3RXEA 2G55A 4TY6A 4IN2A 2NU1E 1IQHA 2C90B 1ZPZA 2ODYB 1GMCG 1MTSA 1H8IH 1NTPA 3GY4A 4WJG2 1O3CA 1ZYOA 2Z3EA 4X8TH 5GCHG 3MWIU 3QZQA 2ZQ2A 3T25A 4ISIH 2GMTC 1PJPA 2L6OA 2VH6A 3S9BA 1NFXA 2ALPA 1T8OA 5HXFA 3ELAH 3UFAA 2AIQA 1O2SA 4HTCH 5HGGA 1AVWA 1GGDC 1O2GH 2VU8E 5ETXA 1Y5AT 1KXAA 1GHYH 1MABB 2BZ6H 2HPQH 5LH8A 1GVKB 4GCHF 1UTLM 2Z9KA 4GHQA 3RMOH 1NRPH 2BD2A 2ZPRA 2FOCA 3MYWA 1V2VT 4X8SH 4Z1MD 4WMDA 3SHAH 2ZO3H 1DUEA 2ANWA 1GGDB 4TPYA 1DY9A 2WPHS 2PP6A 2HOBA 3QTOH 3U8OH 1V2PT 1SGPE 1SI5H 1AKSA 3FOAA 2W3IA 5C1YA 4OS5A 1ELDE 1LHGH 1SGIB 3RU4D 1LHEH 1EUFA 2FOGA 2J98A 2ZG0H 4F4OC 2WPMS 5ESBA 3HPTB 4JZ1A 5IYTA 2BD8A 4XD7D 1O3KA 1Y5UT 1BCUH 1AFQB 1A5IA 2XOKD 4K5ZA 1P2JA 2TGPZ 2XCNA 3PWCA 2A5KA 1GI5A 5J4QA 2J94A 3P6ZB 1WBGB 3N7EA 4FUFA 5C5NA 2ZU1A 1Y3XA 1C5VA 3S7HB 3O8CA 1F0SA
chains in the Genus database with same CATH topology
1GBIA 2AGGX 2TRMA 1AI8H 5LPRA 4Y11E 4MPWA 1GJCB 3RXVA 3P8FA 2VWMA 2Z9IA 1S6FA 1O2KA 5FX6A 1EQ9A 2AMQA 1QR3E 5FPTA 4ABHA 1C5NH 3SQHE 1YBWA 4MVNA 4AGJA 2G4TA 4UD9H 4Y71A 2D2DA 2GVFA 2ZHWH 1BHXF 1ESTA 2QCYA 1O5AB 2A4GA 2GP9B 1SGCA 1FN8A 5A0BA 3BIVH 3AAVA 2J95A 1TNGA 3H7OA 1GHXH 1K2I1 2VINA 2STBE 3MU5A 4FUCA 1EAIA 1AUTC 3H7TA 2R2WU 1A46H 1NU7B 2BB4A 1EP5A 4YOIA 2RA0A 5EXMA 1C1OA 3W95A 1IQIA 1HXFH 2R3YA 4BAKB 1BRCE 3ZZ7A 2GKVE 4ABGA 4DCDA 3C27B 1DWDH 1UCYH 1RFNA 1YCPM 2W26A 2V3HH 3LU9B 5DGJA 1BUIA 1W14U 1J16A 5AFZH 3ZZBA 2DE8A 1P0SH 5DP4A 3O8BA 4DG4A 1V2KT 4BXWA 1F0TA 1FPHH 3GCHC 3RXOA 5C67A 1C5QA 1O2YA 3R3GB 2AH4X 1W12U 1FV9A 4NZQA 1TPOA 1NM6A 1MZDA 1ABJH 4X0WU 3JZ2B 1RD3B 1G3BA 1EAXA 2PTCE 2BY7X 3E90B 3GCHB 1QRWA 3LGIA 4TYDA 3MI4A 4UFEH 3ZZ3A 2Y81A 1DPOA 2QC2A 3LGYA 3UWJH 1MQ6A 5AF9H 1TBZH 1GHBG 2OCVB 3TNSA 3OY6U 2ZFQH 1A1RA 1G3EA 1UK2A 2VJ1A 2PGQB 3QWCH 2B5TB 1O2OA 1CT2E 2D8WA 3KF2A 1OWEA 3SU3A 2A4OA 2H5DA 3ATWA 3TJVA 5L30H 1T4VH 1Z1JA 1C5WB 3TH3H 3SU0A 1FZZA 4FVDA 3U9AH 1MKXK 2Z6BD 3A86A 4NSVA 5DP7A 1O2VA 4I7YH 1AZ8A 3OU0A 4RN6A 1C5RA 1TMBH 3GDUA 1BRAA 1OP0A 2F9VA 2BLVA 4X6PA 1GBKA 4WVPE 3S9CA 2WPIS 4KTSA 2ZQ1A 2BD7A 1EB1H 1K1NA 1QBNA 1RJXB 2GCHF 3ZV9A 2ZZUH 5GDSH 1DWCH 1A0HB 3A7VA 2ZHQH 1LDTT 2BX3A 3ZZDA 1XUFA 1ZTJA 3G01A 3KEEA 3T28A 3LH1A 4B1TA 1JIRA 2R3UA 4ISHH 4KTUA 1GBMA 3FP6E 2PUQH 2GDEH 3CS7A 5DP6A 2R9PA 2H6MA 5A8ZA 1AE8H 1HIAA 1O2XA 2G00A 3HGNA 3SNBA 4Y0ZE 1QCPA 1C9PA 1G3CA 1Y3YA 3MH7A 2Z3DA 4AGKA 5EOKA 1NESE 2C93B 2BY6X 5JYIA 2KAIA 4AYYB 4AFQA 1Z8GA 1GCTC 3Q3KA 1VJ9U 1ID5H 1BRUP 1V2OT 1EXFA 1T8NA 3KNXA 4GCHG 2A0QB 1NC6A 4NGAH 1PPEE 4D8NA 2SGFE 3TU7H 2ZFPH 4WH6A 3K65B 1JRTA 5FAHA 4NWKA 4X1PU 1GCTB 1VITH 1A3BH 1C2HA 3M5NA 1KLTA 1YKTA 1RXPA 4ZKSU 2G5VA 2QIQA 1GMHG 2UWPA 2ZDVH 1OX1A 1LO6A 2P3UB 2UUKB 4MPXA 3MHWU 3I29A 2FMJA 2FYRA 2UWLA 1VJAU 1FXYA 1ETSH 4BAMB 1KXBA 1DVAH 1SC8U 3SI3H 1TA2A 2FOEA 1C2IA 3QUMP 4IBLH 5LPEA 3D23A 5EXLA 4ISOA 1YCPK 1ELEE 3AW1A 2BVSH 1W10U 3PV4A 4NIXA 1J17T 3RXTA 1YPKH 5AVDA 2SGAA 1UTMA 3GCTF 2UUFB 3A8CA 3E16B 4JZFH 1Q3XA 2Y6TA 5FX5A 2QXGA 3TK5A 1CO7E 1WSSH 2HALA 3MNCA 2ZF0H 1EAUA 2CJIA 3LGTA 2XYAA 4X2WA 9LPRA 3RXDA 2KAIB 1J14A 3P95A 2P95A 1MTWA 1SHHB 2Y7XA 2A7HA 1TB6H 2O9QA 4ISNA 1V2UT 3L6PA 4KKDA 2ZU2A 3DD2H 3Q00A 2FO9A 1C5UA 4MPUA 3T5FH 4LXBH 3BEUA 4WXVA 4UFGH 2RCEA 5ABWA 4Q7YA 1SFQB 4INHA 1MTUA 2BVXH 3PMHB 2ZGHA 4B71A 1ZOMA 3PTNA 1SL3A 1OWKA 3EA9A 3TPIZ 1V2JT 1X7AC 4GVUA 2ZDLA 4Y7AA 1WU1A 2IJOB 1LKAA 3P70B 1C1VH 2ZPQA 1F5KU 2AGEX 1DWEH 4BTTB 4TPIZ 5DJ7A 2R0LA 3KN2A 1GBHA 3RC4A 1EOJA 1G2MA 1ELTA 1T8LA 3Q3YA 5DP8A 3PLKA 1A61H 4MNYA 1BTHH 5TCAA 1PPFE 1E37B 1BBRK 1TNLA 2ZDAH 2NU0E 1EATA 3SV2H 2THFB 5EQRA 1P57B 2ILNA 3M3VA 3SJ9A 1NPMA 4JZEH 3BTHE 4I8HA 1GBTA 3U69H 5EG4A 1YP9A 1HAVA 1GI1A 1OP8A 4OS7A 1NFYA 5B6OA 2NU4E 4UFDH 1NU9A 3LOXA 4WH8A 2EEKA 1P04A 3H5CB 4ESTE 1MKXH 3VB4A 2RDLA 2FX6A 1D4PB 1HJAC 2BM2A 2ZNKH 3M35A 4ZKRU 4B73A 1GBBA 3QO6A 1HAOH 3Q3XA 1FDPA 4KP0A 3AVZA 1AVXA 1TRMA 2V35A 2UUYA 3P8GA 1O5GH 2FI5E 1IHSH 3SGBE 3T2NA 5EQQA 1TRNA 1BMMH 1T8MA 1WOFA 1MCVA 2QF0A 2PSXA 3ATMA 1Z1IA 3MU1A 1PFXC 2OLGA 4GLYA 3ZVBA 2HNTF 3ZVGA 2QF3A 1HBTH 1ELAA 5L6NH 1F0UA 1DITH 2GCHG 4A6LA 1W11U 1ELCA 2ZCLP 5FCRA 4ABIA 1IQEA 1SLVB 4ABAA 3B23B 2BY8X 1XUIA 3MO9A 2Y5FA 1TALA 1Z6EA 1GI0A 1CA0B 1QTFA 3BTQE 1AWHB 2GDDA 1P09A 2BXTH 1QQ4A 2ZCHP 3ATIA 3STJA 2RG3A 1NS3A 1HAXB 1HYLA 1AO5A 3UQVA 2OTVA 1BTZA 1A2CH 5JPMH 1O3HA 4IMZA 1HAVB 1YPMH 1TAWA 1G32B 3PTBA 2GZ8A 1S6HA 2ZP0H 1GVLA 1EJMA 1ZMJA 2ZC9H 1SHYA 1K22H 1V2NT 1T4UH 1BA8B 5JBBS 3M61U 1MAXA 4K60A 2FX4A 1K9OE 1AE5A 4B75A 1C2FA 1O2QA 3A7TA 3K6ZA 1C5PA 1GDNA 1Y3WA 2RA3A 3PO1B 4OS4A 1D3TB 1QRZA 3OYPA 8GCHF 3ZYDA 1ANEA 2AERH 2W7UA 1FPCH 3BSQA 5EU8A 3QLPH 3A80A 1LMWB 2J4IA 2QYIA 2ZFRH 1O2WA 1WQSA 1HAYB 1QA0A 1W0ZU 1JOUB 4BAOB 4VGCC 5EXNA 3T29A 2IOTA 1C1MA 4FU7A 4AORA 1P01A 1UK3A 2TGAA 5JBAS 2XC0A 3R0FA 4D7FA 1UO6A 2P93A 4Y0YE 1TX8A 1TLDA 1UVUH 2AFQB 2ZDMA 3KCGH 3P92A 1QL7A 5DKMA 1KY9A 3GCTG 4VGCB 3FANA 2J2UA 3LJOA 1GPZA 1S85A 1EPTA 3KGPA 1FI8A 1BTUA 4A5TS 1AN1E 1DE7H 5A8XA 2FI3E 1XKAC 1HB0B 4FUHA 1HAIH 3E3TA 3O8DA 3SJIA 1NO9H 1Y3UA 3GY8A 3DHKH 1PQAA 1WYKA 2J92A 1QB9A 1MH0A 4OS2A 2LPRA 4ZUHA 3W94A 2FESH 3A82A 6LPRA 1KTTB 1O3MA 3A8DA 1P2IA 1O2TA 2VGCB 1L1NA 1CE5A 2ZGCA 3A7XA 3GY3A 2ZU3A 4F49A 1RS0A 1BHXB 2GTBA 3DA9B 1EZXC 3EDXB 1YPHC 2H1UA 2DUCA 1BDAA 1S0QA 1AVGH 1LCYA 2PR3A 3K2UA 2F91A 3S9AA 6CHAC 4M7GA 2VVUA 1A7SA 2W3KA 1N1LA 3ITIA 3LT3A 1SLWB 2V0BA 1NRRH 1MTVA 1SQAA 3KIDU 2Z9GA 4I31A 5AHGH 3BTME 3O8RA 1G30B 2CF9H 4Y7BA 1AFQC 1TE0A 1CT4E 2A2QH 1GMHF 1BBRH 3WY8A 1SOTA 4FUJA 6CHAB 1EPTC 3QK1A 1RGQA 1S82A 1DXWA 1OWJA 3LC3A 4BTUB 2QA9E 1O35A 4WWYA 3NXPA 2BD4A 1BT7A 1ZR0A 2BY9X 1QY6A 1DUAA 4K1EA 2BD5A 4E06H 4E7RG 1ANCA 1EPTB 1OKXA 3SW2B 2PTNA 4INLA 1K1MA 1XMNB 4I33A 1O32A 1AGJA 3U1JB 3RXUA 4I32A 1A3EH 4FUDA 4BXSA 2OP9A 1CU1A 1O2LA 2C8XB 1K21H 2JH5D 2BZAA 1AHTH 1CGHA 2QV1A 2M5TA 1K28D 2BHGA 1PPHE 2GX4A 2ZHEH 3QX5H 2W7SA 1FLEE 3B9FH 4AFZA 3E0PB 3OY5U 2ALVA 2OXSA 4ASHA 7KMEH 3TLOA 2SGQE 3KQCA 2OC0A 3DFLA 1KLJH 3URCA 1SQOA 2F83A 3U1IB 4WMFA 2FEQH 2YNBA 5K7RA 1HLTH 1HFDA 1TGTA 1HJ8A 3BV9B 3FFGA 1OSSA 1IHTH 3VB6A 9ESTA 3SNDA 2J38A 1QL8A 1B0FA 1C1PA 3NWUA 3SU6A 3PWBA 1QB1A 1TBRH 4FUEA 2HGTH 1PYTD 2VIDA 1D6RA 3E1XB 3F1SB 3SUGA 5EW2H 1Z8RA 1Q2WA 1ARCA 1HV7A 1P9UA 1C4Y2 4I8GA 4K69A 1INCA 1TOMH 1MCTA 2HNTE 1O2ZA 1FAKH 1HAGE 4MQAA 2QAAA 4WF8A 1UTQA 3EA8A 3EE0B 5T3HA 3MNXA 2OC1A 8LPRA 1ZSLA 2BMGB 1AWFH 5LPFA 1OXGA 1UTNA 3M5MA 2ASUB 5C5OA 3ZVDA 2R2MB 5E8EH 4Y8XA 3SJKA 3A84A 4XBCA 4Q80A 2ESTE 4DY7B 4FXGH 3SV9A 1GG6B 1Z8IB 2PHBA 5JB8S 2UWOA 4JYUH 1NRNH 2GZ9A 1OOKB 4YLUA 2BLWA 2AMPA 2FOBA 1JXPA 1ZLRA 3UWIA 5LGOA 2LNCA 1ZHRA 3PMJA 3KHVA 5C1UA 1W3CA 1SQTA 2STAE 1W0YH 4FUBA 2F9BH 8GCHG 4FU9A 1TMTH 5A0AE 4AN7A 5FCKA 1XKBC 5CE1A 1ESAA 4LZ1H 2ODPA 4BOHA 5T6FA 3UREA 4X6NA 1WAYB 1ACBE 1DSUA 2WYGA 3PYHA 1ETRH 1LPKB 2O8MA 4D9RA 1HCGA 2XBVA 2PFEA 1P2QA 1O2UA 2ZEBA 3A87A 1BMLA 5F8XA 2AEIH 1HAHH 3PB1E 3E8LA 3S69A 1C2KA 2VIPA 2XNIA 1J15A 1FY1A 5EGMA 1O3GA 4CBOA 3UQOA 1W8BH 1CGJE 2Y82A 2VH0A 4JMYA 5DO4H 1BTXA 1ZJDA 3VB5A 3VEQB 4CRDA 1AB9C 1D3DB 4AG1A 3ENSB 1ZZZA 3V3MA 3NPSA 5DP9A 4JYTA 2B9LA 3HK3B 1O3OA 4JYVH 4D9QA 1ZTLA 1E38B 1O5FH 2HWLB 1LHFH 3GDVA 2GZ7A 1AFEH 1UTPA 1XXFA 1AB9B 3GY7A 2WUCA 4NCYA 1L2EA 2PSYA 4X2XA 4YOJA 2FOAA 4FVBA 3BEIB 1RTFB 2XTTB 4I8LA 5C1XA 3CP7A 1C2LA 5FPYA 2PGBB 1MKWK 1QBVH 3HGPA 2FOHA 3GY6A 4BTIB 3IG6B 5L2ZH 3GISB 1V2ST 1GI7B 3RMLH 1SGQE 1TWXB 2SFAA 3SOSA 3UNQA 4WY3A 1B7XB 2FOMB 3QGNB 2PV9B 1W7GH 3BN9A 3FVFB 2FXRA 1C2EA 5HMAA 1BMNH 1NRSH 4NSYA 3LONA 1FUJA 4Z0KA 3SUDA 1CQQA 5E0JA 4YT6H 3FAOA 1SSXA 2EI7A 3ATKA 1QQUA 3NKKA 2QGRA 1ZRBA 1TX7A 1BJUA 1UVTH 4A1VA 4KGAA 4YO9A 3GYMA 5IDKA 4OGYA 2VVVA 1LVOA 6GCHF 1V2MT 1GHWH 2I6QA 4B74A 4JK6A 4RKOB 1P12E 1O3NA 2BX4A 1OYQA 1HAZB 1L4ZA 1KSNA 1SLUB 1VCPA 1WUNH 1F0RA 3D62A 1SVPA 2V6NA 1DOJA 4WXIA 1QIXB 2O8LA 4O3TA 4YTAA 5H4IB 2A5AA 3FP8E 1FY5A 4OS6A 1YPEH 2BDHA 4ABBA 3UIRA 3TH4H 1F5RA 4UEHH 4TWWA 3F6UH 1BITA 1IQKA 2TPIZ 4RKJB 2C8WB 6ESTA 1THPB 1ABIH 1EJNA 1EZSC 1KIGH 1ANBA 3GOVB 3RXJA 2Q6FA 4DIIH 4D76A 4NFEA 3DT0H 4X1SU 3TGKE 2SGDE 1O0DH 1YPLH 1TNHA 1W2KH 4H42U 4X1RU 2H9TH 2FDAA 3DFJA 1HNEE 3IWMA 2CV3A 3L3TA 3LGVA 3MH4A 1MUEB 1O2MA 1XXDA 4CBNA 1E34B 2QXJA 3L33A 3M7UA 4AB8A 2G52A 2JKHA 3RDZA 4LK4A 1Y59T 2OQ5A 3QGJA 1GBJA 1ETTH 2FM2A 1KTSB 2HNTC 5GPIB 2ZPSA 2BQ6B 2P16A 3TGIE 5JBCS 1GMDF 1ZSJA 1MTNB 3V0XA 3T27A 4XE4A 3PROA 1FAXA 1GJ7B 5FBEA 5DP3A 3RM0H 1O33A 1V3XA 5F6MA 5GJ4B 1PQ7A 4XOJA 5EW1H 1BMAA 1PYTC 1O5BB 5T6GA 2VNTA 3E0NB 1FY4A 1TA6A 1TIOA 1O37A 3RXIA 3VPKA 1VR1H 2ULLA 3HKIB 2IPHA 3CS0A 1QB6A 1DX5M 1LTOA 1ELBA 1DM4B 1O3EA 1ANDA 1B0EA 3SQEE 1P02A 4BAQB 1SGNE 3RXKA 3BTTE 3I78A 5SGAE 1P3CA 1ZHPA 1P3EA 4K1TA 1SGFG 1ZSKA 3RU4T 1VITF 1V6DA 4H6SB 3LJJA 1FIWA 1HUTH 3F9EA 2BQWB 1YYY1 1XUHA