1MTVA

Factor xa specific inhibitor in complex with bovine trypsin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
molecule tags Serine protease
publication title Crystal structures of factor Xa specific inhibitors in complex with trypsin: structural grounds for inhibition of factor Xa and selectivity against thrombin.
pubmed doi rcsb
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mtvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mtvA02
1V2WT 3DFJA 1E36B 4ZAEA 2GP9B 2F3CE 1S6HA 3RMNH 1GL0E 3LIWA 4A1TA 1MAXA 2H9EH 4AN7A 2AFQB 2ZDKA 3I29A 3MU5A 1GJAB 3A81A 3OX7U 1TMTH 3RXEA 2QGRA 2SGFE 4K8YA 4NA9H 1F5KU 3ZZ3A 2BLWA 2D2DA 4D9RA 4YLUA 2A7HA 2IPHA 1G32B 1C5WB 1C2GA 1KDQA 3SJIA 5I25A 3SNBA 1CHGA 2I6SA 2WV5A 3RXJA 1VR1H 2WINI 1BRBE 1AUJA 1W3CA 5JBTA 1SSXA 2ALPA 4J2YB 2UWLA 3DUXH 1GI2A 3LJOA 1TB6H 3S7HB 1GHBF 4I31A 1P09A 1UVOA 2BD2A 5T6GA 2ZF0H 1D9IA 1UTPA 1EJNA 4ISNA 5ETXA 1C2IA 3ITIA 1ABIH 2VJ1A 3LH1A 2ZO3H 2Q6GA 4AFQA 1G3EA 1SQTA 3OU0A 1C1PA 2SGPE 2HNTC 3RXBA 4AG2A 4Y71A 2KAIB 2LPRA 1CHOG 1WBGB 2WV4A 2XTTB 3RXIA 4U01A 3UOUA 1OYTH 4AYVB 3OYPA 5K7RA 2FEQH 2VIWA 3EA8A 2PV9B 2JH0D 1JXPA 3I78A 1GHZA 2ZTYA 1N8OB 1PPBH 1XVOA 1RXPA 2XW9A 3VPKA 1O0DH 3D62A 1AVXA 1IOEA 3E3TA 1P2IA 4LXBH 2BB4A 1P8VC 1JMOH 1K1JA 1AU8A 5C5OA 1A61H 1HAHH 2UUKB 4Y6DA 1GPZA 4CREA 1OYQA 3SN8A 2Z7FE 2A4GA 5C3NA 1Z6JH 1O2GH 3QGNB 5HM9A 4ASHA 3KL6A 2BY9X 1UVPA 4TYDA 2A5IA 4A5TS 1CBWC 1GHWH 4B74A 2RA3A 1NESE 1RTKA 1TNIA 1P9UA 1XMNB 3PROA 3ZZDA 1FLEE 1O3FA 8GCHF 5EXMA 1TNHA 4U32A 1HPGA 1HJ8A 1P3CA 1XKBC 4INLA 5JBAS 1IQIA 3ZVCA 3T5FH 5B6OA 1GMDF 1PQ7A 1C4Y2 1SR5C 3ZZAA 3D23A 1QL7A 5FBIA 1HV7A 2VB0A 1JRTA 2F9OA 2GCHF 1RTLA 5GPIB 2SNWA 1BTZA 4NIXA 2PW8H 1GL1A 1OWKA 1QJ1B 4I8JA 3SZNA 5A0AE 1EPTA 2BTCE 3U8TH 1A5HA 1SGQE 1UTLM 4UE7H 2UWPA 2QXIA 2QIQA 1YF4A 1BOQA 2QY0B 1F5RA 1WTGH 3HGPA 3TH3H 1DM4B 1C5OH 1TRMA 4BOHA 3QK1A 1TWXB 3PTNA 3UNSA 2R2WU 1TGNA 3OTJE 1HAXB 2IOTA 2FS9A 3KNXA 4WWYA 5FBEA 4U2WA 1KDQB 3IG6B 3ZVFA 2TGAA 3L33A 1GI5A 2Y5FA 1WQSA 1BUIA 2SGAA 3RC6A 1JIRA 3TITA 4DIHH 1DFPA 4VGCB 1W7GH 3ZZ8A 3PO1C 1DUAA 3EE0B 1C1OA 1AY6H 1O2WA 4XDEA 7LPRA 3P92A 4E7NA 3P17H 4AFSA 1FAKH 5DPAA 1RIWB 3KF2A 3TK6A 1LDTT 1RJXB 1S84A 2ODPA 3H7TA 3FAOA 4FUHA 3RXHA 2OC8A 3VGCC 3TNTA 2GMTB 3PWCA 1Z6EA 5T6FA 1KTTB 2DE8A 1A0JA 2Z9JA 3ATLA 2FI4E 1MTUA 4FU7A 1P02A 1YKTA 3M5OA 1TRYA 4RKOB 1O2JA 2XRCA 5A8XA 2ZGHA 4CBNA 1P06A 2ZEBA 1P12E 4E06H 2XC0A 5TCAA 4KTUA 4WXVA 3SU6A 3E16B 4K2YA 3UQVA 3SV8A 2BQWB 1O3EA 1E37B 1GJ8B 2G81E 2Z9IA 2NU1E 3O8BA 2ZDVH 3U98H 5HXFA 2ZDMA 1G3BA 1O2LA 4XOJA 3V7TA 1S6FA 2J38A 1ARCA 2AH4X 4IN1A 4Y10E 3SJKA 1OS8A 3BIVH 3PTBA 4YOJA 3ZZ5A 1Y3XA 1DVAH 1ESBA 3KGPA 3MYWA 2PGBB 4YOIA 1YYY1 1SGCA 1O3LA 2TPIZ 2JETC 4D8NA 1LPZB 4DOQA 1J15A 1G2MA 2TGPZ 3F9HA 1O2NA 2ZPSA 3PMAB 1AD8H 1GMHG 2FZZA 5C2ZA 3H5CB 4K69A 5GCHG 2XC4A 1FQ3A 2HPQH 3ZZ6A 1C5YB 1ELTA 4ABFA 3M7QA 4B1TA 3C27B 4YT7H 7ESTE 1GJCB 3HKJB 2VIQA 2P16A 4LK4A 4DT7B 1WOFA 4YESB 2SFAA 4X8SH 1WTHD 4K1SA 4JZIA 1Y3UA 2V3OH 4ISOA 1LHCH 1P2NA 1E38B 1DITH 3RLYH 4GPGA 1L0ZA 2FX4A 3SUEA 1BTHH 2BHGA 1FDPA 2BVRH 4I8LA 3FZZA 1OP2A 3NXPA 1KIGH 4MPUA 2BDIA 1EOLA 4IC5A 1S82A 2Y6TA 1D4PB 2VGCC 4FXGH 1KLIH 1H4WA 1XUGA 1QNJA 1DOJA 3SBKA 1DLEA 2NU2E 1DWDH 4ZXXH 3SJ9A 1KY9A 1O2TA 1TPSA 3FP7E 1G30B 1FY8E 2BLQA 5T3HA 3KIDU 3BV9B 2CHAC 3CS7A 2FYRA 4DCDA 2CHAB 4Q7YA 1S5SA 1PQ5A 4GVUA 1O32A 2GCHG 2TBSA 4IMQA 2Z9GA 1FIWA 1P57B 1D3TB 3MOCA 3MU8A 4HI3A 2FOFA 2XXLA 5EQQA 2GX4A 4VGCC 1C5MD 5LPFA 1NM6A 1F0RA 4ABDA 5FX6A 3Q77A 3GDVA 4INHA 1THRH 3VB5A 1YC0A 2V6NA 3EA7A 1AB9C 5ESBA 3UOPA 1XUKA 2ZG0H 4BAOB 4XE4A 3SO3A 4BAKB 1O3NA 1W0ZU 4ABJA 3ZZ4A 5JBBS 3RDZA 1GBCA 1RTFB 3QGJA 4BTUB 1EAIA 3STIA 2UUJB 4CR5A 1TLDA 4Y8XA 3V12A 2ANMH 4X6OA 3BEUA 1ZTKA 2GMTC 1EQ9A 1DY9A 1ESAA 5FHTA 3EQ0H 1NU7B 1TGBA 1TX8A 2A2XH 2KAIA 1MMJN 4X8UH 2QC2A 1MTSA 1XKAC 4NA8A 4Y11E 1SI5H 2ANYA 4FUCA 2GV6A 5PTPA 3SNEA 4DG4A 3A87A 4BNRA 4B2CA 3JZ1B 3G01A 3EDXB 4O97A 1C1NA 2W7SA 1CHOF 3BTME 3QN7A 1TE0A 1SGTA 3LGUA 1C9PA 4GSOA 3RU4T 1AKSB 1N6YA 1MTVA 1NFYA 3ATMA 1WV7H 2FOHA 4DVAU 2BOKA 3T62A 3AW0A 1HYLA 2H9HA 4JYVH 3TK5A 1TPAE 1EPTB 1N1LA 5CHAC 4YLQH 3A89A 1LCYA 1C1SA 1C2FA 3SI3H 1OX1A 2Y82A 3ZVEA 1QBNA 1AQ7A 1BB0B 1TNKA 1Y5BT 2XBWA 2ZQ2A 4IS5A 2BD7A 1PFXC 1BTWA 1ANDA 2B5TB 1CU1A 5TJXA 1UMAH 4GLYA 2ZU5A 5EXNA 2FOBA 2XWBI 3Q76A 1DANH 3SJOA 1DSUA 1O5CB 5G4BA 1LKAA 1GVLA 1AO5A 3UREA 4ZUHA 1W13U 3T2NA 4GHQA 2FWWA 3ZVAA 3MI4A 1VJ9U 1FV9A 3CP7A 5J4QA 2BVXH 3PB1E 1ZMLA 1T31A 3A7ZA 3ZZCA 3OY6U 4Y76A 4K8BA 5F03A 2GT7A 1BRAA 2WUCA 3MH7A 2Z3DA 5E2OA 4CRGA 2ASUB 1GJ4H 1HAOH 3MNXA 4BTIB 2R2MB 1AZ8A 3A8AA 3PM3A 4MPVA 2GDDA 1IAUA 1J17T 1LVYA 1TPOA 3PWBA 1DXWA 3SU5A 3MHWU 3LONA 4K1EA 2A4QA 2GV7A 1GJ9B 2AGEX 4ZKSU 1LHDH 1C5RA 1NTPA 1S0QA 5C20A 1EATA 1ELBA 4MTBA 1IQMA 5JBCS 1K1IA 1PYTC 2G55A 1HBTH 1B0FA 1GJDB 1P3EA 4E7RG 3U69H 1UK4A 3ZV8A 4Q7XA 5H4IB 1WU1A 3RM2H 1GHYH 4X6PA 1Y3WA 3K6ZA 5GIBA 3ATIA 1GBAA 4K3JA 4INKA 5GWZA 1O30A 1G9IE 3MO3A 4WY3A 5E0HA 1TA6A 1EJMA 3VB3A 2C8XB 1T8MA 4JZ1A 1NRSH 3TJVA 2G5NA 1MH0A 4RSPA 3GY3A 3FP8E 2P3UB 1ZSLA 4FVDA 2OTVA 4XBCA 2IN2A 1P9SA 3ZVDA 3VB7A 3RMMH 1AIXH 3TGKE 3U1IB 1UVTH 1LQEA 1YLDA 3BN9A 1MCTA 4TPIZ 2P93A 4O9VA 2QCYA 1V2VT 4I32A 3A86A 1AUTC 3HGNA 3RXUA 4D9QA 1MZAA 1BTXA 1EAWA 4DJZB 2OCVB 1IQEA 2PSYA 3SQHE 4YTAA 3RXKA 1CA0C 3SV9A 1MD7A 2FTMA 4RKJB 1VGCC 1XM1A 4Q7ZA 1ANBA 1C2HA 4SGAE 1WYKA 4NA7A 4JMYA 4XFQA 4X1QU 4SGBE 3R0FA 4Y7BA 2JH5D 5FAHA 1TABE 2OBQA 1P2MA 4X2VA 1O37A 3GYLB 2P3FH 3UWJH 1V2PT 2TGTA 3RXSA 1XXDA 1MZDA 2OLGA 4NGAH 3MH4A 1DXPA 2G4UA 1SGEE 3SUDA 1SLXB 3RXGA 3U8RH 1UK2A 1V2OT 1ZRBA 4ABEA 1ETTH 1BTUA 2AEIH 1KYNA 5FCKA 1HXFH 1KXDA 1SLUB 1FN6A 4CRDA 1O2QA 4X6NA 1NN6A 1O3CA 2XBXA 1GJ6A 1FY4A 1V2RT 1O39A 5I46H 1KXEA 1Z8GA 2R3YA 4DW2U 1EOJA 4WXIA 5DP4A 2QXJA 5LH8A 1GI8B 1G37A 2PSXA 1O3BA 1SHYA 1SGFG 2W3IA 3V3MA 1GCTB 1BCUH 2JKHA 1SGYE 4AX9H 1SMFE 2GZ8A 3MNBA 1ZMNA 2OBOA 1YPLH 3E90B 2XCNA 4A6LA 1W7XH 1CVWH 3ZVBA 1E34B 1TONA 2PKSB 4B2AA 1V6DA 1Z8IB 4BXSA 1FY3A 2V3HH 1CA0B 2ZFRH 1FONA 1SHHB 1SQOA 1HUTH 3PLPA 1EJAA 5CHAB 4ABAA 1GMDG 3GYMA 5L2YH 1O2OA 2O9QA 1HNEE 5EODA 1EASA 3RXVA 4UDWH 2HOBA 1ZOMA 1ZSKA 3GOVB 1EXFA 3BEIB 1UTQA 2OC7A 1OP8A 1O3KA 2FXRA 3QZQA 1ELDE 1IHSH 3LPRA 1ARBA 1ANEA 3ZYEA 3NCLA 4WVPE 3GY2A 3JZ2B 4KKDA 5BRRE 1UVSH 1IQHA 5A0CA 1HAVA 1KXCA 3SORA 4X2WA 3UIRA 3KN2A 2B9LA 1O2PA 4WF8A 3DHKH 4WMFA 2GZ9A 1AFQB 2ZHEH 2F9NA 1RGQA 4NZQA 1SGIB 5EXLA 4Y79A 1EZQA 1MQ6A 1QQUA 1XUJA 2C8WB 1K1NA 1GBDA 3M35A 1C5SA 1AZZA 2BMGB 1OXGA 1UCYK 2QN5T 1GCTC 3L3TA 1OPHB 7GCHG 1YPGH 4NIYA 1HGTH 5AF9H 4B76A 2XCFA 4MPXA 1F0SA 2AIQA 3BG4C 1PQAA 4I8GA 2M5TA 3TJOA 1A5GH 4TWWA 5SGAE 4X8TH 2PKSC 5K0HA 3TIUA 4X1NU 1YCPM 4ZROA 2CMYA 4BAMB 1GBMA 1GMCG 2GDEH 3N7OA 4OGXA 2QV1A 3MWIU 3MU1A 1FUJA 1AE8H 2P3TB 2A32A 1C1VH 1TQ0B 2BDCA 2ZFSA 3RC5A 1S81A 1ABJH 3HK6B 4O3UA 1EB1H 2XYAA 5E0GA 2BY6X 3BIUH 1ZPZA 1GVKB 2ILNA 2A4RA 4KELA 3T28A 2THFB 2C90B 3PV4A 1BBRE 1F0TA 3MNCA 2BXTH 1C1TA 1INCA 5DJ7A 1NFUA 2JETB 2A31A 2OP9A 1V2JT 1ORFA 2BDBA 2ZQ1A 3BF6H 4ZH8A 2NU3E 2A7CA 2J92A 2ZHWH 4NWLA 1Y8TA 2W7UA 2EA3A 1ZHPA 4MG3A 4ABIA 2G52A 2P8OC 1J9CH 1CSOE 1O2XA 2OQ5A 1K1LA 3SHAH 1V2MT 4NG9H 3RXCA 2XC5A 1UTKA 4X1SU 2P95A 2ZNKH 4X8VH 1O35A 1CO7E 1J14A 2EC9H 4R0IA 5FXLA 2CXVA 3M3SA 1LPGB 3FVFB 1DPOA 5DP9A 1QFKH 4JYUH 2FOMB 2B0FA 3GCNA 1CT4E 1A1RA 3BEFB 3Q00A 2BD8A 3SU2A 1GI7B 1A4WH 1P2KA 1O5EH 4ZHAA 2WPJS 2ZCHP 2QF3A 1BJVA 2EI8A 1CGHA 4A1XA 4AB9A 4CR9A 1TOCB 3QWCH 4FUFA 5EPYA 1D3DB 1KXBA 1C5PA 1S0RA 4X1RU 3SV2H 2VH6A 2ZWLH 4BTTB 3K65B 1TMBH 3GCOA 4O03A 4CH2B 3VB6A 1QGFA 4XBBA 1GGDC 4FU8A 1TALA 2VIDA 4ZMAH 1BMLA 4ABBA 3Q3KA 1GJ5H 1MKWH 2FP7B 3E0NB 2VIPA 2ZHFH 3BTQE 1LPKB 1O31A 1FN8A 4IC6A 1SB1H 1AFEH 1IQLA 2OD3B 5DP3A 2WPKS 1EPTC 2FLRH 2D1JA 1F2SE 4R8TB 2Y5GA 4IN2A 5A0BA 1HB0B 2AYWA 3SV6A 3BTTE 2R3UA 3W95A 3A8BA 1Z71A 1V2TT 4F49A 1MKXK 3GCHC 1C1UH 1P04A 1C4U2 2VVVA 3AAVA 1T7CA 1XX9A 1H9LB 1K2I1 3PMHB 4D7GA 3ZZBA 3VXFH 1DWBH 1C4V2 2D26C 2SGEE 1QHRB 2ZDNA 1H9IE 1O2IA 1H8DH 2AMQA 3ODDA 3TGIE 4HZHA 9ESTA 1Q31A 3A7VA 5EQRA 1WUNH 5FX5A 1LVMA 2A4OA 1BMNH 1O33A 1C5UA 1K1OA 1GBFA 1GHXH 1VCWA 1YM0A 3STJA 3PYHA 2J95A 3M7UA 1C5LH 2VGCB 1W0YH 2ZCLP 4M7GA 3F9GA 3AVZA 2PTNA 1UCYE 1GDUA 3A8DA 2BZ6H 3UUZA 2B7DH 1THPB 1T8OA 4MNVA 1GBJA 1O2YA 2ZU3A 3UFAA 1W2KH 3SNCA 3TJNA 1EZSC 1XXFA 1P2JA 1V2NT 1GJBB 3LKWA 5C1YA 2J9NA 3SUGA 5ESTE 1O3GA 1H1BA 3ZV9A 2XBYA 2AMDA 5AFZH 1M9UA 1GBBA 1ZHMA 1O2RA 3NZIA 2WPLS 3RXAA 5F8TA 2BQ7B 1O5DH 1ELVA 2NWNA 1BDAA 1Z8JB 1BTPA 4K60A 1O36A 3AASA 1QTFA 1SG8B 3QTOH 1Y5AT 2V0BA 3M3VA 1TQ7B 1TMUH 4ABGA 4CH8B 3ESTA 5T6DA 1NZQH 1ZHRA 3F68H 3P8OA 2ZCKP 4E05H 3TVJB 5JPMH 1HDTH 1O3JA 3RMOH 1PPGE 9LPRA 4TY7A 4GAWA 1TGCA 3MMGA 2CGAA 5DP7A 3QO6A 5GCHF 3KHVA 1TX7A 4UFGH 1YPHC 2WPIS 2YNBA 1AWFH 1F92A 1NRRH 1TBRH 2O8WA 4D7FA 1C2DA 1W10U 2EI6A 5A09A 1KTSB 2CF9H 3RP2A 3KQDA 2O8LA 2BM2A 1VGCB 2FDAA 1FAXA 1WCZA 3BTEE 5DP5A 3M36A 3S69A 5JB9S 2A0QB 1ELGA 1OWJA 1TX6A 2QYIA 3MNSA 3A80A 4NFFA 1W11U 2ZGJA 4NIVA 2ANWA 1GGDB 1MKWK 1GVZA 2QF0A 2ZHDA 1D6WA 1ACBE 2HNTF 3P8GA 3SU4A 2BD4A 3RXQA 3LGYA 4GHTA 4BXWA 2LNCA 1E0FD 3MO6A 1QB9A 5GXPA 1MTNC 1D3PB 3SHCH 1CT0E 1AFQC 1QIXB 2BDHA 1W12U 3M37A 3RLWH 2FOAA 4JZEH 4WMEA 1DX5M 3LT3A 4NSVA 2F9BH 5DP8A 3T26A 1L2EA 3PLKA 3QDZB 4UD9H 1RS0A 2F9UA 1EAXA 2BX3A 1NO9H 3B9FH 3MH6A 2HWLB 3QLPH 2CJIA 7KMEH 5AVDA 3TLOA 2BLOA 1TAWA 3E0PB 3K9XB 4AZ2B 1G3DA 1QA7A 1XUHA 3SJ8A 1CT2E 1CGIE 1O2SA 1YCPK 1BQYA 4MLFB 1SBWA 3ZZ7A 1LVOA 3BG4B 1HJ9A 2A1DB 4LOYH 2BXUH 2NU0E 3SU0A 1GBHA 1MUEB 5DKMA 2WUBA 1EUFA 1NU9A 1BRUP 1A0HB 4IGDA 2C8YB 1GG6C 4NWKA 4HGCA 3RXOA 1CE5A 2A45B 1O3HA 1NROH 2HGTH 3RXLA 3SUFA 1DDJA 4OS7A 1DY8A 4HFPB 4MVNA 4D76A 4MNWA 1VITG 5DG6A 2BZAA 3T25A 1GI4A 1DE7H 3RXDA 2PHBA 2GZ7A 4I8KA 3U9AH 1TNJA 3WY8A 4B73A 2VWLA 5C67A 4MPWA 2BX4A 1SFIA 3LGVA 1SGNE 1GCDA 1UJ1A 5C5NA 3LC3A 1AWHB 1K22H 2Z3EA 5EW2H 4AFUA 3V13A 2SGDE 2WYJA 1MU8B 2O8TA 5DP6A 4NCYA 4XSKU 4A92A 1A3EH 1HAIH 1GHAF 3P6ZB 4I33A 3VGCB 4OS4A 2Y7ZA 1QRXA 1LVBA 1SQAA 3F9FA 1ZJKA 1ETSH 1YGCH 1F5LA 3S0NA 1GBLA 5C1UA 6CHAB 1BBRH 4CRCA 3MU0A 1EP5A 1ZTJA 2BD3A 3HK3B 3ELAH 4AGKA 4WH8A 3GY6A 1Y5UT 3MH5A 1ZJDA 2HRVA 3NUMA 3SW2B 2VVUA 2P59A 1AKSA 2H6MA 1NFWA 4DY7B 2PR3A 3RXMA 2Q6DA 4PROA 5F8ZA 4ZKRU 1IQNA 1XUFA 4UEHH 3LGTA 1EKBB 1CA8B 1QQ4A 4ABHA 2ZZUH 3SV7A 1K1MA 3P8FA 4J1YA 1YPJH 3GDUA 1VCQA 2FI3E 4AOQA 1GI9B 4Y0YE 2B8OH 1ZGIA 1ZR0A 2F83A 5EG4A 3BTHE 4ZKNU 1PPCE 2ZI2H 8LPRA 1KLJH 1TGTA 1G36A 1L1GA 4RN6A 4JZDH 1ZTLA 4TWYA 2ZGBH 3A7XA 2ZP0H 5L30H 1SGRE 4WMDA 2VVCA 3ZYDA 2WYGA 3FFGA 1JWTA 5DK1A 3GY8A 4GCHG 1UTOA 2GVFA 4DURA 3P70B 8KME2 2ZGCA 1BITA 1P01A 2UWOA 2GKVE 1YPMH 2JH6D 4CBOA 4UONA 4U30A 3O8CA 3E6PH 2PUQH 3LH3A 2BD5A 1EAUA 1Z7KA 1A7SA 1NRQH 1O3IA 1MAYA 4WH6A 2BYAX 1UK3A 3FP6E 1HXEH 3EGKH 3F6UH 1MKXH 4O3TA 4Q2KA 1O2UA 4JYTA 3IITA 6CHAC 1L1JA 1TNLA 1NFXA 3BTDE 2ODQA 1K21H 2AS9A 1QBVH 1OOKB 1KXAA 2FOEA 2ZU1A 3H7OA 4AYYB 2BY5X 4X6MA 3MO9A 4TPYA 3VFEA 2ZPQA 5LPEA 1THSH 1Z1IA 2RG3A 4AG1A 3GY5A 2W26A 1TBZH 2Q1JA 1VCPA 2FM2A 4TY6A 1LQDB 2HPPH 2SGQE 2C93B 2F9PA 2F9VA 2NU4E 2ODYB 3KCGH 4B71A 4AORA 4CHAC 4MQAA 3RXTA 1C1WH 3A7WA 4Y8ZA 1L1NA 1S83A 2DUCA 4Y7AA 1HAVB 4ZHMU 1BHXF 2Z6BD 4WJG2 1GHVH 4JCNA 4H4FA 1N8OC 1AVGH 4UFEH 1GHBG 3L6PA 4MDSA 1P11E 2HVXA 3PMBB 2STBE 4OS5A 1BTYA 5DO4H 1GI1A 1V2QT 3TJUA 1P2QA 1BBRK 2BY7X 1QB6A 3RXFA 3URDA 3SU1A 4LZ4B 1GG6B 1TYNA 1C5TA 4YOGA 5EU8A 4BAQB 3LGIA 1O3PB 5L6NH 2GCTC 3NWUA 2G00A 1TIOA 1TFXA 5AHGH 1RIWC 3LGWA 3EAJA 8GCHG 3AW1A 2HNTE 2BOHB 1ZSJA 1ELFA 2J94A 2WPMS 3GCHB 3D49H 5ABWA 1T32A 1O3MA 5IYTA 1LKBA 1QRZA 3ENSB 1O5AB 1SGDE 1DWEH 1UO6A 3GICB 1C5XB 3RXPA 2O8UA 4IW4E 4OS2A 2H2ZA 5CMXH 2ZIQH 3RM0H 1CBWB 3DT0H 1RRKA 1SL3A 2VH0A 2Z94A 1GDQA 1O3DA 4UFDH 1VITF 3UQOA 1O38A 1GMCF 1HAGE 2FOGA 3BSQA 4GUXA 1BZXE 1ZYOA 2Y5HA 1Y3VA 1O5GH 2EI7A 1O2MA 3BTFE 3VB4A 1S85A 3M5LA 1C9TA 1YPKH 1QL8A 2C8ZB 3SNAA 1HRTH 1MBQA 4Y8YA 1GDNA 4FUIA 1J8AA 2J34A 5EQSA 4JZFH 1UHBB 2H5CA 2P8OB 2AGIX 3EA9A 1SLVB 3LDXH 1GBKA 2TIOA 4ISHH 2P94A 4IBLH 3Q3YA 5FPYA 1HAYB 4I7YH 2IJOB 2SNVA 2Y7XA 3QTVH 3RMLH 3U8OH 4ZKOU 4H6TA 1IQKA 1HFDA 1WAYB 2VU8E 3A82A 1DWCH 3GCTG 1GI6A 2HLCA 4KGAA 1K28D 1IQGA 1V3XA 3HKIB 1SOZA 1G2LA 1U6QA 4H6SB 2GT8A 3CS0A 2RCEA 1WSSH 2ULLA 1H8IH 3ATKA 1LMWB 3URCA 1UTJA 1ZRKA 4BAHB 1A3BH 3HPTB 1V2ST 1B5GH 1DS2E 2ZTXA 4JK5A 3UNQA 4FUGA 1IQFA 4YM9A 1ZGVA 2VWOA 2WPHS 1O2ZA 2H1UA 1UCYH 2R9PA 1A5IA 3HATH 3UR6A 5FPSA 4B75A 4GCHF 1AB9B 1F7ZA 5JYIA 1SLWB 2STAE 2GGVB 3A7YA 5EOKA 3O8DA 5CE1A 2Z9KA 1YPHE 2OXSA 3SGQE 3LC5A 1HJAB 1WQVH 3A7TA 2PWXA 3PO1B 1A0LA 4YT6H 1H9HE 1UTMA 1T4VH 1N6XA 3KQBA 3DD2H 1P03A 4AGJA 2VIOA 1V2KT 2PUXB 2ZKSA 1FJSA 1O2HA 1FI8A 1ZMJA 8ESTE 1GI0A 1NRNH 2G5VA 1MD8A 3Q3XA 3NKKA 1ID5H 1PPFE 3LU9B 2A5KA 1BJUA 4X1PU 3GY7A 4FUEA 1RD3B 2FI5E 2VINA 1L4DA 1W14U 4NFEA 5AFYH 1UTNA 1EZXC 2FS8A 2Y81A 3A84A 1OWEA 1P10A 4CRBA 5A8YA 2Q6FA 1F0UA 2PFEA 1XUIA 3FZDA 1FZZA 1HCGA 4OS1A 1Y59T 1TBQH 3M3TA 3R3GB 2G51A 3CENA 3U1JB 2QAAA 1O34A 1Q2WA 6ESTA 1A46H 1MBMA 1K1PA 3GY4A 3ODFA 2DE9A 3F1SB 1UHBA 1EX3A 4X0WU 2ALVA 1FY1A 3UWIA 5EGMA 3T27A 1BMAA 2VIVA 1MTWA 2C4FH 1GBIA 2PGQB 3BG8A 3NK8A 3M7TA 3M5MA 1NY22 2XBVA 2W5EA 3IWMA 1ANCA 2PTCE 1EZUC 3MTYA 2BLVA 3RU4E 2BY8X 1FPCH 1O2KA 2YNAA 2ZU4A 1QJ6B 2OINA 1HJAC 3BTWE 4K1TA 3DFLA 1GMHF 3TU7H 2CN0H 3T29A 1ELAA 1GJ7B 1EP6A 2BVSH 5EW1H 1ZLRA 4Z0KA 1MQ5A 3ZZ9A 4DGJA 1VZQH 4NIWA 4Q80A 2PKAA 1JOUB 1AN1E 4FU9A 3W94A 1Z8RA 1FY5A 2FODA 3AAUA 3NPSA 5JB8S 1D3QB 3BTGE 1X7AC 1B0EA 2A5AA 2FLBH 3B23B 3M5NA 4MNXA 1W8BH 4H42U 3PMJA 2XNIA 2J2UA 1O3AA 1PQ8A 3SQEE 1LHFH 1BA8B 2BDYA 1CGJE 5A2MH 3TH4H 2QA9E 1BHXB 2ZDAH 1ZPBA 2UUFB 2Z9LA 1OWIA 1TOMH 3RUOA 4JK6A 1SGPE 2PLXA 1C2KA 1C1QA 2G4TA 1QRWA 3K2UA 2BDGA 1SVPA 2A7JA 1ZZZA 4A1VA 1HAPH 3OY5U 5HM2A 4CHAB 3D65E 5J4SA 4AFZA 1O5BB 2AERH 1ZPCA 4ESTE 7GCHF 1E35B 2ZA5A 1IQJA 3E91A 2YOLA 3A8CA 2Z3CA 1LTOA 1V2LT 1QB1A 2ZTZA 1O2VA 2Y80A 1SGFA 3LOXA 2ESTE 1BT7A 4KTCA 1EB2A 1OKXA 1PJPA 4OS6A 3TH2H 4F4OC 1QBOA 2GD4B 3A85A 3V0XA 5LGOA 3SGAE 2FO9A 3DA9B 1FPHH 1JRSA 1Q3XA 3RC4A 3TPIZ 1HIAA 1BMMH 6GCHG 2AMPA 5FCRA 5LPRA 2AIPA 1ELEE 1NPMA 1CQQA 4ZXYH 4MNYA 2UUYA 3ATWA 1NC6A 4FUJA 1ETRH 3P95A 3SI4H 3GISB 1C5QA 4DIIH 1DT2A 4KP0A 3M61U 2ZFQH 1MTNB 4YZUA 1C2LA 2FX6A 1C5ZB 4ZHLU 1FIZA 5HGGA 3E8LA 3GDSA 4LZ1H 2A2QH 1DICA 1XVMA 4CRFA 3SNDA 2ZGXH 2W3KA 4XBDA 4FUBA 1SPJA 6GCHF 5E8EH 1C5VA 1GBTA 1LHGH 1NS3A 4THNH 2G8TA 1HAZB 1O3OA 1LHEH 1V2UT 2HALA 1D6RA 1SC8U 4YO9A 2CV3A 1QY6A 4ISLA 1FXYA 1NRPH 1YCPH 1GI3A 3S9CA 4A7IB 1T8LA 2ZPRA 1OSSA 1YP9A 2FIRH 1GHAG 2ZFPH 1TGSZ 1A2CH 3K6YA 4BANB 3TGJE 1FNIA 3OSYA 4X2YA 1JBUH 3MFJA 2H5DA 1T8NA 4FVBA 5F8XA 3UY9A 3RXRA 1AVWA 1IHTH 3I77A 1RFNA 4UFFH 3VEQB 3P8NA 1LO6A 4Z6AH 3QUMP 1P2OA 2BQ6B 3SGBE 2C3SA 3MU4A 1AHTH 4Y0ZE 1AI8H 1PPZA 4QT8C 2ZHQH 3FANA 3S9AA 2QXGA 1C2EA 4NZLA 3KQEA 1SFQB 3GCTF 3QZRA 1C2JA 2RDLA 2AGGX 2FTLE 2ZDLA 3A88A 1C5NH 1AE5A 1SOTA 1DUEA 2O8MA 2OUAA 5TCCA 1QCPA 1MU6B 5IDKA 3UPEA 1L4ZA 1KXFA 3TNSA 2FESH 4HTCH 2FOCA 4OGYA 2FMJA 2J4IA 5L2ZH 1QA0A 1QL9A 4FUDA 1VJAU 1C1MA 2ZU2A 2CF8H 4I8HA 1O5FH 2OQUA 1BIOA 4B2BA 3UNRA 3KQCA 3ZVGA 1TA2A 1QJ7B 4K5ZA 3SU3A 1B7XB 5HYOA 1OWDA 2ANKH 1BRCE 4CRAA 5HMAA 2VWNA 2BD9A 1Z1JA 2F91A 1KLTA 3E1XB 1K9OE 1MCVA 1FMGA 5E0JA 1G3CA 5DGJA 2VWMA 2ZFTA 3C1KA 1QURH 5BPEA 1KSNA 2ZC9H 2ZFFH 5JDUB 1YPEH 2BDAA 2PKAB 5GJ4B 3BTKE 1TNGA 1AMHA 1P05A 2R0KA 2GTBA 2I6QA 5GDSH 2V35A 3RU4D 3TK9A 3S9BA 2EEKA 1PPEE 1TPPA 5F6MA 2XWAA 4X2XA 3LJJA 2H9TH 3PLBA 3UR9A 3SOSA 1TRNA 1J16A 1AGJA 1OP0A 1PYTD 1OWHA 3VXEH 4IMZA 2K1QA 1C2MA 3EYDA 2VNTA 2ZECA 2QXHA 3A83A 1YBWA 2TRMA 5FPTA 3F9EA 1GWAA 5C1XA 2FYQA 1YLCA 3B8JA 1T4UH 1Y3YA 3QX5H 1GBEA 5A8ZA 4NSYA 1JIMA 2R0LA 1HIAB 2FPZA 3O8RA 1UVUH 3S7KB 2TGDA 1ESTA 4ISIH 3UTUH 4AB8A 2GCTB 1C1RA 1DLKB 1PPHE 1HLTH 1QR3E 1ELCA 1VITH 2OC0A 4KTSA 1NT1A 3KEEA 6LPRA 2RA0A 2D8WA 1DSTA 5EPNA 5E2PA 1P0SH 2OC1A
chains in the Genus database with same CATH superfamily
1V2WT 3DFJA 1E36B 4ZAEA 2GP9B 2F3CE 1S6HA 3RMNH 1GL0E 3LIWA 4A1TA 1MAXA 2H9EH 4AN7A 2AFQB 2ZDKA 3I29A 3FKSD 3MU5A 1GJAB 3UAIC 3A81A 2KCPA 3OX7U 1TMTH 3RXEA 2QGRA 2SGFE 4K8YA 4NA9H 1F5KU 3ZZ3A 1FX0B 2BLWA 2D2DA 4D9RA 4YLUA 2A7HA 1EFRD 2IPHA 1G32B 2QE7D 1C5WB 1C2GA 1KDQA 3SJIA 5I25A 3SNBA 1CHGA 2I6SA 3PV5A 2WV5A 3RXJA 1VR1H 2WINI 1BRBE 1AUJA 1W3CA 5JBTA 1SSXA 2ALPA 4J2YB 2UWLA 3DUXH 1GI2A 3LJOA 1TB6H 3S7HB 1GHBF 4I31A 1P09A 1UVOA 2BD2A 3N99A 5T6GA 2ZF0H 1D9IA 4ASUD 1UTPA 1EJNA 4ISNA 5ETXA 1C2IA 3ITIA 4FOUC 1ABIH 2VJ1A 3LH1A 2ZO3H 2Q6GA 4AFQA 1G3EA 1SQTA 3OU0A 1C1PA 3VG8A 2SGPE 2HNTC 3RXBA 4AG2A 4Y71A 2KAIB 2LPRA 1CHOG 1WBGB 2WV4A 2XTTB 3RXIA 4U01A 3UOUA 1OYTH 4AYVB 3OYPA 5K7RA 4FETA 2FEQH 2PP6A 2VIWA 3EA8A 2PV9B 2JH0D 1JXPA 3I78A 1GHZA 2ZTYA 1N8OB 1PPBH 1XVOA 1RXPA 2XW9A 3VPKA 1O0DH 3D62A 1AVXA 1IOEA 3E3TA 1P2IA 4LXBH 2BB4A 1P8VC 1JMOH 1K1JA 1AU8A 5C5OA 1A61H 1HAHH 2UUKB 4Y6DA 1GPZA 4CREA 2J5UA 1OYQA 3SN8A 2Z7FE 1WXRA 2A4GA 5C3NA 1Z6JH 1O2GH 3QGNB 5HM9A 4ASHA 3KL6A 2BY9X 1UVPA 4TYDA 5DN6D 2A5IA 4A5TS 1CBWC 1GHWH 4B74A 2RA3A 1NESE 1RTKA 1TNIA 1P9UA 1XMNB 3PROA 2F43B 3ZZDA 1FLEE 1O3FA 8GCHF 5EXMA 1TNHA 4U32A 1HPGA 1HJ8A 1P3CA 1XKBC 4INLA 5JBAS 1IQIA 3ZVCA 2K8IA 3T5FH 5B6OA 2JJ1D 1GMDF 1PQ7A 1C4Y2 1SR5C 3ZZAA 3D23A 4RT0A 1QL7A 5FBIA 1HV7A 2VB0A 1JRTA 2F9OA 2GCHF 1RTLA 1YY3A 5GPIB 2SNWA 1BTZA 4NIXA 2PW8H 1GL1A 1OWKA 1QJ1B 4I8JA 3SZNA 5A0AE 1EPTA 2BTCE 3U8TH 1A5HA 1SGQE 1UTLM 4UE7H 2UWPA 2QXIA 2QIQA 1YF4A 1BOQA 2QY0B 1F5RA 1WTGH 3HGPA 3TH3H 1DM4B 1C5OH 1TRMA 4BOHA 3QK1A 1TWXB 3PTNA 3UNSA 2R2WU 1TGNA 3OTJE 1HAXB 2IOTA 2FS9A 3KNXA 4WWYA 5FBEA 4U2WA 1KDQB 3IG6B 3ZVFA 2TGAA 2M2AA 1GI5A 3L33A 2IPQX 2Y5FA 1WQSA 1BUIA 2SGAA 3RC6A 1JIRA 3TITA 4DIHH 1DFPA 4VGCB 1W7GH 3ZZ8A 2K0QA 3PO1C 1DUAA 3EE0B 1C1OA 1AY6H 1O2WA 4XDEA 7LPRA 3P92A 4E7NA 2J98A 3P17H 4AFSA 1FAKH 5DPAA 1RIWB 3KF2A 3TK6A 1LDTT 1RJXB 1S84A 2ODPA 3H7TA 3FAOA 2JIZD 4FUHA 3RXHA 2OC8A 5KEDA 3VGCC 3TNTA 2GMTB 3PWCA 1Z6EA 5T6FA 1KTTB 2DE8A 1A0JA 1NBME 2Z9JA 3ATLA 2FI4E 1MTUA 4FU7A 1P02A 1YKTA 3M5OA 1TRYA 4RKOB 1O2JA 2XRCA 5A8XA 2ZGHA 4CBNA 1P06A 2ZEBA 1P12E 4E06H 2XC0A 5TCAA 4KTUA 4WXVA 3SU6A 3E16B 4K2YA 3UQVA 3SV8A 2BQWB 1O3EA 1E37B 1GJ8B 2G81E 2Z9IA 2NU1E 3O8BA 2ZDVH 3U98H 5HXFA 2ZDMA 1G3BA 1O2LA 4XOJA 3V7TA 1S6FA 5EIYA 2J38A 1ARCA 2AH4X 4IN1A 4Y10E 3SJKA 1OS8A 3BIVH 3PTBA 4YOJA 3ZZ5A 1Y3XA 1DVAH 1ESBA 3KGPA 3MYWA 2PGBB 4YOIA 1YYY1 1SGCA 1O3LA 2TPIZ 2JETC 3KYGA 4D8NA 2IJD1 1LPZB 4DOQA 1J15A 1G2MA 2TGPZ 3F9HA 1O2NA 2ZPSA 3PMAB 1AD8H 1GMHG 2FZZA 5C2ZA 3DSGA 3H5CB 4K69A 5GCHG 2XC4A 1FQ3A 2HPQH 3ZZ6A 1C5YB 1ELTA 4ABFA 3M7QA 4B1TA 3C27B 4YT7H 7ESTE 1E79D 1GJCB 3HKJB 2VIQA 2P16A 4LK4A 4DT7B 1WOFA 4YESB 1K0HA 2SFAA 4X8SH 1WTHD 4K1SA 4JZIA 1Y3UA 2V3OH 4ISOA 1LHCH 1P2NA 1E38B 1DITH 4DT4A 3RLYH 4GPGA 1L0ZA 2FX4A 3SUEA 1BTHH 2BHGA 1FDPA 2BVRH 3OFND 4I8LA 3FZZA 1OP2A 3NXPA 1KIGH 4MPUA 2BDIA 1EOLA 4IC5A 1S82A 2VGCC 1D4PB 2Y6TA 4FXGH 1KLIH 1H4WA 1XUGA 1QNJA 1DOJA 3SBKA 5F53A 1DLEA 2NU2E 1DWDH 4ZXXH 3SJ9A 1KY9A 1O2TA 1TPSA 3FP7E 1G30B 1FY8E 2BLQA 5T3HA 3KIDU 3BV9B 2CHAC 3CS7A 2FYRA 4DCDA 2CHAB 3WWFA 4Q7YA 2OK5A 1S5SA 1H8ED 1PQ5A 4GVUA 1O32A 2GCHG 2TBSA 4IMQA 5HIZA 2Z9GA 1FIWA 1P57B 1D3TB 3MOCA 3MU8A 4HI3A 2FOFA 2XXLA 3OAAD 4Z1MD 3F2HA 3UB0A 5EQQA 2GX4A 4VGCC 1C5MD 5LPFA 1NM6A 1F0RA 4ABDA 5FX6A 3Q77A 3GDVA 4INHA 1THRH 3VB5A 2WZQA 1YC0A 3KQ5A 2V6NA 3EA7A 1AB9C 5ESBA 3UOPA 1XUKA 2ZG0H 4BAOB 2YMSD 4XE4A 3SO3A 4BAKB 1O3NA 1W0ZU 4ABJA 3ZZ4A 5JBBS 3RDZA 1GBCA 1RTFB 3QGJA 4BTUB 1EAIA 3STIA 2UUJB 4CR5A 1TLDA 4Y8XA 3V12A 2ANMH 4X6OA 3BEUA 1ZTKA 2GMTC 1EQ9A 1DY9A 1ESAA 5FHTA 3EQ0H 1NU7B 1TGBA 1TX8A 2A2XH 2KAIA 1MMJN 4X8UH 2QC2A 1MTSA 1XKAC 4NA8A 4Y11E 1SI5H 2ANYA 4FUCA 3OEHD 2GV6A 5PTPA 1YLNA 3SNEA 3A87A 4DG4A 4BNRA 4B2CA 4HG6A 3JZ1B 3G01A 3EDXB 4O97A 4Q4LA 1C1NA 2W7SA 1CHOF 3BTME 3QN7A 1TE0A 1SGTA 3LGUA 1C9PA 4GSOA 3RU4T 1AKSB 1N6YA 1MTVA 1NFYA 3ATMA 1WV7H 2FOHA 4DVAU 2BOKA 3T62A 3AW0A 1HYLA 2H9HA 4JYVH 3TK5A 1TPAE 1EPTB 1N1LA 5CHAC 4YLQH 3A89A 1LCYA 1C1SA 1C2FA 3SI3H 1OX1A 2Y82A 3ZVEA 1QBNA 1AQ7A 1BB0B 1TNKA 1Y5BT 2XBWA 2ZQ2A 4IS5A 2BD7A 1PFXC 1BTWA 1ANDA 2B5TB 1CU1A 5TJXA 2QF5A 1UMAH 4GLYA 2ZU5A 5EXNA 2FOBA 2XWBI 3Q76A 1DANH 3SJOA 1DSUA 1O5CB 5G4BA 1LKAA 1GVLA 1AO5A 1H8HD 4ZUHA 1W13U 3T2NA 3N7EA 3UREA 4GHQA 2FWWA 3ZVAA 3MI4A 1VJ9U 1FV9A 3CP7A 5J4QA 2BVXH 3PB1E 1ZMLA 1T31A 3A7ZA 3ZZCA 3OY6U 4Y76A 4K8BA 5F03A 2GT7A 1BRAA 2WUCA 3MH7A 2Z3DA 5E2OA 4CRGA 2ASUB 1GJ4H 1HAOH 3MNXA 4BTIB 2R2MB 1AZ8A 3A8AA 3PM3A 4MPVA 2GDDA 1IAUA 1J17T 1LVYA 1TPOA 3PWBA 1SKYE 1DXWA 3SU5A 3MHWU 3LONA 4K1EA 2A4QA 2GV7A 1GJ9B 2AGEX 4ZKSU 1LHDH 1C5RA 1NTPA 1S0QA 5C20A 1EATA 1ELBA 4MTBA 1IQMA 5JBCS 1K1IA 1PYTC 2V3MA 2G55A 1HBTH 1B0FA 1GJDB 1P3EA 4E7RG 3U69H 1UK4A 3ZV8A 5DSFA 4Q7XA 5H4IB 1WU1A 3RM2H 5CHBA 1GHYH 4X6PA 1Y3WA 3K6ZA 5GIBA 3ATIA 1GBAA 4K3JA 4INKA 5GWZA 1O30A 1G9IE 3MO3A 4WY3A 5E0HA 1TA6A 5HIYA 1EJMA 3VB3A 2C8XB 1T8MA 4JZ1A 1NRSH 3TJVA 2G5NA 1MH0A 4RSPA 3GY3A 3FP8E 2P3UB 1ZSLA 4FVDA 2OTVA 4XBCA 2IN2A 1P9SA 3ZVDA 3VB7A 3RMMH 1AIXH 3TGKE 3U1IB 1UVTH 1LQEA 1YLDA 4P02A 3BN9A 1MCTA 4TPIZ 2P93A 4O9VA 2QCYA 1V2VT 4I32A 3A86A 1AUTC 3HGNA 3RXUA 4D9QA 1MZAA 1BTXA 1EAWA 4DJZB 2OCVB 1IQEA 2PSYA 3SQHE 4YTAA 3RXKA 1CA0C 3F2GA 3SV9A 1MD7A 2FTMA 4RKJB 1VGCC 1XM1A 4Q7ZA 1ANBA 1C2HA 4SGAE 1WYKA 4NA7A 4JMYA 4XFQA 4X1QU 4SGBE 3R0FA 4Y7BA 3KYFA 2JH5D 5FAHA 1TABE 2OBQA 1P2MA 4X2VA 1O37A 3GYLB 2P3FH 3UWJH 1V2PT 2TGTA 3RXSA 1XXDA 2LP6A 1MZDA 2OLGA 4NGAH 3MH4A 1DXPA 2G4UA 1SGEE 3SUDA 1SLXB 3RXGA 3U8RH 1UK2A 1V2OT 1ZRBA 4ABEA 1ETTH 1BTUA 2AEIH 1KYNA 5FCKA 1HXFH 1KXDA 1SLUB 1FN6A 4CRDA 1O2QA 4X6NA 1NN6A 4TSFD 3OE7D 1O3CA 2XBXA 1GJ6A 1FY4A 1V2RT 1O39A 5I46H 1KXEA 1Z8GA 2R3YA 4DW2U 1EOJA 4WXIA 5DP4A 2QXJA 5LH8A 1GI8B 1G37A 1O3BA 1SGFG 1SHYA 2PSXA 2W3IA 3V3MA 1GCTB 1BCUH 2JKHA 4OM9A 3NRLA 1SGYE 4AX9H 3FO8D 1SMFE 2GZ8A 3MNBA 1ZMNA 2OBOA 1YPLH 3E90B 2XCNA 4A6LA 1W7XH 1CVWH 2LELA 3ZVBA 1E34B 1TONA 2PKSB 4B2AA 1V6DA 1Z8IB 4BXSA 1FY3A 2V3HH 1CA0B 2ZFRH 1FONA 1SHHB 1SQOA 1HUTH 3PLPA 1EJAA 5CHAB 4ABAA 1GMDG 3GYMA 5L2YH 1O2OA 2O9QA 1HNEE 5EODA 1EASA 3RXVA 4UDWH 4ACAA 2HOBA 1ZOMA 1ZSKA 3GOVB 1EXFA 3BEIB 3F3BA 1UTQA 2OC7A 1OP8A 1O3KA 1WDIA 2FXRA 3QZQA 1ELDE 1IHSH 3LPRA 1ARBA 1ANEA 3ZYEA 3NCLA 4WVPE 3GY2A 3JZ2B 4KKDA 5BRRE 1UVSH 1IQHA 5A0CA 1HAVA 1KXCA 3SORA 4X2WA 3UIRA 3KN2A 2B9LA 1O2PA 4WF8A 3DHKH 4WMFA 2GZ9A 1AFQB 5T1VA 2ZHEH 2F9NA 1RGQA 4NZQA 1SGIB 5EXLA 4Y79A 1EZQA 1MQ6A 1QQUA 1XUJA 2C8WB 1K1NA 2KZ4A 1GBDA 3M35A 1C5SA 1AZZA 2BMGB 1OXGA 1UCYK 2QN5T 1GCTC 3L3TA 2KR7A 1OPHB 7GCHG 1YPGH 4NIYA 1HGTH 4P00A 4TT3D 1YWUA 5AF9H 4B76A 2XCFA 4MPXA 1F0SA 2AIQA 3BG4C 1PQAA 4I8GA 2M5TA 3TJOA 1A5GH 4TWWA 5SGAE 4X8TH 2PKSC 5K0HA 2KCYA 3TIUA 4X1NU 1YCPM 4ZROA 2CMYA 4BAMB 1GBMA 1GMCG 2GDEH 3N7OA 4OGXA 2QV1A 5C17A 3MWIU 3MU1A 1FUJA 1AE8H 2P3TB 2A32A 1C1VH 1TQ0B 2BDCA 2ZFSA 3RC5A 1S81A 1ABJH 3HK6B 4O3UA 1EB1H 2XYAA 5E0GA 2BY6X 2VBCA 3DCLA 3BIUH 1ZPZA 1GVKB 1BMFD 2ILNA 2A4RA 3PV2A 4KELA 3T28A 2THFB 2C90B 1W0JD 3PV4A 1BBRE 1F0TA 3MNCA 2BXTH 1C1TA 1INCA 5DJ7A 4RI0A 1NFUA 2JETB 2A31A 2OP9A 1V2JT 1ORFA 2BDBA 2ZQ1A 3BF6H 4ZH8A 2NU3E 2A7CA 2J92A 2ZHWH 4NWLA 1Y8TA 2W7UA 4RT1A 2EA3A 1ZHPA 4MG3A 4ABIA 2G52A 1J9CH 1O2XA 1CSOE 2P8OC 2OQ5A 1K1LA 3SHAH 1V2MT 4NG9H 3RXCA 2XC5A 1UTKA 4X1SU 2P95A 2ZNKH 4X8VH 1O35A 1CO7E 1J14A 2EC9H 4R0IA 5FXLA 2CXVA 3M3SA 1LPGB 3FVFB 1DPOA 5DP9A 1QFKH 4JYUH 2FOMB 2B0FA 3GCNA 1CT4E 1A1RA 3BEFB 3Q00A 2BD8A 3SU2A 1GI7B 1A4WH 1P2KA 1COWD 1O5EH 4ZHAA 2WPJS 2ZCHP 2QF3A 3N7DA 1BJVA 2WV9A 2EI8A 1CGHA 4A1XA 4AB9A 2J98B 4CR9A 1TOCB 3QWCH 4FUFA 5EPYA 1D3DB 1KXBA 1C5PA 1S0RA 4X1RU 3SV2H 2VH6A 2ZWLH 4BTTB 3K65B 1TMBH 3GCOA 4O03A 4CH2B 3VB6A 1QGFA 4XBBA 1GGDC 4FU8A 1TALA 2VIDA 4ZMAH 1BMLA 4ABBA 3Q3KA 1GJ5H 1MKWH 2FP7B 3E0NB 2VIPA 2ZHFH 3BTQE 1LPKB 1O31A 1FN8A 4IC6A 1SB1H 1AFEH 1IQLA 2OD3B 5DP3A 2WPKS 1EPTC 2FLRH 2D1JA 1F2SE 4R8TB 2Y5GA 4IN2A 5A0BA 1HB0B 2AYWA 3SV6A 3BTTE 2R3UA 1NBMD 3W95A 4ZCNA 3A8BA 1Z71A 1V2TT 4F49A 1MKXK 3GCHC 1C1UH 1P04A 4M9FA 1C4U2 2VVVA 3AAVA 1T7CA 1XX9A 1H9LB 1K2I1 3PMHB 4D7GA 3ZZBA 3VXFH 1DWBH 1C4V2 2D26C 2SGEE 1QHRB 2ZDNA 1H9IE 1O2IA 1H8DH 2AMQA 3ODDA 3TGIE 4HZHA 9ESTA 1Q31A 3A7VA 5EQRA 1WUNH 2KCAA 5FX5A 1LVMA 2A4OA 1BMNH 1O33A 1C5UA 1K1OA 1GBFA 1GHXH 1VCWA 1YM0A 3STJA 1W0KD 3PYHA 2J95A 3M7UA 1C5LH 2VGCB 2L74A 1W0YH 2ZCLP 4M7GA 3F9GA 3AVZA 2PTNA 5IK2D 1UCYE 1GDUA 3A8DA 2BZ6H 3UUZA 2B7DH 1THPB 2GJGA 1T8OA 4MNVA 1GBJA 1O2YA 2ZU3A 5B6LA 3UFAA 1W2KH 3SNCA 3TJNA 1EZSC 1XXFA 1P2JA 1V2NT 1GJBB 3LKWA 5C1YA 2J9NA 5KECA 3SUGA 5ESTE 1O3GA 1H1BA 3ZV9A 2XBYA 2AMDA 5AFZH 1M9UA 1GBBA 1ZHMA 1O2RA 3NZIA 2WPLS 3RXAA 5F8TA 5HKKD 2BQ7B 1O5DH 1ELVA 2NWNA 1BDAA 1Z8JB 1BTPA 4K60A 1O36A 3AASA 1QTFA 1SG8B 3QTOH 1Y5AT 2V0BA 3PRDA 3M3VA 3U28C 1TQ7B 1TMUH 4ABGA 4CH8B 3ESTA 5T6DA 1NZQH 1ZHRA 3F68H 3P8OA 2ZCKP 2L6OA 4E05H 3TVJB 5JPMH 1HDTH 1O3JA 3RMOH 2EY4C 1PPGE 9LPRA 4TY7A 4GAWA 1TGCA 3MMGA 2CGAA 5DP7A 3QO6A 5GCHF 3KHVA 3F0OA 3PRBA 1TX7A 4UFGH 1YPHC 2W6ID 2WPIS 2YNBA 1AWFH 1F92A 1NRRH 1TBRH 2O8WA 4D7FA 1C2DA 1W10U 2EI6A 5A09A 1KTSB 2CF9H 3RP2A 3KQDA 2O8LA 2BM2A 1VGCB 2FDAA 1FAXA 1WCZA 3BTEE 5DP5A 3M36A 3S69A 5JB9S 2A0QB 1ELGA 1OWJA 1TX6A 2QYIA 3MNSA 3A80A 4NFFA 1W11U 2ZGJA 4NIVA 2ANWA 1GGDB 1MKWK 5C0UA 1GVZA 2QF0A 2ZHDA 5E2PA 1D6WA 1ACBE 2HNTF 3P8GA 3SU4A 2RDEA 2BD4A 3RXQA 3LGYA 4GHTA 4BXWA 2LNCA 1E0FD 2KFWA 3MO6A 1QB9A 5GXPA 1MTNC 1D3PB 3SHCH 1CT0E 1AFQC 1QIXB 2BDHA 1W12U 3M37A 3RLWH 2FOAA 4JZEH 4WMEA 1DX5M 3LT3A 4NSVA 2F9BH 5DP8A 3T26A 1L2EA 3PLKA 3QDZB 4UD9H 1RS0A 2F9UA 1EAXA 2BX3A 1NO9H 3B9FH 3MH6A 2HWLB 3QLPH 2CJIA 7KMEH 3F2FA 5AVDA 3TLOA 2BLOA 1TAWA 3E0PB 3K9XB 4AZ2B 1G3DA 1QA7A 1XUHA 3SJ8A 1CT2E 1CGIE 1O2SA 1YCPK 1BQYA 4MLFB 1SBWA 3ZZ7A 1LVOA 3BG4B 1HJ9A 2A1DB 4LOYH 2BXUH 2NU0E 3SU0A 1GBHA 1MUEB 5DKMA 2WUBA 1EUFA 1NU9A 1BRUP 1A0HB 4IGDA 2C8YB 1GG6C 4NWKA 4HGCA 3RXOA 1CE5A 2A45B 1O3HA 1NROH 2HGTH 2XNDD 3OTPA 2WHXA 3RXLA 3SUFA 1S6LA 1DDJA 4OS7A 1DY8A 4HFPB 2QF4A 4MVNA 4D76A 4MNWA 1VITG 5DG6A 2BZAA 5GNDA 3T25A 1GI4A 1DE7H 3RXDA 2HLDD 2PHBA 2GZ7A 4I8KA 3U9AH 1TNJA 3WY8A 5CDFE 4B73A 2VWLA 5C67A 4MPWA 2BX4A 1SFIA 3LGVA 1SGNE 1GCDA 1UJ1A 5C5NA 3LC3A 1AWHB 1K22H 4Q63A 2Z3EA 5EW2H 4AFUA 3V13A 2SGDE 2WYJA 1MU8B 2O8TA 5DP6A 4NCYA 4XSKU 4A92A 1A3EH 1HAIH 1GHAF 3P6ZB 2JDID 4I33A 3VGCB 4OS4A 2Y7ZA 1QRXA 1LVBA 1SQAA 3F9FA 1ZJKA 1ETSH 1YGCH 1F5LA 3S0NA 1GBLA 5C1UA 6CHAB 1BBRH 4CRCA 3MU0A 1EP5A 1ZTJA 2BD3A 3HK3B 3ELAH 4AGKA 4WH8A 3GY6A 1Y5UT 3MH5A 1ZJDA 2HRVA 3NUMA 3SW2B 2VVUA 2P59A 1AKSA 2H6MA 1NFWA 4DY7B 2PR3A 3RXMA 2Q6DA 4PROA 5F8ZA 4ZKRU 1IQNA 1XUFA 4UEHH 3LGTA 1EKBB 1CA8B 1E1RD 1QQ4A 4ABHA 2ZZUH 3SV7A 1K1MA 3P8FA 4J1YA 1YPJH 5FL7D 3GDUA 1VCQA 2FI3E 4AOQA 1GI9B 4Y0YE 2B8OH 1ZGIA 1ZR0A 2F83A 5EG4A 3BTHE 4ZKNU 1PPCE 2ZI2H 8LPRA 1KLJH 1TGTA 1G36A 1L1GA 4RN6A 4JZDH 1ZTLA 4TWYA 2ZGBH 3A7XA 2ZP0H 5L30H 1SGRE 4WMDA 2VVCA 1MABB 3ZYDA 2WYGA 3FFGA 1JWTA 5DK1A 3GY8A 4GCHG 1UTOA 2GVFA 4DURA 3P70B 8KME2 2ZGCA 1BITA 1P01A 2UWOA 2GKVE 1YPMH 2JH6D 4CBOA 4UONA 4U30A 3O8CA 3E6PH 2PUQH 3LH3A 2BD5A 2KX4A 1EAUA 1Z7KA 1A7SA 1NRQH 1O3IA 1MAYA 4WH6A 2BYAX 1UK3A 3FP6E 1HXEH 3EGKH 3F6UH 1MKXH 4O3TA 4Q2KA 1O2UA 4JYTA 3IITA 6CHAC 1L1JA 1TNLA 1NFXA 3BTDE 2ODQA 1K21H 2AS9A 1QBVH 1OOKB 1KXAA 2FOEA 2ZU1A 3H7OA 4AYYB 2BY5X 5C0TA 1E1QD 4X6MA 3MO9A 4TPYA 3VFEA 2ZPQA 5LPEA 1THSH 1Z1IA 2RG3A 4AG1A 3GY5A 2W26A 1TBZH 2Q1JA 1VCPA 2FM2A 4TY6A 3FOAA 1LQDB 2HPPH 2SGQE 2C93B 4I86A 3SZEA 2F9PA 2F9VA 2NU4E 3WW7A 2AHME 2ODYB 3KCGH 4B71A 4AORA 4CHAC 4MQAA 3RXTA 1C1WH 3A7WA 4Y8ZA 1L1NA 1S83A 2DUCA 4ACBA 4YXWD 2YMSB 1HAVB 4Y7AA 4ZHMU 1BHXF 2Z6BD 4WJG2 1GHVH 4JCNA 4H4FA 2KM0A 1N8OC 1AVGH 4UFEH 1GHBG 3L6PA 4MDSA 1P11E 2HVXA 3PMBB 2EQNA 2STBE 4OS5A 1BTYA 5DO4H 1GI1A 1V2QT 3TJUA 1P2QA 1BBRK 2BY7X 1QB6A 3RXFA 3URDA 3SU1A 4LZ4B 1GG6B 1TYNA 1C5TA 4YOGA 5EU8A 4BAQB 3LGIA 1O3PB 5L6NH 2GCTC 3NWUA 2G00A 1TIOA 1TFXA 5AHGH 1RIWC 3LGWA 3EAJA 8GCHG 3AW1A 2HNTE 2BOHB 1ZSJA 1ELFA 2J94A 2WPMS 3GCHB 3D49H 5ABWA 1T32A 1O3MA 5IYTA 1LKBA 1QRZA 3ENSB 1O5AB 1SGDE 3AK5A 3DSOA 1DWEH 1UO6A 3GICB 1C5XB 3RXPA 2O8UA 4IW4E 4OS2A 2H2ZA 5CMXH 2ZIQH 3RM0H 1CBWB 3DT0H 1RRKA 1SL3A 2VH0A 2Z94A 1GDQA 1O3DA 4UFDH 1VITF 3UQOA 1O38A 1GMCF 1HAGE 2FOGA 3BSQA 4GUXA 1BZXE 1ZYOA 2Y5HA 1Y3VA 1O5GH 2EI7A 1O2MA 3BTFE 3VB4A 1S85A 3M5LA 1C9TA 1YPKH 1QL8A 2C8ZB 3SNAA 1HRTH 1MBQA 4Y8YA 1GDNA 4FUIA 1J8AA 2J34A 5EQSA 4JZFH 1UHBB 2H5CA 2P8OB 2AGIX 3EA9A 1SLVB 2HVYB 3LDXH 1GBKA 2TIOA 4ISHH 2P94A 4IBLH 3Q3YA 5FPYA 1HAYB 4I7YH 2IJOB 2SNVA 2Y7XA 3QTVH 3RMLH 3U8OH 4ZKOU 4H6TA 1IQKA 1HFDA 1WAYB 2VU8E 3A82A 1DWCH 3GCTG 1GI6A 2HLCA 3MQKC 1SQRA 1K28D 4KGAA 1IQGA 1V3XA 3HKIB 1SOZA 1G2LA 1U6QA 4H6SB 2GT8A 3CS0A 2RCEA 1WSSH 2ULLA 1H8IH 3ATKA 1LMWB 3URCA 1UTJA 1ZRKA 4BAHB 1A3BH 2JJ2D 3HPTB 1V2ST 1B5GH 1DS2E 2ZTXA 4JK5A 3UNQA 4FUGA 1IQFA 4YM9A 1ZGVA 2V7QD 2VWOA 1O2ZA 2WPHS 2H1UA 1UCYH 2R9PA 1A5IA 3HATH 3UR6A 5FPSA 4B75A 4GCHF 1AB9B 1F7ZA 5JYIA 1SLWB 2STAE 2GGVB 3A7YA 5EOKA 3O8DA 5CE1A 2Z9KA 1YPHE 2OXSA 3SGQE 3LC5A 1HJAB 1WQVH 3A7TA 2PWXA 3PO1B 1A0LA 4YT6H 1H9HE 1UTMA 1T4VH 1N6XA 3KQBA 3DD2H 1P03A 4AGJA 2VIOA 1OHHD 1V2KT 2PUXB 2ZKSA 3H09A 1FJSA 1O2HA 1FI8A 1ZMJA 8ESTE 1GI0A 1NRNH 2G5VA 1MD8A 3Q3XA 3NKKA 1ID5H 1PPFE 3LU9B 2A5KA 1BJUA 4X1PU 3GY7A 4FUEA 1RD3B 2FI5E 2VINA 1L4DA 1W14U 4NFEA 2XOKD 5AFYH 1UTNA 1EZXC 2FS8A 2Y81A 3A84A 1OWEA 2F4LA 1P10A 4CRBA 5A8YA 2Q6FA 1F0UA 2PFEA 1XUIA 3FZDA 1FZZA 1HCGA 4OS1A 1Y59T 1TBQH 3M3TA 3R3GB 2G51A 3CENA 3U1JB 2QAAA 1O34A 1Q2WA 6ESTA 1A46H 1MBMA 1K1PA 3GY4A 3ODFA 2DE9A 3F1SB 5EJ1A 1UHBA 1EX3A 4X0WU 2ALVA 1FY1A 3DSPA 3UWIA 5EGMA 3T27A 1BMAA 1MTWA 2C4FH 2PGQB 1GBIA 2VIVA 3BG8A 3NK8A 3M7TA 3M5MA 1NY22 5C94A 2XBVA 2W5EA 3IWMA 1ANCA 4B6EA 2PTCE 1EZUC 3MTYA 2BLVA 3RU4E 2BY8X 1FPCH 1O2KA 2YNAA 2ZU4A 1QJ6B 2OINA 1HJAC 3BTWE 4K1TA 3DFLA 1GMHF 3TU7H 2CN0H 3T29A 1ELAA 1GJ7B 1EP6A 2BVSH 5EW1H 1ZLRA 4Z0KA 1MQ5A 3ZZ9A 4DGJA 1VZQH 4NIWA 4Q80A 2PKAA 1JOUB 1AN1E 4FU9A 3W94A 1Z8RA 1FY5A 2FODA 3AAUA 3NPSA 5JB8S 1D3QB 3BTGE 1X7AC 1B0EA 2A5AA 2FLBH 3B23B 3M5NA 4MNXA 1W8BH 4H42U 3PMJA 2XNIA 2J2UA 5EJZA 1O3AA 1PQ8A 3SQEE 1LHFH 1BA8B 2BDYA 1CGJE 5A2MH 3TH4H 2QA9E 1BHXB 2ZDAH 2KCOA 1ZPBA 2UUFB 2WSSD 2Z9LA 1OWIA 1TOMH 3RUOA 4JK6A 1SGPE 2PLXA 2CK3D 1C2KA 1C1QA 2G4TA 1QRWA 3K2UA 2BDGA 1SVPA 2A7JA 1ZZZA 4A1VA 1HAPH 3OY5U 5HM2A 4CHAB 3D65E 5J4SA 3FN8A 4AFZA 1O5BB 2AERH 1ZPCA 4ESTE 7GCHF 1E35B 2ZA5A 1IQJA 3E91A 2YOLA 4XD7D 3A8CA 2Z3CA 1LTOA 1V2LT 1QB1A 2ZTZA 1O2VA 2Y80A 1SGFA 3LOXA 2ESTE 1BT7A 4KTCA 1EB2A 1OKXA 1PJPA 4OS6A 3TH2H 4F4OC 1QBOA 2GD4B 3A85A 3V0XA 5LGOA 3SGAE 2FO9A 3DA9B 1FPHH 1JRSA 1Q3XA 3RC4A 3TPIZ 1HIAA 1BMMH 6GCHG 2AMPA 5FCRA 5LPRA 2AIPA 1ELEE 1NPMA 1CQQA 4ZXYH 4MNYA 2UUYA 3ATWA 1NC6A 4FUJA 1ETRH 3P95A 3SI4H 3GISB 1C5QA 4DIIH 1DT2A 4KP0A 3M61U 2ZFQH 1MTNB 4YZUA 1C2LA 2FX6A 3ZIAD 1C5ZB 4ZHLU 1FIZA 5HGGA 3E8LA 3GDSA 4LZ1H 2A2QH 1DICA 1XVMA 4CRFA 3SNDA 3CNRA 2ZGXH 2W3KA 4XBDA 4F55A 4FUBA 1SPJA 6GCHF 5E8EH 1C5VA 1GBTA 1LHGH 1NS3A 4THNH 2G8TA 1HAZB 1O3OA 1LHEH 1V2UT 2HALA 3EE7A 1D6RA 1SC8U 4YO9A 2CV3A 3WWBA 1QY6A 4ISLA 1FXYA 1NRPH 1YCPH 1GI3A 3S9CA 4A7IB 1T8LA 2ZPRA 1OSSA 1YP9A 2FIRH 1QZ8A 1GHAG 2ZFPH 1TGSZ 1A2CH 3K6YA 4BANB 3TGJE 1FNIA 3OSYA 4X2YA 1JBUH 3MFJA 2H5DA 1T8NA 4FVBA 5F8XA 3UY9A 4AC9A 3RXRA 5KGOA 3F0PA 2YMSC 1AVWA 1IHTH 3I77A 1RFNA 4UFFH 3VEQB 3P8NA 1LO6A 4Z6AH 3QUMP 1P2OA 2BQ6B 3SGBE 2C3SA 3MU4A 1AHTH 4Y0ZE 1AI8H 1PPZA 4QT8C 2ZHQH 3FANA 3OEED 3S9AA 2QXGA 1C2EA 4NZLA 3KQEA 1SFQB 3GCTF 3QZRA 1UW7A 1C2JA 2RDLA 2AGGX 2FTLE 5EJLA 2ZDLA 3A88A 1C5NH 2WPDD 1AE5A 1SOTA 1DUEA 2O8MA 2OUAA 5TCCA 1QCPA 1MU6B 5IDKA 3UPEA 1L4ZA 1KXFA 3TNSA 2FESH 4HTCH 2FOCA 4OGYA 2FMJA 2J4IA 5L2ZH 1QA0A 1QL9A 4FUDA 1VJAU 1C1MA 2ZU2A 2CF8H 4I8HA 1O5FH 2OQUA 1BIOA 4B2BA 3UNRA 3KQCA 3ZVGA 4B6FA 1TA2A 1QJ7B 4K5ZA 3SU3A 1B7XB 5HYOA 1OWDA 2ANKH 1BRCE 4CRAA 5HMAA 2VWNA 2BD9A 1Z1JA 2F91A 3SYJA 1KLTA 3E1XB 1K9OE 1MCVA 1FMGA 5E0JA 1G3CA 5DGJA 2VWMA 2ZFTA 3C1KA 1VKYA 1QURH 5BPEA 1KMHB 1KSNA 2ZC9H 2ZFFH 5JDUB 1YPEH 2BDAA 2PKAB 5GJ4B 3BTKE 1TNGA 1AMHA 1P05A 2W6JD 2R0KA 2GTBA 2I6QA 5GDSH 2V35A 3RU4D 3TK9A 3S9BA 2EEKA 1PPEE 1TPPA 5F6MA 2XWAA 4X2XA 3LJJA 2H9TH 3PLBA 3UR9A 3SOSA 1TRNA 1J16A 1AGJA 1OP0A 1PYTD 1OWHA 3VXEH 4IMZA 2K1QA 1C2MA 3EYDA 2VNTA 2ZECA 2QXHA 3A83A 1YBWA 2RFKC 2TRMA 4XRNA 5FPTA 3F9EA 1GWAA 5C1XA 2FYQA 1YLCA 3B8JA 1T4UH 1Y3YA 3QX5H 1GBEA 5A8ZA 4NSYA 1JIMA 2R0LA 1HIAB 2FPZA 3O8RA 1UVUH 3S7KB 2TGDA 1ESTA 3W1EA 4ISIH 3UTUH 4AB8A 2GCTB 1C1RA 1DLKB 1PPHE 1HLTH 1QR3E 1ELCA 1VITH 2OC0A 3GS9A 1NT1A 3KEEA 4KTSA 2RA0A 6LPRA 2D8WA 4F48B 1DSTA 5EPNA 2J97A 1P0SH 2OC1A
chains in the Genus database with same CATH topology
1V2WT 3DFJA 1E36B 4ZAEA 2GP9B 2F3CE 1S6HA 3RMNH 1GL0E 3LIWA 4A1TA 1MAXA 2H9EH 4AN7A 2AFQB 2ZDKA 3I29A 3MU5A 1GJAB 3A81A 3OX7U 1TMTH 3RXEA 2QGRA 2SGFE 4K8YA 4NA9H 1F5KU 3ZZ3A 2BLWA 2D2DA 4D9RA 4YLUA 2A7HA 2IPHA 1G32B 1C5WB 1C2GA 1KDQA 3SJIA 5I25A 3SNBA 1CHGA 2I6SA 2WV5A 3RXJA 1VR1H 2WINI 1BRBE 1AUJA 1W3CA 5JBTA 1SSXA 2ALPA 4J2YB 2UWLA 3DUXH 1GI2A 3LJOA 1TB6H 3S7HB 1GHBF 4I31A 1P09A 1UVOA 2BD2A 5T6GA 2ZF0H 1D9IA 1UTPA 1EJNA 4ISNA 5ETXA 1C2IA 3ITIA 1ABIH 2VJ1A 3LH1A 2ZO3H 2Q6GA 4AFQA 1G3EA 1SQTA 3OU0A 1C1PA 2SGPE 2HNTC 3RXBA 4AG2A 4Y71A 2KAIB 2LPRA 1CHOG 1WBGB 2WV4A 2XTTB 3RXIA 4U01A 3UOUA 1OYTH 4AYVB 3OYPA 5K7RA 2FEQH 2VIWA 3EA8A 2PV9B 2JH0D 1JXPA 3I78A 1GHZA 2ZTYA 1N8OB 1PPBH 1XVOA 1RXPA 2XW9A 3VPKA 1O0DH 3D62A 1AVXA 1IOEA 3E3TA 1P2IA 4LXBH 2BB4A 1P8VC 1JMOH 1K1JA 1AU8A 5C5OA 1A61H 1HAHH 2UUKB 4Y6DA 1GPZA 4CREA 1OYQA 3SN8A 2Z7FE 2A4GA 5C3NA 1Z6JH 1O2GH 3QGNB 5HM9A 4ASHA 3KL6A 2BY9X 1UVPA 4TYDA 2A5IA 4A5TS 1CBWC 1GHWH 4B74A 2RA3A 1NESE 1RTKA 1TNIA 1P9UA 1XMNB 3PROA 3ZZDA 1FLEE 1O3FA 8GCHF 5EXMA 1TNHA 4U32A 1HPGA 1HJ8A 1P3CA 1XKBC 4INLA 5JBAS 1IQIA 3ZVCA 3T5FH 5B6OA 1GMDF 1PQ7A 1C4Y2 1SR5C 3ZZAA 3D23A 1QL7A 5FBIA 1HV7A 2VB0A 1JRTA 2F9OA 2GCHF 1RTLA 5GPIB 2SNWA 1BTZA 4NIXA 2PW8H 1GL1A 1OWKA 1QJ1B 4I8JA 3SZNA 5A0AE 1EPTA 2BTCE 3U8TH 1A5HA 1SGQE 1UTLM 4UE7H 2UWPA 2QXIA 2QIQA 1YF4A 1BOQA 2QY0B 1F5RA 1WTGH 3HGPA 3TH3H 1DM4B 1C5OH 1TRMA 4BOHA 3QK1A 1TWXB 3PTNA 3UNSA 2R2WU 1TGNA 3OTJE 1HAXB 2IOTA 2FS9A 3KNXA 4WWYA 5FBEA 4U2WA 1KDQB 3IG6B 3ZVFA 2TGAA 3L33A 1GI5A 2Y5FA 1WQSA 1BUIA 2SGAA 3RC6A 1JIRA 3TITA 4DIHH 1DFPA 4VGCB 1W7GH 3ZZ8A 3PO1C 1DUAA 3EE0B 1C1OA 1AY6H 1O2WA 4XDEA 7LPRA 3P92A 4E7NA 3P17H 4AFSA 1FAKH 5DPAA 1RIWB 3KF2A 3TK6A 1LDTT 1RJXB 1S84A 2ODPA 3H7TA 3FAOA 4FUHA 3RXHA 2OC8A 3VGCC 3TNTA 2GMTB 3PWCA 1Z6EA 5T6FA 1KTTB 2DE8A 1A0JA 2Z9JA 3ATLA 2FI4E 1MTUA 4FU7A 1P02A 1YKTA 3M5OA 1TRYA 4RKOB 1O2JA 2XRCA 5A8XA 2ZGHA 4CBNA 1P06A 2ZEBA 1P12E 4E06H 2XC0A 5TCAA 4KTUA 4WXVA 3SU6A 3E16B 4K2YA 3UQVA 3SV8A 2BQWB 1O3EA 1E37B 1GJ8B 2G81E 2Z9IA 2NU1E 3O8BA 2ZDVH 3U98H 5HXFA 2ZDMA 1G3BA 1O2LA 4XOJA 3V7TA 1S6FA 2J38A 1ARCA 2AH4X 4IN1A 4Y10E 3SJKA 1OS8A 3BIVH 3PTBA 4YOJA 3ZZ5A 1Y3XA 1DVAH 1ESBA 3KGPA 3MYWA 2PGBB 4YOIA 1YYY1 1SGCA 1O3LA 2TPIZ 2JETC 4D8NA 1LPZB 4DOQA 1J15A 1G2MA 2TGPZ 3F9HA 1O2NA 2ZPSA 3PMAB 1AD8H 1GMHG 2FZZA 5C2ZA 3H5CB 4K69A 5GCHG 2XC4A 1FQ3A 2HPQH 3ZZ6A 1C5YB 1ELTA 4ABFA 3M7QA 4B1TA 3C27B 4YT7H 7ESTE 1GJCB 3HKJB 2VIQA 2P16A 4LK4A 4DT7B 1WOFA 4YESB 2SFAA 4X8SH 1WTHD 4K1SA 4JZIA 1Y3UA 2V3OH 4ISOA 1LHCH 1P2NA 1E38B 1DITH 3RLYH 4GPGA 1L0ZA 2FX4A 3SUEA 1BTHH 2BHGA 1FDPA 2BVRH 4I8LA 3FZZA 1OP2A 3NXPA 1KIGH 4MPUA 2BDIA 1EOLA 4IC5A 1S82A 2Y6TA 1D4PB 2VGCC 4FXGH 1KLIH 1H4WA 1XUGA 1QNJA 1DOJA 3SBKA 1DLEA 2NU2E 1DWDH 4ZXXH 3SJ9A 1KY9A 1O2TA 1TPSA 3FP7E 1G30B 1FY8E 2BLQA 5T3HA 3KIDU 3BV9B 2CHAC 3CS7A 2FYRA 4DCDA 2CHAB 4Q7YA 1S5SA 1PQ5A 4GVUA 1O32A 2GCHG 2TBSA 4IMQA 2Z9GA 1FIWA 1P57B 1D3TB 3MOCA 3MU8A 4HI3A 2FOFA 2XXLA 5EQQA 2GX4A 4VGCC 1C5MD 5LPFA 1NM6A 1F0RA 4ABDA 5FX6A 3Q77A 3GDVA 4INHA 1THRH 3VB5A 1YC0A 2V6NA 3EA7A 1AB9C 5ESBA 3UOPA 1XUKA 2ZG0H 4BAOB 4XE4A 3SO3A 4BAKB 1O3NA 1W0ZU 4ABJA 3ZZ4A 5JBBS 3RDZA 1GBCA 1RTFB 3QGJA 4BTUB 1EAIA 3STIA 2UUJB 4CR5A 1TLDA 4Y8XA 3V12A 2ANMH 4X6OA 3BEUA 1ZTKA 2GMTC 1EQ9A 1DY9A 1ESAA 5FHTA 3EQ0H 1NU7B 1TGBA 1TX8A 2A2XH 2KAIA 1MMJN 4X8UH 2QC2A 1MTSA 1XKAC 4NA8A 4Y11E 1SI5H 2ANYA 4FUCA 2GV6A 5PTPA 3SNEA 4DG4A 3A87A 4BNRA 4B2CA 3JZ1B 3G01A 3EDXB 4O97A 1C1NA 2W7SA 1CHOF 3BTME 3QN7A 1TE0A 1SGTA 3LGUA 1C9PA 4GSOA 3RU4T 1AKSB 1N6YA 1MTVA 1NFYA 3ATMA 1WV7H 2FOHA 4DVAU 2BOKA 3T62A 3AW0A 1HYLA 2H9HA 4JYVH 3TK5A 1TPAE 1EPTB 1N1LA 5CHAC 4YLQH 3A89A 1LCYA 1C1SA 1C2FA 3SI3H 1OX1A 2Y82A 3ZVEA 1QBNA 1AQ7A 1BB0B 1TNKA 1Y5BT 2XBWA 2ZQ2A 4IS5A 2BD7A 1PFXC 1BTWA 1ANDA 2B5TB 1CU1A 5TJXA 1UMAH 4GLYA 2ZU5A 5EXNA 2FOBA 2XWBI 3Q76A 1DANH 3SJOA 1DSUA 1O5CB 5G4BA 1LKAA 1GVLA 1AO5A 3UREA 4ZUHA 1W13U 3T2NA 4GHQA 2FWWA 3ZVAA 3MI4A 1VJ9U 1FV9A 3CP7A 5J4QA 2BVXH 3PB1E 1ZMLA 1T31A 3A7ZA 3ZZCA 3OY6U 4Y76A 4K8BA 5F03A 2GT7A 1BRAA 2WUCA 3MH7A 2Z3DA 5E2OA 4CRGA 2ASUB 1GJ4H 1HAOH 3MNXA 4BTIB 2R2MB 1AZ8A 3A8AA 3PM3A 4MPVA 2GDDA 1IAUA 1J17T 1LVYA 1TPOA 3PWBA 1DXWA 3SU5A 3MHWU 3LONA 4K1EA 2A4QA 2GV7A 1GJ9B 2AGEX 4ZKSU 1LHDH 1C5RA 1NTPA 1S0QA 5C20A 1EATA 1ELBA 4MTBA 1IQMA 5JBCS 1K1IA 1PYTC 2G55A 1HBTH 1B0FA 1GJDB 1P3EA 4E7RG 3U69H 1UK4A 3ZV8A 4Q7XA 5H4IB 1WU1A 3RM2H 1GHYH 4X6PA 1Y3WA 3K6ZA 5GIBA 3ATIA 1GBAA 4K3JA 4INKA 5GWZA 1O30A 1G9IE 3MO3A 4WY3A 5E0HA 1TA6A 1EJMA 3VB3A 2C8XB 1T8MA 4JZ1A 1NRSH 3TJVA 2G5NA 1MH0A 4RSPA 3GY3A 3FP8E 2P3UB 1ZSLA 4FVDA 2OTVA 4XBCA 2IN2A 1P9SA 3ZVDA 3VB7A 3RMMH 1AIXH 3TGKE 3U1IB 1UVTH 1LQEA 1YLDA 3BN9A 1MCTA 4TPIZ 2P93A 4O9VA 2QCYA 1V2VT 4I32A 3A86A 1AUTC 3HGNA 3RXUA 4D9QA 1MZAA 1BTXA 1EAWA 4DJZB 2OCVB 1IQEA 2PSYA 3SQHE 4YTAA 3RXKA 1CA0C 3SV9A 1MD7A 2FTMA 4RKJB 1VGCC 1XM1A 4Q7ZA 1ANBA 1C2HA 4SGAE 1WYKA 4NA7A 4JMYA 4XFQA 4X1QU 4SGBE 3R0FA 4Y7BA 2JH5D 5FAHA 1TABE 2OBQA 1P2MA 4X2VA 1O37A 3GYLB 2P3FH 3UWJH 1V2PT 2TGTA 3RXSA 1XXDA 1MZDA 2OLGA 4NGAH 3MH4A 1DXPA 2G4UA 1SGEE 3SUDA 1SLXB 3RXGA 3U8RH 1UK2A 1V2OT 1ZRBA 4ABEA 1ETTH 1BTUA 2AEIH 1KYNA 5FCKA 1HXFH 1KXDA 1SLUB 1FN6A 4CRDA 1O2QA 4X6NA 1NN6A 1O3CA 2XBXA 1GJ6A 1FY4A 1V2RT 1O39A 5I46H 1KXEA 1Z8GA 2R3YA 4DW2U 1EOJA 4WXIA 5DP4A 2QXJA 5LH8A 1GI8B 1G37A 2PSXA 1O3BA 1SHYA 1SGFG 2W3IA 3V3MA 1GCTB 1BCUH 2JKHA 1SGYE 4AX9H 1SMFE 2GZ8A 3MNBA 1ZMNA 2OBOA 1YPLH 3E90B 2XCNA 4A6LA 1W7XH 1CVWH 3ZVBA 1E34B 1TONA 2PKSB 4B2AA 1V6DA 1Z8IB 4BXSA 1FY3A 2V3HH 1CA0B 2ZFRH 1FONA 1SHHB 1SQOA 1HUTH 3PLPA 1EJAA 5CHAB 4ABAA 1GMDG 3GYMA 5L2YH 1O2OA 2O9QA 1HNEE 5EODA 1EASA 3RXVA 4UDWH 2HOBA 1ZOMA 1ZSKA 3GOVB 1EXFA 3BEIB 1UTQA 2OC7A 1OP8A 1O3KA 2FXRA 3QZQA 1ELDE 1IHSH 3LPRA 1ARBA 1ANEA 3ZYEA 3NCLA 4WVPE 3GY2A 3JZ2B 4KKDA 5BRRE 1UVSH 1IQHA 5A0CA 1HAVA 1KXCA 3SORA 4X2WA 3UIRA 3KN2A 2B9LA 1O2PA 4WF8A 3DHKH 4WMFA 2GZ9A 1AFQB 2ZHEH 2F9NA 1RGQA 4NZQA 1SGIB 5EXLA 4Y79A 1EZQA 1MQ6A 1QQUA 1XUJA 2C8WB 1K1NA 1GBDA 3M35A 1C5SA 1AZZA 2BMGB 1OXGA 1UCYK 2QN5T 1GCTC 3L3TA 1OPHB 7GCHG 1YPGH 4NIYA 1HGTH 5AF9H 4B76A 2XCFA 4MPXA 1F0SA 2AIQA 3BG4C 1PQAA 4I8GA 2M5TA 3TJOA 1A5GH 4TWWA 5SGAE 4X8TH 2PKSC 5K0HA 3TIUA 4X1NU 1YCPM 4ZROA 2CMYA 4BAMB 1GBMA 1GMCG 2GDEH 3N7OA 4OGXA 2QV1A 3MWIU 3MU1A 1FUJA 1AE8H 2P3TB 2A32A 1C1VH 1TQ0B 2BDCA 2ZFSA 3RC5A 1S81A 1ABJH 3HK6B 4O3UA 1EB1H 2XYAA 5E0GA 2BY6X 3BIUH 1ZPZA 1GVKB 2ILNA 2A4RA 4KELA 3T28A 2THFB 2C90B 3PV4A 1BBRE 1F0TA 3MNCA 2BXTH 1C1TA 1INCA 5DJ7A 1NFUA 2JETB 2A31A 2OP9A 1V2JT 1ORFA 2BDBA 2ZQ1A 3BF6H 4ZH8A 2NU3E 2A7CA 2J92A 2ZHWH 4NWLA 1Y8TA 2W7UA 2EA3A 1ZHPA 4MG3A 4ABIA 2G52A 2P8OC 1J9CH 1CSOE 1O2XA 2OQ5A 1K1LA 3SHAH 1V2MT 4NG9H 3RXCA 2XC5A 1UTKA 4X1SU 2P95A 2ZNKH 4X8VH 1O35A 1CO7E 1J14A 2EC9H 4R0IA 5FXLA 2CXVA 3M3SA 1LPGB 3FVFB 1DPOA 5DP9A 1QFKH 4JYUH 2FOMB 2B0FA 3GCNA 1CT4E 1A1RA 3BEFB 3Q00A 2BD8A 3SU2A 1GI7B 1A4WH 1P2KA 1O5EH 4ZHAA 2WPJS 2ZCHP 2QF3A 1BJVA 2EI8A 1CGHA 4A1XA 4AB9A 4CR9A 1TOCB 3QWCH 4FUFA 5EPYA 1D3DB 1KXBA 1C5PA 1S0RA 4X1RU 3SV2H 2VH6A 2ZWLH 4BTTB 3K65B 1TMBH 3GCOA 4O03A 4CH2B 3VB6A 1QGFA 4XBBA 1GGDC 4FU8A 1TALA 2VIDA 4ZMAH 1BMLA 4ABBA 3Q3KA 1GJ5H 1MKWH 2FP7B 3E0NB 2VIPA 2ZHFH 3BTQE 1LPKB 1O31A 1FN8A 4IC6A 1SB1H 1AFEH 1IQLA 2OD3B 5DP3A 2WPKS 1EPTC 2FLRH 2D1JA 1F2SE 4R8TB 2Y5GA 4IN2A 5A0BA 1HB0B 2AYWA 3SV6A 3BTTE 2R3UA 3W95A 3A8BA 1Z71A 1V2TT 4F49A 1MKXK 3GCHC 1C1UH 1P04A 1C4U2 2VVVA 3AAVA 1T7CA 1XX9A 1H9LB 1K2I1 3PMHB 4D7GA 3ZZBA 3VXFH 1DWBH 1C4V2 2D26C 2SGEE 1QHRB 2ZDNA 1H9IE 1O2IA 1H8DH 2AMQA 3ODDA 3TGIE 4HZHA 9ESTA 1Q31A 3A7VA 5EQRA 1WUNH 5FX5A 1LVMA 2A4OA 1BMNH 1O33A 1C5UA 1K1OA 1GBFA 1GHXH 1VCWA 1YM0A 3STJA 3PYHA 2J95A 3M7UA 1C5LH 2VGCB 1W0YH 2ZCLP 4M7GA 3F9GA 3AVZA 2PTNA 1UCYE 1GDUA 3A8DA 2BZ6H 3UUZA 2B7DH 1THPB 1T8OA 4MNVA 1GBJA 1O2YA 2ZU3A 3UFAA 1W2KH 3SNCA 3TJNA 1EZSC 1XXFA 1P2JA 1V2NT 1GJBB