1MTVA

Factor xa specific inhibitor in complex with bovine trypsin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Crystal structures of factor Xa specific inhibitors in complex with trypsin: structural grounds for inhibition of factor Xa and selectivity against thrombin.
pubmed doi rcsb
molecule tags Serine protease
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mtvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mtvA02
1VITF 2VWMA 2QV1A 1W14U 1GDUA 2F9NA 3A86A 2AYWA 5FPTA 3P8OA 3A87A 3SU2A 2OLGA 1UCYH 1QHRB 1G9IE 1O37A 2OBQA 2PGBB 1HUTH 2A7JA 2H6MA 1SOTA 1YC0A 2J92A 3RXGA 1Z8GA 4Y0YE 3ZZ8A 1XUIA 1K1LA 2TBSA 4H42U 4NZLA 8LPRA 3A7WA 2FYRA 4K8BA 5DG6A 2AGEX 1UVPA 4HFPB 3U69H 1RTLA 4SGBE 4WF8A 2C3SA 3TJUA 4CRFA 5I25A 1Z7KA 3V3MA 4I32A 1AUTC 1TBQH 1C1OA 3A7ZA 2STAE 2WYGA 3TH3H 1GGDC 5AVDA 2VIDA 5I46H 1UTLM 1TNHA 5FX5A 1Y5UT 3NPSA 2OINA 1O35A 2H1UA 1F0SA 3GCHC 4X2XA 3STIA 3MNCA 1AFQC 2GCHF 1Z6EA 1BJUA 1GGDB 1O33A 4ABAA 3RM0H 1P03A 4A5TS 2GD4B 1B0EA 1O3NA 1WU1A 1QB6A 3GCHB 1AKSA 2B9LA 3DFJA 1CGJE 1AFQB 1O5FH 4TPYA 1WTHD 2BTCE 4IGDA 1IQHA 1BTWA 1P01A 4NIXA 2C8YB 1VCPA 4NFFA 3T62A 1QBNA 1Z1IA 1C5NH 3ZV9A 4IW4E 3KGPA 1O2PA 3SU1A 1PYTD 3W95A 5A0AE 1SL3A 1O2ZA 1TONA 2PLXA 1BITA 1ETSH 1GI0A 1JRSA 2BDCA 3FANA 4IC6A 2XWAA 5C1UA 4CRBA 1GBFA 3V7TA 3UQVA 2F9BH 1VCWA 1WAYB 1O3EA 2PKAA 3M3VA 3SNCA 1C1PA 5GDSH 2EI7A 1A7SA 3RUOA 2GT7A 4AORA 2TGAA 3PMJA 3AAVA 2RCEA 4I31A 1CSOE 1Y5BT 5FBEA 2QY0B 1A4WH 3ZZCA 4TY6A 1O32A 1ESAA 1GBBA 3PTNA 1PPBH 1VJ9U 4CRDA 1EAWA 1C1WH 3PB1E 2ZFTA 2GV6A 1SOZA 3MU0A 1WOFA 2RDLA 3KQCA 4I8LA 3GICB 4ASHA 2GDEH 3SNAA 1UTMA 1ZGIA 1JBUH 2FP7B 4YTAA 3FZDA 4ISNA 2ILNA 3M7TA 1C2IA 5EU8A 2PFEA 2ZF0H 2VINA 1GVLA 1UVUH 2ZHDA 2ZPQA 1N6YA 3QDZB 2XBYA 1GMDF 5ABWA 1K21H 1O2OA 3LGIA 4TPIZ 2AERH 1QCPA 3P70B 1TOCB 1DE7H 5T3HA 1XUJA 1NC6A 1TRNA 4BTIB 1O3PB 1EZXC 5DP6A 3S9CA 4U32A 1YPHE 1BTUA 1MTNC 1P9UA 4BXWA 1MZAA 2VB0A 8GCHG 3UIRA 4UFFH 2HPPH 3RXQA 1TMBH 3SNEA 4MTBA 1THPB 4ABJA 1PJPA 4IMZA 1MTNB 2BB4A 1C2EA 1LKBA 1ZRBA 3TJVA 4WH8A 1DXWA 3IWMA 1QTFA 1AB9C 2XWBI 5E8EH 9LPRA 2CF9H 2BDIA 1T4UH 2H5DA 2XBWA 3SV7A 2CHAC 1W0YH 1DY9A 2A31A 3UQOA 1AB9B 1FI8A 1E34B 4JZFH 3JZ2B 3MH5A 4DOQA 1CVWH 4B1TA 1DXPA 3K6YA 1XUGA 1BBRK 2SGAA 3RXFA 2CHAB 1UTPA 1BMNH 1AN1E 3MTYA 4FU7A 4ZXXH 3SO3A 3AAUA 2AGGX 3D65E 1YGCH 1GJDB 4U30A 4ABDA 1P2KA 1TALA 3CENA 3E91A 1SLXB 1TE0A 1WV7H 2HALA 1KTSB 3QGJA 4FUCA 3UOUA 1O2QA 5DP7A 3U9AH 3S9AA 2FDAA 1NFUA 1O3JA 2A4OA 3ODDA 5T6DA 2HNTC 3ATKA 4X8UH 2XXLA 3ZVBA 1Y8TA 4DGJA 2OQ5A 1O5EH 1OYQA 1IAUA 4ESTE 2OC0A 3TNTA 1K1IA 1A5HA 2Z3DA 2WPJS 3M61U 2FM2A 5DK1A 1FV9A 1W2KH 1DFPA 2PR3A 1O3IA 4D9QA 4E05H 1H1BA 1HAIH 1V3XA 1O30A 2FEQH 2J4IA 2VH0A 2ZDKA 1HBTH 1J14A 5EQQA 1RJXB 3QGNB 9ESTA 1FN8A 2FOAA 3H5CB 1F0TA 5HMAA 1QGFA 1XVMA 3GY8A 4CH8B 1P3CA 3RDZA 1C1MA 3LGTA 2V3OH 3LT3A 3MNSA 5JB8S 2QAAA 1C2GA 2BD7A 3I29A 3PLPA 1G3DA 1QB9A 4CBOA 2EA3A 2G5NA 2ZDNA 1KLIH 2A7HA 1ZSKA 2W7SA 2OC8A 2XCFA 3VXEH 1OSSA 3UNQA 5FPYA 2I6QA 2BVXH 5LPFA 1UHBA 5L2ZH 1GJ8B 2AMDA 1GBIA 4H6SB 2P95A 5FBIA 1LPGB 4JZDH 2NU0E 1CHGA 1K1OA 2XBVA 2ZFSA 1O3AA 1AQ7A 2UUJB 1EAIA 3Q76A 1FAXA 2ZPRA 4LXBH 2HRVA 2PSXA 1AMHA 3EQ0H 3PO1C 2TGTA 1D3QB 2A4RA 1NTPA 2OCVB 4LZ1H 1LO6A 2ZU3A 1PFXC 2OUAA 4KELA 3EA7A 2P16A 1BDAA 1OXGA 4CRAA 3ZV8A 1LHFH 4M7GA 3PO1B 5GWZA 1NRPH 1EPTC 1ZHPA 1ZJDA 2Y5HA 3NWUA 4Q80A 1O2YA 3GISB 3SV2H 2VIQA 1F5RA 4IBLH 3FVFB 3TK6A 1GBCA 4AYYB 1E38B 1ACBE 3C1KA 4ABGA 1YM0A 1DDJA 1EPTB 2ZCLP 5F8XA 4UFEH 3MU5A 2BD2A 4BAQB 1ZR0A 1O0DH 3TITA 3M35A 1P3EA 3MO3A 1ZZZA 1GHXH 3QK1A 1IQMA 2Q1JA 1S82A 1QBVH 1TWXB 4MPXA 3GCOA 2BDYA 2ZEBA 4K8YA 1TA2A 4UDWH 1C1QA 1MU8B 3TJNA 1FPCH 3O8BA 1PQ7A 1ANDA 4YT7H 1UVOA 2DE8A 1KXFA 1HAOH 1TX6A 1CA8B 2AFQB 2EEKA 2LNCA 1S6FA 3ATWA 1EOJA 1PPCE 3HK6B 3SNBA 1V2KT 2FWWA 1LQDB 1GHZA 1GVZA 1AD8H 1HCGA 2C93B 4UONA 1JIRA 5JBCS 3GCNA 2QCYA 1GMCG 1HXFH 1AWFH 1ETTH 2QN5T 5AFZH 1QQ4A 3SQEE 4B76A 4Q7ZA 1V2ST 1EATA 1MBMA 3V12A 2R9PA 1C5PA 1TRMA 1C5SA 3R0FA 4UD9H 1W10U 2AEIH 1Y3YA 5E2PA 1CA0B 4K2YA 6ESTA 2CF8H 4LOYH 1MUEB 1KDQB 1UVSH 1QL8A 4X6NA 1FJSA 1QR3E 1GWAA 3RXDA 5TJXA 3M7QA 1HAZB 1QQUA 4Y0ZE 5AHGH 3BEIB 5AFYH 2GV7A 4YLQH 4MNYA 1L4DA 3FP6E 1MKXH 4DCDA 4MLFB 1NPMA 1ZPCA 1SB1H 1FMGA 3P6ZB 3LKWA 1TYNA 1P2NA 5CE1A 2SFAA 1Y3WA 2R0LA 2V0BA 1O3CA 1C4Y2 4Y11E 2G4UA 2Q6FA 4LK4A 1FUJA 4AFZA 4OS7A 1SVPA 2KAIA 4ZHLU 4A6LA 1KTTB 4GHQA 2F3CE 5GCHF 4F49A 1NRQH 5L6NH 1EB2A 3S9BA 5FCRA 4FUIA 1AUJA 4TY7A 5HGGA 3TK9A 4AFUA 3VB4A 1GBJA 3MH7A 1VITH 3A81A 3RXEA 1B0FA 2HLCA 1KXCA 1EUFA 3SORA 1L1JA 3E3TA 1V2QT 5F8TA 1AKSB 1O5DH 1NZQH 1DWBH 2OTVA 1GJ4H 3SU0A 3VB7A 1OP0A 1PQAA 1UK2A 1UCYK 5FAHA 4X6OA 3KHVA 2BOHB 2BX4A 3FP7E 3ZZ3A 2BYAX 1G3CA 2P59A 1C5YB 1E0FD 4IC5A 1MMJN 1AVWA 1GI8B 1O2IA 1ZHMA 2CN0H 1SGNE 3Q3YA 2W5EA 3NKKA 1RTFB 4NA8A 2PKAB 3DA9B 2ANMH 4WJG2 4GAWA 1MTWA 1Q3XA 1J8AA 2Y5FA 1UTQA 3LOXA 1EP6A 3GYLB 1QURH 2PKSC 2Z7FE 3KEEA 1WYKA 2C8XB 1FAKH 1ABIH 1K22H 1VGCB 1OWJA 2IN2A 1ELVA 3VB3A 1TGNA 1O5BB 1BTYA 4FVBA 1ZRKA 1EJNA 2PKSB 2AH4X 2YNAA 4BTUB 5DP3A 3M3SA 4OS2A 1BIOA 3RMOH 2FTMA 1LKAA 1BTPA 1TGTA 1P11E 4UEHH 4FUJA 1ELFA 5A0CA 1V2MT 1ZMNA 4KGAA 1N6XA 2Y7ZA 1QB1A 1Z71A 2ZZUH 4ZH8A 1GMHG 3EA8A 1GI6A 1GBKA 3A7XA 4BAOB 3U98H 2ASUB 1D6WA 1SFQB 3EAJA 2BY5X 1G32B 2AMPA 4AFSA 4MPVA 2RG3A 1JRTA 2FESH 2ANYA 1K28D 1T31A 1DLEA 3PYHA 4GCHG 1Q31A 3T29A 1VJAU 1AI8H 1A0LA 2ANWA 2GGVB 2GZ7A 1GBLA 4A7IB 1RFNA 2YNBA 3TH4H 4DIIH 1GPZA 3PLKA 3RP2A 1OWIA 1IHSH 5L30H 1F92A 5J4SA 2ZFFH 4O3UA 1SGRE 2V6NA 3ZZ7A 1HYLA 1NM6A 2ODPA 3T28A 4XSKU 3TPIZ 3RMNH 2PTCE 4Y7AA 3S0NA 2SGFE 2BVRH 1SI5H 3BTQE 5ESTE 3SU4A 4Y76A 2FMJA 1O3KA 4X6PA 1PPGE 2QXIA 5EXMA 1HAPH 1JWTA 2XBXA 3NXPA 5EPYA 1GDQA 1T8MA 1DS2E 4X8SH 2BDGA 4YOIA 1NU9A 1IQJA 2Z3EA 1HB0B 2FX4A 3PTBA 3DFLA 1FPHH 3AVZA 2PTNA 2BY6X 2G00A 3D49H 2GTBA 2GKVE 3M5MA 1SGCA 1ELAA 4JZ1A 3UFAA 1TX7A 3URDA 3U8RH 4FU8A 1T8NA 4U2WA 3RXSA 3CS7A 3T26A 2VGCC 1SGIB 3QUMP 1W12U 3E8LA 2A4QA 1ANEA 2DUCA 4K3JA 4CREA 1O2GH 2GZ8A 2XNIA 1ZPZA 4I8JA 1Y3VA 2Z9IA 2ZHWH 2NU3E 1TFXA 2VGCB 1BZXE 1G3BA 3A8CA 3S7HB 1DOJA 1UTOA 3BTKE 1GHBG 3I78A 3ATMA 4NZQA 3QN7A 1GHVH 1WSSH 1M9UA 4H4FA 1O2JA 1QJ6B 5LGOA 2XYAA 1W13U 1O2HA 2ZU1A 1N1LA 1XXDA 2HNTE 2QC2A 4KTSA 4GPGA 5JBBS 4DVAU 4WXIA 1UHBB 2BLOA 2WUBA 1J17T 1OYTH 1S0QA 4K69A 5EPNA 5HXFA 1A61H 3KNXA 2ODYB 3VPKA 2ZP0H 5E0JA 5EG4A 3GY4A 1GHYH 5LH8A 2H9TH 1SSXA 3RXOA 3SQHE 1EAUA 1DANH 2ZECA 2ZGHA 3ATIA 3E0NB 5F6MA 4XFQA 1ZHRA 1HFDA 3V0XA 4ISIH 2OD3B 3A88A 1ESBA 1C5TA 2F9PA 1PPZA 1TOMH 3F68H 1GDNA 1C5VA 2FX6A 2D26C 1C2LA 3SI4H 2PW8H 1J9CH 2OC1A 3MO9A 5HYOA 2ODQA 2ZGXH 1TPOA 1O34A 3ATLA 1O2RA 5K0HA 1CHOG 3BTGE 5TCAA 5DKMA 2HNTF 3O8RA 7KMEH 1RS0A 1XKAC 1BA8B 4ISOA 5C20A 1WQSA 3AW1A 4MPWA 1SGQE 2BDAA 2ESTE 3Q3XA 1F2SE 2OXSA 2G8TA 2PSYA 4KP0A 1TABE 2VVVA 4INHA 3E1XB 2C90B 4NWKA 1V2RT 1XUKA 4DG4A 4X2WA 7ESTE 4OS6A 1LPZB 1C5MD 1SQOA 1C5WB 4AGJA 2I6SA 2ZPSA 1RGQA 4I7YH 1CO7E 3PMHB 1TA6A 1V2NT 1YPEH 3EA9A 1G3EA 3TK5A 4BNRA 3UR9A 4R0IA 4ZMAH 1PQ8A 4QT8C 2ALVA 3ZYEA 2FYQA 2Y82A 3I77A 1DM4B 3PMAB 3SGQE 3V13A 1KXDA 4Y8ZA 2J34A 5ESBA 3PMBB 1W11U 1QRXA 3UR6A 2ZCKP 1TIOA 4YOJA 1T7CA 2ZDAH 1SG8B 4XDEA 3TVJB 1QJ7B 1A46H 3BIUH 1DICA 1IQLA 4MNWA 4ZXYH 4JYUH 2QXGA 5CMXH 1ETRH 4KTCA 3SUFA 2PGQB 1V2TT 4NA9H 3P17H 3O8CA 2FOCA 2ZIQH 3NCLA 3MNBA 1QY6A 1FLEE 2D1JA 3KQBA 1P06A 1Z8IB 4ZKRU 5JDUB 3B8JA 1AE8H 3BIVH 5DJ7A 3MMGA 1NFYA 1BTXA 1TNKA 3BTFE 4FUDA 4WXVA 1P02A 2DE9A 3P95A 4FUFA 3ZZAA 4AN7A 1GMCF 1HNEE 1V6DA 3FP8E 5C67A 1V2OT 2FS8A 5EW2H 2BDBA 2KAIB 2Y6TA 1S5SA 4ABFA 1UVTH 3MFJA 3U1JB 1GCTC 1LTOA 4RN6A 4XBDA 1KY9A 2NU4E 3RXVA 2K1QA 4XBCA 3VEQB 3TGKE 3BG4C 4FXGH 1GCTB 1NRRH 1QBOA 3MU8A 1INCA 3RU4T 3B23B 3O8DA 1Z8RA 2BD4A 5T6GA 3BG4B 1NFXA 1UTKA 1J16A 4ABIA 4PROA 2ZU4A 2TRMA 4NWLA 2B7DH 2Z9JA 5DP5A 1WQVH 5E2OA 4Y7BA 2VU8E 5A8XA 1S83A 3DT0H 1SLUB 3ZVDA 1MKXK 4KKDA 4X1NU 1LCYA 4B74A 4D9RA 3M3TA 1LHEH 3QLPH 2PUQH 4NSYA 1E35B 4I33A 1BRAA 1HDTH 4RSPA 2QF0A 3QWCH 1QL7A 4YO9A 2WPKS 2O9QA 2Y5GA 4NSVA 2P94A 3BTDE 1O2UA 4WMFA 1YCPM 1TNGA 2TPIZ 3T5FH 1TBZH 1ZPBA 1UMAH 3SNDA 1P9SA 1BQYA 3URCA 5FCKA 1NT1A 4JK5A 1BRCE 1ANBA 1IQEA 1W7GH 2A5IA 1WTGH 2G51A 3SJIA 5C5OA 2BOKA 3A7TA 1CE5A 2ZHQH 2ZGJA 2HOBA 1P2JA 3MH6A 1HRTH 4CHAC 1OPHB 2B5TB 4X6MA 3K9XB 4NGAH 4ZHMU 6GCHG 1TPAE 1C5QA 1DT2A 1ZMLA 4YESB 4NIYA 1FY3A 1LHCH 4DY7B 1F0RA 2WUCA 3UWIA 3LGUA 5BRRE 1F0UA 4CRGA 1NRNH 4H6TA 5C2ZA 1FZZA 4NIWA 1SGDE 4CHAB 1LVBA 2SGQE 5F03A 3UWJH 4I8GA 4CR9A 1VCQA 1P2IA 3LPRA 1S6HA 1UO6A 4INKA 4VGCC 1YCPH 1D4PB 3K6ZA 1HJAC 3CP7A 1MAXA 4MNVA 1KXEA 1OP2A 4R8TB 1QL9A 1ZSJA 1HV7A 3TU7H 3ZZ5A 1PPHE 3VGCC 3NK8A 4AG1A 3A82A 4NCYA 3SBKA 1WBGB 1N8OC 2VWNA 4VGCB 1KXAA 3D23A 1O2KA 3A7YA 1O3FA 1HJAB 4UE7H 3F1SB 1CA0C 1CU1A 1JOUB 2C8WB 3VGCB 4J2YB 2IPHA 2R3YA 2CJIA 1ELGA 1N8OB 1MQ5A 2GVFA 1RTKA 2W7UA 3SHAH 1TGBA 1FY4A 4Y6DA 1RIWC 3RXTA 1V2PT 1GL1A 5FX6A 1GBMA 4X1SU 2ZDLA 1C1SA 1GMHF 2HVXA 1HAHH 3BTHE 4Z0KA 4INLA 4AX9H 3Q3KA 4UFGH 3MNXA 5C1YA 1EOLA 2FPZA 1RIWB 3RLYH 1MBQA 2P3TB 3JZ1B 3M7UA 1YLCA 2AIQA 1BBRE 4YOGA 4GCHF 1DUAA 1ABJH 3GY2A 4HI3A 3U8OH 1J15A 2A5KA 1EP5A 1X7AC 1FY8E 1TX8A 4HGCA 1DVAH 2H5CA 1EZUC 1ORFA 1RRKA 4K1TA 1GI2A 1H8IH 5IDKA 1SC8U 2ZHFH 3AW0A 3HPTB 2Q6DA 5DO4H 3L6PA 3EYDA 1SLWB 1G2LA 2WPIS 1DITH 1A3BH 2GMTC 2SNWA 1GHAG 3A80A 2PWXA 3RM2H 1FIZA 3AASA 1T4VH 5EOKA 2TGPZ 2ZNKH 1GI1A 2XC4A 1C2MA 1BTZA 3HKIB 3OYPA 2Z9LA 2GT8A 1C5UA 1FY5A 2GMTB 2QGRA 1F5LA 3QTOH 4AB9A 4YT6H 3MO6A 1ELTA 3OY5U 1EZSC 4BOHA 1ZYOA 4D7FA 1K1NA 1AO5A 1G30B 1HAVA 3ZVCA 1GJCB 3A83A 4MVNA 2SGEE 1FIWA 1MTVA 2ZTXA 1A1RA 1JIMA 2ZFRH 4THNH 1O3OA 2OBOA 2QXHA 2ZGCA 3M5LA 5JB9S 5DP4A 2QA9E 2NU2E 2ZCHP 3Q77A 5T6FA 1DWCH 2FOFA 3GY5A 2UUFB 1GJ7B 1VGCC 3M36A 1A0HB 1O3HA 2THFB 4OS4A 3S69A 1HJ8A 5EQSA 4BAKB 4X1PU 2O8MA 1DLKB 4Y8XA 2ZTYA 4X1RU 2BD8A 5CHAC 1CBWC 4ZKSU 1ZJKA 4Y71A 1UTJA 4ISHH 2Q6GA 1A0JA 1ID5H 2V35A 4ZAEA 1S0RA 1HPGA 2PV9B 2BLVA 5CHAB 1AVXA 1S85A 4Z6AH 1CBWB 3WY8A 1GHBF 3D62A 4MDSA 1O2XA 1ARBA 2FI4E 5A2MH 2ANKH 5A8YA 1LHDH 5DGJA 2GP9B 2VWLA 2J38A 1ZTKA 5FPSA 3VB6A 1F7ZA 1V2LT 2Z9KA 5IYTA 1HJ9A 3ZVAA 1V2WT 3LGVA 1SGPE 1YPMH 3BN9A 2H2ZA 1VR1H 4LZ4B 2BQ7B 1LVMA 1EKBB 3SUEA 1SGFG 1K9OE 3LJJA 1MD7A 1FQ3A 1TMUH 2BD3A 5C3NA 3ZZDA 4BTTB 1ELDE 2GX4A 2BLQA 3F6UH 2QF3A 3GDSA 2W3KA 1O36A 2AS9A 5C5NA 3RXIA 1KXBA 1O5GH 1CT0E 3VXFH 3QZRA 4B71A 4O03A 1YPJH 1ZMJA 4CBNA 4ABHA 1C5XB 1AVGH 1DWEH 3F9EA 2Y7XA 1RD3B 4DW2U 1A3EH 1LVOA 3VB5A 1MAYA 1O3MA 1KLTA 3SZNA 3TNSA 4ABBA 1CHOF 1P8VC 3CS0A 2WV4A 1EQ9A 2PUXB 3TH2H 1CGIE 4BAMB 2YOLA 1SGTA 4B75A 2BDHA 1W7XH 2FS9A 5EODA 1EXFA 4CH2B 1DWDH 3LU9B 2OC7A 1YF4A 2ZTZA 3DHKH 3SGBE 4YLUA 2WINI 3KIDU 1K1PA 1O2LA 3RXPA 1DUEA 8GCHF 3FZZA 1C1RA 1GBHA 5DPAA 4Q7YA 1HAXB 1VZQH 5DP8A 1KYNA 3UY9A 2BM2A 1AIXH 2ZHEH 3LGYA 2BD5A 5FXLA 2H9EH 3LONA 2JETC 1O3DA 1RXPA 3E6PH 4WWYA 1C1TA 2FO9A 3RMLH 1ZSLA 1Y3XA 3UREA 4D8NA 1CT4E 3QX5H 1CQQA 4IN1A 3LGWA 4O97A 2OQUA 1HIAA 3UTUH 3HKJB 1XUFA 1Q2WA 3SOSA 1H9LB 2G52A 1KSNA 2JETB 2BHGA 3M5OA 4HZHA 2VIVA 3GYMA 3RXUA 3MWIU 1LQEA 1TPSA 1L1GA 1AZ8A 3H7TA 2GDDA 3GOVB 1QA7A 5EXLA 3OU0A 3IG6B 1ANCA 1T32A 3RMMH 3F9GA 1UK3A 2EI6A 4GLYA 1LVYA 1D3TB 3ESTA 2F83A 3LIWA 3QO6A 2TIOA 1BJVA 5DP9A 2Z3CA 1MKWH 1YPGH 2J94A 3LH1A 5JYIA 1DX5M 5A09A 1ZTLA 1E36B 4TWWA 5PTPA 1BHXB 1L1NA 2ZWLH 3MYWA 1C1NA 1TAWA 3LJOA 1EZQA 2JH5D 1SGFA 5FHTA 3MH4A 1OKXA 2FI5E 1AFEH 2SGDE 2VH6A 1P12E 3A7VA 4B2AA 2BXUH 1UJ1A 4WMDA 7GCHG 4AOQA 1P2QA 7LPRA 2A7CA 3B9FH 1O3LA 3GY7A 5EGMA 3SV8A 8ESTE 3ITIA 1THRH 4BXSA 2A32A 1NESE 4Y8YA 2BMGB 2A2QH 1UCYE 4XOJA 1EASA 3GCTG 1SFIA 4SGAE 4Q7XA 3KL6A 1BMLA 2G81E 3OY6U 1C4U2 1O3BA 1UK4A 1ELCA 1P2MA 3T2NA 3STJA 2Y81A 1GJ6A 1QRZA 2JH0D 3A84A 3A8AA 1FN6A 2BY9X 1PPFE 5JPMH 1NRSH 4J1YA 4AYVB 2BVSH 2JH6D 4K5ZA 1MTUA 1JXPA 1GBEA 1O2TA 1SR5C 2FLRH 1HLTH 4JYTA 2VWOA 3K65B 2UWOA 5LPEA 1C4V2 1SHYA 4X2YA 4X8TH 2FLBH 1QA0A 5K7RA 1MCVA 1TB6H 2ZFPH 3S7KB 2UWLA 1AGJA 3LH3A 3SI3H 2G4TA 4JZIA 2F9UA 1A2CH 3OSYA 4GUXA 4A1TA 1W8BH 4E7RG 2ZG0H 3UNRA 1MD8A 1IOEA 3UNSA 3K2UA 3UOPA 3SUGA 3PLBA 2ZKSA 1GCDA 1GI4A 1GBTA 1LDTT 1TNLA 1VITG 4D76A 2F9VA 2W3IA 2ZO3H 1PYTC 3UPEA 3C27B 2A45B 1G2MA 2ALPA 1Z6JH 1OWEA 1TBRH 1MCTA 1FXYA 3SHCH 2Y80A 3PWCA 2XW9A 2BQWB 3ZVEA 1D6RA 1QJ1B 3KQDA 2FOMB 2FI3E 3KCGH 2FXRA 4OGYA 3ZVFA 4MNXA 4FUBA 2A4GA 1DSUA 4MQAA 5HM9A 2VVCA 1OWHA 1Z8JB 4X8VH 1PPEE 3LDXH 1G37A 1C2DA 1C5ZB 1SPJA 2FTLE 3TIUA 2ZFQH 4A1XA 2BLWA 1FDPA 3LC5A 4K60A 3SU6A 6GCHF 2GCHG 1V2JT 1ARCA 1O2WA 2O8TA 4AZ2B 1C2FA 3RXKA 2P3FH 5ETXA 4AGKA 1EX3A 1WCZA 3P8NA 2Z6BD 3FAOA 1SMFE 2AIPA 2SGPE 3RXAA 5C1XA 2XTTB 6LPRA 1D9IA 2XCNA 1SHHB 2XC0A 1OWDA 1QIXB 1BTHH 1ZGVA 2CXVA 2O8WA 4NIVA 3HATH 1AE5A 4YZUA 1AHTH 1BRBE 3R3GB 5SGAE 2HPQH 1LMWB 3BTEE 1YYY1 2QYIA 1C2KA 1TGSZ 4F4OC 1S81A 1XXFA 3PM3A 3RLWH 2ZQ1A 1YCPK 1O2NA 1GI9B 3RXJA 1C9PA 5E0HA 4BAHB 5GPIB 2RA3A 2G55A 2ZDVH 1CT2E 1OS8A 3ZZ4A 4JK6A 2ZC9H 3SV6A 4DJZB 2UUYA 4K1EA 4B2BA 1K1JA 1GVKB 8KME2 1THSH 4I8HA 2FOBA 2FOEA 1HAYB 1XUHA 2BY8X 2GZ9A 1U6QA 3F9FA 4NG9H 4MG3A 2F91A 1P57B 3ELAH 1YBWA 4WY3A 2QXJA 1TRYA 2A5AA 1GBAA 2STBE 4DURA 2P8OC 1GI3A 1LHGH 4Q2KA 1GI7B 1HAVB 1JMOH 2AMQA 2HGTH 5JBAS 1ZOMA 2WPMS 3KF2A 6CHAC 1GMDG 1TGCA 2EC9H 1O5CB 1TNIA 4RKJB 1Y5AT 2P8OB 1NU7B 1E37B 4O3TA 1MTSA 2P93A 1YPHC 2FIRH 1GI5A 1GHAF 5F8ZA 1TNJA 6CHAB 1W0ZU 4NA7A 4MPUA 4WMEA 4X0WU 1TQ7B 2GCTC 1WUNH 3HK3B 2VJ1A 3L3TA 4FUHA 1C1VH 3HGNA 1P2OA 3SJOA 4DIHH 5AF9H 3RC6A 1CGHA 2IJOB 1SGEE 4IMQA 4XBBA 2GCTB 2H9HA 4TWYA 4X2VA 1L2EA 4K1SA 4AFQA 1L0ZA 1BB0B 1YKTA 1P05A 1C1UH 1K2I1 4JZEH 1W3CA 3SU5A 1BBRH 3NUMA 1FY1A 2VVUA 4YM9A 3ZZ6A 2BZAA 3VFEA 2B8OH 2HWLB 3OX7U 2CV3A 1HXEH 3TGJE 5E0GA 1XVOA 5EXNA 2WV5A 4AB8A 1EJAA 1F5KU 1ELEE 1PQ5A 4WVPE 3ZZ9A 4FUGA 1KLJH 4CRCA 1DSTA 2ULLA 2P3UB 1D3DB 3MHWU 5JBTA 1XM1A 3M37A 4NFEA 5L2YH 3A89A 3QTVH 1BMMH 4E06H 1GJ5H 5GXPA 1C5LH 2M5TA 1FONA 4IS5A 1H9IE 4B2CA 2PHBA 1MH0A 2BQ6B 1EAXA 1NS3A 2BXTH 1A5GH 3BEFB 3RC5A 4JCNA 1OX1A 3E0PB 4JMYA 5GIBA 2XRCA 4X1QU 2C8ZB 3P8FA 3ZZBA 3GY6A 3PWBA 2J9NA 2FZZA 1BOQA 2F9OA 2A2XH 1DPOA 3SU3A 1S84A 4TYDA 2J2UA 1L4ZA 1TQ0B 3M5NA 1O5AB 1YPKH 2WPHS 2VIWA 2BX3A 1AY6H 4E7NA 1QRWA 1C5RA 2ZQ2A 1XMNB 4Y79A 1TLDA 4ZUHA 1EJMA 1OWKA 2ZGBH 2RA0A 1GJ9B 1T8LA 1QFKH 3SJ9A 2B0FA 3TLOA 3IITA 3RXHA 4ZKNU 3MU1A 3RC4A 4I8KA 2ZU2A 3QZQA 4ABEA 1C5OH 4O9VA 1GJBB 2NWNA 5HM2A 2A0QB 1T8OA 4WH6A 3BEUA 1KIGH 1ESTA 3G01A 1FNIA 2R2WU 1BCUH 3Q00A 3NZIA 3U8TH 1IQGA 3GDUA 3F9HA 1SQTA 1NY22 3PV4A 2Z9GA 3T25A 2CGAA 1SGYE 3GDVA 3KN2A 3BF6H 1HIAB 1B5GH 3H7OA 2EI8A 3P8GA 3SV9A 4JYVH 3RXLA 1P04A 5A8ZA 4ZKOU 3BTWE 4OGXA 1BUIA 1BMAA 5EQRA 1SLVB 1V2VT 3SGAE 1NROH 1IQNA 2O8UA 2QIQA 1OOKB 4UFDH 1HGTH 1MU6B 1O2VA 2ZI2H 3FFGA 4GHTA 1UTNA 2ZDMA 3TGIE 2IOTA 1O31A 3SN8A 2VIPA 1GJAB 4A1VA 1XX9A 4ZROA 1TPPA 3RU4E 3LC3A 3ODFA 2R2MB 2WYJA 2VIOA 4IN2A 5TCCA 3A8BA 3L33A 1O39A 2AGIX 1DY8A 1H9HE 1O38A 1AZZA 3SJKA 1A5IA 2G5VA 3DUXH 3SUDA 1H4WA 1AU8A 1ZLRA 1IQKA 1OP8A 3BG8A 4OS1A 1NFWA 3A85A 1YP9A 3A8DA 1SBWA 3MOCA 2CMYA 3U1IB 2BD9A 2R3UA 4U01A 3RXRA 1O2MA 1MQ6A 3MI4A 4KTUA 1D3PB 2VNTA 3RXCA 1Y3UA 4FU9A 2BZ6H 4BANB 1QNJA 5A0BA 1GL0E 2WPLS 1IQIA 5H4IB 5BPEA 1O3GA 1IQFA 1C2HA 2ZA5A 1NN6A 3E90B 2LPRA 1EB1H 2A1DB 1GHWH 1TMTH 4GSOA 1ELBA 2D2DA 3ENSB 3RXBA 2O8LA 1BT7A 3RU4D 3ZYDA 1SQAA 3EE0B 1AWHB 1H8DH 2Z94A 4DT7B 3W94A 7GCHF 2UUKB 1EPTA 1C9TA 2TGDA 1MKWK 1LPKB 1GG6C 1Y59T 3KQEA 3EDXB 4FUEA 3EGKH 2ZU5A 1XKBC 1P0SH 2V3HH 3HGPA 1K1MA 1G36A 3BV9B 2NU1E 5G4BA 4AG2A 2J95A 3RXMA 4A92A 1O2SA 2XC5A 3GCTF 1GG6B 1YLDA 3UUZA 4ISLA 4GVUA 1B7XB 1ZTJA 1NO9H 2FODA 4OS5A 3N7OA 3T27A 4D7GA 2W26A 3SW2B 2FOHA 1C2JA 4RKOB 1BRUP 4ZHAA 3TJOA 2R0KA 4HTCH 1IHTH 2FOGA 5B6OA 1YPLH 2BY7X 1Z1JA 3BTME 4B73A 2D8WA 3MU4A 2SNVA 5GJ4B 1P09A 1BHXF 3E16B 4XE4A 3OTJE 3BSQA 1V2UT 1HAGE 1MZDA 3PROA 3BTTE 3GY3A 3ZVGA 4FVDA 3DD2H 4Y10E 1P10A 2JKHA 2OP9A 5J4QA 3SJ8A 4CR5A 1GBDA 5GCHG 3P92A 2UWPA 2C4FH 5LPRA 1KDQA 5EW1H
chains in the Genus database with same CATH superfamily
1VITF 2VWMA 2QV1A 1W14U 1GDUA 2F9NA 3A86A 2AYWA 5FPTA 3P8OA 3A87A 3SU2A 2OLGA 1UCYH 1QHRB 1G9IE 1O37A 2OBQA 2PGBB 1HUTH 2A7JA 2H6MA 4TSFD 1SOTA 1YC0A 2J92A 3RXGA 1Z8GA 4Y0YE 3ZZ8A 1XUIA 1K1LA 2TBSA 4H42U 4NZLA 8LPRA 3A7WA 2FYRA 4K8BA 5DG6A 2WPDD 2AGEX 1UVPA 4HFPB 3U69H 1RTLA 4SGBE 4WF8A 2C3SA 3TJUA 4CRFA 5I25A 1Z7KA 3V3MA 4I32A 1AUTC 3OTPA 1TBQH 1C1OA 2QE7D 3A7ZA 2STAE 2WYGA 3TH3H 1GGDC 5AVDA 2VIDA 5I46H 1UTLM 1TNHA 5FX5A 1Y5UT 3NPSA 2OINA 1O35A 2H1UA 1F0SA 1W0KD 3GCHC 4X2XA 1VKYA 3STIA 3MNCA 1AFQC 2GCHF 1Z6EA 1BJUA 2WHXA 1GGDB 1O33A 4ABAA 3RM0H 1P03A 4RT0A 4A5TS 2GD4B 1B0EA 1O3NA 1WU1A 1QB6A 3GCHB 5GNDA 1AKSA 2B9LA 3DFJA 3FO8D 1CGJE 1AFQB 1O5FH 4HG6A 4TPYA 1WTHD 2BTCE 4IGDA 1IQHA 1BTWA 1P01A 4NIXA 2C8YB 1VCPA 4NFFA 3T62A 1QBNA 1Z1IA 1C5NH 3ZV9A 4IW4E 3KGPA 1O2PA 3SU1A 1PYTD 3W95A 5A0AE 1SL3A 1O2ZA 1TONA 2PLXA 1BITA 1ETSH 1GI0A 1JRSA 2BDCA 3FANA 4IC6A 2XWAA 5C1UA 4CRBA 1GBFA 3V7TA 3UQVA 2F9BH 1VCWA 1WAYB 1O3EA 2PKAA 3M3VA 3N7EA 3SNCA 1C1PA 5GDSH 2EI7A 1A7SA 3RUOA 2GT7A 4AORA 2TGAA 3PMJA 3AAVA 2RCEA 4I31A 1CSOE 1Y5BT 1SQRA 2QY0B 5FBEA 1A4WH 3ZZCA 4TY6A 1O32A 1ESAA 1GBBA 3PTNA 1PPBH 1VJ9U 4CRDA 1EAWA 1C1WH 3PB1E 2ZFTA 2JIZD 2GV6A 1SOZA 3MU0A 1WOFA 2RDLA 3KQCA 4I8LA 3GICB 4ASHA 2GDEH 3SNAA 1UTMA 1ZGIA 1JBUH 2FP7B 4YTAA 3FZDA 4M9FA 4ISNA 2ILNA 3M7TA 1C2IA 5EU8A 2PFEA 2ZF0H 2VINA 2LP6A 1GVLA 1UVUH 2ZHDA 2ZPQA 1N6YA 3QDZB 2XBYA 1GMDF 5ABWA 1K21H 1O2OA 3LGIA 4TPIZ 2AERH 1QCPA 3P70B 1TOCB 2J97A 1DE7H 5T3HA 1XUJA 1NC6A 1TRNA 4BTIB 1O3PB 1EZXC 5DP6A 3S9CA 4U32A 1YPHE 1BTUA 1MTNC 1P9UA 4BXWA 1MZAA 2VB0A 8GCHG 3UIRA 4UFFH 4Q63A 2HPPH 3RXQA 1TMBH 3SNEA 4MTBA 1THPB 4ABJA 1PJPA 4IMZA 1MTNB 2BB4A 1C2EA 1LKBA 1ZRBA 3TJVA 4WH8A 1DXWA 3IWMA 1QTFA 1AB9C 2XWBI 5E8EH 9LPRA 2CF9H 2BDIA 1T4UH 2H5DA 2IJD1 2XBWA 3SV7A 2CHAC 1W0YH 4YXWD 1WDIA 1DY9A 2A31A 3UQOA 1AB9B 1FI8A 1E34B 4JZFH 3JZ2B 3MH5A 4DOQA 1CVWH 4B1TA 1DXPA 3K6YA 1XUGA 1BBRK 2SGAA 3RXFA 2CHAB 1UTPA 1BMNH 1AN1E 3MTYA 4FU7A 4ZXXH 3SO3A 3AAUA 2AGGX 1YY3A 3D65E 1YGCH 1GJDB 4U30A 4ABDA 1P2KA 1TALA 3CENA 3E91A 1SLXB 1TE0A 1WV7H 2HALA 4ACAA 1KTSB 3QGJA 4FUCA 4P00A 3UOUA 1O2QA 5DP7A 3U9AH 3S9AA 2FDAA 1NFUA 1O3JA 2A4OA 2F4LA 3ODDA 5T6DA 2HNTC 3ATKA 4X8UH 2XXLA 3ZVBA 1Y8TA 4DGJA 2OQ5A 1O5EH 1OYQA 1IAUA 4ESTE 2OC0A 3TNTA 1K1IA 1A5HA 2Z3DA 2WPJS 3M61U 2FM2A 5DK1A 1FV9A 1W2KH 1DFPA 2PR3A 1O3IA 4D9QA 4E05H 1H1BA 1HAIH 1V3XA 1O30A 2FEQH 2J4IA 2VH0A 2ZDKA 1HBTH 1J14A 5EQQA 1RJXB 3QGNB 1UW7A 9ESTA 1FN8A 2FOAA 3H5CB 1F0TA 5HMAA 4DT4A 1QGFA 1XVMA 3GY8A 4CH8B 1P3CA 4TT3D 1C1MA 3RDZA 3LGTA 2V3OH 3LT3A 3MNSA 5JB8S 2QAAA 1C2GA 2BD7A 3I29A 3PLPA 1G3DA 1QB9A 3UAIC 4CBOA 2EA3A 2G5NA 2ZDNA 1KLIH 2A7HA 1ZSKA 2W7SA 2OC8A 2XCFA 3VXEH 1OSSA 3UNQA 5B6LA 5FPYA 2I6QA 2BVXH 5LPFA 1UHBA 3PV5A 5L2ZH 5T1VA 1GJ8B 2AMDA 1GBIA 4H6SB 2P95A 5FBIA 5F53A 1LPGB 4JZDH 2NU0E 1CHGA 1K1OA 2XBVA 2ZFSA 1O3AA 1AQ7A 2UUJB 1EAIA 3OE7D 3Q76A 1FAXA 2ZPRA 4LXBH 2HRVA 2PSXA 1AMHA 3EQ0H 3PO1C 2TGTA 1D3QB 2A4RA 1NTPA 2OCVB 4LZ1H 1LO6A 2ZU3A 1PFXC 2OUAA 4KELA 3SYJA 3EA7A 2P16A 1BDAA 1OXGA 4CRAA 3ZV8A 1LHFH 4M7GA 3PO1B 5GWZA 1NRPH 1EPTC 1ZHPA 1ZJDA 2Y5HA 3NWUA 4Q80A 1O2YA 3GISB 3SV2H 2VIQA 1F5RA 4IBLH 3FVFB 3TK6A 1GBCA 4AYYB 1E38B 1ACBE 3C1KA 4ABGA 1YM0A 1DDJA 1EPTB 2ZCLP 5F8XA 4UFEH 3MU5A 2BD2A 4BAQB 1ZR0A 1O0DH 3TITA 3OEED 3M35A 1P3EA 3MO3A 1ZZZA 1GHXH 3UB0A 3QK1A 1IQMA 2Q1JA 1S82A 1QBVH 1MABB 1TWXB 4MPXA 3GCOA 4B6EA 2BDYA 2ZEBA 4K8YA 1TA2A 4UDWH 1C1QA 1MU8B 3TJNA 1FPCH 3O8BA 1PQ7A 1ANDA 4YT7H 1UVOA 2DE8A 2HLDD 1WXRA 1KXFA 1HAOH 1TX6A 3H09A 1CA8B 2AFQB 2EEKA 2LNCA 1S6FA 3ATWA 1EOJA 1PPCE 3HK6B 3SNBA 1V2KT 2FWWA 1LQDB 1GHZA 1GVZA 1AD8H 1HCGA 2C93B 2J98A 4UONA 1JIRA 1K0HA 5JBCS 3GCNA 2QCYA 1GMCG 1HXFH 1AWFH 1ETTH 2QN5T 5AFZH 1QQ4A 3SQEE 4B76A 4Q7ZA 1V2ST 1EATA 1MBMA 3V12A 2R9PA 1C5PA 1TRMA 1C5SA 3R0FA 4UD9H 1W10U 2AEIH 1Y3YA 5E2PA 1CA0B 4K2YA 6ESTA 2CF8H 4LOYH 1MUEB 1KDQB 1UVSH 1QL8A 4X6NA 1FJSA 1QR3E 1GWAA 2KZ4A 3RXDA 5TJXA 3M7QA 1HAZB 1QQUA 4Y0ZE 5AHGH 3BEIB 5AFYH 2GV7A 3N7DA 4YLQH 4MNYA 1L4DA 3FP6E 1MKXH 4DCDA 4MLFB 1NPMA 1ZPCA 1SB1H 1FMGA 3P6ZB 3LKWA 1TYNA 1P2NA 5CE1A 2SFAA 4AC9A 1Y3WA 2R0LA 2V0BA 1O3CA 1C4Y2 4Y11E 2G4UA 5FL7D 2Q6FA 4LK4A 1FUJA 4AFZA 4OS7A 1SVPA 2KAIA 4ZHLU 4A6LA 1KTTB 4GHQA 2F3CE 3DCLA 5GCHF 4F49A 1NRQH 5L6NH 1EB2A 3S9BA 5FCRA 4FUIA 1AUJA 4TY7A 5HGGA 3TK9A 4AFUA 3VB4A 1GBJA 3MH7A 1VITH 3N99A 3A81A 3RXEA 1B0FA 2HLCA 1KXCA 1EUFA 3SORA 1L1JA 3E3TA 1V2QT 3FKSD 5F8TA 1AKSB 1O5DH 1NZQH 1DWBH 2OTVA 1GJ4H 3SU0A 3VB7A 1OP0A 2EQNA 1PQAA 1UK2A 1UCYK 5FAHA 4X6OA 3KHVA 2BOHB 2BX4A 3FP7E 3ZZ3A 2BYAX 1G3CA 2P59A 1C5YB 1E0FD 4IC5A 1MMJN 1AVWA 1GI8B 1O2IA 1ZHMA 2CN0H 1SGNE 3Q3YA 2W5EA 3NKKA 1RTFB 4NA8A 2PKAB 3DA9B 2ANMH 4WJG2 4GAWA 1MTWA 1Q3XA 3PRBA 1J8AA 2Y5FA 1UTQA 3LOXA 1EP6A 3WWFA 3GYLB 1QURH 2PKSC 2Z7FE 3KEEA 2VBCA 1WYKA 2C8XB 1FAKH 1ABIH 1K22H 1VGCB 1OWJA 2IN2A 1ELVA 4RI0A 3VB3A 1TGNA 1O5BB 1E1QD 1BTYA 4FVBA 1ZRKA 1EJNA 2PKSB 2AH4X 2YNAA 4BTUB 5DP3A 3M3SA 4OS2A 1BIOA 3RMOH 2FTMA 1LKAA 1BTPA 1TGTA 1E79D 1P11E 4OM9A 4UEHH 4FUJA 1ELFA 5A0CA 1V2MT 1ZMNA 4KGAA 4FETA 1N6XA 2Y7ZA 1QB1A 1Z71A 2ZZUH 4ZH8A 1GMHG 3EA8A 1GI6A 1GBKA 3A7XA 4BAOB 3U98H 2ASUB 1D6WA 1SFQB 3EAJA 2BY5X 1G32B 2AMPA 4AFSA 4MPVA 2RG3A 1JRTA 2FESH 3WWBA 2ANYA 1K28D 1T31A 1DLEA 3PYHA 4GCHG 1Q31A 3T29A 1VJAU 1AI8H 1A0LA 2ANWA 2GGVB 2GZ7A 2K8IA 1GBLA 4A7IB 1RFNA 2YNBA 3TH4H 4DIIH 1GPZA 3PLKA 3RP2A 1OWIA 1IHSH 5L30H 1F92A 5J4SA 2ZFFH 4O3UA 1SGRE 2V6NA 3ZZ7A 1HYLA 1NM6A 2ODPA 3T28A 4XSKU 3TPIZ 3RMNH 2CK3D 2PTCE 4Y7AA 3S0NA 3EE7A 2SGFE 2BVRH 3KYFA 1SI5H 3BTQE 5ESTE 3SU4A 4Y76A 2FMJA 1O3KA 2GJGA 3OAAD 4X6PA 1PPGE 2QXIA 5EXMA 1HAPH 1JWTA 2XBXA 3NXPA 5EPYA 1GDQA 1T8MA 1DS2E 4X8SH 2BDGA 4YOIA 1NU9A 1IQJA 2Z3EA 1HB0B 2FX4A 3PTBA 3DFLA 1FPHH 3AVZA 3F0OA 2PTNA 2BY6X 2G00A 3D49H 2GTBA 2GKVE 3M5MA 1SGCA 1ELAA 4JZ1A 3UFAA 1TX7A 3URDA 3U8RH 4FU8A 1T8NA 3FN8A 4U2WA 3RXSA 3CS7A 3PRDA 3T26A 2VGCC 1SGIB 3QUMP 1W12U 3E8LA 2A4QA 1ANEA 2DUCA 4K3JA 4CREA 1O2GH 2GZ8A 2XNIA 1ZPZA 4I8JA 1Y3VA 2Z9IA 2ZHWH 2NU3E 1TFXA 2VGCB 1BZXE 1G3BA 3A8CA 2M2AA 3S7HB 1DOJA 1UTOA 3BTKE 1GHBG 3I78A 2JDID 3ATMA 4NZQA 3QN7A 1GHVH 1WSSH 1M9UA 4H4FA 1O2JA 1QJ6B 5LGOA 2XYAA 1W13U 1O2HA 2ZU1A 1N1LA 1XXDA 2HNTE 2QC2A 4KTSA 4GPGA 5JBBS 4DVAU 4WXIA 1UHBB 2BLOA 2WUBA 1J17T 1OYTH 1S0QA 4K69A 5EPNA 4ASUD 5HXFA 1A61H 3KNXA 2ODYB 3VPKA 2ZP0H 5E0JA 5EG4A 3GY4A 1GHYH 5LH8A 2H9TH 2V7QD 1SSXA 3RXOA 3SQHE 1EAUA 1DANH 2ZECA 2ZGHA 3ATIA 3E0NB 5F6MA 4XFQA 1ZHRA 1HFDA 3V0XA 4ISIH 2OD3B 3A88A 1ESBA 1C5TA 2F9PA 1PPZA 1TOMH 3F68H 1GDNA 1C5VA 2FX6A 2D26C 1C2LA 3SI4H 2PW8H 1J9CH 2OC1A 3MO9A 5HYOA 2ODQA 2ZGXH 1TPOA 1O34A 3ATLA 1O2RA 5K0HA 1CHOG 3BTGE 5TCAA 5DKMA 3OFND 2HNTF 3O8RA 7KMEH 1RS0A 1XKAC 1BA8B 4ISOA 5C20A 1WQSA 3AW1A 4MPWA 1SGQE 2BDAA 2ESTE 3Q3XA 1F2SE 2OXSA 2G8TA 2PSYA 4KP0A 1TABE 2VVVA 4INHA 3E1XB 2C90B 4NWKA 1V2RT 1XUKA 4DG4A 4X2WA 7ESTE 4OS6A 2YMSD 1LPZB 1C5MD 1SQOA 1C5WB 4AGJA 2I6SA 2ZPSA 1RGQA 4Q4LA 4I7YH 1CO7E 3F2GA 3PMHB 1TA6A 1V2NT 3DSOA 1YPEH 3EA9A 1G3EA 3TK5A 4BNRA 3UR9A 4R0IA 4ZMAH 1PQ8A 4QT8C 2ALVA 3ZYEA 2FYQA 2Y82A 2V3MA 2J98B 3I77A 1DM4B 3PMAB 3SGQE 3V13A 1KXDA 4Y8ZA 2J34A 5ESBA 3PMBB 1W11U 1QRXA 3UR6A 2ZCKP 3ZIAD 1TIOA 4YOJA 1T7CA 2ZDAH 1SG8B 4XDEA 3TVJB 1QJ7B 5C0UA 1A46H 3BIUH 1DICA 1IQLA 4MNWA 4ZXYH 4JYUH 2QXGA 5CMXH 1ETRH 4KTCA 3SUFA 2PGQB 1V2TT 4NA9H 3P17H 3O8CA 2FOCA 2ZIQH 3NCLA 3MNBA 1QY6A 1FLEE 2D1JA 3KQBA 1P06A 1Z8IB 4ZKRU 5JDUB 3B8JA 1AE8H 3BIVH 5DJ7A 3MMGA 1NFYA 1BTXA 1TNKA 2QF5A 3BTFE 4FUDA 1P02A 2DE9A 3P95A 4FUFA 4WXVA 3ZZAA 2XOKD 4AN7A 1GMCF 1HNEE 1V6DA 3FP8E 5C67A 1V2OT 2FS8A 5EW2H 2BDBA 2KAIB 2Y6TA 1S5SA 4ABFA 1UVTH 3MFJA 3U1JB 1GCTC 1LTOA 4RN6A 4XBDA 1KY9A 2NU4E 3RXVA 2K1QA 3GS9A 4XBCA 3VEQB 3TGKE 3BG4C 4FXGH 1GCTB 1NRRH 1QBOA 3MU8A 1INCA 3RU4T 3B23B 3O8DA 1Z8RA 2BD4A 5T6GA 3BG4B 3DSPA 1NFXA 1UTKA 1J16A 4ABIA 4PROA 2ZU4A 5C17A 2TRMA 4NWLA 2B7DH 2Z9JA 5DP5A 1WQVH 5E2OA 4Y7BA 2VU8E 5A8XA 1S83A 3DT0H 1SLUB 3ZVDA 1MKXK 4KKDA 4X1NU 1LCYA 4B74A 4D9RA 3M3TA 1LHEH 3QLPH 1YWUA 2PUQH 4NSYA 1E35B 4I33A 1BRAA 1HDTH 4RSPA 2QF0A 3QWCH 1QL7A 4YO9A 2WPKS 2O9QA 2Y5GA 4NSVA 1QZ8A 2P94A 3BTDE 1O2UA 4WMFA 1YCPM 1TNGA 2TPIZ 3T5FH 1TBZH 1ZPBA 1UMAH 2KM0A 3SNDA 5EJ1A 1P9SA 2JJ2D 1BQYA 3URCA 5FCKA 1NT1A 4JK5A 1BRCE 1ANBA 1IQEA 1W7GH 2A5IA 1WTGH 2G51A 3SJIA 5C5OA 1W0JD 2BOKA 3A7TA 1CE5A 2ZHQH 2ZGJA 2HOBA 1P2JA 3MH6A 1HRTH 5IK2D 4CHAC 1OPHB 2B5TB 4X6MA 3K9XB 5CHBA 4NGAH 4ZHMU 2XNDD 6GCHG 1TPAE 1C5QA 1DT2A 1ZMLA 4RT1A 4YESB 4NIYA 1FY3A 1LHCH 4DY7B 1F0RA 2WUCA 3UWIA 3LGUA 5BRRE 1F0UA 4CRGA 1NRNH 4H6TA 5C2ZA 1FZZA 4NIWA 1SGDE 4CHAB 1LVBA 2SGQE 5F03A 3UWJH 4I8GA 4CR9A 1VCQA 1P2IA 3LPRA 1S6HA 1UO6A 4INKA 4VGCC 1YCPH 1D4PB 3K6ZA 1HJAC 3CP7A 1MAXA 4MNVA 1KXEA 1OP2A 4P02A 1QL9A 1ZSJA 4R8TB 1HV7A 3TU7H 3ZZ5A 1PPHE 3VGCC 3NK8A 4AG1A 3A82A 4NCYA 3SBKA 1WBGB 1N8OC 2VWNA 3NRLA 4VGCB 1KXAA 3D23A 1O2KA 3A7YA 1O3FA 1HJAB 4UE7H 3F1SB 1CA0C 1CU1A 1JOUB 2C8WB 3VGCB 4J2YB 2IPHA 2R3YA 2CJIA 1ELGA 1N8OB 1MQ5A 2GVFA 1RTKA 2W7UA 3SHAH 1TGBA 1FY4A 4Y6DA 1RIWC 3RXTA 1V2PT 1GL1A 5FX6A 1GBMA 4X1SU 2ZDLA 1C1SA 1GMHF 2HVXA 1HAHH 3BTHE 4Z0KA 4INLA 4AX9H 3Q3KA 4UFGH 3MNXA 4I86A 5C1YA 1EOLA 2FPZA 1RIWB 3RLYH 1MBQA 2P3TB 3JZ1B 3M7UA 1YLCA 2AIQA 1BBRE 4YOGA 4GCHF 1DUAA 1ABJH 3GY2A 4HI3A 3U8OH 1J15A 2A5KA 5HIZA 1EP5A 1X7AC 1FY8E 1TX8A 4HGCA 1DVAH 2H5CA 1EZUC 1ORFA 1RRKA 4K1TA 1GI2A 1H8IH 5IDKA 1SC8U 2ZHFH 3AW0A 3HPTB 2Q6DA 5DO4H 3L6PA 3EYDA 1SLWB 1G2LA 2WPIS 1DITH 1A3BH 2GMTC 2SNWA 1GHAG 3A80A 2PWXA 3RM2H 1FIZA 3AASA 1T4VH 5EOKA 2TGPZ 2ZNKH 1GI1A 2XC4A 1C2MA 1BTZA 3HKIB 3OYPA 2Z9LA 2GT8A 1C5UA 1FY5A 2GMTB 2QGRA 1F5LA 3QTOH 4AB9A 4YT6H 3MO6A 2KCAA 1ELTA 3OY5U 1EZSC 2J5UA 4BOHA 1ZYOA 2L6OA 4D7FA 1K1NA 1AO5A 1G30B 1HAVA 3ZVCA 1GJCB 3A83A 4MVNA 2SGEE 1FIWA 1MTVA 2ZTXA 2WSSD 1A1RA 1JIMA 2ZFRH 4THNH 1O3OA 2HVYB 2OBOA 2QXHA 2ZGCA 3M5LA 5JB9S 5DP4A 2QA9E 2NU2E 2WZQA 2ZCHP 3Q77A 5T6FA 1DWCH 2FOFA 3GY5A 2UUFB 1GJ7B 1VGCC 3M36A 1A0HB 1O3HA 2THFB 4OS4A 3S69A 1HJ8A 5EQSA 3F0PA 4BAKB 2KFWA 4X1PU 2O8MA 1DLKB 4Y8XA 2ZTYA 4X1RU 2BD8A 5CHAC 1CBWC 4ZKSU 1ZJKA 4Y71A 2K0QA 1UTJA 4ISHH 2Q6GA 1A0JA 1ID5H 2V35A 4ZAEA 1S0RA 1HPGA 2PV9B 2BLVA 5CHAB 1AVXA 1S85A 4Z6AH 1CBWB 3WY8A 1GHBF 3D62A 4MDSA 1NBME 1O2XA 2KCOA 1ARBA 2FI4E 5A2MH 2ANKH 5A8YA 1LHDH 5DGJA 2GP9B 2VWLA 2J38A 1ZTKA 5FPSA 3VB6A 1F7ZA 1V2LT 2Z9KA 5IYTA 2IPQX 1HJ9A 3ZVAA 1V2WT 3LGVA 1SGPE 1YPMH 3BN9A 5EIYA 2H2ZA 1VR1H 4LZ4B 2BQ7B 1LVMA 1EKBB 3SUEA 1SGFG 1K9OE 3LJJA 1MD7A 1FQ3A 1TMUH 2BD3A 5C3NA 3ZZDA 4BTTB 1ELDE 5EJLA 2GX4A 2BLQA 3F6UH 3WW7A 2QF3A 3GDSA 2W3KA 1O36A 2AS9A 5C5NA 3RXIA 1KXBA 1O5GH 1CT0E 3VXFH 3QZRA 4B71A 4O03A 1YPJH 1ZMJA 4CBNA 4ABHA 1C5XB 1AVGH 1DWEH 3F9EA 2Y7XA 1RD3B 4DW2U 1A3EH 1LVOA 3VB5A 4ACBA 1MAYA 1O3MA 1NBMD 1KLTA 3SZNA 3TNSA 4ABBA 1CHOF 1P8VC 3CS0A 2WV4A 1EQ9A 2PUXB 3TH2H 1CGIE 4XRNA 4BAMB 2YOLA 1SGTA 4B75A 2BDHA 1W7XH 2FS9A 5EODA 1EXFA 4CH2B 1DWDH 3LU9B 2OC7A 1YF4A 2ZTZA 3DHKH 3SGBE 4YLUA 2WINI 1BMFD 3KIDU 1K1PA 1O2LA 3RXPA 1DUEA 8GCHF 3FZZA 1C1RA 1GBHA 5DPAA 4Q7YA 1HAXB 1VZQH 5DP8A 1KYNA 3UY9A 2BM2A 1AIXH 2ZHEH 3LGYA 2BD5A 5FXLA 2H9EH 3LONA 2JETC 1O3DA 1RXPA 3E6PH 4WWYA 1C1TA 2FO9A 3RMLH 1ZSLA 1Y3XA 3UREA 4D8NA 1CT4E 3QX5H 1CQQA 4IN1A 3LGWA 4O97A 2OQUA 5DSFA 3SZEA 1HIAA 3UTUH 3HKJB 1XUFA 1Q2WA 3SOSA 1H9LB 2G52A 1KSNA 2JETB 2BHGA 3M5OA 1H8ED 4HZHA 2VIVA 3GYMA 3RXUA 3MWIU 1LQEA 1TPSA 1L1GA 1AZ8A 3H7TA 2GDDA 3GOVB 1QA7A 3W1EA 5EXLA 3OU0A 3IG6B 1ANCA 1T32A 3RMMH 3F9GA 1UK3A 2EI6A 4GLYA 1LVYA 1D3TB 3ESTA 2F83A 3LIWA 3QO6A 2TIOA 1BJVA 5HKKD 5DP9A 5KEDA 2Z3CA 1MKWH 1YPGH 2J94A 3LH1A 5JYIA 1DX5M 5A09A 1ZTLA 1E36B 4TWWA 5PTPA 1BHXB 1L1NA 2ZWLH 3MYWA 1C1NA 1TAWA 3LJOA 1EZQA 2JH5D 1SGFA 5FHTA 3MH4A 1OKXA 2FI5E 1AFEH 2SGDE 2VH6A 1P12E 3A7VA 4B2AA 4F55A 2BXUH 1UJ1A 4WMDA 7GCHG 4AOQA 1P2QA 5C0TA 2A7CA 3B9FH 7LPRA 1O3LA 3GY7A 5EGMA 3SV8A 8ESTE 3ITIA 1THRH 4BXSA 2A32A 1NESE 4Y8YA 2BMGB 2A2QH 1UCYE 4XOJA 1EASA 3GCTG 1SFIA 4SGAE 4Q7XA 3KL6A 1BMLA 2G81E 3OY6U 1C4U2 1O3BA 1UK4A 1ELCA 1P2MA 3T2NA 3STJA 2Y81A 2W6JD 1GJ6A 1QRZA 2JH0D 3A84A 3A8AA 1FN6A 2BY9X 1PPFE 5JPMH 1NRSH 4J1YA 4AYVB 2BVSH 2JH6D 4K5ZA 1MTUA 1JXPA 1GBEA 1O2TA 1SR5C 2FLRH 1HLTH 4JYTA 2VWOA 3K65B 2UWOA 5LPEA 1C4V2 1SHYA 1OHHD 4X2YA 4X8TH 2FLBH 1QA0A 5K7RA 1MCVA 3VG8A 5HIYA 1TB6H 2ZFPH 3S7KB 2UWLA 1AGJA 3LH3A 3SI3H 2G4TA 4JZIA 3F2FA 2F9UA 1A2CH 3OSYA 4GUXA 4A1TA 1W8BH 4E7RG 2ZG0H 3UNRA 1MD8A 1IOEA 3UNSA 3K2UA 3UOPA 3SUGA 3PLBA 2ZKSA 1GCDA 1GI4A 2LELA 1GBTA 1LDTT 1TNLA 1VITG 4D76A 2KR7A 2F9VA 2W3IA 2ZO3H 1KMHB 1PYTC 3UPEA 3C27B 2A45B 1G2MA 2ALPA 1Z6JH 1OWEA 1TBRH 1MCTA 1FXYA 2EY4C 3SHCH 2Y80A 3PWCA 2XW9A 2BQWB 3ZVEA 1D6RA 1QJ1B 3KQDA 2FOMB 2FI3E 3KCGH 2FXRA 4OGYA 3ZVFA 4MNXA 4FUBA 2A4GA 1DSUA 4MQAA 5HM9A 2VVCA 1OWHA 1Z8JB 4X8VH 1PPEE 3LDXH 1G37A 1C2DA 1C5ZB 1SPJA 2FTLE 3TIUA 2ZFQH 4A1XA 2BLWA 1FDPA 3LC5A 4K60A 3SU6A 6GCHF 2GCHG 1V2JT 1ARCA 1O2WA 2O8TA 4AZ2B 1C2FA 3RXKA 2P3FH 5ETXA 4AGKA 1EX3A 1WCZA 3P8NA 2Z6BD 3FAOA 1SMFE 2AIPA 2KCYA 2SGPE 3RXAA 5C1XA 2XTTB 6LPRA 1D9IA 2XCNA 1SHHB 3AK5A 2XC0A 1OWDA 1QIXB 1BTHH 1ZGVA 2CXVA 2O8WA 4NIVA 3HATH 1AE5A 4YZUA 1AHTH 1BRBE 3R3GB 5SGAE 2HPQH 1LMWB 3BTEE 1YYY1 2QYIA 1C2KA 1TGSZ 4F4OC 1S81A 1XXFA 3PM3A 3RLWH 2ZQ1A 1YCPK 1O2NA 1GI9B 3RXJA 1C9PA 3PV2A 4FOUC 5E0HA 4BAHB 2WV9A 5GPIB 2RA3A 2G55A 2ZDVH 1CT2E 1OS8A 3ZZ4A 4JK6A 2ZC9H 3SV6A 1FX0B 4DJZB 2UUYA 4K1EA 4B2BA 1K1JA 1GVKB 8KME2 1THSH 2YMSC 2FOBA 4I8HA 2FOEA 1HAYB 1XUHA 2KCPA 1YLNA 2BY8X 2GZ9A 1U6QA 3F9FA 4NG9H 4MG3A 2F91A 2YMSB 1P57B 1E1RD 3MQKC 3ELAH 1YBWA 4WY3A 2QXJA 1TRYA 2A5AA 1GBAA 2STBE 4DURA 2P8OC 1GI3A 1LHGH 4Q2KA 1GI7B 1HAVB 1JMOH 2AMQA 2QF4A 2HGTH 5JBAS 1ZOMA 2WPMS 3KF2A 6CHAC 1GMDG 5KECA 1TGCA 2EC9H 1O5CB 1TNIA 4RKJB 1Y5AT 2P8OB 1NU7B 1E37B 4O3TA 1MTSA 2P93A 1YPHC 2FIRH 1GI5A 1GHAF 5F8ZA 1TNJA 6CHAB 1W0ZU 4NA7A 4MPUA 4WMEA 4X0WU 1TQ7B 2GCTC 1WUNH 3HK3B 2VJ1A 3L3TA 4FUHA 1C1VH 3HGNA 1P2OA 3SJOA 4DIHH 4F48B 5AF9H 3RC6A 1CGHA 2IJOB 1SGEE 4IMQA 4XBBA 2GCTB 2H9HA 4TWYA 4X2VA 1L2EA 4K1SA 4AFQA 1L0ZA 1BB0B 1YKTA 1P05A 1C1UH 1K2I1 4JZEH 1W3CA 3SU5A 1BBRH 3NUMA 1FY1A 2VVUA 4YM9A 3ZZ6A 4ZCNA 2BZAA 3VFEA 2B8OH 2HWLB 3OX7U 2CV3A 1HXEH 3TGJE 5E0GA 1XVOA 5EXNA 2WV5A 4AB8A 1S6LA 1EJAA 1F5KU 1ELEE 1PQ5A 4WVPE 3ZZ9A 4FUGA 2OK5A 1KLJH 4CRCA 1DSTA 3CNRA 2F43B 3OEHD 2ULLA 2P3UB 1D3DB 3MHWU 5JBTA 1XM1A 3M37A 4NFEA 5L2YH 2AHME 3A89A 3QTVH 1BMMH 1H8HD 5KGOA 4E06H 1GJ5H 5GXPA 1C5LH 2M5TA 1FONA 4IS5A 1H9IE 4B2CA 2PHBA 1MH0A 2BQ6B 1EAXA 1NS3A 2BXTH 1A5GH 2W6ID 3BEFB 3RC5A 4JCNA 1OX1A 3E0PB 4JMYA 5GIBA 2XRCA 4X1QU 2C8ZB 3P8FA 3ZZBA 3GY6A 3PWBA 2J9NA 1COWD 2FZZA 1BOQA 2F9OA 1EFRD 2A2XH 1DPOA 3SU3A 1S84A 4TYDA 2J2UA 1L4ZA 1TQ0B 3KQ5A 3M5NA 1O5AB 1YPKH 2WPHS 2VIWA 4XD7D 2BX3A 1AY6H 4E7NA 1QRWA 1C5RA 2ZQ2A 1XMNB 4Y79A 1TLDA 4ZUHA 1EJMA 1OWKA 2ZGBH 2RA0A 1GJ9B 1T8LA 1QFKH 3SJ9A 2B0FA 3TLOA 3IITA 3RXHA 4ZKNU 3MU1A 3RC4A 3DSGA 4I8KA 2ZU2A 3QZQA 4ABEA 1C5OH 4O9VA 1GJBB 2NWNA 5HM2A 2A0QB 1T8OA 4WH6A 3BEUA 1KIGH 1ESTA 3G01A 1FNIA 2R2WU 1BCUH 3Q00A 3NZIA 3U8TH 1IQGA 3GDUA 5EJZA 3F9HA 1SQTA 2RDEA 1NY22 3PV4A 2Z9GA 1SKYE 3T25A 2CGAA 2JJ1D 1SGYE 3GDVA 3KN2A 3BF6H 1HIAB 1B5GH 3H7OA 2EI8A 3P8GA 3SV9A 4JYVH 3RXLA 1P04A 5A8ZA 4ZKOU 3BTWE 4OGXA 1BUIA 1BMAA 5EQRA 1SLVB 1V2VT 2RFKC 3SGAE 1NROH 1IQNA 2O8UA 2QIQA 1OOKB 4UFDH 1HGTH 1MU6B 1O2VA 2ZI2H 3FFGA 4GHTA 4B6FA 1UTNA 2ZDMA 5C94A 3TGIE 2IOTA 1O31A 3SN8A 2VIPA 1GJAB 4A1VA 1XX9A 4ZROA 2KX4A 1TPPA 3RU4E 3LC3A 3ODFA 2R2MB 4Z1MD 2WYJA 2VIOA 4IN2A 5TCCA 3A8BA 3L33A 1O39A 2AGIX 1DY8A 1H9HE 1O38A 1AZZA 3SJKA 1A5IA 2G5VA 3DUXH 3SUDA 1H4WA 1AU8A 1ZLRA 1IQKA 1OP8A 3BG8A 4OS1A 1NFWA 3A85A 1YP9A 3A8DA 1SBWA 3MOCA 2CMYA 3U1IB 2BD9A 2R3UA 4U01A 3RXRA 1O2MA 1MQ6A 2PP6A 3MI4A 4KTUA 1D3PB 2VNTA 3RXCA 1Y3UA 4FU9A 2BZ6H 4BANB 1QNJA 5A0BA 1GL0E 2WPLS 1IQIA 5H4IB 5BPEA 1O3GA 1IQFA 1C2HA 2ZA5A 1NN6A 3E90B 2LPRA 1EB1H 2A1DB 1GHWH 1TMTH 4GSOA 1ELBA 2D2DA 3ENSB 3RXBA 2O8LA 1BT7A 3RU4D 3ZYDA 1SQAA 3EE0B 1AWHB 1H8DH 2Z94A 3FOAA 4DT7B 3W94A 7GCHF 2UUKB 1EPTA 1C9TA 2TGDA 1MKWK 1LPKB 1GG6C 1Y59T 3KQEA 3EDXB 4FUEA 3EGKH 2ZU5A 1XKBC 1P0SH 2V3HH 3HGPA 1K1MA 3KYGA 1G36A 3BV9B 2NU1E 5G4BA 4AG2A 2J95A 3RXMA 4A92A 1O2SA 2XC5A 3GCTF 1GG6B 1YLDA 3UUZA 3F3BA 5CDFE 4ISLA 4GVUA 1B7XB 1ZTJA 1NO9H 2FODA 4OS5A 3N7OA 3T27A 4D7GA 2W26A 3SW2B 2FOHA 1C2JA 4RKOB 1BRUP 4ZHAA 3TJOA 2R0KA 4HTCH 5DN6D 1IHTH 2FOGA 5B6OA 1YPLH 3U28C 2BY7X 1Z1JA 3BTME 4B73A 2D8WA 3MU4A 2SNVA 5GJ4B 1P09A 1BHXF 3E16B 4XE4A 3OTJE 3BSQA 1V2UT 1HAGE 1MZDA 3PROA 3BTTE 3GY3A 3ZVGA 3F2HA 4FVDA 3DD2H 4Y10E 1P10A 2L74A 2JKHA 2OP9A 5J4QA 3SJ8A 4CR5A 1GBDA 5GCHG 3P92A 2UWPA 2C4FH 5LPRA 1KDQA 5EW1H
chains in the Genus database with same CATH topology
1VITF 2VWMA 2QV1A 1W14U 1GDUA 2F9NA 3A86A 2AYWA 5FPTA 3P8OA 3A87A 3SU2A 2OLGA 1UCYH 1QHRB 1G9IE 1O37A 2OBQA 2PGBB 1HUTH 2A7JA 2H6MA 1SOTA 1YC0A 2J92A 3RXGA 1Z8GA 4Y0YE 3ZZ8A 1XUIA 1K1LA 2TBSA 4H42U 4NZLA 8LPRA 3A7WA 2FYRA 4K8BA 5DG6A 2AGEX 1UVPA 4HFPB 3U69H 1RTLA 4SGBE 4WF8A 2C3SA 3TJUA 4CRFA 5I25A 1Z7KA 3V3MA 4I32A 1AUTC 1TBQH 1C1OA 3A7ZA 2STAE 2WYGA 3TH3H 1GGDC 5AVDA 2VIDA 5I46H 1UTLM 1TNHA 5FX5A 1Y5UT 3NPSA 2OINA 1O35A 2H1UA 1F0SA 3GCHC 4X2XA 3STIA 3MNCA 1AFQC 2GCHF 1Z6EA 1BJUA 1GGDB 1O33A 4ABAA 3RM0H 1P03A 4A5TS 2GD4B 1B0EA 1O3NA 1WU1A 1QB6A 3GCHB 1AKSA 2B9LA 3DFJA 1CGJE 1AFQB 1O5FH 4TPYA 1WTHD 2BTCE 4IGDA 1IQHA 1BTWA 1P01A 4NIXA 2C8YB 1VCPA 4NFFA 3T62A 1QBNA 1Z1IA 1C5NH 3ZV9A 4IW4E 3KGPA 1O2PA 3SU1A 1PYTD 3W95A 5A0AE 1SL3A 1O2ZA 1TONA 2PLXA 1BITA 1ETSH 1GI0A 1JRSA 2BDCA 3FANA 4IC6A 2XWAA 5C1UA 4CRBA 1GBFA 3V7TA 3UQVA 2F9BH 1VCWA 1WAYB 1O3EA 2PKAA 3M3VA 3SNCA 1C1PA 5GDSH 2EI7A 1A7SA 3RUOA 2GT7A 4AORA 2TGAA 3PMJA 3AAVA 2RCEA 4I31A 1CSOE 1Y5BT 5FBEA 2QY0B 1A4WH 3ZZCA 4TY6A 1O32A 1ESAA 1GBBA 3PTNA 1PPBH 1VJ9U 4CRDA 1EAWA 1C1WH 3PB1E 2ZFTA 2GV6A 1SOZA 3MU0A 1WOFA 2RDLA 3KQCA 4I8LA 3GICB 4ASHA 2GDEH 3SNAA 1UTMA 1ZGIA 1JBUH 2FP7B 4YTAA 3FZDA 4ISNA 2ILNA 3M7TA 1C2IA 5EU8A 2PFEA 2ZF0H 2VINA 1GVLA 1UVUH 2ZHDA 2ZPQA 1N6YA 3QDZB 2XBYA 1GMDF 5ABWA 1K21H 1O2OA 3LGIA 4TPIZ 2AERH 1QCPA 3P70B 1TOCB 1DE7H 5T3HA 1XUJA 1NC6A 1TRNA 4BTIB 1O3PB 1EZXC 5DP6A 3S9CA 4U32A 1YPHE 1BTUA 1MTNC 1P9UA 4BXWA 1MZAA 2VB0A 8GCHG 3UIRA 4UFFH 2HPPH 3RXQA 1TMBH 3SNEA 4MTBA 1THPB 4ABJA 1PJPA 4IMZA 1MTNB 2BB4A 1C2EA 1LKBA 1ZRBA 3TJVA 4WH8A 1DXWA 3IWMA 1QTFA 1AB9C 2XWBI 5E8EH 9LPRA 2CF9H 2BDIA 1T4UH 2H5DA 2XBWA 3SV7A 2CHAC 1W0YH 1DY9A 2A31A 3UQOA 1AB9B 1FI8A 1E34B 4JZFH 3JZ2B 3MH5A 4DOQA 1CVWH 4B1TA 1DXPA 3K6YA 1XUGA 1BBRK 2SGAA 3RXFA 2CHAB 1UTPA 1BMNH 1AN1E 3MTYA 4FU7A 4ZXXH 3SO3A 3AAUA 2AGGX 3D65E 1YGCH 1GJDB 4U30A 4ABDA 1P2KA 1TALA 3CENA 3E91A 1SLXB 1TE0A 1WV7H 2HALA 1KTSB 3QGJA 4FUCA 3UOUA 1O2QA 5DP7A 3U9AH 3S9AA 2FDAA 1NFUA 1O3JA 2A4OA 3ODDA 5T6DA 2HNTC 3ATKA 4X8UH 2XXLA 3ZVBA 1Y8TA 4DGJA 2OQ5A 1O5EH 1OYQA 1IAUA 4ESTE 2OC0A 3TNTA 1K1IA 1A5HA 2Z3DA 2WPJS 3M61U 2FM2A 5DK1A 1FV9A 1W2KH 1DFPA 2PR3A 1O3IA 4D9QA 4E05H 1H1BA 1HAIH 1V3XA 1O30A 2FEQH 2J4IA 2VH0A 2ZDKA 1HBTH 1J14A 5EQQA 1RJXB 3QGNB 9ESTA 1FN8A 2FOAA 3H5CB 1F0TA 5HMAA 1QGFA 1XVMA 3GY8A 4CH8B 1P3CA 3RDZA 1C1MA 3LGTA 2V3OH 3LT3A 3MNSA 5JB8S 2QAAA 1C2GA 2BD7A 3I29A 3PLPA 1G3DA 1QB9A 4CBOA 2EA3A 2G5NA 2ZDNA 1KLIH 2A7HA 1ZSKA 2W7SA 2OC8A 2XCFA 3VXEH 1OSSA 3UNQA 5FPYA 2I6QA 2BVXH 5LPFA 1UHBA 5L2ZH 1GJ8B 2AMDA 1GBIA 4H6SB 2P95A 5FBIA 1LPGB 4JZDH 2NU0E 1CHGA 1K1OA 2XBVA 2ZFSA 1O3AA 1AQ7A 2UUJB 1EAIA 3Q76A 1FAXA 2ZPRA 4LXBH 2HRVA 2PSXA 1AMHA 3EQ0H 3PO1C 2TGTA 1D3QB 2A4RA 1NTPA 2OCVB 4LZ1H 1LO6A 2ZU3A 1PFXC 2OUAA 4KELA 3EA7A 2P16A 1BDAA 1OXGA 4CRAA 3ZV8A 1LHFH 4M7GA 3PO1B 5GWZA 1NRPH 1EPTC 1ZHPA 1ZJDA 2Y5HA 3NWUA 4Q80A 1O2YA 3GISB 3SV2H 2VIQA 1F5RA 4IBLH 3FVFB 3TK6A 1GBCA 4AYYB 1E38B 1ACBE 3C1KA 4ABGA 1YM0A 1DDJA 1EPTB 2ZCLP 5F8XA 4UFEH 3MU5A 2BD2A 4BAQB 1ZR0A 1O0DH 3TITA 3M35A 1P3EA 3MO3A 1ZZZA 1GHXH 3QK1A 1IQMA 2Q1JA 1S82A 1QBVH 1TWXB 4MPXA 3GCOA 2BDYA 2ZEBA 4K8YA 1TA2A 4UDWH 1C1QA 1MU8B 3TJNA 1FPCH 3O8BA 1PQ7A 1ANDA 4YT7H 1UVOA 2DE8A 1KXFA 1HAOH 1TX6A 1CA8B 2AFQB 2EEKA 2LNCA 1S6FA 3ATWA 1EOJA 1PPCE 3HK6B 3SNBA 1V2KT 2FWWA 1LQDB 1GHZA 1GVZA 1AD8H 1HCGA 2C93B 4UONA 1JIRA 5JBCS 3GCNA 2QCYA 1GMCG 1HXFH 1AWFH 1ETTH 2QN5T 5AFZH 1QQ4A 3SQEE 4B76A 4Q7ZA 1V2ST 1EATA 1MBMA 3V12A 2R9PA 1C5PA 1TRMA 1C5SA 3R0FA 4UD9H 1W10U 2AEIH 1Y3YA 5E2PA 1CA0B 4K2YA 6ESTA 2CF8H 4LOYH 1MUEB 1KDQB 1UVSH 1QL8A 4X6NA 1FJSA 1QR3E 1GWAA 3RXDA 5TJXA 3M7QA 1HAZB 1QQUA 4Y0ZE 5AHGH 3BEIB 5AFYH 2GV7A 4YLQH 4MNYA 1L4DA 3FP6E 1MKXH 4DCDA 4MLFB 1NPMA 1ZPCA 1SB1H 1FMGA 3P6ZB 3LKWA 1TYNA 1P2NA 5CE1A 2SFAA 1Y3WA 2R0LA 2V0BA 1O3CA 1C4Y2 4Y11E 2G4UA 2Q6FA 4LK4A 1FUJA 4AFZA 4OS7A 1SVPA 2KAIA 4ZHLU 4A6LA 1KTTB 4GHQA 2F3CE 5GCHF 4F49A 1NRQH 5L6NH 1EB2A 3S9BA 5FCRA 4FUIA 1AUJA 4TY7A 5HGGA 3TK9A 4AFUA 3VB4A 1GBJA 3MH7A 1VITH 3A81A 3RXEA 1B0FA 2HLCA 1KXCA 1EUFA 3SORA 1L1JA 3E3TA 1V2QT 5F8TA 1AKSB 1O5DH 1NZQH 1DWBH 2OTVA 1GJ4H 3SU0A 3VB7A 1OP0A 1PQAA 1UK2A 1UCYK 5FAHA 4X6OA 3KHVA 2BOHB 2BX4A 3FP7E 3ZZ3A 2BYAX 1G3CA 2P59A 1C5YB 1E0FD 4IC5A 1MMJN 1AVWA 1GI8B 1O2IA 1ZHMA 2CN0H 1SGNE 3Q3YA 2W5EA 3NKKA 1RTFB 4NA8A 2PKAB 3DA9B 2ANMH 4WJG2 4GAWA 1MTWA 1Q3XA 1J8AA 2Y5FA 1UTQA 3LOXA 1EP6A 3GYLB 1QURH 2PKSC 2Z7FE 3KEEA 1WYKA 2C8XB 1FAKH 1ABIH 1K22H 1VGCB 1OWJA 2IN2A 1ELVA 3VB3A 1TGNA 1O5BB 1BTYA 4FVBA 1ZRKA 1EJNA 2PKSB 2AH4X 2YNAA 4BTUB 5DP3A 3M3SA 4OS2A 1BIOA 3RMOH 2FTMA 1LKAA 1BTPA 1TGTA 1P11E 4UEHH 4FUJA 1ELFA 5A0CA 1V2MT 1ZMNA 4KGAA 1N6XA 2Y7ZA 1QB1A 1Z71A 2ZZUH 4ZH8A 1GMHG 3EA8A 1GI6A 1GBKA 3A7XA 4BAOB 3U98H 2ASUB 1D6WA 1SFQB 3EAJA 2BY5X 1G32B 2AMPA 4AFSA 4MPVA 2RG3A 1JRTA 2FESH 2ANYA 1K28D 1T31A 1DLEA 3PYHA 4GCHG 1Q31A 3T29A 1VJAU 1AI8H 1A0LA 2ANWA 2GGVB 2GZ7A 1GBLA 4A7IB 1RFNA 2YNBA 3TH4H 4DIIH 1GPZA 3PLKA 3RP2A 1OWIA 1IHSH 5L30H 1F92A 5J4SA 2ZFFH 4O3UA 1SGRE 2V6NA 3ZZ7A 1HYLA 1NM6A 2ODPA 3T28A 4XSKU 3TPIZ 3RMNH 2PTCE 4Y7AA 3S0NA 2SGFE 2BVRH 1SI5H 3BTQE 5ESTE 3SU4A 4Y76A 2FMJA 1O3KA 4X6PA 1PPGE 2QXIA 5EXMA 1HAPH 1JWTA 2XBXA 3NXPA 5EPYA 1GDQA 1T8MA 1DS2E 4X8SH 2BDGA 4YOIA 1NU9A 1IQJA 2Z3EA 1HB0B 2FX4A 3PTBA 3DFLA 1FPHH 3AVZA 2PTNA 2BY6X 2G00A 3D49H 2GTBA 2GKVE 3M5MA 1SGCA 1ELAA 4JZ1A 3UFAA 1TX7A 3URDA 3U8RH 4FU8A 1T8NA 4U2WA 3RXSA 3CS7A 3T26A 2VGCC 1SGIB 3QUMP 1W12U 3E8LA 2A4QA 1ANEA 2DUCA 4K3JA 4CREA 1O2GH 2GZ8A 2XNIA 1ZPZA 4I8JA 1Y3VA 2Z9IA 2ZHWH 2NU3E 1TFXA 2VGCB 1BZXE 1G3BA 3A8CA 3S7HB 1DOJA 1UTOA 3BTKE 1GHBG 3I78A 3ATMA 4NZQA 3QN7A 1GHVH 1WSSH 1M9UA 4H4FA 1O2JA 1QJ6B 5LGOA 2XYAA 1W13U 1O2HA 2ZU1A 1N1LA 1XXDA 2HNTE 2QC2A 4KTSA 4GPGA 5JBBS 4DVAU 4WXIA 1UHBB 2BLOA 2WUBA 1J17T 1OYTH 1S0QA 4K69A 5EPNA 5HXFA 1A61H 3KNXA 2ODYB 3VPKA 2ZP0H 5E0JA 5EG4A 3GY4A 1GHYH 5LH8A 2H9TH 1SSXA 3RXOA 3SQHE 1EAUA 1DANH 2ZECA 2ZGHA 3ATIA 3E0NB 5F6MA 4XFQA 1ZHRA 1HFDA 3V0XA 4ISIH 2OD3B 3A88A 1ESBA 1C5TA 2F9PA 1PPZA 1TOMH 3F68H 1GDNA 1C5VA 2FX6A 2D26C 1C2LA 3SI4H 2PW8H 1J9CH 2OC1A 3MO9A 5HYOA 2ODQA 2ZGXH 1TPOA 1O34A 3ATLA 1O2RA 5K0HA 1CHOG 3BTGE 5TCAA 5DKMA 2HNTF 3O8RA 7KMEH 1RS0A 1XKAC 1BA8B 4ISOA 5C20A 1WQSA 3AW1A 4MPWA 1SGQE 2BDAA 2ESTE 3Q3XA 1F2SE 2OXSA 2G8TA 2PSYA 4KP0A 1TABE 2VVVA 4INHA 3E1XB 2C90B 4NWKA 1V2RT 1XUKA 4DG4A 4X2WA 7ESTE 4OS6A 1LPZB 1C5MD 1SQOA 1C5WB 4AGJA 2I6SA 2ZPSA 1RGQA 4I7YH 1CO7E 3PMHB 1TA6A 1V2NT 1YPEH 3EA9A 1G3EA 3TK5A 4BNRA 3UR9A 4R0IA 4ZMAH 1PQ8A 4QT8C 2ALVA 3ZYEA 2FYQA 2Y82A 3I77A 1DM4B 3PMAB 3SGQE 3V13A 1KXDA 4Y8ZA 2J34A 5ESBA 3PMBB 1W11U 1QRXA 3UR6A 2ZCKP 1TIOA 4YOJA 1T7CA 2ZDAH 1SG8B 4XDEA 3TVJB 1QJ7B 1A46H 3BIUH 1DICA 1IQLA 4MNWA 4ZXYH 4JYUH 2QXGA 5CMXH 1ETRH 4KTCA 3SUFA 2PGQB 1V2TT 4NA9H 3P17H 3O8CA 2FOCA 2ZIQH 3NCLA 3MNBA 1QY6A 1FLEE 2D1JA 3KQBA 1P06A 1Z8IB 4ZKRU 5JDUB 3B8JA 1AE8H 3BIVH 5DJ7A 3MMGA 1NFYA 1BTXA 1TNKA 3BTFE 4FUDA 4WXVA 1P02A 2DE9A 3P95A 4FUFA 3ZZAA 4AN7A 1GMCF 1HNEE 1V6DA 3FP8E 5C67A 1V2OT 2FS8A 5EW2H 2BDBA 2KAIB 2Y6TA 1S5SA 4ABFA 1UVTH 3MFJA 3U1JB 1GCTC 1LTOA 4RN6A 4XBDA 1KY9A 2NU4E 3RXVA 2K1QA 4XBCA 3VEQB 3TGKE 3BG4C 4FXGH 1GCTB 1NRRH 1QBOA 3MU8A 1INCA 3RU4T 3B23B 3O8DA 1Z8RA 2BD4A 5T6GA 3BG4B 1NFXA 1UTKA 1J16A 4ABIA 4PROA 2ZU4A 2TRMA 4NWLA 2B7DH 2Z9JA 5DP5A 1WQVH 5E2OA 4Y7BA 2VU8E 5A8XA 1S83A 3DT0H 1SLUB 3ZVDA 1MKXK 4KKDA 4X1NU 1LCYA 4B74A 4D9RA 3M3TA 1LHEH 3QLPH 2PUQH 4NSYA 1E35B 4I33A 1BRAA 1HDTH 4RSPA 2QF0A 3QWCH 1QL7A 4YO9A 2WPKS 2O9QA 2Y5GA 4NSVA 2P94A 3BTDE 1O2UA 4WMFA 1YCPM 1TNGA 2TPIZ 3T5FH 1TBZH 1ZPBA 1UMAH 3SNDA 1P9SA 1BQYA 3URCA 5FCKA 1NT1A 4JK5A 1BRCE 1ANBA 1IQEA 1W7GH 2A5IA 1WTGH 2G51A 3SJIA 5C5OA 2BOKA 3A7TA 1CE5A 2ZHQH 2ZGJA 2HOBA 1P2JA 3MH6A 1HRTH 4CHAC 1OPHB 2B5TB 4X6MA 3K9XB 4NGAH 4ZHMU 6GCHG 1TPAE 1C5QA 1DT2A 1ZMLA 4YESB 4NIYA 1FY3A 1LHCH 4DY7B 1F0RA