1MTVA

Factor xa specific inhibitor in complex with bovine trypsin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Crystal structures of factor Xa specific inhibitors in complex with trypsin: structural grounds for inhibition of factor Xa and selectivity against thrombin.
pubmed doi rcsb
molecule tags Serine protease
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mtvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mtvA02
1JBUH 1TONA 5FCKA 1YGCH 2FTMA 5EODA 5PTPA 3ZVAA 4A6LA 1W2KH 3NUMA 4CR9A 2FO9A 1Z7KA 1HAGE 4A7IB 3BSQA 1ZSLA 2VWNA 2W3KA 4VGCB 2IJOB 1DSUA 3SUGA 3MO9A 3MH6A 2XBXA 4ISLA 1D3TB 4IMQA 2PR3A 2VGCB 5GCHF 3TK5A 1S83A 1UTKA 1ELEE 1TNGA 3RU4T 3T5FH 2EA3A 1O33A 1UHBB 1O5GH 1GDNA 4B76A 4Y79A 4X1NU 1KXCA 1Q3XA 5FX6A 3BTTE 2ZFSA 3QUMP 1OOKB 4WXIA 1C4V2 4ABAA 4Q7XA 1BDAA 1AZ8A 1K2I1 2O8UA 3SI4H 1TRNA 2FOMB 3TJUA 3DUXH 4WMEA 4AYVB 2UUKB 1BBRK 3EA8A 3F1SB 5E2OA 3AAUA 2UWLA 1GI1A 3KQDA 3S0NA 2AEIH 3RC5A 1PPEE 1L1JA 2BX4A 1TMBH 2BDAA 1KXDA 1QA7A 1GJ4H 2G55A 4YO9A 1XXFA 1HAXB 4A92A 1GG6B 1S84A 2PSYA 3KF2A 5EPYA 1SGCA 5HMAA 2XRCA 1Y3YA 4GVUA 3PLBA 1O2TA 1PPCE 4DVAU 2ZGHA 1K21H 5FHTA 1TLDA 3UWJH 4YTAA 1WBGB 1UTQA 1O2UA 1E38B 2GMTC 2XC4A 1YM0A 1IQEA 4NZQA 3P8FA 1GBTA 4UE7H 1UK2A 2WPJS 1S5SA 4AG2A 1TGTA 1XUFA 3ZYDA 2ODYB 3HK3B 2V0BA 3RXUA 1RRKA 1PQAA 2XCFA 4K8BA 3GDUA 1OP8A 1SOTA 1TRMA 3A7ZA 1NFYA 1GBKA 3TH2H 1ZR0A 3UOUA 2BDGA 3MNXA 3UFAA 1QRXA 2BXTH 1TPPA 3TGJE 1O3FA 1BTPA 5ABWA 1AGJA 1O3AA 4FUCA 3LH3A 1F0RA 2F9OA 1EKBB 1GI3A 5DP3A 7GCHG 2R3YA 2GKVE 1SLWB 2VIOA 2PKAA 2XBWA 3RXCA 1HJ9A 1MMJN 4X2XA 1ANEA 3RXOA 1SLUB 2BD4A 2BQ6B 2WPHS 2K1QA 2GVFA 3SU6A 1V2JT 4CR5A 4WF8A 4MVNA 1TQ0B 1MH0A 1T4VH 2CF8H 1O3IA 3MH5A 1XM1A 3A7XA 4SGAE 4B75A 3SJ8A 3UR6A 4LZ4B 1EB2A 1XUKA 3RM2H 2OLGA 2GDDA 2HOBA 1LMWB 4NFFA 1PPFE 2XC5A 1YLCA 2THFB 1TRYA 2AGIX 1FN8A 3P6ZB 1P12E 4AOQA 3FZZA 5E0HA 1UVUH 1CQQA 1K1JA 2OXSA 4O97A 4ISNA 1F0TA 1C1UH 3FFGA 4NIXA 1GDQA 1GI4A 1MZDA 1P04A 3TK9A 1BTUA 1DWCH 1JIRA 3SNBA 3RXJA 1EJNA 1SGFG 1T8NA 1A3EH 2UUYA 4Y6DA 3O8RA 2Z94A 2AGGX 3MH4A 1PFXC 3OY6U 3V3MA 1JOUB 1TBZH 1P2KA 2G81E 2ZQ1A 2PUXB 4UD9H 3MU0A 3SNCA 2GZ9A 1EAIA 1H9LB 4NIYA 3T28A 4ESTE 4GPGA 1C5LH 1GHYH 1GL0E 3E6PH 4ABGA 2FX4A 5GXPA 2WPLS 1O3DA 1GHBF 1GMHF 2O8LA 3M3SA 4H42U 3KQEA 2RA3A 4OGYA 1YBWA 4JZIA 2WPIS 3GICB 1AWFH 3R3GB 5DO4H 3E8LA 5DP8A 1V2KT 2ZFQH 2ZDMA 2TIOA 1DM4B 1H8IH 1WCZA 2F3CE 2RCEA 3ZZAA 1G9IE 2F91A 3VB6A 5I46H 1CBWC 4CRDA 1J14A 1EPTC 3A7TA 4ZMAH 1HGTH 1NROH 4Y10E 1AUTC 2Y6TA 5AVDA 1QJ6B 2YOLA 1UCYE 1W8BH 1ZMNA 5GCHG 3SJKA 2AH4X 3KNXA 1FQ3A 3MYWA 3RMOH 4H4FA 5EPNA 2A7CA 1O5BB 1D9IA 3A82A 1DICA 3PLPA 3MMGA 1ZZZA 1Y3VA 2BQ7B 1O2IA 1H9IE 3LOXA 1O5AB 2VINA 1S0RA 1O32A 2UUJB 4RSPA 2XW9A 2BDBA 4AYYB 1HRTH 1TNKA 4B2BA 3TJNA 4NG9H 1LCYA 4AX9H 5TJXA 4D7GA 2F83A 3QDZB 1MTSA 2BY8X 3ZZBA 1NU7B 3K9XB 2H1UA 3RM0H 2TRMA 3S9BA 2ZFRH 1GJ8B 3BTKE 1WQSA 1N8OC 1OYQA 1E34B 3SJOA 1Z1JA 1UTNA 4O3UA 3QGNB 2PTNA 3ZZ6A 5L2YH 1NFWA 1SLXB 1V6DA 1ZPCA 3RU4D 2GCTB 1HJAC 1CA0C 4O3TA 1P2MA 1SGFA 2NU1E 1GWAA 1SOZA 1KDQB 2BD9A 5JDUB 2W7SA 1TAWA 1LPGB 2FLBH 4TPYA 4E7RG 1W7XH 2HGTH 3P17H 5HM2A 3PMHB 4BXWA 3AVZA 3VPKA 4JYTA 2YNAA 2ASUB 4KTUA 3UUZA 2ALVA 3KCGH 4K2YA 2FI3E 5A8YA 1EOJA 1TE0A 1MTNC 3RU4E 2D1JA 2PLXA 4BOHA 1GHWH 3U8TH 1NM6A 3AASA 3RXTA 2QF3A 1TPSA 2FIRH 1HFDA 1BRAA 2BTCE 2C3SA 1AHTH 4JK6A 1ELCA 1P09A 5EQQA 1HB0B 1Z8GA 3UY9A 2P8OC 3EA9A 3FZDA 3I78A 4FVBA 2G5NA 1BJUA 2SGDE 1Z1IA 1O3CA 4GSOA 1PPHE 2ZFPH 1NS3A 1SHYA 1SHHB 2Z7FE 2JETB 2VIPA 3BTFE 1TGCA 1EX3A 2P93A 4JMYA 2H5CA 1TNJA 3MH7A 2LNCA 1NTPA 2B8OH 1EJAA 3SZNA 5ESBA 1DVAH 1YCPM 1ZPZA 4AGKA 4D9RA 1Z6EA 1UTLM 1OKXA 3VB4A 2BLQA 2FDAA 1DITH 3VB5A 3S9CA 1DWEH 4X1SU 2VNTA 2ZIQH 1YPGH 2ESTE 4MNWA 5BRRE 1V2QT 3SU4A 1WTGH 1ZGIA 1GI5A 3MU8A 1DPOA 4O9VA 3M5OA 1SGEE 1GGDC 2XXLA 5L30H 4Y71A 1YPLH 4ZAEA 3ATKA 1GBMA 3CP7A 4Y7BA 1TX7A 1UVPA 2BD2A 2ODPA 2BD3A 3S69A 3B8JA 3O8BA 2VWMA 3KQBA 2WUBA 2AERH 4UFFH 1GHAF 2HWLB 3MHWU 1TGSZ 4BAQB 3HKJB 1F5LA 1WTHD 2QA9E 1GHBG 1GMHG 1V2ST 3TNTA 3GY3A 2CV3A 1JIMA 1CA8B 1O5EH 2HNTF 1DLKB 1F5KU 1AKSA 4CRGA 2O8MA 3E1XB 4R0IA 2FZZA 1WYKA 2NU0E 4DT7B 1G3DA 4X8UH 5L6NH 3BN9A 3MU1A 4ABHA 1O2KA 1C9PA 5E0JA 1FLEE 1BITA 4D76A 1O2NA 1W13U 1UK3A 4Y0YE 2VWOA 1GJ9B 3UPEA 2VIDA 1ETSH 3R0FA 2FOHA 5H4IB 2GCHF 1HXFH 1HAVB 1P03A 2OINA 5GDSH 1K1NA 4I33A 4CRCA 1ZHMA 4WXVA 5C1UA 1K1OA 2QXHA 2Y5HA 1BT7A 1MCTA 1LTOA 2A32A 4I31A 7ESTE 1XUHA 1VJ9U 6CHAC 4BNRA 1EASA 1CHOF 3CS7A 2I6SA 2ANYA 2FI4E 1DSTA 1V2UT 4E05H 3PWCA 2BMGB 1O2HA 3O8DA 1QB1A 2BY6X 3Q76A 2QCYA 4DY7B 4F4OC 3HGNA 1GPZA 2GD4B 1O3PB 2G51A 4YT7H 3UNQA 3QK1A 4Z6AH 1EP6A 2F9NA 4IBLH 1NRPH 1A61H 4XBBA 1H4WA 1PQ8A 1MTVA 3LC5A 1BJVA 1BIOA 2A5AA 1T7CA 1W14U 1UTJA 2PFEA 1P2NA 2I6QA 4GHTA 4F49A 1Q31A 1O2QA 1TIOA 1MCVA 4CRFA 3P70B 2ZU1A 2ZPSA 9LPRA 2A4QA 3BF6H 2VIWA 4A1XA 1ANDA 3LJOA 1IQJA 5CHAC 5AHGH 5T6DA 1EPTA 1MAYA 3UWIA 1B7XB 1C2KA 2BDHA 3HKIB 3ZZCA 2M5TA 1HBTH 1T8OA 2PTCE 1MTWA 1P2JA 1E35B 2ZFTA 3RXHA 5JB9S 1IHSH 1TQ7B 1IQMA 3RXFA 5C3NA 2OD3B 4DG4A 2ZP0H 2BHGA 4OS7A 4M7GA 2BD5A 1TOMH 2WUCA 2TGPZ 4LOYH 2ZHQH 1LHDH 1QL8A 1SQOA 1UTOA 2DE8A 2ZU5A 5T6FA 2ZECA 2J94A 2PKAB 1KXAA 3QTVH 1YCPH 1EUFA 1O5CB 1GHVH 2G4UA 3K6ZA 2TBSA 3F68H 2A2XH 1C2MA 1HNEE 3UTUH 3PWBA 1G30B 4ZHAA 3K2UA 3RLYH 2CF9H 3BTME 1JXPA 4FUBA 1LO6A 4UDWH 2Q6DA 2WV4A 5FPTA 3ZVCA 4Q7ZA 3VB7A 2CHAB 3SNEA 1O35A 5EQRA 3SU1A 3SO3A 4AFSA 5GIBA 4UFEH 3QTOH 1FMGA 4IS5A 2JKHA 3GY6A 4Y7AA 1W3CA 2GT8A 1GJDB 1O3MA 1O2SA 3SI3H 1C1WH 4CREA 1SLVB 5ESTE 2ZHFH 1KLIH 2RDLA 3DHKH 1ESTA 1TALA 2QN5T 1GJBB 2C8XB 3HATH 1S0QA 5CMXH 1A5HA 2PSXA 4FUFA 2SNVA 3CENA 1AFQC 3I77A 1BMLA 4TY6A 4BANB 3RC6A 1OWIA 1ZJKA 4HI3A 1HDTH 5F6MA 4NCYA 5EGMA 1AUJA 3U8OH 2FPZA 1JRTA 2VH6A 1CT4E 4ZUHA 1ZRKA 4X8VH 4MNXA 3M5NA 3RUOA 1UTPA 5FX5A 4Y0ZE 1MBQA 3GY7A 1AI8H 2J92A 2P16A 1XUJA 1L1NA 1ESAA 4NA7A 2B5TB 2OTVA 1Y3UA 1DLEA 1GCTC 1GHAG 3HK6B 2XC0A 1AE5A 1P11E 1ZSJA 1HPGA 1YPJH 3Q3KA 1KXEA 1QL7A 2AIPA 4MPXA 2FXRA 3GY4A 4JZ1A 1C5MD 2BX3A 2Y7XA 1O2OA 2UUFB 3UR9A 1EXFA 3BEUA 5BPEA 1S85A 1K9OE 2CJIA 1EAWA 3KEEA 1C5PA 2FMJA 1XUIA 4NZLA 1TABE 5C67A 4B2AA 4J1YA 1ARCA 1K28D 2FX6A 2VH0A 3LGYA 1W10U 4NA8A 4D8NA 2GCHG 3TITA 3EDXB 1RD3B 3V13A 5JBBS 3T2NA 5A0BA 4MTBA 3TJVA 2V35A 1EOLA 1KY9A 4ABEA 3DD2H 2TGAA 1CHOG 1C2GA 4X2YA 3GCNA 4ZKOU 2VVVA 3IG6B 1BHXB 2ZGCA 3FAOA 1SGRE 1VCQA 3A87A 1TGNA 3MO6A 4FUJA 2BOKA 2BVRH 3F9GA 1NRSH 1FIWA 3L3TA 5EXLA 3RC4A 4FVDA 1L2EA 4IC6A 4DGJA 4WJG2 1VITH 2ZZUH 5DGJA 1GBAA 1DXWA 4AFQA 1RTFB 3BG4B 3T62A 1QL9A 3PV4A 3W94A 1HIAB 1THRH 2OBOA 2WPMS 1XVOA 2ZNKH 5A0AE 3SN8A 4BAOB 2JH0D 4ABJA 3RXKA 3V7TA 1D6WA 2HRVA 2TPIZ 3M7QA 4CRAA 3ZZ4A 3M35A 1HUTH 3F9FA 4DCDA 2GX4A 5JPMH 1DANH 1TPAE 1HAYB 1P57B 4UEHH 9ESTA 2P3UB 4OS5A 1Y3WA 1O34A 3TIUA 3PTBA 1A46H 1ZTLA 2AMDA 1Z8IB 3MFJA 2PUQH 1K1LA 3ELAH 5C5OA 3SGQE 3A85A 1H8DH 3LGIA 1MQ5A 1YPMH 2B0FA 1LVOA 1C1MA 1C5RA 4JZDH 4YOJA 4A1TA 1EZUC 1VCPA 1TYNA 1T8LA 1T4UH 1DWDH 3A8DA 3H7OA 2FEQH 2C8WB 4ZKSU 3VEQB 3T27A 1BOQA 1M9UA 3SQHE 3SGBE 3QGJA 1ZTJA 1NRQH 1HJ8A 2G8TA 3A8AA 2Z9KA 3L6PA 1O2RA 1TNHA 2RG3A 1ZMLA 3KN2A 2Z9JA 4K3JA 4AB8A 3NKKA 3A7YA 5A09A 1XKAC 3OSYA 4J2YB 2GMTB 3BEFB 4MLFB 4BTIB 1D3QB 3FP7E 3U9AH 1AB9C 1WU1A 2ZEBA 3MU4A 4U30A 1FY8E 1JRSA 3SORA 3SV2H 4H6SB 1FV9A 2R9PA 2FOGA 2HVXA 4KELA 4AFUA 1Y5UT 3A80A 1PJPA 3GISB 4HZHA 1DS2E 2ZDAH 1GDUA 5EOKA 3PO1C 5DJ7A 4CBOA 1O2ZA 3MNBA 1YP9A 1FPCH 1P06A 4X1PU 1MQ6A 2GCTC 1QRZA 1TOCB 3G01A 2OQUA 5JB8S 5A2MH 3PYHA 3A88A 4ABFA 4ZHLU 1TNLA 3UNSA 1QNJA 3VGCB 1QY6A 1IHTH 4FU9A 1V2TT 5L2ZH 1EB1H 3TH4H 1MKXH 4INKA 3E90B 3SW2B 3MWIU 4MNVA 3MI4A 2P94A 1AKSB 1LPKB 2ZDKA 1ZGVA 2BLVA 2SNWA 2Z3DA 1C9TA 1C2JA 1P2IA 1DY8A 4LXBH 5K7RA 2Y7ZA 1BRCE 5DK1A 1MU8B 1AVXA 3LH1A 2SFAA 3EE0B 1GI2A 2JH6D 3RXVA 3ZYEA 2HPPH 2QF0A 1T31A 4I8LA 1G2MA 1GJ5H 4XFQA 1SFIA 1SC8U 1W0ZU 1XUGA 1P2QA 4Z0KA 4CH2B 1NO9H 2ZDNA 3RXEA 3UOPA 2IN2A 1HV7A 2P3TB 1BTWA 3LDXH 3ATIA 3NPSA 4CHAC 4AN7A 3BV9B 5DG6A 4AG1A 2ZF0H 1QCPA 4OS6A 1P01A 1WSSH 3ATMA 2C90B 3NZIA 1FAXA 1CE5A 1L4DA 1ANCA 2CGAA 4X2VA 1OWJA 1LQDB 1FY3A 3LGWA 5EU8A 3M3TA 1C5OH 1HAZB 2FYQA 5JBAS 1IQKA 4GUXA 1FIZA 1AWHB 1O2GH 5EW1H 1F5RA 1KLJH 1Z8RA 1ELGA 4INLA 1ABIH 1UVOA 2Z9GA 3C27B 1BMNH 1MKWH 1CO7E 3URDA 1F7ZA 1QQUA 1SSXA 1P3CA 5C5NA 1B5GH 1UCYH 4TPIZ 3E16B 3A84A 1IQNA 2A2QH 4MPUA 2V3OH 1SPJA 2ANKH 1MZAA 2R0LA 4UFGH 5AF9H 2FS8A 3PMJA 3N7OA 2FOCA 2ZWLH 1YPHE 1DE7H 1ZYOA 4MPWA 3U98H 5DP9A 3T29A 1GVLA 4XE4A 1C2DA 5HXFA 1LKBA 5I25A 1KSNA 2G52A 2EI6A 3ZVBA 3U1JB 3VB3A 1CSOE 3PLKA 1OSSA 1E0FD 2UWOA 1F92A 3EAJA 2GV7A 4I8GA 2BY9X 1O2MA 1O3HA 4NWLA 1PYTD 1ELDE 1GJCB 2H5DA 1LVMA 2QV1A 1Y5BT 1QFKH 1NPMA 1SGDE 1C5YB 5FXLA 4MPVA 1SB1H 1BBRE 4Q7YA 2A7JA 1QURH 2Q6GA 1ORFA 1DY9A 2A4RA 3BEIB 2TGTA 3LPRA 3V0XA 1N8OB 2FLRH 1SGPE 4CH8B 5DP5A 4JCNA 2OQ5A 4ZHMU 2J2UA 3VFEA 4R8TB 2BDCA 3BIVH 1XXDA 3A83A 3B23B 1CGHA 1HJAB 3C1KA 2BD7A 2ZU4A 1O39A 2J95A 1G32B 1W11U 4ABIA 3P8OA 3SV8A 3FP8E 3ZVEA 4AZ2B 3DFJA 2R2MB 4X6OA 3MNSA 1F0UA 1NT1A 2BDIA 1YPKH 2R3UA 1O2VA 3SHCH 1LQEA 2A31A 3PMAB 4WWYA 6ESTA 1BTYA 1ETRH 2W7UA 4NSYA 3FP6E 4XDEA 1IQFA 1D3PB 5CE1A 5HGGA 1NC6A 1C1RA 4B74A 1C5VA 2KAIA 2O8WA 3NCLA 5T3HA 4I8HA 1GVZA 1HCGA 1LHCH 2B7DH 1P02A 1GI9B 1C5NH 2A0QB 4B71A 1PYTC 1KTSB 2BY7X 1WV7H 3ATWA 4WMDA 2ZDLA 1K1MA 3RDZA 4OS1A 1G2LA 5FPYA 5JBCS 5FBEA 2OP9A 1SGNE 4GHQA 1TMTH 1SBWA 3E91A 1RXPA 4CBNA 2EI7A 1A4WH 1AO5A 1B0EA 3SHAH 1QBNA 2AFQB 4LZ1H 1BB0B 2XNIA 1W7GH 4BAKB 1NU9A 1BBRH 2QXIA 1OPHB 1PQ5A 8KME2 3PMBB 4GCHF 1GBLA 3GCHC 3KHVA 3TU7H 4YZUA 2PKSC 4JZEH 2PW8H 3SOSA 1MUEB 4WH8A 1C5SA 4NSVA 1TA6A 1RIWC 2BXUH 1J15A 4FUGA 3U69H 2PHBA 4Q80A 1C2LA 3Q3XA 1A0HB 1AIXH 4NA9H 1O37A 3OY5U 2O9QA 1FY4A 1GGDB 1A7SA 1IOEA 1S81A 2STAE 2FM2A 2Q1JA 1CT2E 6GCHF 1J8AA 1S6HA 3KIDU 4ISOA 4WY3A 1ELVA 2V3HH 1D6RA 4O03A 4RN6A 3P92A 1BQYA 3ZZDA 2WYJA 1V2WT 1ANBA 1FXYA 1VJAU 2OC8A 4YLQH 5EXMA 4FUEA 1VGCB 1AN1E 1G3CA 1J16A 1ELFA 3PB1E 4NIVA 4VGCC 1O3GA 1ZTKA 5F8XA 2J38A 4NWKA 1O3KA 5T6GA 1DT2A 3MNCA 2A4OA 3Q77A 2BYAX 2VGCC 3GYLB 3MU5A 5J4SA 1GJ6A 2WV5A 2P95A 2Y82A 2OCVB 1O3LA 1GMDF 2OUAA 1O0DH 4NGAH 4BTTB 1PQ7A 1ZHRA 1QBOA 2IOTA 3PROA 2ZCHP 3F9EA 4X1QU 4QT8C 3ZZ5A 1QHRB 1KIGH 1GI0A 2ULLA 2QXGA 3LGVA 5F8ZA 1C2HA 1F2SE 4E7NA 2SGEE 4A1VA 4JK5A 6CHAB 1YYY1 3Q00A 1FY5A 2C93B 3SV7A 1GL1A 1CT0E 3SJ9A 3LIWA 2FOEA 3D49H 1DWBH 5DPAA 3TGIE 1V2LT 3PTNA 2DE9A 4ISIH 1UTMA 1QGFA 3WY8A 3V12A 1GG6C 3RMNH 1A5GH 1FONA 2CN0H 1EP5A 1C1NA 3Q3YA 1G3BA 1ETTH 2GZ7A 5F03A 3O8CA 1LVBA 3LT3A 4IN2A 3KQCA 3SUFA 1KLTA 3MTYA 1B0FA 1LKAA 1BUIA 2ZU2A 3TNSA 3QLPH 1HAHH 1V2NT 1FNIA 3QO6A 4K1SA 2A4GA 1VITF 2Y80A 1V3XA 1TPOA 1Z6JH 3SU5A 1IQIA 5CHAB 3KGPA 4SGBE 2VB0A 4I8KA 4KTSA 1AQ7A 2Z9IA 1SFQB 1NESE 3RXQA 3SBKA 1VR1H 2FWWA 4WH6A 3BG4C 1ESBA 4TY7A 3QWCH 1C1SA 1GBBA 1V2RT 1EZXC 3E0NB 1C5TA 1YLDA 2BQWB 4A5TS 2A45B 3M36A 2WINI 3FANA 5IYTA 1K22H 1H1BA 1XMNB 2SGAA 3IITA 1O3BA 1TGBA 1V2OT 1RS0A 1P2OA 5C2ZA 1ZOMA 1P3EA 4K1EA 1GCDA 4YESB 2W5EA 4X6NA 1EZQA 4YT6H 1XVMA 1QQ4A 4X6MA 5F8TA 2VVUA 2W3IA 3OU0A 4IC5A 2IPHA 5SGAE 2D2DA 1HAVA 1KYNA 4K5ZA 3KL6A 2AMQA 3IWMA 7LPRA 1ELBA 4XOJA 8ESTE 4XSKU 3ZZ7A 3D23A 4KKDA 1T32A 2BD8A 4WMFA 5TCAA 1IQGA 1C5QA 2CXVA 1P05A 4ABDA 1MD7A 1XX9A 1O2WA 3BG8A 1OP0A 3ESTA 7KMEH 1O3JA 4GCHG 3H5CB 4IMZA 1QRWA 3M3VA 3LGTA 1OXGA 2A7HA 4UONA 1ELAA 3RXDA 2F9BH 1DUEA 1P9SA 1SVPA 2BOHB 2R2WU 1GBFA 4NFEA 3AW1A 1AFQB 3ZVDA 4UFDH 2V6NA 1PPZA 4I7YH 1BCUH 4DURA 1WUNH 1XKBC 1QB6A 1DOJA 3EA7A 1L4ZA 5FAHA 5C1YA 1Y3XA 3STJA 1RGQA 1ZJDA 3NXPA 3EYDA 4FUHA 6GCHG 2BY5X 1AU8A 3BIUH 3RXIA 2O8TA 4ZKNU 4WVPE 5E2PA 1C4U2 3S7KB 1GCTB 2VWLA 3GY5A 3QZRA 1C5WB 1IQLA 2ZGBH 3ENSB 1MBMA 4BXSA 2ZO3H 2F9PA 2VVCA 4U2WA 4ABBA 3EQ0H 4GAWA 1WAYB 4BAMB 4FUIA 1L1GA 4Y8ZA 4MG3A 1V2MT 1HLTH 1GBJA 2ZHDA 2BVXH 1YCPK 3VGCC 1Q2WA 1GI7B 2J34A 2ZHEH 2C4FH 4OGXA 4AGJA 3A7VA 3GCTF 2VIQA 1C1QA 3EGKH 3QZQA 1GMDG 3BTQE 3GY2A 1PPGE 3A7WA 3OYPA 4HFPB 2ALPA 2Q6FA 3GYMA 2H9HA 3BTGE 2A5IA 2ZU3A 2ZPQA 3ZV8A 1BRUP 5EG4A 3MOCA 1QTFA 3LJJA 2VIVA 3UQVA 1NN6A 1NZQH 3RXPA 2QY0B 3NWUA 1FPHH 2ANMH 3ZV9A 3TLOA 1OP2A 5JBTA 1GI8B 1GVKB 2ZHWH 2VU8E 2FOFA 3RMMH 4JYVH 4MQAA 1O2LA 1AY6H 1HAPH 1GI6A 2XBVA 2F9VA 2GZ8A 1A0LA 3T26A 4X2WA 1V2VT 4ASHA 1BZXE 5DKMA 1UVSH 4Y8XA 3ITIA 1BTHH 1THSH 4FXGH 3GCOA 2OC0A 1C2EA 1QBVH 1TFXA 1HAIH 1BMAA 1GBIA 1N6XA 4MNYA 4X1RU 3P8NA 3ATLA 2GTBA 1GBCA 3CS0A 1H9HE 1FDPA 2ZCKP 3D62A 1S6FA 4TYDA 1QA0A 1W12U 1YF4A 8GCHF 3M5LA 2ZKSA 1VITG 3ZZ3A 1UHBA 2JH5D 2ZC9H 1GBEA 1FJSA 1VZQH 2GT7A 2UWPA 4DW2U 2ZGXH 4GLYA 1LDTT 1JMOH 2KAIB 1NY22 3L33A 2XWAA 5DP4A 4HGCA 3RXMA 4AFZA 3RXSA 1OWHA 5FCRA 2R0KA 1SQAA 2P3FH 3LC3A 2W26A 1FAKH 1C2FA 1YPEH 2HALA 1RTLA 3UQOA 2OBQA 3GDVA 1AFEH 4THNH 1SL3A 4ZH8A 1TBRH 4OS2A 3URCA 2FOAA 1O3EA 3QX5H 5EXNA 2OC7A 4IW4E 3M61U 1SGTA 1T8MA 1O5FH 1OWDA 2J4IA 1C5XB 2JETC 1W0YH 3UIRA 1C1OA 1TNIA 1C1TA 2GGVB 5HYOA 1OX1A 1GJAB 1O36A 1TB6H 1AZZA 1C2IA 2QGRA 4BAHB 3RXLA 5GPIB 3SGAE 3I29A 1UVTH 4JZFH 1U6QA 1O2JA 1O2PA 1AB9B 2FI5E 2ZQ2A 4X8SH 2H9TH 5GJ4B 1P9UA 3TJOA 1ZLRA 5DP7A 2ILNA 1SR5C 3OTJE 1F0SA 2A1DB 1SG8B 1A3BH 2NU4E 5FPSA 1Z71A 2XYAA 2PV9B 3PO1B 1CGJE 3F6UH 2SGQE 3VXEH 3A8BA 3A8CA 1EJMA 2QIQA 2QYIA 1NRRH 1BTZA 1O2XA 4BTUB 2PGBB 1EATA 3RP2A 1HIAA 2G5VA 1CBWB 1SMFE 5IDKA 1ACBE 1EPTB 3TH3H 1YKTA 2AGEX 3M5MA 1DDJA 2P59A 4Y76A 2ZPRA 3SU3A 2Z6BD 5AFYH 1CGIE 1TX6A 1O38A 5LPRA 3K65B 1OWEA 1O31A 1Y59T 4X0WU 4RKJB 2ANWA 4ZXYH 3M37A 1VCWA 3S7HB 1AMHA 4DOQA 2C8YB 4KGAA 4FU7A 1N6YA 2XCNA 4U01A 5HM9A 1C1VH 4I8JA 1QJ1B 1EAUA 5C20A 2XTTB 1K1PA 4DIIH 2AIQA 4D7FA 1Z8JB 4H6TA 5LPFA 5A0CA 2AMPA 1KTTB 1ZSKA 2EI8A 3MO3A 5B6OA 2ZTXA 4XBDA 3GCTG 4LK4A 3NK8A 3P95A 3DFLA 1GMCF 2ZI2H 5E0GA 4CHAB 2HLCA 1C1PA 3A89A 1BTXA 1YPHC 1SI5H 1AVGH 1X7AC 3SV9A 3BTEE 2H9EH 3M7UA 3E3TA 2BB4A 3TVJB 1SGIB 2FYRA 1CVWH 1OS8A 1CA0B 1TA2A 3A81A 5FBIA 1OWKA 3RMLH 4OS4A 1A0JA 3LKWA 4Q2KA 1PPBH 1YC0A 2YNBA 3BTHE 1A5IA 2VJ1A 3JZ1B 1SQTA 4K69A 1CU1A 5AFZH 1FZZA 4IN1A 4HTCH 4ISHH 2G4TA 1J9CH 2ZA5A 1LHEH 3QN7A 4DIHH 3BTDE 4XBCA 2FOBA 1MTNB 3SQEE 2AS9A 1A2CH 1BA8B 1E36B 4RKOB 1JWTA 2Y81A 4INHA 1ARBA 3LONA 1MKXK 1AVWA 1BRBE 2TGDA 1P0SH 1QB9A 3ODDA 1TBQH 3HPTB 5C1XA 3SUEA 1G36A 2ODQA 3DT0H 1WOFA 2D8WA 1RFNA 2P8OB 1V2PT 2HNTE 1VGCC 1K1IA 8GCHG 1NRNH 2NU3E 1ZHPA 1BMMH 1LHGH 3ZVFA 4TWYA 1O5DH 2BLOA 2QAAA 2AYWA 2GDEH 2ZDVH 4B73A 1D4PB 6LPRA 5JYIA 8LPRA 3SV6A 3FVFB 1SGQE 2GP9B 1N1LA 2SGPE 4K1TA 1Y5AT 1G37A 3RXGA 1HXEH 2XBYA 2ZG0H 1G3EA 2CMYA 4YM9A 1QR3E 1NFUA 1C4Y2 2FESH 1THPB 1RTKA 2BZAA 3SNAA 1ELTA 1ID5H 3W95A 2C8ZB 4K60A 4DJZB 1EAXA 4YOIA 1OYTH 1CHGA 1UMAH 3AW0A 4U32A 2FS9A 4IGDA 5ETXA 1O3NA 1GBDA 2ZTYA 1P8VC 2A5KA 3RXRA 3BTWE 4X8TH 5EW2H 4ZROA 1QIXB 5J4QA 4AB9A 3RXBA 2HNTC 3SU2A 3GDSA 1UJ1A 3SJIA 1TWXB 1C5ZB 2ZTZA 5K0HA 1KXFA 3H7TA 5G4BA 3GOVB 1FY1A 1KXBA 2CHAC 4MDSA 3P8GA 2DUCA 3VXFH 1GHZA 3TPIZ 3U8RH 2PGQB 1S82A 3UNRA 3STIA 1KDQA 3AAVA 1LVYA 4ZXXH 1QJ7B 4D9QA 2BZ6H 2ZGJA 2ZCLP 2WYGA 1C5UA 1EZSC 1MKWK 1O2YA 3M7TA 1MAXA 3SU0A 2Z3CA 5LH8A 4YOGA 4B1TA 1ZRBA 2EEKA 1GHXH 1UCYK 2J9NA 2SGFE 2Z9LA 4FU8A 3SNDA 5GWZA 3TGKE 1AD8H 1UK4A 2BLWA 1SGYE 1ZMJA 2G00A 4KTCA 3LGUA 2PWXA 5A8XA 1GJ7B 2LPRA 4YLUA 7GCHF 2EC9H 1HYLA 1AE8H 3RXAA 1A1RA 2XWBI 2Z3EA 3D65E 1IAUA 4ZKRU 4Y8YA 5A8ZA 3A86A 1DFPA 2NU2E 2FTLE 3ZVGA 1TX8A 2BVSH 2FODA 4NIWA 5TCCA 1HAOH 3SUDA 5LPEA 1RJXB 3HGPA 2NWNA 3U1IB 1IQHA 1E37B 1UO6A 1J17T 1FN6A 2Y5GA 4X6PA 5EQSA 1MU6B 1TMUH 2H2ZA 2F9UA 2B9LA 3DA9B 1DXPA 1MTUA 1INCA 2RA0A 4JYUH 3UREA 1BHXF 2BDYA 4Y11E 3S9AA 4TWWA 1WQVH 3ZZ9A 4AORA 2WPKS 3GCHB 2OC1A 2PKSB 2HPQH 2QXJA 4K8YA 1DX5M 3GY8A 1EQ9A 1RIWB 1P10A 3B9FH 4I32A 1LPZB 5LGOA 1Y8TA 1O30A 3F9HA 1MD8A 2D26C 3K6YA 2QC2A 2FP7B 1L0ZA 1ABJH 3ODFA 2STBE 1GMCG 5DP6A 1O3OA 2Y5FA 2BM2A 1DUAA 1ZPBA 4FUDA 2H6MA 1LHFH 3JZ2B 3TK6A 3T25A 1NFXA 3LU9B 4PROA 5E8EH 3RLWH 3PM3A 3ZZ8A 3OX7U 1FUJA 3E0PB 1FI8A 4B2CA 2ZFFH 1D3DB 1GBHA 4KP0A 4CRBA 2GV6A 4E06H
chains in the Genus database with same CATH superfamily
1JBUH 1TONA 5FCKA 1YGCH 2FTMA 5EODA 5PTPA 3ZVAA 4A6LA 1W2KH 3NUMA 4CR9A 2FO9A 1Z7KA 1HAGE 4A7IB 3BSQA 1ZSLA 2VWNA 2W3KA 4VGCB 2IJOB 4HG6A 1DSUA 3SUGA 3MO9A 3MH6A 2XBXA 4ISLA 1D3TB 4IMQA 2PR3A 2VGCB 5GCHF 3TK5A 1S83A 1UTKA 1ELEE 1TNGA 3RU4T 3T5FH 2EA3A 1O33A 1UHBB 2KCAA 1O5GH 1GDNA 4B76A 4Y79A 4X1NU 1KXCA 1Q3XA 5FX6A 3BTTE 2ZFSA 3QUMP 1OOKB 3OEED 4WXIA 1C4V2 4ABAA 4Q7XA 1BDAA 1AZ8A 1K2I1 2O8UA 3SI4H 1TRNA 2FOMB 3TJUA 3DUXH 4WMEA 4AYVB 2UUKB 1BBRK 3EA8A 3F1SB 5E2OA 3AAUA 2W6JD 3F0PA 2UWLA 1GI1A 3W1EA 3KQDA 3S0NA 2AEIH 3RC5A 1PPEE 1L1JA 2BX4A 1TMBH 2BDAA 1KXDA 1QA7A 1GJ4H 2G55A 4YO9A 1XXFA 5CDFE 1HAXB 4A92A 1GG6B 1S84A 2PSYA 3KF2A 5EPYA 1SGCA 5HMAA 2XRCA 1Y3YA 4GVUA 3PLBA 1O2TA 2IPQX 1PPCE 4DVAU 2ZGHA 1K21H 5FHTA 1TLDA 3UWJH 4YTAA 2LELA 1WBGB 1UTQA 1O2UA 1E38B 2GMTC 2XC4A 1YM0A 1IQEA 4NZQA 3PV5A 3P8FA 1GBTA 4UE7H 1UK2A 2WPJS 1S5SA 4AG2A 1TGTA 1XUFA 4ACAA 3ZYDA 2ODYB 3HK3B 2V0BA 3RXUA 1RRKA 1PQAA 2XCFA 4K8BA 3GDUA 1OP8A 1SOTA 1TRMA 3A7ZA 1NFYA 1GBKA 3TH2H 1ZR0A 3UOUA 2BDGA 3MNXA 3UFAA 1QRXA 2BXTH 1TPPA 3TGJE 1O3FA 1BTPA 4Z1MD 5ABWA 1AGJA 1O3AA 4FUCA 3LH3A 1F0RA 2F9OA 1EKBB 1GI3A 5DP3A 7GCHG 2R3YA 2XNDD 2GKVE 1SLWB 2JJ2D 2VIOA 2PKAA 2XBWA 3RXCA 1HJ9A 1MMJN 4X2XA 1ANEA 3RXOA 1SLUB 2BD4A 2BQ6B 2WPHS 2K1QA 2GVFA 2J98B 3SU6A 1OHHD 1V2JT 4CR5A 4WF8A 4MVNA 1TQ0B 2QE7D 1MH0A 1T4VH 2CF8H 1O3IA 3MH5A 1XM1A 3A7XA 4SGAE 4B75A 3SJ8A 3UR6A 4LZ4B 1EB2A 1XUKA 3RM2H 2OLGA 2GDDA 2HOBA 1LMWB 4NFFA 1PPFE 2OK5A 2XC5A 1YLCA 2HVYB 2THFB 1TRYA 2AGIX 1FN8A 3P6ZB 1P12E 4AOQA 3FZZA 5E0HA 1UVUH 1CQQA 1K1JA 2OXSA 4O97A 4ISNA 1F0TA 1C1UH 3FFGA 4NIXA 1GDQA 1GI4A 1MZDA 1P04A 3TK9A 1BTUA 1DWCH 1JIRA 1VKYA 3SNBA 3RXJA 1EJNA 1SGFG 1T8NA 1A3EH 2UUYA 4Y6DA 3O8RA 2Z94A 2AGGX 3MH4A 1PFXC 3OY6U 3V3MA 1JOUB 1TBZH 1P2KA 2G81E 2ZQ1A 2PUXB 4UD9H 3MU0A 3SNCA 2GZ9A 3UB0A 1EAIA 1H9LB 4NIYA 3T28A 4ESTE 4GPGA 1C5LH 1GHYH 1GL0E 3E6PH 4ABGA 2FX4A 5GXPA 2WPLS 1O3DA 1GHBF 1GMHF 2O8LA 3M3SA 4H42U 3KQEA 2RA3A 4OGYA 1YBWA 4JZIA 2WPIS 3GICB 1AWFH 3R3GB 5DO4H 3E8LA 5DP8A 1V2KT 2ZFQH 2ZDMA 2TIOA 1DM4B 1H8IH 1WCZA 2F3CE 2RCEA 3ZZAA 1G9IE 2F91A 3VB6A 5I46H 1CBWC 4CRDA 1J14A 1EPTC 3A7TA 4ZMAH 1HGTH 1NROH 4Y10E 1AUTC 2Y6TA 5AVDA 1QJ6B 2YOLA 1S6LA 1UCYE 1W8BH 1ZMNA 5GCHG 3SJKA 2AH4X 3KNXA 2CK3D 1FQ3A 3MYWA 3RMOH 4H4FA 5EPNA 2A7CA 1O5BB 1D9IA 3A82A 1DICA 3PLPA 3MMGA 1ZZZA 1Y3VA 2BQ7B 1O2IA 1H9IE 3LOXA 1O5AB 2VINA 1S0RA 1O32A 2UUJB 4RSPA 2XW9A 2BDBA 1COWD 4AYYB 1HRTH 1TNKA 2V7QD 3PRBA 4B2BA 3TJNA 4NG9H 1LCYA 4AX9H 5TJXA 4D7GA 2F83A 3QDZB 1MTSA 2BY8X 3ZZBA 1NU7B 3K9XB 2H1UA 3RM0H 2TRMA 3S9BA 2ZFRH 1GJ8B 3BTKE 1WQSA 1N8OC 1OYQA 1E34B 3SJOA 2WPDD 1Z1JA 1UTNA 4O3UA 3OEHD 3QGNB 2PTNA 3ZZ6A 5L2YH 1NFWA 1SLXB 1V6DA 1ZPCA 3RU4D 2GCTB 1HJAC 1CA0C 4O3TA 1P2MA 1SGFA 2NU1E 1GWAA 1SOZA 1KDQB 2BD9A 5JDUB 2W7SA 1TAWA 1LPGB 2FLBH 4TPYA 4E7RG 1W7XH 2HGTH 3P17H 5HM2A 3PMHB 4BXWA 3AVZA 3VPKA 4JYTA 2YNAA 2ASUB 4KTUA 3UUZA 2ALVA 3KCGH 4K2YA 2FI3E 5A8YA 1EOJA 1TE0A 1MTNC 3RU4E 2D1JA 2PLXA 4BOHA 1GHWH 3U8TH 1NM6A 4RI0A 3AASA 3RXTA 2QF3A 1TPSA 2FIRH 1HFDA 2WV9A 1BRAA 2BTCE 2C3SA 1AHTH 4JK6A 1ELCA 1P09A 5EQQA 1HB0B 1Z8GA 3UY9A 2P8OC 3EA9A 3FZDA 3I78A 2JDID 4FVBA 2G5NA 1BJUA 2SGDE 1Z1IA 1O3CA 4GSOA 1PPHE 2ZFPH 1NS3A 1SHYA 5GNDA 1SHHB 2Z7FE 2JETB 2VIPA 3BTFE 1TGCA 1EX3A 2P93A 4JMYA 2H5CA 4F55A 1TNJA 3MH7A 2LNCA 1NTPA 2B8OH 1EJAA 2QF4A 3SZNA 5ESBA 1DVAH 1YCPM 1ZPZA 4AGKA 4D9RA 2VBCA 1Z6EA 1UTLM 1OKXA 3VB4A 2BLQA 2FDAA 1DITH 3VB5A 3S9CA 1DWEH 4X1SU 2VNTA 2ZIQH 3EE7A 1QZ8A 1YPGH 2ESTE 4MNWA 5BRRE 1V2QT 3SU4A 1WTGH 1ZGIA 1GI5A 3MU8A 1DPOA 4O9VA 3M5OA 1SGEE 1GGDC 2XXLA 3GS9A 4Y71A 5L30H 1YPLH 4ZAEA 3ATKA 1GBMA 3CP7A 4Y7BA 1TX7A 1UVPA 2BD2A 2ODPA 2BD3A 3S69A 3B8JA 4XRNA 3O8BA 2VWMA 3KQBA 2WUBA 2AERH 4UFFH 1GHAF 2HWLB 3MHWU 1TGSZ 2AHME 4BAQB 3HKJB 3FKSD 2XOKD 1F5LA 1WTHD 2QA9E 1GHBG 1GMHG 1V2ST 3TNTA 3GY3A 2CV3A 1JIMA 1CA8B 1O5EH 2HNTF 1DLKB 3ZIAD 5C94A 1F5KU 1AKSA 2GJGA 4CRGA 2O8MA 3E1XB 4R0IA 2FZZA 1WYKA 2NU0E 4DT7B 1G3DA 4X8UH 5L6NH 3BN9A 3MU1A 4ABHA 1O2KA 1C9PA 5E0JA 1FLEE 1BITA 4D76A 1O2NA 1W13U 4P02A 1UK3A 4Y0YE 2VWOA 1GJ9B 3UPEA 4ASUD 2VIDA 5B6LA 1ETSH 3R0FA 2FOHA 5H4IB 2GCHF 1HXFH 1HAVB 1P03A 2OINA 5GDSH 1K1NA 4FOUC 4I33A 1ZHMA 4CRCA 4WXVA 5C1UA 1K1OA 2QXHA 2Y5HA 1BT7A 1MCTA 1LTOA 2A32A 4I31A 7ESTE 1XUHA 1VJ9U 6CHAC 4BNRA 1EASA 1CHOF 3CS7A 2I6SA 2ANYA 2FI4E 1DSTA 1V2UT 4E05H 3PWCA 2BMGB 1O2HA 3O8DA 1QB1A 2BY6X 3Q76A 2QCYA 4DY7B 4F4OC 3HGNA 1GPZA 2GD4B 1O3PB 2G51A 4YT7H 3UNQA 3QK1A 4Z6AH 1EP6A 2F9NA 4IBLH 1NRPH 1A61H 4XBBA 1H4WA 1PQ8A 1MTVA 3LC5A 1BJVA 2W6ID 1BIOA 2A5AA 1T7CA 1W14U 1UTJA 4XD7D 2PFEA 1P2NA 2I6QA 4GHTA 4F49A 1Q31A 1O2QA 1TIOA 1MCVA 4CRFA 3P70B 4I86A 2ZU1A 2ZPSA 1UW7A 9LPRA 2A4QA 3BF6H 2VIWA 4A1XA 1ANDA 3LJOA 1IQJA 5CHAC 5AHGH 5T6DA 1EPTA 1MAYA 3UWIA 1B7XB 1C2KA 2BDHA 3HKIB 3ZZCA 2M5TA 1HBTH 1T8OA 2PTCE 1MTWA 1P2JA 1E35B 2ZFTA 3RXHA 5JB9S 1IHSH 1TQ7B 1YY3A 1IQMA 3RXFA 5C3NA 2OD3B 4DG4A 2ZP0H 2BHGA 3FN8A 4OS7A 4M7GA 3FOAA 2BD5A 1TOMH 2WUCA 2TGPZ 4LOYH 2ZHQH 1SKYE 1LHDH 1QL8A 1SQOA 1UTOA 2DE8A 2ZU5A 5T6FA 2ZECA 2J94A 2PKAB 1KXAA 3QTVH 1YCPH 1EUFA 1O5CB 1GHVH 2G4UA 3K6ZA 2TBSA 3F68H 2A2XH 1C2MA 1HNEE 3UTUH 3PWBA 1G30B 4ZHAA 3K2UA 3RLYH 2CF9H 3BTME 1JXPA 4FUBA 1LO6A 4UDWH 2Q6DA 2WV4A 5FPTA 3ZVCA 1H8ED 4Q7ZA 3VB7A 2CHAB 3SNEA 1O35A 5EQRA 3SU1A 3SO3A 4AFSA 5GIBA 4UFEH 3QTOH 1FMGA 4IS5A 5CHBA 2JKHA 3GY6A 4Y7AA 1W3CA 2GT8A 1GJDB 1O3MA 1O2SA 3SI3H 1C1WH 4CREA 1SLVB 5ESTE 2ZHFH 1KLIH 2RDLA 3DHKH 1ESTA 1TALA 2QN5T 3DCLA 1GJBB 2C8XB 3HATH 1S0QA 5CMXH 1A5HA 2PSXA 4FUFA 2SNVA 3CENA 1AFQC 3I77A 1BMLA 4TY6A 4BANB 3RC6A 1OWIA 1ZJKA 4HI3A 1HDTH 5F6MA 4NCYA 5EGMA 1AUJA 3U8OH 2FPZA 1JRTA 2VH6A 1CT4E 4ZUHA 2HLDD 3OAAD 1ZRKA 4X8VH 4MNXA 3M5NA 3RUOA 1UTPA 5FX5A 4Y0ZE 1MBQA 3GY7A 3H09A 1AI8H 2J92A 1WDIA 2P16A 1XUJA 1L1NA 1ESAA 4NA7A 2B5TB 2OTVA 1Y3UA 3OFND 1DLEA 1GCTC 1GHAG 3HK6B 2XC0A 1AE5A 1P11E 1ZSJA 1HPGA 1YPJH 3Q3KA 1KXEA 1QL7A 2AIPA 4MPXA 2FXRA 3GY4A 4JZ1A 1C5MD 2BX3A 2Y7XA 1O2OA 2UUFB 3UR9A 1EXFA 3BEUA 2YMSD 3N7DA 5BPEA 1S85A 2F4LA 5C0TA 1K9OE 2CJIA 1EAWA 3KEEA 1C5PA 2FMJA 1XUIA 2V3MA 4NZLA 1TABE 5C67A 4B2AA 4J1YA 1ARCA 1K28D 2FX6A 2VH0A 3LGYA 1W10U 4NA8A 4D8NA 2GCHG 3TITA 3EDXB 1RD3B 3V13A 5JBBS 3T2NA 5A0BA 4MTBA 3TJVA 2V35A 1EOLA 1KY9A 4ABEA 4DT4A 3DD2H 2TGAA 1CHOG 1C2GA 4X2YA 3GCNA 4ZKOU 2VVVA 3IG6B 1BHXB 2ZGCA 3FAOA 1SGRE 1VCQA 3A87A 1TGNA 3MO6A 4FUJA 2BOKA 2BVRH 3F9GA 1NRSH 1FIWA 3L3TA 5EXLA 3RC4A 4FVDA 1L2EA 4IC6A 4DGJA 4WJG2 1VITH 2ZZUH 5DGJA 1GBAA 1DXWA 4AFQA 2PP6A 1RTFB 3BG4B 3T62A 1QL9A 3PV4A 2LP6A 3W94A 1HIAB 1THRH 2OBOA 2WPMS 1XVOA 2ZNKH 5A0AE 5FL7D 3SN8A 4BAOB 2JH0D 4ABJA 3RXKA 3V7TA 1D6WA 2HRVA 2TPIZ 2YMSC 3M7QA 4CRAA 3ZZ4A 3M35A 1HUTH 3F9FA 4DCDA 2GX4A 5JPMH 1DANH 1TPAE 1HAYB 1P57B 4UEHH 9ESTA 2P3UB 4OS5A 1Y3WA 1O34A 3TIUA 3PTBA 1A46H 1ZTLA 2AMDA 1Z8IB 3MFJA 2PUQH 1K1LA 3ELAH 5C5OA 3SGQE 3A85A 1H8DH 3LGIA 1MQ5A 1YPMH 2B0FA 1LVOA 1C1MA 1C5RA 4JZDH 4YOJA 4A1TA 1EZUC 1VCPA 1TYNA 1T8LA 1T4UH 1DWDH 3A8DA 3H7OA 2FEQH 2C8WB 4ZKSU 3VEQB 3T27A 3PV2A 1BOQA 1M9UA 3SQHE 3SGBE 1W0KD 3QGJA 2K0QA 1ZTJA 1NRQH 1HJ8A 2G8TA 3A8AA 2Z9KA 3L6PA 1O2RA 1TNHA 2RG3A 1ZMLA 3KN2A 5HIZA 2Z9JA 4K3JA 4AB8A 3NKKA 3A7YA 5A09A 1XKAC 3OSYA 4J2YB 2GMTB 3BEFB 4MLFB 4BTIB 1D3QB 3FP7E 3U9AH 1AB9C 1WU1A 2ZEBA 3MU4A 4U30A 1FY8E 1JRSA 3SORA 3SV2H 4H6SB 1FV9A 2WHXA 2R9PA 2FOGA 2HVXA 4KELA 4AFUA 1Y5UT 3A80A 5EJZA 1PJPA 3GISB 4HZHA 1DS2E 2ZDAH 1GDUA 5EOKA 3PO1C 5DJ7A 4CBOA 1O2ZA 3MNBA 1YP9A 1FPCH 1P06A 3NRLA 4X1PU 1MQ6A 2GCTC 1QRZA 1TOCB 3G01A 1KMHB 2OQUA 5JB8S 5A2MH 1H8HD 3PYHA 3A88A 4ABFA 4ZHLU 1TNLA 3UNSA 1QNJA 3VGCB 1QY6A 1IHTH 4FU9A 1V2TT 5L2ZH 1EB1H 3TH4H 1MKXH 4INKA 3E90B 3SW2B 3MWIU 4MNVA 3MI4A 2P94A 1AKSB 1LPKB 2ZDKA 1ZGVA 3KQ5A 2BLVA 2SNWA 2Z3DA 3F2GA 1C9TA 1C2JA 1P2IA 1DY8A 4LXBH 5K7RA 2Y7ZA 1BRCE 5DK1A 1MU8B 1AVXA 3LH1A 2SFAA 3EE0B 1GI2A 2JH6D 3RXVA 3ZYEA 2HPPH 2QF0A 1T31A 4I8LA 1G2MA 1GJ5H 4XFQA 1SFIA 1SC8U 1W0ZU 1XUGA 1K0HA 1P2QA 4Z0KA 4CH2B 1NO9H 2ZDNA 3RXEA 3UOPA 2IN2A 4ZCNA 1HV7A 2P3TB 1BTWA 3LDXH 3ATIA 3F2HA 3NPSA 4CHAC 4AN7A 3BV9B 5DG6A 4AG1A 2ZF0H 1QCPA 4OS6A 1P01A 1WSSH 3ATMA 2C90B 5KGOA 3NZIA 1FAXA 1CE5A 1L4DA 1ANCA 2CGAA 4X2VA 1OWJA 1LQDB 1FY3A 3LGWA 5EU8A 3M3TA 5DN6D 1C5OH 1HAZB 2FYQA 5JBAS 1IQKA 4GUXA 1FIZA 1AWHB 1O2GH 5EW1H 1F5RA 1KLJH 1Z8RA 1ELGA 4INLA 1ABIH 3KYFA 1UVOA 2Z9GA 3C27B 1BMNH 1MKWH 1CO7E 3N99A 3URDA 1F7ZA 1QQUA 1SSXA 1P3CA 5C5NA 1B5GH 1UCYH 4TPIZ 3E16B 3A84A 1IQNA 2A2QH 4MPUA 2V3OH 1SPJA 2ANKH 1MZAA 2R0LA 4UFGH 5AF9H 2FS8A 3PMJA 2QF5A 3N7OA 2FOCA 2ZWLH 1YPHE 1DE7H 1NBME 1ZYOA 4MPWA 3U98H 5DP9A 5F53A 3T29A 1GVLA 4XE4A 1C2DA 5HXFA 1LKBA 5I25A 1KSNA 2G52A 2J98A 2EI6A 3ZVBA 3U1JB 3VB3A 1CSOE 3PLKA 1OSSA 1E0FD 2UWOA 1F92A 3EAJA 2GV7A 4I8GA 2BY9X 1O2MA 1O3HA 4NWLA 1PYTD 1ELDE 1GJCB 2H5DA 1LVMA 2QV1A 1Y5BT 1QFKH 1NPMA 1SGDE 1C5YB 5FXLA 4MPVA 1SB1H 1BBRE 4Q7YA 2A7JA 1QURH 2Q6GA 1ORFA 1DY9A 2A4RA 3BEIB 2TGTA 3LPRA 3V0XA 1N8OB 2FLRH 1SGPE 4CH8B 5DP5A 4JCNA 2KCPA 2OQ5A 4ZHMU 2J2UA 3VFEA 4R8TB 2BDCA 3BIVH 1XXDA 3A83A 3B23B 1CGHA 1HJAB 3C1KA 2BD7A 2ZU4A 1O39A 2J95A 1G32B 3AK5A 1W11U 4ABIA 3P8OA 3KYGA 3SV8A 3FP8E 3ZVEA 4AZ2B 3DFJA 2R2MB 4X6OA 3MNSA 1F0UA 1NT1A 2BDIA 1YPKH 2R3UA 1O2VA 3SHCH 1LQEA 2A31A 3PMAB 4WWYA 6ESTA 3UAIC 1BTYA 1ETRH 2W7UA 1YLNA 3FP6E 4NSYA 4XDEA 1IQFA 1D3PB 5CE1A 5HGGA 1NC6A 1C1RA 4B74A 1C5VA 2KAIA 3F3BA 2O8WA 3NCLA 3WWFA 1W0JD 5T3HA 4I8HA 1GVZA 1HCGA 1LHCH 2B7DH 1P02A 1GI9B 1C5NH 2A0QB 4B71A 1PYTC 1KTSB 2BY7X 1WV7H 3ATWA 4WMDA 2ZDLA 1K1MA 3RDZA 4OS1A 1G2LA 5FPYA 5JBCS 5FBEA 2OP9A 1SGNE 4GHQA 1TMTH 1SBWA 3E91A 1RXPA 4CBNA 4Q63A 2EI7A 1A4WH 1AO5A 4M9FA 1B0EA 5C0UA 3SHAH 1QBNA 2AFQB 4LZ1H 1BB0B 2XNIA 1W7GH 4BAKB 1NU9A 1BBRH 2QXIA 1OPHB 1PQ5A 8KME2 3PMBB 4GCHF 1GBLA 3GCHC 3KHVA 3TU7H 4YZUA 2PKSC 4JZEH 2PW8H 3SOSA 1MUEB 4WH8A 1C5SA 4NSVA 1TA6A 1RIWC 2BXUH 1J15A 4FUGA 3U69H 2PHBA 4Q80A 1C2LA 3Q3XA 1A0HB 1AIXH 4NA9H 1O37A 3OY5U 2O9QA 1FY4A 4TT3D 1GGDB 1A7SA 1IOEA 1S81A 2STAE 3FO8D 2FM2A 2Q1JA 1CT2E 6GCHF 1J8AA 1S6HA 3CNRA 3KIDU 4ISOA 4WY3A 1ELVA 2V3HH 1D6RA 4O03A 4RN6A 3P92A 1BQYA 3ZZDA 2WYJA 1V2WT 1ANBA 1FXYA 1VJAU 2OC8A 4YLQH 5EXMA 4FUEA 1VGCB 1AN1E 1G3CA 1J16A 1ELFA 3PB1E 4NIVA 4VGCC 1O3GA 1ZTKA 5F8XA 2J38A 4NWKA 2EQNA 1O3KA 5T6GA 4B6FA 1DT2A 3MNCA 2A4OA 3Q77A 2BYAX 2VGCC 3GYLB 3MU5A 5J4SA 1GJ6A 2WV5A 2P95A 2Y82A 2OCVB 1O3LA 1GMDF 2OUAA 1O0DH 4NGAH 2L74A 4BTTB 1PQ7A 1ZHRA 1QBOA 2IOTA 2K8IA 3PROA 2ZCHP 3F9EA 4X1QU 4QT8C 3ZZ5A 1SQRA 4B6EA 1QHRB 1KIGH 1GI0A 2ULLA 2QXGA 3LGVA 1E1QD 2WSSD 5F8ZA 1C2HA 1F2SE 4E7NA 2SGEE 4A1VA 4JK5A 6CHAB 1YYY1 3Q00A 1FY5A 2C93B 3SV7A 1GL1A 1CT0E 3SJ9A 3LIWA 2FOEA 3D49H 1DWBH 5DPAA 3TGIE 1V2LT 2EY4C 3PTNA 2DE9A 4ISIH 1UTMA 1QGFA 3WY8A 3V12A 1GG6C 3RMNH 1A5GH 1FONA 2CN0H 1EP5A 1C1NA 3Q3YA 1G3BA 1ETTH 2GZ7A 5F03A 3O8CA 1LVBA 3LT3A 4IN2A 2KM0A 3KQCA 3SUFA 1KLTA 3MTYA 1B0FA 1LKAA 1BUIA 2ZU2A 3TNSA 3QLPH 1HAHH 1V2NT 1FNIA 3QO6A 4K1SA 2A4GA 1VITF 2Y80A 1V3XA 1TPOA 1Z6JH 3SU5A 1IQIA 2KCYA 5CHAB 3KGPA 4SGBE 2VB0A 4I8KA 4KTSA 2F43B 5HIYA 1AQ7A 2Z9IA 1SFQB 1NESE 3RXQA 3SBKA 1VR1H 2FWWA 4WH6A 3BG4C 3WW7A 1ESBA 4TY7A 3QWCH 1C1SA 1GBBA 1V2RT 1EZXC 3E0NB 1C5TA 1YLDA 2BQWB 4A5TS 2A45B 5EJ1A 3M36A 2WINI 3FANA 5IYTA 1K22H 1H1BA 1XMNB 2SGAA 3IITA 1O3BA 1TGBA 1V2OT 1RS0A 1P2OA 5C2ZA 1ZOMA 1P3EA 4K1EA 1GCDA 4YESB 2W5EA 4X6NA 1EZQA 4YT6H 1XVMA 4YXWD 1QQ4A 4X6MA 5F8TA 2VVUA 2W3IA 3OTPA 3OU0A 2IPHA 4IC5A 5SGAE 2D2DA 1HAVA 1KYNA 4K5ZA 3KL6A 2AMQA 3IWMA 7LPRA 1ELBA 4XOJA 8ESTE 4XSKU 3ZZ7A 3D23A 4KKDA 1T32A 2BD8A 4WMFA 5TCAA 1IQGA 1C5QA 2CXVA 1P05A 4ABDA 1MD7A 1XX9A 1O2WA 3BG8A 1OP0A 3ESTA 7KMEH 1O3JA 4GCHG 3H5CB 4IMZA 1QRWA 3M3VA 3LGTA 1OXGA 2A7HA 4UONA 1ELAA 3RXDA 2F9BH 1DUEA 1P9SA 1SVPA 2BOHB 2R2WU 1GBFA 4NFEA 3AW1A 1AFQB 3ZVDA 4F48B 4UFDH 2V6NA 1PPZA 4I7YH 1BCUH 4DURA 1WUNH 1XKBC 1QB6A 1DOJA 3PRDA 3EA7A 1L4ZA 5FAHA 5C1YA 1Y3XA 3STJA 1MABB 1RGQA 1ZJDA 3NXPA 3EYDA 5EIYA 4FUHA 6GCHG 2BY5X 1AU8A 3BIUH 3RXIA 2O8TA 4ZKNU 4WVPE 5E2PA 1C4U2 3S7KB 1GCTB 2VWLA 3GY5A 3QZRA 1C5WB 1IQLA 2ZGBH 3ENSB 1MBMA 4BXSA 2ZO3H 2F9PA 2VVCA 4U2WA 4ABBA 3EQ0H 4GAWA 1WAYB 4BAMB 4FUIA 2KFWA 1L1GA 4Y8ZA 4MG3A 1V2MT 1HLTH 1GBJA 2ZHDA 2BVXH 1YCPK 3VGCC 1Q2WA 1GI7B 2J34A 2ZHEH 2C4FH 4OGXA 4AGJA 3A7VA 3GCTF 2VIQA 1C1QA 2M2AA 3EGKH 3QZQA 1GMDG 3BTQE 3GY2A 1PPGE 3A7WA 3OYPA 4HFPB 2ALPA 2Q6FA 1WXRA 3GYMA 2H9HA 3BTGE 2A5IA 2ZU3A 2ZPQA 3ZV8A 1BRUP 5EG4A 3MOCA 1QTFA 3LJJA 2VIVA 3UQVA 1NN6A 1NZQH 3RXPA 2QY0B 3NWUA 1FPHH 2J97A 2ANMH 3ZV9A 3TLOA 1OP2A 5JBTA 1GI8B 1GVKB 2ZHWH 2VU8E 2FOFA 3RMMH 4JYVH 4MQAA 1O2LA 1AY6H 1HAPH 1GI6A 2XBVA 2F9VA 2GZ8A 1A0LA 3T26A 1BMFD 4X2WA 1V2VT 4ASHA 1BZXE 5DKMA 1UVSH 4Y8XA 3ITIA 1BTHH 1THSH 4FXGH 3GCOA 2OC0A 1C2EA 1QBVH 1TFXA 1HAIH 1BMAA 1GBIA 1N6XA 4MNYA 4X1RU 3P8NA 3ATLA 2GTBA 1GBCA 3CS0A 1H9HE 1FDPA 2ZCKP 3D62A 1S6FA 2YMSB 4TYDA 1QA0A 1W12U 1YF4A 3DSOA 8GCHF 3M5LA 2ZKSA 1VITG 3ZZ3A 1UHBA 2JH5D 2ZC9H 1GBEA 1FJSA 1VZQH 2GT7A 2UWPA 4DW2U 2ZGXH 4GLYA 1LDTT 1JMOH 2KAIB 1NY22 3L33A 1E79D 2XWAA 5DP4A 4HGCA 3RXMA 4AFZA 3RXSA 1OWHA 4TSFD 5FCRA 2R0KA 1SQAA 2P3FH 3LC3A 2W26A 1FAKH 1C2FA 1YPEH 2HALA 1RTLA 3UQOA 2OBQA 3GDVA 1AFEH 4THNH 1SL3A 1E1RD 4ZH8A 1TBRH 4OS2A 3URCA 5C17A 2FOAA 1O3EA 3QX5H 5EXNA 2OC7A 4IW4E 3M61U 1SGTA 1T8MA 1O5FH 1OWDA 2J4IA 1C5XB 2JETC 4Q4LA 1W0YH 3UIRA 1C1OA 1TNIA 1C1TA 2GGVB 5HYOA 1OX1A 1GJAB 1O36A 5EJLA 1TB6H 1AZZA 1C2IA 2QGRA 4BAHB 3RXLA 5GPIB 3SGAE 3I29A 3DSPA 1UVTH 4JZFH 1U6QA 1O2JA 1O2PA 4AC9A 2RFKC 1AB9B 2FI5E 3F0OA 2ZQ2A 4FETA 4X8SH 2H9TH 5GJ4B 1P9UA 3TJOA 1ZLRA 5DP7A 2ILNA 1SR5C 3OTJE 1F0SA 2A1DB 1SG8B 1A3BH 3DSGA 2NU4E 5FPSA 1Z71A 2XYAA 2PV9B 3PO1B 1CGJE 3F6UH 2SGQE 3VXEH 3A8BA 3A8CA 1EJMA 1NBMD 2QIQA 2QYIA 1NRRH 1BTZA 1O2XA 4BTUB 2PGBB 1EATA 3RP2A 2J5UA 1HIAA 2KR7A 2G5VA 1CBWB 1SMFE 5IDKA 1ACBE 1EPTB 3TH3H 1YKTA 2AGEX 3M5MA 1DDJA 2P59A 4Y76A 2ZPRA 3SU3A 2Z6BD 5AFYH 1CGIE 1TX6A 1O38A 5T1VA 5LPRA 3K65B 1OWEA 1O31A 1Y59T 4X0WU 4RKJB 2ANWA 4ZXYH 3M37A 1VCWA 3S7HB 1AMHA 4DOQA 2C8YB 4KGAA 4FU7A 1N6YA 2XCNA 2KCOA 4U01A 5HM9A 1C1VH 5KEDA 4I8JA 1QJ1B 1EAUA 5C20A 2XTTB 1K1PA 1EFRD 4DIIH 2AIQA 5DSFA 4D7FA 1Z8JB 4H6TA 3SYJA 5LPFA 5A0CA 2AMPA 1KTTB 1ZSKA 2EI8A 3MO3A 5B6OA 2ZTXA 4XBDA 3GCTG 4LK4A 3NK8A 3P95A 3DFLA 1GMCF 2ZI2H 5E0GA 4CHAB 3WWBA 2HLCA 1C1PA 3A89A 1BTXA 1FX0B 1YPHC 1SI5H 1AVGH 4OM9A 1X7AC 3SV9A 3BTEE 2H9EH 3M7UA 3E3TA 2BB4A 3TVJB 1SGIB 2FYRA 1CVWH 1OS8A 1CA0B 1TA2A 3A81A 5FBIA 1OWKA 3RMLH 4OS4A 1A0JA 3VG8A 3LKWA 4Q2KA 1PPBH 1YC0A 2YNBA 3BTHE 1A5IA 2VJ1A 3JZ1B 1SQTA 4K69A 1CU1A 5AFZH 1FZZA 4IN1A 4HTCH 4ISHH 2G4TA 1J9CH 2ZA5A 1LHEH 3QN7A 4DIHH 3BTDE 4XBCA 2FOBA 1MTNB 3SQEE 2AS9A 4RT1A 1A2CH 1BA8B 1E36B 4RKOB 1JWTA 2Y81A 4INHA 1ARBA 3LONA 1MKXK 1AVWA 1BRBE 2TGDA 1P0SH 1QB9A 3ODDA 1TBQH 3HPTB 5C1XA 3SUEA 1G36A 2ODQA 3DT0H 1WOFA 2D8WA 2WZQA 1RFNA 2P8OB 1V2PT 2HNTE 1VGCC 1K1IA 8GCHG 5HKKD 1NRNH 2NU3E 1ZHPA 1BMMH 1LHGH 3ZVFA 4TWYA 1O5DH 2BLOA 2QAAA 2AYWA 2GDEH 2ZDVH 4B73A 1D4PB 6LPRA 5JYIA 8LPRA 3SV6A 3FVFB 1SGQE 2GP9B 1N1LA 2SGPE 4K1TA 1Y5AT 1G37A 3RXGA 1HXEH 4RT0A 2XBYA 2ZG0H 1G3EA 2CMYA 4YM9A 1QR3E 1NFUA 1C4Y2 2FESH 1THPB 1RTKA 2BZAA 3SNAA 1ELTA 1ID5H 3W95A 2C8ZB 4K60A 3SZEA 4DJZB 1EAXA 4YOIA 1OYTH 1CHGA 1UMAH 3AW0A 4U32A 2FS9A 2JIZD 4IGDA 5ETXA 1O3NA 1GBDA 2ZTYA 1P8VC 2A5KA 3RXRA 3BTWE 4X8TH 3OE7D 5EW2H 4ZROA 1QIXB 1YWUA 5J4QA 4AB9A 3RXBA 2HNTC 3SU2A 3GDSA 1UJ1A 3SJIA 1TWXB 1C5ZB 2ZTZA 5K0HA 1KXFA 3H7TA 5G4BA 3GOVB 1FY1A 1KXBA 2CHAC 2JJ1D 4MDSA 3P8GA 2DUCA 3VXFH 1GHZA 3TPIZ 3U8RH 2PGQB 1S82A 3UNRA 3STIA 1KDQA 3AAVA 1LVYA 4ZXXH 1QJ7B 4D9QA 2BZ6H 4ACBA 2ZGJA 2ZCLP 2WYGA 1C5UA 1EZSC 1MKWK 1O2YA 3M7TA 1MAXA 3SU0A 2Z3CA 5IK2D 5LH8A 4YOGA 4B1TA 1ZRBA 2EEKA 1GHXH 1UCYK 2J9NA 2SGFE 2Z9LA 4FU8A 3SNDA 5GWZA 3TGKE 1AD8H 1UK4A 2BLWA 1SGYE 1ZMJA 4P00A 2G00A 4KTCA 3LGUA 2PWXA 5A8XA 1GJ7B 2LPRA 4YLUA 7GCHF 2EC9H 1HYLA 1AE8H 3RXAA 1A1RA 2XWBI 2Z3EA 3D65E 1IAUA 4ZKRU 4Y8YA 5A8ZA 3A86A 1DFPA 2NU2E 2FTLE 3ZVGA 1TX8A 2BVSH 2FODA 4NIWA 5TCCA 1HAOH 3SUDA 5LPEA 1RJXB 3HGPA 2NWNA 3U1IB 1IQHA 1E37B 1UO6A 1J17T 1FN6A 2Y5GA 4X6PA 5EQSA 1MU6B 1TMUH 2H2ZA 2F9UA 2B9LA 3DA9B 1DXPA 1MTUA 1INCA 2L6OA 2RA0A 3N7EA 4JYUH 3UREA 1BHXF 2BDYA 4Y11E 3S9AA 4TWWA 1WQVH 3ZZ9A 4AORA 5KECA 2WPKS 3GCHB 2OC1A 2PKSB 2HPQH 2QXJA 4K8YA 1DX5M 3GY8A 1EQ9A 1RIWB 1P10A 3B9FH 4I32A 1LPZB 5LGOA 1Y8TA 1O30A 3F9HA 1MD8A 3U28C 2D26C 3K6YA 2QC2A 2FP7B 1L0ZA 1ABJH 2RDEA 3ODFA 2STBE 3F2FA 1GMCG 5DP6A 1O3OA 2Y5FA 2BM2A 1DUAA 1ZPBA 4FUDA 2H6MA 1LHFH 2IJD1 3JZ2B 3TK6A 3MQKC 3T25A 1NFXA 3LU9B 4PROA 5E8EH 3RLWH 3PM3A 3ZZ8A 2KX4A 3OX7U 1FUJA 3E0PB 1FI8A 4B2CA 2ZFFH 2KZ4A 1D3DB 1GBHA 4KP0A 4CRBA 2GV6A 4E06H
chains in the Genus database with same CATH topology
1JBUH 1TONA 5FCKA 1YGCH 2FTMA 5EODA 5PTPA 3ZVAA 4A6LA 1W2KH 3NUMA 4CR9A 2FO9A 1Z7KA 1HAGE 4A7IB 3BSQA 1ZSLA 2VWNA 2W3KA 4VGCB 2IJOB 1DSUA 3SUGA 3MO9A 3MH6A 2XBXA 4ISLA 1D3TB 4IMQA 2PR3A 2VGCB 5GCHF 3TK5A 1S83A 1UTKA 1ELEE 1TNGA 3RU4T 3T5FH 2EA3A 1O33A 1UHBB 1O5GH 1GDNA 4B76A 4Y79A 4X1NU 1KXCA 1Q3XA 5FX6A 3BTTE 2ZFSA 3QUMP 1OOKB 4WXIA 1C4V2 4ABAA 4Q7XA 1BDAA 1AZ8A 1K2I1 2O8UA 3SI4H 1TRNA 2FOMB 3TJUA 3DUXH 4WMEA 4AYVB 2UUKB 1BBRK 3EA8A 3F1SB 5E2OA 3AAUA 2UWLA 1GI1A 3KQDA 3S0NA 2AEIH 3RC5A 1PPEE 1L1JA 2BX4A 1TMBH 2BDAA 1KXDA 1QA7A 1GJ4H 2G55A 4YO9A 1XXFA 1HAXB 4A92A 1GG6B 1S84A 2PSYA 3KF2A 5EPYA 1SGCA 5HMAA 2XRCA 1Y3YA 4GVUA 3PLBA 1O2TA 1PPCE 4DVAU 2ZGHA 1K21H 5FHTA 1TLDA 3UWJH 4YTAA 1WBGB 1UTQA 1O2UA 1E38B 2GMTC 2XC4A 1YM0A 1IQEA 4NZQA 3P8FA 1GBTA 4UE7H 1UK2A 2WPJS 1S5SA 4AG2A 1TGTA 1XUFA 3ZYDA 2ODYB 3HK3B 2V0BA 3RXUA 1RRKA 1PQAA 2XCFA 4K8BA 3GDUA 1OP8A 1SOTA 1TRMA 3A7ZA 1NFYA 1GBKA 3TH2H 1ZR0A 3UOUA 2BDGA 3MNXA 3UFAA 1QRXA 2BXTH 1TPPA 3TGJE 1O3FA 1BTPA 5ABWA 1AGJA 1O3AA 4FUCA 3LH3A 1F0RA 2F9OA 1EKBB 1GI3A 5DP3A 7GCHG 2R3YA 2GKVE 1SLWB 2VIOA 2PKAA 2XBWA 3RXCA 1HJ9A 1MMJN 4X2XA 1ANEA 3RXOA 1SLUB 2BD4A 2BQ6B 2WPHS 2K1QA 2GVFA 3SU6A 1V2JT 4CR5A 4WF8A 4MVNA 1TQ0B 1MH0A 1T4VH 2CF8H 1O3IA 3MH5A 1XM1A 3A7XA 4SGAE 4B75A 3SJ8A 3UR6A 4LZ4B 1EB2A 1XUKA 3RM2H 2OLGA 2GDDA 2HOBA 1LMWB 4NFFA 1PPFE 2XC5A 1YLCA 2THFB 1TRYA 2AGIX 1FN8A 3P6ZB 1P12E 4AOQA 3FZZA 5E0HA 1UVUH 1CQQA 1K1JA 2OXSA 4O97A 4ISNA 1F0TA 1C1UH 3FFGA 4NIXA 1GDQA 1GI4A 1MZDA 1P04A 3TK9A 1BTUA 1DWCH 1JIRA 3SNBA 3RXJA 1EJNA 1SGFG 1T8NA 1A3EH 2UUYA 4Y6DA 3O8RA 2Z94A 2AGGX 3MH4A 1PFXC 3OY6U 3V3MA 1JOUB 1TBZH 1P2KA 2G81E 2ZQ1A 2PUXB 4UD9H 3MU0A 3SNCA 2GZ9A 1EAIA 1H9LB 4NIYA 3T28A 4ESTE 4GPGA 1C5LH 1GHYH 1GL0E 3E6PH 4ABGA 2FX4A 5GXPA 2WPLS 1O3DA 1GHBF 1GMHF 2O8LA 3M3SA 4H42U 3KQEA 2RA3A 4OGYA 1YBWA 4JZIA 2WPIS 3GICB 1AWFH 3R3GB 5DO4H 3E8LA 5DP8A 1V2KT 2ZFQH 2ZDMA 2TIOA 1DM4B 1H8IH 1WCZA 2F3CE 2RCEA 3ZZAA 1G9IE 2F91A 3VB6A 5I46H 1CBWC 4CRDA 1J14A 1EPTC 3A7TA 4ZMAH 1HGTH 1NROH 4Y10E 1AUTC 2Y6TA 5AVDA 1QJ6B 2YOLA 1UCYE 1W8BH 1ZMNA 5GCHG 3SJKA 2AH4X 3KNXA 1FQ3A 3MYWA 3RMOH 4H4FA 5EPNA 2A7CA 1O5BB 1D9IA 3A82A 1DICA 3PLPA 3MMGA 1ZZZA 1Y3VA 2BQ7B 1O2IA 1H9IE 3LOXA 1O5AB 2VINA 1S0RA 1O32A 2UUJB 4RSPA 2XW9A 2BDBA 4AYYB 1HRTH 1TNKA 4B2BA 3TJNA 4NG9H 1LCYA 4AX9H 5TJXA 4D7GA 2F83A 3QDZB 1MTSA 2BY8X 3ZZBA 1NU7B 3K9XB 2H1UA 3RM0H 2TRMA 3S9BA 2ZFRH 1GJ8B 3BTKE 1WQSA 1N8OC 1OYQA 1E34B 3SJOA 1Z1JA 1UTNA 4O3UA 3QGNB 2PTNA 3ZZ6A 5L2YH 1NFWA 1SLXB 1V6DA 1ZPCA 3RU4D 2GCTB 1HJAC 1CA0C 4O3TA 1P2MA 1SGFA 2NU1E 1GWAA 1SOZA 1KDQB 2BD9A 5JDUB 2W7SA 1TAWA 1LPGB 2FLBH 4TPYA 4E7RG 1W7XH 2HGTH 3P17H 5HM2A 3PMHB 4BXWA 3AVZA 3VPKA 4JYTA 2YNAA 2ASUB 4KTUA 3UUZA 2ALVA 3KCGH 4K2YA 2FI3E 5A8YA 1EOJA 1TE0A 1MTNC 3RU4E 2D1JA 2PLXA 4BOHA 1GHWH 3U8TH 1NM6A 3AASA 3RXTA 2QF3A 1TPSA 2FIRH 1HFDA 1BRAA 2BTCE 2C3SA 1AHTH 4JK6A 1ELCA 1P09A 5EQQA 1HB0B 1Z8GA 3UY9A 2P8OC 3EA9A 3FZDA 3I78A 4FVBA 2G5NA 1BJUA 2SGDE 1Z1IA 1O3CA 4GSOA 1PPHE 2ZFPH 1NS3A 1SHYA 1SHHB 2Z7FE 2JETB 2VIPA 3BTFE 1TGCA 1EX3A 2P93A 4JMYA 2H5CA 1TNJA 3MH7A 2LNCA 1NTPA 2B8OH 1EJAA 3SZNA 5ESBA 1DVAH 1YCPM 1ZPZA 4AGKA 4D9RA 1Z6EA 1UTLM 1OKXA 3VB4A 2BLQA 2FDAA 1DITH 3VB5A 3S9CA 1DWEH 4X1SU 2VNTA 2ZIQH 1YPGH 2ESTE 4MNWA 5BRRE 1V2QT 3SU4A 1WTGH 1ZGIA 1GI5A 3MU8A 1DPOA 4O9VA 3M5OA 1SGEE 1GGDC 2XXLA 5L30H 4Y71A 1YPLH 4ZAEA 3ATKA 1GBMA 3CP7A 4Y7BA 1TX7A 1UVPA 2BD2A 2ODPA 2BD3A 3S69A 3B8JA 3O8BA 2VWMA 3KQBA 2WUBA 2AERH 4UFFH 1GHAF 2HWLB 3MHWU 1TGSZ 4BAQB 3HKJB 1F5LA 1WTHD 2QA9E 1GHBG 1GMHG 1V2ST 3TNTA 3GY3A 2CV3A 1JIMA 1CA8B 1O5EH 2HNTF 1DLKB 1F5KU 1AKSA 4CRGA 2O8MA 3E1XB 4R0IA 2FZZA 1WYKA 2NU0E 4DT7B 1G3DA 4X8UH 5L6NH 3BN9A 3MU1A 4ABHA 1O2KA 1C9PA 5E0JA 1FLEE 1BITA 4D76A 1O2NA 1W13U 1UK3A 4Y0YE 2VWOA 1GJ9B 3UPEA 2VIDA 1ETSH 3R0FA 2FOHA 5H4IB 2GCHF 1HXFH 1HAVB 1P03A 2OINA 5GDSH 1K1NA 4I33A 4CRCA 1ZHMA 4WXVA 5C1UA 1K1OA 2QXHA 2Y5HA 1BT7A 1MCTA 1LTOA 2A32A 4I31A 7ESTE 1XUHA 1VJ9U 6CHAC 4BNRA 1EASA 1CHOF 3CS7A 2I6SA 2ANYA 2FI4E 1DSTA 1V2UT 4E05H 3PWCA 2BMGB 1O2HA 3O8DA 1QB1A 2BY6X 3Q76A 2QCYA 4DY7B 4F4OC 3HGNA 1GPZA 2GD4B 1O3PB 2G51A 4YT7H 3UNQA 3QK1A 4Z6AH 1EP6A 2F9NA 4IBLH 1NRPH 1A61H 4XBBA 1H4WA 1PQ8A 1MTVA 3LC5A 1BJVA 1BIOA 2A5AA 1T7CA 1W14U 1UTJA 2PFEA 1P2NA 2I6QA 4GHTA 4F49A 1Q31A 1O2QA 1TIOA 1MCVA 4CRFA 3P70B 2ZU1A 2ZPSA 9LPRA 2A4QA 3BF6H 2VIWA 4A1XA 1ANDA 3LJOA 1IQJA 5CHAC 5AHGH 5T6DA 1EPTA 1MAYA 3UWIA 1B7XB 1C2KA 2BDHA 3HKIB 3ZZCA 2M5TA 1HBTH 1T8OA 2PTCE 1MTWA 1P2JA 1E35B 2ZFTA 3RXHA 5JB9S 1IHSH 1TQ7B 1IQMA 3RXFA 5C3NA 2OD3B 4DG4A 2ZP0H 2BHGA 4OS7A 4M7GA 2BD5A 1TOMH 2WUCA 2TGPZ 4LOYH 2ZHQH 1LHDH 1QL8A 1SQOA 1UTOA 2DE8A 2ZU5A 5T6FA 2ZECA 2J94A 2PKAB 1KXAA 3QTVH 1YCPH 1EUFA 1O5CB 1GHVH 2G4UA 3K6ZA 2TBSA 3F68H 2A2XH 1C2MA 1HNEE 3UTUH 3PWBA 1G30B 4ZHAA 3K2UA 3RLYH 2CF9H 3BTME 1JXPA 4FUBA 1LO6A 4UDWH 2Q6DA 2WV4A 5FPTA 3ZVCA 4Q7ZA 3VB7A 2CHAB 3SNEA 1O35A 5EQRA 3SU1A 3SO3A 4AFSA 5GIBA 4UFEH 3QTOH 1FMGA 4IS5A 2JKHA 3GY6A 4Y7AA 1W3CA 2GT8A 1GJDB 1O3MA 1O2SA 3SI3H 1C1WH 4CREA 1SLVB 5ESTE 2ZHFH 1KLIH 2RDLA 3DHKH 1ESTA 1TALA 2QN5T 1GJBB 2C8XB 3HATH 1S0QA 5CMXH 1A5HA 2PSXA 4FUFA 2SNVA 3CENA 1AFQC 3I77A 1BMLA 4TY6A 4BANB 3RC6A 1OWIA 1ZJKA 4HI3A 1HDTH 5F6MA 4NCYA 5EGMA 1AUJA 3U8OH 2FPZA 1JRTA 2VH6A 1CT4E 4ZUHA 1ZRKA 4X8VH 4MNXA 3M5NA 3RUOA 1UTPA 5FX5A 4Y0ZE 1MBQA 3GY7A 1AI8H 2J92A 2P16A 1XUJA 1L1NA 1ESAA 4NA7A 2B5TB 2OTVA 1Y3UA 1DLEA 1GCTC 1GHAG 3HK6B 2XC0A 1AE5A 1P11E 1ZSJA 1HPGA 1YPJH 3Q3KA 1KXEA 1QL7A 2AIPA 4MPXA 2FXRA 3GY4A 4JZ1A 1C5MD 2BX3A 2Y7XA 1O2OA 2UUFB 3UR9A 1EXFA 3BEUA 5BPEA 1S85A 1K9OE 2CJIA 1EAWA 3KEEA 1C5PA 2FMJA 1XUIA 4NZLA 1TABE 5C67A 4B2AA 4J1YA 1ARCA 1K28D 2FX6A 2VH0A 3LGYA 1W10U 4NA8A 4D8NA 2GCHG 3TITA 3EDXB 1RD3B 3V13A 5JBBS 3T2NA 5A0BA 4MTBA 3TJVA 2V35A 1EOLA 1KY9A 4ABEA 3DD2H 2TGAA 1CHOG 1C2GA 4X2YA 3GCNA 4ZKOU 2VVVA 3IG6B 1BHXB 2ZGCA 3FAOA 1SGRE 1VCQA 3A87A 1TGNA 3MO6A 4FUJA 2BOKA 2BVRH 3F9GA 1NRSH 1FIWA 3L3TA 5EXLA 3RC4A 4FVDA 1L2EA 4IC6A 4DGJA 4WJG2 1VITH 2ZZUH 5DGJA 1GBAA 1DXWA 4AFQA 1RTFB 3BG4B 3T62A 1QL9A 3PV4A 3W94A 1HIAB 1THRH 2OBOA 2WPMS 1XVOA 2ZNKH 5A0AE 3SN8A 4BAOB 2JH0D 4ABJA 3RXKA 3V7TA 1D6WA 2HRVA 2TPIZ 3M7QA 4CRAA 3ZZ4A 3M35A 1HUTH 3F9FA 4DCDA 2GX4A 5JPMH 1DANH 1TPAE 1HAYB 1P57B 4UEHH 9ESTA 2P3UB 4OS5A 1Y3WA 1O34A 3TIUA 3PTBA 1A46H 1ZTLA 2AMDA 1Z8IB 3MFJA 2PUQH 1K1LA 3ELAH 5C5OA 3SGQE 3A85A 1H8DH 3LGIA 1MQ5A 1YPMH 2B0FA 1LVOA 1C1MA 1C5RA 4JZDH 4YOJA 4A1TA 1EZUC 1VCPA 1TYNA 1T8LA 1T4UH 1DWDH 3A8DA 3H7OA 2FEQH 2C8WB 4ZKSU 3VEQB 3T27A 1BOQA 1M9UA 3SQHE 3SGBE 3QGJA 1ZTJA 1NRQH 1HJ8A 2G8TA 3A8AA 2Z9KA 3L6PA 1O2RA 1TNHA 2RG3A 1ZMLA 3KN2A 2Z9JA 4K3JA 4AB8A 3NKKA 3A7YA 5A09A 1XKAC 3OSYA 4J2YB 2GMTB 3BEFB 4MLFB 4BTIB 1D3QB 3FP7E 3U9AH 1AB9C 1WU1A 2ZEBA 3MU4A 4U30A 1FY8E 1JRSA 3SORA 3SV2H 4H6SB 1FV9A 2R9PA 2FOGA 2HVXA 4KELA 4AFUA 1Y5UT 3A80A 1PJPA 3GISB 4HZHA 1DS2E 2ZDAH 1GDUA 5EOKA 3PO1C 5DJ7A 4CBOA 1O2ZA 3MNBA 1YP9A 1FPCH 1P06A 4X1PU 1MQ6A 2GCTC 1QRZA 1TOCB 3G01A 2OQUA 5JB8S 5A2MH 3PYHA 3A88A 4ABFA 4ZHLU 1TNLA 3UNSA 1QNJA 3VGCB 1QY6A 1IHTH 4FU9A 1V2TT 5L2ZH 1EB1H 3TH4H 1MKXH 4INKA 3E90B 3SW2B 3MWIU 4MNVA 3MI4A 2P94A 1AKSB 1LPKB 2ZDKA 1ZGVA 2BLVA 2SNWA 2Z3DA 1C9TA 1C2JA 1P2IA 1DY8A 4LXBH 5K7RA 2Y7ZA 1BRCE 5DK1A 1MU8B 1AVXA 3LH1A 2SFAA 3EE0B 1GI2A 2JH6D 3RXVA 3ZYEA 2HPPH 2QF0A 1T31A 4I8LA 1G2MA 1GJ5H 4XFQA 1SFIA 1SC8U 1W0ZU 1XUGA 1P2QA 4Z0KA 4CH2B 1NO9H 2ZDNA 3RXEA 3UOPA 2IN2A 1HV7A 2P3TB 1BTWA 3LDXH 3ATIA 3NPSA 4CHAC 4AN7A 3BV9B 5DG6A 4AG1A 2ZF0H 1QCPA 4OS6A 1P01A 1WSSH 3ATMA 2C90B 3NZIA 1FAXA 1CE5A 1L4DA 1ANCA 2CGAA 4X2VA 1OWJA 1LQDB 1FY3A 3LGWA 5EU8A 3M3TA 1C5OH 1HAZB 2FYQA 5JBAS 1IQKA 4GUXA 1FIZA 1AWHB 1O2GH 5EW1H 1F5RA 1KLJH 1Z8RA 1ELGA 4INLA 1ABIH 1UVOA 2Z9GA 3C27B 1BMNH 1MKWH 1CO7E 3URDA 1F7ZA 1QQUA 1SSXA 1P3CA 5C5NA 1B5GH 1UCYH 4TPIZ 3E16B 3A84A 1IQNA 2A2QH 4MPUA 2V3OH 1SPJA 2ANKH 1MZAA