1MTVA

Factor xa specific inhibitor in complex with bovine trypsin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords TRYPSIN
publication title Crystal structures of factor Xa specific inhibitors in complex with trypsin: structural grounds for inhibition of factor Xa and selectivity against thrombin.
pubmed doi rcsb
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mtvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mtvA02
1KDQB 3QZQA 7GCHG 2TGPZ 3MNCA 1O3FA 4IMZA 1NZQH 2FOHA 4U2WA 3RU4E 5E0HA 4NWLA 1PFXC 1QBOA 2BD3A 2FOAA 2BQ6B 1BTXA 5LPFA 3BEUA 3TLOA 1AO5A 2FESH 3TH4H 1ZPCA 3LOXA 3A84A 1HJAB 1BQYA 2XNIA 4JZDH 3OSYA 1CVWH 2PSXA 1D6WA 2H1UA 2BZ6H 1HAHH 3RXAA 4JYVH 2VIQA 1T8OA 3RM2H 5FXLA 3BG8A 2B0FA 2UUJB 1ZZZA 1GGDC 1D3DB 1Z6JH 3BTQE 4YLQH 3LGIA 1P2QA 2Z3CA 2TBSA 3PMBB 2Y82A 2Z9GA 1GVKB 3TNTA 3EAJA 3PROA 3ZYDA 1C1WH 2ZGJA 1ESBA 4K1EA 2YNBA 5EODA 1V2ST 5FCRA 1K28D 1UTJA 2NU1E 2ZF0H 3T26A 5K7RA 5EG4A 3E3TA 1ZSJA 3UNSA 4CHAB 3FP6E 4Y0ZE 3ZVBA 1EKBB 4ISHH 4KGAA 1THRH 1Y3XA 1GDNA 1O30A 1O2RA 4WY3A 2PUQH 3EA8A 3S0NA 1O3CA 5IYTA 1RTFB 4ZHLU 4ZKSU 1ARBA 1K21H 2WUCA 2ESTE 4AG2A 3H7TA 5C20A 3ZZ8A 8KME2 4J2YB 4X1SU 5JPMH 2STBE 1Z8JB 1ELTA 3KF2A 2ZFRH 2FM2A 2WPLS 1C1NA 3K9XB 1HCGA 3OU0A 4BXWA 2ZU2A 3M35A 4LOYH 2QXHA 5DO4H 4WXVA 2NU4E 4O97A 5E8EH 1O5DH 1GMCG 1C5SA 1E36B 2GV7A 4Q7YA 1GBAA 1G2MA 2GVFA 1XUKA 2Z9KA 3RXUA 1LHCH 1VGCC 2XYAA 1TE0A 2ZFQH 3P17H 1JBUH 4ABGA 1EOJA 4J1YA 1TBZH 1OOKB 2OQ5A 1O5EH 3V0XA 5C5OA 3ZVGA 1KXCA 3MH4A 1H9HE 1BTPA 6LPRA 5HYOA 4Y7AA 1GBCA 1DXWA 3U8RH 3GY6A 1Z1IA 2EI8A 3BF6H 2BD8A 2BD4A 2ZDNA 3F6UH 2BDIA 2G4UA 1HV7A 3MU8A 4MPWA 1LCYA 1NPMA 2W7SA 3RXIA 5LPEA 5PTPA 2WUBA 1UVOA 1UK4A 3RXMA 3SHAH 2ZPSA 1LHDH 2ZZUH 3UIRA 4DT7B 1DUAA 1QJ1B 1EZSC 1QBVH 1AFQC 4Y71A 1DWCH 5GXPA 4ABJA 1TGNA 4FUHA 5A8XA 5A8YA 4X6PA 3O8BA 1GJAB 1FY8E 1O2SA 4TPYA 1TNJA 4K1SA 1IQHA 4NSYA 1L4ZA 1P06A 3FVFB 1T8MA 2ULLA 2B9LA 4Y79A 1VJ9U 2FOFA 3BTME 2C8YB 1C1VH 1TNGA 4HGCA 4OS5A 1K1JA 2ZC9H 5GDSH 1GI2A 4R0IA 4HTCH 1V2TT 3VXEH 5EQQA 1L0ZA 3E0PB 2W3IA 1C2DA 1EAXA 1TA6A 2C8ZB 1GI0A 1QRXA 1P01A 4UEHH 2OBOA 4I31A 5DG6A 2IN2A 3ZZ3A 2ODPA 3PLBA 4CRBA 4DW2U 1LKAA 4PROA 1TWXB 1NRSH 1C1TA 1XX9A 2DE8A 2WPHS 4AFUA 1SGFA 4GAWA 1UMAH 2JETC 1GJDB 4DIHH 2ZHFH 1C1PA 1V2RT 1Y8TA 2CGAA 3QWCH 2BDAA 3ZVEA 2QGRA 5TJXA 2GX4A 4KTSA 3VPKA 4NA8A 4X2XA 5C2ZA 4KTUA 4CH2B 3TGJE 1CA0B 2A0QB 1IHTH 4H6SB 1HDTH 2D26C 1UVUH 3L3TA 2XCFA 1OXGA 3I77A 2AERH 1EJNA 1EAUA 5IDKA 2OD3B 4FUEA 3ATWA 3MU5A 4MG3A 1SOTA 4KP0A 1XUFA 1VITH 3H5CB 2J9NA 2VWNA 2CMYA 3SN8A 4RKJB 3BEIB 1SLXB 4MNYA 3TK9A 4ZMAH 1KLJH 3MO6A 2WYJA 2G4TA 2ZGHA 1Q31A 3BN9A 1TBRH 1BHXB 4NIVA 2Z9JA 5GIBA 1O3GA 1Y59T 4X1PU 2R2WU 1XKAC 3A83A 1MKWK 2BX3A 3PM3A 1DWDH 3AASA 3ATLA 3TGIE 4AFSA 1C5RA 2QY0B 3MU1A 5E2OA 4I7YH 1HGTH 5CHAC 3RXJA 1YP9A 2VGCB 1O2OA 1GI9B 4I8LA 1O2XA 2FIRH 1G30B 1A1RA 1P2JA 1GG6C 3TVJB 3A81A 1YGCH 1C5UA 3LONA 1LHEH 1KXDA 1PYTD 1DITH 2BD2A 3LT3A 2ZP0H 1N8OB 2ZTXA 1A4WH 1FNIA 3UNQA 3A80A 1GBIA 3EE0B 4TPIZ 2ZTYA 1Q3XA 5ESBA 4XBBA 1UCYE 4A5TS 1HBTH 1MU8B 3GY4A 2R0LA 3M5OA 3M5NA 3C27B 1DUEA 1O0DH 3T27A 1ZHMA 3PV4A 1MKWH 4ZHAA 1UJ1A 2KAIA 2GTBA 1E37B 3ZVCA 1O2NA 2P8OC 3SW2B 2Y6TA 4NWKA 1W0YH 3QN7A 1GCDA 1AN1E 1WQVH 2J4IA 2C93B 4OS2A 4NFEA 5E2PA 1O3PB 1O3HA 1GVZA 1UVTH 4UFFH 4ZKNU 1HAOH 1CQQA 1H4WA 3LJJA 1EZUC 3SO3A 1BIOA 2F9VA 1FY4A 4NA7A 1ABJH 4ISNA 3VB3A 1G36A 3BV9B 3MYWA 5LGOA 3SV6A 3VGCC 1ZTKA 1HUTH 1AB9C 5C1YA 1CGIE 1AD8H 2FI5E 1AMHA 1TALA 2BY7X 2V0BA 3A7YA 3E91A 1K9OE 1BRBE 2A31A 2OC0A 1TA2A 4D7FA 3KL6A 4AFZA 2PGBB 1BBRK 1JRSA 1J17T 2Y5HA 3KCGH 3UUZA 1SGFG 1XXFA 4JZIA 3BTWE 1V2MT 1MTVA 1QB6A 4AB9A 1DE7H 1QB9A 1G3DA 1O2UA 4I8GA 1K22H 4A1XA 3KQEA 2VIPA 5HXFA 1GHZA 5JBTA 3SGAE 5EXMA 1O2LA 1S85A 3QZRA 1P2KA 1LTOA 1SLWB 3QTOH 4ABEA 1B0EA 4AORA 1O3AA 4H4FA 3NZIA 1D3QB 3M3VA 3RXKA 1WCZA 2FDAA 3LH1A 5FPSA 2A45B 2ZG0H 4XFQA 4K1TA 1CGHA 1BMMH 1ZMNA 2OBQA 1O3MA 2AMDA 3RMMH 9ESTA 4BOHA 1NROH 3M36A 3KQDA 1MAYA 1XKBC 1XUHA 4NSVA 1RIWB 2GD4B 2CHAC 1XXDA 1C5PA 3MFJA 3TJNA 1XMNB 3A88A 1LPZB 6CHAC 4WH8A 1BB0B 1NU9A 3ZZ6A 4YESB 1RTLA 4LZ1H 4XDEA 1GHBF 3GCTF 1A5IA 1EASA 2W3KA 3ATKA 3P95A 1SFIA 2G8TA 3PO1B 1L1JA 3QGJA 3LH3A 2EI7A 3A8DA 2STAE 3V12A 1RTKA 3SJKA 4UE7H 1IQMA 2H6MA 3K6YA 3A82A 1KXFA 3VEQB 4NIYA 2Q1JA 3MOCA 3W95A 2GMTB 3NK8A 2BY8X 1P2IA 1E0FD 1UHBA 5E0GA 1CT0E 1KXAA 3NWUA 3MWIU 1FQ3A 3P8OA 2QYIA 2NU3E 2VINA 2ZQ1A 3BTKE 3BTHE 2W5EA 4MPVA 1EB1H 4UD9H 5F03A 1TMTH 1VCWA 4FU8A 2HLCA 4ISIH 2TPIZ 5DP8A 1P3CA 1BMAA 1GJCB 1YYY1 5CE1A 3HGNA 1RS0A 1DLKB 4ZROA 4I8HA 1OX1A 3BTEE 1GJ7B 1QFKH 3MTYA 3RLWH 2ANMH 1GGDB 3M7QA 1GVLA 3RXQA 2BY9X 1O39A 1ETSH 4DOQA 3DHKH 2Z6BD 3KQCA 3KNXA 1O2HA 2YNAA 1O2QA 2HWLB 3OYPA 1ZMLA 3ODDA 4ABBA 2FOMB 3DFJA 3RXDA 4IS5A 3BSQA 1FXYA 1K1MA 3V7TA 2QXJA 1ELDE 2G51A 2VVCA 3SOSA 2A7CA 2F9UA 4D9QA 5GCHF 1QNJA 8ESTE 2FS8A 1WAYB 1GJ9B 1MQ5A 3D65E 5G4BA 1K1NA 3SNBA 1O3DA 2QF0A 4Q7ZA 3MHWU 1NRQH 1GHVH 3QUMP 1FONA 4INLA 1TFXA 4BXSA 3V3MA 1TNLA 2A2XH 3O8RA 2XBVA 3SI3H 1O33A 1CE5A 3PTNA 1UVPA 4IC5A 3TJOA 1AKSB 1THSH 1EUFA 5JYIA 5JB8S 1KTSB 4MDSA 4D9RA 1FLEE 2A32A 2GCTC 1J8AA 1SSXA 2GGVB 1TLDA 1A0HB 1TQ0B 2FI3E 2WV5A 3E6PH 1E38B 1A7SA 4TY6A 1C2FA 3Q77A 3RXCA 1VGCB 4O3TA 1ANBA 1WTHD 2W26A 4GPGA 3U98H 3CS0A 2GCHG 1EXFA 1CGJE 3ZZCA 2J2UA 4IN1A 5JBBS 2R9PA 2ZIQH 1AVXA 2CF8H 1BCUH 4THNH 2UUKB 3UR9A 1QL7A 1G3BA 2WYGA 4A7IB 1XUGA 1EPTA 1S5SA 3UFAA 2C3SA 1SGIB 1TPPA 1M9UA 2ZCLP 3RXFA 4D8NA 4FVBA 1GJBB 3O8DA 5I46H 1GI3A 2OP9A 1BOQA 1FIZA 2PWXA 1E35B 2FOGA 4RSPA 4BTIB 1JRTA 1HAVA 3A7XA 3TPIZ 9LPRA 2O9QA 2P16A 1DANH 2SGEE 3M5MA 1AFQB 3PYHA 1S0RA 2BLWA 2BMGB 1HNEE 5LPRA 1YPLH 1F5KU 4AFQA 1UTQA 1P2MA 2ZKSA 1A46H 1C2GA 4X8UH 2C8WB 5EXNA 3RC6A 3NXPA 1NFXA 4X1RU 1LHFH 1ZPBA 2B5TB 1O3KA 2OXSA 1DS2E 2ZPQA 3A7TA 3NPSA 1OP0A 4IN2A 2Q6GA 2FEQH 5DK1A 4YOGA 1SGYE 3P70B 4U30A 3LDXH 1CHOG 2FPZA 1ELFA 3PWBA 3RC4A 1AWHB 4CRCA 1P09A 3ZV9A 4Q80A 3RXPA 2UWOA 1H8DH 3Q3YA 4ZH8A 3I29A 7LPRA 4ZHMU 2ZGCA 1HXEH 2VH0A 3GYLB 2IJOB 5A09A 1BTYA 1YF4A 4JZEH 1ZTJA 3B9FH 3EDXB 3ZVDA 1AUJA 4FUJA 1KDQA 1G3CA 4X6MA 2BLOA 1C5ZB 4MTBA 1CBWB 5C1UA 1YLCA 1LQDB 1GHBG 1DFPA 1PPGE 3GCTG 2AMQA 1V2NT 3FZDA 4Y0YE 2GT8A 1SVPA 1C2HA 4ZUHA 4B75A 1BA8B 1BT7A 3SUGA 1DVAH 2OTVA 1RGQA 4B2BA 4YO9A 1ZRKA 1GL1A 3S69A 3UOUA 2AFQB 5GJ4B 1JMOH 1MTNB 3LGWA 7KMEH 1INCA 3ZYEA 1W7XH 5HMAA 3RXTA 3PWCA 1EPTC 4ISOA 3A8AA 1GI5A 3U69H 4FUGA 4I8JA 2PW8H 4NCYA 3JZ2B 1IQFA 1C2JA 5AFZH 4AYVB 3NCLA 2R2MB 1VCPA 3TJUA 3GDVA 1KLTA 1PJPA 2I6SA 4K69A 2BD7A 2VVUA 2D2DA 2FO9A 3HKJB 2FOBA 1PQ7A 2GDDA 1NC6A 3U1JB 1D3PB 4ESTE 1HAIH 4HZHA 2P94A 2BOHB 5F8XA 1SQTA 5CHAB 2ANYA 1O3JA 4MPUA 1F2SE 4CRGA 2QF3A 1Z6EA 2WPKS 1GHAF 2FWWA 3F9GA 4A6LA 1P3EA 2XTTB 3BEFB 1HPGA 2QAAA 4HI3A 2QXGA 1O2GH 1ZJDA 3UQOA 3P92A 2G55A 2ZNKH 3ODFA 1SOZA 2ODYB 3BTDE 4AYYB 5DP6A 3PMAB 5GWZA 2HOBA 4X8SH 2AGGX 4WMEA 1RD3B 3D49H 4ABFA 2XC5A 5FHTA 5FPTA 1K1OA 2ZHEH 2XBYA 2UUFB 5GCHG 3H7OA 3OX7U 3LU9B 4BNRA 2ASUB 3DD2H 2BLVA 2GZ9A 1IQNA 1P12E 1F0SA 1T31A 1SLVB 5FPYA 1T7CA 4U01A 4Y11E 1O32A 1O2KA 2BX4A 1HXFH 3UWJH 4ABDA 1D4PB 1NESE 2FTLE 1O38A 3IWMA 2P8OB 1IAUA 2XC4A 1GDQA 1S82A 2TGAA 1SHYA 1FAKH 1Z8RA 2FOEA 1UTMA 1NFWA 4M7GA 1SGPE 1EB2A 3M37A 1P05A 2F9BH 4Y8YA 1AZZA 1GBEA 4Y76A 2F3CE 3ZZBA 1QIXB 3FFGA 3MMGA 4FUDA 1W7GH 3ZVAA 1A3EH 1BMNH 3VGCB 4WMDA 2A5AA 4B2AA 2G00A 2ZCKP 1HIAA 4O3UA 1F92A 1YPKH 1HYLA 2O8MA 2EA3A 5DP9A 1GL0E 4B74A 1AVWA 6GCHF 4RKOB 1DXPA 1E34B 2VIOA 4OGXA 1F7ZA 4A1VA 1GBMA 5DGJA 1ETTH 5DPAA 3SORA 5EPYA 1MD7A 3SUFA 2BHGA 4VGCC 1TABE 4E05H 4KTCA 3RXEA 2ZHWH 1ANDA 2XWAA 2FMJA 2HNTF 1HJ9A 3LGVA 1IQKA 2QA9E 1P8VC 1W3CA 2G5NA 1AQ7A 1XUJA 1NY22 5FBIA 3MNSA 1FJSA 1P0SH 2J38A 3F1SB 3SU3A 1AE8H 1EAWA 1O3OA 1C2LA 1O3BA 1PYTC 1L1GA 1BHXF 3KQBA 3UR6A 1YPJH 1Z1JA 2I6QA 1O5GH 1OWJA 2HPQH 1OWKA 1WUNH 4K2YA 4UFGH 5DP3A 1WU1A 1EAIA 3SNEA 4GCHF 2RCEA 1L2EA 2A1DB 2WPIS 4MNWA 4YLUA 2ZDVH 1N6XA 3PTBA 1J9CH 2P3TB 2FI4E 4ZXXH 3FANA 1P2NA 1C1SA 3R0FA 2ZHQH 1MBQA 1GCTC 2CHAB 2RA3A 4GHQA 1O3EA 3DFLA 3KEEA 1B5GH 1P11E 3SU0A 1QL9A 4JK5A 3U8OH 1GDUA 2M5TA 4Y6DA 4DURA 2VIWA 6CHAB 4B76A 1P9UA 1ARCA 3TK6A 3RXBA 1S6FA 1HB0B 1Z71A 3FAOA 5T6GA 1F5LA 3E8LA 1Z8IB 2PUXB 3GY8A 3T62A 1P10A 1EX3A 1LQEA 2CV3A 1HJ8A 1YC0A 3HPTB 1S84A 3RXVA 1SPJA 4CREA 2BD5A 2PTNA 1NRPH 2QN5T 1ZYOA 1EZQA 2HNTE 3RU4T 5SGAE 2SGFE 1WV7H 3PMHB 3QO6A 1QGFA 1S6HA 3M7UA 4GSOA 1ZGIA 1O2YA 3LIWA 1W11U 1FV9A 2RA0A 5DJ7A 1AU8A 4FXGH 1WQSA 1ZRBA 2BLQA 3ZZ7A 2VWLA 5JBAS 3SU5A 3JZ1B 3TU7H 2FTMA 5AFYH 4BANB 2AGIX 1H9LB 3RXSA 2TGDA 1ELGA 2CXVA 3P8FA 4KKDA 1TNIA 2BXUH 1C4Y2 4AGKA 3UREA 1GHAG 1V3XA 1O5FH 1MTWA 4NZLA 6ESTA 1DDJA 4CRDA 2WV4A 3SNDA 1ZHPA 3KIDU 1KXBA 2TIOA 1SB1H 2BVXH 3S7HB 3DA9B 5TCCA 5HM9A 1UTNA 4FUBA 3SUDA 1TGCA 2FLRH 1N6YA 1SGCA 1FPHH 1XUIA 2PHBA 4GUXA 1KY9A 1P02A 4TY7A 1DY8A 1QBNA 3KGPA 3T2NA 4AB8A 1AHTH 2VB0A 3GCHC 3GISB 1NS3A 2VWMA 5EPNA 2ZDLA 1TX7A 1IQJA 1PPBH 2HNTC 1A5HA 1LVOA 5FBEA 1C4V2 1O3IA 2EC9H 5AVDA 4NGAH 1GBLA 4X2WA 4X8TH 4BAOB 2ZU4A 5EW2H 2GZ8A 2W7UA 1GI7B 1TMUH 2GZ7A 2D8WA 2Z3EA 3SJIA 2A7JA 1WOFA 1KYNA 2DE9A 2FZZA 2A5KA 3UTUH 1Y3YA 1RJXB 1K2I1 1Y3UA 5DP5A 1NU7B 3VFEA 3TNSA 1NTPA 3VB6A 1A3BH 1UCYK 3RMLH 3TITA 2Z9LA 1BJUA 1TMBH 1TGSZ 2A2QH 3RMNH 1O2PA 3F9HA 4B2CA 1HFDA 2VU8E 3SNAA 3SU1A 5F6MA 3M7TA 1TIOA 3T5FH 1AVGH 2PV9B 3B8JA 4A1TA 1JWTA 1O5AB 3TJVA 2A5IA 4ABHA 1MKXH 5C5NA 1FI8A 1H9IE 2ZGXH 1V6DA 3UQVA 1ORFA 3SQHE 3HKIB 4K8YA 2V3OH 1FN8A 2Y81A 1TPSA 1G2LA 2P93A 3MH7A 3RXRA 1QQ4A 4YTAA 5EQRA 1C1MA 1G3EA 2ZWLH 4RN6A 6GCHG 3A8BA 4XBDA 5DP7A 5BRRE 4Z6AH 3BG4C 2FXRA 4X6NA 3CP7A 2OCVB 4UFEH 1BZXE 3IITA 4NZQA 5F8ZA 2Y5GA 1TRMA 1OWEA 4WWYA 1QY6A 3DT0H 1GI1A 1V2QT 1SGQE 3MH6A 3I78A 4UONA 1CO7E 2FX6A 3MNBA 2P95A 4ABAA 5C67A 2BDCA 1UCYH 2ZA5A 4WMFA 4CRFA 1C5OH 3ZZ5A 2ODQA 2PKAA 1UTKA 4NIWA 3PB1E 5EW1H 3BTTE 4YZUA 1W14U 1MAXA 2ZI2H 1F0RA 4XE4A 2BY5X 3QTVH 1SBWA 2XWBI 1ZSLA 1QA7A 1P57B 4GCHG 4X0WU 1GMCF 2XC0A 3TH3H 4JZFH 2JH5D 1D9IA 1EOLA 1A5GH 1MQ6A 1T8NA 1G9IE 1ID5H 1O2MA 3RXHA 5A0BA 3CS7A 1GI6A 1O2VA 4YM9A 1SQOA 1OS8A 3ESTA 3EGKH 4FUCA 2ZQ2A 1LKBA 1EP5A 2G81E 5FX6A 2ZU5A 1Y5BT 4O9VA 1F0TA 2ZFSA 2FODA 1ZLRA 1QRWA 1LPKB 3D23A 1RRKA 2GKVE 2AYWA 2F9OA 1G37A 4I33A 2SGAA 1ANEA 2B7DH 3T29A 1TPAE 1A0JA 5EU8A 4IC6A 1PPZA 1FDPA 3VB5A 1TRNA 2AIQA 3A7VA 1DPOA 3A89A 1OWIA 1KIGH 1NRNH 2UWPA 2Z9IA 3RP2A 4D7GA 4X6OA 3EQ0H 3GDUA 1UK3A 3MO3A 1IOEA 1GBBA 1ABIH 4XBCA 1P2OA 1YKTA 1GBTA 1O36A 1XVMA 3SZNA 5L2ZH 3ENSB 3GYMA 1LMWB 1ZOMA 1QCPA 1YPHE 3SU4A 1EZXC 2C8XB 1W0ZU 4CR9A 1TGTA 2AIPA 2P3UB 3S7KB 1GJ6A 2D1JA 1ELCA 4E06H 1BTWA 4X2VA 1HAVB 1BRAA 3CENA 2EI6A 1O31A 1OKXA 1NM6A 3SQEE 1B7XB 2OQUA 1Z8GA 1WYKA 1F5RA 2AH4X 1YCPH 2IOTA 2VH6A 1RFNA 3LGTA 1BTZA 3ZZ4A 1AIXH 4DY7B 1ZSKA 1PQ5A 1O3NA 2ZDMA 1L4DA 2C4FH 4Y10E 1JXPA 4X1QU 5ABWA 1RIWC 2SFAA 1O3LA 4KELA 1VITF 2OINA 3AAUA 1LVBA 2ZO3H 1AE5A 1TNKA 1V2LT 3E0NB 3UWIA 3URCA 2H5DA 1AKSA 2F83A 2VJ1A 1SI5H 3IG6B 4Q7XA 4CH8B 2FYRA 3E90B 2A4QA 3MNXA 1O2TA 2AS9A 1A2CH 2J94A 4ZXYH 1EJMA 2RG3A 4CBNA 1TONA 1MTUA 3OTJE 4DVAU 2GMTC 3G01A 3L33A 4Z0KA 1GI4A 3DUXH 1O5CB 1HAGE 2Z94A 5T6FA 1PQAA 1YPHC 4LK4A 2ZFTA 1DWBH 2J34A 2BVRH 3ZZDA 4B1TA 1MCTA 3SJOA 2VIDA 1DOJA 2JETB 4NIXA 1GBDA 5L30H 3PLPA 3VB7A 1MH0A 2PLXA 4ASHA 1GMHF 1TPOA 4YOIA 5E0JA 4AG1A 3U8TH 2Y80A 3HK3B 2GP9B 2A4RA 3MO9A 4INKA 2LNCA 1TOCB 1QJ7B 3U9AH 1ZJKA 1EP6A 2VWOA 2FX4A 2PKSC 1TQ7B 3N7OA 5T6DA 2A7HA 2NU2E 4DJZB 3M3SA 1VCQA 2BDHA 2TGTA 1NO9H 2C90B 1ZHRA 2AGEX 3BTFE 4FUIA 1SGNE 1QURH 3FP7E 3LGYA 4TWYA 3SNCA 1QA0A 5A0CA 2BYAX 2H9TH 2OC8A 2WPMS 3LJOA 1W2KH 1YBWA 1C2IA 4VGCB 1BTHH 1LDTT 2ZCHP 4FU9A 1QRZA 1OWHA 5BPEA 3QLPH 4CBOA 4K60A 5A8ZA 4AOQA 4JYTA 3Q3KA 4JZ1A 1C2MA 1CSOE 2HPPH 2WINI 3F9EA 1BRCE 3UPEA 4DIIH 1GHWH 4MVNA 4MNVA 1G32B 4WF8A 1IHSH 1X7AC 3K6ZA 3AW0A 1MU6B 1TB6H 2LPRA 2HVXA 3T25A 4I8KA 1T4VH 3GY3A 1T32A 1DLEA 2PTCE 2Y7ZA 2CN0H 2PGQB 1C1RA 1SL3A 1Y3WA 2SGQE 4MNXA 2QV1A 7ESTE 1MZDA 2H5CA 2QXIA 1GG6B 1GCTB 3Q00A 5C3NA 3TK5A 1GPZA 1OPHB 1PPCE 4SGBE 4GLYA 2P3FH 4K3JA 3RU4D 1Y5UT 1SR5C 1J14A 1TX8A 5K0HA 1HAXB 8GCHF 3SV9A 5HGGA 1OWDA 5L2YH 1AZ8A 3A8CA 3SGBE 3ZVFA 4E7RG 1V2UT 1FN6A 2VVVA 3LGUA 2CJIA 2J92A 2HALA 3MH5A 4FVDA 2BTCE 2ZDAH 4UDWH 1C5LH 1ETRH 1L1NA 3C1KA 3SJ9A 1J15A 1HIAB 1C9PA 3KN2A 1EJAA 3HK6B 1GJ5H 2YOLA 4BAQB 1DSTA 3EYDA 2HGTH 1HJAC 1S81A 3GY5A 5A0AE 3E1XB 3P6ZB 1Z7KA 2ZHDA 3M5LA 1D3TB 4K5ZA 1AB9B 4AGJA 1FIWA 2ALPA 2BM2A 1C4U2 3E16B 2FP7B 4F49A 5EXLA 2O8TA 1GBHA 5JBCS 3LKWA 1N1LA 1W8BH 1VZQH 3AW1A 4XOJA 1NFUA 2H2ZA 2V3HH 1MMJN 1FAXA 3RM0H 1AFEH 1A61H 5EQSA 3F68H 2O8LA 2ZU3A 4CHAC 1VITG 4AX9H 1DICA 4ZKRU 1Y5AT 1CBWC 4OS7A 1ANCA 1IQLA 3OY5U 2SNVA 2WPJS 1FUJA 1C5MD 2ZFPH 1CU1A 1HAPH 1O5BB 1EQ9A 4CR5A 2SNWA 4UFDH 3GCHB 1DT2A 1CA8B 1SG8B 3NKKA 3SU6A 3SJ8A 1GHYH 4WJG2 4OGYA 1F0UA 3URDA 1YLDA 2JH0D 2QC2A 5F8TA 3O8CA 1ESAA 2Z7FE 1MTNC 4YT7H 3STIA 8LPRA 1ZR0A 1LO6A 1FY5A 1KXEA 3PMJA 1TAWA 1PQ8A 4ZKOU 4MQAA 2K1QA 1KTTB 2F9NA 2GT7A 2BY6X 2FOCA 5HM2A 2RDLA 3SV8A 2P59A 1DM4B 2ILNA 2OC1A 2Y7XA 1GMDF 1WBGB 2HRVA 2KAIB 3RXGA 1C5NH 3LC3A 1BBRE 1V2PT 4BTTB 3Q76A 1GMHG 1CT2E 4X8VH 1FMGA 2EEKA 2BQ7B 1HAYB 1DX5M 5FCKA 1TNHA 3A7ZA 4OS1A 1DSUA 5B6OA 3GY7A 2JKHA 4IW4E 4YT6H 1O35A 3AAVA 3TGKE 2BB4A 1S83A 4ABIA 2Q6FA 3SHCH 2VNTA 2ZTZA 3A87A 3ZV8A 3BG4B 4JCNA 1VR1H 4F4OC 2AMPA 2H9EH 1DWEH 1ZPZA 4CRAA 3SV7A 3EA7A 3QGNB 1QR3E 2UWLA 1S0QA 5T3HA 3ATIA 1XM1A 1ELAA 3UY9A 2OLGA 2BOKA 4Y8XA 1RXPA 1VJAU 1THPB 2DUCA 5TCAA 1C1OA 3BIUH 4B71A 3TH2H 2BQWB 3SI4H 5L6NH 1SLUB 2Z3DA 1LPGB 3P8GA 1OP2A 1P9SA 1YM0A 4ISLA 4IGDA 1SC8U 3RXLA 1C5WB 3B23B 4OS4A 4Y8ZA 1UTOA 3M3TA 1LVYA 4TWWA 3OY6U 3HATH 1SFQB 1TYNA 4O03A 1SGRE 2ALVA 3V13A 2G52A 4XSKU 1ZGVA 1V2VT 2NU0E 3U1IB 1JOUB 3RMOH 3A85A 1D6RA 1WTGH 4BTUB 1SGDE 1K1PA 1V2OT 1GJ8B 4FUFA 4JMYA 3VB4A 2XRCA 1V2JT 5DP4A 5I25A 1AGJA 3TIUA 1C5VA 2BVSH 1B0FA 2ZEBA 1GBKA 5ETXA 1QB1A 3AVZA 4Q2KA 5FAHA 3GCOA 4GHTA 2GCHF 1MKXK 1C1UH 1CA0C 4WXIA 5AF9H 1GJ4H 1QTFA 2PR3A 1TBQH 3S9BA 2FS9A 1AI8H 3SV2H 3ZZAA 8GCHG 2VIVA 2XBXA 4BAHB 1O2WA 4TYDA 1C5XB 5J4QA 2ANWA 3LC5A 1SGEE 4OS6A 5AHGH 1BDAA 1O2ZA 3KHVA 1O2IA 3MU0A 1TX6A 1K1LA 2QIQA 7GCHF 3UNRA 3EA9A 1MD8A 2F91A 1V2KT 4GVUA 4WH6A 1NN6A 1HLTH 2FYQA 1CT4E 1C5QA 1UTPA 5CMXH 3GY2A 4X2YA 4R8TB 3GOVB 3K2UA 1AY6H 1GBJA 3MI4A 4YOJA 1ACBE 1C1QA 2GCTB 5JDUB 1BITA 1O37A 1PPHE 5A2MH 2QCYA 3RDZA 2V35A 3GICB 5C1XA 3S9AA 1YPEH 1HAZB 1ELEE 4B73A 1OYQA 2XW9A 3SU2A 1CHOF 3QX5H 1BUIA 1Y3VA 3MU4A 4ZAEA 4E7NA 2B8OH 1UHBB 1C2EA 2VGCC 1IQEA 1W10U 1W12U 4Y7BA 5EOKA 4AZ2B 4D76A 3HGPA 1MZAA 2BDYA 4NA9H 4LXBH 1NRRH 2OC7A 1U6QA 2PKAB 3SUEA 3FZZA 2J95A 2R3UA 2O8WA 2ZFFH 3Q3XA 4DCDA 1BBRH 1HRTH 2ZECA 4IBLH 1H8IH 3L6PA 2BZAA 1T8LA 1ELVA 1N8OC 1MTSA 1PPEE 2XBWA 1ELBA 3RLYH 1BMLA 1JIMA 2F9PA 3SBKA 2THFB 1UTLM 1YPGH 2OUAA 2R0KA 2SGPE 1BRUP 2ANKH 2IPHA 2BXTH 2FLBH 3A86A 2BD9A 1SMFE 3D62A 1O34A 1XVOA 4FU7A 3BTGE 3A7WA 1YCPM 1W13U 1UK2A 2XCNA 3F9FA 2V6NA 3ELAH 2BDBA 1Q2WA 3PLKA 4WVPE 3SGQE 4H6TA 1IQIA 4QT8C 2ZU1A 3WY8A 3GDSA 1CHGA 3ITIA 3UOPA 1MCVA 4LZ4B 1QL8A 1KLIH 1C5YB 1GMDG 1MBMA 4JK6A 2UUYA 2Y5FA 2O8UA 1DY9A 1QHRB 1GBFA 2AEIH 1C2KA 1V2WT 4I32A 1NFYA 1QJ6B 5ESTE 5H4IB 1TOMH 1J16A 1YCPK 3RC5A 1QQUA 4X1NU 1TGBA 3P8NA 3W94A 1AUTC 2XXLA 4AN7A 3BIVH 1FY1A 2JH6D 2PKSB 1T4UH 1TRYA 1OSSA 1MUEB 4K8BA 1FY3A 3NUMA 2TRMA 3STJA 3ZZ9A 3ATMA 4DGJA 1EATA 5FX5A 4U32A 1C9TA 2G5VA 1IQGA 3QK1A 3FP8E 2R3YA 1AWFH 5LH8A 3M61U 3QDZB 1A0LA 4IMQA 4NFFA 1EPTB 2PFEA 5DKMA 3RUOA 1LVMA 3R3GB 1O2JA 2ZGBH 3T28A 1ESTA 3K65B 1LHGH 2BDGA 2CF9H 2A4GA 1K1IA 4H42U 1JIRA 2Q6DA 5J4SA 3GCNA 4DG4A 1GHXH 1GI8B 4SGAE 2GV6A 1UO6A 1C5TA 2ZPRA 1UVSH 1GWAA 4JYUH 5JB9S 1FPCH 1ZTLA 1ZMJA 2GDEH 5EGMA 1SHHB 2PSYA 1KSNA 3VXFH 1SGTA 1OP8A 1PPFE 1SQAA 4HFPB 4MPXA 3S9CA 4BAKB 1WSSH 4MLFB 1YPMH 4NG9H 5GPIB 4BAMB 4A92A 1BJVA 1FZZA 1H1BA 1P04A 3PO1C 1OYTH 4INHA 3RXOA 1BTUA 1NT1A 2SGDE 2A4OA 2NWNA 2ZDKA 3LPRA 1P03A 2H9HA
chains in the Genus database with same CATH superfamily
5HKKD 1KDQB 3QZQA 7GCHG 2TGPZ 3MNCA 2IJD1 1O3FA 4IMZA 1NZQH 2FOHA 4U2WA 3RU4E 5E0HA 4NWLA 3MQKC 1PFXC 1QBOA 2BD3A 2FOAA 2BQ6B 3AK5A 1BTXA 5LPFA 3BEUA 3TLOA 3GS9A 1AO5A 2FESH 3TH4H 1ZPCA 3LOXA 3A84A 1HJAB 1BQYA 2XNIA 4JZDH 3OSYA 1CVWH 2PSXA 1D6WA 2H1UA 2BZ6H 1HAHH 3RXAA 4JYVH 2VIQA 1T8OA 5C17A 3RM2H 5FXLA 3BG8A 2B0FA 2UUJB 1ZZZA 1GGDC 1D3DB 1NBME 1Z6JH 3BTQE 4YLQH 3LGIA 1P2QA 2Z3CA 2TBSA 3PMBB 2Y82A 2Z9GA 1GVKB 3TNTA 3EAJA 3PROA 5F53A 3ZYDA 1C1WH 2ZGJA 1ESBA 4K1EA 2YNBA 5EODA 1V2ST 5FCRA 1K28D 1UTJA 2NU1E 2ZF0H 3T26A 5K7RA 5EG4A 3E3TA 1ZSJA 3UNSA 2JIZD 3FP6E 4Y0ZE 4CHAB 3ZVBA 1EKBB 4ISHH 4KGAA 1THRH 1Y3XA 2KCAA 1GDNA 1O30A 1O2RA 4WY3A 2PUQH 3EA8A 3S0NA 1O3CA 5IYTA 1RTFB 4ZHLU 2J5UA 4ZKSU 3SYJA 1ARBA 1K21H 2WUCA 2ESTE 4AG2A 3H7TA 5C20A 3ZZ8A 8KME2 4J2YB 4X1SU 2JDID 5JPMH 2STBE 1Z8JB 1ELTA 3KF2A 2ZFRH 2FM2A 2WPLS 1C1NA 3K9XB 1HCGA 3OU0A 4BXWA 2ZU2A 3M35A 4LOYH 2QXHA 5DO4H 4WXVA 2NU4E 4O97A 5E8EH 1O5DH 1GMCG 1C5SA 1E36B 2GV7A 4Q7YA 1GBAA 1G2MA 2GVFA 1XUKA 2Z9KA 2QE7D 3RXUA 1LHCH 1VGCC 2XYAA 1TE0A 2ZFQH 3P17H 1JBUH 4ABGA 2AHME 1EOJA 4J1YA 1TBZH 1OOKB 2OQ5A 1O5EH 3V0XA 5C5OA 3ZVGA 1KXCA 3MH4A 1H9HE 1BTPA 6LPRA 5HYOA 4Y7AA 1GBCA 5EJ1A 1DXWA 2HVYB 3U8RH 3GY6A 1Z1IA 2EI8A 3BF6H 2BD8A 2BD4A 2ZDNA 3F6UH 2BDIA 2G4UA 1HV7A 3MU8A 4MPWA 1LCYA 1NPMA 2W7SA 3RXIA 5LPEA 5PTPA 2WUBA 1UVOA 1UK4A 2M2AA 3RXMA 3SHAH 2ZPSA 1LHDH 2ZZUH 3UIRA 4DT7B 1DUAA 1QJ1B 1EZSC 1QBVH 1AFQC 4Y71A 1DWCH 5GXPA 4ABJA 1TGNA 4FUHA 5A8XA 5A8YA 4X6PA 3O8BA 1GJAB 1FY8E 1O2SA 4TPYA 1TNJA 4K1SA 1IQHA 4NSYA 1L4ZA 1P06A 3FVFB 1T8MA 2ULLA 2B9LA 4Y79A 1VJ9U 2FOFA 2JJ1D 3BTME 2C8YB 1C1VH 1TNGA 4HGCA 4OS5A 1K1JA 2ZC9H 5GDSH 1GI2A 4R0IA 4HTCH 1V2TT 3VXEH 5EQQA 1L0ZA 3E0PB 2W3IA 1C2DA 1EAXA 1TA6A 1E1RD 1GI0A 1QRXA 1P01A 2C8ZB 4UEHH 2OBOA 4I31A 5DG6A 2IN2A 3ZZ3A 4ACBA 2ODPA 3PLBA 4CRBA 4DW2U 1LKAA 4PROA 1TWXB 1NRSH 1C1TA 1XX9A 2DE8A 2WPHS 4AFUA 1SGFA 4GAWA 1UMAH 2JETC 1GJDB 4DIHH 2ZHFH 1C1PA 1V2RT 1Y8TA 2CGAA 3QWCH 4YXWD 2BDAA 3ZVEA 2QGRA 5TJXA 2GX4A 4KTSA 3VPKA 4NA8A 4X2XA 5C2ZA 4KTUA 4CH2B 3TGJE 1CA0B 2A0QB 1IHTH 4H6SB 1HDTH 2D26C 1UVUH 3L3TA 2XCFA 1OXGA 3I77A 2AERH 1EJNA 1EAUA 5IDKA 2OD3B 4FUEA 4FOUC 3ATWA 3MU5A 4MG3A 1SOTA 4KP0A 1XUFA 1VITH 3H5CB 2J9NA 2W6ID 2VWNA 2CMYA 4FETA 3SN8A 4RKJB 1SQRA 3BEIB 1SLXB 4MNYA 3TK9A 4ZMAH 1KLJH 3MO6A 2WYJA 2G4TA 2ZGHA 1Q31A 3BN9A 1TBRH 1BHXB 4NIVA 2Z9JA 5GIBA 1O3GA 1Y59T 4X1PU 2R2WU 1XKAC 3A83A 1MKWK 2BX3A 3PM3A 1DWDH 3AASA 3ATLA 3TGIE 1E1QD 4AFSA 1C5RA 2QY0B 3MU1A 5E2OA 4I7YH 1HGTH 1YY3A 5CHAC 3RXJA 1YP9A 2VGCB 1O2OA 1GI9B 4I8LA 1O2XA 2FIRH 1G30B 1A1RA 1P2JA 2K8IA 1GG6C 3TVJB 3A81A 1YGCH 1C5UA 3LONA 1LHEH 1KXDA 1PYTD 1DITH 2BD2A 3LT3A 2ZP0H 1N8OB 2ZTXA 1A4WH 1FNIA 2EY4C 3UNQA 3A80A 1GBIA 3EE0B 4TPIZ 2ZTYA 1Q3XA 5ESBA 4XBBA 1UCYE 4A5TS 1HBTH 1MU8B 3GY4A 2R0LA 3M5OA 3M5NA 3C27B 1DUEA 1O0DH 3T27A 1ZHMA 3PV4A 1MKWH 4ZHAA 1UJ1A 2KAIA 2GTBA 2KZ4A 1E37B 3ZVCA 1O2NA 2P8OC 3SW2B 2Y6TA 4NWKA 1W0YH 3QN7A 1GCDA 1AN1E 1WQVH 2J4IA 2C93B 4OS2A 4NFEA 5E2PA 1O3PB 1O3HA 1GVZA 1UVTH 4UFFH 4ZKNU 1HAOH 1CQQA 1H4WA 3LJJA 1EZUC 3SO3A 5DN6D 1BIOA 2F9VA 2YMSC 1FY4A 4NA7A 1ABJH 4ISNA 3VB3A 1G36A 3BV9B 3MYWA 5LGOA 3SV6A 3VGCC 1ZTKA 1HUTH 1AB9C 5C1YA 1CGIE 1AD8H 2FI5E 1AMHA 4AC9A 3N99A 1TALA 2BY7X 2K0QA 2V0BA 3A7YA 3E91A 1K9OE 1BRBE 2A31A 2OC0A 1TA2A 4D7FA 3KL6A 4AFZA 1BBRK 1JRSA 2PGBB 1J17T 2Y5HA 3KCGH 4RI0A 3UUZA 1SGFG 1XXFA 4JZIA 3BTWE 1V2MT 1MTVA 1QB6A 4AB9A 1DE7H 1QB9A 5KECA 1G3DA 1O2UA 4I8GA 1K22H 3PV5A 4A1XA 3KQEA 2VIPA 5HXFA 1GHZA 5JBTA 3SGAE 5EXMA 1O2LA 1S85A 3QZRA 1P2KA 1LTOA 1SLWB 3QTOH 4ABEA 1B0EA 4AORA 1O3AA 4H4FA 3NZIA 1D3QB 3M3VA 3RXKA 1WCZA 2FDAA 3UR6A 3LH1A 5FPSA 2A45B 2ZG0H 4XFQA 4K1TA 1CGHA 1BMMH 1ZMNA 2OBQA 1O3MA 2AMDA 3RMMH 9ESTA 4BOHA 1NROH 3OFND 3M36A 3KQDA 4HG6A 1MAYA 1XKBC 1XUHA 4NSVA 1RIWB 2GD4B 2CHAC 2F43B 1XXDA 1C5PA 3MFJA 3TJNA 1XMNB 3A88A 5CDFE 1LPZB 6CHAC 4WH8A 1BB0B 1NU9A 3ZZ6A 4YESB 1RTLA 4LZ1H 4XDEA 1GHBF 3GCTF 1A5IA 1EASA 2W3KA 3ATKA 2WV9A 3P95A 1SFIA 2G8TA 3PO1B 1L1JA 3QGJA 3LH3A 2EI7A 3A8DA 2STAE 3V12A 1RTKA 3SJKA 4UE7H 1IQMA 2H6MA 4RT0A 3K6YA 3A82A 1KXFA 3VEQB 4NIYA 2Q1JA 3MOCA 3W95A 2GMTB 3NK8A 2BY8X 1P2IA 1E0FD 1UHBA 5E0GA 1CT0E 1KXAA 3NWUA 3MWIU 1FQ3A 3P8OA 2QYIA 2NU3E 2VINA 2ZQ1A 3BTKE 3BTHE 2W5EA 4MPVA 1EB1H 4UD9H 2V3MA 5F03A 1TMTH 1VCWA 4FU8A 2HLCA 4ISIH 2TPIZ 5DP8A 1P3CA 1BMAA 1GJCB 1YYY1 5CE1A 3HGNA 1S6LA 4RT1A 1RS0A 1DLKB 4ZROA 4I8HA 1OX1A 3BTEE 1GJ7B 1QFKH 3MTYA 3RLWH 2ANMH 1GGDB 3M7QA 1GVLA 3RXQA 2BY9X 1O39A 1ETSH 4DOQA 3DHKH 2Z6BD 4B6EA 3KQCA 3KNXA 1O2HA 2YNAA 1O2QA 2HWLB 3OYPA 1ZMLA 3ODDA 4ABBA 2FOMB 3DFJA 3RXDA 4IS5A 3BSQA 1FXYA 1K1MA 3V7TA 2QXJA 1ELDE 2G51A 2VVCA 3SOSA 2A7CA 2F9UA 4D9QA 5GCHF 1QNJA 8ESTE 2FS8A 1WAYB 2L6OA 3CNRA 1GJ9B 2WHXA 1MQ5A 3D65E 5G4BA 1K1NA 3SNBA 1O3DA 5EIYA 2QF0A 4Q7ZA 3MHWU 1NRQH 5C0TA 1GHVH 3QUMP 1FONA 4INLA 1TFXA 4BXSA 3V3MA 1TNLA 2A2XH 5HIYA 3O8RA 4Q63A 2XBVA 3SI3H 1O33A 1CE5A 3PTNA 1UVPA 4IC5A 3TJOA 1AKSB 1THSH 1EUFA 3UAIC 5JYIA 5JB8S 1KTSB 4MDSA 4D9RA 1FLEE 2A32A 2GCTC 1J8AA 1SSXA 2GGVB 1TLDA 1A0HB 1TQ0B 2FI3E 2WV5A 3E6PH 1E38B 1A7SA 4TY6A 1C2FA 3Q77A 3RXCA 1VGCB 4O3TA 1ANBA 1WTHD 2W26A 4GPGA 3U98H 3CS0A 2GCHG 2KR7A 1EXFA 1CGJE 3ZZCA 2J2UA 4IN1A 5JBBS 2R9PA 2ZIQH 1AVXA 2CF8H 1BCUH 4THNH 2UUKB 3UR9A 1QL7A 1G3BA 2WYGA 4A7IB 1XUGA 1EPTA 1S5SA 3UFAA 2C3SA 1SGIB 1TPPA 1M9UA 2ZCLP 3RXFA 4D8NA 4FVBA 1GJBB 3O8DA 5I46H 1GI3A 1SKYE 2OP9A 1BOQA 1FIZA 2PWXA 1E35B 2FOGA 4RSPA 4BTIB 1JRTA 1HAVA 3A7XA 3TPIZ 9LPRA 2O9QA 2P16A 1DANH 2SGEE 3M5MA 1AFQB 3PYHA 1S0RA 2BLWA 2BMGB 1HNEE 5LPRA 1YPLH 1F5KU 4AFQA 1UTQA 1P2MA 2ZKSA 1A46H 1C2GA 4X8UH 2C8WB 2V7QD 5EXNA 3RC6A 3NXPA 1NFXA 4X1RU 1LHFH 1ZPBA 2B5TB 1O3KA 2OXSA 1DS2E 2ZPQA 3A7TA 3NPSA 1OP0A 4IN2A 2Q6GA 2FEQH 5DK1A 4YOGA 1SGYE 3P70B 4U30A 3LDXH 1CHOG 2FPZA 1ELFA 3PWBA 3RC4A 1AWHB 4CRCA 1P09A 3ZV9A 4Q80A 2XOKD 3RXPA 2UWOA 1H8DH 3Q3YA 4ZH8A 3I29A 7LPRA 2QF4A 2ZGCA 4ZHMU 1HXEH 2VH0A 3GYLB 2IJOB 5A09A 1BTYA 1YF4A 4JZEH 1ZTJA 3B9FH 3FN8A 3EDXB 3ZVDA 1AUJA 4FUJA 1KDQA 1G3CA 4X6MA 2BLOA 1C5ZB 4MTBA 2GJGA 2LP6A 1CBWB 5C1UA 1YLCA 1LQDB 1GHBG 1DFPA 1PPGE 3GCTG 3F3BA 1COWD 3ZIAD 2AMQA 1V2NT 3FZDA 4Y0YE 2GT8A 1SVPA 1C2HA 4ZUHA 4B75A 1BA8B 1BT7A 3SUGA 1DVAH 2OTVA 1RGQA 4B2BA 4YO9A 1ZRKA 1GL1A 3S69A 3UOUA 2AFQB 5GJ4B 1JMOH 2W6JD 1MTNB 3LGWA 4DT4A 7KMEH 1INCA 3ZYEA 1W7XH 2HLDD 2XNDD 5HMAA 3RXTA 3PWCA 1EPTC 4ISOA 3A8AA 1GI5A 3U69H 4FUGA 4I8JA 2PW8H 4NCYA 3JZ2B 1IQFA 1C2JA 5AFZH 4AYVB 3NCLA 2R2MB 1VCPA 3TJUA 3GDVA 1KLTA 1PJPA 2I6SA 3FOAA 4K69A 2BD7A 2VVUA 2D2DA 2FO9A 3HKJB 2FOBA 1PQ7A 2GDDA 5KEDA 1NC6A 3U1JB 1D3PB 4ESTE 1HAIH 4HZHA 2P94A 2BOHB 5F8XA 1SQTA 5CHAB 2ANYA 1O3JA 4MPUA 1F2SE 4CRGA 5GNDA 2QF3A 1Z6EA 2WPKS 1GHAF 2FWWA 3F9GA 4A6LA 1P3EA 2XTTB 3BEFB 1HPGA 2QAAA 4HI3A 2QXGA 1O2GH 1ZJDA 3UQOA 3P92A 2G55A 2ZNKH 3ODFA 1SOZA 2ODYB 3BTDE 4AYYB 5DP6A 3PMAB 5GWZA 2HOBA 4X8SH 2AGGX 4WMEA 1RD3B 3D49H 4ABFA 2XC5A 5FHTA 5FPTA 1K1OA 2ZHEH 2XBYA 2UUFB 5GCHG 3H7OA 3OX7U 3LU9B 4BNRA 2ASUB 3DD2H 2BLVA 2GZ9A 1IQNA 1P12E 3F2HA 1F0SA 1T31A 1SLVB 5FPYA 1T7CA 4U01A 4Y11E 1O32A 1O2KA 2BX4A 1HXFH 3UWJH 3FKSD 1H8ED 1D4PB 2KFWA 4ABDA 1NESE 2FTLE 1O38A 3IWMA 2P8OB 1IAUA 2XC4A 1GDQA 1S82A 2TGAA 1SHYA 5KGOA 1FAKH 1Z8RA 2FOEA 1UTMA 1NFWA 1WDIA 4M7GA 1SGPE 3KYGA 1EB2A 3M37A 1P05A 2F9BH 4Y8YA 1AZZA 2YMSB 1GBEA 4Y76A 2F3CE 3ZZBA 1QIXB 3FFGA 3MMGA 4FUDA 1W7GH 3ZVAA 1A3EH 1BMNH 3VGCB 3H09A 4WMDA 2A5AA 4B2AA 2G00A 2ZCKP 1HIAA 4O3UA 1F92A 5B6LA 1YPKH 4XRNA 1HYLA 2IPQX 2EA3A 2O8MA 5DP9A 1GL0E 4B74A 1AVWA 6GCHF 4RKOB 2VBCA 2JJ2D 1DXPA 1E34B 2VIOA 4OGXA 1F7ZA 2OK5A 4A1VA 1GBMA 2RDEA 5DGJA 1ETTH 5DPAA 3SORA 5EPYA 1MD7A 3SUFA 2BHGA 4VGCC 1TABE 4E05H 4KTCA 3RXEA 2ZHWH 1ANDA 2XWAA 2FMJA 2HNTF 1HJ9A 3LGVA 1IQKA 2QA9E 1P8VC 3N7DA 1W3CA 2G5NA 1AQ7A 1XUJA 1NY22 5FBIA 3MNSA 1FJSA 1P0SH 2J38A 3F1SB 3SU3A 1AE8H 1EAWA 1O3OA 1C2LA 1O3BA 1PYTC 1L1GA 1BHXF 2LELA 3KQBA 1YPJH 1Z1JA 2I6QA 1O5GH 1OWJA 2HPQH 1OWKA 1WUNH 4K2YA 4UFGH 5DP3A 1WU1A 1EAIA 3SNEA 4GCHF 2RCEA 1L2EA 4TT3D 2A1DB 2WPIS 4MNWA 4YLUA 2ZDVH 1N6XA 3PTBA 1J9CH 1UW7A 2P3TB 2FI4E 4ZXXH 3FANA 1P2NA 1C1SA 3R0FA 2ZHQH 1MBQA 1GCTC 2CHAB 2RA3A 4GHQA 1O3EA 3DFLA 3KEEA 1B5GH 1P11E 3SU0A 1QL9A 4JK5A 3U8OH 3DCLA 1GDUA 2M5TA 1WXRA 4Y6DA 4DURA 2VIWA 6CHAB 4B76A 1P9UA 1ARCA 3TK6A 3RXBA 1S6FA 1HB0B 3WWFA 3W1EA 1Z71A 3FAOA 5T6GA 1F5LA 3E8LA 1Z8IB 2PUXB 3GY8A 3T62A 1P10A 1EX3A 1LQEA 2CV3A 1HJ8A 1YC0A 3HPTB 1S84A 3RXVA 1SPJA 4CREA 2BD5A 2PTNA 1NRPH 2QN5T 1ZYOA 1EZQA 2HNTE 3RU4T 5SGAE 2SGFE 5HIZA 1WV7H 3PMHB 3QO6A 1QGFA 1S6HA 3M7UA 4GSOA 1ZGIA 1O2YA 3LIWA 4P00A 1W11U 1FV9A 2RA0A 5DJ7A 1AU8A 4FXGH 1WQSA 1ZRBA 2BLQA 3ZZ7A 2VWLA 5T1VA 3F0PA 5JBAS 3SU5A 3JZ1B 3TU7H 2FTMA 5AFYH 4BANB 3PRDA 2AGIX 1H9LB 3RXSA 2TGDA 1ELGA 2CXVA 3P8FA 4KKDA 1TNIA 2BXUH 1C4Y2 4AGKA 3UREA 1GHAG 1V3XA 1O5FH 1MTWA 4NZLA 6ESTA 1DDJA 4CRDA 2WV4A 3SNDA 1ZHPA 3KIDU 1KXBA 2TIOA 1SB1H 2BVXH 3S7HB 3DA9B 5TCCA 5HM9A 1UTNA 4FUBA 3SUDA 1TGCA 2FLRH 1N6YA 1SGCA 1FPHH 1XUIA 2PHBA 4GUXA 1KY9A 1P02A 4TY7A 5IK2D 1DY8A 1QBNA 3KGPA 3T2NA 4AB8A 1AHTH 2VB0A 3GCHC 3GISB 1NS3A 2VWMA 4M9FA 5EPNA 2ZDLA 1TX7A 1IQJA 1PPBH 2HNTC 1A5HA 1LVOA 5FBEA 1C4V2 1O3IA 2EC9H 5AVDA 4NGAH 1GBLA 4X2WA 4X8TH 4BAOB 2ZU4A 5EW2H 2GZ8A 2W7UA 1GI7B 1TMUH 2GZ7A 2QF5A 2D8WA 2Z3EA 3SJIA 2A7JA 1WOFA 1KYNA 2DE9A 2FZZA 2A5KA 3UTUH 1Y3YA 1RJXB 1K2I1 1Y3UA 5DP5A 1NU7B 3VFEA 3TNSA 1NTPA 3VB6A 1A3BH 1UCYK 3RMLH 3TITA 2Z9LA 1BJUA 1TMBH 1TGSZ 2A2QH 3RMNH 1O2PA 3F9HA 4B2CA 1HFDA 2VU8E 3SNAA 3SU1A 5F6MA 3M7TA 1TIOA 3T5FH 1AVGH 2PV9B 3B8JA 4A1TA 1JWTA 1O5AB 3TJVA 2A5IA 4ABHA 1MKXH 3PV2A 5C5NA 1FI8A 1H9IE 2ZGXH 1V6DA 3UQVA 1ORFA 3SQHE 3HKIB 4K8YA 2V3OH 1FN8A 2Y81A 1TPSA 1G2LA 2P93A 3MH7A 3RXRA 1QQ4A 4YTAA 5EQRA 1C1MA 1G3EA 2ZWLH 4P02A 4RN6A 6GCHG 3A8BA 4XBDA 5DP7A 5BRRE 4Z6AH 3BG4C 2FXRA 4X6NA 3CP7A 2OCVB 4ASUD 4UFEH 1BZXE 3IITA 4NZQA 5F8ZA 2Y5GA 1TRMA 1OWEA 4WWYA 1QY6A 3DT0H 1GI1A 1V2QT 1SGQE 3MH6A 3I78A 4UONA 1CO7E 2FX6A 3MNBA 2P95A 4ABAA 5C67A 2BDCA 1UCYH 2ZA5A 4WMFA 4CRFA 1C5OH 3ZZ5A 2ODQA 2PKAA 1UTKA 4NIWA 3PB1E 5EW1H 3BTTE 4YZUA 1W14U 1MAXA 2ZI2H 1F0RA 4XE4A 2BY5X 3QTVH 1SBWA 2XWBI 1ZSLA 1QA7A 1P57B 4GCHG 4X0WU 1GMCF 2XC0A 3TH3H 4JZFH 2JH5D 1D9IA 1EOLA 1A5GH 1MQ6A 1T8NA 1G9IE 1ID5H 1O2MA 3RXHA 5A0BA 3CS7A 1GI6A 1O2VA 4YM9A 1SQOA 1OS8A 3ESTA 3EGKH 4FUCA 2ZQ2A 1LKBA 1EP5A 2G81E 5FX6A 2ZU5A 1Y5BT 4O9VA 1F0TA 2ZFSA 2FODA 2J98B 1ZLRA 1QRWA 1LPKB 3D23A 1RRKA 2GKVE 2AYWA 2F9OA 1G37A 4I33A 2SGAA 1ANEA 2B7DH 3T29A 1TPAE 1A0JA 5EU8A 4IC6A 1PPZA 1FDPA 3VB5A 1TRNA 2AIQA 3A7VA 1DPOA 3A89A 1OWIA 1KIGH 1NRNH 2UWPA 2Z9IA 3RP2A 4D7GA 4X6OA 3EQ0H 3GDUA 1UK3A 3MO3A 1K0HA 1IOEA 1GBBA 5EJLA 1ABIH 4XBCA 1P2OA 1YKTA 1GBTA 1O36A 1XVMA 3SZNA 2CK3D 4Z1MD 5L2ZH 3ENSB 3GYMA 1LMWB 1ZOMA 1QCPA 1YPHE 3SU4A 1EZXC 2C8XB 1W0ZU 4CR9A 1TGTA 2AIPA 2P3UB 3S7KB 1GJ6A 2D1JA 1ELCA 4E06H 1BTWA 4X2VA 1HAVB 4B6FA 1BRAA 3CENA 2EI6A 1O31A 1OKXA 1NM6A 3SQEE 1B7XB 2OQUA 1Z8GA 1WYKA 1F5RA 2AH4X 1YCPH 2IOTA 2VH6A 1RFNA 3LGTA 1BTZA 3ZZ4A 1AIXH 4DY7B 1ZSKA 1PQ5A 1O3NA 2ZDMA 1L4DA 2C4FH 4Y10E 1JXPA 4X1QU 5ABWA 1RIWC 2SFAA 1O3LA 4KELA 1VITF 2OINA 3AAUA 1LVBA 2ZO3H 1AE5A 1TNKA 1V2LT 3E0NB 3UWIA 3URCA 2H5DA 1AKSA 2F83A 4TSFD 2VJ1A 1SI5H 3IG6B 4Q7XA 4CH8B 2FYRA 3E90B 2A4QA 3MNXA 1O2TA 2AS9A 1A2CH 2J94A 4ZXYH 1EJMA 2RG3A 4CBNA 1TONA 1MTUA 3OTJE 1MABB 4DVAU 2GMTC 3G01A 3L33A 4Z0KA 1GI4A 3DUXH 1O5CB 1HAGE 2Z94A 5T6FA 1PQAA 1YPHC 4LK4A 2ZFTA 1DWBH 2J34A 2BVRH 5C0UA 3ZZDA 4B1TA 1MCTA 3OAAD 3SJOA 2VIDA 1DOJA 2JETB 4NIXA 1GBDA 5L30H 3PLPA 3VB7A 1H8HD 1MH0A 2PLXA 4ASHA 1GMHF 1TPOA 4YOIA 5E0JA 4AG1A 3U8TH 2Y80A 3HK3B 4Q4LA 2GP9B 2A4RA 3MO9A 4INKA 2LNCA 1TOCB 1QJ7B 3U9AH 1ZJKA 1EP6A 2VWOA 2FX4A 2PKSC 1TQ7B 3N7OA 5T6DA 2A7HA 2NU2E 4DJZB 3M3SA 1VCQA 2BDHA 2TGTA 1NO9H 2C90B 1ZHRA 2AGEX 3BTFE 4FUIA 1SGNE 1QURH 3FP7E 3LGYA 4TWYA 3SNCA 1QA0A 3DSPA 3SZEA 2BYAX 2H9TH 2OC8A 2WPMS 3LJOA 5A0CA 1W2KH 1YBWA 1C2IA 4VGCB 1BTHH 1LDTT 2ZCHP 4FU9A 1QRZA 1OWHA 5BPEA 3QLPH 4CBOA 4K60A 5A8ZA 3KQ5A 5DSFA 4AOQA 4JYTA 3Q3KA 4JZ1A 1C2MA 1CSOE 2HPPH 2WINI 3F9EA 1BRCE 3UPEA 4DIIH 1GHWH 4MVNA 4MNVA 1G32B 4WF8A 1IHSH 1X7AC 4ZCNA 3K6ZA 3AW0A 1MU6B 1TB6H 2LPRA 2PP6A 2HVXA 3T25A 4I8KA 1T4VH 3F2FA 3GY3A 1T32A 1DLEA 2PTCE 2Y7ZA 2CN0H 2PGQB 1C1RA 2WZQA 1SL3A 1Y3WA 2SGQE 4MNXA 2QV1A 7ESTE 2H5CA 1MZDA 2QXIA 1GG6B 1GCTB 3Q00A 2RFKC 5C3NA 3TK5A 1E79D 2L74A 1GPZA 1OPHB 1PPCE 4SGBE 4GLYA 2P3FH 4K3JA 3RU4D 1Y5UT 1SR5C 1J14A 1TX8A 5K0HA 1HAXB 8GCHF 3SV9A 5HGGA 1OWDA 5L2YH 1AZ8A 3A8CA 3SGBE 3ZVFA 4E7RG 1V2UT 1FN6A 2VVVA 3LGUA 2CJIA 2J92A 2HALA 3MH5A 4FVDA 2BTCE 2ZDAH 4UDWH 1C5LH 1ETRH 1L1NA 3C1KA 3SJ9A 1J15A 1NBMD 1HIAB 1C9PA 3FO8D 3KN2A 4OM9A 2KCYA 1EJAA 3HK6B 1GJ5H 2YOLA 4BAQB 1DSTA 3EYDA 2HGTH 1HJAC 1S81A 3GY5A 5A0AE 3E1XB 3P6ZB 1Z7KA 2ZHDA 3M5LA 1D3TB 4K5ZA 1AB9B 4AGJA 1FIWA 2ALPA 2BM2A 1C4U2 3E16B 2FP7B 4F49A 5EXLA 2O8TA 1GBHA 5JBCS 3LKWA 1N1LA 1W8BH 1VZQH 3AW1A 4XOJA 1NFUA 2H2ZA 2V3HH 1MMJN 1BMFD 1FAXA 3RM0H 1AFEH 1A61H 5EQSA 3N7EA 3F68H 2O8LA 2ZU3A 4CHAC 1VITG 4AX9H 1DICA 4ZKRU 1Y5AT 1VKYA 1CBWC 4OS7A 4F55A 1ANCA 1IQLA 3OY5U 2SNVA 2WPJS 1FUJA 1C5MD 3F0OA 2ZFPH 1CU1A 1HAPH 1O5BB 1EQ9A 4CR5A 2SNWA 4UFDH 3GCHB 1DT2A 1CA8B 1SG8B 3NKKA 1W0KD 3SU6A 3SJ8A 1GHYH 4WJG2 4OGYA 1F0UA 3URDA 1YLDA 2JH0D 2QC2A 5F8TA 3O8CA 3OEED 1ESAA 3OTPA 2Z7FE 1MTNC 4YT7H 3STIA 8LPRA 1ZR0A 1LO6A 1FY5A 1KXEA 3PMJA 1TAWA 1PQ8A 4ZKOU 4MQAA 2K1QA 1KTTB 2F9NA 2GT7A 2BY6X 2FOCA 5HM2A 2RDLA 3SV8A 1YLNA 2P59A 1DM4B 2ILNA 5C94A 2OC1A 2Y7XA 1GMDF 1WBGB 2HRVA 2KAIB 3RXGA 3UB0A 1C5NH 3LC3A 1BBRE 1V2PT 4BTTB 3Q76A 1GMHG 1CT2E 4X8VH 1FMGA 2EEKA 2BQ7B 1HAYB 1DX5M 5FCKA 1TNHA 3A7ZA 4OS1A 2KX4A 1KMHB 1DSUA 5B6OA 3GY7A 2JKHA 1QZ8A 4IW4E 4YT6H 1O35A 3AAVA 3TGKE 2BB4A 3OE7D 1S83A 4ABIA 2Q6FA 3SHCH 2VNTA 2ZTZA 3A87A 3ZV8A 3BG4B 4JCNA 1VR1H 4F4OC 2AMPA 2H9EH 1DWEH 1ZPZA 4CRAA 3SV7A 3EA7A 2WSSD 3QGNB 1QR3E 2UWLA 1S0QA 5T3HA 3ATIA 1XM1A 1ELAA 3UY9A 2OLGA 2BOKA 4Y8XA 1RXPA 1VJAU 1THPB 2DUCA 5TCAA 1C1OA 3BIUH 4B71A 3TH2H 2BQWB 3SI4H 2KCPA 1SLUB 2Z3DA 5L6NH 1LPGB 3P8GA 1OP2A 1P9SA 1YM0A 4ISLA 1OHHD 4IGDA 1SC8U 3RXLA 1C5WB 3B23B 4OS4A 4Y8ZA 1UTOA 1YWUA 1LVYA 3F2GA 3M3TA 3OY6U 3EE7A 4TWWA 3HATH 1SFQB 1TYNA 4O03A 1SGRE 2ALVA 3V13A 2G52A 3WWBA 4XSKU 1ZGVA 1V2VT 2NU0E 3U1IB 3WW7A 1JOUB 3RMOH 3A85A 1D6RA 1WTGH 4BTUB 1SGDE 1K1PA 1V2OT 1GJ8B 1FX0B 4FUFA 4JMYA 3VB4A 2XRCA 1V2JT 5DP4A 5I25A 1AGJA 3TIUA 1C5VA 2BVSH 1B0FA 2ZEBA 1GBKA 5ETXA 1QB1A 3AVZA 4Q2KA 5FAHA 3GCOA 4GHTA 2GCHF 3U28C 1MKXK 1C1UH 1CA0C 4WXIA 5AF9H 1GJ4H 1QTFA 2PR3A 1TBQH 3S9BA 2FS9A 1AI8H 3SV2H 3ZZAA 8GCHG 2VIVA 2XBXA 4BAHB 1O2WA 4TYDA 1C5XB 5J4QA 2ANWA 3LC5A 1SGEE 4OS6A 5AHGH 1BDAA 1O2ZA 3KHVA 1O2IA 3MU0A 1TX6A 1K1LA 2QIQA 7GCHF 2YMSD 3UNRA 3EA9A 1MD8A 2F91A 1V2KT 4GVUA 4WH6A 1NN6A 1HLTH 2FYQA 1CT4E 1C5QA 1UTPA 5CMXH 3GY2A 4X2YA 4R8TB 4F48B 3GOVB 3K2UA 1AY6H 1GBJA 3MI4A 4YOJA 1ACBE 1C1QA 2GCTB 5JDUB 1BITA 1O37A 1PPHE 5A2MH 2QCYA 3RDZA 2V35A 3GICB 5C1XA 3S9AA 1YPEH 1HAZB 1ELEE 4B73A 1OYQA 2XW9A 3OEHD 3SU2A 1CHOF 3QX5H 1W0JD 1BUIA 1Y3VA 3MU4A 4ZAEA 4E7NA 2B8OH 1UHBB 1C2EA 2VGCC 1IQEA 1W10U 1W12U 4Y7BA 5EOKA 4AZ2B 4D76A 3HGPA 1MZAA 2BDYA 4NA9H 4LXBH 1NRRH 2OC7A 4ACAA 1U6QA 2PKAB 3SUEA 3FZZA 2J95A 2R3UA 2O8WA 2ZFFH 3KYFA 3Q3XA 4DCDA 2EQNA 1BBRH 1HRTH 2ZECA 4IBLH 1H8IH 3L6PA 2BZAA 1EFRD 1T8LA 1ELVA 1N8OC 1MTSA 1PPEE 2XBWA 1ELBA 3RLYH 1BMLA 1JIMA 2F9PA 3SBKA 2THFB 1UTLM 1YPGH 2OUAA 2R0KA 2SGPE 4I86A 5EJZA 1BRUP 2ANKH 2IPHA 2BXTH 2FLBH 3A86A 2BD9A 1SMFE 3D62A 2J97A 1O34A 1XVOA 4FU7A 3BTGE 3A7WA 1YCPM 1W13U 1UK2A 2XCNA 3F9FA 2V6NA 3ELAH 2BDBA 1Q2WA 3PLKA 4WVPE 3SGQE 4H6TA 1IQIA 4QT8C 2ZU1A 3WY8A 3GDSA 3PRBA 1CHGA 3ITIA 3UOPA 1MCVA 4LZ4B 1QL8A 1KLIH 1C5YB 1GMDG 1MBMA 4JK6A 2UUYA 2Y5FA 2O8UA 1DY9A 1QHRB 1GBFA 2AEIH 1C2KA 1V2WT 3DSGA 4I32A 1NFYA 1QJ6B 5ESTE 5H4IB 1TOMH 1J16A 1YCPK 3RC5A 1QQUA 4X1NU 5CHBA 1TGBA 3P8NA 3W94A 1AUTC 2XXLA 4AN7A 3BIVH 1FY1A 2JH6D 2PKSB 1T4UH 1TRYA 1OSSA 1MUEB 4K8BA 1FY3A 3NUMA 5FL7D 2TRMA 3STJA 3ZZ9A 3ATMA 4DGJA 1EATA 5FX5A 4U32A 1C9TA 2G5VA 1IQGA 3QK1A 3FP8E 2R3YA 1AWFH 5LH8A 3M61U 3QDZB 1A0LA 4IMQA 4NFFA 1EPTB 2F4LA 2PFEA 2KCOA 5DKMA 3RUOA 1LVMA 3VG8A 3R3GB 1O2JA 2ZGBH 3T28A 1ESTA 3K65B 1LHGH 2BDGA 2J98A 2CF9H 2KM0A 2A4GA 1K1IA 4H42U 1JIRA 2Q6DA 5J4SA 3GCNA 4DG4A 1GHXH 1GI8B 4SGAE 2GV6A 1UO6A 1C5TA 2ZPRA 1UVSH 1GWAA 4JYUH 2WPDD 5JB9S 1FPCH 1ZTLA 1ZMJA 2GDEH 5EGMA 1SHHB 2PSYA 1KSNA 3DSOA 3NRLA 3VXFH 1SGTA 1OP8A 1PPFE 1SQAA 4HFPB 4MPXA 3S9CA 4BAKB 1WSSH 4MLFB 1YPMH 4NG9H 5GPIB 4BAMB 4A92A 1BJVA 1FZZA 1H1BA 1P04A 3PO1C 1OYTH 4INHA 3RXOA 1BTUA 4XD7D 1NT1A 2SGDE 2A4OA 2NWNA 2ZDKA 3LPRA 1P03A 2H9HA
chains in the Genus database with same CATH topology
1KDQB 3QZQA 7GCHG 2TGPZ 3MNCA 1O3FA 4IMZA 1NZQH 2FOHA 4U2WA 3RU4E 5E0HA 4NWLA 1PFXC 1QBOA 2BD3A 2FOAA 2BQ6B 1BTXA 5LPFA 3BEUA 3TLOA 1AO5A 2FESH 3TH4H 1ZPCA 3LOXA 3A84A 1HJAB 1BQYA 2XNIA 4JZDH 3OSYA 1CVWH 2PSXA 1D6WA 2H1UA 2BZ6H 1HAHH 3RXAA 4JYVH 2VIQA 1T8OA 3RM2H 5FXLA 3BG8A 2B0FA 2UUJB 1ZZZA 1GGDC 1D3DB 1Z6JH 3BTQE 4YLQH 3LGIA 1P2QA 2Z3CA 2TBSA 3PMBB 2Y82A 2Z9GA 1GVKB 3TNTA 3EAJA 3PROA 3ZYDA 1C1WH 2ZGJA 1ESBA 4K1EA 2YNBA 5EODA 1V2ST 5FCRA 1K28D 1UTJA 2NU1E 2ZF0H 3T26A 5K7RA 5EG4A 3E3TA 1ZSJA 3UNSA 4CHAB 3FP6E 4Y0ZE 3ZVBA 1EKBB 4ISHH 4KGAA 1THRH 1Y3XA 1GDNA 1O30A 1O2RA 4WY3A 2PUQH 3EA8A 3S0NA 1O3CA 5IYTA 1RTFB 4ZHLU 4ZKSU 1ARBA 1K21H 2WUCA 2ESTE 4AG2A 3H7TA 5C20A 3ZZ8A 8KME2 4J2YB 4X1SU 5JPMH 2STBE 1Z8JB 1ELTA 3KF2A 2ZFRH 2FM2A 2WPLS 1C1NA 3K9XB 1HCGA 3OU0A 4BXWA 2ZU2A 3M35A 4LOYH 2QXHA 5DO4H 4WXVA 2NU4E 4O97A 5E8EH 1O5DH 1GMCG 1C5SA 1E36B 2GV7A 4Q7YA 1GBAA 1G2MA 2GVFA 1XUKA 2Z9KA 3RXUA 1LHCH 1VGCC 2XYAA 1TE0A 2ZFQH 3P17H 1JBUH 4ABGA 1EOJA 4J1YA 1TBZH 1OOKB 2OQ5A 1O5EH 3V0XA 5C5OA 3ZVGA 1KXCA 3MH4A 1H9HE 1BTPA 6LPRA 5HYOA 4Y7AA 1GBCA 1DXWA 3U8RH 3GY6A 1Z1IA 2EI8A 3BF6H 2BD8A 2BD4A 2ZDNA 3F6UH 2BDIA 2G4UA 1HV7A 3MU8A 4MPWA 1LCYA 1NPMA 2W7SA 3RXIA 5LPEA 5PTPA 2WUBA 1UVOA 1UK4A 3RXMA 3SHAH 2ZPSA 1LHDH 2ZZUH 3UIRA 4DT7B 1DUAA 1QJ1B 1EZSC 1QBVH 1AFQC 4Y71A 1DWCH 5GXPA 4ABJA 1TGNA 4FUHA 5A8XA 5A8YA 4X6PA 3O8BA 1GJAB 1FY8E 1O2SA 4TPYA 1TNJA 4K1SA 1IQHA 4NSYA 1L4ZA 1P06A 3FVFB 1T8MA 2ULLA 2B9LA 4Y79A 1VJ9U 2FOFA 3BTME 2C8YB 1C1VH 1TNGA 4HGCA 4OS5A 1K1JA 2ZC9H 5GDSH 1GI2A 4R0IA 4HTCH 1V2TT 3VXEH 5EQQA 1L0ZA 3E0PB 2W3IA 1C2DA 1EAXA 1TA6A 2C8ZB 1GI0A 1QRXA 1P01A 4UEHH 2OBOA 4I31A 5DG6A 2IN2A 3ZZ3A 2ODPA 3PLBA 4CRBA 4DW2U 1LKAA 4PROA 1TWXB 1NRSH 1C1TA 1XX9A 2DE8A 2WPHS 4AFUA 1SGFA 4GAWA 1UMAH 2JETC 1GJDB 4DIHH 2ZHFH 1C1PA 1V2RT 1Y8TA 2CGAA 3QWCH 2BDAA 3ZVEA 2QGRA 5TJXA 2GX4A 4KTSA 3VPKA 4NA8A 4X2XA 5C2ZA 4KTUA 4CH2B 3TGJE 1CA0B 2A0QB 1IHTH 4H6SB 1HDTH 2D26C 1UVUH 3L3TA 2XCFA 1OXGA 3I77A 2AERH 1EJNA 1EAUA 5IDKA 2OD3B 4FUEA 3ATWA 3MU5A 4MG3A 1SOTA 4KP0A 1XUFA 1VITH 3H5CB 2J9NA 2VWNA 2CMYA 3SN8A 4RKJB 3BEIB 1SLXB 4MNYA 3TK9A 4ZMAH 1KLJH 3MO6A 2WYJA 2G4TA 2ZGHA 1Q31A 3BN9A 1TBRH 1BHXB 4NIVA 2Z9JA 5GIBA 1O3GA 1Y59T 4X1PU 2R2WU 1XKAC 3A83A 1MKWK 2BX3A 3PM3A 1DWDH 3AASA 3ATLA 3TGIE 4AFSA 1C5RA 2QY0B 3MU1A 5E2OA 4I7YH 1HGTH 5CHAC 3RXJA 1YP9A 2VGCB 1O2OA 1GI9B 4I8LA 1O2XA 2FIRH 1G30B 1A1RA 1P2JA 1GG6C 3TVJB 3A81A 1YGCH 1C5UA 3LONA 1LHEH 1KXDA 1PYTD 1DITH 2BD2A 3LT3A 2ZP0H 1N8OB 2ZTXA 1A4WH 1FNIA 3UNQA 3A80A 1GBIA 3EE0B 4TPIZ 2ZTYA 1Q3XA 5ESBA 4XBBA 1UCYE 4A5TS 1HBTH 1MU8B 3GY4A 2R0LA 3M5OA 3M5NA 3C27B 1DUEA 1O0DH 3T27A 1ZHMA 3PV4A 1MKWH 4ZHAA 1UJ1A 2KAIA 2GTBA 1E37B 3ZVCA 1O2NA 2P8OC 3SW2B 2Y6TA 4NWKA 1W0YH 3QN7A 1GCDA 1AN1E 1WQVH 2J4IA 2C93B 4OS2A 4NFEA 5E2PA 1O3PB 1O3HA 1GVZA 1UVTH 4UFFH 4ZKNU 1HAOH 1CQQA 1H4WA 3LJJA 1EZUC 3SO3A 1BIOA 2F9VA 1FY4A 4NA7A 1ABJH 4ISNA 3VB3A 1G36A 3BV9B 3MYWA 5LGOA 3SV6A 3VGCC 1ZTKA 1HUTH 1AB9C 5C1YA 1CGIE 1AD8H 2FI5E 1AMHA 1TALA 2BY7X 2V0BA 3A7YA 3E91A 1K9OE 1BRBE 2A31A 2OC0A 1TA2A 4D7FA 3KL6A 4AFZA 2PGBB 1BBRK 1JRSA 1J17T 2Y5HA 3KCGH 3UUZA 1SGFG 1XXFA 4JZIA 3BTWE 1V2MT 1MTVA 1QB6A 4AB9A 1DE7H 1QB9A 1G3DA 1O2UA 4I8GA 1K22H 4A1XA 3KQEA 2VIPA 5HXFA 1GHZA 5JBTA 3SGAE 5EXMA 1O2LA 1S85A 3QZRA 1P2KA 1LTOA 1SLWB 3QTOH 4ABEA 1B0EA 4AORA 1O3AA 4H4FA 3NZIA 1D3QB 3M3VA 3RXKA 1WCZA 2FDAA 3LH1A 5FPSA 2A45B 2ZG0H 4XFQA 4K1TA 1CGHA 1BMMH 1ZMNA 2OBQA 1O3MA 2AMDA 3RMMH 9ESTA 4BOHA 1NROH 3M36A 3KQDA 1MAYA 1XKBC 1XUHA 4NSVA 1RIWB 2GD4B 2CHAC 1XXDA 1C5PA 3MFJA 3TJNA 1XMNB 3A88A 1LPZB 6CHAC 4WH8A 1BB0B 1NU9A 3ZZ6A 4YESB 1RTLA 4LZ1H 4XDEA 1GHBF 3GCTF 1A5IA 1EASA 2W3KA 3ATKA 3P95A 1SFIA 2G8TA 3PO1B 1L1JA 3QGJA 3LH3A 2EI7A 3A8DA 2STAE 3V12A 1RTKA 3SJKA 4UE7H 1IQMA 2H6MA 3K6YA 3A82A 1KXFA 3VEQB 4NIYA 2Q1JA 3MOCA 3W95A 2GMTB 3NK8A 2BY8X 1P2IA 1E0FD 1UHBA 5E0GA 1CT0E 1KXAA 3NWUA 3MWIU 1FQ3A 3P8OA 2QYIA 2NU3E 2VINA 2ZQ1A 3BTKE 3BTHE 2W5EA 4MPVA 1EB1H 4UD9H 5F03A 1TMTH 1VCWA 4FU8A 2HLCA 4ISIH 2TPIZ 5DP8A 1P3CA 1BMAA 1GJCB 1YYY1 5CE1A 3HGNA 1RS0A 1DLKB 4ZROA 4I8HA 1OX1A 3BTEE 1GJ7B 1QFKH 3MTYA 3RLWH 2ANMH 1GGDB 3M7QA 1GVLA 3RXQA 2BY9X 1O39A 1ETSH 4DOQA 3DHKH 2Z6BD 3KQCA 3KNXA 1O2HA 2YNAA 1O2QA 2HWLB 3OYPA 1ZMLA 3ODDA 4ABBA 2FOMB 3DFJA 3RXDA 4IS5A 3BSQA 1FXYA 1K1MA 3V7TA 2QXJA 1ELDE 2G51A 2VVCA 3SOSA 2A7CA 2F9UA 4D9QA 5GCHF 1QNJA 8ESTE 2FS8A 1WAYB 1GJ9B 1MQ5A 3D65E 5G4BA 1K1NA 3SNBA 1O3DA 2QF0A 4Q7ZA 3MHWU 1NRQH 1GHVH 3QUMP 1FONA 4INLA 1TFXA 4BXSA 3V3MA 1TNLA 2A2XH 3O8RA 2XBVA 3SI3H 1O33A 1CE5A 3PTNA 1UVPA 4IC5A 3TJOA 1AKSB 1THSH 1EUFA 5JYIA 5JB8S 1KTSB 4MDSA 4D9RA 1FLEE 2A32A 2GCTC 1J8AA 1SSXA 2GGVB 1TLDA 1A0HB 1TQ0B 2FI3E 2WV5A 3E6PH 1E38B 1A7SA 4TY6A 1C2FA 3Q77A 3RXCA 1VGCB 4O3TA 1ANBA 1WTHD 2W26A 4GPGA 3U98H 3CS0A 2GCHG 1EXFA 1CGJE 3ZZCA 2J2UA 4IN1A 5JBBS 2R9PA 2ZIQH 1AVXA 2CF8H 1BCUH 4THNH 2UUKB 3UR9A 1QL7A 1G3BA 2WYGA 4A7IB 1XUGA 1EPTA 1S5SA 3UFAA 2C3SA 1SGIB 1TPPA 1M9UA 2ZCLP 3RXFA 4D8NA 4FVBA 1GJBB 3O8DA 5I46H 1GI3A 2OP9A 1BOQA 1FIZA 2PWXA 1E35B 2FOGA 4RSPA 4BTIB 1JRTA 1HAVA 3A7XA 3TPIZ 9LPRA 2O9QA 2P16A 1DANH 2SGEE 3M5MA 1AFQB 3PYHA 1S0RA 2BLWA 2BMGB 1HNEE 5LPRA 1YPLH 1F5KU 4AFQA 1UTQA 1P2MA 2ZKSA 1A46H 1C2GA 4X8UH 2C8WB 5EXNA 3RC6A 3NXPA 1NFXA 4X1RU 1LHFH 1ZPBA 2B5TB 1O3KA 2OXSA 1DS2E 2ZPQA 3A7TA 3NPSA 1OP0A 4IN2A 2Q6GA 2FEQH 5DK1A 4YOGA 1SGYE 3P70B 4U30A 3LDXH 1CHOG 2FPZA 1ELFA 3PWBA 3RC4A 1AWHB 4CRCA 1P09A 3ZV9A 4Q80A 3RXPA 2UWOA 1H8DH 3Q3YA 4ZH8A 3I29A 7LPRA 4ZHMU 2ZGCA 1HXEH 2VH0A 3GYLB 2IJOB 5A09A 1BTYA 1YF4A 4JZEH 1ZTJA 3B9FH 3EDXB 3ZVDA 1AUJA 4FUJA 1KDQA 1G3CA 4X6MA 2BLOA 1C5ZB 4MTBA 1CBWB 5C1UA 1YLCA 1LQDB 1GHBG 1DFPA 1PPGE 3GCTG 2AMQA 1V2NT 3FZDA 4Y0YE 2GT8A 1SVPA 1C2HA 4ZUHA 4B75A 1BA8B 1BT7A 3SUGA 1DVAH 2OTVA 1RGQA 4B2BA 4YO9A 1ZRKA 1GL1A 3S69A 3UOUA 2AFQB 5GJ4B 1JMOH 1MTNB 3LGWA 7KMEH 1INCA 3ZYEA 1W7XH 5HMAA 3RXTA 3PWCA 1EPTC 4ISOA 3A8AA 1GI5A 3U69H 4FUGA 4I8JA 2PW8H 4NCYA 3JZ2B 1IQFA 1C2JA 5AFZH 4AYVB 3NCLA 2R2MB 1VCPA 3TJUA 3GDVA 1KLTA 1PJPA 2I6SA 4K69A 2BD7A 2VVUA 2D2DA 2FO9A 3HKJB 2FOBA 1PQ7A 2GDDA 1NC6A 3U1JB 1D3PB 4ESTE 1HAIH 4HZHA 2P94A 2BOHB 5F8XA 1SQTA 5CHAB 2ANYA 1O3JA 4MPUA 1F2SE 4CRGA 2QF3A 1Z6EA 2WPKS 1GHAF 2FWWA 3F9GA 4A6LA 1P3EA 2XTTB 3BEFB 1HPGA 2QAAA 4HI3A 2QXGA 1O2GH 1ZJDA 3UQOA 3P92A 2G55A 2ZNKH 3ODFA 1SOZA 2ODYB 3BTDE 4AYYB 5DP6A 3PMAB 5GWZA 2HOBA 4X8SH 2AGGX 4WMEA 1RD3B 3D49H 4ABFA 2XC5A 5FHTA 5FPTA 1K1OA 2ZHEH 2XBYA 2UUFB 5GCHG 3H7OA 3OX7U 3LU9B 4BNRA 2ASUB 3DD2H 2BLVA 2GZ9A 1IQNA 1P12E 1F0SA 1T31A 1SLVB 5FPYA 1T7CA 4U01A 4Y11E 1O32A 1O2KA 2BX4A 1HXFH 3UWJH 4ABDA 1D4PB 1NESE 2FTLE 1O38A 3IWMA 2P8OB 1IAUA 2XC4A 1GDQA 1S82A 2TGAA 1SHYA 1FAKH 1Z8RA 2FOEA 1UTMA 1NFWA 4M7GA 1SGPE 1EB2A 3M37A 1P05A 2F9BH 4Y8YA 1AZZA 1GBEA 4Y76A 2F3CE 3ZZBA 1QIXB 3FFGA 3MMGA 4FUDA 1W7GH 3ZVAA 1A3EH 1BMNH 3VGCB 4WMDA 2A5AA 4B2AA 2G00A 2ZCKP 1HIAA 4O3UA 1F92A 1YPKH 1HYLA 2O8MA 2EA3A 5DP9A 1GL0E 4B74A 1AVWA 6GCHF 4RKOB 1DXPA 1E34B 2VIOA 4OGXA 1F7ZA 4A1VA 1GBMA 5DGJA 1ETTH 5DPAA 3SORA 5EPYA 1MD7A 3SUFA 2BHGA 4VGCC 1TABE 4E05H 4KTCA 3RXEA 2ZHWH 1ANDA 2XWAA 2FMJA 2HNTF 1HJ9A 3LGVA 1IQKA 2QA9E 1P8VC 1W3CA 2G5NA 1AQ7A 1XUJA 1NY22 5FBIA 3MNSA 1FJSA 1P0SH 2J38A 3F1SB 3SU3A 1AE8H 1EAWA 1O3OA 1C2LA 1O3BA 1PYTC 1L1GA 1BHXF 3KQBA 3UR6A 1YPJH 1Z1JA 2I6QA 1O5GH 1OWJA 2HPQH 1OWKA 1WUNH 4K2YA 4UFGH 5DP3A 1WU1A 1EAIA 3SNEA 4GCHF 2RCEA 1L2EA 2A1DB 2WPIS 4MNWA 4YLUA 2ZDVH 1N6XA 3PTBA 1J9CH 2P3TB 2FI4E 4ZXXH 3FANA 1P2NA 1C1SA 3R0FA 2ZHQH 1MBQA 1GCTC 2CHAB 2RA3A 4GHQA 1O3EA 3DFLA 3KEEA 1B5GH 1P11E 3SU0A 1QL9A 4JK5A 3U8OH 1GDUA 2M5TA 4Y6DA 4DURA 2VIWA 6CHAB 4B76A 1P9UA 1ARCA 3TK6A 3RXBA 1S6FA 1HB0B 1Z71A 3FAOA 5T6GA 1F5LA 3E8LA 1Z8IB 2PUXB 3GY8A 3T62A 1P10A 1EX3A 1LQEA 2CV3A 1HJ8A 1YC0A 3HPTB 1S84A 3RXVA 1SPJA 4CREA 2BD5A 2PTNA 1NRPH 2QN5T 1ZYOA 1EZQA 2HNTE 3RU4T 5SGAE 2SGFE 1WV7H 3PMHB