2OC7A

Structure of hepatitis c viral ns3 protease domain complexed with ns4a peptide and ketoamide sch571696
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
181
structure length
181
Chain Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Hepatitis C Virus
publication title Discovery of the HCV NS3/4A protease inhibitor (1R,5S)-N-[3-amino-1-(cyclobutylmethyl)-2,3-dioxopropyl]-3- [2(S)-[[[(1,1-dimethylethyl)amino]carbonyl]amino]-3,3-dimethyl-1-oxobutyl]- 6,6-dimethyl-3-azabicyclo[3.1.0]hexan-2(S)-carboxamide (Sch 503034) II. Key steps in structure-based optimization.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 41
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2oc7A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2oc7A01
1BJVA 1OWHA 2CHAB 4VGCB 3SV7A 2AGEX 1NFYA 1CSOE 2A4QA 3ZV8A 4YT7H 3UWJH 3PTBA 3UNQA 2G8TA 1RTFB 1BMLA 2WPKS 4NFFA 3P95A 4RKOB 1MD7A 1UK2A 1GJCB 1UVSH 3SZEA 1K1NA 1K21H 1W7GH 2HGTH 4TY7A 1OWDA 3GCNA 2H6MA 1TBQH 3MU4A 3K2UA 4KTCA 4I31A 4BAHB 2WZQA 1CGHA 1HJAC 4CRGA 3M36A 2OQUA 3F9GA 2TGDA 1ELGA 1MQ6A 2SGFE 3F9HA 3MH7A 3M7QA 1HAZB 3O8CA 2PKAA 2ZTYA 4WF8A 4A1TA 1P9SA 2WPLS 3E3TA 4OGYA 5A0CA 4ASHA 1TLDA 2D1JA 2A1DB 2VWLA 1GHBF 1VCQA 3GDUA 4MVNA 3UFAA 1AQ7A 2WUCA 1D3DB 1H4WA 4DURA 2O8UA 4CR5A 1Q2WA 3ZVGA 1ZSKA 2BLWA 3S9CA 1ELVA 1JBUH 3NUMA 1HJ8A 2BXTH 1A3EH 3STIA 3RXEA 1H9HE 3GYLB 1C1VH 1OP8A 1XUHA 4Q2KA 1P3CA 1MD8A 2WPIS 4I32A 1SFIA 1QFKH 1P06A 5FX5A 2R0LA 5A2MH 1P09A 4NWLA 3QX5H 6GCHF 2A2QH 3SN8A 2C93B 2ZGBH 1GG6C 5FPTA 3A7TA 3QK1A 3E91A 1PPGE 1VCWA 1YKTA 3MNSA 2BLQA 5BRRE 2GCHF 2H5DA 3E16B 2GT7A 1K2I1 5DP8A 8ESTE 3PYHA 4IN1A 4NSVA 1ZOMA 1ZMJA 3FFGA 1HXFH 3GY6A 3D62A 9LPRA 1ZGVA 3RC6A 3RXFA 2J95A 2IPHA 1EOJA 5AHGH 1K28D 1OKXA 1SMFE 2A2XH 3QZQA 1P01A 2G51A 1V2QT 1V2TT 1BB0B 4BAOB 3RXQA 1NFWA 1T4VH 2ZI2H 4H42U 4AYYB 4NZQA 2ZGCA 2GV6A 1BMMH 1W2KH 3LPRA 3GDVA 5AVDA 1D3QB 1CO7E 3PTNA 1ZJKA 3GOVB 5HM2A 2BLOA 2BVSH 2EC9H 2C8YB 2RCEA 1GJ6A 4YT6H 5C1YA 5A09A 1FLEE 1C4V2 2RA3A 2ZHEH 1MCTA 2A5KA 1FY4A 2DE8A 3RXKA 1FMGA 2BQWB 3M3TA 3MU1A 1H8IH 4YOGA 1C1SA 1Y3WA 1GDUA 1E0FD 1EZSC 4HZHA 2V6NA 3RUOA 3D49H 3TPIZ 3MNCA 3T27A 1CT2E 5E2PA 1W3CA 1RIWC 3LC3A 4THNH 2NU0E 2BD5A 1SB1H 4XBDA 3HK3B 4BANB 2QIQA 2BM2A 3BG8A 3LKWA 1P8VC 1B5GH 4YM9A 1TNLA 2FP7B 2G55A 1THPB 3K6YA 4ZH8A 1C2FA 3QDZB 1EJMA 4AYVB 6CHAC 2PTNA 3F9FA 3MU0A 2Y5GA 4Y0ZE 1DOJA 2AMDA 1GG6B 2EI8A 1C5NH 3D23A 1DX5M 4ABFA 1V2RT 1ZSJA 1W7XH 4WXVA 2QF3A 1IQMA 1FJSA 2I6QA 4FVDA 4X1SU 1KY9A 1TQ7B 5EQRA 2Z9GA 2PLXA 1CGJE 2OC0A 3ZVCA 2UWLA 1HAVA 1DXPA 1P04A 1AKSB 1QA0A 1GWAA 3MH5A 2XBVA 2ANMH 1NY22 2BYAX 1O30A 5EXNA 2ZPRA 1UVUH 4RKJB 3P6ZB 2FLRH 1TIOA 2A45B 1QQUA 1IQFA 5DK1A 4DOQA 3KCGH 4FUEA 4JYTA 3SNCA 1D9IA 4ESTE 2JETC 3BEFB 3M3SA 1YGCH 1DWCH 1NO9H 4CRAA 1ELTA 2BVXH 2WV9A 1C5XB 1AZ8A 2LPRA 2ZU2A 3A85A 1FAKH 3MYWA 2ZDMA 3SUEA 1OXGA 2AGGX 1FY3A 4I33A 1W8BH 1GVZA 3SUGA 4BTUB 5HM9A 2BY8X 1GBAA 2ZCLP 2H1UA 3S7KB 3HGPA 1F0UA 1C5ZB 1AGJA 1O5FH 3A81A 3RXSA 2F3CE 1NRNH 3AW0A 1RIWB 1DXWA 4AFUA 3A88A 1S5SA 5ETXA 2QN5T 3PV4A 4LZ4B 4WWYA 3GY3A 1QL8A 5AFZH 1TB6H 2FPZA 4KKDA 4MNYA 2GCHG 2SGQE 1B0EA 3IITA 2ZEBA 1C1WH 3NXPA 1ANCA 1TBZH 4ZMAH 2VJ1A 3UQOA 6CHAB 4K60A 2P3UB 1EJNA 5J4QA 4K2YA 1J8AA 3ESTA 3P8OA 4UFEH 2Q6FA 3IG6B 2OP9A 1OWEA 4ZKNU 5FHTA 1SHHB 5ABWA 2BTCE 1BIOA 1EB2A 4ZKSU 3V7TA 1C5YB 4AG2A 2QF0A 2FMJA 3M35A 1ELCA 1HGTH 2G81E 4WJG2 4Y7AA 1C5MD 2O9QA 5DP3A 4FU7A 5EODA 3FZDA 2H9TH 1SPJA 3VB5A 1P2MA 1GI6A 5DP7A 3SV9A 1BTYA 3EE0B 2PSYA 2ZPSA 2HVXA 4FU9A 1C2EA 1FY5A 2JETB 1THSH 4X6NA 1P2OA 1LVYA 5H4IB 1ESAA 1IAUA 2QC2A 3ENSB 5ESBA 3RXLA 3UTUH 4NSYA 4AN7A 4R8TB 1K1PA 1LDTT 4QT8C 1BMNH 1WAYB 1EZQA 2UUFB 1FUJA 2G4UA 2ANWA 1QA7A 1HFDA 1QCPA 5A8XA 1VITF 2VIOA 1SG8B 1ABJH 5K7RA 1QJ1B 1C9TA 3C1KA 3URCA 3ZZCA 4SGAE 1XXDA 1ELBA 2J4IA 4E05H 1CT4E 1EUFA 4D8NA 1S6FA 3VB7A 1XUFA 3RDZA 1L1NA 3SU2A 1F7ZA 4CH2B 1O2NA 3ITIA 1E37B 1BHXF 2IOTA 2Y6TA 1LMWB 1DITH 1TRYA 1A46H 5DKMA 3ZZAA 2PGBB 3RXCA 1SLWB 4MQAA 1QQ4A 1O39A 1P12E 1XXFA 1GJ7B 2BVRH 1Y3UA 2FOGA 2UWPA 3RU4E 3KF2A 2M5TA 3P92A 1Y8TA 5A8ZA 3KQEA 2TGAA 5DGJA 4ABIA 5CE1A 2PKAB 2WYGA 1HDTH 3RXPA 2P94A 1H9IE 1V2ST 1SGDE 1O35A 1A61H 3OU0A 4MPVA 3RXOA 1KDQA 3A89A 1S84A 1O0DH 2ZGJA 4NG9H 3OYPA 1QB1A 2ZGXH 1T4UH 4NA8A 4K1EA 4B73A 1C2IA 1O3GA 1YCPM 1ELEE 4B1TA 4GCHF 2ZWLH 4I8HA 2J9NA 1ZSLA 2XC0A 1NFXA 3D65E 1YPEH 3HPTB 2ZHWH 3OTJE 2ZA5A 1CT0E 3JZ1B 1MTUA 3S9BA 2BXUH 1SGFG 1V2VT 4X8UH 5EW1H 3FVFB 1TOMH 3KN2A 3LJOA 2LNCA 4A92A 1TOCB 1C5OH 4GHTA 4I8KA 3TK9A 1C9PA 1O2OA 3ATWA 4FUCA 1GI3A 2HNTF 3U8RH 2HALA 2PFEA 3JZ2B 7GCHG 3RM0H 2VWMA 1CQQA 1QJ7B 3UY9A 1PQ5A 1O5AB 4NIVA 1E36B 4X1NU 1MTVA 3M5OA 3UWIA 4ZKRU 5PTPA 1UCYE 4WH6A 2FOFA 3ZZ6A 1MCVA 2P93A 5I46H 4Z0KA 1HCGA 2AIPA 2QXIA 1AIXH 3SW2B 3ZZ4A 3FP7E 1O2WA 4I8LA 4ABBA 2OINA 1OWKA 3EA7A 1MH0A 3B23B 3OSYA 4XBBA 3SV8A 3LH3A 2YOLA 3LC5A 4AFQA 2ZHQH 2XBXA 1KXAA 2VIPA 4O3TA 1P2QA 3ODFA 3UR6A 2HRVA 2DUCA 3SUDA 5L30H 2F9PA 1GGDC 1A3BH 4HTCH 2FS9A 3URDA 1HBTH 2ZDNA 1GMHF 1ETRH 1SGCA 3ATLA 1C5QA 2CHAC 2CXVA 2ZCKP 1MKXK 1H1BA 2ZCHP 4GUXA 2BD3A 4LZ1H 2JH5D 3RU4D 4AGKA 2FOMB 1TNKA 2EEKA 1OX1A 4Y79A 4Y71A 4I8GA 5L6NH 3MMGA 4B2CA 4FUBA 2B5TB 1AMHA 1DT2A 1HAXB 4MDSA 1GHWH 1YP9A 2GD4B 4E7RG 4UONA 1GBJA 3UNRA 1XUGA 1BRCE 1DWDH 4X6MA 1ELAA 1WYKA 1V2JT 2Y81A 3NWUA 1ZHPA 3BTKE 1TRMA 1TMTH 2QXJA 1D4PB 5JDUB 3QWCH 3QUMP 2ZDKA 1DPOA 1BTHH 2C90B 1BMAA 3LGWA 2NU1E 5IDKA 3MNBA 4Y0YE 4ZAEA 1AZZA 1JWTA 1GMDG 1AFQC 4FUFA 1B7XB 1N6XA 1Y3YA 2EA3A 3TJUA 1EP5A 1HAVB 1L0ZA 2F91A 1ZRKA 2OBOA 5F8XA 4CBNA 5EQSA 4MPWA 1BDAA 3TGIE 3SJ8A 2A0QB 2W5EA 3VXEH 4NIWA 2WV4A 5FCRA 2CJIA 5F8TA 1SGYE 2A32A 1C1UH 2GZ8A 5GXPA 1QBOA 2XW9A 1GI9B 4B74A 4D7FA 2ZFQH 4BAMB 1HIAA 3G01A 3BTTE 1WOFA 1MTNB 1P10A 2ASUB 3QO6A 1O37A 5F8ZA 3DA9B 3PWCA 5JB8S 2Q6DA 1NZQH 1V2PT 5L2ZH 4D9RA 1BRAA 1N8OB 1EZUC 1BRBE 1O2QA 2B9LA 2ZFRH 1C2LA 3V3MA 3BN9A 3HKJB 4AFSA 4NWKA 1BTZA 2BY5X 1GGDB 1WV7H 1QGFA 1YPMH 1IQJA 1GBCA 3A8CA 3PMHB 1AUJA 1MKXH 2VIVA 2Z9KA 3DFLA 1GHAG 2ESTE 2B7DH 1XX9A 1C4U2 1L2EA 1BQYA 4IMZA 1ZHRA 1IQLA 3MTYA 1V2MT 1SGTA 4OS1A 3SGQE 4UE7H 3SU5A 3NPSA 2VVUA 2ZFPH 3M7UA 1LVMA 8GCHG 4GPGA 2FIRH 2FM2A 2PV9B 4CH8B 4X6PA 5JBTA 2ULLA 1K22H 1O2RA 2BD4A 1UTKA 5GJ4B 1AWHB 1GL1A 3SUFA 3TK6A 4AOQA 1HAOH 3OY6U 5C1XA 1NRQH 2ZP0H 5GCHG 2UWOA 4NA7A 1BBRE 1TGTA 1AFQB 1O2HA 4IGDA 3S9AA 3TJOA 3M7TA 1KLJH 4AB9A 6ESTA 4MPXA 3A7VA 1UVOA 4B76A 1V2UT 1ZZZA 1FNIA 2GDEH 1QRXA 3M3VA 4PROA 3RMNH 1KSNA 1GI2A 2ODPA 3PLBA 4WVPE 1XMNB 4ABEA 2QA9E 3A86A 3EDXB 1O3FA 1CHGA 1GL0E 3ZZ3A 3TH3H 1VITH 2HNTC 1EAXA 1AWFH 5SGAE 1C2JA 2BZAA 3PLKA 4KTUA 1W12U 1RJXB 2GZ9A 2F9OA 2V3HH 1F0SA 3GISB 2BMGB 3NK8A 2ALVA 2GKVE 2D8WA 3U8OH 2Y80A 2K1QA 2AERH 3GY5A 1GI1A 1VZQH 3L33A 8LPRA 4DVAU 4AX9H 4D7GA 2SGDE 1O2SA 1KXCA 2I6SA 2SGPE 2ZTZA 3ELAH 1TONA 1L4DA 1T7CA 1BHXB 1EP6A 4JYVH 1MZDA 1F0RA 1WSSH 2FX6A 1O5CB 4ZHMU 2J92A 4B2AA 1C4Y2 3U1IB 1O33A 4YO9A 1AO5A 5T1VA 3Q77A 1P02A 1JIMA 1MBQA 1TYNA 4TPIZ 4CRCA 4DJZB 2J34A 2ZC9H 1PPEE 3V0XA 1IHTH 2PWXA 1ZHMA 1BTPA 1TPPA 3TU7H 1O2JA 1J14A 1KXBA 1Z8JB 3I78A 1AD8H 1AY6H 3SU1A 1TAWA 3LONA 1ZRBA 3RXUA 5EPYA 2ZU3A 4FUIA 2QV1A 1SGRE 1XUKA 1FZZA 3MH4A 1UMAH 1TGCA 1OWJA 2BDBA 4H6SB 1KDQB 4MLFB 1P3EA 1CHOG 4AGJA 1Y3VA 3QTOH 2AEIH 1QL9A 3AASA 1F5KU 3ZVEA 9ESTA 1MMJN 2FWWA 1FN8A 2PR3A 4LXBH 3N7OA 4Y76A 5T6GA 2FYRA 3R3GB 1OP2A 2BOKA 4OS5A 1FIZA 5J4SA 1C2KA 2DE9A 1LCYA 1TPOA 3K6ZA 3STJA 5DG6A 1LQDB 4WMEA 5TCCA 1Y5UT 3PMAB 1GJ4H 1GHXH 1E35B 1XUJA 4IC6A 3FP6E 1KYNA 2J38A 1QL7A 1PPZA 1KXEA 1A5HA 1O5EH 4M9FA 3ZVDA 1C1TA 2OC8A 1OSSA 3SU0A 2G00A 2OLGA 3RM2H 2XRCA 2THFB 2C4FH 1SGEE 5TJXA 2OCVB 2ZFFH 1C5VA 3FP8E 1IQKA 4GAWA 3GDSA 3AW1A 2R3YA 3BTEE 3RXGA 3M5LA 3UNSA 3E1XB 2BB4A 1A0JA 3UQVA 2C8ZB 1BT7A 1ARBA 1TA2A 2ZQ1A 1MTSA 4SGBE 1ELFA 3KGPA 3T62A 2UUJB 5E2OA 4NZLA 1AE5A 1SR5C 1C5RA 1P2KA 3BTFE 2OC7A 3SU4A 5DP5A 2OQ5A 2BX4A 3TITA 3ZYEA 3TH2H 3MHWU 1GHBG 4NGAH 3UR9A 2ZNKH 3TGJE 1Y5AT 2TRMA 4IMQA 3BSQA 5F6MA 4NCYA 3I29A 1D3PB 1O3EA 4ABGA 2V0BA 1TMBH 2QGRA 1N1LA 2W3IA 4DGJA 3U8TH 5HMAA 1FV9A 4DIIH 2Z6BD 4X2VA 1V2NT 1RS0A 1GHVH 1BCUH 3ZZ9A 1BRUP 6GCHG 1EATA 3VFEA 1CVWH 2BQ7B 2BDAA 2H9EH 3Q00A 3T26A 3SZNA 4RSPA 1EB1H 4YZUA 2A4RA 4B75A 1AFEH 2XWAA 2VINA 4HI3A 1HV7A 1QB9A 3A8BA 3U1JB 1KIGH 2B0FA 1G36A 1EAIA 2Y5HA 1DFPA 3KNXA 4A5TS 2A4OA 1KTSB 1C1PA 1D6RA 3SNDA 2ODQA 1OYTH 4KP0A 2FTLE 2FOBA 5FXLA 1DY8A 1UVPA 2XCNA 1DSTA 1PPFE 1PYTC 2Y7XA 3BEUA 3SU3A 4TWYA 3ZVFA 1C5SA 5JPMH 1V6DA 5FCKA 1J16A 2ZFSA 1SGQE 5HGGA 4ABJA 1HIAB 1KXDA 2QAAA 2EI6A 2FOCA 4B71A 1UCYH 1V2OT 2TGTA 2BDIA 1O31A 5E0JA 5LGOA 4ZHAA 2HOBA 5IYTA 5JBCS 3RXMA 1GBIA 3RXDA 1KLIH 1OYQA 1NPMA 2HNTE 3UPEA 1A0HB 3A80A 4IBLH 4Y10E 1O2GH 1IQNA 2FI5E 1SBWA 1OS8A 1MUEB 5E0HA 3ZZDA 5AF9H 1Z1IA 3AK5A 1NU7B 1V2LT 4IN2A 3P8NA 3F1SB 3PM3A 2RDLA 2YNBA 3VPKA 2AFQB 1GJ9B 1GI4A 1ZGIA 3HKIB 3PMBB 1LHFH 3EYDA 4Y8YA 4K1SA 1O3NA 2OTVA 1QHRB 4FVBA 3LGVA 1OPHB 1PQ8A 2G5VA 4MG3A 3GCHC 4RN6A 3EA9A 3PROA 3BEIB 4Y6DA 1TE0A 3LGTA 4DT7B 4JMYA 4AORA 3AAVA 5DP9A 1EXFA 2BD7A 4ZXXH 3Q3KA 5GIBA 1TX6A 2ZIQH 1ABIH 1NS3A 4U2WA 2BHGA 2R0KA 1P0SH 3A8DA 5FPSA 2CF8H 1EPTA 1QIXB 1SI5H 1LPKB 1O32A 1LKAA 4M7GA 2FZZA 1Y59T 3AAUA 4U30A 2VB0A 3ZZ7A 3GY4A 1MQ5A 4WXIA 5C5OA 3ZZ5A 5EOKA 5A0AE 1ZJDA 3Q3XA 4CRFA 4D76A 2BQ6B 3MH6A 1BTXA 2VH6A 1ZPBA 5DO4H 1JOUB 2GV7A 1GI7B 3SJIA 2PGQB 3O8BA 2NU3E 1GMCF 1MU8B 1A7SA 4DY7B 2Z3DA 2GZ7A 3TH4H 4CRBA 2D2DA 5B6OA 5ESTE 1T8LA 3HK6B 3SGAE 2J94A 5AFYH 1C5WB 2CF9H 2V3OH 5I25A 4XDEA 2VH0A 5C1UA 2ZO3H 1O3KA 4NA9H 5G4BA 3TVJB 4X1PU 1GJ5H 3BTWE 2XBWA 1FY8E 3TNTA 1UTJA 2PUQH 4ZKOU 4JZDH 3EAJA 4O9VA 1K1IA 1ARCA 4ISNA 1A1RA 1NT1A 2R9PA 4WMFA 4CBOA 1N6YA 2BZ6H 1DE7H 1RTKA 1O34A 2ANKH 4WH8A 1BTUA 1C5UA 3A8AA 1A4WH 2PKSC 1LVOA 1HAHH 3S69A 2A7CA 2GVFA 3BV9B 3GCHB 1DWBH 1YC0A 2XC5A 2BOHB 1HAIH 3ATMA 2PUXB 1O3AA 3HGNA 3VGCC 1Z7KA 3UIRA 5EXMA 3GCOA 3A7YA 4FUJA 1IOEA 2GTBA 1TBRH 3OTPA 1EJAA 3ZZBA 2VU8E 2WUBA 3EGKH 1UHBA 4FUGA 3SORA 5GNDA 3P8GA 2FXRA 4K8YA 1ANEA 2ZF0H 1MTNC 1TGBA 1RFNA 1NRRH 1ZTLA 4F49A 1GBFA 2ZTXA 4A1XA 1BITA 1N8OC 4TPYA 3DT0H 1O2LA 3SU6A 1FPHH 3QGNB 4I8JA 1TABE 4O3UA 3SOSA 5T6DA 2C8XB 3RC4A 4UDWH 3VXFH 4B2BA 5DP6A 1QR3E 4KTSA 2R2WU 5JB9S 1YM0A 1Z1JA 1G3BA 4ISOA 4YESB 1M9UA 4BAQB 5GDSH 1WQSA 1VITG 1XKBC 3EA8A 4X6OA 4MNXA 4MNWA 3SO3A 1GVLA 4BXSA 1O2KA 5E8EH 3TIUA 1HUTH 1O3LA 1SGPE 1EQ9A 1THRH 1VCPA 1GCTC 3KHVA 2AYWA 1O3BA 4J2YB 4E06H 2A4GA 2B8OH 4IW4E 2Z7FE 1PPHE 1WTHD 5EPNA 4Y11E 4AFZA 1S85A 1C2DA 2FLBH 2P95A 4UFGH 2XNIA 4Y7BA 1OP0A 2PKSB 3PB1E 1NC6A 2HPQH 2RA0A 4YLUA 1INCA 1FAXA 5T3HA 1SLXB 2QXHA 3T28A 1SQOA 4JK6A 3AVZA 3VGCB 3BF6H 3T29A 1YYY1 3UOUA 3TJVA 4U32A 3FAOA 3H09A 1UTQA 2XCFA 2HPPH 2C8WB 1TNHA 1DUEA 1P03A 3KQDA 2GX4A 1DUAA 2KAIA 1P05A 1WCZA 2AGIX 2BY7X 2XBYA 4GVUA 3LOXA 1UVTH 1O2PA 2GCTC 2UUYA 4DCDA 1O2XA 3M5MA 3RP2A 2STAE 3P70B 4NIXA 2ZU4A 3MO6A 1L1JA 4GCHG 1Q31A 2R2MB 5CHAC 4RI0A 4JZFH 2A5IA 2D26C 2PSXA 3A87A 4K8BA 3RMOH 1AU8A 2NU4E 3KL6A 2ZZUH 1HJ9A 1O3OA 2H2ZA 2AIQA 1F2SE 2ZKSA 1ZTJA 5L2YH 1P57B 1U6QA 1O2YA 3VB3A 5FX6A 2AMQA 1G2LA 7LPRA 1GDNA 5DP4A 1C5TA 1SGNE 1GHZA 3RXJA 4BTIB 2ZG0H 4BAKB 1QRWA 3MO9A 2Z94A 3NKKA 5JBAS 1DANH 1J15A 1LO6A 2CV3A 3BTDE 3S0NA 1DLKB 1O2ZA 1HAGE 1LVBA 3T25A 2QXGA 1S81A 3QLPH 2CGAA 2PTCE 2GDDA 4YLQH 5GPIB 3SGBE 1S83A 1GCTB 4BXWA 1H9LB 1MZAA 1ACBE 4UD9H 2BY6X 1O2IA 1BTWA 1Z6EA 2XWBI 3IWMA 4GSOA 3ATKA 4ISHH 3SHCH 1EPTC 1YF4A 2Y7ZA 4INHA 3T2NA 5DPAA 1AI8H 1RGQA 2H5CA 2J2UA 2A31A 2P59A 2UUKB 1C2GA 3KQBA 1QJ6B 1E38B 4TYDA 1UO6A 3A7ZA 1G30B 4X2YA 1GJ8B 1NU9A 4OS4A 2O8WA 3TK5A 1GBMA 1XKAC 3SI3H 1GDQA 4IC5A 1GHYH 3GICB 2TGPZ 4JYUH 5BPEA 1HXEH 2FESH 1Y3XA 3E90B 3MU5A 1G3DA 2A7JA 1SOZA 5FAHA 4Y8XA 5B6LA 1IQHA 1Q3XA 2F9UA 2WPMS 1WTGH 3LIWA 1L1GA 2R3UA 1EASA 2BDCA 1AN1E 1SLUB 2JH6D 4Q80A 2GCTB 3U98H 2Z3EA 4B6EA 1E34B 4ABHA 2OC1A 2FTMA 1NFUA 5EU8A 1GMHG 5GWZA 1W14U 1ZYOA 5CHAB 4GHQA 4BNRA 1C1MA 7KMEH 1PYTD 3E0PB 2FOHA 1GCDA 1GI8B 1KTTB 2QCYA 1ANDA 1DSUA 4Y8ZA 2IN2A 1RRKA 1PFXC 1DICA 1EAWA 1G9IE 1QBNA 4X1QU 1JRSA 4A1VA 3S7HB 4Q7XA 2BLVA 1GVKB 1PJPA 3CS7A 2JKHA 5C67A 1V2KT 1QURH 3SJ9A 3PV5A 1ZMLA 5C5NA 3MOCA 1DDJA 4YTAA 2WV5A 2WHXA 1ETSH 2VVCA 1VGCC 5A8YA 1SC8U 1CGIE 1PQ7A 5HXFA 1SQAA 1TA6A 1UTPA 1YBWA 1EPTB 3LH1A 1PPCE 2G52A 1C1NA 1WBGB 4O03A 1QNJA 1UTMA 1T32A 3KIDU 3RXTA 2VGCC 2Y5FA 1O3DA 4JK5A 5EG4A 1ESBA 1GBTA 1B0FA 1G2MA 2P3FH 2SGAA 3PWBA 3LGYA 1G32B 4F4OC 1CU1A 1Z6JH 1SHYA 1O3JA 2Z9LA 4ISIH 2F4LA 3OX7U 1BUIA 2P3TB 3CP7A 1C5LH 2QYIA 3FZZA 4OS7A 4ZROA 1S0RA 1TPAE 2OUAA 2BD8A 3TLOA 3QGJA 1MAYA 3SNAA 2VBCA 1FIWA 3RXIA 1HJAB 4JZIA 4UFFH 1O38A 2GGVB 2V35A 2ZU5A 2G4TA 2ZFTA 3GY7A 3ZZ8A 3UOPA 1JMOH 3E0NB 3M5NA 3VEQB 1SOTA 1YCPK 1ZLRA 2HLCA 4XFQA 2Z9JA 1F0TA 1W0YH 4OS6A 1F92A 3BIVH 4ABAA 2W26A 1A5GH 1GPZA 1S6HA 2ZHFH 1AHTH 3RMMH 1HAPH 3LT3A 5K0HA 2W7SA 1MKWK 1S0QA 1T8OA 4AB8A 1A2CH 3HATH 3SJKA 1NM6A 3BTHE 1D6WA 1VGCB 3SNBA 1DVAH 2RG3A 3ZVBA 1W11U 2HWLB 4X8TH 1GJDB 1UHBB 2FYQA 2O8TA 3O8RA 1F5LA 3PO1C 4YOIA 1W13U 4H6TA 1Y5BT 3C27B 2BDGA 4LK4A 1UCYK 3LJJA 4MTBA 1NTPA 3TJNA 1O3HA 1O2VA 1UJ1A 3TNSA 2VGCB 4YOJA 2C3SA 2WPJS 4XE4A 3E6PH 1NRSH 3ZYDA 1O3MA 1TRNA 1SGIB 3SNEA 5E0GA 1AVWA 3Q3YA 2ALPA 1W0ZU 1TNGA 3GYMA 1PQAA 4MNVA 2GMTC 1GBBA 1RTLA 3Q76A 2VNTA 5TCAA 5EW2H 1NRPH 1CBWC 3DD2H 1NROH 3RMLH 1K1MA 1TPSA 2OXSA 2BDYA 1EKBB 2ZDAH 4CHAC 3RXHA 2WPHS 2VIQA 1SVPA 2FX4A 2Y82A 4X2XA 1SQTA 4FUDA 1AE8H 1QRZA 3M37A 2OBQA 1G37A 3QZRA 2ZQ2A 4OGXA 4K3JA 2XC4A 4X1RU 3TGKE 5T6FA 4ZHLU 1SGFA 3VB4A 2IJOB 3RXRA 2O8LA 1HPGA 1YCPH 4ZUHA 5A0BA 2AH4X 4BOHA 4H4FA 3T5FH 5FPYA 1J17T 3DHKH 1IHSH 1P11E 2FOEA 3SQHE 2VWOA 1QBVH 1TGNA 1O3CA 3P17H 2A7HA 2H9HA 1S82A 1HRTH 1K1OA 3EQ0H 1ESTA 3LU9B 5LPFA 1LHCH 3U69H 1V3XA 2FS8A 3PMJA 3DFJA 4X8SH 1MKWH 1JIRA 2ZECA 4U01A 1XVOA 7GCHF 1T8NA 4MPUA 1UTNA 2XTTB 1P2JA 1O5GH 2BD9A 1LPZB 1XUIA 2TPIZ 2AS9A 1K1JA 1GBDA 1TNJA 1WXRA 3B9FH 1SLVB 2FO9A 4R0IA 2GT8A 1TWXB 2KAIB 1GI5A 3PO1B 5LPRA 5FBIA 4AG1A 1NESE 2FEQH 1C1QA 1QB6A 2W3KA 2FI3E 1VJ9U 2GP9B 3SHAH 1MU6B 3ZVAA 2BX3A 2F9VA 1HLTH 1GBEA 2VIWA 2PHBA 2P16A 1EAUA 3B8JA 1YPHC 1LTOA 1OOKB 2GMTB 3A82A 1WU1A 1MTWA 3CENA 6LPRA 1CBWB 1V2WT 1QTFA 2VIDA 4TWWA 1YPJH 1QY6A 1JRTA 5JBBS 2XXLA 4CHAB 2W7UA 2XYAA 4UEHH 1ZR0A 4GLYA 1DS2E 3WY8A 3QTVH 4X2WA 4XOJA 3UUZA 3H7TA 1O5BB 1OWIA 3RLWH 1UTLM 3R0FA 2NU2E 2ZDVH 1TX7A 3P8FA 2ZDLA 1TALA 2O8MA 1FQ3A 2WINI 3ZV9A 2IJD1 4FUHA 1GBKA 2QY0B 4X0WU 1ZPCA 2G5NA 4FXGH 3L6PA 3MWIU 1UK4A 5DJ7A 1SSXA 1AVXA 3BIUH 1AUTC 1DM4B 4TY6A 4OS2A 1ANBA 1DY9A 3SJOA 1BJUA 1L4ZA 1SFQB 4LOYH 3RC5A 2YNAA 1LPGB 2Z3CA 1JXPA 3V13A 1Z8RA 1HYLA 1YPGH 3A84A 1DLEA 5C3NA 4CRDA 1BZXE 3GCTF 2FOAA 4XSKU 2OD3B 1O2MA 1GMDF 4NIYA 4Q7ZA 3DUXH 5C20A 1BBRK 1IQIA 1O3IA 3SI4H 1TGSZ 3H7OA 1MBMA 1VJAU 2VWNA 2ANYA 1Z8IB 4DIHH 4K69A 5LPEA 1TNIA 3U9AH 3I77A 5CMXH 2WYJA 1K9OE 1XM1A 1Z71A 1T8MA 1AB9C 1TMUH 3GY2A 5LH8A 3V12A 1O5DH 1NN6A 4A7IB 3W95A 4FU8A 2ZPQA 4JZ1A 1YPKH 1KLTA 3LDXH 1SL3A 3BTME 4NFEA 3VB6A 3M61U 1ZPZA 5C2ZA 2TBSA 3MI4A 2SNVA 1IQGA 1GJBB 1LHGH 1YLCA 2F83A 2OK5A 4X8VH 3BG4C 4CR9A 2NWNA 3F68H 4KELA 1P2NA 1PPBH 4Z6AH 1D3TB 3KEEA 3A7WA 1FDPA 4ZXYH 4ABDA 1G3CA 3RXAA 1UTOA 1GHAF 2CMYA 3SV6A 1VR1H 1DWEH 4JZEH 1ZTKA 4K5ZA 1BA8B 1X7AC 1YPLH 1CE5A 4BTTB 1LQEA 4E7NA 1LHDH 2BDHA 4INLA 1H8DH 2SFAA 4IS5A 3ODDA 4XBCA 3W94A 4OM9A 1FONA 3SQEE 1UK3A 2STBE 1F5RA 4HFPB 3E8LA 2FDAA 8GCHF 3BTQE 3L3TA 1A0LA 7ESTE 1FN6A 1HB0B 1HAYB 5GCHF 1AKSA 1T31A 1BBRH 3LGIA 3NCLA 1P2IA 3UREA 1TX8A 2FODA 4K1TA 4WMDA 1XVMA 4KGAA 3SV2H 1CA0C 1TQ0B 2AMPA 1P9UA 1Z8GA 1J9CH 1W10U 1O3PB 1AB9B 1C1OA 1BOQA 3MFJA 1GI0A 3RXVA 2EI7A 3MU8A 1ELDE 1G3EA 4UFDH 1GJAB 2FI4E 3MNXA 1GBLA 3RLYH 1C1RA 4WY3A 2BD2A 1EX3A 1C2HA 2TIOA 2ZHDA 2P8OC 4VGCC 1GBHA 4DG4A 5HYOA 5FBEA 1IQEA 1ORFA 3A83A 1C2MA 4CREA 3BG4B 4INKA 1TFXA 1RXPA 3CS0A 2ZGHA 3PLPA 1A5IA 1K1LA 3FANA 5F03A 4I7YH 1O2UA 3ATIA 1WUNH 1AVGH 1CA8B 2SNWA 1LKBA 1FI8A 1ETTH 4A6LA 2Q6GA 2PW8H 1ID5H 3MO3A 1RD3B 2ZU1A 4JCNA 3A7XA 3GCTG 1EOLA 3KQCA 3O8DA 4D9QA 3H5CB 3RU4T 4ISLA 3K9XB 1HNEE 2F9BH 4AZ2B 1YLDA 3OY5U 2CN0H 4O97A 4B6FA 1FXYA 8KME2 4DW2U 3LGUA 1GMCG 1O36A 3QN7A 1O2TA 2A5AA 3SYJA 1FPCH 3K65B 3F9EA 1YPHE 5JYIA 5EGMA 1WQVH 3SBKA 3F6UH 2VVVA 3BTGE 1FY1A 2SGEE 2BY9X 5EQQA 4HGCA 1CHOF 1CA0B 1ZMNA 3GY8A 3PV2A 4J1YA 2F9NA 2JH0D 2ILNA 4Q7YA 3NZIA 1LHEH 2Z9IA 2ODYB 1EZXC 2Q1JA 1C5PA 1MAXA 3RXBA 5EXLA 2P8OB 1KXFA
chains in the Genus database with same CATH superfamily
1BJVA 1OWHA 2CHAB 4VGCB 3SV7A 2AGEX 1NFYA 2JIZD 1CSOE 2A4QA 3ZV8A 4YT7H 3FKSD 3UWJH 3PTBA 3UNQA 2G8TA 1RTFB 1BMLA 2WPKS 4NFFA 3P95A 4RKOB 1MD7A 1UK2A 4RT1A 1GJCB 1UVSH 2W6ID 3SZEA 1K1NA 1K21H 1W7GH 2HGTH 4TY7A 1OWDA 2YMSC 3GCNA 2H6MA 1TBQH 3MU4A 3K2UA 4KTCA 4I31A 4BAHB 2WZQA 1CGHA 1HJAC 4CRGA 3M36A 2OQUA 3F9GA 2TGDA 1ELGA 1MQ6A 2SGFE 3F9HA 3MH7A 3M7QA 1HAZB 3O8CA 2PKAA 2ZTYA 4WF8A 4A1TA 1P9SA 2WPLS 3E3TA 4OGYA 5A0CA 5EIYA 4ASHA 1TLDA 2D1JA 2A1DB 2VWLA 1GHBF 1VCQA 3GDUA 4MVNA 3UFAA 1AQ7A 2WUCA 1D3DB 1H4WA 4DURA 2O8UA 4CR5A 1Q2WA 3ZVGA 1ZSKA 2BLWA 3S9CA 1ELVA 1JBUH 3NUMA 1HJ8A 2BXTH 1A3EH 3STIA 3RXEA 1H9HE 3N7DA 5HIZA 3GYLB 1C1VH 1OP8A 1XUHA 4Q2KA 1P3CA 1MD8A 2WPIS 4I32A 1SFIA 1QFKH 1P06A 5FX5A 2R0LA 5A2MH 1P09A 4NWLA 3QX5H 1MABB 2KCYA 6GCHF 2A2QH 3SN8A 4P02A 2C93B 2ZGBH 1GG6C 5FPTA 3A7TA 3QK1A 3E91A 1PPGE 1VCWA 1YKTA 3MNSA 2BLQA 5BRRE 2GCHF 2H5DA 3E16B 2GT7A 1K2I1 5DP8A 8ESTE 3PYHA 4IN1A 4NSVA 1ZOMA 1ZMJA 3FFGA 3KYGA 1HXFH 3GY6A 3D62A 9LPRA 1ZGVA 3RC6A 3RXFA 4ACAA 2J95A 2IPHA 1EOJA 5AHGH 5HKKD 1K28D 1OKXA 1SMFE 2A2XH 3QZQA 1P01A 2G51A 1V2QT 1V2TT 1BB0B 3OEHD 4BAOB 3RXQA 1NFWA 1T4VH 5FL7D 2ZI2H 4H42U 4AYYB 4NZQA 2ZGCA 2GV6A 1BMMH 1W2KH 3LPRA 3GDVA 5AVDA 1D3QB 1CO7E 3PTNA 1ZJKA 3GOVB 5HM2A 2BLOA 2BVSH 2EC9H 2C8YB 2RCEA 1GJ6A 4YT6H 5C1YA 5A09A 1FLEE 1C4V2 2RA3A 2ZHEH 1MCTA 2A5KA 1FY4A 2DE8A 3RXKA 1FMGA 2BQWB 3M3TA 3WWFA 3VG8A 4HG6A 3MU1A 1H8IH 4YOGA 1C1SA 1Y3WA 1GDUA 1E0FD 1EZSC 4HZHA 2V6NA 3RUOA 1E79D 3D49H 3TPIZ 5C17A 3MNCA 3T27A 1CT2E 5E2PA 1W3CA 1RIWC 3LC3A 4THNH 2NU0E 2BD5A 1SB1H 4XBDA 3HK3B 4BANB 2QIQA 2BM2A 3BG8A 3LKWA 1P8VC 1B5GH 4YM9A 1TNLA 2FP7B 2G55A 1THPB 3K6YA 4ZH8A 1C2FA 3QDZB 1EJMA 4AYVB 6CHAC 2PTNA 3F9FA 3MU0A 2Y5GA 4Y0ZE 1DOJA 2AMDA 1GG6B 2EI8A 1C5NH 3D23A 1DX5M 4ABFA 1V2RT 1ZSJA 1W7XH 4WXVA 2QF3A 1IQMA 1FJSA 2I6QA 4FVDA 4X1SU 1KY9A 1TQ7B 5EQRA 5EJZA 2Z9GA 2PLXA 1CGJE 2OC0A 3ZVCA 2UWLA 1HAVA 3UAIC 1DXPA 1P04A 1AKSB 1QA0A 1GWAA 3MH5A 2XBVA 2ANMH 1NY22 2BYAX 1O30A 5EXNA 2ZPRA 1UVUH 4RKJB 3P6ZB 3F0PA 2FLRH 1TIOA 2A45B 1QQUA 1IQFA 5DK1A 4DOQA 3KCGH 4FUEA 4JYTA 3SNCA 1D9IA 4ESTE 2JETC 3BEFB 3M3SA 1YGCH 1DWCH 1NO9H 2WV9A 1ELTA 2BVXH 4CRAA 1C5XB 1AZ8A 2LPRA 2ZU2A 3A85A 1FAKH 3MYWA 2ZDMA 3SUEA 1OXGA 3OEED 2J98B 2AGGX 1FY3A 3NRLA 4I33A 1W8BH 1WDIA 1GVZA 3SUGA 4BTUB 5HM9A 2BY8X 1GBAA 2ZCLP 2H1UA 3S7KB 3HGPA 1F0UA 1C5ZB 1AGJA 2PP6A 1O5FH 3A81A 3RXSA 2F3CE 1NRNH 2QF4A 1RIWB 3AW0A 4AFUA 1DXWA 3A88A 1S5SA 5ETXA 2QN5T 3PV4A 4LZ4B 4WWYA 3GY3A 1QL8A 5AFZH 1TB6H 4ZCNA 2FPZA 4KKDA 4MNYA 2GCHG 2SGQE 1B0EA 3IITA 2ZEBA 1C1WH 3NXPA 1ANCA 1TBZH 4ZMAH 2VJ1A 3UQOA 6CHAB 4K60A 2P3UB 1EJNA 5J4QA 4K2YA 1J8AA 1E1QD 3ESTA 3P8OA 4UFEH 2Q6FA 3IG6B 2OP9A 1OWEA 4ZKNU 5FHTA 1SHHB 5ABWA 2BTCE 1W0JD 1BIOA 1EB2A 4ZKSU 3V7TA 1C5YB 4AG2A 2QF0A 2FMJA 3M35A 1ELCA 1HGTH 2G81E 4WJG2 4Y7AA 1C5MD 2O9QA 5DP3A 4FU7A 5EODA 3FZDA 2H9TH 1SPJA 3VB5A 1P2MA 1GI6A 5DP7A 3SV9A 1BTYA 3EE0B 2PSYA 2ZPSA 2HVXA 4FU9A 2RDEA 1C2EA 1FY5A 2JETB 1THSH 4DT4A 4X6NA 1P2OA 1LVYA 1UW7A 5H4IB 1ESAA 1IAUA 2QC2A 3ENSB 5ESBA 3RXLA 3UTUH 4NSYA 4AN7A 4R8TB 1K1PA 1LDTT 4QT8C 1BMNH 1WAYB 1EZQA 2UUFB 1FUJA 2G4UA 2ANWA 1QA7A 1HFDA 1QCPA 5A8XA 1VITF 2VIOA 1SG8B 1ABJH 5K7RA 1QJ1B 3FO8D 1C9TA 3C1KA 3URCA 3ZZCA 4SGAE 1XXDA 1ELBA 2J4IA 4E05H 1CT4E 1EUFA 4D8NA 1S6FA 3VB7A 1XUFA 3RDZA 1L1NA 3SU2A 1F7ZA 4CH2B 1O2NA 3ITIA 1E37B 1BHXF 2IOTA 2Y6TA 1LMWB 1DITH 1TRYA 1A46H 5DKMA 3ZZAA 2PGBB 3RXCA 1SLWB 4MQAA 1QQ4A 1O39A 1P12E 1XXFA 1GJ7B 2BVRH 1Y3UA 2FOGA 2UWPA 3RU4E 3KF2A 2M5TA 3P92A 1Y8TA 5A8ZA 3KQEA 2TGAA 5DGJA 4ABIA 5CE1A 2PKAB 2WYGA 1HDTH 3RXPA 2P94A 1H9IE 1V2ST 1SGDE 1O35A 1A61H 3OU0A 4MPVA 3RXOA 1KDQA 3A89A 1S84A 1O0DH 2ZGJA 4NG9H 3OYPA 1QB1A 2ZGXH 1T4UH 4NA8A 4K1EA 4B73A 1C2IA 1O3GA 1YCPM 1ELEE 4B1TA 4GCHF 2ZWLH 4I8HA 2J9NA 1ZSLA 2XC0A 1NFXA 3D65E 1YPEH 3HPTB 2ZHWH 1YWUA 3OTJE 2ZA5A 1CT0E 2YMSD 3JZ1B 1MTUA 3S9BA 2XNDD 2BXUH 1SGFG 1V2VT 4X8UH 5EW1H 4XD7D 3ZIAD 3FVFB 1TOMH 3KN2A 3LJOA 2LNCA 4A92A 1TOCB 1C5OH 4GHTA 4I8KA 3TK9A 1C9PA 1O2OA 3ATWA 4FUCA 1GI3A 3WWBA 2HNTF 3U8RH 5KECA 2HALA 2PFEA 5HIYA 3JZ2B 7GCHG 3RM0H 2VWMA 1CQQA 1QJ7B 3UY9A 1KMHB 1PQ5A 1O5AB 4NIVA 1E36B 4X1NU 1MTVA 3M5OA 3UWIA 4ZKRU 5PTPA 4TT3D 1UCYE 4WH6A 2FOFA 3F3BA 1MCVA 3ZZ6A 2P93A 5I46H 4Z0KA 1HCGA 2AIPA 2QXIA 5DN6D 1AIXH 3SW2B 3ZZ4A 3FP7E 1O2WA 4I8LA 4ABBA 2OINA 1SKYE 1OWKA 3EA7A 1MH0A 3B23B 3OSYA 4XBBA 3SV8A 3LH3A 2YOLA 3LC5A 3U28C 4AFQA 2ZHQH 2XBXA 1KXAA 2VIPA 4O3TA 5CHBA 1P2QA 3ODFA 3UR6A 2HRVA 2DUCA 3SUDA 5L30H 2F9PA 1FX0B 1A3BH 1GGDC 4HTCH 2FS9A 3URDA 1HBTH 2ZDNA 1GMHF 1ETRH 1SGCA 2IPQX 1C5QA 3ATLA 2CHAC 2CXVA 2ZCKP 1MKXK 1H1BA 2ZCHP 4GUXA 2BD3A 4LZ1H 2JH5D 3RU4D 4AGKA 2FOMB 1TNKA 2EEKA 1OX1A 4Y79A 4Y71A 4I8GA 5L6NH 3MMGA 4B2CA 4FUBA 2B5TB 2XOKD 1AMHA 1DT2A 1HAXB 4MDSA 1GHWH 1YP9A 2GD4B 4E7RG 4UONA 1GBJA 3UNRA 1XUGA 2CK3D 1BRCE 1DWDH 3FN8A 4X6MA 1ELAA 1WYKA 1V2JT 2Y81A 3NWUA 1ZHPA 3BTKE 1TRMA 1TMTH 2QXJA 1D4PB 5JDUB 3QWCH 3QUMP 2ZDKA 1DPOA 1BTHH 2C90B 1BMAA 3LGWA 2NU1E 5IDKA 3MNBA 4Y0YE 4ZAEA 1AZZA 1JWTA 1GMDG 1AFQC 4FUFA 1B7XB 4YXWD 1N6XA 1Y3YA 1VKYA 2EA3A 3TJUA 1EP5A 1HAVB 1L0ZA 2F91A 1ZRKA 2OBOA 5F8XA 4CBNA 5EQSA 4MPWA 1BDAA 4FETA 3TGIE 3SJ8A 2A0QB 2W5EA 3VXEH 4NIWA 2WV4A 5FCRA 2CJIA 5F8TA 1SGYE 2A32A 1C1UH 2GZ8A 5GXPA 1NBME 1QBOA 2XW9A 1GI9B 4B74A 4D7FA 2ZFQH 4BAMB 1HIAA 3G01A 1H8ED 3BTTE 1WOFA 1MTNB 1P10A 2ASUB 3QO6A 1O37A 5F8ZA 3DA9B 3PWCA 5JB8S 2Q6DA 1NZQH 1V2PT 5L2ZH 4D9RA 1BRAA 1N8OB 1EZUC 1BRBE 1O2QA 2B9LA 2ZFRH 1C2LA 3V3MA 3OAAD 3BN9A 3HKJB 4AFSA 4NWKA 1BTZA 2BY5X 1GGDB 1WV7H 1QGFA 1YPMH 1IQJA 1GBCA 3A8CA 3N99A 3PMHB 1AUJA 1MKXH 2VIVA 2Z9KA 3DFLA 1GHAG 2ESTE 2B7DH 1XX9A 1C4U2 1L2EA 1BQYA 4IMZA 1ZHRA 1IQLA 3MTYA 1V2MT 1SGTA 4OS1A 3SGQE 4UE7H 3SU5A 3NPSA 2VVUA 2ZFPH 3M7UA 1LVMA 8GCHG 4GPGA 2FIRH 2FM2A 2PV9B 4CH8B 4X6PA 5JBTA 2ULLA 1K22H 1O2RA 2BD4A 1UTKA 5GJ4B 1AWHB 1GL1A 3SUFA 3TK6A 4AOQA 1HAOH 3OY6U 5C1XA 1NRQH 2ZP0H 5GCHG 2UWOA 4NA7A 1BBRE 1TGTA 1AFQB 1O2HA 4IGDA 3S9AA 3TJOA 3M7TA 1KLJH 4AB9A 6ESTA 4MPXA 4AC9A 3A7VA 1UVOA 4B76A 2JDID 1V2UT 1ZZZA 1FNIA 2GDEH 1QRXA 3M3VA 4PROA 3RMNH 1KSNA 1GI2A 2ODPA 3PLBA 4WVPE 1XMNB 4ABEA 2QA9E 3A86A 3EDXB 1O3FA 1CHGA 1GL0E 3ZZ3A 3TH3H 1VITH 2HNTC 1EAXA 1AWFH 5SGAE 1C2JA 2BZAA 3PLKA 4KTUA 1W12U 1RJXB 2GZ9A 2F9OA 2V3HH 1F0SA 3GISB 3KQ5A 2BMGB 3NK8A 2ALVA 2GKVE 2D8WA 3U8OH 2Y80A 2K1QA 2AERH 3GY5A 1GI1A 1VZQH 3L33A 8LPRA 4DVAU 4AX9H 4D7GA 2SGDE 1O2SA 1KXCA 2I6SA 2SGPE 2ZTZA 3ELAH 1TONA 1L4DA 1T7CA 1NBMD 1BHXB 1EP6A 4JYVH 1MZDA 1F0RA 1WSSH 2FX6A 1O5CB 4ZHMU 2J92A 4B2AA 1C4Y2 3U1IB 1O33A 4YO9A 1AO5A 5T1VA 3Q77A 1P02A 1JIMA 1MBQA 1TYNA 4TPIZ 4CRCA 4DJZB 2J34A 2ZC9H 1PPEE 3V0XA 1IHTH 2PWXA 1ZHMA 1BTPA 1TPPA 3WW7A 3TU7H 1O2JA 1J14A 1KXBA 1Z8JB 3I78A 1AD8H 1AY6H 3SU1A 1TAWA 3LONA 1ZRBA 3RXUA 5EPYA 2ZU3A 4FUIA 2QV1A 1SGRE 1XUKA 1FZZA 3MH4A 1UMAH 1TGCA 1OWJA 2BDBA 4H6SB 1KDQB 4TSFD 4MLFB 1P3EA 1CHOG 4AGJA 1Y3VA 3QTOH 2KCOA 2AEIH 1QL9A 3AASA 1F5KU 3ZVEA 9ESTA 3DSPA 1MMJN 2FWWA 1FN8A 2PR3A 4LXBH 3N7OA 4Y76A 5T6GA 5EJ1A 2FYRA 3R3GB 1OP2A 2BOKA 4OS5A 1BMFD 1FIZA 5J4SA 1C2KA 2DE9A 1LCYA 1TPOA 2JJ1D 3K6ZA 3STJA 5DG6A 1LQDB 4WMEA 5TCCA 1Y5UT 3PMAB 1GJ4H 1GHXH 1E35B 1XUJA 4IC6A 3FP6E 1KYNA 2J38A 1QL7A 1PPZA 1KXEA 1A5HA 1O5EH 4M9FA 3ZVDA 1C1TA 2OC8A 1OSSA 3SU0A 2G00A 2OLGA 3RM2H 2EY4C 2XRCA 2THFB 2C4FH 1SGEE 5TJXA 2OCVB 2ZFFH 1C5VA 3FP8E 1IQKA 4GAWA 3GDSA 3AW1A 2F43B 2R3YA 3BTEE 3RXGA 3M5LA 3UNSA 3E1XB 2BB4A 1A0JA 3UQVA 2C8ZB 1BT7A 1ARBA 1TA2A 2ZQ1A 1MTSA 4SGBE 1ELFA 3KGPA 3T62A 5F53A 2UUJB 5IK2D 5E2OA 4NZLA 1AE5A 1SR5C 1C5RA 1P2KA 3BTFE 2OC7A 3SU4A 5DP5A 2OQ5A 2BX4A 3TITA 3ZYEA 2J97A 3TH2H 3MHWU 1GHBG 4NGAH 3UR9A 2ZNKH 3TGJE 2WSSD 1Y5AT 2TRMA 4IMQA 3BSQA 5F6MA 2JJ2D 4NCYA 3I29A 1D3PB 1O3EA 4ABGA 2V0BA 1TMBH 2QGRA 1N1LA 2W3IA 4DGJA 3U8TH 5HMAA 1FV9A 4DIIH 2KR7A 2Z6BD 4X2VA 1V2NT 2LELA 1RS0A 1GHVH 1BCUH 3ZZ9A 1BRUP 6GCHG 1EATA 3VFEA 1CVWH 2BQ7B 2KM0A 2WPDD 2BDAA 2H9EH 3Q00A 3T26A 3SZNA 4RSPA 1EB1H 4YZUA 2A4RA 4B75A 2KCPA 1AFEH 2XWAA 2VINA 4HI3A 1HV7A 5C94A 1QB9A 3A8BA 3U1JB 1KIGH 2B0FA 1G36A 1EAIA 2Y5HA 1DFPA 3KNXA 4A5TS 2A4OA 1KTSB 1C1PA 1D6RA 3SNDA 2W6JD 4Q63A 1OYTH 2ODQA 4KP0A 2FTLE 2FOBA 5FXLA 1DY8A 1UVPA 3F0OA 2XCNA 1DSTA 1PPFE 1PYTC 2Y7XA 3BEUA 3SU3A 4TWYA 3ZVFA 1C5SA 5JPMH 1V6DA 5FCKA 1J16A 2ZFSA 1SGQE 5HGGA 4ABJA 1HIAB 1KXDA 2QAAA 2EI6A 2FOCA 4B71A 1UCYH 1V2OT 2TGTA 2BDIA 1O31A 5E0JA 5LGOA 4ZHAA 2HOBA 5IYTA 5JBCS 3RXMA 1GBIA 3RXDA 1KLIH 1OYQA 2KX4A 1NPMA 2HNTE 3UPEA 1A0HB 3A80A 4IBLH 4Y10E 1O2GH 1IQNA 2FI5E 1SBWA 1OS8A 1MUEB 5E0HA 3ZZDA 5AF9H 1Z1IA 3AK5A 1NU7B 1V2LT 4IN2A 3P8NA 3F1SB 3PM3A 2RDLA 2YNBA 3VPKA 2AFQB 1GJ9B 1GI4A 1ZGIA 3HKIB 3PMBB 1LHFH 3EYDA 4Y8YA 4K1SA 1O3NA 2K0QA 2OTVA 4XRNA 1QHRB 4FVBA 3LGVA 1OPHB 1PQ8A 2G5VA 4MG3A 3GCHC 4RN6A 3EA9A 3PROA 3BEIB 4Y6DA 1TE0A 3LGTA 4DT7B 4JMYA 4AORA 3AAVA 5DP9A 1EXFA 2BD7A 4ZXXH 3Q3KA 5GIBA 1TX6A 2ZIQH 1ABIH 1NS3A 4U2WA 2BHGA 2R0KA 1P0SH 3A8DA 5FPSA 2CF8H 1EPTA 1QIXB 1SI5H 1LPKB 1O32A 1LKAA 4M7GA 2FZZA 1Y59T 3AAUA 4U30A 2VB0A 3ZZ7A 3GY4A 1MQ5A 4WXIA 5C5OA 3ZZ5A 2QE7D 5EOKA 5A0AE 1ZJDA 3Q3XA 4CRFA 4D76A 2BQ6B 3MH6A 1BTXA 1K0HA 2VH6A 1ZPBA 5DO4H 1JOUB 2GV7A 1GI7B 3SJIA 2PGQB 3O8BA 2NU3E 1GMCF 1MU8B 1A7SA 4DY7B 2Z3DA 2GZ7A 3TH4H 4CRBA 2D2DA 5B6OA 2M2AA 5ESTE 1T8LA 3HK6B 3SGAE 2J94A 5AFYH 1C5WB 2CF9H 2V3OH 5I25A 4XDEA 2VH0A 5C1UA 2ZO3H 1O3KA 4NA9H 5G4BA 3TVJB 4X1PU 1GJ5H 3BTWE 2XBWA 1FY8E 3TNTA 1UTJA 2PUQH 4ZKOU 4JZDH 3EAJA 4O9VA 4P00A 1K1IA 1ARCA 4I86A 4ISNA 1A1RA 1NT1A 2R9PA 4WMFA 4CBOA 1N6YA 2BZ6H 1DE7H 1RTKA 1O34A 2ANKH 4WH8A 1BTUA 1C5UA 3A8AA 1A4WH 2PKSC 1LVOA 1HAHH 3S69A 2A7CA 2GVFA 3BV9B 3GCHB 1DWBH 1YC0A 2XC5A 2BOHB 1HAIH 3ATMA 2PUXB 1O3AA 3HGNA 3VGCC 1Z7KA 3UIRA 5EXMA 3GCOA 3A7YA 4FUJA 1IOEA 2GTBA 1TBRH 3OTPA 1EJAA 3ZZBA 2VU8E 2WUBA 3EGKH 1UHBA 4FUGA 3SORA 5GNDA 3P8GA 2FXRA 4K8YA 1ANEA 2ZF0H 1MTNC 1TGBA 1RFNA 1NRRH 1ZTLA 4F49A 1GBFA 2ZTXA 4A1XA 1BITA 1N8OC 4TPYA 3DT0H 1O2LA 3SU6A 1FPHH 3QGNB 4I8JA 1TABE 4O3UA 3SOSA 5T6DA 2C8XB 3RC4A 4UDWH 3VXFH 4B2BA 5DP6A 1QR3E 4KTSA 2R2WU 5JB9S 1YM0A 1Z1JA 1G3BA 3DCLA 4ISOA 4YESB 1M9UA 4BAQB 1EFRD 5GDSH 1WQSA 1VITG 4FOUC 1XKBC 3EA8A 4X6OA 4MNXA 4MNWA 3SO3A 1GVLA 4BXSA 1O2KA 5E8EH 3TIUA 3GS9A 1HUTH 1O3LA 1SGPE 1EQ9A 1THRH 1VCPA 1GCTC 3KHVA 2AYWA 1O3BA 4J2YB 4E06H 2A4GA 2B8OH 4IW4E 2Z7FE 1PPHE 1WTHD 5EPNA 4Y11E 4AFZA 1S85A 1C2DA 2FLBH 2P95A 4UFGH 2XNIA 4Y7BA 1OP0A 2PKSB 3PB1E 1NC6A 2HPQH 2RA0A 4YLUA 1INCA 1FAXA 5T3HA 1SLXB 2QXHA 3T28A 1SQOA 4JK6A 3AVZA 3VGCB 3BF6H 3T29A 1YYY1 3UOUA 3TJVA 4U32A 3FAOA 3H09A 5KEDA 1UTQA 2XCFA 2HPPH 2C8WB 1TNHA 1DUEA 1P03A 3KQDA 2GX4A 1DUAA 2KAIA 1P05A 1WCZA 2AGIX 2BY7X 2XBYA 4GVUA 3LOXA 1UVTH 1O2PA 2GCTC 2UUYA 4DCDA 2J5UA 1O2XA 3M5MA 3RP2A 2STAE 3P70B 4NIXA 1OHHD 2ZU4A 3MO6A 1L1JA 4GCHG 1Q31A 2R2MB 5CHAC 4RI0A 4JZFH 2A5IA 2D26C 2PSXA 2KCAA 3A87A 4K8BA 3RMOH 1AU8A 4Z1MD 2NU4E 3KL6A 2ZZUH 1HJ9A 1O3OA 2H2ZA 2AIQA 1F2SE 2ZKSA 1ZTJA 5L2YH 1P57B 1U6QA 1O2YA 3VB3A 5FX6A 2AMQA 1G2LA 7LPRA 1GDNA 5DP4A 1C5TA 1SGNE 1GHZA 3RXJA 4BTIB 2ZG0H 4BAKB 1QRWA 3MO9A 2Z94A 3NKKA 5JBAS 1DANH 1J15A 1LO6A 2CV3A 3BTDE 3S0NA 1DLKB 1O2ZA 1HAGE 1LVBA 3T25A 2QXGA 1S81A 3QLPH 2CGAA 2PTCE 2GDDA 4YLQH 5GPIB 3SGBE 1S83A 1GCTB 4BXWA 1H9LB 1MZAA 1ACBE 4UD9H 2BY6X 1O2IA 1BTWA 1Z6EA 2XWBI 3IWMA 4GSOA 3ATKA 4ISHH 3SHCH 1EPTC 1YF4A 2Y7ZA 4INHA 3T2NA 5DPAA 1AI8H 1RGQA 2H5CA 3W1EA 2J2UA 2A31A 2EQNA 2P59A 2UUKB 1C2GA 3KQBA 1QJ6B 1E38B 4TYDA 1UO6A 3A7ZA 1G30B 4X2YA 1GJ8B 1NU9A 4OS4A 2O8WA 3TK5A 1GBMA 1XKAC 3SI3H 1GDQA 4IC5A 4ACBA 1GHYH 3GICB 2TGPZ 4JYUH 5BPEA 1HXEH 2FESH 1Y3XA 3E90B 3MU5A 1G3DA 2A7JA 1SOZA 5FAHA 4Y8XA 5B6LA 1IQHA 1Q3XA 2F9UA 2WPMS 1WTGH 3LIWA 1L1GA 2R3UA 1EASA 2BDCA 1AN1E 1SLUB 2JH6D 4Q80A 2GCTB 3U98H 2Z3EA 4B6EA 1E34B 4ABHA 2OC1A 2FTMA 1NFUA 5EU8A 1GMHG 5GWZA 1W14U 1ZYOA 2QF5A 5CHAB 4GHQA 4BNRA 1C1MA 7KMEH 1PYTD 3E0PB 2FOHA 1GCDA 1GI8B 1KTTB 2QCYA 1ANDA 1DSUA 4Y8ZA 2IN2A 1RRKA 1PFXC 1DICA 1EAWA 1G9IE 1QBNA 4X1QU 1JRSA 4A1VA 3S7HB 4Q7XA 2BLVA 1GVKB 1PJPA 3CS7A 2JKHA 5C67A 1V2KT 1QURH 3SJ9A 3PV5A 1ZMLA 5C5NA 3MOCA 1DDJA 4YTAA 2WV5A 2WHXA 1ETSH 2VVCA 1VGCC 2HLDD 2AHME 5A8YA 1SC8U 1CGIE 1PQ7A 5HXFA 5EJLA 1SQAA 1TA6A 1UTPA 1YBWA 1EPTB 3F2HA 1PPCE 3LH1A 2G52A 1C1NA 5C0TA 1WBGB 4O03A 1QNJA 1UTMA 1T32A 5DSFA 3KIDU 3RXTA 2VGCC 2Y5FA 1O3DA 4JK5A 5EG4A 3FOAA 2V3MA 1ESBA 1GBTA 1B0FA 1G2MA 2P3FH 2SGAA 3PWBA 3LGYA 1G32B 4F4OC 1CU1A 1Z6JH 1SHYA 1O3JA 2Z9LA 4ISIH 2F4LA 3OX7U 1BUIA 2P3TB 3CP7A 3OFND 1C5LH 2QYIA 3FZZA 4OS7A 4ZROA 1S0RA 1TPAE 2YMSB 2OUAA 2BD8A 3TLOA 3QGJA 1MAYA 3SNAA 2KZ4A 2VBCA 1FIWA 3RXIA 1HJAB 4JZIA 4UFFH 1O38A 3EE7A 2GGVB 2V35A 2ZU5A 2G4TA 2ZFTA 3GY7A 1QZ8A 3ZZ8A 3UOPA 1JMOH 3E0NB 3M5NA 3VEQB 1SOTA 1YCPK 1ZLRA 2HLCA 3DSGA 4XFQA 2Z9JA 1F0TA 1W0YH 4OS6A 1F92A 2L74A 3BIVH 4ABAA 2W26A 4ASUD 1A5GH 1GPZA 1S6HA 2ZHFH 1AHTH 3RMMH 1HAPH 3LT3A 5K0HA 2W7SA 1MKWK 1S0QA 1T8OA 4AB8A 1A2CH 3HATH 3SJKA 5KGOA 1NM6A 3BTHE 1D6WA 1VGCB 3SNBA 1DVAH 2RG3A 3ZVBA 1W11U 2HWLB 4X8TH 1GJDB 1UHBB 2FYQA 2O8TA 3O8RA 1F5LA 3PO1C 4YOIA 1W13U 4H6TA 1Y5BT 3C27B 2BDGA 4LK4A 1UCYK 3LJJA 4MTBA 1NTPA 3TJNA 1O3HA 1O2VA 1UJ1A 3TNSA 2VGCB 4YOJA 2C3SA 2WPJS 4XE4A 3E6PH 1NRSH 3ZYDA 1O3MA 1TRNA 1SGIB 3SNEA 5E0GA 1AVWA 3Q3YA 2ALPA 1W0ZU 1TNGA 3GYMA 1PQAA 4MNVA 2GMTC 1GBBA 1RTLA 3Q76A 2VNTA 5TCAA 5EW2H 1NRPH 1CBWC 3DD2H 1NROH 3RMLH 1K1MA 1TPSA 2OXSA 2BDYA 1EKBB 2ZDAH 4CHAC 3RXHA 2WPHS 2VIQA 1SVPA 2FX4A 2Y82A 3CNRA 1SQTA 3F2GA 4FUDA 4X2XA 1AE8H 1QRZA 3M37A 2OBQA 3MQKC 1G37A 3QZRA 2ZQ2A 4OGXA 4K3JA 2XC4A 4X1RU 3TGKE 5T6FA 4ZHLU 1SGFA 3VB4A 2IJOB 3RXRA 1E1RD 2O8LA 1HPGA 1YCPH 4ZUHA 5A0BA 2AH4X 4BOHA 4H4FA 3T5FH 5FPYA 1J17T 3DHKH 1IHSH 1P11E 2FOEA 3SQHE 2VWOA 1QBVH 1TGNA 1O3CA 3P17H 2A7HA 2H9HA 1S82A 1HRTH 1K1OA 3EQ0H 1ESTA 3LU9B 5LPFA 1COWD 1LHCH 3U69H 1V3XA 3N7EA 2HVYB 1YY3A 2FS8A 3PMJA 3DFJA 4X8SH 1MKWH 1JIRA 2ZECA 4U01A 1XVOA 7GCHF 2GJGA 1T8NA 4MPUA 1UTNA 2XTTB 1P2JA 1O5GH 2BD9A 1LPZB 1XUIA 2TPIZ 2AS9A 1YLNA 1K1JA 1GBDA 1TNJA 1WXRA 3B9FH 1SLVB 2FO9A 4R0IA 2GT8A 1TWXB 2KAIB 1GI5A 3PO1B 5LPRA 5FBIA 4AG1A 1NESE 2FEQH 1C1QA 2K8IA 1QB6A 2W3KA 1H8HD 2FI3E 1VJ9U 2LP6A 2GP9B 3SHAH 1MU6B 3ZVAA 2BX3A 2F9VA 1HLTH 3OE7D 1GBEA 2VIWA 2PHBA 2P16A 1EAUA 3B8JA 1YPHC 1LTOA 1OOKB 2GMTB 3A82A 3PRDA 1WU1A 1MTWA 3CENA 6LPRA 1CBWB 1V2WT 1QTFA 2VIDA 4TWWA 1YPJH 1QY6A 1JRTA 5JBBS 2XXLA 4CHAB 2W7UA 2XYAA 4UEHH 1ZR0A 4GLYA 5CDFE 1DS2E 3WY8A 3QTVH 4X2WA 4XOJA 3UUZA 3H7TA 1O5BB 1OWIA 3RLWH 1UTLM 1S6LA 3R0FA 2NU2E 2ZDVH 1TX7A 3P8FA 2ZDLA 1TALA 2O8MA 1FQ3A 2WINI 3ZV9A 2IJD1 4FUHA 1GBKA 2QY0B 4X0WU 1ZPCA 2G5NA 4FXGH 3L6PA 3MWIU 4F48B 1UK4A 5DJ7A 1SSXA 1AVXA 3BIUH 1AUTC 1DM4B 4TY6A 4OS2A 1ANBA 1DY9A 3SJOA 1BJUA 1L4ZA 1SFQB 4LOYH 3RC5A 2YNAA 1LPGB 2Z3CA 1JXPA 3V13A 1Z8RA 1HYLA 1YPGH 3A84A 2RFKC 1DLEA 5C3NA 4CRDA 1BZXE 3GCTF 2FOAA 4XSKU 2OD3B 1O2MA 1GMDF 4NIYA 4Q7ZA 3DUXH 5C20A 1BBRK 1IQIA 1O3IA 3SI4H 1TGSZ 3H7OA 1MBMA 1VJAU 2VWNA 2ANYA 1Z8IB 4DIHH 4K69A 5LPEA 1TNIA 3U9AH 3I77A 5CMXH 2WYJA 1K9OE 1XM1A 1Z71A 1T8MA 1AB9C 1TMUH 3GY2A 5LH8A 3V12A 1O5DH 1NN6A 4A7IB 3W95A 4FU8A 2ZPQA 4JZ1A 1YPKH 1KLTA 3LDXH 1SL3A 3BTME 4NFEA 3VB6A 3M61U 1ZPZA 5C2ZA 2TBSA 5C0UA 3MI4A 2SNVA 1IQGA 1GJBB 1LHGH 1YLCA 2F83A 2OK5A 4X8VH 3BG4C 4CR9A 2NWNA 3F68H 4KELA 1P2NA 1PPBH 4Z6AH 1D3TB 3KEEA 3A7WA 1FDPA 4ZXYH 4ABDA 1G3CA 3RXAA 1UTOA 1GHAF 2CMYA 3SV6A 1VR1H 4F55A 1DWEH 4JZEH 1ZTKA 4K5ZA 1BA8B 1X7AC 1YPLH 1CE5A 4BTTB 1LQEA 3UB0A 4E7NA 1LHDH 2BDHA 4INLA 1H8DH 2SFAA 4IS5A 3ODDA 4XBCA 3KYFA 3W94A 4OM9A 1FONA 3SQEE 1UK3A 2STBE 1F5RA 4HFPB 3E8LA 2FDAA 8GCHF 3BTQE 3L3TA 1A0LA 7ESTE 1FN6A 1HB0B 1HAYB 5GCHF 4RT0A 2L6OA 1AKSA 1T31A 1BBRH 3LGIA 3NCLA 1P2IA 3UREA 1TX8A 2FODA 4K1TA 4WMDA 1XVMA 4KGAA 3SV2H 1CA0C 1TQ0B 2AMPA 1P9UA 1Z8GA 1J9CH 1W10U 1O3PB 1AB9B 1C1OA 1BOQA 3MFJA 1GI0A 3RXVA 2EI7A 3DSOA 3MU8A 1ELDE 1G3EA 4UFDH 1GJAB 2FI4E 3MNXA 1GBLA 3RLYH 1C1RA 2J98A 4WY3A 2BD2A 1EX3A 1C2HA 2TIOA 2ZHDA 2P8OC 4VGCC 1GBHA 4DG4A 5HYOA 5FBEA 1IQEA 1ORFA 3A83A 3F2FA 1C2MA 4CREA 3BG4B 4INKA 1TFXA 1RXPA 3CS0A 2ZGHA 3PLPA 1A5IA 2V7QD 1K1LA 3FANA 5F03A 4I7YH 1O2UA 3ATIA 1WUNH 1AVGH 1CA8B 2SNWA 1LKBA 1FI8A 1ETTH 4A6LA 2Q6GA 2PW8H 1ID5H 3MO3A 2KFWA 1RD3B 2ZU1A 4JCNA 3A7XA 3GCTG 1EOLA 3KQCA 3O8DA 4D9QA 3H5CB 3RU4T 4ISLA 3K9XB 1HNEE 2F9BH 4AZ2B 1YLDA 3OY5U 2CN0H 4O97A 4B6FA 1FXYA 8KME2 4DW2U 3LGUA 3PRBA 1GMCG 1O36A 3QN7A 1O2TA 2A5AA 3SYJA 1FPCH 3K65B 3F9EA 1YPHE 5JYIA 5EGMA 1WQVH 3SBKA 3F6UH 2VVVA 3BTGE 1FY1A 2SGEE 2BY9X 5EQQA 1SQRA 1CHOF 4HGCA 1CA0B 1ZMNA 3GY8A 3PV2A 1W0KD 4J1YA 2F9NA 2JH0D 2ILNA 4Q7YA 4Q4LA 3NZIA 1LHEH 2Z9IA 2ODYB 1EZXC 2Q1JA 1C5PA 1MAXA 3RXBA 5EXLA 2P8OB 1KXFA
chains in the Genus database with same CATH topology
1BJVA 1OWHA 2CHAB 4VGCB 3SV7A 2AGEX 1NFYA 2JIZD 1CSOE 2A4QA 3ZV8A 4YT7H 3FKSD 3UWJH 3PTBA 3UNQA 2G8TA 1RTFB 1BMLA 2WPKS 4NFFA 3P95A 4RKOB 1MD7A 1UK2A 1GJCB 1UVSH 2W6ID 3SZEA 1K1NA 1K21H 1W7GH 2HGTH 4TY7A 1OWDA 2YMSC 3GCNA 2H6MA 1TBQH 3MU4A 3K2UA 4KTCA 4I31A 4BAHB 2WZQA 1CGHA 1HJAC 4CRGA 3M36A 2OQUA 3F9GA 2TGDA 1ELGA 1MQ6A 2SGFE 3F9HA 3MH7A 3M7QA 1HAZB 3O8CA 2PKAA 2ZTYA 4WF8A 4A1TA 1P9SA 2WPLS 3E3TA 4OGYA 5A0CA 4ASHA 1TLDA 2D1JA 2A1DB 2VWLA 1GHBF 1VCQA 3GDUA 4MVNA 3UFAA 1AQ7A 2WUCA 1D3DB 1H4WA 4DURA 2O8UA 4CR5A 1Q2WA 3ZVGA 1ZSKA 2BLWA 3S9CA 1ELVA 1JBUH 3NUMA 1HJ8A 2BXTH 1A3EH 3STIA 3RXEA 1H9HE 3N7DA 3GYLB 1C1VH 1OP8A 1XUHA 4Q2KA 1P3CA 1MD8A 2WPIS 4I32A 1SFIA 1QFKH 1P06A 5FX5A 2R0LA 5A2MH 1P09A 4NWLA 3QX5H 1MABB 6GCHF 2KCYA 2A2QH 3SN8A 2C93B 2ZGBH 1GG6C 5FPTA 3A7TA 3QK1A 3E91A 1PPGE 1VCWA 1YKTA 3MNSA 2BLQA 5BRRE 2GCHF 2H5DA 3E16B 2GT7A 1K2I1 5DP8A 8ESTE 3PYHA 4IN1A 4NSVA 1ZOMA 1ZMJA 3FFGA 1HXFH 3GY6A 3D62A 9LPRA 1ZGVA 3RC6A 3RXFA 2J95A 2IPHA 1EOJA 5AHGH 5HKKD 1K28D 1OKXA 1SMFE 2A2XH 3QZQA 1P01A 2G51A 1V2QT 1V2TT 1BB0B 3OEHD 4BAOB 3RXQA 1NFWA 1T4VH 5FL7D 2ZI2H 4H42U 4AYYB 4NZQA 2ZGCA 2GV6A 1BMMH 1W2KH 3LPRA 3GDVA 5AVDA 1D3QB 1CO7E 3PTNA 1ZJKA 3GOVB 5HM2A 2BLOA 2BVSH 2EC9H 2C8YB 2RCEA 1GJ6A 4YT6H 5C1YA 5A09A 1FLEE 1C4V2 2RA3A 2ZHEH 1MCTA 2A5KA 1FY4A 2DE8A 3RXKA 1FMGA 2BQWB 3M3TA 3WWFA 3VG8A 3MU1A 1H8IH 4YOGA 1C1SA 1Y3WA 1GDUA 1E0FD 1EZSC 4HZHA 2V6NA 3RUOA 1E79D 3D49H 3TPIZ 5C17A 3MNCA 3T27A 1CT2E 5E2PA 1W3CA 1RIWC 3LC3A 4THNH 2NU0E 2BD5A 1SB1H 4XBDA 3HK3B 4BANB 2QIQA 2BM2A 3BG8A 3LKWA 1P8VC 1B5GH 4YM9A 1TNLA 2FP7B 2G55A 1THPB 3K6YA 4ZH8A 1C2FA 3QDZB 1EJMA 4AYVB 6CHAC 2PTNA 3F9FA 3MU0A 2Y5GA 4Y0ZE 1DOJA 2AMDA 1GG6B 2EI8A 1C5NH 3D23A 1DX5M 4ABFA 1V2RT 1ZSJA 1W7XH 4WXVA 2QF3A 1IQMA 1FJSA 2I6QA 4FVDA 4X1SU 1KY9A 1TQ7B 5EQRA 2Z9GA 2PLXA 1CGJE 2OC0A 3ZVCA 2UWLA 1HAVA 1DXPA 1P04A 1AKSB 1QA0A 1GWAA 3MH5A 2XBVA 2ANMH 1NY22 2BYAX 1O30A 5EXNA 2ZPRA 1UVUH 4RKJB 3P6ZB 3F0PA 2FLRH 1TIOA 2A45B 1QQUA 1IQFA 5DK1A 4DOQA 3KCGH 4FUEA 4JYTA 3SNCA 1D9IA 4ESTE 2JETC 3BEFB 3M3SA 1YGCH 1DWCH 1NO9H 4CRAA 1ELTA 2BVXH 2WV9A 1C5XB 1AZ8A 2LPRA 2ZU2A 3A85A 1FAKH 3MYWA 2ZDMA 3SUEA 1OXGA 3OEED 2AGGX 1FY3A 3NRLA 4I33A 1W8BH 1GVZA 3SUGA 4BTUB 5HM9A 2BY8X 1GBAA 2ZCLP 2H1UA 3S7KB 3HGPA 1F0UA 1C5ZB 1AGJA 1O5FH 3A81A 3RXSA 2F3CE 1NRNH 3AW0A 1RIWB 1DXWA 4AFUA 2QF4A 3A88A 1S5SA 5ETXA 2QN5T 3PV4A 4LZ4B 4WWYA 3GY3A 1QL8A 5AFZH 1TB6H 4ZCNA 2FPZA 4KKDA 4MNYA 2GCHG 2SGQE 1B0EA 3IITA 2ZEBA 1C1WH 3NXPA 1ANCA 1TBZH 4ZMAH 2VJ1A 3UQOA 6CHAB 4K60A 2P3UB 1EJNA 5J4QA 4K2YA 1J8AA 3ESTA 3P8OA 4UFEH 1E1QD 2Q6FA 3IG6B 2OP9A 1OWEA 4ZKNU 5FHTA 1SHHB 5ABWA 2BTCE 1W0JD 1BIOA 1EB2A 4ZKSU 3V7TA 1C5YB 4AG2A 2QF0A 2FMJA 3M35A 1ELCA 1HGTH 2G81E 4WJG2 4Y7AA 1C5MD 2O9QA 5DP3A 4FU7A 5EODA 3FZDA 2H9TH 1SPJA 3VB5A 1P2MA 1GI6A 5DP7A 3SV9A 1BTYA 3EE0B 2PSYA 2ZPSA 2HVXA 4FU9A 1C2EA 1FY5A 2JETB 1THSH 4DT4A 4X6NA 1P2OA 1LVYA 5H4IB 1ESAA 1IAUA 2QC2A 3ENSB 5ESBA 3RXLA 3UTUH 4NSYA 4AN7A 4R8TB 1K1PA 1LDTT 4QT8C 1BMNH 1WAYB 1EZQA 2UUFB 1FUJA 2G4UA 2ANWA 1QA7A 1HFDA 1QCPA 5A8XA 1VITF 2VIOA 1SG8B 1ABJH 5K7RA 1QJ1B 3FO8D 1C9TA 3C1KA 3URCA 3ZZCA 4SGAE 1XXDA 1ELBA 2J4IA 4E05H 1CT4E 1EUFA 4D8NA 1S6FA 3VB7A 1XUFA 3RDZA 1L1NA 3SU2A 1F7ZA 4CH2B 1O2NA 3ITIA 1E37B 1BHXF 2IOTA 2Y6TA 1LMWB 1DITH 1TRYA 1A46H 5DKMA 3ZZAA 2PGBB 3RXCA 1SLWB 4MQAA 1QQ4A 1O39A 1P12E 1XXFA 1GJ7B 2BVRH 1Y3UA 2FOGA 2UWPA 3RU4E 3KF2A 2M5TA 3P92A 1Y8TA 5A8ZA 3KQEA 2TGAA 5DGJA 4ABIA 5CE1A 2PKAB 2WYGA 1HDTH 3RXPA 2P94A 1H9IE 1V2ST 1SGDE 1O35A 1A61H 3OU0A 4MPVA 3RXOA 1KDQA 3A89A 1S84A 1O0DH 2ZGJA 4NG9H 3OYPA 1QB1A 2ZGXH 1T4UH 4NA8A 4K1EA 4B73A 1C2IA 1O3GA 1YCPM 1ELEE 4B1TA 4GCHF 2ZWLH 4I8HA 2J9NA 1ZSLA 2XC0A 1NFXA 3D65E 1YPEH 3HPTB 2ZHWH 3OTJE 2ZA5A 1CT0E 2YMSD 3JZ1B 1MTUA 3S9BA 2XNDD 2BXUH 1SGFG 1V2VT 4X8UH 5EW1H 4XD7D 3ZIAD 3FVFB 1TOMH 3KN2A 3LJOA 2LNCA 4A92A 1TOCB 1C5OH 4GHTA 4I8KA 3TK9A 1C9PA 1O2OA 3ATWA 4FUCA 1GI3A 3WWBA 2HNTF 3U8RH 2HALA 2PFEA 3JZ2B 7GCHG 3RM0H 2VWMA 1CQQA 1QJ7B 3UY9A 1KMHB 1PQ5A 1O5AB 4NIVA 1E36B 4X1NU 1MTVA 3M5OA 3UWIA 4ZKRU 5PTPA 4TT3D 1UCYE 4WH6A 2FOFA 3ZZ6A 1MCVA 3F3BA 2P93A 5I46H 4Z0KA 1HCGA 2AIPA 2QXIA 5DN6D 1AIXH 3SW2B 3ZZ4A 3FP7E 1O2WA 4I8LA 4ABBA 2OINA 1SKYE 1OWKA 3EA7A 1MH0A 3B23B 3OSYA 4XBBA 3SV8A 3LH3A 2YOLA 3LC5A 4AFQA 2ZHQH 2XBXA 1KXAA 2VIPA 4O3TA 5CHBA 1P2QA 3ODFA 3UR6A 2HRVA 2DUCA 3SUDA 5L30H 2F9PA 1GGDC 1A3BH 1FX0B 4HTCH 2FS9A 3URDA 1HBTH 2ZDNA 1GMHF 1ETRH 1SGCA 3ATLA 1C5QA 2CHAC 2CXVA 2ZCKP 1MKXK 1H1BA 2ZCHP 4GUXA 2BD3A 4LZ1H 2JH5D 3RU4D 4AGKA 2FOMB 1TNKA 2EEKA 1OX1A 4Y79A 4Y71A 4I8GA 5L6NH 3MMGA 4B2CA 4FUBA 2B5TB 2XOKD 1AMHA 1DT2A 1HAXB 4MDSA 1GHWH 1YP9A 2GD4B 4E7RG 4UONA 1GBJA 3UNRA 1XUGA 2CK3D 1BRCE 1DWDH 4X6MA 3FN8A 1ELAA 1WYKA 1V2JT 2Y81A 3NWUA 1ZHPA 3BTKE 1TRMA 1TMTH 2QXJA 1D4PB 5JDUB 3QWCH 3QUMP 2ZDKA 1DPOA 1BTHH 2C90B 1BMAA 3LGWA 2NU1E 5IDKA 3MNBA 4Y0YE 4ZAEA 1AZZA 1JWTA 1GMDG 1AFQC 4FUFA 1B7XB 4YXWD 1N6XA 1Y3YA 2EA3A 3TJUA 1EP5A 1HAVB 1L0ZA 2F91A 1ZRKA 2OBOA 5F8XA 4CBNA 5EQSA 4MPWA 1BDAA 4FETA 3TGIE 3SJ8A 2A0QB 2W5EA 3VXEH 4NIWA 2WV4A 5FCRA 2CJIA 5F8TA 1SGYE 2A32A 1C1UH 2GZ8A 5GXPA 1QBOA 1NBME 2XW9A 1GI9B 4B74A 4D7FA 2ZFQH 4BAMB 1HIAA 3G01A 1H8ED 3BTTE 1WOFA 1MTNB 1P10A 2ASUB 3QO6A 1O37A 5F8ZA 3DA9B 3PWCA 5JB8S 2Q6DA 1NZQH 1V2PT 5L2ZH 4D9RA 1BRAA 1N8OB 1EZUC 1BRBE 1O2QA 2B9LA 2ZFRH 1C2LA 3V3MA 3OAAD 3BN9A 3HKJB 4AFSA 4NWKA 1BTZA 2BY5X 1GGDB 1WV7H 1QGFA 1YPMH 1IQJA 1GBCA 3A8CA 3N99A 3PMHB 1AUJA 1MKXH 2VIVA 2Z9KA 3DFLA 1GHAG 2ESTE 2B7DH 1XX9A 1C4U2 1L2EA 1BQYA 4IMZA 1ZHRA 1IQLA 3MTYA 1V2MT 1SGTA 4OS1A 3SGQE 4UE7H 3SU5A 3NPSA 2VVUA 2ZFPH 3M7UA 1LVMA 8GCHG 4GPGA 2FIRH 2FM2A 2PV9B 4CH8B 4X6PA 5JBTA 2ULLA 1K22H 1O2RA 2BD4A 1UTKA 5GJ4B 1AWHB 1GL1A 3SUFA 3TK6A 4AOQA 1HAOH 3OY6U 5C1XA 1NRQH 2ZP0H 5GCHG 2UWOA 4NA7A 1BBRE 1TGTA 1AFQB 1O2HA 4IGDA 3S9AA 3TJOA 3M7TA 1KLJH 4AB9A 6ESTA 4MPXA 3A7VA 1UVOA 4B76A 2JDID 1V2UT 1ZZZA 1FNIA 2GDEH 1QRXA 3M3VA 4PROA 3RMNH 1KSNA 1GI2A 2ODPA 3PLBA 4WVPE 1XMNB 4ABEA 2QA9E 3A86A 3EDXB 1O3FA 1CHGA 1GL0E 3ZZ3A 3TH3H 1VITH 2HNTC 1EAXA 1AWFH 5SGAE 1C2JA 2BZAA 3PLKA 4KTUA 1W12U 1RJXB 2GZ9A 2F9OA 2V3HH 1F0SA 3GISB 2BMGB 3NK8A 2ALVA 2GKVE 2D8WA 3U8OH 2Y80A 2K1QA 2AERH 3GY5A 1GI1A 1VZQH 3L33A 8LPRA 4DVAU 4AX9H 4D7GA 2SGDE 1O2SA 1KXCA 2I6SA 2SGPE 2ZTZA 3ELAH 1TONA 1L4DA 1T7CA 1NBMD 1BHXB 1EP6A 4JYVH 1MZDA 1F0RA 1WSSH 2FX6A 1O5CB 4ZHMU 2J92A 4B2AA 1C4Y2 3U1IB 1O33A 4YO9A 1AO5A 5T1VA 3Q77A 1P02A 1JIMA 1MBQA 1TYNA 4TPIZ 4CRCA 4DJZB 2J34A 2ZC9H 1PPEE 3V0XA 1IHTH 2PWXA 1ZHMA 1BTPA 1TPPA 3WW7A 3TU7H 1O2JA 1J14A 1KXBA 1Z8JB 3I78A 1AD8H 1AY6H 3SU1A 1TAWA 3LONA 1ZRBA 3RXUA 5EPYA 2ZU3A 4FUIA 2QV1A 1SGRE 1XUKA 1FZZA 3MH4A 1UMAH 1TGCA 1OWJA 2BDBA 4H6SB 1KDQB 4TSFD 4MLFB 1P3EA 1CHOG 4AGJA 1Y3VA 3QTOH 2KCOA 2AEIH 1QL9A 3AASA 1F5KU 3ZVEA 9ESTA 3DSPA 1MMJN 2FWWA 1FN8A 2PR3A 4LXBH 3N7OA 4Y76A 5T6GA 2FYRA 3R3GB 1OP2A 2BOKA 4OS5A 1BMFD 1FIZA 5J4SA 1C2KA 2DE9A 1LCYA 1TPOA 2JJ1D 3K6ZA 3STJA 5DG6A 1LQDB 4WMEA 5TCCA 1Y5UT 3PMAB 1GJ4H 1GHXH 1E35B 1XUJA 4IC6A 3FP6E 1KYNA 2J38A 1QL7A 1PPZA 1KXEA 1A5HA 1O5EH 4M9FA 3ZVDA 1C1TA 2OC8A 1OSSA 3SU0A 2G00A 2OLGA 3RM2H 2XRCA 2THFB 2C4FH 1SGEE 5TJXA 2OCVB 2ZFFH 1C5VA 3FP8E 1IQKA 4GAWA 3GDSA 3AW1A 2R3YA 2F43B 3BTEE 3RXGA 3M5LA 3UNSA 3E1XB 2BB4A 1A0JA 3UQVA 2C8ZB 1BT7A 1ARBA 1TA2A 2ZQ1A 1MTSA 4SGBE 1ELFA 3KGPA 3T62A 5F53A 2UUJB 5IK2D 5E2OA 4NZLA 1AE5A 1SR5C 1C5RA 1P2KA 3BTFE 2OC7A 3SU4A 5DP5A 2OQ5A 2BX4A 3TITA 3ZYEA 3TH2H 3MHWU 1GHBG 4NGAH 3UR9A 2ZNKH 3TGJE 2WSSD 1Y5AT 2TRMA 4IMQA 3BSQA 5F6MA 4NCYA 2JJ2D 3I29A 1D3PB 1O3EA 4ABGA 2V0BA 1TMBH 2QGRA 1N1LA 2W3IA 4DGJA 3U8TH 5HMAA 1FV9A 4DIIH 2KR7A 2Z6BD 4X2VA 1V2NT 2LELA 1RS0A 1GHVH 1BCUH 3ZZ9A