3WWFA

Crystal structure of the computationally designed pizza2-sr protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
82
structure length
82
Chain Sequence
NTQTVLPFTGLNTPSGVAVDSAGTVYVTDRGNNRVVKLAAGSNTQTVLPFTGLNTPSGVAVDSAGTVYVTDRGNNRVVKLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational design of a self-assembling symmetrical beta-propeller protein.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords pizza2sr-pb protein
total genus 10
structure length 82
sequence length 82
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.500 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3wwfA00
5CHBA 3WWFA 4ZCNA 5F53A 3WWBA 3WW7A
chains in the Genus database with same CATH superfamily
5LH8A 2ZKSA 3AW0A 1P2OA 4CRAA 4DCDA 1O30A 2P3FH 5EJ1A 1YLDA 3KIDU 1QHRB 1O3PB 3UNSA 1SOZA 2P3TB 1T4VH 1A3EH 2BDBA 2GZ8A 3DSOA 1L0ZA 5E0GA 2UUYA 4NFEA 1HPGA 1E36B 1XUIA 1T32A 4BXWA 4DURA 1PPEE 2BDHA 2P16A 3D65E 1O3NA 1GBHA 1CHOG 1K1OA 2JH0D 4A92A 1KXAA 2PGBB 4U2WA 3PWBA 4XBDA 4D8NA 1EPTC 1PPCE 1QL8A 4UONA 1BIOA 1FN6A 2BDGA 4ZHLU 1H9LB 2AS9A 2XBVA 1WUNH 5KGOA 1WXRA 4BTTB 2BXTH 2ZPRA 3V3MA 1G3BA 2VU8E 3LGWA 2H5DA 1QJ7B 4HGCA 1O2MA 4CRBA 2KR7A 4JYVH 4WF8A 1V2TT 4AYVB 3QZQA 2A4OA 3Q76A 3UQOA 3MNSA 1AB9B 1DWCH 3QX5H 4X1NU 3ZV9A 1W10U 3WY8A 1ZSJA 1Z8IB 1HGTH 1Y3WA 3SU4A 3K6YA 1PPHE 3ATWA 4J2YB 4ZCNA 3TNSA 3D49H 1VGCC 2GGVB 1TQ0B 3SGBE 1GHZA 1WSSH 1UHBB 4OS1A 2K8IA 1A4WH 1DM4B 1VCQA 3RXMA 1GBKA 1YGCH 2GCHG 4NWKA 3RM2H 1P2KA 2FM2A 1NT1A 1AKSB 1C1MA 4YLQH 1EAXA 1TGTA 1EX3A 3Q3XA 1SLXB 4HG6A 4CRDA 1S0QA 3HGNA 4DVAU 1NFYA 3M7QA 2NWNA 2GV6A 3QK1A 3FN8A 2V3HH 1HAYB 3KEEA 1AVWA 4IN1A 3CP7A 4M9FA 1NC6A 1G3DA 1AFEH 2BLVA 1AI8H 5JBAS 4UFEH 2GCTC 1BOQA 3E1XB 5DP3A 5GDSH 1EZQA 4X2YA 1QRWA 6CHAC 2XCNA 2ZU5A 5T6DA 4B2BA 1ESAA 1KXFA 1ELCA 2BYAX 4MG3A 5A09A 1S85A 3TITA 1CHGA 1JRTA 1O2IA 2A32A 1MTSA 2CMYA 2ZTXA 3IWMA 1P2JA 2STBE 2GKVE 1K1IA 3ZVFA 4AGKA 2WYJA 4HZHA 1MD7A 2ZI2H 4JZIA 2VGCB 5C94A 3SU6A 4BAHB 1DT2A 1AZ8A 1GJ6A 1TPSA 1EAWA 1O2XA 2GX4A 5DP8A 5E8EH 9ESTA 5CDFE 5EJLA 5AVDA 3M3VA 1HJ9A 2P8OB 4OS6A 4AB8A 4FUCA 3TGKE 1P2MA 1WBGB 3JZ2B 3TVJB 1C5WB 1C1TA 2SGAA 3RM0H 1ZTLA 1LVOA 1CBWC 2FIRH 3B9FH 2C90B 1F2SE 5GJ4B 5A2MH 3KGPA 1B0EA 1D6RA 5DGJA 2PP6A 2VJ1A 2ZGXH 3NPSA 4GHQA 1GJ4H 1HAVA 1OWKA 1UVSH 3V13A 3OAAD 4TY6A 1H9IE 3T2NA 4AGJA 2QF0A 2J98B 4Y8ZA 1NBMD 4Y8YA 3F0OA 3SUDA 2BDAA 3UIRA 3RXTA 1K9OE 1P8VC 7GCHF 5L6NH 3PLBA 4MPWA 2O9QA 2QAAA 5GIBA 1O3CA 3A80A 3FO8D 1AIXH 1KLTA 3DD2H 5EW2H 4UFFH 1SGTA 2TIOA 3M61U 4ABAA 3LGTA 5FX6A 4JYUH 1NFWA 1H8ED 4FUBA 4JYTA 1O5DH 3GY3A 3MU5A 1QURH 3VG8A 5EXNA 1QFKH 2ZGHA 2BY6X 1A5GH 1BTWA 1GDUA 1SMFE 1O2SA 4AZ2B 4Q80A 3UOUA 3RXJA 5EPNA 3T62A 1T8OA 1P9UA 3ZZAA 1KXCA 1MAYA 2OC7A 4IBLH 2XC4A 4X2XA 2BXUH 1K1NA 1CA0C 3RXOA 2KCYA 1O31A 3AVZA 1RXPA 3A8AA 3MU8A 2G51A 1YPKH 1VZQH 2AGGX 1M9UA 2QGRA 1UW7A 4WMDA 5A0AE 2GZ7A 3URCA 1ZGVA 1INCA 4F4OC 1SGFG 1GMDF 4RKJB 2XOKD 2OINA 3BEIB 3A8CA 1QBNA 4RT1A 4P00A 1HDTH 1YYY1 1C5PA 4NWLA 1BRUP 3STJA 1TRNA 1W0ZU 3LH1A 2R3YA 3UOPA 3A8DA 7GCHG 2G55A 1F0TA 3A82A 4IC6A 2ZTYA 1N6YA 5I25A 1UTKA 3HATH 4YOJA 5FBEA 4VGCB 5PTPA 4TT3D 1IHTH 1TABE 3M7TA 2JJ1D 1C1PA 1GCTC 1BA8B 3S7HB 4K8YA 1YPEH 5LPFA 1DE7H 1TONA 3FFGA 5BPEA 2FPZA 1O2LA 1G32B 3UREA 1UVPA 1Z1JA 1GI2A 2UWOA 4X8UH 4NSVA 3K6ZA 4OS7A 1UTNA 2ZFSA 1BZXE 3C1KA 3SN8A 2J98A 2C8XB 3SJ9A 4AB9A 3RP2A 3UWIA 2SGEE 1RIWC 1O2OA 4AC9A 1KMHB 1XM1A 3F68H 1LPKB 3STIA 3U8OH 3SNDA 4CRCA 3E91A 1Y3UA 4J1YA 4Y11E 2HNTF 3ENSB 1CSOE 1DLEA 1XUGA 3A88A 1DY8A 3A7WA 4R8TB 1CA8B 1VJAU 2ZFTA 1W14U 3RMLH 1O5EH 3RXFA 3SHAH 1AE5A 3E0NB 2FOGA 3VEQB 2NU2E 4I7YH 1O2PA 1GBDA 2L74A 4MNXA 3AW1A 1LVMA 3M5MA 1OSSA 1TA6A 1QQUA 3P8GA 4Y0ZE 4GCHG 4LZ4B 1AWFH 1XMNB 4IC5A 1ZMNA 1LHDH 2SGDE 2VIOA 4D76A 1CU1A 2VB0A 1VCPA 1BHXF 3OE7D 1GBEA 3A7ZA 4X1PU 3W1EA 1KDQB 3N7DA 1NRQH 1QL7A 3A7XA 1HXFH 1SGNE 2A31A 2CF8H 2STAE 1GJ5H 1GDNA 3OYPA 1RTKA 1DFPA 2UUFB 2FZZA 3MWIU 1SGPE 3GY7A 3PV2A 1C5OH 1K1PA 3CNRA 4Q7ZA 1C1WH 2OQ5A 1OHHD 1SG8B 2A45B 3MTYA 4NIWA 1HUTH 1O2JA 2Y7XA 3SO3A 4IW4E 2C8YB 3GOVB 5LPRA 1AGJA 1QB1A 1K1MA 2Y82A 1UJ1A 2R2WU 5EIYA 2F9UA 4CBNA 1MCTA 1WU1A 3PB1E 1OKXA 3RU4D 1LHFH 1J8AA 1EZXC 2AIPA 4I33A 2BVXH 4A1VA 2ZU4A 2EA3A 2F9NA 1THRH 5C67A 4CH2B 3BN9A 1QCPA 4I8HA 1TWXB 4X2VA 2Z9LA 1T31A 3Q3KA 2PW8H 5B6OA 4Y76A 5JBCS 1HIAB 2VGCC 5GNDA 1AQ7A 1LMWB 2KFWA 2OD3B 1O3IA 1LHGH 2PGQB 4WMEA 1GJ7B 4ZUHA 1IQNA 1D6WA 3RXHA 4AFSA 2JH6D 3LGUA 2AIQA 1SGFA 1NFUA 1MH0A 4NIVA 4RI0A 3ODFA 4WH8A 1GGDC 2J4IA 1CVWH 5I46H 1KDQA 1QA0A 3FANA 3BEUA 1TNKA 4AORA 2XCFA 1GVLA 1SQOA 1V3XA 2JETB 5DP4A 3BTEE 1DLKB 3OY6U 1OWIA 1KXBA 4INHA 5C1YA 1O0DH 3SU2A 1FIZA 5H4IB 4UFDH 2RG3A 2QN5T 1XKAC 1F7ZA 1ETSH 1QTFA 3F9HA 3UAIC 1O3KA 2WV9A 2O8UA 3EA9A 1LDTT 4FVBA 3BTFE 1GI5A 1OOKB 4TPYA 1PFXC 2ZPQA 3SUGA 2CHAB 4O3TA 1E37B 2A2QH 2QXHA 3OFND 3T28A 5DN6D 3P17H 4NA9H 1O3OA 1Q31A 2IOTA 4MVNA 2RDLA 3BTTE 1PYTD 1V2KT 2JETC 1D9IA 2ZU3A 1AHTH 4TY7A 1NESE 4IMQA 1UTLM 1ZOMA 3RXIA 4OS2A 1T7CA 2GP9B 5J4SA 2Z94A 3QN7A 2B7DH 1BTXA 1HIAA 4I31A 4AX9H 1EAUA 2ZP0H 2EI8A 3A7VA 3M3TA 2XRCA 3ZZ5A 1SVPA 4AYYB 3SYJA 1KYNA 1F5RA 2V7QD 3BG8A 1O3MA 1IQMA 2GZ9A 3ZZ9A 1ZRBA 4XOJA 2PKAA 1GMCF 1S6FA 1Z8JB 2I6SA 2L6OA 1NPMA 1K0HA 1HAGE 3TH3H 1C2IA 2AMPA 1ELEE 3OEHD 1XVMA 2CN0H 1K28D 4BAOB 3SJOA 2BOHB 1TPPA 1UK4A 4B74A 2TGPZ 3BIVH 5BRRE 2AMQA 3DSGA 3S0NA 4O97A 1DITH 4AN7A 1O2HA 2K1QA 1GDQA 3LGVA 3NWUA 3PRDA 4X1RU 1XXDA 1KTTB 3LIWA 1E1RD 1MABB 4ACAA 2D2DA 1V6DA 4ZMAH 1O3AA 3NZIA 3F1SB 1OYTH 4YOIA 4KTCA 1TQ7B 3RXSA 3FP6E 4E05H 3GDUA 1MQ6A 4UDWH 3SZNA 1DOJA 3ZIAD 3M36A 1NY22 4HFPB 1KLJH 2CF9H 1AWHB 3BG4B 1AY6H 2HGTH 4F55A 2OBOA 1W12U 4GAWA 3WWFA 1B0FA 1P2IA 2VVVA 1FZZA 3LONA 1P03A 3LT3A 2GMTC 1WV7H 3SJKA 3E8LA 2QXJA 2HPPH 3L6PA 1UTQA 1TMBH 2A1DB 3SI3H 1S83A 1KIGH 3MHWU 3RMNH 2ZFFH 4BAMB 4MPVA 4Q7XA 4GPGA 1PPZA 4ISOA 1Y5AT 1E34B 2J9NA 1GJCB 1NRRH 6LPRA 4SGAE 1A5IA 1ABJH 1TPAE 2FEQH 1P2QA 2YMSC 6CHAB 2TGDA 1J17T 5DPAA 3SGQE 3ZZ3A 4Y6DA 3DUXH 4TYDA 3QZRA 3MNXA 3KYGA 2BD5A 4YLUA 1NN6A 5F6MA 3VGCC 1A5HA 5GCHG 1FQ3A 1TALA 1FX0B 3IG6B 3VB3A 2ZNKH 4ABFA 3VB5A 1GHAF 1ACBE 1HBTH 1OWHA 3ELAH 3U1IB 1DICA 5EG4A 1G2LA 4SGBE 4BANB 1THPB 4OS4A 1O2QA 5FAHA 4R0IA 4ZXXH 1EQ9A 3RC6A 3TK9A 2BD4A 2FLBH 5T1VA 3SBKA 2BD7A 4ISIH 3U28C 1S5SA 1HJAC 1X7AC 1CT0E 4U32A 1UVUH 1QBVH 1LHEH 1DSTA 1BUIA 2FI3E 1H1BA 5JYIA 2JJ2D 1L2EA 1GJBB 1L1GA 1IQFA 2BB4A 1ZMJA 1ZJKA 3D62A 1BB0B 1GG6B 5C1XA 1QGFA 2ZFRH 2ODYB 1EAIA 1O2VA 3UQVA 1TIOA 1F0SA 3OU0A 1ZHPA 3LOXA 3FP7E 5ESBA 3MNCA 1XKBC 3L3TA 2W26A 4CBOA 1TB6H 3M35A 1SL3A 1WYKA 1C2HA 3BTME 1ELTA 1B7XB 1MTUA 2BMGB 2BY5X 4ZROA 1Y5BT 1W11U 3CENA 2F9PA 1H8HD 1MU8B 1QL9A 5JBBS 1RGQA 1EOJA 1NU9A 4FUIA 1BTYA 1F5LA 5JB8S 1T8LA 3ZVEA 3OEED 3N7OA 1SFQB 1L1NA 1O3HA 1JRSA 2PR3A 3F0PA 5DP7A 3RXQA 1HYLA 1IAUA 5G4BA 5J4QA 1A7SA 3B8JA 1TE0A 1E35B 2Y7ZA 3RDZA 1GHVH 2H2ZA 3LDXH 1V2QT 3FZZA 1ZJDA 5L2ZH 4KP0A 1DY9A 1EKBB 1AZZA 1SGDE 4LOYH 1KY9A 2WPLS 1NRSH 3SI4H 1O2YA 1MTVA 2BY8X 4CHAC 1BMMH 1W7XH 4JMYA 4ZKOU 3MOCA 2OP9A 3PM3A 2ANKH 1FY4A 3VFEA 1DWBH 1BBRH 1MTWA 2OLGA 5FL7D 2ASUB 1O37A 1T8MA 4K1EA 1TPOA 1EB2A 2QC2A 1VITH 5EU8A 4ZKRU 3T29A 7KMEH 5JPMH 2YNBA 5DG6A 1EATA 2ILNA 2ZFPH 1G30B 1F92A 1HAZB 3PV4A 2BZAA 3S69A 1SQTA 3LC5A 3BSQA 1ESBA 4WXVA 1Z6JH 1GI7B 3M5OA 4MNYA 5CHBA 1LPZB 2WZQA 4X6NA 1D3TB 1XUJA 4OM9A 3RXLA 1D3PB 2XYAA 1V2JT 3A85A 3SU5A 4MNWA 3SORA 1GJDB 3ITIA 1QB6A 8GCHF 2VIQA 1UVOA 1HAHH 2R2MB 1XUHA 3KQ5A 1DUEA 1FPCH 1EASA 3TK5A 2GCTB 1BJVA 1OP8A 1GJ8B 3FP8E 4ISHH 2CV3A 3RXAA 1QY6A 4ZXYH 1A46H 2PLXA 3BG4C 4NCYA 5EGMA 4H42U 4O03A 4D7GA 3KCGH 1BRAA 3K9XB 1K2I1 1N8OB 1O3JA 3T25A 7LPRA 1F5KU 2ZDMA 4Y7AA 4BNRA 1MKWK 1NS3A 1V2NT 3EE7A 3M3SA 4CH8B 1BMAA 2GV7A 3UY9A 1E1QD 3PYHA 1FNIA 1G3CA 2HLDD 1GBBA 5EXLA 3EAJA 1IOEA 2OK5A 1V2UT 3BV9B 4Q63A 1ELFA 1NM6A 1YBWA 2W7SA 1P9SA 3R0FA 3KQCA 3RLWH 1GBLA 5E0HA 1ZGIA 1VGCB 2HPQH 5DO4H 1QBOA 3V12A 2F83A 1U6QA 5EJZA 1N8OC 3PO1B 3ZZDA 1PQ7A 1ELVA 1C1QA 1WDIA 2ZTZA 3EE0B 3P70B 1XX9A 3QO6A 1PJPA 4WH6A 5HKKD 1TNIA 2BVRH 3DFJA 1XVOA 1ZSLA 1C5XB 2CXVA 4OGXA 3U69H 1EJMA 1S84A 2ODPA 4K8BA 5FCKA 4JK5A 2FS8A 2XNIA 2FESH 3E0PB 4FU9A 2BLOA 5E2PA 1UTMA 2WPIS 1L4DA 3ESTA 2W3KA 1YKTA 4GLYA 1IQHA 2PWXA 5GXPA 1O38A 2VWOA 2FDAA 3QTOH 4B1TA 5C0TA 3HK6B 1W8BH 2P94A 1DXWA 1O5BB 2P93A 2FODA 1EB1H 1HJAB 2JH5D 4X8VH 3BF6H 1S6LA 2QXIA 1JBUH 3TJOA 2KCOA 5T6GA 2PFEA 4FUDA 4Y0YE 1YCPK 2Y5FA 3GY4A 3F2FA 2F9BH 3TGIE 3GY8A 2FYRA 3UNQA 3HKIB 5A8YA 5ESTE 1TRMA 4OS5A 4MLFB 4ZAEA 5GPIB 1C1RA 5B6LA 5DJ7A 3SU0A 2OUAA 5HGGA 1SQAA 3PLPA 4GCHF 3M5LA 5T6FA 3FOAA 1HXEH 2Z9GA 3KYFA 1MD8A 4TPIZ 1RIWB 5ETXA 3KHVA 1GJ9B 1QRXA 4B71A 3N99A 1P02A 2XWAA 1UO6A 1XUKA 1HAXB 5JDUB 1QB9A 2RA0A 1AVXA 2EQNA 3ZZ7A 1LTOA 3OTJE 2EEKA 2DE8A 4BXSA 5HM9A 3MO6A 1AO5A 2V6NA 3F9GA 1YM0A 2QIQA 1O3EA 3ATMA 1MUEB 4XRNA 4FUFA 3TJVA 1BTHH 3I78A 2P3UB 3MU1A 1OS8A 1GI9B 1TGCA 6ESTA 4ABBA 1IQLA 1FAXA 3A84A 3GDVA 1O33A 2FOCA 1TGBA 2K0QA 1PYTC 2B5TB 5KEDA 5DP5A 2G8TA 4RKOB 2GCHF 5FPSA 8KME2 1CQQA 4THNH 4K69A 1BTZA 1CGIE 1GHXH 1ANDA 1UVTH 1WQVH 5E0JA 1C1VH 1YCPH 3JZ1B 5HXFA 1SLVB 3SNAA 1XUFA 3TH2H 3BTWE 4FUGA 1IHSH 2BD2A 3RXPA 4A6LA 1BHXB 5DK1A 3O8DA 1RS0A 2ZHEH 3RMOH 1FY8E 1HCGA 1GI4A 1BJUA 1GHBG 1V2ST 4ZKSU 3ZYEA 4INKA 2XBYA 3MO9A 3MQKC 4ABDA 4X0WU 3MH6A 3DCLA 3MMGA 9LPRA 3RLYH 2UUKB 3PLKA 3LC3A 3I77A 2Q1JA 3T27A 3DHKH 1ZLRA 2Y81A 2VINA 3I29A 1GMHG 2SGQE 1C5RA 1N1LA 5SGAE 4YTAA 2C4FH 3RXVA 3FKSD 4F49A 1AUTC 1FMGA 5EPYA 3EA8A 1C2FA 3P95A 1HNEE 4O9VA 2O8LA 3F3BA 1IQJA 3A7TA 1NO9H 1Y3VA 1KXEA 3SNBA 1SHHB 3EA7A 1WTGH 4A1TA 3URDA 4NSYA 1QNJA 1OWEA 2AGIX 3VXFH 1BCUH 1YF4A 3UB0A 6GCHF 4WY3A 1ORFA 1A61H 1QA7A 2VIDA 1GJAB 1C5VA 1ARBA 1P04A 3T26A 3Q3YA 4AG2A 4XBBA 2ZCKP 4PROA 1Q2WA 3Q77A 4X1SU 2FOBA 2W7UA 1HAVB 2BY9X 3B23B 2ZU1A 4DGJA 2I6QA 2Z9IA 4FU7A 2QF5A 4GHTA 1SGRE 3RU4T 2XW9A 4A1XA 1ZTKA 2EI6A 1KXDA 1MMJN 5AFYH 4Z0KA 2CK3D 3TJUA 4K5ZA 2OC8A 4K2YA 3F6UH 1C4U2 1SGEE 2ZGJA 2W5EA 3H7TA 2A4GA 4K1TA 1HLTH 1Z8GA 3ZZBA 1EP5A 4UEHH 1Z8RA 2QCYA 2FYQA 1TNGA 3BIUH 2Y6TA 2FP7B 1GBIA 4UE7H 1CHOF 1UK3A 5TCAA 1C2GA 2LPRA 2SGFE 2FMJA 4ABHA 1W0YH 1RTLA 2QF3A 3MH5A 2BQWB 2H1UA 2PHBA 1JMOH 3ZZ4A 1QRZA 8LPRA 3UFAA 4HTCH 2GVFA 1O2TA 4I8KA 4K3JA 2FO9A 1YY3A 2FX4A 3U8TH 1C2MA 1FV9A 4Y8XA 3SV6A 2BD3A 1JIRA 4MQAA 1XXFA 3F9FA 2CGAA 3TGJE 2ZDLA 2Y80A 3RXUA 1EPTA 2OXSA 2JDID 2TGTA 1J14A 1UK2A 1TBQH 1NRPH 2GDEH 2ZDNA 5A8ZA 2HOBA 1GI0A 1RD3B 2J92A 1YPMH 4FETA 5EQQA 2J95A 1YLCA 2Q6GA 4RN6A 3VB4A 1AKSA 1O3BA 2G52A 3SV8A 2ZDKA 1TA2A 3FZDA 3ODDA 3W95A 2ZA5A 2C8WB 5EQSA 3SJ8A 3UUZA 2VWMA 1TYNA 4XBCA 2P59A 4CRFA 3LH3A 4I8JA 4BAKB 4Y71A 1SBWA 1S82A 1C2JA 3RXGA 2P95A 1O5CB 1MCVA 2XWBI 3L33A 2FWWA 2IJD1 1MZDA 3ZVBA 3BTDE 1BMFD 4Z1MD 1H8IH 2V3MA 1EOLA 4B73A 1YLNA 2F9VA 1AMHA 1ZPBA 2ZZUH 1BMLA 1C9PA 3MFJA 1AUJA 4CRGA 2KZ4A 4CREA 1AD8H 2ANYA 2PKSC 4CR9A 1P0SH 1GHWH 1NFXA 4AFQA 1TX8A 4JZDH 2RCEA 1LKBA 3P8FA 1DWEH 2BOKA 4K1SA 1ESTA 3PROA 1GGDB 1FI8A 4X2WA 2V3OH 5CHAC 2AHME 5LGOA 3QWCH 4I32A 1TX6A 1ELAA 1S0RA 1P11E 4X6MA 1ZZZA 2C93B 4Y10E 2CJIA 2DUCA 4NIYA 2GT8A 1UCYK 4E06H 1TRYA 2ZPSA 4DT4A 2D26C 2J2UA 4IGDA 2BDCA 3VB7A 1VJ9U 2OC0A 5F8TA 3GY2A 1CE5A 2ZHDA 1HV7A 1C5NH 1CO7E 3NRLA 2VIVA 1A0JA 3SV7A 3P6ZB 1G37A 4WVPE 1C5LH 1KTSB 3LJOA 2WUCA 1KSNA 4YO9A 1IQEA 1Y3YA 2JKHA 2PKSB 3A87A 3SQHE 1BRCE 4XSKU 3K2UA 3A83A 1C9TA 3AK5A 1OWDA 4AFUA 4ABGA 5CMXH 1EPTB 2ZEBA 3NUMA 5EQRA 5C17A 1TAWA 1EZUC 2JIZD 1VCWA 2HNTE 2ZECA 1W3CA 3OY5U 3ZZ6A 2WPHS 2AEIH 2BX4A 2VIPA 1O3FA 4JK6A 2A0QB 2F43B 2ZQ2A 4Q2KA 3RUOA 1MTNB 1V2WT 2R3UA 3AASA 2A5AA 1FPHH 1YPJH 1SOTA 2WPMS 1O2WA 2H9TH 3A86A 3KQBA 3QGJA 1TOMH 3HK3B 1C5TA 1LPGB 3GCTF 3TJNA 1BT7A 1FAKH 2Z3CA 2ZU2A 1GBCA 3VPKA 1A1RA 1K1LA 1O5AB 5A0CA 2ZG0H 4VGCC 1GMCG 2FTMA 4D7FA 3EYDA 2Z3EA 3BTQE 3M37A 1NU7B 3RXRA 1EFRD 2XC5A 1Q3XA 5TCCA 1C4Y2 4MPXA 2SNWA 3PTNA 1O2UA 1O2RA 2G00A 4MNVA 1C2KA 1BTPA 2RFKC 2FXRA 2GTBA 1P09A 2A7HA 5C5NA 4ZKNU 1J9CH 1DVAH 2BQ6B 1SB1H 1MQ5A 4JZFH 5L30H 3AAUA 1FY3A 1QQ4A 4NGAH 1Y5UT 3UTUH 2ZO3H 1LHCH 3PV5A 4WJG2 1FDPA 1OXGA 3PMHB 1TNJA 1UCYE 5IYTA 3SV2H 1EJAA 2H5CA 1IQIA 4X6PA 5FPYA 1NROH 2SNVA 2WSSD 1SGCA 1ZTJA 1MZAA 2LELA 4BTUB 2WUBA 2AYWA 5C1UA 1LVYA 2QY0B 2EY4C 3MH4A 1SKYE 4U30A 2J97A 3ZYDA 4F48B 3H09A 1GG6C 1UTJA 1BBRE 1C1NA 3DA9B 2PUXB 2IJOB 5IDKA 4ACBA 2B0FA 2NU4E 4X8SH 3U8RH 4A7IB 1RJXB 3ZV8A 2FI4E 1GCTB 2A2XH 3GDSA 5C20A 5F03A 1MBQA 2Z7FE 4I8LA 1W2KH 2C3SA 5DP6A 2ANWA 2A4RA 4H4FA 2IPQX 1V2PT 4NZQA 3O8CA 3P8OA 3T5FH 8GCHG 3O8RA 1SGYE 2TBSA 2ZQ1A 3G01A 3UR9A 2FS9A 4DG4A 3SJIA 1YC0A 3SU3A 2DE9A 1QZ8A 3E90B 1P12E 1UMAH 1GWAA 2A4QA 3GCOA 5JB9S 1VITF 3F2HA 1RTFB 3GCHC 3OX7U 4DJZB 4XFQA 3GY6A 1SLWB 1A2CH 4ZHMU 1S81A 3WW7A 4ASUD 2IN2A 4JZEH 1GI1A 1H8DH 1GVKB 1SI5H 3BTGE 3M5NA 1ELDE 1GI6A 2PV9B 4NZLA 4E7NA 3PTBA 2WPDD 4A5TS 3HKJB 1C5MD 2VVUA 1ZRKA 1GMDG 1CA0B 1EUFA 3SV9A 2Z9JA 1FJSA 1OP0A 2Q6FA 4NFFA 1HJ8A 1S6HA 4Q4LA 1GBTA 3DFLA 2WPJS 4NA8A 1OYQA 2GD4B 2P8OC 2QXGA 1LO6A 4HI3A 1JWTA 1C1UH 2BVSH 3TNTA 1TMUH 1EP6A 4FOUC 1V2MT 1L4ZA 2VBCA 5K7RA 2G4UA 3MNBA 3HPTB 4TWWA 1FIWA 1PPBH 3SHCH 1C5YB 1O2GH 1O2NA 5C5OA 3RXKA 2AERH 2ZWLH 1FY1A 1A0HB 3A89A 1WOFA 3LKWA 3PMBB 1C4V2 1MBMA 1LCYA 4B2AA 2YMSB 2QF4A 3QUMP 1VR1H 3MU0A 1ZHMA 5DSFA 2O8TA 3V0XA 1ELGA 2YOLA 5AFZH 3ZZCA 1GPZA 4P02A 1L1JA 2HRVA 2G81E 1LQEA 1O3DA 2A5IA 1H9HE 2NU1E 1TMTH 3NKKA 1MKWH 3D23A 2AGEX 2BQ7B 5GWZA 2BDIA 1YPHC 4YESB 1E0FD 2AH4X 3ZVAA 2FOHA 5FXLA 4ISNA 2KX4A 2R9PA 1CT2E 1ZMLA 4FVDA 1YCPM 2ZC9H 1GHAG 1FN8A 5ABWA 1WQSA 2KM0A 2HVXA 2ZFQH 4INLA 1P3EA 1CGJE 1GBMA 1ANCA 4E7RG 2TPIZ 3RXBA 2BD8A 2D1JA 3MH7A 2YNAA 1PQ8A 1CBWB 2ZCLP 3UPEA 2H9EH 3BTHE 1C5SA 1P05A 1QIXB 2GT7A 4U01A 3RXCA 3TK6A 3ZVGA 5L2YH 2XNDD 3EDXB 1SHYA 2Z9KA 1KLIH 2PSXA 1O2ZA 3QDZB 3OSYA 8ESTE 1V2OT 4I86A 3C27B 4AG1A 2J38A 5EODA 2OTVA 3SOSA 2UUJB 5CHAB 1ZSKA 4JCNA 3SUFA 1E38B 5HMAA 1WCZA 1F0UA 2WINI 3SGAE 3SNEA 2OQUA 4Q7YA 1CT4E 1SSXA 2BD9A 4GVUA 3RC4A 1HB0B 3GYLB 2BM2A 4KKDA 2HNTC 3CS0A 3RMMH 4DW2U 3RXDA 1C5UA 5T3HA 3RXEA 2WYGA 3DT0H 1YWUA 1NZQH 1RFNA 4B6FA 1PPGE 4DT7B 5TJXA 1VKYA 5EOKA 3GCHB 2Y5HA 3GS9A 2G5VA 3E6PH 1HFDA 2H9HA 4DY7B 1FLEE 5E2OA 4KELA 1Y8TA 2QE7D 3LU9B 1W0KD 2ZHWH 1TOCB 2FTLE 1PPFE 3H5CB 1MAXA 2D8WA 2ALVA 3AAVA 3GICB 2KAIB 1EXFA 1AE8H 1IQGA 1G3EA 3MI4A 1OX1A 5FCRA 1ZPCA 5DKMA 4AOQA 1HAIH 1C2LA 2WPKS 2B8OH 3FVFB 3U98H 2BLQA 2KCPA 4YZUA 1Y3XA 1ARCA 3K65B 4MTBA 1Z1IA 1V2LT 4NA7A 1P3CA 1K1JA 2F4LA 3ZZ8A 1SGQE 1D3DB 3QLPH 5LPEA 1BRBE 5IK2D 2CHAC 2OC1A 2VWNA 4FUEA 1Z71A 3LPRA 4XE4A 1AFQC 5CE1A 5EXMA 3SNCA 2ZGBH 1GI8B 4YOGA 3RC5A 3ATIA 4DOQA 3WWBA 4KGAA 2WV4A 2Z3DA 3IITA 3RU4E 1O32A 1ID5H 3PO1C 3N7EA 3VB6A 3SUEA 1CGHA 3V7TA 2A5KA 3P8NA 2R0KA 2KAIA 5F8ZA 1AVGH 1P2NA 1TX7A 1NTPA 4JZ1A 3U1JB 1HAOH 3OTPA 2KCAA 1DSUA 1UTOA 2THFB 1O36A 1P01A 1GBFA 4ABEA 7ESTE 4DIIH 4ABIA 1ANBA 1QR3E 2RA3A 4XD7D 5F8XA 4CR5A 4ASHA 3TU7H 1J15A 2H6MA 3MYWA 4Z6AH 2B9LA 4FUHA 5A8XA 5FX5A 3FAOA 2HALA 1G36A 1GBJA 1D4PB 3A7YA 2Y5GA 4KTSA 3BEFB 2QV1A 2XXLA 4Y79A 1C1SA 2PUQH 2TRMA 3ATKA 1LVBA 1O34A 4NG9H 5HIZA 1F0RA 2A7JA 4IS5A 4B76A 2XBXA 1AB9C 1O5GH 1TLDA 1LKAA 3EQ0H 1O5FH 1WAYB 1MKXK 2BX3A 1LQDB 1GL1A 5FBIA 4FUJA 1N6XA 4BTIB 5C3NA 3BTKE 1T8NA 4H6SB 1GHBF 3PMAB 1IQKA 2F9OA 2ZDAH 2FOFA 2ANMH 1RRKA 2ULLA 2ZHQH 4RT0A 4OGYA 1C2EA 2W6JD 1DX5M 1YPLH 1FY5A 1H4WA 2PTCE 2LNCA 3KQEA 1O2KA 1ABIH 4YT6H 4WMFA 1A0LA 1TGNA 1YPGH 4XDEA 5K0HA 1TNLA 5AHGH 1TBRH 1J16A 1A3BH 1FONA 1SPJA 1DS2E 1YP9A 4QT8C 3Q00A 3LJJA 3S9AA 1WTHD 4O3UA 3KF2A 1P06A 2BDYA 1BDAA 1ZPZA 4YXWD 5HIYA 2W3IA 1ANEA 4FU8A 4LK4A 3KNXA 2ZHFH 2XTTB 2XBWA 3HGPA 2VH6A 5HM2A 3LGIA 2EI7A 2GDDA 1JXPA 2OCVB 1ZR0A 3M7UA 2VWLA 5F53A 5DP9A 4FXGH 5JBTA 1JIMA 3A8BA 3QGNB 4TWYA 3F9EA 2R0LA 1Z7KA 2BLWA 3SZEA 4B6EA 1FUJA 1PQ5A 2G4TA 1DANH 2O8MA 2NU3E 2SGPE 4B2CA 1VITG 4UD9H 1JOUB 3PRBA 1BMNH 2PKAB 3EGKH 1DDJA 1EJNA 3SW2B 3UNRA 1T4UH 1EZSC 1K22H 3F2GA 2UWLA 1OWJA 1P57B 2ODQA 2VVCA 2ZGCA 4YT7H 2RDEA 3A81A 5C2ZA 2TGAA 2HLCA 4ESTE 2FX6A 3PMJA 4IMZA 5C0UA 4ISLA 3ZVDA 4AFZA 4UFGH 4IN2A 2F91A 3NK8A 1ETTH 2WHXA 1V2VT 2ZCHP 5FHTA 2HVYB 1W0JD 1SGIB 3U9AH 2YMSD 3TH4H 3S7KB 1ZHRA 1C5ZB 1DWDH 2ZF0H 4KTUA 1SR5C 2NU0E 2GJGA 5GCHF 1O39A 2Q6DA 1UCYH 1E79D 1O35A 4LZ1H 3ATLA 3SU1A 4YM9A 2XC0A 2F3CE 4X1QU 3W94A 1DUAA 3O8BA 3R3GB 2V0BA 1HAPH 1TNHA 1SC8U 1DPOA 1W13U 2EC9H 2BHGA 2LP6A 1BTUA 3PWCA 4GUXA 1GHYH 1UTPA 1GI3A 4MPUA 4D9QA 2UWPA 2BTCE 3H7OA 4NIXA 3GY5A 4BOHA 4Y7BA 1OP2A 2FOMB 2IPHA 3GCNA 1GMHF 1SFIA 3VXEH 2PSYA 1SLUB 4D9RA 4MDSA 3DSPA 1GL0E 2M2AA 2ESTE 1AU8A 4X6OA 1G9IE 4RSPA 4B75A 2BZ6H 2PTNA 1D3QB 1Y59T 1C2DA 3P92A 3GISB 2ZDVH 4LXBH 1SQRA 1K21H 2A7CA 4H6TA 3TIUA 1C1OA 2SFAA 1TBZH 2FOAA 1O3LA 4K60A 5FPTA 1ETRH 3E3TA 3UR6A 4I8GA 2BY7X 1W7GH 2HWLB 4X8TH 1BITA 2C8ZB 1MTNC 2GMTB 2V35A 1UHBA 4WWYA 1B5GH 2VH0A 1AN1E 1GBAA 2Z6BD 2G5NA 3SQEE 3VGCB 1HRTH 2OBQA 1DXPA 3KN2A 1YPHE 3E16B 1BBRK 3S9CA 2J94A 1ZYOA 1GVZA 4M7GA 1OPHB 5A0BA 1NBME 2O8WA 3CS7A 6GCHG 1FXYA 2AMDA 1C5QA 3UWJH 1MKXH 2M5TA 4ZH8A 2ALPA 1ELBA 2VNTA 2AFQB 3NXPA 2J5UA 2FOEA 1MU6B 1QJ6B 2VIWA 3ZVCA 4ZHAA 1GCDA 1QJ1B 1V2RT 2FI5E 3S9BA 1PQAA 1BQYA 3TLOA 4GSOA 3KQDA 1Z6EA 3NCLA 3TPIZ 2ZIQH 1TGSZ 1COWD 1AFQB 3MU4A 5HYOA 1G2MA 3QTVH 4DIHH 2FLRH 2QA9E 3KL6A 3GYMA 4WXIA 1O3GA 1TFXA 1P10A 4ABJA 2WV5A 1THSH 5KECA 3GCTG 4TSFD 5AF9H 5EW1H 4CHAB 2J34A 4BAQB 3MO3A 2QYIA 2W6ID 1NRNH 3LGYA
chains in the Genus database with same CATH topology
3F0PA 3N7DA 2OC8A 3OE7D 2YMSB 2XCNA 2QF4A 3OYPA 2A4GA 3PV2A 5DSFA 2AHME 2FOMB 2YMSC 2YOLA 2XOKD 4I32A 1DY9A 2OINA 1OHHD 2KCPA 3DSOA 4NWLA 2K0QA 3PV5A 4I31A 3KF2A 3DSPA 4TYDA 2M2AA 2F4LA 2FP7B 4B75A 4JMYA 3SU6A 5FPSA 5FPYA 5IK2D 2WSSD 1FX0B 4YXWD 2OC1A 4A92A 2LELA 2F9UA 4WH6A 3SYJA 5HKKD 2V7QD 4DT4A 1RTLA 5CDFE 1SKYE 3KNXA 5FL7D 3U1IB 3H09A 4TT3D 3RC5A 2JJ1D 2OC0A 2GVFA 4I33A 4K8BA 5FPTA 3WWBA 4A1VA 2IJOB 2L6OA 1JXPA 2XNIA 3N7EA 5IDKA 3SUEA 3O8DA 3P8NA 3RC6A 5F53A 3NRLA 2KM0A 5T1VA 3SV6A 3U1JB 1WXRA 3OTPA 2KCAA 3SV7A 5C0TA 2A4RA 5GJ4B 3O8CA 3OEHD 3SZEA 1DXWA 3P8OA 3O8RA 3DCLA 4B6EA 2KR7A 4B74A 2JDID 3SU3A 2O8MA 3M5OA 1S6LA 4WF8A 5GNDA 4U01A 2KFWA 3OAAD 4XD7D 2KCOA 5CHBA 2WZQA 2OBQA 2XNDD 3E90B 3PRBA 2K1QA 2A4QA 2JJ2D 1NBMD 1DXPA 3KN2A 3PRDA 4OM9A 1E1RD 3F0OA 3F2GA 3F2HA 3SU4A 3SU5A 3SUDA 1MABB 1N1LA 4FETA 3AK5A 1NBME 5EQQA 3F2FA 4ZCNA 3FKSD 4RI0A 4WH8A 5EQRA 5EPYA 4ASUD 1KMHB 2GGVB 3WW7A 4KTCA 5C17A 2JIZD 2QV1A 3SV8A 3M5NA 3F3BA 1W3CA 3SUFA 3LOXA 3FO8D 5EQSA 2K8IA 2WPDD 2XCFA 5ESBA 3ZIAD 5C0UA 4A1TA 5GPIB 2P59A 2F43B 4B76A 2J5UA 3SU2A 3SU0A 5B6LA 5H4IB 3RC4A 4NWKA 3UB0A 2FM2A 1DY8A 3SV9A 4F55A 2OBOA 3M5LA 1H8ED 4R8TB 3FOAA 2IJD1 2WHXA 3VG8A 3WWFA 1BT7A 4Q4LA 1W0JD 1A1RA 2YMSD 2WV9A 1BMFD 5ETXA 1H8HD 3LONA 4B71A 4Z1MD 1COWD 3N99A 4B6FA 5EPNA 3EYDA 1NS3A 3GS9A 3M5MA 4B73A 1RGQA 1E79D 2F9VA 3FN8A 2OC7A 3L6PA 3SU1A 1E1QD 3SUGA 2VBCA 3KEEA 2QF5A 1EFRD 3OFND 2QE7D 5DN6D 2W6JD 1W0KD 2HLDD 2KCYA 2KZ4A 3O8BA 4M9FA 4A1XA 4TSFD 2OK5A 3OEED 1CU1A 4Q63A 2CK3D 2W6ID 3LKWA 3W1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHB A;  3WWF A;  4ZCN A;  5F53 A;  3WWB A;  3WW7 A; 
#chains in the Genus database with same CATH topology
 5LH8 A;  2ZKS A;  3AW0 A;  1P2O A;  4CRA A;  4DCD A;  1O30 A;  2P3F H;  5EJ1 A;  1YLD A;  3KID U;  1QHR B;  1O3P B;  3UNS A;  1SOZ A;  2P3T B;  1T4V H;  1A3E H;  2BDB A;  2GZ8 A;  3DSO A;  1L0Z A;  5E0G A;  2UUY A;  4NFE A;  1HPG A;  1E36 B;  1XUI A;  1T32 A;  4BXW A;  4DUR A;  1PPE E;  2BDH A;  2P16 A;  3D65 E;  1O3N A;  1GBH A;  1CHO G;  1K1O A;  2JH0 D;  4A92 A;  1KXA A;  2PGB B;  4U2W A;  3PWB A;  4XBD A;  4D8N A;  1EPT C;  1PPC E;  1QL8 A;  4UON A;  1BIO A;  1FN6 A;  2BDG A;  4ZHL U;  1H9L B;  2AS9 A;  2XBV A;  1WUN H;  5KGO A;  1WXR A;  4BTT B;  2BXT H;  2ZPR A;  3V3M A;  1G3B A;  2VU8 E;  3LGW A;  2H5D A;  1QJ7 B;  4HGC A;  1O2M A;  4CRB A;  2KR7 A;  4JYV H;  4WF8 A;  1V2T T;  4AYV B;  3QZQ A;  2A4O A;  3Q76 A;  3UQO A;  3MNS A;  1AB9 B;  1DWC H;  3QX5 H;  4X1N U;  3ZV9 A;  1W10 U;  3WY8 A;  1ZSJ A;  1Z8I B;  1HGT H;  1Y3W A;  3SU4 A;  3K6Y A;  1PPH E;  3ATW A;  4J2Y B;  4ZCN A;  3TNS A;  3D49 H;  1VGC C;  2GGV B;  1TQ0 B;  3SGB E;  1GHZ A;  1WSS H;  1UHB B;  4OS1 A;  2K8I A;  1A4W H;  1DM4 B;  1VCQ A;  3RXM A;  1GBK A;  1YGC H;  2GCH G;  4NWK A;  3RM2 H;  1P2K A;  2FM2 A;  1NT1 A;  1AKS B;  1C1M A;  4YLQ H;  1EAX A;  1TGT A;  1EX3 A;  3Q3X A;  1SLX B;  4HG6 A;  4CRD A;  1S0Q A;  3HGN A;  4DVA U;  1NFY A;  3M7Q A;  2NWN A;  2GV6 A;  3QK1 A;  3FN8 A;  2V3H H;  1HAY B;  3KEE A;  1AVW A;  4IN1 A;  3CP7 A;  4M9F A;  1NC6 A;  1G3D A;  1AFE H;  2BLV A;  1AI8 H;  5JBA S;  4UFE H;  2GCT C;  1BOQ A;  3E1X B;  5DP3 A;  5GDS H;  1EZQ A;  4X2Y A;  1QRW A;  6CHA C;  2XCN A;  2ZU5 A;  5T6D A;  4B2B A;  1ESA A;  1KXF A;  1ELC A;  2BYA X;  4MG3 A;  5A09 A;  1S85 A;  3TIT A;  1CHG A;  1JRT A;  1O2I A;  2A32 A;  1MTS A;  2CMY A;  2ZTX A;  3IWM A;  1P2J A;  2STB E;  2GKV E;  1K1I A;  3ZVF A;  4AGK A;  2WYJ A;  4HZH A;  1MD7 A;  2ZI2 H;  4JZI A;  2VGC B;  5C94 A;  3SU6 A;  4BAH B;  1DT2 A;  1AZ8 A;  1GJ6 A;  1TPS A;  1EAW A;  1O2X A;  2GX4 A;  5DP8 A;  5E8E H;  9EST A;  5CDF E;  5EJL A;  5AVD A;  3M3V A;  1HJ9 A;  2P8O B;  4OS6 A;  4AB8 A;  4FUC A;  3TGK E;  1P2M A;  1WBG B;  3JZ2 B;  3TVJ B;  1C5W B;  1C1T A;  2SGA A;  3RM0 H;  1ZTL A;  1LVO A;  1CBW C;  2FIR H;  3B9F H;  2C90 B;  1F2S E;  5GJ4 B;  5A2M H;  3KGP A;  1B0E A;  1D6R A;  5DGJ A;  2PP6 A;  2VJ1 A;  2ZGX H;  3NPS A;  4GHQ A;  1GJ4 H;  1HAV A;  1OWK A;  1UVS H;  3V13 A;  3OAA D;  4TY6 A;  1H9I E;  3T2N A;  4AGJ A;  2QF0 A;  2J98 B;  4Y8Z A;  1NBM D;  4Y8Y A;  3F0O A;  3SUD A;  2BDA A;  3UIR A;  3RXT A;  1K9O E;  1P8V C;  7GCH F;  5L6N H;  3PLB A;  4MPW A;  2O9Q A;  2QAA A;  5GIB A;  1O3C A;  3A80 A;  3FO8 D;  1AIX H;  1KLT A;  3DD2 H;  5EW2 H;  4UFF H;  1SGT A;  2TIO A;  3M61 U;  4ABA A;  3LGT A;  5FX6 A;  4JYU H;  1NFW A;  1H8E D;  4FUB A;  4JYT A;  1O5D H;  3GY3 A;  3MU5 A;  1QUR H;  3VG8 A;  5EXN A;  1QFK H;  2ZGH A;  2BY6 X;  1A5G H;  1BTW A;  1GDU A;  1SMF E;  1O2S A;  4AZ2 B;  4Q80 A;  3UOU A;  3RXJ A;  5EPN A;  3T62 A;  1T8O A;  1P9U A;  3ZZA A;  1KXC A;  1MAY A;  2OC7 A;  4IBL H;  2XC4 A;  4X2X A;  2BXU H;  1K1N A;  1CA0 C;  3RXO A;  2KCY A;  1O31 A;  3AVZ A;  1RXP A;  3A8A A;  3MU8 A;  2G51 A;  1YPK H;  1VZQ H;  2AGG X;  1M9U A;  2QGR A;  1UW7 A;  4WMD A;  5A0A E;  2GZ7 A;  3URC A;  1ZGV A;  1INC A;  4F4O C;  1SGF G;  1GMD F;  4RKJ B;  2XOK D;  2OIN A;  3BEI B;  3A8C A;  1QBN A;  4RT1 A;  4P00 A;  1HDT H;  1YYY 1;  1C5P A;  4NWL A;  1BRU P;  3STJ A;  1TRN A;  1W0Z U;  3LH1 A;  2R3Y A;  3UOP A;  3A8D A;  7GCH G;  2G55 A;  1F0T A;  3A82 A;  4IC6 A;  2ZTY A;  1N6Y A;  5I25 A;  1UTK A;  3HAT H;  4YOJ A;  5FBE A;  4VGC B;  5PTP A;  4TT3 D;  1IHT H;  1TAB E;  3M7T A;  2JJ1 D;  1C1P A;  1GCT C;  1BA8 B;  3S7H B;  4K8Y A;  1YPE H;  5LPF A;  1DE7 H;  1TON A;  3FFG A;  5BPE A;  2FPZ A;  1O2L A;  1G32 B;  3URE A;  1UVP A;  1Z1J A;  1GI2 A;  2UWO A;  4X8U H;  4NSV A;  3K6Z A;  4OS7 A;  1UTN A;  2ZFS A;  1BZX E;  3C1K A;  3SN8 A;  2J98 A;  2C8X B;  3SJ9 A;  4AB9 A;  3RP2 A;  3UWI A;  2SGE E;  1RIW C;  1O2O A;  4AC9 A;  1KMH B;  1XM1 A;  3F68 H;  1LPK B;  3STI A;  3U8O H;  3SND A;  4CRC A;  3E91 A;  1Y3U A;  4J1Y A;  4Y11 E;  2HNT F;  3ENS B;  1CSO E;  1DLE A;  1XUG A;  3A88 A;  1DY8 A;  3A7W A;  4R8T B;  1CA8 B;  1VJA U;  2ZFT A;  1W14 U;  3RML H;  1O5E H;  3RXF A;  3SHA H;  1AE5 A;  3E0N B;  2FOG A;  3VEQ B;  2NU2 E;  4I7Y H;  1O2P A;  1GBD A;  2L74 A;  4MNX A;  3AW1 A;  1LVM A;  3M5M A;  1OSS A;  1TA6 A;  1QQU A;  3P8G A;  4Y0Z E;  4GCH G;  4LZ4 B;  1AWF H;  1XMN B;  4IC5 A;  1ZMN A;  1LHD H;  2SGD E;  2VIO A;  4D76 A;  1CU1 A;  2VB0 A;  1VCP A;  1BHX F;  3OE7 D;  1GBE A;  3A7Z A;  4X1P U;  3W1E A;  1KDQ B;  3N7D A;  1NRQ H;  1QL7 A;  3A7X A;  1HXF H;  1SGN E;  2A31 A;  2CF8 H;  2STA E;  1GJ5 H;  1GDN A;  3OYP A;  1RTK A;  1DFP A;  2UUF B;  2FZZ A;  3MWI U;  1SGP E;  3GY7 A;  3PV2 A;  1C5O H;  1K1P A;  3CNR A;  4Q7Z A;  1C1W H;  2OQ5 A;  1OHH D;  1SG8 B;  2A45 B;  3MTY A;  4NIW A;  1HUT H;  1O2J A;  2Y7X A;  3SO3 A;  4IW4 E;  2C8Y B;  3GOV B;  5LPR A;  1AGJ A;  1QB1 A;  1K1M A;  2Y82 A;  1UJ1 A;  2R2W U;  5EIY A;  2F9U A;  4CBN A;  1MCT A;  1WU1 A;  3PB1 E;  1OKX A;  3RU4 D;  1LHF H;  1J8A A;  1EZX C;  2AIP A;  4I33 A;  2BVX H;  4A1V A;  2ZU4 A;  2EA3 A;  2F9N A;  1THR H;  5C67 A;  4CH2 B;  3BN9 A;  1QCP A;  4I8H A;  1TWX B;  4X2V A;  2Z9L A;  1T31 A;  3Q3K A;  2PW8 H;  5B6O A;  4Y76 A;  5JBC S;  1HIA B;  2VGC C;  5GND A;  1AQ7 A;  1LMW B;  2KFW A;  2OD3 B;  1O3I A;  1LHG H;  2PGQ B;  4WME A;  1GJ7 B;  4ZUH A;  1IQN A;  1D6W A;  3RXH A;  4AFS A;  2JH6 D;  3LGU A;  2AIQ A;  1SGF A;  1NFU A;  1MH0 A;  4NIV A;  4RI0 A;  3ODF A;  4WH8 A;  1GGD C;  2J4I A;  1CVW H;  5I46 H;  1KDQ A;  1QA0 A;  3FAN A;  3BEU A;  1TNK A;  4AOR A;  2XCF A;  1GVL A;  1SQO A;  1V3X A;  2JET B;  5DP4 A;  3BTE E;  1DLK B;  3OY6 U;  1OWI A;  1KXB A;  4INH A;  5C1Y A;  1O0D H;  3SU2 A;  1FIZ A;  5H4I B;  4UFD H;  2RG3 A;  2QN5 T;  1XKA C;  1F7Z A;  1ETS H;  1QTF A;  3F9H A;  3UAI C;  1O3K A;  2WV9 A;  2O8U A;  3EA9 A;  1LDT T;  4FVB A;  3BTF E;  1GI5 A;  1OOK B;  4TPY A;  1PFX C;  2ZPQ A;  3SUG A;  2CHA B;  4O3T A;  1E37 B;  2A2Q H;  2QXH A;  3OFN D;  3T28 A;  5DN6 D;  3P17 H;  4NA9 H;  1O3O A;  1Q31 A;  2IOT A;  4MVN A;  2RDL A;  3BTT E;  1PYT D;  1V2K T;  2JET C;  1D9I A;  2ZU3 A;  1AHT H;  4TY7 A;  1NES E;  4IMQ A;  1UTL M;  1ZOM A;  3RXI A;  4OS2 A;  1T7C A;  2GP9 B;  5J4S A;  2Z94 A;  3QN7 A;  2B7D H;  1BTX A;  1HIA A;  4I31 A;  4AX9 H;  1EAU A;  2ZP0 H;  2EI8 A;  3A7V A;  3M3T A;  2XRC A;  3ZZ5 A;  1SVP A;  4AYY B;  3SYJ A;  1KYN A;  1F5R A;  2V7Q D;  3BG8 A;  1O3M A;  1IQM A;  2GZ9 A;  3ZZ9 A;  1ZRB A;  4XOJ A;  2PKA A;  1GMC F;  1S6F A;  1Z8J B;  2I6S A;  2L6O A;  1NPM A;  1K0H A;  1HAG E;  3TH3 H;  1C2I A;  2AMP A;  1ELE E;  3OEH D;  1XVM A;  2CN0 H;  1K28 D;  4BAO B;  3SJO A;  2BOH B;  1TPP A;  1UK4 A;  4B74 A;  2TGP Z;  3BIV H;  5BRR E;  2AMQ A;  3DSG A;  3S0N A;  4O97 A;  1DIT H;  4AN7 A;  1O2H A;  2K1Q A;  1GDQ A;  3LGV A;  3NWU A;  3PRD A;  4X1R U;  1XXD A;  1KTT B;  3LIW A;  1E1R D;  1MAB B;  4ACA A;  2D2D A;  1V6D A;  4ZMA H;  1O3A A;  3NZI A;  3F1S B;  1OYT H;  4YOI A;  4KTC A;  1TQ7 B;  3RXS A;  3FP6 E;  4E05 H;  3GDU A;  1MQ6 A;  4UDW H;  3SZN A;  1DOJ A;  3ZIA D;  3M36 A;  1NY2 2;  4HFP B;  1KLJ H;  2CF9 H;  1AWH B;  3BG4 B;  1AY6 H;  2HGT H;  4F55 A;  2OBO A;  1W12 U;  4GAW A;  3WWF A;  1B0F A;  1P2I A;  2VVV A;  1FZZ A;  3LON A;  1P03 A;  3LT3 A;  2GMT C;  1WV7 H;  3SJK A;  3E8L A;  2QXJ A;  2HPP H;  3L6P A;  1UTQ A;  1TMB H;  2A1D B;  3SI3 H;  1S83 A;  1KIG H;  3MHW U;  3RMN H;  2ZFF H;  4BAM B;  4MPV A;  4Q7X A;  4GPG A;  1PPZ A;  4ISO A;  1Y5A T;  1E34 B;  2J9N A;  1GJC B;  1NRR H;  6LPR A;  4SGA E;  1A5I A;  1ABJ H;  1TPA E;  2FEQ H;  1P2Q A;  2YMS C;  6CHA B;  2TGD A;  1J17 T;  5DPA A;  3SGQ E;  3ZZ3 A;  4Y6D A;  3DUX H;  4TYD A;  3QZR A;  3MNX A;  3KYG A;  2BD5 A;  4YLU A;  1NN6 A;  5F6M A;  3VGC C;  1A5H A;  5GCH G;  1FQ3 A;  1TAL A;  1FX0 B;  3IG6 B;  3VB3 A;  2ZNK H;  4ABF A;  3VB5 A;  1GHA F;  1ACB E;  1HBT H;  1OWH A;  3ELA H;  3U1I B;  1DIC A;  5EG4 A;  1G2L A;  4SGB E;  4BAN B;  1THP B;  4OS4 A;  1O2Q A;  5FAH A;  4R0I A;  4ZXX H;  1EQ9 A;  3RC6 A;  3TK9 A;  2BD4 A;  2FLB H;  5T1V A;  3SBK A;  2BD7 A;  4ISI H;  3U28 C;  1S5S A;  1HJA C;  1X7A C;  1CT0 E;  4U32 A;  1UVU H;  1QBV H;  1LHE H;  1DST A;  1BUI A;  2FI3 E;  1H1B A;  5JYI A;  2JJ2 D;  1L2E A;  1GJB B;  1L1G A;  1IQF A;  2BB4 A;  1ZMJ A;  1ZJK A;  3D62 A;  1BB0 B;  1GG6 B;  5C1X A;  1QGF A;  2ZFR H;  2ODY B;  1EAI A;  1O2V A;  3UQV A;  1TIO A;  1F0S A;  3OU0 A;  1ZHP A;  3LOX A;  3FP7 E;  5ESB A;  3MNC A;  1XKB C;  3L3T A;  2W26 A;  4CBO A;  1TB6 H;  3M35 A;  1SL3 A;  1WYK A;  1C2H A;  3BTM E;  1ELT A;  1B7X B;  1MTU A;  2BMG B;  2BY5 X;  4ZRO A;  1Y5B T;  1W11 U;  3CEN A;  2F9P A;  1H8H D;  1MU8 B;  1QL9 A;  5JBB S;  1RGQ A;  1EOJ A;  1NU9 A;  4FUI A;  1BTY A;  1F5L A;  5JB8 S;  1T8L A;  3ZVE A;  3OEE D;  3N7O A;  1SFQ B;  1L1N A;  1O3H A;  1JRS A;  2PR3 A;  3F0P A;  5DP7 A;  3RXQ A;  1HYL A;  1IAU A;  5G4B A;  5J4Q A;  1A7S A;  3B8J A;  1TE0 A;  1E35 B;  2Y7Z A;  3RDZ A;  1GHV H;  2H2Z A;  3LDX H;  1V2Q T;  3FZZ A;  1ZJD A;  5L2Z H;  4KP0 A;  1DY9 A;  1EKB B;  1AZZ A;  1SGD E;  4LOY H;  1KY9 A;  2WPL S;  1NRS H;  3SI4 H;  1O2Y A;  1MTV A;  2BY8 X;  4CHA C;  1BMM H;  1W7X H;  4JMY A;  4ZKO U;  3MOC A;  2OP9 A;  3PM3 A;  2ANK H;  1FY4 A;  3VFE A;  1DWB H;  1BBR H;  1MTW A;  2OLG A;  5FL7 D;  2ASU B;  1O37 A;  1T8M A;  4K1E A;  1TPO A;  1EB2 A;  2QC2 A;  1VIT H;  5EU8 A;  4ZKR U;  3T29 A;  7KME H;  5JPM H;  2YNB A;  5DG6 A;  1EAT A;  2ILN A;  2ZFP H;  1G30 B;  1F92 A;  1HAZ B;  3PV4 A;  2BZA A;  3S69 A;  1SQT A;  3LC5 A;  3BSQ A;  1ESB A;  4WXV A;  1Z6J H;  1GI7 B;  3M5O A;  4MNY A;  5CHB A;  1LPZ B;  2WZQ A;  4X6N A;  1D3T B;  1XUJ A;  4OM9 A;  3RXL A;  1D3P B;  2XYA A;  1V2J T;  3A85 A;  3SU5 A;  4MNW A;  3SOR A;  1GJD B;  3ITI A;  1QB6 A;  8GCH F;  2VIQ A;  1UVO A;  1HAH H;  2R2M B;  1XUH A;  3KQ5 A;  1DUE A;  1FPC H;  1EAS A;  3TK5 A;  2GCT B;  1BJV A;  1OP8 A;  1GJ8 B;  3FP8 E;  4ISH H;  2CV3 A;  3RXA A;  1QY6 A;  4ZXY H;  1A46 H;  2PLX A;  3BG4 C;  4NCY A;  5EGM A;  4H42 U;  4O03 A;  4D7G A;  3KCG H;  1BRA A;  3K9X B;  1K2I 1;  1N8O B;  1O3J A;  3T25 A;  7LPR A;  1F5K U;  2ZDM A;  4Y7A A;  4BNR A;  1MKW K;  1NS3 A;  1V2N T;  3EE7 A;  3M3S A;  4CH8 B;  1BMA A;  2GV7 A;  3UY9 A;  1E1Q D;  3PYH A;  1FNI A;  1G3C A;  2HLD D;  1GBB A;  5EXL A;  3EAJ A;  1IOE A;  2OK5 A;  1V2U T;  3BV9 B;  4Q63 A;  1ELF A;  1NM6 A;  1YBW A;  2W7S A;  1P9S A;  3R0F A;  3KQC A;  3RLW H;  1GBL A;  5E0H A;  1ZGI A;  1VGC B;  2HPQ H;  5DO4 H;  1QBO A;  3V12 A;  2F83 A;  1U6Q A;  5EJZ A;  1N8O C;  3PO1 B;  3ZZD A;  1PQ7 A;  1ELV A;  1C1Q A;  1WDI A;  2ZTZ A;  3EE0 B;  3P70 B;  1XX9 A;  3QO6 A;  1PJP A;  4WH6 A;  5HKK D;  1TNI A;  2BVR H;  3DFJ A;  1XVO A;  1ZSL A;  1C5X B;  2CXV A;  4OGX A;  3U69 H;  1EJM A;  1S84 A;  2ODP A;  4K8B A;  5FCK A;  4JK5 A;  2FS8 A;  2XNI A;  2FES H;  3E0P B;  4FU9 A;  2BLO A;  5E2P A;  1UTM A;  2WPI S;  1L4D A;  3EST A;  2W3K A;  1YKT A;  4GLY A;  1IQH A;  2PWX A;  5GXP A;  1O38 A;  2VWO A;  2FDA A;  3QTO H;  4B1T A;  5C0T A;  3HK6 B;  1W8B H;  2P94 A;  1DXW A;  1O5B B;  2P93 A;  2FOD A;  1EB1 H;  1HJA B;  2JH5 D;  4X8V H;  3BF6 H;  1S6L A;  2QXI A;  1JBU H;  3TJO A;  2KCO A;  5T6G A;  2PFE A;  4FUD A;  4Y0Y E;  1YCP K;  2Y5F A;  3GY4 A;  3F2F A;  2F9B H;  3TGI E;  3GY8 A;  2FYR A;  3UNQ A;  3HKI B;  5A8Y A;  5EST E;  1TRM A;  4OS5 A;  4MLF B;  4ZAE A;  5GPI B;  1C1R A;  5B6L A;  5DJ7 A;  3SU0 A;  2OUA A;  5HGG A;  1SQA A;  3PLP A;  4GCH F;  3M5L A;  5T6F A;  3FOA A;  1HXE H;  2Z9G A;  3KYF A;  1MD8 A;  4TPI Z;  1RIW B;  5ETX A;  3KHV A;  1GJ9 B;  1QRX A;  4B71 A;  3N99 A;  1P02 A;  2XWA A;  1UO6 A;  1XUK A;  1HAX B;  5JDU B;  1QB9 A;  2RA0 A;  1AVX A;  2EQN A;  3ZZ7 A;  1LTO A;  3OTJ E;  2EEK A;  2DE8 A;  4BXS A;  5HM9 A;  3MO6 A;  1AO5 A;  2V6N A;  3F9G A;  1YM0 A;  2QIQ A;  1O3E A;  3ATM A;  1MUE B;  4XRN A;  4FUF A;  3TJV A;  1BTH H;  3I78 A;  2P3U B;  3MU1 A;  1OS8 A;  1GI9 B;  1TGC A;  6EST A;  4ABB A;  1IQL A;  1FAX A;  3A84 A;  3GDV A;  1O33 A;  2FOC A;  1TGB A;  2K0Q A;  1PYT C;  2B5T B;  5KED A;  5DP5 A;  2G8T A;  4RKO B;  2GCH F;  5FPS A;  8KME 2;  1CQQ A;  4THN H;  4K69 A;  1BTZ A;  1CGI E;  1GHX H;  1AND A;  1UVT H;  1WQV H;  5E0J A;  1C1V H;  1YCP H;  3JZ1 B;  5HXF A;  1SLV B;  3SNA A;  1XUF A;  3TH2 H;  3BTW E;  4FUG A;  1IHS H;  2BD2 A;  3RXP A;  4A6L A;  1BHX B;  5DK1 A;  3O8D A;  1RS0 A;  2ZHE H;  3RMO H;  1FY8 E;  1HCG A;  1GI4 A;  1BJU A;  1GHB G;  1V2S T;  4ZKS U;  3ZYE A;  4INK A;  2XBY A;  3MO9 A;  3MQK C;  4ABD A;  4X0W U;  3MH6 A;  3DCL A;  3MMG A;  9LPR A;  3RLY H;  2UUK B;  3PLK A;  3LC3 A;  3I77 A;  2Q1J A;  3T27 A;  3DHK H;  1ZLR A;  2Y81 A;  2VIN A;  3I29 A;  1GMH G;  2SGQ E;  1C5R A;  1N1L A;  5SGA E;  4YTA A;  2C4F H;  3RXV A;  3FKS D;  4F49 A;  1AUT C;  1FMG A;  5EPY A;  3EA8 A;  1C2F A;  3P95 A;  1HNE E;  4O9V A;  2O8L A;  3F3B A;  1IQJ A;  3A7T A;  1NO9 H;  1Y3V A;  1KXE A;  3SNB A;  1SHH B;  3EA7 A;  1WTG H;  4A1T A;  3URD A;  4NSY A;  1QNJ A;  1OWE A;  2AGI X;  3VXF H;  1BCU H;  1YF4 A;  3UB0 A;  6GCH F;  4WY3 A;  1ORF A;  1A61 H;  1QA7 A;  2VID A;  1GJA B;  1C5V A;  1ARB A;  1P04 A;  3T26 A;  3Q3Y A;  4AG2 A;  4XBB A;  2ZCK P;  4PRO A;  1Q2W A;  3Q77 A;  4X1S U;  2FOB A;  2W7U A;  1HAV B;  2BY9 X;  3B23 B;  2ZU1 A;  4DGJ A;  2I6Q A;  2Z9I A;  4FU7 A;  2QF5 A;  4GHT A;  1SGR E;  3RU4 T;  2XW9 A;  4A1X A;  1ZTK A;  2EI6 A;  1KXD A;  1MMJ N;  5AFY H;  4Z0K A;  2CK3 D;  3TJU A;  4K5Z A;  2OC8 A;  4K2Y A;  3F6U H;  1C4U 2;  1SGE E;  2ZGJ A;  2W5E A;  3H7T A;  2A4G A;  4K1T A;  1HLT H;  1Z8G A;  3ZZB A;  1EP5 A;  4UEH H;  1Z8R A;  2QCY A;  2FYQ A;  1TNG A;  3BIU H;  2Y6T A;  2FP7 B;  1GBI A;  4UE7 H;  1CHO F;  1UK3 A;  5TCA A;  1C2G A;  2LPR A;  2SGF E;  2FMJ A;  4ABH A;  1W0Y H;  1RTL A;  2QF3 A;  3MH5 A;  2BQW B;  2H1U A;  2PHB A;  1JMO H;  3ZZ4 A;  1QRZ A;  8LPR A;  3UFA A;  4HTC H;  2GVF A;  1O2T A;  4I8K A;  4K3J A;  2FO9 A;  1YY3 A;  2FX4 A;  3U8T H;  1C2M A;  1FV9 A;  4Y8X A;  3SV6 A;  2BD3 A;  1JIR A;  4MQA A;  1XXF A;  3F9F A;  2CGA A;  3TGJ E;  2ZDL A;  2Y80 A;  3RXU A;  1EPT A;  2OXS A;  2JDI D;  2TGT A;  1J14 A;  1UK2 A;  1TBQ H;  1NRP H;  2GDE H;  2ZDN A;  5A8Z A;  2HOB A;  1GI0 A;  1RD3 B;  2J92 A;  1YPM H;  4FET A;  5EQQ A;  2J95 A;  1YLC A;  2Q6G A;  4RN6 A;  3VB4 A;  1AKS A;  1O3B A;  2G52 A;  3SV8 A;  2ZDK A;  1TA2 A;  3FZD A;  3ODD A;  3W95 A;  2ZA5 A;  2C8W B;  5EQS A;  3SJ8 A;  3UUZ A;  2VWM A;  1TYN A;  4XBC A;  2P59 A;  4CRF A;  3LH3 A;  4I8J A;  4BAK B;  4Y71 A;  1SBW A;  1S82 A;  1C2J A;  3RXG A;  2P95 A;  1O5C B;  1MCV A;  2XWB I;  3L33 A;  2FWW A;  2IJD 1;  1MZD A;  3ZVB A;  3BTD E;  1BMF D;  4Z1M D;  1H8I H;  2V3M A;  1EOL A;  4B73 A;  1YLN A;  2F9V A;  1AMH A;  1ZPB A;  2ZZU H;  1BML A;  1C9P A;  3MFJ A;  1AUJ A;  4CRG A;  2KZ4 A;  4CRE A;  1AD8 H;  2ANY A;  2PKS C;  4CR9 A;  1P0S H;  1GHW H;  1NFX A;  4AFQ A;  1TX8 A;  4JZD H;  2RCE A;  1LKB A;  3P8F A;  1DWE H;  2BOK A;  4K1S A;  1EST A;  3PRO A;  1GGD B;  1FI8 A;  4X2W A;  2V3O H;  5CHA C;  2AHM E;  5LGO A;  3QWC H;  4I32 A;  1TX6 A;  1ELA A;  1S0R A;  1P11 E;  4X6M A;  1ZZZ A;  2C93 B;  4Y10 E;  2CJI A;  2DUC A;  4NIY A;  2GT8 A;  1UCY K;  4E06 H;  1TRY A;  2ZPS A;  4DT4 A;  2D26 C;  2J2U A;  4IGD A;  2BDC A;  3VB7 A;  1VJ9 U;  2OC0 A;  5F8T A;  3GY2 A;  1CE5 A;  2ZHD A;  1HV7 A;  1C5N H;  1CO7 E;  3NRL A;  2VIV A;  1A0J A;  3SV7 A;  3P6Z B;  1G37 A;  4WVP E;  1C5L H;  1KTS B;  3LJO A;  2WUC A;  1KSN A;  4YO9 A;  1IQE A;  1Y3Y A;  2JKH A;  2PKS B;  3A87 A;  3SQH E;  1BRC E;  4XSK U;  3K2U A;  3A83 A;  1C9T A;  3AK5 A;  1OWD A;  4AFU A;  4ABG A;  5CMX H;  1EPT B;  2ZEB A;  3NUM A;  5EQR A;  5C17 A;  1TAW A;  1EZU C;  2JIZ D;  1VCW A;  2HNT E;  2ZEC A;  1W3C A;  3OY5 U;  3ZZ6 A;  2WPH S;  2AEI H;  2BX4 A;  2VIP A;  1O3F A;  4JK6 A;  2A0Q B;  2F43 B;  2ZQ2 A;  4Q2K A;  3RUO A;  1MTN B;  1V2W T;  2R3U A;  3AAS A;  2A5A A;  1FPH H;  1YPJ H;  1SOT A;  2WPM S;  1O2W A;  2H9T H;  3A86 A;  3KQB A;  3QGJ A;  1TOM H;  3HK3 B;  1C5T A;  1LPG B;  3GCT F;  3TJN A;  1BT7 A;  1FAK H;  2Z3C A;  2ZU2 A;  1GBC A;  3VPK A;  1A1R A;  1K1L A;  1O5A B;  5A0C A;  2ZG0 H;  4VGC C;  1GMC G;  2FTM A;  4D7F A;  3EYD A;  2Z3E A;  3BTQ E;  3M37 A;  1NU7 B;  3RXR A;  1EFR D;  2XC5 A;  1Q3X A;  5TCC A;  1C4Y 2;  4MPX A;  2SNW A;  3PTN A;  1O2U A;  1O2R A;  2G00 A;  4MNV A;  1C2K A;  1BTP A;  2RFK C;  2FXR A;  2GTB A;  1P09 A;  2A7H A;  5C5N A;  4ZKN U;  1J9C H;  1DVA H;  2BQ6 B;  1SB1 H;  1MQ5 A;  4JZF H;  5L30 H;  3AAU A;  1FY3 A;  1QQ4 A;  4NGA H;  1Y5U T;  3UTU H;  2ZO3 H;  1LHC H;  3PV5 A;  4WJG 2;  1FDP A;  1OXG A;  3PMH B;  1TNJ A;  1UCY E;  5IYT A;  3SV2 H;  1EJA A;  2H5C A;  1IQI A;  4X6P A;  5FPY A;  1NRO H;  2SNV A;  2WSS D;  1SGC A;  1ZTJ A;  1MZA A;  2LEL A;  4BTU B;  2WUB A;  2AYW A;  5C1U A;  1LVY A;  2QY0 B;  2EY4 C;  3MH4 A;  1SKY E;  4U30 A;  2J97 A;  3ZYD A;  4F48 B;  3H09 A;  1GG6 C;  1UTJ A;  1BBR E;  1C1N A;  3DA9 B;  2PUX B;  2IJO B;  5IDK A;  4ACB A;  2B0F A;  2NU4 E;  4X8S H;  3U8R H;  4A7I B;  1RJX B;  3ZV8 A;  2FI4 E;  1GCT B;  2A2X H;  3GDS A;  5C20 A;  5F03 A;  1MBQ A;  2Z7F E;  4I8L A;  1W2K H;  2C3S A;  5DP6 A;  2ANW A;  2A4R A;  4H4F A;  2IPQ X;  1V2P T;  4NZQ A;  3O8C A;  3P8O A;  3T5F H;  8GCH G;  3O8R A;  1SGY E;  2TBS A;  2ZQ1 A;  3G01 A;  3UR9 A;  2FS9 A;  4DG4 A;  3SJI A;  1YC0 A;  3SU3 A;  2DE9 A;  1QZ8 A;  3E90 B;  1P12 E;  1UMA H;  1GWA A;  2A4Q A;  3GCO A;  5JB9 S;  1VIT F;  3F2H A;  1RTF B;  3GCH C;  3OX7 U;  4DJZ B;  4XFQ A;  3GY6 A;  1SLW B;  1A2C H;  4ZHM U;  1S81 A;  3WW7 A;  4ASU D;  2IN2 A;  4JZE H;  1GI1 A;  1H8D H;  1GVK B;  1SI5 H;  3BTG E;  3M5N A;  1ELD E;  1GI6 A;  2PV9 B;  4NZL A;  4E7N A;  3PTB A;  2WPD D;  4A5T S;  3HKJ B;  1C5M D;  2VVU A;  1ZRK A;  1GMD G;  1CA0 B;  1EUF A;  3SV9 A;  2Z9J A;  1FJS A;  1OP0 A;  2Q6F A;  4NFF A;  1HJ8 A;  1S6H A;  4Q4L A;  1GBT A;  3DFL A;  2WPJ S;  4NA8 A;  1OYQ A;  2GD4 B;  2P8O C;  2QXG A;  1LO6 A;  4HI3 A;  1JWT A;  1C1U H;  2BVS H;  3TNT A;  1TMU H;  1EP6 A;  4FOU C;  1V2M T;  1L4Z A;  2VBC A;  5K7R A;  2G4U A;  3MNB A;  3HPT B;  4TWW A;  1FIW A;  1PPB H;  3SHC H;  1C5Y B;  1O2G H;  1O2N A;  5C5O A;  3RXK A;  2AER H;  2ZWL H;  1FY1 A;  1A0H B;  3A89 A;  1WOF A;  3LKW A;  3PMB B;  1C4V 2;  1MBM A;  1LCY A;  4B2A A;  2YMS B;  2QF4 A;  3QUM P;  1VR1 H;  3MU0 A;  1ZHM A;  5DSF A;  2O8T A;  3V0X A;  1ELG A;  2YOL A;  5AFZ H;  3ZZC A;  1GPZ A;  4P02 A;  1L1J A;  2HRV A;  2G81 E;  1LQE A;  1O3D A;  2A5I A;  1H9H E;  2NU1 E;  1TMT H;  3NKK A;  1MKW H;  3D23 A;  2AGE X;  2BQ7 B;  5GWZ A;  2BDI A;  1YPH C;  4YES B;  1E0F D;  2AH4 X;  3ZVA A;  2FOH A;  5FXL A;  4ISN A;  2KX4 A;  2R9P A;  1CT2 E;  1ZML A;  4FVD A;  1YCP M;  2ZC9 H;  1GHA G;  1FN8 A;  5ABW A;  1WQS A;  2KM0 A;  2HVX A;  2ZFQ H;  4INL A;  1P3E A;  1CGJ E;  1GBM A;  1ANC A;  4E7R G;  2TPI Z;  3RXB A;  2BD8 A;  2D1J A;  3MH7 A;  2YNA A;  1PQ8 A;  1CBW B;  2ZCL P;  3UPE A;  2H9E H;  3BTH E;  1C5S A;  1P05 A;  1QIX B;  2GT7 A;  4U01 A;  3RXC A;  3TK6 A;  3ZVG A;  5L2Y H;  2XND D;  3EDX B;  1SHY A;  2Z9K A;  1KLI H;  2PSX A;  1O2Z A;  3QDZ B;  3OSY A;  8EST E;  1V2O T;  4I86 A;  3C27 B;  4AG1 A;  2J38 A;  5EOD A;  2OTV A;  3SOS A;  2UUJ B;  5CHA B;  1ZSK A;  4JCN A;  3SUF A;  1E38 B;  5HMA A;  1WCZ A;  1F0U A;  2WIN I;  3SGA E;  3SNE A;  2OQU A;  4Q7Y A;  1CT4 E;  1SSX A;  2BD9 A;  4GVU A;  3RC4 A;  1HB0 B;  3GYL B;  2BM2 A;  4KKD A;  2HNT C;  3CS0 A;  3RMM H;  4DW2 U;  3RXD A;  1C5U A;  5T3H A;  3RXE A;  2WYG A;  3DT0 H;  1YWU A;  1NZQ H;  1RFN A;  4B6F A;  1PPG E;  4DT7 B;  5TJX A;  1VKY A;  5EOK A;  3GCH B;  2Y5H A;  3GS9 A;  2G5V A;  3E6P H;  1HFD A;  2H9H A;  4DY7 B;  1FLE E;  5E2O A;  4KEL A;  1Y8T A;  2QE7 D;  3LU9 B;  1W0K D;  2ZHW H;  1TOC B;  2FTL E;  1PPF E;  3H5C B;  1MAX A;  2D8W A;  2ALV A;  3AAV A;  3GIC B;  2KAI B;  1EXF A;  1AE8 H;  1IQG A;  1G3E A;  3MI4 A;  1OX1 A;  5FCR A;  1ZPC A;  5DKM A;  4AOQ A;  1HAI H;  1C2L A;  2WPK S;  2B8O H;  3FVF B;  3U98 H;  2BLQ A;  2KCP A;  4YZU A;  1Y3X A;  1ARC A;  3K65 B;  4MTB A;  1Z1I A;  1V2L T;  4NA7 A;  1P3C A;  1K1J A;  2F4L A;  3ZZ8 A;  1SGQ E;  1D3D B;  3QLP H;  5LPE A;  1BRB E;  5IK2 D;  2CHA C;  2OC1 A;  2VWN A;  4FUE A;  1Z71 A;  3LPR A;  4XE4 A;  1AFQ C;  5CE1 A;  5EXM A;  3SNC A;  2ZGB H;  1GI8 B;  4YOG A;  3RC5 A;  3ATI A;  4DOQ A;  3WWB A;  4KGA A;  2WV4 A;  2Z3D A;  3IIT A;  3RU4 E;  1O32 A;  1ID5 H;  3PO1 C;  3N7E A;  3VB6 A;  3SUE A;  1CGH A;  3V7T A;  2A5K A;  3P8N A;  2R0K A;  2KAI A;  5F8Z A;  1AVG H;  1P2N A;  1TX7 A;  1NTP A;  4JZ1 A;  3U1J B;  1HAO H;  3OTP A;  2KCA A;  1DSU A;  1UTO A;  2THF B;  1O36 A;  1P01 A;  1GBF A;  4ABE A;  7EST E;  4DII H;  4ABI A;  1ANB A;  1QR3 E;  2RA3 A;  4XD7 D;  5F8X A;  4CR5 A;  4ASH A;  3TU7 H;  1J15 A;  2H6M A;  3MYW A;  4Z6A H;  2B9L A;  4FUH A;  5A8X A;  5FX5 A;  3FAO A;  2HAL A;  1G36 A;  1GBJ A;  1D4P B;  3A7Y A;  2Y5G A;  4KTS A;  3BEF B;  2QV1 A;  2XXL A;  4Y79 A;  1C1S A;  2PUQ H;  2TRM A;  3ATK A;  1LVB A;  1O34 A;  4NG9 H;  5HIZ A;  1F0R A;  2A7J A;  4IS5 A;  4B76 A;  2XBX A;  1AB9 C;  1O5G H;  1TLD A;  1LKA A;  3EQ0 H;  1O5F H;  1WAY B;  1MKX K;  2BX3 A;  1LQD B;  1GL1 A;  5FBI A;  4FUJ A;  1N6X A;  4BTI B;  5C3N A;  3BTK E;  1T8N A;  4H6S B;  1GHB F;  3PMA B;  1IQK A;  2F9O A;  2ZDA H;  2FOF A;  2ANM H;  1RRK A;  2ULL A;  2ZHQ H;  4RT0 A;  4OGY A;  1C2E A;  2W6J D;  1DX5 M;  1YPL H;  1FY5 A;  1H4W A;  2PTC E;  2LNC A;  3KQE A;  1O2K A;  1ABI H;  4YT6 H;  4WMF A;  1A0L A;  1TGN A;  1YPG H;  4XDE A;  5K0H A;  1TNL A;  5AHG H;  1TBR H;  1J16 A;  1A3B H;  1FON A;  1SPJ A;  1DS2 E;  1YP9 A;  4QT8 C;  3Q00 A;  3LJJ A;  3S9A A;  1WTH D;  4O3U A;  3KF2 A;  1P06 A;  2BDY A;  1BDA A;  1ZPZ A;  4YXW D;  5HIY A;  2W3I A;  1ANE A;  4FU8 A;  4LK4 A;  3KNX A;  2ZHF H;  2XTT B;  2XBW A;  3HGP A;  2VH6 A;  5HM2 A;  3LGI A;  2EI7 A;  2GDD A;  1JXP A;  2OCV B;  1ZR0 A;  3M7U A;  2VWL A;  5F53 A;  5DP9 A;  4FXG H;  5JBT A;  1JIM A;  3A8B A;  3QGN B;  4TWY A;  3F9E A;  2R0L A;  1Z7K A;  2BLW A;  3SZE A;  4B6E A;  1FUJ A;  1PQ5 A;  2G4T A;  1DAN H;  2O8M A;  2NU3 E;  2SGP E;  4B2C A;  1VIT G;  4UD9 H;  1JOU B;  3PRB A;  1BMN H;  2PKA B;  3EGK H;  1DDJ A;  1EJN A;  3SW2 B;  3UNR A;  1T4U H;  1EZS C;  1K22 H;  3F2G A;  2UWL A;  1OWJ A;  1P57 B;  2ODQ A;  2VVC A;  2ZGC A;  4YT7 H;  2RDE A;  3A81 A;  5C2Z A;  2TGA A;  2HLC A;  4EST E;  2FX6 A;  3PMJ A;  4IMZ A;  5C0U A;  4ISL A;  3ZVD A;  4AFZ A;  4UFG H;  4IN2 A;  2F91 A;  3NK8 A;  1ETT H;  2WHX A;  1V2V T;  2ZCH P;  5FHT A;  2HVY B;  1W0J D;  1SGI B;  3U9A H;  2YMS D;  3TH4 H;  3S7K B;  1ZHR A;  1C5Z B;  1DWD H;  2ZF0 H;  4KTU A;  1SR5 C;  2NU0 E;  2GJG A;  5GCH F;  1O39 A;  2Q6D A;  1UCY H;  1E79 D;  1O35 A;  4LZ1 H;  3ATL A;  3SU1 A;  4YM9 A;  2XC0 A;  2F3C E;  4X1Q U;  3W94 A;  1DUA A;  3O8B A;  3R3G B;  2V0B A;  1HAP H;  1TNH A;  1SC8 U;  1DPO A;  1W13 U;  2EC9 H;  2BHG A;  2LP6 A;  1BTU A;  3PWC A;  4GUX A;  1GHY H;  1UTP A;  1GI3 A;  4MPU A;  4D9Q A;  2UWP A;  2BTC E;  3H7O A;  4NIX A;  3GY5 A;  4BOH A;  4Y7B A;  1OP2 A;  2FOM B;  2IPH A;  3GCN A;  1GMH F;  1SFI A;  3VXE H;  2PSY A;  1SLU B;  4D9R A;  4MDS A;  3DSP A;  1GL0 E;  2M2A A;  2EST E;  1AU8 A;  4X6O A;  1G9I E;  4RSP A;  4B75 A;  2BZ6 H;  2PTN A;  1D3Q B;  1Y59 T;  1C2D A;  3P92 A;  3GIS B;  2ZDV H;  4LXB H;  1SQR A;  1K21 H;  2A7C A;  4H6T A;  3TIU A;  1C1O A;  2SFA A;  1TBZ H;  2FOA A;  1O3L A;  4K60 A;  5FPT A;  1ETR H;  3E3T A;  3UR6 A;  4I8G A;  2BY7 X;  1W7G H;  2HWL B;  4X8T H;  1BIT A;  2C8Z B;  1MTN C;  2GMT B;  2V35 A;  1UHB A;  4WWY A;  1B5G H;  2VH0 A;  1AN1 E;  1GBA A;  2Z6B D;  2G5N A;  3SQE E;  3VGC B;  1HRT H;  2OBQ A;  1DXP A;  3KN2 A;  1YPH E;  3E16 B;  1BBR K;  3S9C A;  2J94 A;  1ZYO A;  1GVZ A;  4M7G A;  1OPH B;  5A0B A;  1NBM E;  2O8W A;  3CS7 A;  6GCH G;  1FXY A;  2AMD A;  1C5Q A;  3UWJ H;  1MKX H;  2M5T A;  4ZH8 A;  2ALP A;  1ELB A;  2VNT A;  2AFQ B;  3NXP A;  2J5U A;  2FOE A;  1MU6 B;  1QJ6 B;  2VIW A;  3ZVC A;  4ZHA A;  1GCD A;  1QJ1 B;  1V2R T;  2FI5 E;  3S9B A;  1PQA A;  1BQY A;  3TLO A;  4GSO A;  3KQD A;  1Z6E A;  3NCL A;  3TPI Z;  2ZIQ H;  1TGS Z;  1COW D;  1AFQ B;  3MU4 A;  5HYO A;  1G2M A;  3QTV H;  4DIH H;  2FLR H;  2QA9 E;  3KL6 A;  3GYM A;  4WXI A;  1O3G A;  1TFX A;  1P10 A;  4ABJ A;  2WV5 A;  1THS H;  5KEC A;  3GCT G;  4TSF D;  5AF9 H;  5EW1 H;  4CHA B;  2J34 A;  4BAQ B;  3MO3 A;  2QYI A;  2W6I D;  1NRN H;  3LGY A; 
#chains in the Genus database with same CATH homology
 3F0P A;  3N7D A;  2OC8 A;  3OE7 D;  2YMS B;  2XCN A;  2QF4 A;  3OYP A;  2A4G A;  3PV2 A;  5DSF A;  2AHM E;  2FOM B;  2YMS C;  2YOL A;  2XOK D;  4I32 A;  1DY9 A;  2OIN A;  1OHH D;  2KCP A;  3DSO A;  4NWL A;  2K0Q A;  3PV5 A;  4I31 A;  3KF2 A;  3DSP A;  4TYD A;  2M2A A;  2F4L A;  2FP7 B;  4B75 A;  4JMY A;  3SU6 A;  5FPS A;  5FPY A;  5IK2 D;  2WSS D;  1FX0 B;  4YXW D;  2OC1 A;  4A92 A;  2LEL A;  2F9U A;  4WH6 A;  3SYJ A;  5HKK D;  2V7Q D;  4DT4 A;  1RTL A;  5CDF E;  1SKY E;  3KNX A;  5FL7 D;  3U1I B;  3H09 A;  4TT3 D;  3RC5 A;  2JJ1 D;  2OC0 A;  2GVF A;  4I33 A;  4K8B A;  5FPT A;  3WWB A;  4A1V A;  2IJO B;  2L6O A;  1JXP A;  2XNI A;  3N7E A;  5IDK A;  3SUE A;  3O8D A;  3P8N A;  3RC6 A;  5F53 A;  3NRL A;  2KM0 A;  5T1V A;  3SV6 A;  3U1J B;  1WXR A;  3OTP A;  2KCA A;  3SV7 A;  5C0T A;  2A4R A;  5GJ4 B;  3O8C A;  3OEH D;  3SZE A;  1DXW A;  3P8O A;  3O8R A;  3DCL A;  4B6E A;  2KR7 A;  4B74 A;  2JDI D;  3SU3 A;  2O8M A;  3M5O A;  1S6L A;  4WF8 A;  5GND A;  4U01 A;  2KFW A;  3OAA D;  4XD7 D;  2KCO A;  5CHB A;  2WZQ A;  2OBQ A;  2XND D;  3E90 B;  3PRB A;  2K1Q A;  2A4Q A;  2JJ2 D;  1NBM D;  1DXP A;  3KN2 A;  3PRD A;  4OM9 A;  1E1R D;  3F0O A;  3F2G A;  3F2H A;  3SU4 A;  3SU5 A;  3SUD A;  1MAB B;  1N1L A;  4FET A;  3AK5 A;  1NBM E;  5EQQ A;  3F2F A;  4ZCN A;  3FKS D;  4RI0 A;  4WH8 A;  5EQR A;  5EPY A;  4ASU D;  1KMH B;  2GGV B;  3WW7 A;  4KTC A;  5C17 A;  2JIZ D;  2QV1 A;  3SV8 A;  3M5N A;  3F3B A;  1W3C A;  3SUF A;  3LOX A;  3FO8 D;  5EQS A;  2K8I A;  2WPD D;  2XCF A;  5ESB A;  3ZIA D;  5C0U A;  4A1T A;  5GPI B;  2P59 A;  2F43 B;  4B76 A;  2J5U A;  3SU2 A;  3SU0 A;  5B6L A;  5H4I B;  3RC4 A;  4NWK A;  3UB0 A;  2FM2 A;  1DY8 A;  3SV9 A;  4F55 A;  2OBO A;  3M5L A;  1H8E D;  4R8T B;  3FOA A;  2IJD 1;  2WHX A;  3VG8 A;  3WWF A;  1BT7 A;  4Q4L A;  1W0J D;  1A1R A;  2YMS D;  2WV9 A;  1BMF D;  5ETX A;  1H8H D;  3LON A;  4B71 A;  4Z1M D;  1COW D;  3N99 A;  4B6F A;  5EPN A;  3EYD A;  1NS3 A;  3GS9 A;  3M5M A;  4B73 A;  1RGQ A;  1E79 D;  2F9V A;  3FN8 A;  2OC7 A;  3L6P A;  3SU1 A;  1E1Q D;  3SUG A;  2VBC A;  3KEE A;  2QF5 A;  1EFR D;  3OFN D;  2QE7 D;  5DN6 D;  2W6J D;  1W0K D;  2HLD D;  2KCY A;  2KZ4 A;  3O8B A;  4M9F A;  4A1X A;  4TSF D;  2OK5 A;  3OEE D;  1CU1 A;  4Q63 A;  2CK3 D;  2W6I D;  3LKW A;  3W1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...