5HYOA

X-ray structure of unbound porcine epidemic diarrhea virus 3clpro
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
301
structure length
301
Chain Sequence
AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVICPRHVIASSTTSTIDYDYALSVLRLHNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDGSAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMTTVVNTDCFSILAAKTGVDVQRLLASIQSLHKNFGGKQILGYTSLTDEFTTGEVIRQMYGVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords PEDV 3CLpro
publication title X-Ray Structure and Inhibition of 3C-like Protease from Porcine Epidemic Diarrhea Virus.
pubmed doi rcsb
source organism Porcine epidemic diarrhea virus
total genus 83
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 5hyoA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5hyoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5hyoA01
1EJNA 1FY8E 1IHTH 1C4Y2 4DVAU 1M9UA 3M5OA 1BCUH 1S82A 5LPFA 3H7OA 2F9BH 2ZGJA 2A7HA 2QN5T 1VGCB 1GJBB 2ZGHA 1O2WA 1QB9A 2F9VA 3DFJA 1LVOA 1JRTA 3ATIA 2R0LA 2R9PA 5H4IB 3SV2H 1GJCB 1TPOA 5I25A 3AAVA 4Y6DA 5EXNA 4DCDA 1YBWA 1QJ6B 1BMAA 2XBWA 1IQIA 1V6DA 1XUHA 2FM2A 2ZGXH 2ZHDA 3HKJB 1GI0A 3A7VA 2H5CA 1NTPA 2PFEA 3E3TA 2HOBA 1FZZA 1HAGE 4E7NA 2C93B 4CRCA 1CT0E 1W7XH 1YP9A 1YC0A 3QWCH 3SI4H 1YF4A 5C1YA 3TK6A 1L1JA 1DFPA 1G36A 1Z6JH 4ISLA 1AFEH 1NPMA 1NC6A 2FX6A 1Z8GA 1OKXA 1ZTKA 2Z3CA 1NROH 1SLWB 1ABJH 1TAWA 4NIXA 1C2FA 3SUFA 4ABBA 1P05A 4CR5A 3BTHE 1A5HA 1V2VT 2FOGA 1SPJA 3RXMA 2FYQA 4DIIH 4IGDA 3TU7H 1MTSA 3AASA 1C1WH 4AFQA 1H9HE 4D9RA 3EAJA 3OSYA 2ZHEH 1LPKB 1O5AB 1TX8A 4GVUA 2ZPSA 1GCTC 1BMLA 3P17H 2BXTH 1GPZA 1ZRKA 1QCPA 1N6YA 4XFQA 2ZHQH 3L6PA 1G3EA 1HJ8A 3LC5A 1A4WH 1QBVH 1BRCE 1KLTA 2ZG0H 5LPEA 1GDNA 2ODPA 3PWBA 1SGFG 1F0TA 2XBVA 3DT0H 2GCTC 3VXEH 1QBOA 3FVFB 3A89A 1K2I1 2F9PA 1HYLA 4ISNA 4YO9A 1ANEA 4U01A 1DY8A 1O2OA 2G51A 3RXBA 1VCWA 1NRNH 1BTWA 2VIOA 2BD4A 1O2YA 4WH8A 1DWEH 4K69A 3TH3H 2ZFSA 2BHGA 1S81A 4JZ1A 4WMEA 4K8BA 3VXFH 4CH8B 1WTGH 3SNCA 2FP7B 5A8YA 3SU5A 3B23B 3BN9A 4K5ZA 4ZKOU 1Y5BT 4ABDA 1GI3A 3GICB 2SNVA 1FAXA 1YPHC 2SGAA 2ZPQA 2FTMA 1BHXB 3K2UA 2FX4A 3PLPA 3MWIU 1XMNB 3QGNB 3SJ9A 2J2UA 1AMHA 2QGRA 1CVWH 2G5NA 2ZI2H 3I77A 3Q3KA 1AB9B 5CMXH 1SMFE 1KDQA 3LDXH 1A5IA 5AFZH 3FP8E 2ANWA 1S6FA 2G8TA 3K6YA 1QJ7B 2BDBA 1GMHG 1A46H 2P8OB 1J16A 3QO6A 3UNQA 1P9SA 1QJ1B 4NSVA 1HUTH 2IOTA 4FUEA 1F5RA 2OC1A 1SLVB 5C67A 4TY6A 1AUTC 2Y81A 1Q31A 1YPMH 2HLCA 2PUQH 1XVOA 2JH6D 2Z9LA 3NK8A 4SGBE 4GCHG 1O2KA 2BTCE 3BTTE 3ZZ3A 1F5LA 7GCHG 1NRSH 1TRNA 5GXPA 5GIBA 3PWCA 3M7TA 1RTLA 8ESTE 1ZSKA 1GJ6A 4AG2A 1BBRH 3UREA 3BEFB 3ZZAA 3AVZA 1TNKA 1O37A 2Q6GA 1HJAC 2TBSA 3K9XB 3GDSA 1HB0B 1MQ6A 1SBWA 2UWLA 3UNRA 4CR9A 3SUEA 3RXUA 3ZZBA 1EXFA 5DK1A 1MU6B 1TBZH 1Y3YA 4B1TA 2C90B 1GL0E 4FUHA 3H7TA 3TH4H 3STJA 1MTUA 2D26C 1O2VA 1BZXE 4FUGA 2F9OA 3IG6B 2XCNA 2Y7ZA 1FI8A 1C2EA 1ELEE 1LMWB 3A86A 3BTWE 5DJ7A 3SBKA 1YCPK 1CT4E 4BAMB 5CHAC 1MAYA 3BIUH 2GVFA 3RXDA 1HLTH 3MU5A 3S69A 2FYRA 3MH4A 2FOAA 4X2YA 3ZV8A 1MQ5A 3MU4A 2ZU3A 3QN7A 3EE0B 3W94A 3SU0A 2G5VA 1RTFB 2WPJS 3TNTA 2HVXA 4LZ4B 2VIWA 5GPIB 2ALVA 1GBIA 1PPGE 1OS8A 1XUKA 1VGCC 3QTVH 3D49H 1QNJA 2F83A 2GV7A 1DANH 3KNXA 2BDIA 2JETB 1ACBE 4JZFH 1SQOA 1O2LA 3K65B 4I8LA 5LH8A 2W3KA 1OYQA 2ZU1A 3GY6A 2BY9X 1BT7A 2ESTE 4NCYA 1AVWA 8GCHG 4NWLA 4GLYA 1KXFA 3HKIB 4FUBA 2Y7XA 5F8TA 3SHCH 2RA3A 1V2WT 4IC5A 4MQAA 2ZEBA 2ZWLH 1S0QA 4B75A 4AYYB 1EUFA 1UVOA 1HIAB 2FESH 2B7DH 1AD8H 1B0EA 1HDTH 2CGAA 2OUAA 3V7TA 4BTUB 2WINI 1GHAF 3P8OA 3GY4A 3KEEA 4MNVA 4A1TA 1G3CA 3OU0A 3LGVA 5E2PA 2Z94A 1V2RT 2O8WA 2OP9A 1NO9H 2D8WA 2NU1E 4MPXA 3PROA 4IMZA 2ZHFH 3SNAA 1H9LB 3S9AA 2AS9A 4MG3A 5A0CA 2BD8A 2QXJA 3R3GB 1C2LA 1PPEE 1A3BH 2STAE 1O34A 3SQEE 1KY9A 5A09A 2O8MA 1GBMA 1FY4A 1TWXB 1FPCH 2ZFQH 4E06H 1C2KA 1T32A 2R2WU 2PWXA 1V3XA 5FBEA 2QYIA 1MZAA 1ZJDA 5A8ZA 4KGAA 4Y10E 1CGIE 1RFNA 3A7TA 2QAAA 3GDVA 1O33A 1DX5M 2AGGX 5TCCA 3T62A 4D9QA 1OWHA 4MNWA 1EOLA 2V3HH 3P92A 1KXEA 1Z1JA 2OD3B 4WVPE 3SU1A 3TITA 4AFUA 3QZRA 1K1MA 1YPHE 4NFFA 4Y76A 3T5FH 2PSXA 2VGCB 4ABGA 2VU8E 1C1OA 4INLA 2F9UA 1XUGA 2W5EA 1FDPA 1GJAB 3UR9A 3RMNH 4K2YA 4X6MA 4ABHA 4OS6A 4YLUA 4MLFB 5K7RA 2VVVA 3GY5A 4AB8A 3SNBA 1GCDA 1QL8A 1TQ7B 1EPTB 1W3CA 1NU9A 2ZCHP 3MU1A 4Y0YE 1XVMA 1K1LA 1YPKH 5DP5A 1GI7B 4IC6A 3URCA 1P11E 1D6RA 3HGPA 4Q7XA 3RXRA 4LK4A 1PYTC 5FPYA 1HAPH 1LHCH 1ESBA 1TPAE 1F92A 2IJOB 4Y8XA 1D3QB 3RP2A 1O2QA 3MH7A 1DLKB 1EJAA 4HTCH 3TH2H 1D3TB 2KAIA 5J4QA 1YGCH 1MMJN 1LKAA 3T25A 1ZMJA 3RXVA 5AFYH 5ESBA 3KQBA 3ATLA 1V2TT 5TCAA 1AB9C 2B0FA 5EG4A 1SG8B 4Y71A 2XC4A 1OX1A 1VITF 2BDCA 5EQQA 1NN6A 3HK6B 2QF0A 4A1VA 4CREA 1GI6A 1GBAA 1C5ZB 3V0XA 1O2GH 3FANA 3PYHA 2CF9H 3RU4T 4NSYA 3BEIB 4K8YA 1YPJH 4OS4A 2P8OC 4UEHH 4INKA 4JYTA 2DE8A 3PTNA 1CGHA 4K3JA 1ANBA 3SJKA 3RC4A 3O8DA 2JKHA 1CA8B 1DSUA 1TLDA 3A7XA 3D65E 4Y11E 1UJ1A 1KTTB 1NFWA 1KXCA 4BAHB 3DHKH 4NA8A 3F9HA 4AFSA 2AGEX 1UO6A 2BVRH 1HAHH 2PKAA 1FN8A 1AZ8A 1BQYA 3F9EA 3MH5A 2GP9B 3QX5H 1SL3A 2QXIA 3GCTG 4YM9A 1Z8RA 3M3TA 3RXSA 2OBQA 1C5UA 1W7GH 1ZOMA 3VB7A 5GJ4B 3LIWA 3V3MA 1V2OT 3GYLB 1Y59T 3FP7E 1UCYK 3MNXA 1A0JA 1PPFE 2F9NA 4ZHLU 4WWYA 4DT7B 1HAVB 1O5EH 2C4FH 1C2IA 1E36B 4MDSA 4NA9H 3SGAE 5BPEA 5FXLA 1P06A 3PV4A 4J1YA 3S7HB 4DY7B 1QA7A 1AVXA 3SW2B 3OTJE 2FDAA 2ZDVH 3U8TH 4E05H 1DM4B 1WBGB 2GDDA 1DOJA 2PSYA 1OOKB 3Q3YA 4BNRA 1HBTH 4BTTB 3RXEA 1AU8A 3RM0H 3A8BA 4X6NA 4BAOB 1OWJA 3BG8A 7ESTE 4NFEA 2CMYA 3QDZB 1LQDB 3LONA 1IQKA 1UK4A 1WTHD 1A3EH 2EI7A 1A1RA 1DDJA 3EYDA 3QK1A 5DP6A 3CENA 1BMNH 1ZHPA 1SVPA 1T8NA 4ZKSU 1G2LA 2PTCE 4CRGA 5DP7A 2ZCLP 3RXJA 1Q3XA 1NT1A 5HM9A 1XXDA 2VVUA 1K1IA 3SJOA 3QTOH 1SGYE 3QUMP 3KQEA 5TJXA 3KGPA 3ZZ5A 1C5NH 1ESTA 2SNWA 1NS3A 2PV9B 3SU4A 3FAOA 1GGDB 1THPB 2C8XB 1HXEH 5A0BA 2P3UB 1GHWH 3AAUA 1Z8IB 1BBRE 1TNGA 5L2YH 6LPRA 1TGNA 4BXWA 3A8DA 3SZNA 1QY6A 2BY5X 3ITIA 3MO9A 3Q3XA 3GCNA 4GCHF 3E8LA 1F5KU 4ABAA 1LCYA 2A5KA 2ZZUH 1TMTH 2ZPRA 6CHAC 3M5NA 2OINA 4Y7BA 2EI6A 3ODFA 2CF8H 5DG6A 3OYPA 4DURA 3SGQE 3F68H 3A81A 3E6PH 1JWTA 8LPRA 3SN8A 3B8JA 3TPIZ 4FVDA 4ZKNU 1HAYB 5T3HA 1FMGA 1C4V2 2FMJA 1TONA 2Y80A 2FOHA 1Y3WA 3R0FA 1GI5A 4WMFA 3E0NB 4YTAA 1SGCA 4XDEA 5C1UA 5AHGH 1GJ7B 2D2DA 4AZ2B 1ETSH 2O9QA 3GY7A 2JH0D 1BTZA 1EJMA 3MOCA 5EW1H 5FBIA 1QB6A 3ELAH 2RG3A 2BMGB 4AX9H 1RD3B 1C5OH 1MKWK 1BMMH 3PLKA 1QQUA 1O3MA 2UWPA 1AKSB 2ZFPH 5E2OA 2VGCC 3LGWA 3UOUA 1TABE 4KTCA 3VB6A 1DICA 1KLJH 2A1DB 1J8AA 3PMBB 1KIGH 1DPOA 5L30H 2ALPA 4MPUA 2ZDLA 1VJAU 2TIOA 4K1SA 3TJUA 1O3FA 1ZYOA 1BUIA 3KHVA 2BLOA 1EPTC 1Y3VA 1QTFA 1LQEA 1WSSH 4ABIA 4MNYA 5EPYA 3A87A 1GHYH 1ETRH 2PTNA 1C4U2 4JZDH 1GI9B 1TGTA 4GAWA 1DSTA 4JCNA 3MFJA 1GMDF 1G3DA 8GCHF 1V2PT 2ZECA 2A5AA 2BDAA 4AB9A 1YLCA 2P95A 1AI8H 3SU6A 3SOSA 3GY8A 2STBE 5IYTA 1AVGH 1FAKH 4CRBA 1O3IA 2UUFB 3NZIA 3W95A 5B6OA 2EA3A 3VPKA 5GCHG 4UFEH 5G4BA 2Q6FA 3EBNA 1ZPBA 1G2MA 3VEQB 2PHBA 4YZUA 2BZ6H 1P3EA 2ODYB 3RC5A 2HPPH 1C2DA 2RDLA 1Z1IA 1AN1E 4D7FA 1O0DH 1QQ4A 1GBCA 1MTVA 1NZQH 1SGIB 1KSNA 4X2XA 1C1PA 1G30B 2O8LA 1GVKB 4OS2A 3OX7U 4OS7A 4Y8ZA 5GWZA 1GI1A 1O3HA 4O97A 4SGAE 5E0GA 1K9OE 3VB4A 3UTUH 1ZSJA 4Q7YA 3MHWU 1YKTA 2Z6BD 4BTIB 1V2UT 4PROA 1MBMA 2ZO3H 1LPGB 2OCVB 1V2QT 2TGTA 1TOMH 1MH0A 3KN2A 4H42U 1TNLA 2OQ5A 2GMTC 2Z9GA 1O2NA 2IN2A 3AW0A 1AWFH 4VGCB 4TPYA 4IN1A 1RGQA 1THRH 1ARBA 3TJOA 1O3EA 2BY6X 3P95A 2A2XH 1DUAA 2Z7FE 3QZQA 3RUOA 3ZVCA 2BX3A 3BTKE 1O3JA 3LGUA 2OQUA 4MPWA 3LC3A 2RA0A 4LOYH 4ZAEA 1TNHA 1C5YB 1W0YH 2BLWA 1KXAA 1G9IE 1ELVA 1HNEE 3UQOA 3AW1A 3D62A 2A4QA 1NRPH 2TRMA 3M37A 4WF8A 2J4IA 1TRMA 1PPHE 2NWNA 3VFEA 1UTQA 1GMCG 5K0HA 3MO6A 1INCA 4KTUA 1TGSZ 1L1GA 1RJXB 4ISHH 4WY3A 1IQNA 2ZFTA 2QCYA 1MCVA 4GHTA 1P2OA 3BTQE 3FP6E 1PQ5A 1BA8B 1SGQE 5C2ZA 2GT8A 1EOJA 1W0ZU 1ZMLA 1NM6A 1J14A 2OTVA 3UFAA 4ASHA 3PO1B 1AZZA 1O3BA 2CHAB 1GGDC 2F91A 5AF9H 1J15A 4Q80A 1GJ5H 4QT8C 2D1JA 4CH2B 1P2KA 1F2SE 3CS7A 1GI2A 1O5BB 2BLQA 5EQRA 1EAUA 2SGDE 4WMDA 2ASUB 1QRWA 2BYAX 4NIVA 1KXDA 2GTBA 2LPRA 3KQCA 3A80A 4Z0KA 5ABWA 1OYTH 4ABEA 3RMOH 1BOQA 1YCPM 3BTME 1IQFA 3SQHE 1EKBB 1C5PA 1ELTA 1FLEE 3ZVFA 3LU9B 3SORA 4WXIA 5JBBS 2C8WB 4RN6A 4AOQA 2BVXH 2HPQH 2XCFA 3M5LA 2WPIS 4A7IB 2P94A 3LH1A 1V2MT 1N8OB 3IITA 3SGBE 1C1NA 3MU8A 3ZV9A 3S9BA 4XSKU 2ANYA 3U9AH 4ABFA 3BTFE 3TGKE 1Q2WA 5EU8A 2FLBH 4I32A 1TFXA 2H5DA 2UWOA 1ZGVA 4BXSA 2R2MB 4J2YB 2THFB 4ZMAH 3EA9A 3T26A 3GCHB 1BRBE 4I8GA 4IW4E 1O2JA 1GBDA 1AHTH 3BSQA 4ZXXH 3MO3A 1YPLH 1D3PB 1OWKA 3N7OA 4GUXA 3KL6A 3F9GA 1BRAA 4XBCA 1MKXK 1GBTA 1UK3A 4OS5A 3RXQA 3ZYEA 2FS9A 2ZNKH 1OP0A 4X1NU 1C1RA 3M3VA 3A7YA 4JK6A 1O5GH 1H8IH 2GCHF 1MZDA 1FY5A 5JBTA 3GY2A 2ZU4A 1HAIH 1MD7A 2RCEA 2J38A 1SFQB 2AIPA 2XXLA 3E90B 4Y8YA 1EB2A 2FS8A 2NU0E 3SV9A 3PTBA 2WUCA 3LT3A 4U32A 2J94A 1VZQH 1AE5A 1EP5A 2WPLS 4HGCA 3ZVBA 1BJVA 2W3IA 3RMLH 1D3DB 1TPSA 5JBCS 5HM2A 2FWWA 2PLXA 4FVBA 4I8JA 2SFAA 2VINA 6CHAB 1TIOA 1MTWA 5JB9S 1O2TA 4Y7AA 1E37B 7KMEH 4ZKRU 3NXPA 1GHBF 1UK2A 1L1NA 3LGTA 1VITH 4JMYA 1T31A 2VWLA 1DXPA 1TA6A 5IDKA 2B5TB 2PR3A 1KXBA 3A7WA 1F0UA 2ZF0H 2FPZA 3FZDA 2OC0A 4X2WA 2EC9H 2J95A 3EA8A 1PQ7A 1K28D 2TGDA 2LIZA 1AY6H 2K1QA 1XKBC 1LTOA 1MUEB 3PLBA 4HZHA 1D4PB 1PPBH 4JZIA 5EXMA 1TX6A 1C1UH 1O3OA 2J34A 1X7AC 1TBQH 4U30A 1C1SA 4LZ1H 1P57B 1XUFA 1AIXH 1ZTLA 1GBBA 2BXUH 4KELA 4TY7A 4XBDA 1DUEA 1O2UA 2IPHA 1G37A 1O2RA 2ZFRH 1ZGIA 1FN6A 3GYMA 2P3FH 2PW8H 3Q00A 3GCOA 3RU4E 3DUXH 1S83A 1P10A 4K1TA 3ATWA 1GL1A 2AGIX 3ZZCA 1HIAA 2FOMB 2GKVE 3LPRA 2Z9KA 4VGCC 2WYGA 1MBQA 2ZDMA 2C3SA 2H6MA 1NRRH 2Y5FA 1FIZA 1PPZA 1O31A 2GV6A 1ELDE 3TJNA 2GT7A 1F0RA 3MH6A 1KYNA 5FCKA 4O03A 1AFQC 1DLEA 4BAQB 2W7SA 1UTKA 1GI4A 2ZGBH 3H5CB 4O3TA 4DG4A 1OSSA 1O39A 1XXFA 1O3DA 2BOKA 4JYVH 1SLXB 3P6ZB 3A8AA 1TRYA 2HALA 1DT2A 4XOJA 5DP8A 3T2NA 3BEUA 1FPHH 2QF3A 1O5FH 2BVSH 3NWUA 3ZZ9A 3SV6A 4UE7H 4XBBA 4F4OC 1P8VC 1ZJKA 2AIQA 2XWAA 1HRTH 4BANB 1QGFA 2A2QH 1C5RA 1GG6B 3BTEE 1ZLRA 3DFLA 2A7JA 3SNEA 4CBOA 1ETTH 1FQ3A 1Y3UA 1W2KH 1TA2A 5GCHF 1UTJA 3U98H 3DD2H 1S85A 1VJ9U 2JH5D 5F6MA 2Z3EA 1K1NA 1DWCH 5AVDA 1C1MA 1YYY1 1LHFH 1EPTA 4UONA 5T6DA 1IQEA 1FNIA 3CS0A 3PMAB 4HFPB 4DIHH 1FONA 3PO1C 1W8BH 2O8UA 4NZQA 2H1UA 2HRVA 2CHAC 4O9VA 3C27B 2ILNA 1CT2E 4MVNA 1QRZA 1YCPH 2ANMH 2SGFE 3UPEA 3TGJE 1GHZA 2OC7A 1MU8B 1J9CH 2GMTB 1CHOG 1NFUA 4NIWA 2P93A 4A92A 1L4DA 1ZSLA 1ZTJA 3WY8A 4TPIZ 1O36A 3UUZA 1P12E 2G4TA 4CRAA 5A8XA 4UDWH 4FU9A 4A1XA 1SGDE 1FXYA 1C5MD 5LGOA 4ISOA 3BTGE 4NGAH 3Q76A 1EAXA 3UIRA 1NFXA 5FHTA 4RKJB 3ZZ4A 3P8NA 1N8OC 1RRKA 1K1PA 3S7KB 1QRXA 3SNDA 1H1BA 1FV9A 2R3YA 1A61H 4MTBA 1CSOE 4YOJA 1E34B 1E38B 3TIUA 5EXLA 3JZ1B 4B2CA 4IBLH 2Z3DA 1TYNA 1A0HB 1GI8B 1O3LA 3GCHC 3EDXB 2PUXB 2VH0A 1GBEA 1FJSA 1OPHB 1JIMA 1P2IA 9LPRA 2ZDNA 2FEQH 1BTUA 3TNSA 1C2GA 4D8NA 1CA0B 3UOPA 1SHHB 1TMBH 1TPPA 1GJ9B 1RIWB 4X6PA 4LXBH 1FIWA 4NIYA 4U2WA 2FOBA 4GSOA 4KTSA 2I6QA 2GZ7A 1O2HA 3LKWA 3BIVH 1UHBB 1NRQH 2AFQB 3SHAH 2QC2A 4FU7A 1GHVH 3NCLA 1GMHF 1HAVA 5E0HA 5BRRE 1GBJA 3C1KA 1K1JA 2XRCA 5EQSA 3MYWA 4X1PU 4ESTE 3M35A 2BD9A 3NUMA 5T6FA 3ATMA 1HV7A 4FUCA 1GDQA 2AYWA 2QY0B 2G52A 5FAHA 1SGNE 7GCHF 1EQ9A 1GBFA 3ZVAA 1ZRBA 2Z9JA 2FXRA 1Z6EA 1O5DH 2CN0H 2AMQA 3U69H 1OP2A 2B9LA 1LVBA 3LOXA 3KF2A 1PFXC 2BLVA 2BY7X 1RS0A 5CE1A 2I6SA 2FI4E 2FO9A 2ZIQH 1A7SA 4GPGA 2LNCA 2NU2E 3RDZA 2WV5A 3TK5A 2C8ZB 2WPKS 4CRDA 2B8OH 2ZU5A 2V0BA 4X0WU 5C3NA 2ZGCA 3LJJA 5JPMH 1WUNH 3O8RA 5LPRA 4ZUHA 1SSXA 3I29A 4OGXA 1P2NA 3EQ0H 1YPEH 1ANCA 2BX4A 1ELFA 2XYAA 1BTYA 1C9TA 3HPTB 1EASA 2VIVA 4FUFA 2H9EH 1AUJA 1BBRK 3B9FH 1WQSA 2G55A 1PJPA 1OWIA 2BDYA 1BITA 2TGPZ 5HXFA 4B73A 1D9IA 1UVTH 2OLGA 1NFYA 1QBNA 4FXGH 1XM1A 1TOCB 3MMGA 1Z71A 2A4GA 4AN7A 4DJZB 1E35B 1SOTA 2FOFA 1P2MA 1C5LH 2UUJB 1UTLM 4FU8A 1BRUP 1FY3A 2ANKH 2BDGA 3S0NA 3JZ2B 1ELGA 1J17T 5EOKA 4FUDA 4AG1A 3URDA 3A88A 1ZHMA 4I31A 2FLRH 3V12A 1V2NT 1ELBA 3MNCA 2ZTYA 3LH3A 2ZQ2A 2A4RA 1JIRA 2VIDA 4R8TB 1C2MA 3T28A 2DUCA 1ABIH 2XC0A 2Y82A 4BOHA 1O2MA 3MNBA 2XBYA 2FOCA 1WOFA 3NPSA 2ZP0H 1GG6C 1AKSA 1DITH 1O3GA 4I8HA 4YESB 1OWDA 2SGPE 4X8TH 1C5WB 1OP8A 1SGRE 1V2LT 1NESE 3ZZDA 1VITG 2CJIA 2P3TB 1TQ0B 2BD2A 4XE4A 1UCYH 1EP6A 1ZPCA 3LGYA 1P0SH 3V13A 1S5SA 1W11U 3SO3A 1OXGA 2VNTA 2G81E 3GDUA 4NA7A 1EB1H 1Y3XA 4OGYA 3HGNA 3BTDE 4JZEH 1O3PB 1O2SA 1TGBA 1EAIA 2FZZA 3P70B 3S9CA 1C2JA 3OY5U 2XNIA 1DS2E 2Q1JA 2FOEA 2BQ6B 3M36A 2WUBA 1QA0A 1BTHH 1CU1A 1G32B 2XW9A 2F3CE 1KDQB 1HJ9A 4M7GA 5I46H 2ODQA 2A7CA 1SI5H 4WJG2 1W14U 1XUIA 2AERH 2XTTB 3G01A 3ATKA 1VR1H 1AFQB 4NG9H 1C5TA 1CQQA 1GBKA 1S6HA 4Y0ZE 3A7ZA 4Y79A 1B0FA 2V6NA 5A0AE 1UVPA 1SGTA 4TWWA 1XUJA 1TGCA 1T4UH 4I33A 2TPIZ 5DP3A 5HMAA 1HAZB 1P09A 4ZHMU 1N6XA 4YOIA 1GBHA 2AEIH 1IQLA 4E7RG 1GVZA 1LHDH 2P59A 1KLIH 1CGJE 1WYKA 5F03A 1LHEH 1ELAA 1ANDA 2W7UA 1WCZA 3RXAA 5EPNA 3OY6U 1A2CH 1C2HA 1CA0C 1ARCA 1O38A 8KME2 5DPAA 1A5GH 1CBWB 2ZKSA 1RIWC 1T7CA 2BDHA 2BD7A 3L33A 4KKDA 5DP4A 4D76A 3TK9A 1S0RA 1B5GH 2WPHS 5JYIA 1LDTT 1FY1A 1V2JT 3SI3H 2A31A 2YNAA 4CHAB 1P9UA 1VCQA 2R3UA 1TB6H 1EZUC 2Y5HA 3MNSA 3ZZ8A 4HI3A 3A84A 3ZZ7A 1SLUB 2J9NA 1RTKA 1GDUA 3RXKA 4H6TA 1W10U 3RXCA 1ID5H 1IHSH 9ESTA 1PYTD 1C1VH 2FI3E 2VWMA 2VH6A 3E0PB 1QIXB 1O35A 3PM3A 1MAXA 3M7QA 3ZYDA 3GCTF 6GCHG 2YNBA 1CHOF 4H6SB 4WXVA 5C1XA 1ESAA 1BTXA 1MKWH 1DY9A 3KQDA 5F8ZA 1P3CA 2NU3E 4KP0A 1JRSA 5T6GA 1PQAA 1Z8JB 3VGCB 1HGTH 1QB1A 2R0KA 2PGBB 5C20A 5E8EH 4BAKB 4JYUH 5HGGA 1FUJA 3RXFA 2ZFFH 1W12U 1N1LA 1DWDH 3F9FA 1U6QA 3U8OH 3HATH 2CV3A 3U1IB 6ESTA 2OXSA 3SV7A 2A5IA 1O2PA 2BD3A 4AGJA 2VIQA 2BZAA 2ZDKA 1HFDA 1CO7E 1C1TA 1IQHA 3ODDA 2FODA 1UVSH 3O8CA 1VCPA 1F0SA 4MNXA 1HAXB 1BIOA 2GZ9A 1LHGH 3L3TA 1HCGA 1K1OA 2HWLB 2PGQB 2TGAA 5JDUB 2ZU2A 1QR3E 4JK5A 1C9PA 1THSH 2XWBI 1JOUB 4UFGH 4MPVA 1G3BA 1LKBA 4B71A 2EI8A 3LGIA 3A82A 3D23A 1C5QA 1QL9A 1IQGA 1Z7KA 4UD9H 3SJIA 2BB4A 1LVMA 1SGFA 1KTSB 4TYDA 1WQVH 3E16B 2BY8X 5EW2H 2FTLE 2P16A 1L0ZA 1H9IE 1MTNB 1SC8U 5FX6A 1SGPE 2V3OH 5A2MH 2QIQA 1WAYB 2WV4A 2PKSB 4X1SU 1T4VH 2BD5A 1PPCE 1GMDG 2AH4X 4ZXYH 2FI5E 3QLPH 1V2KT 2SGEE 1ELCA 1EZXC 3PMHB 1TX7A 4YT6H 4NZLA 5PTPA 4RSPA 3ZVGA 3BG4B 1JBUH 3UQVA 3I78A 1C1QA 2ULLA 1HXFH 4B74A 3GOVB 1O3CA 1O5CB 2NU4E 1SR5C 1GJ8B 3GY3A 1GJ4H 2VIPA 4X2VA 1H8DH 3TVJB 1K22H 1HPGA 1O30A 2UUYA 4A5TS 2G4UA 5EGMA 1P2QA 1RXPA 4ZHAA 1Y5AT 1O3AA 2Y6TA 3QGJA 2QXHA 1SB1H 3A85A 3SJ8A 2GGVB 1DWBH 1BJUA 1GJDB 1S84A 5FPTA 1OWEA 1GWAA 4DW2U 3UNSA 4X8SH 3RXOA 4YT7H 1BDAA 2AMPA 2KAIB 3VB3A 3P8FA 1IQMA 1JMOH 5SGAE 2BOHB 3ZZ6A 3ZVEA 2WPMS 5DGJA 4AGKA 3F6UH 1YM0A 2ZHWH 1TALA 1TMUH 5JB8S 3TGIE 5FCRA 1MCTA 5DO4H 5DKMA 2HNTF 3K6ZA 4R0IA 1ZPZA 2VB0A 4B2BA 3MTYA 5JBAS 2GX4A 4ZH8A 3NKKA 2Z9IA 2A32A 4IMQA 1O3NA 3PMJA 1UTNA 3U8RH 1SHYA 2BQ7B 3A83A 3T29A 1D6WA 1EAWA 2AMDA 1E0FD 4X8UH 1YPGH 2HNTC 3TJVA 1P04A 1BHXF 1EZSC 2VJ1A 3GISB 4THNH 2GZ8A 4X6OA 1P02A 2QXGA 5E0JA 1V2ST 3EA7A 2PKAB 1MD8A 1ZZZA 3Q77A 1QFKH 1JXPA 1P2JA 2A45B 4H4FA 5F8XA 4UFFH 4WH6A 1B7XB 2G00A 1QHRB 4I7YH 3E91A 1UCYE 1XX9A 4CRFA 1DVAH 1UMAH 4RKOB 3KCGH 1CBWC 1Y8TA 1EZQA 5ESTE 1AE8H 3UWIA 4ISIH 1BTPA 2VWOA 3RXTA 4CHAC 2O8TA 2H9HA 4AYVB 1T8LA 3KIDU 4X1QU 3ZVDA 1GCTB 1WV7H 2A0QB 3RXHA 1P03A 1EX3A 3T27A 3P8GA 1O2ZA 4GHQA 4A6LA 2EEKA 2BQWB 4K60A 3UR6A 3RLYH 1O2IA 4YLQH 1C5SA 2QA9E 2GCTB 1AO5A 5EODA 1L4ZA 1NY22 3FFGA 1LPZB 1BB0B 5HYOA 1GVLA 2J92A 1MKXH 1DXWA 3STIA 1H4WA 1TNJA 5ETXA 2Q6DA 1IQJA 3VGCC 4AFZA 4OS1A 1ORFA 1HAOH 1IAUA 1IOEA 1WU1A 3RXGA 2W26A 1NU7B 4ABJA 2XBXA 2ZC9H 5C5OA 1UVUH 1C5VA 1W13U 2GD4B 2VVCA 4B2AA 3BF6H 4O3UA 1SGEE 4INHA 4I8KA 3O8BA 4D7GA 3IWMA 3E1XB 3RMMH 4CBNA 4TWYA 2ZQ1A 4DGJA 1SQAA 1AGJA 1O2XA 1SFIA 3RC6A 2A4OA 4Z6AH 5L6NH 3MU0A 1QL7A 1GMCF 2UUKB 3ESTA 3RXPA 3VB5A 1GBLA 3SV8A 2XC5A 4X8VH 2CXVA 5L2ZH 4F49A 4AORA 2VWNA 4UFDH 1T8OA 4B76A 3M7UA 5FPSA 3M61U 3SU3A 2GCHG 2Y5GA 1UTOA 4DOQA 2OBOA 1LO6A 2H2ZA 1PQ8A 2ZTXA 1ZMNA 3MI4A 3U1JB 1MTNC 3F1SB 4NWKA 2JETC 3M3SA 3RXIA 4Q7ZA 5FX5A 2C8YB 3UY9A 3SUDA 1CHGA 1SOZA 2PKSC 5J4SA 7LPRA 1UTPA 5C5NA 2ZA5A 3RLWH 1F7ZA 3UWJH 1CE5A 3RU4D 1GHXH 3EGKH 1GHAG 1O32A 4IS5A 3RM2H 4K1EA 1L2EA 4YOGA 6GCHF 1GHBG 1HJAB 3FZZA 2BM2A 3TLOA 3BG4C 2ZDAH 1P01A 2YOLA 1K21H 1AQ7A 1T8MA 2SGQE 1A0LA 2V35A 5GDSH 1UTMA 2WYJA 2OC8A 1UHBA 3M5MA 3PB1E 3DA9B 3SUGA 3RXLA 3CP7A 1Y5UT 1C5XB 2HGTH 4FUJA 4X1RU 1QURH 3HK3B 3LJOA 2GDEH 5CHAB 1EATA 1LVYA 1DE7H 4Q2KA 1TNIA 2H9TH 2FIRH 3A8CA 2QV1A 1ZHRA 2K7XA 4IN2A 1XKAC 2HNTE 3SU2A 5DP9A 1O3KA 1TE0A 4FUIA 3BV9B 3ENSB 1SQTA 2ZCKP 2DE9A 1ZR0A 2ZTZA 1YLDA 2M5TA 1AWHB 4ZROA 1TBRH
chains in the Genus database with same CATH superfamily
1EJNA 1FY8E 1IHTH 1C4Y2 4DVAU 4B6EA 1M9UA 3M5OA 1BCUH 1S82A 5LPFA 3H7OA 2F9BH 2ZGJA 2KCYA 2A7HA 2QN5T 1VGCB 1GJBB 2ZGHA 1O2WA 1QB9A 2F9VA 3DFJA 1LVOA 1JRTA 3ATIA 2R0LA 2R9PA 5H4IB 3SV2H 1GJCB 1TPOA 5I25A 3AAVA 4Y6DA 5EXNA 4DCDA 1YBWA 1QJ6B 1BMAA 2XBWA 1IQIA 1V6DA 1XUHA 2FM2A 2ZGXH 2ZHDA 3HKJB 1GI0A 3A7VA 2H5CA 1NTPA 2PFEA 3E3TA 2HOBA 1FZZA 1HAGE 4E7NA 5HIYA 2C93B 4CRCA 1CT0E 1W7XH 1YP9A 2K8IA 1YC0A 3QWCH 3SI4H 1YF4A 5C1YA 3TK6A 1L1JA 1DFPA 1G36A 1Z6JH 4ISLA 1AFEH 1NPMA 3F0OA 1NC6A 2FX6A 1Z8GA 1OKXA 1ZTKA 2Z3CA 1NROH 3U28C 1SLWB 1ABJH 2WHXA 1TAWA 4NIXA 1C2FA 3SUFA 4ABBA 1P05A 4CR5A 3BTHE 1A5HA 1V2VT 2FOGA 1SPJA 3RXMA 2FYQA 4DIIH 4IGDA 2XNDD 3TU7H 1MTSA 3AASA 1C1WH 4AFQA 1H9HE 4D9RA 3EAJA 3OSYA 2ZHEH 1LPKB 1O5AB 1TX8A 4GVUA 2ZPSA 1GCTC 1BMLA 3P17H 4Z1MD 2BXTH 1GPZA 1ZRKA 1QCPA 1N6YA 4XFQA 2ZHQH 3L6PA 1G3EA 3KQ5A 1HJ8A 3VG8A 3LC5A 1A4WH 1QBVH 1BRCE 1KLTA 2ZG0H 5LPEA 1GDNA 2ODPA 3PWBA 1SGFG 5DSFA 1F0TA 2XBVA 3DT0H 2GCTC 3VXEH 1QBOA 3FVFB 3A89A 3OTPA 1K2I1 2F9PA 1HYLA 4ISNA 4YO9A 1ANEA 4U01A 1DY8A 1O2OA 2G51A 3RXBA 1VCWA 1NRNH 1BTWA 2VIOA 2BD4A 1O2YA 4WH8A 1DWEH 4K69A 3TH3H 2ZFSA 2BHGA 2RDEA 1S81A 4JZ1A 3WWFA 4WMEA 2QF4A 4K8BA 3VXFH 4CH8B 1WTGH 3SNCA 2FP7B 5A8YA 3SU5A 2EQNA 3B23B 3BN9A 1NBMD 4K5ZA 4ZKOU 1Y5BT 4ABDA 1VKYA 1GI3A 3GICB 2SNVA 1FAXA 1YPHC 2SGAA 2ZPQA 2FTMA 1BHXB 3K2UA 2FX4A 3PLPA 3MWIU 1XMNB 3QGNB 3SJ9A 2J2UA 1AMHA 2QGRA 1CVWH 2G5NA 2ZI2H 3I77A 3Q3KA 1AB9B 5CMXH 1SMFE 1KDQA 3LDXH 3DSGA 1A5IA 5AFZH 3FP8E 2ANWA 1S6FA 2G8TA 3K6YA 1QJ7B 2BDBA 1GMHG 1A46H 2P8OB 1J16A 3QO6A 3UNQA 1P9SA 1QJ1B 4NSVA 1HUTH 2IOTA 4FUEA 5C0UA 1F5RA 2OC1A 1SLVB 2WPDD 1KMHB 5EJZA 5C67A 4TY6A 1AUTC 2Y81A 1Q31A 1YPMH 2HLCA 2PUQH 1XVOA 2JH6D 2HLDD 2Z9LA 3DCLA 3NK8A 4SGBE 4GCHG 1O2KA 2BTCE 3BTTE 3ZZ3A 1F5LA 7GCHG 1NRSH 1TRNA 5GXPA 5GIBA 3PWCA 3M7TA 1RTLA 8ESTE 1ZSKA 1GJ6A 4AG2A 1BBRH 2V7QD 3UREA 3BEFB 3ZZAA 3AVZA 1TNKA 1O37A 2Q6GA 1HJAC 2TBSA 3K9XB 3GDSA 1HB0B 1MQ6A 1SBWA 5KGOA 2UWLA 3UNRA 4CR9A 3SUEA 3RXUA 3ZZBA 1EXFA 5DK1A 1MU6B 1TBZH 1Y3YA 4XRNA 4B1TA 2C90B 1GL0E 4FUHA 3H7TA 3TH4H 3STJA 1MTUA 2D26C 1O2VA 1YY3A 1BZXE 4FUGA 2F9OA 3IG6B 2XCNA 2Y7ZA 1FI8A 1C2EA 1ELEE 1LMWB 3A86A 3BTWE 5DJ7A 3SBKA 1YCPK 1CT4E 4BAMB 5CHAC 1MAYA 3BIUH 1H8ED 2GVFA 3RXDA 1HLTH 5GNDA 3MU5A 3S69A 3F2GA 2FYRA 4RI0A 2J97A 3MH4A 2FOAA 4X2YA 4ZCNA 3ZV8A 1MQ5A 3MU4A 2ZU3A 3QN7A 3EE0B 3W94A 3SU0A 2G5VA 1RTFB 2WPJS 3TNTA 2HVXA 3OEHD 4LZ4B 2VIWA 5GPIB 2ALVA 1FX0B 1GBIA 1PPGE 1OS8A 1XUKA 1VGCC 3QTVH 3D49H 1QNJA 2F83A 2GV7A 5KEDA 1DANH 3KNXA 2BDIA 2JETB 1ACBE 4JZFH 1SQOA 1O2LA 3K65B 4I8LA 5LH8A 2W3KA 1OYQA 2ZU1A 3GY6A 2BY9X 1BT7A 2ESTE 4NCYA 1AVWA 8GCHG 4NWLA 4GLYA 1KXFA 3HKIB 2W6JD 4FUBA 2Y7XA 5F8TA 3SHCH 2RA3A 1V2WT 4IC5A 4MQAA 2ZEBA 4ACBA 2RFKC 2ZWLH 1S0QA 4B75A 4AYYB 1EUFA 1UVOA 1HIAB 2FESH 2B7DH 1AD8H 1B0EA 1HDTH 2CGAA 2OUAA 3V7TA 4BTUB 2WINI 1GHAF 3P8OA 3GY4A 3KEEA 4MNVA 4A1TA 1G3CA 3OU0A 3LGVA 5E2PA 2Z94A 1V2RT 2O8WA 2OP9A 1NO9H 2D8WA 3KYGA 2NU1E 4MPXA 3PROA 4IMZA 2ZHFH 3SNAA 1H9LB 3S9AA 2AS9A 4MG3A 5A0CA 2BD8A 2QXJA 3R3GB 1C2LA 1PPEE 1A3BH 2STAE 1O34A 3SQEE 1KY9A 5A09A 2O8MA 1GBMA 1FY4A 1TWXB 1FPCH 2ZFQH 4E06H 1C2KA 1T32A 2R2WU 2PWXA 1V3XA 5FBEA 2QYIA 1MZAA 1ZJDA 5A8ZA 4KGAA 4Y10E 1CGIE 1RFNA 3A7TA 2QAAA 3GDVA 1O33A 1DX5M 2AGGX 5TCCA 3T62A 4D9QA 1OWHA 4MNWA 1EOLA 2V3HH 3P92A 1KXEA 1Z1JA 2OD3B 4WVPE 3SU1A 3TITA 4AFUA 5F53A 3QZRA 1K1MA 1YPHE 4NFFA 4Y76A 3T5FH 2WZQA 2PSXA 2VGCB 4ABGA 2VU8E 1C1OA 4INLA 2F9UA 1XUGA 2W5EA 1FDPA 1GJAB 3UR9A 3RMNH 4K2YA 3ZIAD 4X6MA 4ABHA 4OS6A 4YLUA 4MLFB 5K7RA 2VVVA 3GY5A 4AB8A 3SNBA 1GCDA 1QL8A 1TQ7B 1EPTB 1W3CA 1NU9A 2ZCHP 3MU1A 4Y0YE 1XVMA 1K1LA 1YPKH 5DP5A 1GI7B 4IC6A 3URCA 1P11E 1D6RA 2IJD1 3HGPA 4Q7XA 3RXRA 4LK4A 1PYTC 2L6OA 5FPYA 1HAPH 1LHCH 1ESBA 1TPAE 1F92A 2IJOB 4Y8XA 1D3QB 3RP2A 1O2QA 3MH7A 1DLKB 1EJAA 2KM0A 4HTCH 1D3TB 2KAIA 3TH2H 5J4QA 1YGCH 1MMJN 1LKAA 3T25A 1ZMJA 3RXVA 5AFYH 5ESBA 3KQBA 3ATLA 1V2TT 5TCAA 1AB9C 2B0FA 5EG4A 1SG8B 4Y71A 2XC4A 1OX1A 1VITF 2BDCA 5EQQA 1NN6A 3HK6B 2QF0A 4A1VA 4CREA 1GI6A 1GBAA 1C5ZB 3V0XA 1O2GH 3FANA 3PYHA 2CF9H 3RU4T 4NSYA 3BEIB 4K8YA 1YPJH 4OS4A 2P8OC 4UEHH 4INKA 4JYTA 2DE8A 3PTNA 1CGHA 4K3JA 1ANBA 3SJKA 3RC4A 3O8DA 2JKHA 1CA8B 1DSUA 1TLDA 3A7XA 3D65E 4Y11E 3OAAD 1UJ1A 1KTTB 2WV9A 1NFWA 1KXCA 4BAHB 3DHKH 4NA8A 3F9HA 4AFSA 2AGEX 1UO6A 2BVRH 1HAHH 2PKAA 1FN8A 1AZ8A 1BQYA 3F9EA 3MH5A 2GP9B 3QX5H 1SL3A 2QXIA 3GCTG 4YM9A 1Z8RA 3M3TA 3RXSA 2OBQA 1C5UA 1W7GH 1ZOMA 3VB7A 5GJ4B 4FETA 3LIWA 3V3MA 1V2OT 3GYLB 1Y59T 3FP7E 1UCYK 3FO8D 1A0JA 3MNXA 1PPFE 2F9NA 4ZHLU 4WWYA 4DT7B 1HAVB 1O5EH 2C4FH 1C2IA 1E36B 4MDSA 4NA9H 3SGAE 5BPEA 5FXLA 1P06A 3PV4A 4J1YA 3S7HB 4DY7B 1QA7A 1AVXA 3SW2B 3OTJE 2FDAA 2ZDVH 3U8TH 2KCAA 4E05H 1DM4B 1WBGB 2GDDA 1DOJA 2HVYB 2PSYA 1OOKB 3Q3YA 4BNRA 1HBTH 4BTTB 3RXEA 1AU8A 3RM0H 1W0JD 3A8BA 4X6NA 4BAOB 1OWJA 3BG8A 7ESTE 4NFEA 2CMYA 3QDZB 1LQDB 3LONA 1IQKA 1UK4A 1WTHD 1A3EH 2EI7A 1A1RA 1DDJA 3EYDA 3QK1A 5DP6A 3CENA 1BMNH 1ZHPA 1SVPA 1T8NA 4ZKSU 1G2LA 2PTCE 4CRGA 5DP7A 2ZCLP 3RXJA 1Q3XA 1NT1A 5HM9A 1XXDA 2VVUA 1K1IA 3SJOA 3QTOH 1SGYE 3QUMP 3KQEA 5TJXA 3KGPA 3ZZ5A 1C5NH 1ESTA 2SNWA 1NS3A 2PV9B 3SU4A 3FAOA 1GGDB 1THPB 2C8XB 1HXEH 5A0BA 2P3UB 1GHWH 3AAUA 1Z8IB 1BBRE 5B6LA 1OHHD 1TNGA 5L2YH 6LPRA 1NBME 2L74A 1TGNA 4BXWA 3A8DA 3SZNA 1QY6A 2BY5X 3ITIA 3MO9A 3Q3XA 3GCNA 4GCHF 3E8LA 1F5KU 4ABAA 1LCYA 2A5KA 2ZZUH 1TMTH 2ZPRA 6CHAC 3M5NA 2OINA 4Y7BA 2EI6A 3ODFA 2CF8H 4RT1A 5DG6A 3OYPA 4DURA 3SGQE 3F68H 3A81A 3E6PH 1JWTA 3N7EA 8LPRA 3SN8A 3B8JA 3TPIZ 4FVDA 4ZKNU 1HAYB 5T3HA 1FMGA 1C4V2 2FMJA 1TONA 2Y80A 2FOHA 1Y3WA 3R0FA 2KCOA 1GI5A 3SZEA 4WMFA 3OEED 3E0NB 4YTAA 1SGCA 4XDEA 5C1UA 5AHGH 1GJ7B 2D2DA 4AZ2B 3F2HA 1ETSH 2O9QA 3GY7A 4TSFD 2JH0D 4YXWD 1BTZA 1EJMA 3MOCA 5EW1H 5FBIA 3WWBA 1QB6A 3ELAH 5FL7D 2RG3A 2BMGB 4AX9H 1RD3B 1C5OH 1MKWK 1BMMH 3PLKA 1QQUA 1O3MA 2UWPA 1AKSB 2ZFPH 5E2OA 2VGCC 3LGWA 3UOUA 1TABE 1YLNA 4KTCA 3VB6A 1DICA 1KLJH 2A1DB 1J8AA 3PMBB 1KIGH 1DPOA 5L30H 2ALPA 4MPUA 2ZDLA 1VJAU 2TIOA 4K1SA 3TJUA 1O3FA 1ZYOA 1BUIA 3KHVA 2BLOA 1EPTC 1Y3VA 1QTFA 1LQEA 1WSSH 4ABIA 4MNYA 5EPYA 3A87A 1GHYH 1ETRH 2PTNA 1C4U2 4JZDH 1GI9B 1TGTA 4GAWA 1DSTA 4JCNA 3MFJA 1GMDF 1G3DA 8GCHF 1V2PT 2ZECA 2A5AA 2BDAA 4AB9A 1YLCA 2P95A 1AI8H 3SU6A 3SOSA 3GY8A 2STBE 5IYTA 1AVGH 1FAKH 4CRBA 1O3IA 2UUFB 3NZIA 3W95A 5B6OA 2EA3A 3VPKA 5GCHG 4UFEH 5G4BA 2Q6FA 3EBNA 1ZPBA 1G2MA 3VEQB 2PHBA 4YZUA 2BZ6H 1P3EA 2ODYB 3RC5A 2QE7D 2HPPH 1C2DA 2RDLA 1Z1IA 1AN1E 4XD7D 4D7FA 1O0DH 1QQ4A 1GBCA 1MTVA 1NZQH 1SGIB 1KSNA 4X2XA 1C1PA 1G30B 2O8LA 1GVKB 4OS2A 3OX7U 4OS7A 4Y8ZA 5GWZA 1GI1A 1O3HA 4O97A 4SGAE 5E0GA 1K9OE 3VB4A 3UTUH 5KECA 1ZSJA 4Q7YA 3MHWU 1YKTA 2Z6BD 4BTIB 1V2UT 4PROA 1MBMA 2ZO3H 1LPGB 2OCVB 4F55A 1V2QT 2TGTA 1TOMH 1MH0A 3KN2A 4H42U 1TNLA 2OQ5A 2JJ2D 2GMTC 2Z9GA 1O2NA 2IN2A 3AW0A 1AWFH 4VGCB 4TPYA 4IN1A 1RGQA 1THRH 1ARBA 3TJOA 1O3EA 2BY6X 3P95A 1UW7A 4AC9A 2A2XH 1DUAA 2Z7FE 3QZQA 3RUOA 3ZVCA 2BX3A 2VBCA 1O3JA 3BTKE 3LGUA 2OQUA 4MPWA 3LC3A 2RA0A 4LOYH 4ZAEA 3DSPA 1TNHA 1C5YB 1W0YH 2BLWA 1KXAA 1G9IE 1ELVA 1HNEE 3UQOA 3AW1A 3D62A 2A4QA 1NRPH 2TRMA 3M37A 4WF8A 2J4IA 1TRMA 1PPHE 2NWNA 3VFEA 3PRBA 1UTQA 1GMCG 5K0HA 3MO6A 1INCA 4KTUA 1TGSZ 1L1GA 1RJXB 4ISHH 4WY3A 1IQNA 2ZFTA 2QCYA 1MCVA 4GHTA 1YWUA 1P2OA 3BTQE 3FP6E 1PQ5A 1BA8B 1SGQE 5C2ZA 2GT8A 1EOJA 1W0ZU 1ZMLA 1NM6A 1J14A 2OTVA 3UFAA 4ASHA 3PO1B 1AZZA 1O3BA 2CHAB 5CDFE 1GGDC 1EFRD 2F91A 5AF9H 1J15A 4Q80A 1GJ5H 4QT8C 2D1JA 4CH2B 1P2KA 1F2SE 2K0QA 3CS7A 1GI2A 1O5BB 2BLQA 5EQRA 1EAUA 2SGDE 4WMDA 2ASUB 1QRWA 2BYAX 4NIVA 1KXDA 2GTBA 2LPRA 3KQCA 3A80A 4Z0KA 5ABWA 1OYTH 4ABEA 3RMOH 1BOQA 1YCPM 3BTME 1IQFA 3SQHE 1EKBB 1C5PA 1ELTA 1FLEE 3ZVFA 3LU9B 3SORA 4WXIA 5JBBS 2C8WB 4RN6A 4AOQA 2BVXH 2HPQH 2XCFA 3M5LA 2WPIS 4A7IB 2P94A 3LH1A 1V2MT 1K0HA 1N8OB 3IITA 3SGBE 1C1NA 3MU8A 3ZV9A 3S9BA 4XSKU 2ANYA 3U9AH 4ABFA 3BTFE 3TGKE 1Q2WA 5EU8A 2FLBH 4I32A 2JDID 1TFXA 2QF5A 2H5DA 2UWOA 3OE7D 1ZGVA 4BXSA 2R2MB 4J2YB 2THFB 4ZMAH 3EA9A 3T26A 3GCHB 4Q4LA 1BRBE 4I8GA 4IW4E 1O2JA 1GBDA 1AHTH 3BSQA 4ZXXH 3MO3A 1YPLH 1D3PB 1OWKA 3N7OA 4GUXA 3KL6A 3F9GA 1BRAA 4XBCA 1MKXK 1GBTA 1UK3A 4OS5A 3RXQA 2WSSD 3ZYEA 2FS9A 2ZNKH 1OP0A 4X1NU 1C1RA 3M3VA 3A7YA 4JK6A 1O5GH 1H8IH 4P02A 2GCHF 1MZDA 4M9FA 1FY5A 5JBTA 3GY2A 2ZU4A 1HAIH 1MD7A 2RCEA 2J38A 1SFQB 2AIPA 2XXLA 3E90B 4Y8YA 1EB2A 2FS8A 2NU0E 3SV9A 3PTBA 2WUCA 3LT3A 4U32A 2J94A 1VZQH 1AE5A 1EP5A 2WPLS 4HGCA 3ZVBA 1BJVA 2W3IA 3RMLH 1D3DB 1TPSA 5EJ1A 5JBCS 5HM2A 2FWWA 2PLXA 4FVBA 4I8JA 2SFAA 2VINA 6CHAB 1TIOA 1MTWA 5JB9S 1O2TA 4Y7AA 1E37B 1QZ8A 7KMEH 4ZKRU 3NXPA 1GHBF 1UK2A 1L1NA 3LGTA 1VITH 4JMYA 1T31A 2VWLA 1DXPA 1TA6A 5IDKA 2B5TB 2PR3A 1KXBA 3A7WA 1F0UA 3N7DA 2ZF0H 2FPZA 3FZDA 2OC0A 4X2WA 2EC9H 2J95A 3EA8A 1PQ7A 1K28D 2TGDA 2LIZA 1AY6H 2K1QA 3H09A 1XKBC 1LTOA 1MUEB 3PLBA 3PV2A 4HZHA 1D4PB 1PPBH 4JZIA 5EXMA 1TX6A 1C1UH 1O3OA 2J34A 1X7AC 1TBQH 4U30A 1C1SA 4LZ1H 1P57B 1XUFA 1AIXH 1ZTLA 1GBBA 2BXUH 4KELA 4TY7A 4XBDA 1DUEA 1O2UA 2IPHA 1G37A 1O2RA 2ZFRH 1ZGIA 1FN6A 3GYMA 2P3FH 2PW8H 3Q00A 3GCOA 3RU4E 3DUXH 1S83A 1P10A 4K1TA 3ATWA 1GL1A 2AGIX 3ZZCA 1HIAA 2FOMB 2GKVE 1W0KD 5HIZA 3LPRA 2Z9KA 2W6ID 4VGCC 2WYGA 1MBQA 2ZDMA 2C3SA 2H6MA 1NRRH 2Y5FA 1FIZA 1PPZA 1O31A 2GV6A 1ELDE 3TJNA 2GT7A 1F0RA 3MH6A 1KYNA 5FCKA 4O03A 1AFQC 1DLEA 4BAQB 3GS9A 2W7SA 1UTKA 1GI4A 2ZGBH 3H5CB 4O3TA 4DG4A 1OSSA 1O39A 1XXFA 1O3DA 2BOKA 4JYVH 1SLXB 3P6ZB 3A8AA 1TRYA 2HALA 1DT2A 4XOJA 5DP8A 3T2NA 3BEUA 1FPHH 2QF3A 1O5FH 2BVSH 3NWUA 3ZZ9A 3SV6A 2OK5A 4UE7H 4XBBA 4F4OC 1P8VC 1ZJKA 2AHME 2AIQA 2XWAA 1HRTH 4BANB 1QGFA 2A2QH 2KR7A 3MQKC 1C5RA 1GG6B 3BTEE 1ZLRA 3DFLA 3OFND 2A7JA 3SNEA 4CBOA 1ETTH 1FQ3A 1WXRA 1Y3UA 1W2KH 1TA2A 5GCHF 1UTJA 3U98H 3DD2H 1S85A 1VJ9U 2JH5D 5F6MA 2Z3EA 1K1NA 3AK5A 1DWCH 5AVDA 1C1MA 1YYY1 1LHFH 1EPTA 4UONA 5T6DA 1IQEA 1FNIA 3CS0A 3PMAB 4HFPB 2F4LA 1FONA 3PO1C 1W8BH 1E1QD 2O8UA 4NZQA 2H1UA 2HRVA 4DIHH 2CHAC 4O9VA 3C27B 2ILNA 1CT2E 4MVNA 1QRZA 5C94A 1YCPH 2ANMH 2SGFE 3UPEA 3TGJE 1GHZA 2OC7A 1MU8B 1J9CH 2GMTB 1CHOG 1NFUA 4NIWA 2P93A 4A92A 1L4DA 1ZSLA 1ZTJA 3WY8A 4TPIZ 5C0TA 1O36A 3UUZA 1P12E 2G4TA 4CRAA 5A8XA 4UDWH 4FU9A 4A1XA 1SGDE 1FXYA 3NRLA 1C5MD 4HG6A 5LGOA 4ISOA 3BTGE 4NGAH 3Q76A 1EAXA 3UIRA 1NFXA 5FHTA 4RKJB 3ZZ4A 3P8NA 1N8OC 1RRKA 1K1PA 3S7KB 1QRXA 3SNDA 3CNRA 1H1BA 1FV9A 2R3YA 3WW7A 1A61H 4MTBA 1CSOE 4YOJA 1E34B 1E38B 3TIUA 5EXLA 3JZ1B 4B2CA 4IBLH 2Z3DA 2J98B 1TYNA 1A0HB 1GI8B 1O3LA 3GCHC 3EDXB 2PUXB 2VH0A 3DSOA 1GBEA 1FJSA 1OPHB 1JIMA 1P2IA 9LPRA 2ZDNA 2FEQH 1BTUA 3TNSA 1C2GA 4D8NA 1CA0B 3UOPA 1SHHB 1TMBH 1TPPA 2J5UA 1GJ9B 1RIWB 4X6PA 4LXBH 1FIWA 4NIYA 4U2WA 2FOBA 4GSOA 4KTSA 2I6QA 2GZ7A 1O2HA 3LKWA 3BIVH 1UHBB 1NRQH 2AFQB 3SHAH 2QC2A 4FU7A 1GHVH 3NCLA 1GMHF 1HAVA 5E0HA 5BRRE 1GBJA 3C1KA 1K1JA 2XRCA 5EQSA 3MYWA 3PV5A 4X1PU 4ESTE 3M35A 2BD9A 3NUMA 4I86A 5T6FA 3ATMA 1HV7A 4FUCA 1GDQA 2AYWA 2QY0B 2G52A 5FAHA 1SGNE 7GCHF 1EQ9A 1GBFA 3ZVAA 1ZRBA 2Z9JA 2FXRA 1Z6EA 1O5DH 2CN0H 2AMQA 3U69H 1OP2A 2B9LA 1LVBA 3LOXA 3KF2A 1PFXC 2BLVA 2BY7X 1RS0A 5CE1A 2I6SA 2FI4E 2FO9A 2ZIQH 1A7SA 4GPGA 2LNCA 2NU2E 3RDZA 2WV5A 3TK5A 2C8ZB 2WPKS 4CRDA 2B8OH 2ZU5A 2V0BA 4X0WU 5C3NA 2ZGCA 3LJJA 5JPMH 2LELA 1WUNH 3O8RA 5LPRA 4ZUHA 1SSXA 3I29A 4OGXA 1P2NA 3EQ0H 1YPEH 1ANCA 2BX4A 1COWD 1ELFA 2XYAA 1BTYA 1C9TA 2GJGA 3HPTB 1EASA 2VIVA 4FUFA 2H9EH 1AUJA 1BBRK 3B9FH 1WQSA 2G55A 1PJPA 1OWIA 2BDYA 1BITA 2TGPZ 5HXFA 4B73A 1D9IA 1UVTH 2KZ4A 2OLGA 1NFYA 1QBNA 4FXGH 1XM1A 1TOCB 3MMGA 1Z71A 2A4GA 4AN7A 4DJZB 1E35B 1SOTA 2FOFA 1P2MA 5T1VA 1C5LH 2UUJB 1UTLM 4FU8A 1BRUP 1FY3A 2ANKH 2BDGA 3S0NA 3JZ2B 1ELGA 1J17T 5EOKA 4FUDA 4AG1A 3URDA 3A88A 1ZHMA 4I31A 2FLRH 3V12A 3UAIC 1V2NT 1ELBA 3MNCA 2ZTYA 3LH3A 2ZQ2A 2A4RA 1JIRA 2VIDA 4R8TB 1C2MA 3T28A 2DUCA 1ABIH 2XC0A 2Y82A 4BOHA 1O2MA 3MNBA 2XBYA 2FOCA 1WOFA 3NPSA 5EIYA 2ZP0H 1GG6C 5DN6D 1AKSA 1DITH 1O3GA 4I8HA 4YESB 1OWDA 2SGPE 4X8TH 1C5WB 1OP8A 2EY4C 1SGRE 1V2LT 1NESE 3ZZDA 1VITG 2CJIA 2P3TB 2IPQX 1TQ0B 2BD2A 4XE4A 1UCYH 1EP6A 1ZPCA 3LGYA 1P0SH 1BMFD 3V13A 1S5SA 1W11U 3SO3A 1OXGA 2VNTA 2G81E 3GDUA 4NA7A 1EB1H 1Y3XA 2KX4A 4OGYA 4ASUD 3HGNA 3BTDE 4JZEH 1O3PB 1O2SA 1TGBA 1EAIA 2FZZA 3P70B 3S9CA 1C2JA 2JIZD 3OY5U 2XNIA 1DS2E 2Q1JA 2LP6A 2FOEA 2BQ6B 3M36A 2WUBA 1QA0A 1BTHH 1CU1A 1G32B 2XW9A 2F3CE 1KDQB 1HJ9A 4M7GA 5I46H 2ODQA 2A7CA 1SI5H 4WJG2 1W14U 1XUIA 2AERH 2XTTB 3G01A 3ATKA 1VR1H 1AFQB 4NG9H 1C5TA 1CQQA 1GBKA 1S6HA 4Y0ZE 3A7ZA 4Y79A 1B0FA 2V6NA 5A0AE 1UVPA 1SGTA 4TWWA 1XUJA 1TGCA 1T4UH 4I33A 2TPIZ 5DP3A 5HMAA 1HAZB 1P09A 4ZHMU 1N6XA 4YOIA 1GBHA 2AEIH 1IQLA 4E7RG 1GVZA 1LHDH 2P59A 1KLIH 5HKKD 1CGJE 1WYKA 5F03A 1LHEH 1ELAA 1ANDA 2W7UA 1WCZA 3RXAA 5EPNA 3OY6U 1A2CH 1C2HA 1CA0C 1ARCA 1O38A 8KME2 5DPAA 1A5GH 1CBWB 2ZKSA 1RIWC 1T7CA 2BDHA 2BD7A 3L33A 4KKDA 5DP4A 4D76A 3TK9A 1S0RA 4Q63A 1B5GH 2WPHS 5JYIA 1LDTT 1FY1A 1V2JT 3SI3H 2A31A 2YNAA 4CHAB 1P9UA 1VCQA 2R3UA 1TB6H 1EZUC 2Y5HA 3MNSA 3ZZ8A 4HI3A 3A84A 3ZZ7A 1SLUB 2J9NA 1RTKA 1GDUA 3RXKA 1E1RD 4H6TA 1W10U 3RXCA 1ID5H 1IHSH 9ESTA 1PYTD 1C1VH 2FI3E 2VWMA 2VH6A 3E0PB 1QIXB 1O35A 3PM3A 1MAXA 3M7QA 3ZYDA 3GCTF 6GCHG 2YNBA 1CHOF 4H6SB 4WXVA 4P00A 5C1XA 1ESAA 1BTXA 1MKWH 4FOUC 1DY9A 3KQDA 5F8ZA 1P3CA 2NU3E 3FKSD 4KP0A 1JRSA 5T6GA 4OM9A 1PQAA 1Z8JB 3VGCB 1HGTH 1QB1A 2R0KA 2PGBB 5C20A 5E8EH 4BAKB 4JYUH 5HGGA 1FUJA 3RXFA 2ZFFH 1W12U 1N1LA 2CK3D 1DWDH 3F9FA 1U6QA 3U8OH 3HATH 5IK2D 2CV3A 3U1IB 6ESTA 2OXSA 3SV7A 2A5IA 1O2PA 2BD3A 3UB0A 4AGJA 2VIQA 2BZAA 2ZDKA 1HFDA 1CO7E 1C1TA 1IQHA 3ODDA 2FODA 1UVSH 3O8CA 1VCPA 1F0SA 4MNXA 1HAXB 1BIOA 2GZ9A 1LHGH 3L3TA 1HCGA 1K1OA 2HWLB 2V3MA 3PRDA 2PGQB 2TGAA 5JDUB 2ZU2A 1QR3E 4JK5A 1C9PA 1THSH 2XWBI 1JOUB 4UFGH 4MPVA 1G3BA 1LKBA 4B71A 2EI8A 3LGIA 3A82A 3D23A 1C5QA 1QL9A 1IQGA 1Z7KA 4TT3D 4UD9H 4RT0A 3SJIA 2BB4A 1LVMA 1SGFA 1KTSB 4TYDA 1WQVH 4ACAA 3E16B 2BY8X 5EW2H 2FTLE 2P16A 1L0ZA 1H9IE 1MTNB 1SC8U 5FX6A 1SGPE 2V3OH 5A2MH 2QIQA 1WAYB 2WV4A 2PKSB 4X1SU 1T4VH 2BD5A 1PPCE 1GMDG 2AH4X 4ZXYH 2FI5E 3W1EA 3QLPH 1V2KT 2SGEE 1ELCA 1EZXC 3PMHB 5C17A 1TX7A 4YT6H 4NZLA 5PTPA 4RSPA 3ZVGA 3BG4B 1JBUH 3N99A 3UQVA 3I78A 1C1QA 2ULLA 2JJ1D 1HXFH 4B74A 3GOVB 1O3CA 1O5CB 2NU4E 4DT4A 1SR5C 1GJ8B 3GY3A 1GJ4H 2VIPA 4X2VA 1H8DH 3TVJB 1K22H 1HPGA 1O30A 2UUYA 4A5TS 2G4UA 5EGMA 1P2QA 1RXPA 4ZHAA 1Y5AT 1O3AA 2Y6TA 3QGJA 2QXHA 1SB1H 3A85A 1WDIA 3SJ8A 1DWBH 2GGVB 1BJUA 1GJDB 1SKYE 2YMSB 1S84A 5FPTA 1OWEA 1GWAA 4DW2U 3UNSA 4X8SH 3SYJA 3FN8A 3RXOA 4F48B 4YT7H 1BDAA 2AMPA 2KAIB 3VB3A 3P8FA 1IQMA 1JMOH 5SGAE 2BOHB 3ZZ6A 3ZVEA 2WPMS 5DGJA 4AGKA 3F6UH 1YM0A 2ZHWH 1TALA 1TMUH 5JB8S 3TGIE 5FCRA 1MCTA 5DO4H 5DKMA 2HNTF 3K6ZA 4R0IA 1ZPZA 2VB0A 4B2BA 3MTYA 5JBAS 2GX4A 4ZH8A 3NKKA 2Z9IA 2A32A 4B6FA 4IMQA 1O3NA 3PMJA 1UTNA 3U8RH 1SHYA 2BQ7B 3A83A 3T29A 1D6WA 1EAWA 2AMDA 1E0FD 4X8UH 1YPGH 2HNTC 3TJVA 1P04A 1BHXF 1EZSC 2VJ1A 3GISB 4THNH 2GZ8A 4X6OA 1P02A 2QXGA 5E0JA 1H8HD 1V2ST 3F3BA 3EA7A 2YMSD 2PKAB 1MD8A 1ZZZA 3Q77A 1QFKH 1S6LA 1JXPA 1P2JA 2F43B 2A45B 4H4FA 5F8XA 4UFFH 4WH6A 1B7XB 2G00A 1QHRB 4I7YH 3E91A 1UCYE 1XX9A 4CRFA 1DVAH 1UMAH 4RKOB 3KCGH 1CBWC 1Y8TA 1EZQA 5ESTE 1AE8H 3UWIA 4ISIH 1BTPA 2VWOA 3RXTA 4CHAC 2O8TA 2H9HA 4AYVB 1T8LA 3KIDU 4X1QU 3ZVDA 1GCTB 2XOKD 1WV7H 2A0QB 3RXHA 1P03A 1EX3A 3T27A 3P8GA 1O2ZA 4GHQA 4A6LA 2EEKA 2BQWB 4K60A 3UR6A 3RLYH 1O2IA 4YLQH 1C5SA 2QA9E 2GCTB 1AO5A 1MABB 5EODA 1L4ZA 1NY22 3FFGA 1LPZB 1BB0B 5HYOA 1GVLA 2J92A 1MKXH 1DXWA 3STIA 1H4WA 1TNJA 5ETXA 2Q6DA 2KFWA 1IQJA 3VGCC 4AFZA 4OS1A 1ORFA 1HAOH 1IAUA 1IOEA 1WU1A 3RXGA 2W26A 1NU7B 4ABJA 2XBXA 2ZC9H 5C5OA 1UVUH 1C5VA 1W13U 1E79D 2GD4B 2VVCA 4B2AA 3BF6H 4O3UA 1SGEE 4INHA 4I8KA 3O8BA 4D7GA 3IWMA 3E1XB 3RMMH 4CBNA 4TWYA 2ZQ1A 4DGJA 1SQAA 1AGJA 1O2XA 1SFIA 3RC6A 2A4OA 4Z6AH 5L6NH 3MU0A 1QL7A 1GMCF 2UUKB 3ESTA 3RXPA 3VB5A 1GBLA 3SV8A 2XC5A 4X8VH 2CXVA 5L2ZH 4F49A 4AORA 2VWNA 4UFDH 1T8OA 2M2AA 4B76A 3M7UA 5FPSA 3M61U 3SU3A 2GCHG 3FOAA 2Y5GA 1UTOA 4DOQA 2OBOA 1LO6A 2H2ZA 1PQ8A 2ZTXA 1ZMNA 3MI4A 3U1JB 1MTNC 3F1SB 4NWKA 2JETC 3M3SA 2PP6A 3RXIA 4Q7ZA 5FX5A 2C8YB 5EJLA 3UY9A 3F0PA 3SUDA 1CHGA 1SOZA 2PKSC 5J4SA 7LPRA 2J98A 1UTPA 5C5NA 2ZA5A 3RLWH 1F7ZA 3UWJH 1CE5A 2KCPA 3EE7A 3RU4D 1GHXH 3EGKH 1GHAG 1O32A 4IS5A 3RM2H 4K1EA 1L2EA 4YOGA 6GCHF 1GHBG 1HJAB 3FZZA 2BM2A 3TLOA 3BG4C 2ZDAH 1P01A 2YOLA 1K21H 1AQ7A 1T8MA 2SGQE 3KYFA 1A0LA 2V35A 5GDSH 1UTMA 2WYJA 2OC8A 1UHBA 3M5MA 3PB1E 3DA9B 3SUGA 3RXLA 3CP7A 1Y5UT 1C5XB 2HGTH 4FUJA 4X1RU 1QURH 3HK3B 3LJOA 2GDEH 5CHAB 1EATA 1LVYA 1DE7H 4Q2KA 1TNIA 2H9TH 1SQRA 2FIRH 2QV1A 3A8CA 1ZHRA 2K7XA 4IN2A 2YMSC 1XKAC 2HNTE 3SU2A 5DP9A 1O3KA 5CHBA 1TE0A 3F2FA 4FUIA 3BV9B 3ENSB 1SQTA 2ZCKP 2DE9A 1ZR0A 2ZTZA 1YLDA 2M5TA 1AWHB 4ZROA 1TBRH
chains in the Genus database with same CATH topology
1EJNA 1FY8E 1IHTH 1C4Y2 4DVAU 1M9UA 3M5OA 1BCUH 1S82A 5LPFA 3H7OA 2F9BH 2ZGJA 2A7HA 2QN5T 1VGCB 1GJBB 2ZGHA 1O2WA 1QB9A 2F9VA 3DFJA 1LVOA 1JRTA 3ATIA 2R0LA 2R9PA 5H4IB 3SV2H 1GJCB 1TPOA 5I25A 3AAVA 4Y6DA 5EXNA 4DCDA 1YBWA 1QJ6B 1BMAA 2XBWA 1IQIA 1V6DA 1XUHA 2FM2A 2ZGXH 2ZHDA 3HKJB 1GI0A 3A7VA 2H5CA 1NTPA 2PFEA 3E3TA 2HOBA 1FZZA 1HAGE 4E7NA 2C93B 4CRCA 1CT0E 1W7XH 1YP9A 1YC0A 3QWCH 3SI4H 1YF4A 5C1YA 3TK6A 1L1JA 1DFPA 1G36A 1Z6JH 4ISLA 1AFEH 1NPMA 1NC6A 2FX6A 1Z8GA 1OKXA 1ZTKA 2Z3CA 1NROH 1SLWB 1ABJH 1TAWA 4NIXA 1C2FA 3SUFA 4ABBA 1P05A 4CR5A 3BTHE 1A5HA 1V2VT 2FOGA 1SPJA 3RXMA 2FYQA 4DIIH 4IGDA 3TU7H 1MTSA 3AASA 1C1WH 4AFQA 1H9HE 4D9RA 3EAJA 3OSYA 2ZHEH 1LPKB 1O5AB 1TX8A 4GVUA 2ZPSA 1GCTC 1BMLA 3P17H 2BXTH 1GPZA 1ZRKA 1QCPA 1N6YA 4XFQA 2ZHQH 3L6PA 1G3EA 1HJ8A 3LC5A 1A4WH 1QBVH 1BRCE 1KLTA 2ZG0H 5LPEA 1GDNA 2ODPA 3PWBA 1SGFG 1F0TA 2XBVA 3DT0H 2GCTC 3VXEH 1QBOA 3FVFB 3A89A 1K2I1 2F9PA 1HYLA 4ISNA 4YO9A 1ANEA 4U01A 1DY8A 1O2OA 2G51A 3RXBA 1VCWA 1NRNH 1BTWA 2VIOA 2BD4A 1O2YA 4WH8A 1DWEH 4K69A 3TH3H 2ZFSA 2BHGA 1S81A 4JZ1A 4WMEA 4K8BA 3VXFH 4CH8B 1WTGH 3SNCA 2FP7B 5A8YA 3SU5A 3B23B 3BN9A 4K5ZA 4ZKOU 1Y5BT 4ABDA 1GI3A 3GICB 2SNVA 1FAXA 1YPHC 2SGAA 2ZPQA 2FTMA 1BHXB 3K2UA 2FX4A 3PLPA 3MWIU 1XMNB 3QGNB 3SJ9A 2J2UA 1AMHA 2QGRA 1CVWH 2G5NA 2ZI2H 3I77A 3Q3KA 1AB9B 5CMXH 1SMFE 1KDQA 3LDXH 1A5IA 5AFZH 3FP8E 2ANWA 1S6FA 2G8TA 3K6YA 1QJ7B 2BDBA 1GMHG 1A46H 2P8OB 1J16A 3QO6A 3UNQA 1P9SA 1QJ1B 4NSVA 1HUTH 2IOTA 4FUEA 1F5RA 2OC1A 1SLVB 5C67A 4TY6A 1AUTC 2Y81A 1Q31A 1YPMH 2HLCA 2PUQH 1XVOA 2JH6D 2Z9LA 3NK8A 4SGBE 4GCHG 1O2KA 2BTCE 3BTTE 3ZZ3A 1F5LA 7GCHG 1NRSH 1TRNA 5GXPA 5GIBA 3PWCA 3M7TA 1RTLA 8ESTE 1ZSKA 1GJ6A 4AG2A 1BBRH 3UREA 3BEFB 3ZZAA 3AVZA 1TNKA 1O37A 2Q6GA 1HJAC 2TBSA 3K9XB 3GDSA 1HB0B 1MQ6A 1SBWA 2UWLA 3UNRA 4CR9A 3SUEA 3RXUA 3ZZBA 1EXFA 5DK1A 1MU6B 1TBZH 1Y3YA 4B1TA 2C90B 1GL0E 4FUHA 3H7TA 3TH4H 3STJA 1MTUA 2D26C 1O2VA 1BZXE 4FUGA 2F9OA 3IG6B 2XCNA 2Y7ZA 1FI8A 1C2EA 1ELEE 1LMWB 3A86A 3BTWE 5DJ7A 3SBKA 1YCPK 1CT4E 4BAMB 5CHAC 1MAYA 3BIUH 2GVFA 3RXDA 1HLTH 3MU5A 3S69A 2FYRA 3MH4A 2FOAA 4X2YA 3ZV8A 1MQ5A 3MU4A 2ZU3A 3QN7A 3EE0B 3W94A 3SU0A 2G5VA 1RTFB 2WPJS 3TNTA 2HVXA 4LZ4B 2VIWA 5GPIB 2ALVA 1GBIA 1PPGE 1OS8A 1XUKA 1VGCC 3QTVH 3D49H 1QNJA 2F83A 2GV7A 1DANH 3KNXA 2BDIA 2JETB 1ACBE 4JZFH 1SQOA 1O2LA 3K65B 4I8LA 5LH8A 2W3KA 1OYQA 2ZU1A 3GY6A 2BY9X 1BT7A 2ESTE 4NCYA 1AVWA 8GCHG 4NWLA 4GLYA 1KXFA 3HKIB 4FUBA 2Y7XA 5F8TA 3SHCH 2RA3A 1V2WT 4IC5A 4MQAA 2ZEBA 2ZWLH 1S0QA 4B75A 4AYYB 1EUFA 1UVOA 1HIAB 2FESH 2B7DH 1AD8H 1B0EA 1HDTH 2CGAA 2OUAA 3V7TA 4BTUB 2WINI 1GHAF 3P8OA 3GY4A 3KEEA 4MNVA 4A1TA 1G3CA 3OU0A 3LGVA 5E2PA 2Z94A 1V2RT 2O8WA 2OP9A 1NO9H 2D8WA 2NU1E 4MPXA 3PROA 4IMZA 2ZHFH 3SNAA 1H9LB 3S9AA 2AS9A 4MG3A 5A0CA 2BD8A 2QXJA 3R3GB 1C2LA 1PPEE 1A3BH 2STAE 1O34A 3SQEE 1KY9A 5A09A 2O8MA 1GBMA 1FY4A 1TWXB 1FPCH 2ZFQH 4E06H 1C2KA 1T32A 2R2WU 2PWXA 1V3XA 5FBEA 2QYIA 1MZAA 1ZJDA 5A8ZA 4KGAA 4Y10E 1CGIE 1RFNA 3A7TA 2QAAA 3GDVA 1O33A 1DX5M 2AGGX 5TCCA 3T62A 4D9QA 1OWHA 4MNWA 1EOLA 2V3HH 3P92A 1KXEA 1Z1JA 2OD3B 4WVPE 3SU1A 3TITA 4AFUA 3QZRA 1K1MA 1YPHE 4NFFA 4Y76A 3T5FH 2PSXA 2VGCB 4ABGA 2VU8E 1C1OA 4INLA 2F9UA 1XUGA 2W5EA 1FDPA 1GJAB 3UR9A 3RMNH 4K2YA 4X6MA 4ABHA 4OS6A 4YLUA 4MLFB 5K7RA 2VVVA 3GY5A 4AB8A 3SNBA 1GCDA 1QL8A 1TQ7B 1EPTB 1W3CA 1NU9A 2ZCHP 3MU1A 4Y0YE 1XVMA 1K1LA 1YPKH 5DP5A 1GI7B 4IC6A 3URCA 1P11E 1D6RA 3HGPA 4Q7XA 3RXRA 4LK4A 1PYTC 5FPYA 1HAPH 1LHCH 1ESBA 1TPAE 1F92A 2IJOB 4Y8XA 1D3QB 3RP2A 1O2QA 3MH7A 1DLKB 1EJAA 4HTCH 3TH2H 1D3TB 2KAIA 5J4QA 1YGCH 1MMJN 1LKAA 3T25A 1ZMJA 3RXVA 5AFYH 5ESBA 3KQBA 3ATLA 1V2TT 5TCAA 1AB9C 2B0FA 5EG4A 1SG8B 4Y71A 2XC4A 1OX1A 1VITF 2BDCA 5EQQA 1NN6A 3HK6B 2QF0A 4A1VA 4CREA 1GI6A 1GBAA 1C5ZB 3V0XA 1O2GH 3FANA 3PYHA 2CF9H 3RU4T 4NSYA 3BEIB 4K8YA 1YPJH 4OS4A 2P8OC 4UEHH 4INKA 4JYTA 2DE8A 3PTNA 1CGHA 4K3JA 1ANBA 3SJKA 3RC4A 3O8DA 2JKHA 1CA8B 1DSUA 1TLDA 3A7XA 3D65E 4Y11E 1UJ1A 1KTTB 1NFWA 1KXCA 4BAHB 3DHKH 4NA8A 3F9HA 4AFSA 2AGEX 1UO6A 2BVRH 1HAHH 2PKAA 1FN8A 1AZ8A 1BQYA 3F9EA 3MH5A 2GP9B 3QX5H 1SL3A 2QXIA 3GCTG 4YM9A 1Z8RA 3M3TA 3RXSA 2OBQA 1C5UA 1W7GH 1ZOMA 3VB7A 5GJ4B 3LIWA 3V3MA 1V2OT 3GYLB 1Y59T 3FP7E 1UCYK 3MNXA 1A0JA 1PPFE 2F9NA 4ZHLU 4WWYA 4DT7B 1HAVB 1O5EH 2C4FH 1C2IA 1E36B 4MDSA 4NA9H 3SGAE 5BPEA 5FXLA 1P06A 3PV4A 4J1YA 3S7HB 4DY7B 1QA7A 1AVXA 3SW2B 3OTJE 2FDAA 2ZDVH 3U8TH 4E05H 1DM4B 1WBGB 2GDDA 1DOJA 2PSYA 1OOKB 3Q3YA 4BNRA 1HBTH 4BTTB 3RXEA 1AU8A 3RM0H 3A8BA 4X6NA 4BAOB 1OWJA 3BG8A 7ESTE 4NFEA 2CMYA 3QDZB 1LQDB 3LONA 1IQKA 1UK4A 1WTHD 1A3EH 2EI7A 1A1RA 1DDJA 3EYDA 3QK1A 5DP6A 3CENA 1BMNH 1ZHPA 1SVPA 1T8NA 4ZKSU 1G2LA 2PTCE 4CRGA 5DP7A 2ZCLP 3RXJA 1Q3XA 1NT1A 5HM9A 1XXDA 2VVUA 1K1IA 3SJOA 3QTOH 1SGYE 3QUMP 3KQEA 5TJXA 3KGPA 3ZZ5A 1C5NH 1ESTA 2SNWA 1NS3A 2PV9B 3SU4A 3FAOA 1GGDB 1THPB 2C8XB 1HXEH 5A0BA 2P3UB 1GHWH 3AAUA 1Z8IB 1BBRE 1TNGA 5L2YH 6LPRA 1TGNA 4BXWA 3A8DA 3SZNA 1QY6A 2BY5X 3ITIA 3MO9A 3Q3XA 3GCNA 4GCHF 3E8LA 1F5KU 4ABAA 1LCYA 2A5KA 2ZZUH 1TMTH 2ZPRA 6CHAC 3M5NA 2OINA 4Y7BA 2EI6A 3ODFA 2CF8H 5DG6A 3OYPA 4DURA 3SGQE 3F68H 3A81A 3E6PH 1JWTA 8LPRA 3SN8A 3B8JA 3TPIZ 4FVDA 4ZKNU 1HAYB 5T3HA 1FMGA 1C4V2 2FMJA 1TONA 2Y80A 2FOHA 1Y3WA 3R0FA 1GI5A 4WMFA 3E0NB 4YTAA 1SGCA 4XDEA 5C1UA 5AHGH 1GJ7B 2D2DA 4AZ2B 1ETSH 2O9QA 3GY7A 2JH0D 1BTZA 1EJMA 3MOCA 5EW1H 5FBIA 1QB6A 3ELAH 2RG3A 2BMGB 4AX9H 1RD3B 1C5OH 1MKWK 1BMMH 3PLKA 1QQUA 1O3MA 2UWPA 1AKSB 2ZFPH 5E2OA 2VGCC 3LGWA 3UOUA 1TABE 4KTCA 3VB6A 1DICA 1KLJH 2A1DB 1J8AA 3PMBB 1KIGH 1DPOA 5L30H 2ALPA 4MPUA 2ZDLA 1VJAU 2TIOA 4K1SA 3TJUA 1O3FA 1ZYOA 1BUIA 3KHVA 2BLOA 1EPTC 1Y3VA 1QTFA 1LQEA 1WSSH 4ABIA 4MNYA 5EPYA 3A87A 1GHYH 1ETRH 2PTNA 1C4U2 4JZDH 1GI9B 1TGTA 4GAWA 1DSTA 4JCNA 3MFJA 1GMDF 1G3DA 8GCHF 1V2PT 2ZECA 2A5AA 2BDAA 4AB9A 1YLCA 2P95A 1AI8H 3SU6A 3SOSA 3GY8A 2STBE 5IYTA 1AVGH 1FAKH 4CRBA 1O3IA 2UUFB 3NZIA 3W95A 5B6OA 2EA3A 3VPKA 5GCHG 4UFEH 5G4BA 2Q6FA 3EBNA 1ZPBA 1G2MA 3VEQB 2PHBA 4YZUA 2BZ6H 1P3EA 2ODYB 3RC5A 2HPPH 1C2DA 2RDLA 1Z1IA 1AN1E 4D7FA 1O0DH 1QQ4A 1GBCA 1MTVA 1NZQH 1SGIB 1KSNA 4X2XA 1C1PA 1G30B 2O8LA 1GVKB 4OS2A 3OX7U 4OS7A 4Y8ZA 5GWZA 1GI1A 1O3HA 4O97A 4SGAE 5E0GA 1K9OE 3VB4A 3UTUH 1ZSJA 4Q7YA 3MHWU 1YKTA 2Z6BD 4BTIB 1V2UT 4PROA 1MBMA 2ZO3H 1LPGB 2OCVB 1V2QT 2TGTA 1TOMH 1MH0A 3KN2A 4H42U 1TNLA 2OQ5A 2GMTC 2Z9GA 1O2NA 2IN2A 3AW0A 1AWFH 4VGCB 4TPYA 4IN1A 1RGQA 1THRH 1ARBA 3TJOA 1O3EA 2BY6X 3P95A 2A2XH 1DUAA 2Z7FE 3QZQA 3RUOA 3ZVCA 2BX3A 3BTKE 1O3JA 3LGUA 2OQUA 4MPWA 3LC3A 2RA0A 4LOYH 4ZAEA 1TNHA 1C5YB 1W0YH 2BLWA 1KXAA 1G9IE 1ELVA 1HNEE 3UQOA 3AW1A 3D62A 2A4QA 1NRPH 2TRMA 3M37A 4WF8A 2J4IA 1TRMA 1PPHE 2NWNA 3VFEA 1UTQA 1GMCG 5K0HA 3MO6A 1INCA 4KTUA 1TGSZ 1L1GA 1RJXB 4ISHH 4WY3A 1IQNA 2ZFTA 2QCYA 1MCVA 4GHTA 1P2OA 3BTQE 3FP6E 1PQ5A 1BA8B 1SGQE 5C2ZA 2GT8A 1EOJA 1W0ZU 1ZMLA 1NM6A 1J14A 2OTVA 3UFAA 4ASHA 3PO1B 1AZZA 1O3BA 2CHAB 1GGDC 2F91A 5AF9H 1J15A 4Q80A 1GJ5H 4QT8C 2D1JA 4CH2B 1P2KA 1F2SE 3CS7A 1GI2A 1O5BB 2BLQA 5EQRA 1EAUA 2SGDE 4WMDA 2ASUB 1QRWA 2BYAX 4NIVA 1KXDA 2GTBA 2LPRA 3KQCA 3A80A 4Z0KA 5ABWA 1OYTH 4ABEA 3RMOH 1BOQA 1YCPM 3BTME 1IQFA 3SQHE 1EKBB 1C5PA 1ELTA 1FLEE 3ZVFA 3LU9B 3SORA 4WXIA 5JBBS 2C8WB 4RN6A 4AOQA 2BVXH 2HPQH 2XCFA 3M5LA 2WPIS 4A7IB 2P94A 3LH1A 1V2MT 1N8OB 3IITA 3SGBE 1C1NA 3MU8A 3ZV9A 3S9BA 4XSKU 2ANYA 3U9AH 4ABFA 3BTFE 3TGKE 1Q2WA 5EU8A 2FLBH 4I32A 1TFXA 2H5DA 2UWOA 1ZGVA 4BXSA 2R2MB 4J2YB 2THFB 4ZMAH 3EA9A 3T26A 3GCHB 1BRBE 4I8GA 4IW4E 1O2JA 1GBDA 1AHTH 3BSQA 4ZXXH 3MO3A 1YPLH 1D3PB 1OWKA 3N7OA 4GUXA 3KL6A 3F9GA 1BRAA 4XBCA 1MKXK 1GBTA 1UK3A 4OS5A 3RXQA 3ZYEA 2FS9A 2ZNKH 1OP0A 4X1NU 1C1RA 3M3VA 3A7YA 4JK6A 1O5GH 1H8IH 2GCHF 1MZDA 1FY5A 5JBTA 3GY2A 2ZU4A 1HAIH 1MD7A 2RCEA 2J38A 1SFQB 2AIPA 2XXLA 3E90B 4Y8YA 1EB2A 2FS8A 2NU0E 3SV9A 3PTBA 2WUCA 3LT3A 4U32A 2J94A 1VZQH 1AE5A 1EP5A 2WPLS 4HGCA 3ZVBA 1BJVA