5HYOA

X-ray structure of unbound porcine epidemic diarrhea virus 3clpro
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
301
structure length
301
Chain Sequence
AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVICPRHVIASSTTSTIDYDYALSVLRLHNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTPKYTYRTVRPGESFNILACYDGSAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSLFTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMTTVVNTDCFSILAAKTGVDVQRLLASIQSLHKNFGGKQILGYTSLTDEFTTGEVIRQMYGVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEDV 3CLpro
publication title X-Ray Structure and Inhibition of 3C-like Protease from Porcine Epidemic Diarrhea Virus.
pubmed doi rcsb
source organism Porcine epidemic diarrhea virus
molecule tags Viral protein
total genus 83
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 5hyoA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5hyoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5hyoA01
2B8OH 2LNCA 2BY7X 3ESTA 4Q80A 4ZAEA 4HI3A 1LTOA 1SGEE 2OXSA 1FIWA 3MNCA 1J14A 3FZZA 4U2WA 1ANCA 4MPVA 1O5AB 2BDBA 1BCUH 3GCTG 2TBSA 3W95A 8ESTE 2VB0A 2FODA 3A8CA 1CA8B 2BLVA 4RKOB 2FESH 2ZHDA 4UFEH 1KYNA 3LGWA 1IHTH 3RXMA 2W26A 1ESAA 1QL8A 2GX4A 1HNEE 2I6QA 1SGIB 1C9TA 2FOHA 4IN2A 5FAHA 4Y76A 1C9PA 2GV7A 1SHHB 1WTGH 4Y0ZE 1ZGIA 2AGGX 2Z94A 1GMHF 1S6HA 3MNXA 4NG9H 2A45B 1Y3UA 4Y8ZA 1BDAA 1THPB 2ZC9H 1BJVA 3UWIA 1A5GH 2C8ZB 2AFQB 4FUBA 1BTPA 3SNBA 1TBRH 4A1VA 5GIBA 3RXTA 1J16A 3A80A 4MG3A 4D9RA 2BD3A 1P3CA 4AYYB 5C1XA 2BQ6B 3E3TA 4U32A 5LPRA 1SI5H 3SJ9A 1O2YA 3VB6A 1YBWA 1F0TA 2B9LA 2ZTXA 1GHVH 3SO3A 1LPGB 1FAXA 2A1DB 1HAHH 1P11E 2JKHA 3A83A 3ATKA 2BX4A 3KHVA 2ZFTA 5E2OA 1O35A 1O38A 4LOYH 1DOJA 4ABAA 1DSUA 3NK8A 2FI4E 3ZYEA 3SNDA 4Y7BA 4OS5A 2ZU4A 6GCHG 2GMTC 4XBBA 3MTYA 1Y3VA 1FY1A 1O0DH 1W0YH 5L2YH 1XKBC 2J34A 1DFPA 5C3NA 3PM3A 8KME2 1Z1IA 1CO7E 3M35A 2A7JA 4NIVA 1O2VA 1ABIH 2ZDLA 3M7QA 1WAYB 3SGQE 4LZ4B 2AMQA 1H4WA 3LC5A 4B71A 3VGCC 1O2WA 1V2QT 1PQ7A 4X0WU 1SGCA 1TQ7B 1GBAA 2ANKH 3SUGA 5B6OA 1W2KH 1C2LA 3GY2A 5DP5A 1YCPK 1QY6A 4ESTE 1S82A 3NKKA 3RXVA 2GP9B 1SOZA 1B5GH 3LDXH 3RXBA 1GG6C 3ENSB 5IDKA 2OBOA 1KXBA 2GKVE 3VB3A 1OSSA 1C2MA 2F9NA 1INCA 4NWKA 4K69A 1HAXB 2ZTZA 3TJOA 2ZQ1A 1Y3XA 5LPFA 1BMNH 1E38B 1HV7A 1UHBB 1B0EA 4YOGA 1TYNA 1P12E 2Q6DA 2Q6FA 1GVZA 1SGDE 1YYY1 3GOVB 1YCPH 1W7GH 1ARBA 1SGYE 5HYOA 3RXAA 1SQAA 2ALVA 3MU1A 4AG1A 1GWAA 1PFXC 1YPEH 1CBWB 1W13U 3E0PB 1J8AA 1C5TA 1P02A 4E05H 3E8LA 5GDSH 1X7AC 2A4OA 2G51A 2IN2A 3SI4H 1S85A 1O2LA 2VIQA 2SGEE 1RTKA 1BZXE 1XVOA 2ZHEH 4I8GA 1UVSH 1GMDF 4JK6A 4MTBA 3F6UH 4OS1A 2ALPA 2Z3DA 1AFQB 3SI3H 1O2ZA 2P95A 1TGTA 2FX4A 1LQDB 7GCHG 1TRNA 4TPYA 2BY6X 3PYHA 2Y7XA 1D3PB 4FU8A 1ZSLA 1CQQA 4X6MA 1BQYA 4AZ2B 3E16B 5JB9S 2EI8A 4B2AA 1ZR0A 3SGBE 1EUFA 3ZZCA 1BTWA 3OY5U 2A31A 2CGAA 3A7YA 4H6TA 3NPSA 2Y6TA 5AHGH 1ZRKA 1D3DB 1GMCG 1EAIA 3M3VA 2BDHA 2GV6A 1SGRE 2QF3A 1C5SA 3HATH 1Z8JB 3GDVA 1EATA 2HLCA 2CHAB 2HGTH 3QWCH 1TGCA 4GAWA 4Y71A 2ZU2A 3SV8A 2BD5A 3PMBB 4BTTB 4DVAU 3D49H 1UVUH 1AGJA 5AFZH 1SL3A 3RU4T 1G37A 2VGCC 1HDTH 5BPEA 2FDAA 2D26C 2P3TB 2THFB 1SBWA 5A0AE 1ORFA 1F7ZA 2OD3B 3GY6A 3LT3A 1A4WH 4AORA 1C5VA 2AERH 4CRCA 1V2LT 2HALA 2P94A 1YPGH 1U6QA 1LHDH 1P9SA 1LVMA 2AIPA 2ZDNA 3S9BA 1YM0A 3E1XB 2Z7FE 5GPIB 1P2NA 1DLKB 2GZ7A 5ESTE 2G81E 1TNIA 3RM0H 1O2KA 2VIVA 3SGAE 3UR6A 1A0LA 1C2HA 1ZHRA 3A82A 4KTSA 4CR5A 4UD9H 1YGCH 2ZPQA 1AHTH 1G36A 4B74A 2G5NA 1KLTA 1GBTA 1MQ5A 4NA9H 1BTUA 1MKWH 3MNSA 7ESTE 3TJVA 1XVMA 3TITA 2CMYA 2Z9IA 5CMXH 5I46H 4Q7ZA 1TNGA 4GHQA 1IQJA 1MTSA 3ZV9A 1K28D 1ZOMA 1W14U 2C4FH 1H8IH 5FCKA 1T31A 2C93B 2ILNA 1ZGVA 2WUBA 1QBNA 3P95A 3MU5A 1YC0A 1F5KU 1DLEA 3MH7A 9LPRA 1EPTA 1GHBF 1AKSA 3BIUH 4I8LA 1JRTA 3SNEA 4O3UA 1V2KT 1OWEA 3OY6U 2NWNA 4SGBE 1W3CA 1G2MA 1O3PB 4GCHF 1TGSZ 1H9LB 4NA8A 4ZKSU 3QX5H 3ODDA 4JK5A 2BD4A 2TIOA 1EZQA 2PFEA 3RXEA 2Z9KA 1WBGB 5CE1A 1WSSH 2JETC 1GHWH 1VGCB 2VU8E 3SU4A 3SU6A 4PROA 1GI3A 3M3TA 3QO6A 5J4QA 1UK4A 5A8XA 3NXPA 1RIWB 1GJDB 2GVFA 4XOJA 2BVSH 5JBBS 2DUCA 2FZZA 3ATLA 1TMTH 1UCYE 1WQVH 3U8OH 3EAJA 2ZFPH 3BTFE 2ASUB 4NSVA 2ZCLP 1PPGE 3VEQB 4AOQA 3BTME 2QXHA 5L6NH 1J9CH 2BLQA 2EI6A 4O3TA 5AVDA 3KEEA 3B9FH 2QXJA 1JWTA 1GGDC 3STIA 1GI9B 3GY8A 1C1WH 1S83A 1QRXA 1GBDA 2Q1JA 1F5LA 4BAMB 1V2PT 2ZG0H 4WMFA 1P06A 3RLWH 4GVUA 3O8CA 1GBFA 5HMAA 4YZUA 1BRBE 1OX1A 3SJKA 1UTNA 1G32B 4K3JA 1MUEB 1JOUB 3LGUA 4OS4A 1E37B 1C5YB 4AB8A 1O33A 4K5ZA 5HXFA 1TA2A 3KQDA 1O3MA 1ZSKA 2VIWA 1EJNA 1P2QA 3BIVH 4K60A 1NRSH 5FX6A 2PTCE 3HKJB 3E0NB 1NFWA 1GI2A 1O2SA 4H42U 1EAUA 3GY7A 3P70B 1V2NT 3O8RA 1D6RA 4R0IA 1YP9A 2ZECA 1C1RA 5JBAS 3U1IB 3BTQE 2ZFRH 1Z1JA 2ZGXH 1OS8A 1UTPA 1MTVA 1TALA 7LPRA 3OSYA 3ZVFA 2GCHF 1S81A 3Q3YA 5F8TA 3FANA 1K1LA 2VNTA 3MH4A 1QJ6B 2ESTE 5JYIA 1RXPA 1G3BA 3ZZ9A 4TWWA 4Y0YE 1V2ST 4DCDA 1AVXA 1ELAA 4NIYA 4BANB 2PLXA 1ANDA 2SFAA 3NZIA 3S0NA 3I77A 1TPAE 2ZKSA 3MFJA 5L2ZH 3QLPH 4YLQH 1C2IA 1HYLA 1SGQE 3LGIA 3BN9A 1UTQA 1W0ZU 1W10U 1MU8B 3M61U 4WXIA 4Y7AA 5JB8S 3SUEA 5DP3A 4ZMAH 3TNTA 2WUCA 2QIQA 3UFAA 4YT6H 4CHAC 1KXCA 2P3UB 2FLBH 2D8WA 2ZZUH 3GCHB 1C1TA 5I25A 3MYWA 1GJ4H 2TGAA 4CRAA 1GJ8B 4BXSA 2FOMB 5E0JA 1TMUH 2HNTF 4I8KA 1G2LA 2SGAA 4Q2KA 4DIHH 1CA0B 6CHAC 3QGJA 4X2WA 3P8OA 5EW1H 4MQAA 4GUXA 1AQ7A 2PGQB 1A5HA 2ANYA 1ELEE 1PQAA 3AAVA 2ZIQH 2H9TH 3P92A 2AEIH 1NFXA 3SZNA 1O32A 5T6DA 3V3MA 5T6FA 1N1LA 3Q3KA 3RU4D 3RXUA 3A88A 4BTUB 1J17T 3IWMA 3MO9A 1GJCB 5LPEA 1HXEH 5FHTA 1ACBE 1H9HE 4DJZB 4Y8YA 2Z9GA 1GBIA 2WV4A 3M5NA 2KAIA 1AN1E 3LC3A 4AFZA 1BTHH 1RJXB 4JZDH 1N8OB 4Q7YA 2HRVA 3EQ0H 1O2XA 4ZH8A 3TVJB 1GDQA 1OP8A 1O2TA 1HJAC 3BTWE 5T6GA 4O97A 1BMAA 2AGIX 5E0HA 1T8NA 3PMJA 2G52A 1OPHB 3M5OA 3SV9A 2P8OB 1LVBA 3M37A 1A0JA 4OS2A 1DXWA 1C5XB 1GVLA 5J4SA 1DXPA 2SGFE 4MNXA 1MMJN 4WJG2 2JH6D 1P2JA 1TPPA 1JBUH 1NY22 4KKDA 2BD9A 1VITG 1XXFA 1A5IA 1KLIH 3F1SB 1NS3A 4WXVA 2ZGBH 1GI1A 1BOQA 2Z9LA 1CHOF 2F9UA 3RXDA 3UREA 5ABWA 1TABE 2ZI2H 2UUFB 5C1UA 2EI7A 1SLVB 1SFQB 2OBQA 1LDTT 1NT1A 4FVBA 1AWHB 1NFUA 1BBRE 1BTXA 3SU2A 1P2MA 1F0UA 3GCTF 5DP6A 4HFPB 3S7KB 3ZZDA 1W12U 2VJ1A 3BG4B 5DGJA 5DP4A 3LKWA 3TJNA 2QN5T 2YNBA 2A2QH 5C2ZA 4NFEA 4XFQA 3SOSA 3U8TH 3MHWU 3PMAB 1ZJDA 4ZHLU 4YOJA 1Z6JH 1BHXB 2XRCA 1XMNB 2ANWA 1F5RA 3SV2H 4E7RG 2VH6A 3EA9A 2VIPA 1K21H 3QTVH 3A7ZA 4X2XA 2W5EA 1EZUC 4UONA 3EYDA 2PKAA 1EOLA 2A32A 4YLUA 3TH3H 1AFEH 2FOEA 3ZVAA 1Q31A 1QCPA 1TA6A 3RMOH 4CREA 2F9BH 3EGKH 2XBYA 1PPCE 1YPKH 5BRRE 1GHXH 2WINI 1TPOA 4R8TB 2OP9A 1C5ZB 3U8RH 2TRMA 2F83A 4YESB 1E0FD 2V3OH 1ZHMA 2P59A 3H7OA 4LK4A 1FAKH 3GYMA 3STJA 2BDCA 3M7UA 1BITA 3SNCA 1QL9A 2F9OA 3K65B 2ZP0H 5LH8A 3IITA 2ZCHP 1V2JT 2C3SA 1L0ZA 1Z7KA 1C5PA 3FP6E 3ZV8A 2ZFSA 5AF9H 1VCQA 6GCHF 1EXFA 1QRZA 4I32A 2WYGA 2WPJS 2ODPA 4FXGH 1H8DH 2RG3A 2PKSB 3R3GB 4U30A 3FVFB 3E6PH 1E36B 4ABIA 1G9IE 1F92A 2QF0A 2ZHQH 3BTTE 2QC2A 3SU0A 1RS0A 5C67A 4ABEA 3LOXA 1O2GH 2YOLA 2QA9E 1ZYOA 3T25A 1OYQA 1GDNA 2GTBA 1ZHPA 1GI4A 1DANH 2VIDA 1FIZA 1Y5UT 1BTYA 1C2FA 3NWUA 5IYTA 1LPZB 2FTMA 5A09A 4I33A 1L4ZA 1FY4A 3ZVDA 2A0QB 2XC4A 4X8TH 2PV9B 1P8VC 3ZZ3A 2STAE 3AW1A 2FM2A 3FFGA 1DM4B 2TGPZ 2H9EH 3MU0A 1QB9A 3PB1E 1HGTH 2B5TB 1O2IA 4UE7H 1ELTA 1HB0B 2G55A 1BB0B 1CU1A 4NCYA 1ZTLA 1TRYA 2ZPSA 5EQSA 2H2ZA 1N6YA 1TLDA 2Y82A 3SV6A 1K2I1 3ZZ5A 1SMFE 2A4RA 2FOFA 3V0XA 4LXBH 1A7SA 2BY5X 4E06H 1P2IA 3HGPA 3MOCA 2GCTB 1CGIE 2CF8H 3BTDE 3MH5A 2J2UA 1QQUA 3AASA 1O2JA 4KGAA 1G30B 1D3QB 2FP7B 2UWLA 5GWZA 1T8MA 4DY7B 3A8BA 3URCA 4GHTA 3U9AH 1O2NA 3HK6B 3SJ8A 4K8YA 1NROH 1AB9B 1C1SA 4ISNA 3RXHA 3GYLB 5DP9A 1SQTA 3L3TA 3W94A 3PTNA 1NRRH 1YKTA 7GCHF 3F9FA 4H6SB 1O3LA 1SGFG 4B76A 2OQ5A 1DICA 1CBWC 2GT8A 3BV9B 2VH0A 1EPTB 1AKSB 1O2HA 2OC8A 2AMDA 2V6NA 4OGYA 3QK1A 2XNIA 3RXIA 3UR9A 9ESTA 5TCAA 1JXPA 4KTCA 3VB5A 3Q00A 1EAWA 3UTUH 1NRNH 1O5GH 2F9PA 3U69H 3EE0B 1CGHA 1N6XA 1SQOA 1ZMJA 3RXJA 1AB9C 1WV7H 1GMCF 1HAIH 2F3CE 4ZKOU 1L1NA 4B2BA 1O3BA 3PTBA 1AFQC 1K1PA 3VPKA 3TU7H 1O30A 3V12A 2EEKA 2Z3EA 2XTTB 1L1GA 1EB1H 3Q76A 2CN0H 1UK3A 2ZEBA 2PW8H 1OP2A 2HOBA 1O3HA 3ATMA 5JBTA 4NZQA 3EA7A 2R0KA 3MMGA 3K6ZA 3RXPA 4X2VA 4YM9A 1V6DA 4VGCB 4XDEA 2ZTYA 1SFIA 4Z0KA 2Z9JA 1C5UA 1T4UH 4FUDA 1HUTH 4MLFB 3KL6A 5GJ4B 1EJAA 2DE8A 1E34B 2FOBA 2P3FH 1VCPA 2BM2A 2CHAC 2ZDKA 3C27B 1AVGH 2BXUH 3P17H 1O2UA 4AYVB 1VCWA 1OWJA 1ZRBA 4TPIZ 5GCHG 1C5QA 1G3DA 1FMGA 1EQ9A 4DW2U 1ELCA 5F8XA 3RMLH 3LIWA 3A7WA 3OX7U 2FPZA 3I78A 5HM2A 2RCEA 2Q6GA 4DT7B 3L33A 3QN7A 3FP7E 1C2JA 3L6PA 2PGBB 1O5CB 3UQVA 1AU8A 3PWCA 1C1MA 3A87A 1IQKA 1WOFA 2XYAA 1SGPE 1YCPM 4K1TA 1TWXB 4WF8A 3S7HB 1GBCA 4MNVA 4AN7A 2J94A 1L4DA 2QY0B 1C1NA 1UHBA 3UOUA 1HAGE 2A7HA 1ELFA 2G4TA 3QGNB 1FPCH 3AAUA 3PMHB 1GL0E 1PYTD 3T29A 1AWFH 4AB9A 3TNSA 3LJJA 4FU9A 5A8ZA 3ITIA 2VVCA 4ISIH 2FS8A 2BVXH 3P8GA 4NGAH 1H9IE 2O8WA 3ZVCA 2BY8X 4GSOA 3RC6A 3ZZAA 2FWWA 1FLEE 1OKXA 1QQ4A 1YPJH 3QDZB 1NPMA 1Y5AT 1TBQH 2G5VA 3G01A 2A2XH 3NCLA 1V2VT 2BYAX 1TRMA 4BAOB 1WQSA 1LPKB 3H7TA 1A0HB 2CV3A 1UTLM 1B0FA 3MWIU 2R3UA 3SBKA 1JIRA 4Y79A 1GJ6A 1UCYK 1NRPH 1OOKB 1GI6A 1MTNB 1C5RA 1DX5M 2K1QA 3S69A 1ZLRA 2ZFFH 1GHBG 1HCGA 2BQWB 3BEIB 3VXFH 2VWLA 2PUXB 1DVAH 1KSNA 1IQMA 3BTKE 3D65E 1VR1H 1MKXK 1ELBA 4Y6DA 2FYRA 4JCNA 1V2RT 3TPIZ 4D7FA 1BT7A 1FY5A 3CENA 2ZNKH 1C5LH 3T26A 2BHGA 2ZU5A 3FZDA 4FUCA 1A3BH 2C8YB 4MPWA 2BOHB 1VGCC 4X1RU 4X8UH 2GZ9A 2RA0A 2CJIA 1BIOA 1UCYH 4XE4A 2FOGA 1ZTJA 3UNQA 1A46H 5EXMA 1W7XH 4X8VH 1RIWC 5EQQA 2J4IA 5FBIA 3D23A 2UWPA 1CGJE 2K7XA 1AO5A 2TGTA 3LH1A 4CRGA 2XC5A 2IOTA 3SV7A 1IQLA 1NRQH 2KAIB 5FBEA 2GGVB 3UQOA 1GI5A 2VWMA 3HGNA 2WPMS 1P2OA 2VWNA 5EXLA 3AW0A 5F6MA 1YPMH 1HAPH 5FCRA 1LQEA 1KTTB 3SN8A 1SLUB 2GD4B 1LKBA 3KQCA 4WVPE 1PYTC 1LVOA 3DFJA 1IOEA 1O37A 2CF9H 2UUKB 1P04A 4IS5A 2PTNA 1O3KA 3M3SA 2LPRA 1IAUA 3UWJH 3A84A 1CT0E 4Q7XA 5EODA 5DPAA 5DP7A 2XBWA 4MVNA 1BUIA 4FUJA 3KIDU 1EP6A 2ZA5A 2WPIS 1TBZH 1FZZA 1Y8TA 2FOCA 2ZDVH 1YPHE 4ABJA 1CT4E 1GBLA 3MI4A 4WWYA 2ZWLH 4JMYA 1NU9A 1QRWA 3ZZ4A 1Y3WA 4B2CA 1DY9A 1V2WT 1HXFH 1FN6A 2P16A 2O8LA 2VINA 4DURA 3LONA 2ZGJA 4ABHA 2V0BA 5EGMA 1TAWA 1C4V2 3SUFA 1QFKH 1XM1A 2RA3A 1WCZA 2O9QA 4IGDA 5TJXA 2QGRA 2J9NA 1FV9A 3MU8A 1DWEH 1VZQH 4SGAE 1XUGA 3SQEE 1S0RA 4ISOA 4JZIA 4K8BA 3A81A 1HIAA 5EPYA 2WV5A 4JYUH 2A4GA 3SU1A 4INLA 2ODYB 1TB6H 3UUZA 3O8DA 1Z8IB 4BNRA 2NU1E 2PKAB 1AD8H 2BLOA 1GBMA 2FXRA 4X1PU 1GJAB 2W3IA 3M36A 4CBOA 2BVRH 4TWYA 1HFDA 1IHSH 2NU3E 4CR9A 3UPEA 1TONA 3P6ZB 4RKJB 1AUTC 1O2RA 5L30H 1O34A 1O2QA 2ZHFH 5DJ7A 2R2MB 1ZZZA 1S84A 3TK9A 1ESBA 1TGNA 4NZLA 4Y11E 3DUXH 3GCHC 1PPFE 4ZROA 5ESBA 1EB2A 2GDDA 2OQUA 1BMLA 1MAYA 4A7IB 4LZ1H 1MZAA 1P9UA 3LH3A 4ZKNU 1Z71A 2H9HA 4IBLH 1JIMA 3P8FA 1CA0C 1TX6A 3GY3A 1P09A 1C5NH 5CHAB 2FMJA 4B73A 4WMEA 1C2EA 4U01A 2R0LA 2WPHS 1BTZA 4NIXA 3RMNH 4ZUHA 2BZ6H 4NA7A 5LGOA 1XKAC 2J92A 2H6MA 2BZAA 4TY7A 3RXFA 2XCNA 1AIXH 3RXSA 5TCCA 3RDZA 1HRTH 8GCHG 4NSYA 1HJ9A 3BEFB 2FEQH 2F9VA 1KXAA 4D76A 5A0CA 2BDGA 3P8NA 2Y7ZA 1GHAG 3PLKA 3ODFA 1XUJA 3ATWA 1A1RA 4WH6A 4X8SH 2BDIA 5DKMA 3GDSA 6ESTA 1DY8A 3KNXA 3PLBA 2M5TA 3CS7A 4BXWA 3AVZA 1BBRK 1UTOA 1EJMA 1ANEA 1S5SA 1SR5C 5EQRA 3RC4A 1RGQA 3VXEH 3RXGA 2XWBI 3N7OA 1N8OC 2BDAA 1HLTH 1BA8B 2XW9A 3ZZ7A 1UO6A 5K0HA 1HPGA 4CH8B 1TIOA 3A89A 1O3AA 1GCTB 1FDPA 2SGQE 5F8ZA 4BAKB 3T62A 4ZXXH 1HAVA 1W8BH 3K2UA 4X6PA 1ETSH 2P8OC 4CRFA 5AFYH 1FQ3A 2QAAA 3KGPA 1NTPA 2O8TA 5DO4H 1P3EA 2OC7A 1O39A 2NU4E 1GBJA 1OWHA 1PQ8A 2G8TA 1QB6A 1DWCH 4INHA 2PSYA 1BRCE 5JPMH 2A5KA 1XUFA 2GT7A 1UVPA 1YLCA 4WMDA 1BBRH 2VWOA 1D9IA 1TOMH 2BDYA 5A0BA 2I6SA 3ELAH 4O9VA 1AE8H 2R9PA 1KDQA 4ABFA 1GBKA 2W7UA 1KY9A 1GCTC 2FTLE 5DG6A 4JZFH 2OC0A 3GCNA 1FUJA 3RXLA 3VFEA 4MNWA 1FY3A 2OTVA 4D8NA 4ZXYH 5C5NA 4BTIB 1Y5BT 1C2DA 4K1SA 2ZGHA 2QYIA 3M5LA 1WU1A 2C90B 1Z8RA 2AH4X 1O5DH 3BG4C 3UNSA 4KP0A 2IJOB 3A8DA 1S0QA 1QL7A 1LVYA 3GDUA 1OP0A 4GLYA 2BMGB 1EX3A 1LHGH 2Y81A 4AGJA 1C2GA 4TY6A 4UFDH 7KMEH 2ZDMA 1A3EH 1QGFA 1AZZA 1WUNH 1QA0A 1THRH 5HM9A 1O3JA 2RDLA 1GJBB 1M9UA 1NC6A 2BD2A 5DK1A 1K1IA 1QURH 3ZVBA 1GMHG 5EW2H 1PQ5A 1YPLH 2HPQH 2HNTE 3DHKH 2GMTB 1SVPA 1BHXF 1K9OE 2SGDE 4ISHH 2XXLA 5JDUB 2FO9A 5FPYA 1GBBA 1T8OA 4FUGA 2EC9H 1MTWA 4MNYA 1K22H 2DE9A 3DD2H 4O03A 3DA9B 4BOHA 2CXVA 3CP7A 3GISB 1O36A 2O8UA 1V2UT 2UWOA 3VGCB 1UJ1A 6LPRA 1MH0A 5EU8A 1ABJH 2QXGA 1RTFB 2BTCE 1SGTA 4GPGA 1C5WB 3SORA 4A1TA 1BMMH 3ZZBA 1TNHA 4ABBA 4DIIH 1A61H 1XUHA 3RXCA 3RP2A 1LO6A 4A5TS 1E35B 1GG6B 2PKSC 3RXRA 1O31A 1B7XB 1C4U2 1DDJA 3B23B 3TK5A 3H5CB 2EA3A 1HAYB 4RSPA 1D3TB 3EA8A 2R3YA 1ESTA 1P57B 1AUJA 4QT8C 3IG6B 1P01A 2Y5FA 2ODQA 1KXDA 4ASHA 1K1OA 4JZEH 3RMMH 3SUDA 1V2OT 2ZU1A 3S9CA 4CH2B 1VITH 1ZMLA 2HVXA 1MZDA 3A86A 4AFQA 4AGKA 3BF6H 2XCFA 1EASA 2OINA 3UNRA 3MO3A 1G3CA 4BAHB 3LGVA 3SHAH 1K1MA 1XUIA 1BRAA 4X6OA 1HAOH 4OGXA 1ELDE 4X1NU 3BSQA 1FI8A 2BQ7B 2LIZA 1SGNE 1AI8H 1C5OH 1Q3XA 1ETTH 5EOKA 1L1JA 1GBEA 3V13A 2ZDAH 2JH0D 3T2NA 1IQNA 1CE5A 1IQIA 3E91A 1LHEH 1GDUA 1Q2WA 1GBHA 5F03A 3ZVGA 1O2PA 4Z6AH 1UTKA 5A8YA 2GCTC 4MDSA 1TX7A 1IQHA 3DFLA 1T4VH 4HTCH 3SU3A 1MD7A 1BRUP 3SU5A 3SJOA 3SJIA 1CSOE 1SLXB 2AS9A 4I8HA 4UFGH 4FUEA 4H4FA 1SC8U 1PPHE 3T28A 3UOPA 2XBXA 4JYVH 1GMDG 4HGCA 3GICB 3BTEE 1O2OA 4UEHH 5E0GA 1OWKA 4ZHAA 1P0SH 3TK6A 5EPNA 1OXGA 2PR3A 3KCGH 5A2MH 2UUYA 4XBCA 2B0FA 1LCYA 4RN6A 2H5CA 1DUAA 2ZO3H 3FP8E 1EPTC 3RU4E 3RC5A 2W3KA 1QIXB 1Z6EA 2XC0A 1IQEA 3KN2A 3RXQA 4KELA 4BAQB 4KTUA 1V2MT 2ZU3A 3JZ1B 1XX9A 3SW2B 1O3NA 1QBOA 2VGCB 1T32A 2C8XB 1PPZA 3LGTA 4F49A 2FOAA 2SNWA 1ZJKA 3K6YA 4NIWA 2V35A 2ULLA 4ABDA 3BTGE 3I29A 5FX5A 5HGGA 3PV4A 1ZPCA 3F9EA 3K9XB 1H1BA 5PTPA 1PPEE 5C5OA 4CRDA 3ZYDA 4IMQA 5GCHF 3TJUA 3Q77A 4X1SU 3OTJE 2AMPA 1SSXA 1O2MA 4MPUA 4Y10E 1F0SA 2ZF0H 2W7SA 1FN8A 4VGCC 2XBVA 2AYWA 3PROA 1VJ9U 1MTUA 4D7GA 2SGPE 1CT2E 1RFNA 3VB4A 1YPHC 2GZ8A 2JH5D 1V2TT 4AFSA 1IQGA 3A7VA 3QZQA 2SNVA 4A1XA 1YF4A 2ANMH 3MNBA 2TGDA 1C1VH 3OU0A 2FI3E 1SGFA 1MKWK 2D2DA 5T3HA 3SHCH 4AG2A 1GL1A 1D4PB 1D6WA 2ZFQH 2ZPRA 4WY3A 2Y5HA 3ATIA 2ZGCA 1K1JA 1O3IA 1SLWB 1UTMA 1DPOA 1MU6B 4OS6A 5DP8A 4IN1A 3MO6A 4UFFH 1ANBA 1O3GA 2QV1A 3LPRA 1ID5H 2J38A 1DWBH 4X6NA 1DITH 5H4IB 4A6LA 5ETXA 3TGIE 1SPJA 1FY8E 1F2SE 3E90B 1WTHD 1NFYA 3FAOA 3JZ2B 3UIRA 2A7CA 3EDXB 3SQHE 4CBNA 5E2PA 1P2KA 1ZTKA 1TGBA 1TNJA 2A4QA 4Y8XA 1QB1A 2JETB 3LU9B 1HIAB 2P93A 2PUQH 3F9GA 1T7CA 3TH4H 1YLDA 1RD3B 1FJSA 4YTAA 4YOIA 4A92A 1F0RA 3Q3XA 1DE7H 1GI8B 3RXKA 4IW4E 4E7NA 1LHFH 3U1JB 1CHGA 1NZQH 4XSKU 1Y59T 4HZHA 1ELGA 1TMBH 4IMZA 1AZ8A 1AE5A 1L2EA 1AMHA 1EZSC 2OLGA 4GCHG 5G4BA 3A85A 1JRSA 1FNIA 4MPXA 4IC5A 1MCVA 3SNAA 3PO1B 3TH2H 1EKBB 2GDEH 1ARCA 2PHBA 1GGDB 2BY9X 1ELVA 2IPHA 4B1TA 2ZHWH 3U98H 1O3OA 2AGEX 1MTNC 2WPLS 4J1YA 1GJ7B 1EP5A 4FUFA 1O5EH 1GHZA 1ZMNA 4YO9A 1TNKA 2O8MA 1KTSB 1UVTH 1JMOH 2TPIZ 2FIRH 1C1OA 4X2YA 1RTLA 3PO1C 2FLRH 1KIGH 1MKXH 4DG4A 1C4Y2 5C20A 1SOTA 4FUIA 3KQEA 1DUEA 2PWXA 1HAZB 2BLWA 1O5FH 3F68H 1RRKA 1UMAH 3MH6A 2VVVA 3BTHE 1TX8A 3LJOA 1QTFA 2YNAA 1DWDH 1ETRH 5C1YA 1QA7A 1Z8GA 3RM2H 3CS0A 4DGJA 3S9AA 3PLPA 1TQ0B 1P03A 1LHCH 1NN6A 2WPKS 3VB7A 1TOCB 2BOKA 1Y3YA 1NM6A 3GY4A 1MBMA 1GJ5H 2H5DA 1PJPA 4ZHMU 1SG8B 1BJUA 1AVWA 1S6FA 3KF2A 4I31A 1DT2A 1C1QA 2OCVB 2AIQA 3TGJE 1FPHH 3C1KA 1EAXA 3GY5A 5FXLA 1AY6H 1HAVB 3A7XA 1GCDA 1O3FA 4OS7A 3GCOA 1ZPZA 2A5AA 1GI7B 2FS9A 4DOQA 4JYTA 1O5BB 2BB4A 5GXPA 2GCHG 4CHAB 3PWBA 4M7GA 1MCTA 4FUHA 1VJAU 3ZZ8A 2A5IA 1WYKA 3HPTB 1QHRB 5FPTA 1C2KA 1KDQB 4X1QU 1XUKA 2WYJA 1KXFA 3A7TA 4TYDA 1V3XA 4WH8A 2G4UA 3R0FA 1IQFA 1LMWB 1TE0A 2BXTH 1GJ9B 3NUMA 6CHAB 4I7YH 1O3CA 2HWLB 4AFUA 1TPSA 1NESE 5SGAE 1OWDA 1J15A 2HNTC 3HKIB 1G3EA 4CRBA 3QTOH 4B75A 4K2YA 2FYQA 4XBDA 2OUAA 3M5MA 3LGYA 3M7TA 5JBCS 1GVKB 3O8BA 4ISLA 4IC6A 1QR3E 1QJ7B 4UDWH 3TIUA 1HBTH 4K1EA 5E8EH 2QCYA 2VIOA 1SB1H 3T5FH 1QNJA 2ZQ2A 1MD8A 2NU2E 4D9QA 2BD7A 8LPRA 1C1PA 5FPSA 2FI5E 1P05A 3KQBA 2Z6BD 3ZZ6A 3DT0H 1KLJH 5EG4A 4AX9H 4FU7A 3B8JA 3QZRA 2QXIA 2C8WB 3TLOA 1NU7B 1HJAB 1HJ8A 1O3EA 4NWLA 1OWIA 3A8AA 1EZXC 1ZPBA 1DSTA 2V3HH 1SHYA 2Y80A 3V7TA 4NFFA 1EOJA 2UUJB 8GCHF 1CVWH 2VVUA 4J2YB 1NO9H 4THNH 2XWAA 2D1JA 2Y5GA 3EBNA 2HPPH 3HK3B 1GHAF 1FONA 1LKAA 1MBQA 2FX6A 1K1NA 2F91A 3BEUA 1FXYA 4I8JA 3TGKE 2G00A 2PSXA 4ZKRU 3ZVEA 3D62A 1TNLA 5CHAC 1UK2A 1VITF 3RUOA 5K7RA 1KXEA 3RLYH 3OYPA 1GPZA 1C5MD 3T27A 1QJ1B 1W11U 3MU4A 3RXOA 2OC1A 1P10A 2R2WU 1GHYH 4ABGA 4YT7H 5EXNA 2B7DH 1O3DA 1MAXA 3URDA 1TFXA 3UY9A 2ZCKP 1THSH 3F9HA 3BG8A 1OYTH 1T8LA 3WY8A 1QBVH 4JZ1A 2BX3A 1C1UH 1MQ6A 2BD8A 4F4OC 4INKA 2H1UA 3QUMP 4FVDA 1UTJA 2NU0E 1ZSJA 1DS2E 1CHOG 2J95A 1PPBH 1UVOA 1GI0A 1XXDA 2Z3CA 1A2CH 2STBE
chains in the Genus database with same CATH superfamily
2B8OH 2LNCA 2BY7X 3ESTA 4Q80A 4ZAEA 4HI3A 1LTOA 1SGEE 2OXSA 1FIWA 3MNCA 1J14A 3FZZA 4U2WA 1ANCA 4MPVA 1O5AB 2BDBA 1BCUH 3GCTG 2TBSA 3W95A 8ESTE 2VB0A 2FODA 3A8CA 1CA8B 2BLVA 4RKOB 2FESH 2ZHDA 4UFEH 1KYNA 3LGWA 1IHTH 3RXMA 2W26A 1ESAA 1QL8A 2GX4A 3PRBA 1HNEE 2I6QA 1SGIB 1C9TA 2FOHA 4IN2A 5FAHA 4Y76A 1C9PA 2GV7A 1SHHB 1WTGH 4Y0ZE 1ZGIA 2AGGX 2Z94A 1GMHF 1S6HA 3MNXA 4NG9H 2A45B 1Y3UA 4Y8ZA 1BDAA 1THPB 2ZC9H 1BJVA 3UWIA 1A5GH 2C8ZB 2AFQB 4FUBA 1BTPA 3NRLA 3SNBA 1TBRH 4A1VA 5GIBA 3RXTA 1J16A 3A80A 4MG3A 4D9RA 2BD3A 1P3CA 4AYYB 5C1XA 2BQ6B 3E3TA 4U32A 5LPRA 1SI5H 3SJ9A 1O2YA 3VB6A 1YBWA 1F0TA 2B9LA 2ZTXA 1GHVH 2IPQX 3OAAD 3SO3A 1LPGB 1FAXA 2A1DB 1HAHH 1P11E 2JKHA 3A83A 3ATKA 2BX4A 3KHVA 2ZFTA 5E2OA 1O35A 1O38A 4LOYH 1DOJA 4ABAA 1DSUA 3NK8A 2FI4E 3ZYEA 3SNDA 4Y7BA 4OS5A 2ZU4A 6GCHG 2GMTC 4XBBA 3MTYA 1Y3VA 1FY1A 1O0DH 2J97A 1W0YH 5L2YH 1XKBC 2J34A 1DFPA 5C3NA 3PM3A 2KCAA 8KME2 1Z1IA 1CO7E 1EFRD 3M35A 2A7JA 4NIVA 1O2VA 1ABIH 2ZDLA 3M7QA 1WAYB 3SGQE 4LZ4B 2AMQA 1H4WA 3LC5A 4B71A 3VGCC 1O2WA 1V2QT 1NBME 1PQ7A 4X0WU 1SGCA 1TQ7B 1GBAA 4ZCNA 2ANKH 3SUGA 5B6OA 1W2KH 1C2LA 3GY2A 5DP5A 1YCPK 1QY6A 4ESTE 5B6LA 1S82A 5C0UA 3NKKA 3RXVA 2GP9B 1SOZA 1B5GH 3LDXH 3RXBA 1GG6C 2AHME 3ENSB 5IDKA 2OBOA 1KXBA 2VBCA 2GKVE 3VB3A 1OSSA 1C2MA 2F9NA 1INCA 4NWKA 4K69A 2L6OA 1HAXB 2ZTZA 3TJOA 2ZQ1A 1Y3XA 5LPFA 4XD7D 1BMNH 5F53A 1E38B 1HV7A 1UHBB 1B0EA 4YOGA 1TYNA 1P12E 4RI0A 2Q6DA 2Q6FA 1GVZA 1SGDE 1YYY1 3GOVB 5GNDA 1YCPH 1W7GH 2RDEA 1ARBA 1SGYE 5HYOA 3RXAA 1SQAA 2ALVA 3MU1A 4AG1A 1GWAA 1PFXC 1YPEH 1CBWB 1W13U 3E0PB 1J8AA 1C5TA 1P02A 4E05H 3E8LA 2M2AA 5GDSH 1X7AC 2A4OA 2G51A 2IN2A 3SI4H 1S85A 1O2LA 2VIQA 2SGEE 3KYGA 4P00A 1RTKA 2EY4C 1BZXE 1XVOA 2ZHEH 4I8GA 1UVSH 1GMDF 4JK6A 4MTBA 3F6UH 4OS1A 2ALPA 2Z3DA 1AFQB 3SI3H 1O2ZA 2P95A 1TGTA 1SQRA 2FX4A 1LQDB 7GCHG 1TRNA 4TPYA 2BY6X 5C17A 4TT3D 1YLNA 3PYHA 2Y7XA 1D3PB 4FU8A 1ZSLA 1CQQA 4X6MA 1BQYA 4AZ2B 3E16B 5JB9S 2EI8A 4B2AA 1ZR0A 3SGBE 1EUFA 3ZZCA 1BTWA 3OY5U 2A31A 2CGAA 3A7YA 4H6TA 3NPSA 2Y6TA 5AHGH 4DT4A 1ZRKA 1D3DB 1GMCG 1EAIA 3M3VA 2BDHA 1S6LA 2GV6A 1SGRE 2QF3A 1C5SA 3HATH 1Z8JB 3GDVA 1EATA 2HLCA 2CHAB 2HGTH 3QWCH 1TGCA 4GAWA 4Y71A 2ZU2A 3SV8A 2BD5A 3PMBB 4BTTB 1H8ED 4DVAU 3D49H 1UVUH 1AGJA 5AFZH 1SL3A 3RU4T 1G37A 2VGCC 1HDTH 5BPEA 1SKYE 5CDFE 2RFKC 2FDAA 2D26C 2P3TB 2THFB 1SBWA 5A0AE 1ORFA 1F7ZA 2OD3B 3GY6A 3LT3A 2WPDD 4Q4LA 1A4WH 4AORA 1C5VA 2AERH 4CRCA 1V2LT 2HALA 2P94A 1YPGH 1U6QA 1LHDH 1P9SA 1LVMA 2AIPA 2ZDNA 3S9BA 1YM0A 3E1XB 2Z7FE 5GPIB 1P2NA 1DLKB 2GZ7A 5ESTE 2G81E 1MABB 1TNIA 3RM0H 2F4LA 1O2KA 2VIVA 3SGAE 3UR6A 1A0LA 1C2HA 1ZHRA 3A82A 4KTSA 4CR5A 4UD9H 1YGCH 2ZPQA 1AHTH 1G36A 4B74A 2G5NA 1KLTA 2JJ2D 1GBTA 1MQ5A 4NA9H 1BTUA 1MKWH 3MNSA 7ESTE 3TJVA 1XVMA 3TITA 2CMYA 2Z9IA 5CMXH 5I46H 4Q7ZA 1TNGA 4GHQA 1IQJA 1MTSA 3ZV9A 1K28D 1ZOMA 1W14U 2C4FH 1H8IH 5FCKA 1T31A 2C93B 2ILNA 1ZGVA 2WUBA 1QBNA 3P95A 3MU5A 3W1EA 1YC0A 3CNRA 1F5KU 1DLEA 3MH7A 9LPRA 1EPTA 1GHBF 1AKSA 3BIUH 4I8LA 1JRTA 3SNEA 4O3UA 1V2KT 1OWEA 3OY6U 2NWNA 4SGBE 1W3CA 1G2MA 1O3PB 4GCHF 1TGSZ 1H9LB 4NA8A 4ZKSU 3QX5H 3ODDA 4JK5A 2BD4A 2TIOA 3PRDA 1EZQA 2PFEA 3RXEA 2Z9KA 1WBGB 5CE1A 1WSSH 2JETC 1GHWH 1VGCB 2VU8E 3SU4A 3SU6A 4PROA 1GI3A 3M3TA 3QO6A 5J4QA 1UK4A 5A8XA 3NXPA 5EJ1A 1RIWB 1GJDB 2GVFA 4XOJA 2BVSH 5JBBS 2DUCA 4Q63A 2FZZA 3ATLA 5KEDA 1TMTH 1UCYE 1WQVH 1KMHB 3U8OH 3EAJA 2ZFPH 1E1RD 2QF4A 3BTFE 2ASUB 4NSVA 2ZCLP 1PPGE 3VEQB 4AOQA 3BTME 2QXHA 5L6NH 1J9CH 2BLQA 2EI6A 4O3TA 5AVDA 3KEEA 3B9FH 2QXJA 1JWTA 1GGDC 3STIA 1GI9B 2IJD1 1C1WH 3GY8A 1S83A 1QRXA 2W6ID 1GBDA 2Q1JA 1F5LA 4BAMB 2EQNA 1V2PT 2ZG0H 4WMFA 1P06A 3RLWH 4GVUA 3O8CA 1GBFA 5HMAA 4YZUA 1BRBE 1OX1A 3SJKA 1UTNA 1G32B 4K3JA 1MUEB 1JOUB 3LGUA 4OS4A 1E37B 1C5YB 2KCOA 4AB8A 1O33A 4K5ZA 5HXFA 1TA2A 3KQDA 1O3MA 1ZSKA 2VIWA 5HIYA 1EJNA 1P2QA 3BIVH 4K60A 1NRSH 5FX6A 2PTCE 3HKJB 3E0NB 1NFWA 1GI2A 1O2SA 4H42U 1EAUA 3GY7A 1NBMD 3P70B 1V2NT 3O8RA 1D6RA 4R0IA 1YP9A 2ZECA 1C1RA 3N7EA 5JBAS 3U1IB 3BTQE 2ZFRH 1Z1JA 2ZGXH 1OS8A 1UTPA 1MTVA 1TALA 7LPRA 3OSYA 3ZVFA 2GCHF 1S81A 3Q3YA 5F8TA 3FANA 1K1LA 2VNTA 3MH4A 1QJ6B 2ESTE 2LELA 5JYIA 1RXPA 1G3BA 3ZZ9A 4TWWA 4Y0YE 1V2ST 4DCDA 1AVXA 1ELAA 4NIYA 4BANB 2PLXA 1ANDA 2SFAA 3NZIA 3S0NA 3I77A 4HG6A 1TPAE 2ZKSA 3MFJA 5L2ZH 3QLPH 4YLQH 1C2IA 1HYLA 1SGQE 3LGIA 3BN9A 1UTQA 1W0ZU 1W10U 1MU8B 3M61U 4WXIA 4Y7AA 5JB8S 3SUEA 5DP3A 4ZMAH 3TNTA 2WUCA 2QIQA 2WHXA 4YT6H 3UFAA 4CHAC 1KXCA 2P3UB 2FLBH 2D8WA 2ZZUH 3GCHB 1C1TA 5I25A 3MYWA 1GJ4H 2TGAA 4CRAA 1GJ8B 3GS9A 4BXSA 2FOMB 5E0JA 1TMUH 2HNTF 4I8KA 1G2LA 2SGAA 4Q2KA 5T1VA 1UW7A 1WXRA 1CA0B 6CHAC 4DIHH 3QGJA 1H8HD 4X2WA 3P8OA 5EW1H 4MQAA 4GUXA 1AQ7A 2PGQB 1A5HA 2ANYA 1ELEE 1PQAA 3AAVA 2ZIQH 2H9TH 3P92A 2AEIH 1NFXA 3SZNA 1O32A 5T6DA 3V3MA 5T6FA 1N1LA 3Q3KA 3RU4D 2LP6A 3RXUA 3F0PA 3A88A 2KFWA 4BTUB 1J17T 3IWMA 3MO9A 1GJCB 5LPEA 1HXEH 5FHTA 1ACBE 1H9HE 4TSFD 4DJZB 4Y8YA 2Z9GA 4B6FA 1GBIA 2WV4A 3M5NA 2KAIA 5FL7D 1AN1E 3LC3A 4AFZA 4RT0A 1BTHH 1RJXB 4JZDH 1N8OB 4Q7YA 2HRVA 3EQ0H 1O2XA 4ZH8A 3TVJB 1GDQA 1OP8A 1O2TA 1HJAC 3BTWE 5T6GA 4O97A 1BMAA 2AGIX 5E0HA 3AK5A 1T8NA 3PMJA 2G52A 1OPHB 3M5OA 3SV9A 2P8OB 1W0JD 1LVBA 3M37A 1A0JA 4OS2A 1DXWA 1C5XB 1GVLA 5J4SA 1DXPA 2SGFE 4MNXA 1MMJN 4WJG2 2JH6D 1P2JA 1TPPA 1JBUH 1NY22 4KKDA 2BD9A 1VITG 1XXFA 2WZQA 1A5IA 1KLIH 3F1SB 1NS3A 4WXVA 2ZGBH 1GI1A 1OHHD 1BOQA 2Z9LA 1CHOF 2F9UA 3RXDA 3UREA 5ABWA 1TABE 2ZI2H 4I86A 2UUFB 5C1UA 2EI7A 1SLVB 1SFQB 2OBQA 1LDTT 1NT1A 4FVBA 1AWHB 1NFUA 1BBRE 1BTXA 3SU2A 1P2MA 1F0UA 3GCTF 5DP6A 4HFPB 3S7KB 3ZZDA 1W12U 2VJ1A 3BG4B 2CK3D 5DGJA 5DP4A 3LKWA 3PV2A 3TJNA 2QN5T 2YNBA 2A2QH 5C2ZA 4NFEA 4XFQA 3SOSA 3U8TH 3MHWU 3PMAB 1ZJDA 4ZHLU 4YOJA 1Z6JH 1BHXB 2XRCA 1XMNB 2ANWA 1F5RA 3SV2H 4E7RG 2VH6A 3EA9A 2VIPA 1K21H 3QTVH 3A7ZA 4X2XA 2W5EA 1EZUC 3UB0A 4UONA 3EYDA 2PKAA 1EOLA 2A32A 4YLUA 3TH3H 1AFEH 2FOEA 3ZVAA 1Q31A 1QCPA 1TA6A 3RMOH 4CREA 2F9BH 3EGKH 2XBYA 1PPCE 1YPKH 5BRRE 1GHXH 5EJZA 2WINI 1TPOA 4R8TB 3F2GA 2OP9A 1C5ZB 3U8RH 2TRMA 2F83A 4YESB 1E0FD 2V3OH 1ZHMA 2P59A 3H7OA 4LK4A 1FAKH 3GYMA 3STJA 2BDCA 3M7UA 1BITA 3SNCA 1QL9A 2F9OA 3K65B 2ZP0H 5LH8A 3IITA 2ZCHP 1V2JT 2C3SA 1L0ZA 1Z7KA 1C5PA 3FP6E 3ZV8A 2ZFSA 5AF9H 1VCQA 6GCHF 1EXFA 1QRZA 4I32A 2WYGA 2WPJS 2ODPA 4FXGH 1H8DH 2RG3A 3WW7A 2PKSB 3R3GB 4U30A 3FVFB 3E6PH 1E36B 4ABIA 1G9IE 1F92A 3KQ5A 2QF0A 2ZHQH 3BTTE 2QC2A 3SU0A 5DN6D 1RS0A 5C67A 4ABEA 3LOXA 1O2GH 2YOLA 2QA9E 1ZYOA 3T25A 1OYQA 1GDNA 5IK2D 2GTBA 1ZHPA 1GI4A 1DANH 2VIDA 1FIZA 1Y5UT 1BTYA 1C2FA 3NWUA 5IYTA 1LPZB 2FTMA 3SYJA 4I33A 5A09A 1L4ZA 1FY4A 3ZVDA 2A0QB 2XC4A 4X8TH 2PV9B 1P8VC 3ZZ3A 2STAE 3AW1A 2FM2A 3FFGA 1DM4B 2TGPZ 2H9EH 3MU0A 1QB9A 3PB1E 1HGTH 2B5TB 1O2IA 4UE7H 1ELTA 1HB0B 2G55A 1BB0B 1CU1A 4NCYA 1ZTLA 1TRYA 2ZPSA 5EQSA 2H2ZA 1N6YA 1TLDA 2Y82A 3KYFA 3SV6A 1K2I1 3ZZ5A 1SMFE 2A4RA 2FOFA 3V0XA 4LXBH 1A7SA 2BY5X 2V3MA 4E06H 1P2IA 3HGPA 3MOCA 2GCTB 1CGIE 3UAIC 2CF8H 3BTDE 3MH5A 2J2UA 1QQUA 3AASA 1O2JA 4KGAA 1G30B 1D3QB 2FP7B 2UWLA 5GWZA 1T8MA 1YWUA 4DY7B 3A8BA 3URCA 4GHTA 3U9AH 1O2NA 3HK6B 3SJ8A 4K8YA 1NROH 1AB9B 1C1SA 4ISNA 3RXHA 3GYLB 5DP9A 1SQTA 3L3TA 3W94A 2J98A 3PTNA 1NRRH 4XRNA 1YKTA 7GCHF 3F9FA 4H6SB 1O3LA 1SGFG 4B76A 2OQ5A 1DICA 1CBWC 2GT8A 3BV9B 2VH0A 1EPTB 1AKSB 1O2HA 2OC8A 2AMDA 1W0KD 2V6NA 4OGYA 3QK1A 2XNIA 3RXIA 3UR9A 9ESTA 5TCAA 1JXPA 4KTCA 3VB5A 3Q00A 1EAWA 3UTUH 1NRNH 1O5GH 2F9PA 3U69H 3EE0B 1CGHA 5HKKD 1N6XA 1SQOA 1ZMJA 3RXJA 1AB9C 1WV7H 1GMCF 1HAIH 2F3CE 4ZKOU 1L1NA 4B2BA 1O3BA 3PTBA 1AFQC 1K1PA 3VPKA 3TU7H 1O30A 3V12A 2EEKA 2Z3EA 2XTTB 1L1GA 1EB1H 3Q76A 2CN0H 1UK3A 2ZEBA 2PW8H 1OP2A 2HOBA 1O3HA 3ATMA 3OEED 5JBTA 4NZQA 3EA7A 2R0KA 3MMGA 3K6ZA 3RXPA 4X2VA 4YM9A 1V6DA 4VGCB 4XDEA 2ZTYA 1SFIA 4Z0KA 3ZIAD 2Z9JA 1C5UA 1T4UH 4FUDA 1HUTH 4MLFB 3KL6A 5GJ4B 1EJAA 2DE8A 1E34B 4P02A 2FOBA 2P3FH 1VCPA 2BM2A 2CHAC 3DSGA 2ZDKA 3C27B 1AVGH 2BXUH 3P17H 1O2UA 4AYVB 1VCWA 1OWJA 1ZRBA 4TPIZ 5GCHG 1C5QA 1G3DA 1FMGA 1EQ9A 4DW2U 1ELCA 5F8XA 3RMLH 3LIWA 3A7WA 3OX7U 2FPZA 3I78A 5HM2A 2RCEA 2Q6GA 4DT7B 3L33A 3QN7A 4YXWD 3FP7E 1C2JA 3L6PA 2PGBB 1O5CB 3UQVA 1AU8A 3PWCA 1C1MA 3A87A 1IQKA 1WOFA 2WV9A 2XYAA 1SGPE 1YCPM 4K1TA 1TWXB 4WF8A 3S7HB 1GBCA 4MNVA 4AN7A 2J94A 1L4DA 2QY0B 1C1NA 1UHBA 3UOUA 1HAGE 2A7HA 1ELFA 2G4TA 3QGNB 1FPCH 3AAUA 3PMHB 1GL0E 1PYTD 3T29A 1AWFH 4AB9A 2YMSB 3TNSA 3LJJA 4FU9A 5A8ZA 3ITIA 2VVCA 4ISIH 2FS8A 2BVXH 3P8GA 4NGAH 1H9IE 2O8WA 3ZVCA 2BY8X 4GSOA 3RC6A 3ZZAA 2FWWA 1FLEE 1OKXA 5DSFA 1QQ4A 1YPJH 3QDZB 1NPMA 1Y5AT 1TBQH 2G5VA 3G01A 2A2XH 3NCLA 1V2VT 2BYAX 1TRMA 4BAOB 1BMFD 1WQSA 1LPKB 3H7TA 1A0HB 2CV3A 1UTLM 1B0FA 3MWIU 2R3UA 3SBKA 4ASUD 5HIZA 1JIRA 4Y79A 1GJ6A 1UCYK 1NRPH 1OOKB 1GI6A 1MTNB 1C5RA 1DX5M 2K1QA 3S69A 1ZLRA 2ZFFH 1GHBG 1HCGA 2BQWB 3BEIB 3VXFH 2VWLA 2PUXB 1DVAH 1KSNA 1IQMA 3BTKE 3D65E 2XNDD 1VR1H 1MKXK 1ELBA 4Y6DA 2FYRA 4JCNA 1V2RT 3TPIZ 4D7FA 1BT7A 1FY5A 3CENA 2ZNKH 1C5LH 3T26A 2BHGA 2ZU5A 3FZDA 4FUCA 1A3BH 2C8YB 4MPWA 2BOHB 1VGCC 4X1RU 4X8UH 2GZ9A 2RA0A 2CJIA 1BIOA 1UCYH 4XE4A 2FOGA 1ZTJA 3UNQA 1A46H 5EXMA 1W7XH 4X8VH 1RIWC 5EQQA 2J4IA 5FBIA 3D23A 2UWPA 1CGJE 2K7XA 1AO5A 2TGTA 3LH1A 4CRGA 2XC5A 2IOTA 3SV7A 1IQLA 1NRQH 2K0QA 2KAIB 2GGVB 5FBEA 3UQOA 1GI5A 2VWMA 3HGNA 2WPMS 1P2OA 2VWNA 5EXLA 3AW0A 5F6MA 1YPMH 1HAPH 2XOKD 5FCRA 1LQEA 1KTTB 3SN8A 1SLUB 2GD4B 1LKBA 3KQCA 4WVPE 1PYTC 2K8IA 1LVOA 3DFJA 1IOEA 1O37A 2CF9H 2KX4A 2UUKB 1P04A 4IS5A 2PTNA 1O3KA 3M3SA 2LPRA 1IAUA 3UWJH 3A84A 1CT0E 4Q7XA 5EODA 5DPAA 5DP7A 2XBWA 4MVNA 1BUIA 4FUJA 3KIDU 1EP6A 2ZA5A 2WPIS 1TBZH 1FZZA 1Y8TA 2KR7A 2FOCA 2ZDVH 1YPHE 4ABJA 1CT4E 1GBLA 3MI4A 4WWYA 2ZWLH 4JMYA 1NU9A 1QRWA 3ZZ4A 1Y3WA 3VG8A 4B2CA 1DY9A 1V2WT 1HXFH 1FN6A 2P16A 2O8LA 2VINA 4DURA 3LONA 2ZGJA 4ABHA 2V0BA 5EGMA 1TAWA 1C4V2 3SUFA 1QFKH 1XM1A 2RA3A 1WCZA 2O9QA 4IGDA 5TJXA 2QGRA 2J9NA 1FV9A 3MU8A 1DWEH 1VZQH 4SGAE 1XUGA 3SQEE 1S0RA 4ISOA 4JZIA 4K8BA 3A81A 1HIAA 5EPYA 2WV5A 4JYUH 1K0HA 2A4GA 3SU1A 4INLA 2ODYB 1TB6H 3UUZA 3O8DA 2W6JD 1Z8IB 4BNRA 2NU1E 2PKAB 1AD8H 2BLOA 1GBMA 2FXRA 4X1PU 1GJAB 2W3IA 3M36A 4CBOA 2BVRH 4TWYA 1HFDA 1IHSH 2NU3E 4CR9A 3UPEA 1TONA 3P6ZB 4RKJB 1AUTC 1O2RA 5L30H 1O34A 1O2QA 2ZHFH 5DJ7A 3F0OA 2R2MB 1ZZZA 1S84A 3TK9A 1ESBA 1TGNA 4NZLA 4Y11E 3FKSD 3DUXH 3GCHC 1PPFE 4ZROA 5ESBA 1EB2A 2GDDA 2OQUA 1BMLA 1MAYA 4A7IB 4LZ1H 1MZAA 1P9UA 3LH3A 4ZKNU 1Z71A 2H9HA 4IBLH 1JIMA 3P8FA 1CA0C 1TX6A 3GY3A 1P09A 1C5NH 5CHAB 2FMJA 4B73A 4WMEA 1C2EA 4U01A 2R0LA 2WPHS 1BTZA 4NIXA 2OK5A 3RMNH 4ZUHA 2BZ6H 4NA7A 5LGOA 1XKAC 2J92A 2H6MA 2BZAA 4TY7A 3RXFA 2XCNA 1AIXH 3RXSA 5TCCA 3RDZA 1HRTH 8GCHG 4NSYA 3OFND 1HJ9A 3BEFB 2FEQH 2F9VA 1KXAA 4D76A 5A0CA 2BDGA 3P8NA 2Y7ZA 1GHAG 3PLKA 3ODFA 1XUJA 3ATWA 1A1RA 4WH6A 4X8SH 2BDIA 5DKMA 3GDSA 6ESTA 1DY8A 3KNXA 3PLBA 2M5TA 3CS7A 2HVYB 4BXWA 3AVZA 1BBRK 1UTOA 1EJMA 1ANEA 1S5SA 1SR5C 5EQRA 3RC4A 1RGQA 3VXEH 3RXGA 2XWBI 3N7OA 1N8OC 2BDAA 1HLTH 1BA8B 2XW9A 3ZZ7A 1UO6A 5K0HA 1HPGA 4CH8B 1TIOA 3A89A 1O3AA 1GCTB 1FDPA 2SGQE 4RT1A 5F8ZA 4BAKB 3T62A 4ZXXH 1HAVA 1W8BH 3K2UA 1YY3A 4X6PA 1ETSH 2P8OC 4CRFA 5AFYH 1FQ3A 2QAAA 3KGPA 1NTPA 5C0TA 2JJ1D 2O8TA 5DO4H 1P3EA 2OC7A 1O39A 2NU4E 1GBJA 1OWHA 1PQ8A 2G8TA 1QB6A 1DWCH 4INHA 2PSYA 1BRCE 5JPMH 2A5KA 1XUFA 2GT7A 1UVPA 1YLCA 4WMDA 1BBRH 2VWOA 1D9IA 1TOMH 2BDYA 5A0BA 2I6SA 3ELAH 4O9VA 1AE8H 2R9PA 1KDQA 4ABFA 1GBKA 2W7UA 1KY9A 1GCTC 2FTLE 5DG6A 4JZFH 2OC0A 3GCNA 1FUJA 3RXLA 3VFEA 4MNWA 1FY3A 2OTVA 4D8NA 4ZXYH 5C5NA 4BTIB 1Y5BT 1C2DA 4K1SA 2ZGHA 2QYIA 3M5LA 1WU1A 2C90B 1Z8RA 2AH4X 2KCPA 1O5DH 3BG4C 3UNSA 4KP0A 2IJOB 3A8DA 1S0QA 1QL7A 1LVYA 3GDUA 1OP0A 2J98B 4GLYA 2BMGB 1EX3A 1LHGH 2Y81A 4AGJA 1C2GA 4TY6A 4UFDH 7KMEH 2ZDMA 1A3EH 1QGFA 1AZZA 1WUNH 1QA0A 1THRH 5HM9A 1O3JA 2RDLA 1GJBB 1M9UA 1NC6A 2BD2A 5DK1A 1K1IA 1QURH 3ZVBA 1GMHG 5EW2H 1PQ5A 1YPLH 2HPQH 2HNTE 3DHKH 2GMTB 1SVPA 1BHXF 1K9OE 2SGDE 4ISHH 2XXLA 5JDUB 3H09A 2FO9A 5FPYA 4Z1MD 1GBBA 1T8OA 4FUGA 2EC9H 1MTWA 4MNYA 1K22H 2DE9A 3DD2H 4O03A 3DA9B 4BOHA 4M9FA 2CXVA 3CP7A 3GISB 1O36A 2O8UA 1V2UT 2UWOA 3VGCB 1UJ1A 6LPRA 1MH0A 5EU8A 1ABJH 2QXGA 1RTFB 2BTCE 1SGTA 4GPGA 1C5WB 3SORA 4A1TA 1BMMH 3ZZBA 1TNHA 4ABBA 3N99A 4DIIH 1A61H 1XUHA 3RXCA 3RP2A 1LO6A 4A5TS 1E35B 1GG6B 2PKSC 3RXRA 1O31A 1B7XB 2J5UA 1C4U2 1DDJA 3B23B 3TK5A 3H5CB 2JIZD 2EA3A 1HAYB 4RSPA 1D3TB 3EA8A 2R3YA 1ESTA 1P57B 1AUJA 4QT8C 3IG6B 1P01A 2Y5FA 2ODQA 1KXDA 4ASHA 1K1OA 4JZEH 3RMMH 3SUDA 3WWFA 1V2OT 2ZU1A 3S9CA 4CH2B 1VITH 1ZMLA 2HVXA 5CHBA 1MZDA 3A86A 4AFQA 4AGKA 3BF6H 2XCFA 1EASA 2OINA 3UNRA 3MO3A 1G3CA 4BAHB 3LGVA 3SHAH 1K1MA 1XUIA 1BRAA 4X6OA 1HAOH 4OGXA 1ELDE 3OE7D 4X1NU 3BSQA 1FI8A 2BQ7B 2LIZA 1SGNE 1AI8H 2F43B 1C5OH 1Q3XA 1ETTH 5EOKA 1L1JA 1GBEA 3V13A 2ZDAH 3FO8D 2JH0D 5KGOA 3T2NA 1IQNA 1CE5A 1IQIA 3E91A 1LHEH 1GDUA 1Q2WA 1GBHA 5F03A 3ZVGA 1O2PA 4Z6AH 1UTKA 5A8YA 2GCTC 4MDSA 1TX7A 1IQHA 3DFLA 1T4VH 4HTCH 2V7QD 3SU3A 5C94A 1MD7A 1BRUP 2KM0A 3SU5A 3SJOA 3SJIA 1CSOE 1SLXB 2QF5A 2AS9A 4I8HA 4UFGH 4FUEA 4H4FA 1SC8U 1PPHE 3T28A 3UOPA 2XBXA 4JYVH 1GMDG 4HGCA 3GICB 3BTEE 1O2OA 4UEHH 5E0GA 1OWKA 4ZHAA 1P0SH 3TK6A 5EPNA 1OXGA 2PR3A 3KCGH 5A2MH 2UUYA 4XBCA 2B0FA 4F48B 1LCYA 4RN6A 2H5CA 1DUAA 2ZO3H 3FP8E 5EIYA 1EPTC 3RU4E 3RC5A 2W3KA 1QIXB 3FOAA 1Z6EA 2XC0A 1IQEA 3KN2A 3RXQA 2HLDD 4KELA 4KTUA 4BAQB 1V2MT 2ZU3A 3JZ1B 1XX9A 3SW2B 1O3NA 1QBOA 2VGCB 1T32A 2C8XB 2YMSD 1PPZA 3LGTA 4ACBA 4F49A 2FOAA 2SNWA 1ZJKA 3K6YA 4NIWA 2V35A 2ULLA 4ABDA 3BTGE 3I29A 2GJGA 5FX5A 5HGGA 3PV4A 1ZPCA 3F9EA 3K9XB 1H1BA 5PTPA 1PPEE 5C5OA 4CRDA 3ZYDA 4IMQA 5GCHF 3TJUA 3Q77A 4X1SU 3OTJE 2AMPA 1SSXA 1O2MA 4MPUA 4Y10E 1F0SA 2ZF0H 2W7SA 1FN8A 4VGCC 2XBVA 2AYWA 3PROA 1VJ9U 1MTUA 4D7GA 2SGPE 1CT2E 1RFNA 3VB4A 1YPHC 2GZ8A 2JH5D 1V2TT 4AFSA 1IQGA 3A7VA 3QZQA 2SNVA 4A1XA 1YF4A 2ANMH 3MNBA 2TGDA 1C1VH 3OU0A 2FI3E 1SGFA 1MKWK 2D2DA 5T3HA 3SHCH 4AG2A 1GL1A 1D4PB 1D6WA 2ZFQH 2ZPRA 4WY3A 2Y5HA 3ATIA 2ZGCA 1K1JA 1O3IA 1SLWB 1UTMA 1DPOA 1MU6B 4OS6A 2L74A 5DP8A 4IN1A 3MO6A 4UFFH 1ANBA 1O3GA 3N7DA 2QV1A 1E79D 3LPRA 1ID5H 2J38A 1DWBH 3F2HA 1DITH 4X6NA 5H4IB 4A6LA 5ETXA 3TGIE 1SPJA 3PV5A 1FY8E 1F2SE 3E90B 1WTHD 1NFYA 3FAOA 3JZ2B 3UIRA 2A7CA 3EDXB 3SQHE 4CBNA 5E2PA 1P2KA 1ZTKA 1TGBA 1TNJA 2A4QA 4Y8XA 1QB1A 2JETB 3LU9B 1HIAB 2P93A 2PUQH 3F9GA 1T7CA 3TH4H 1YLDA 2YMSC 1RD3B 1FJSA 4YTAA 4YOIA 4A92A 1F0RA 3Q3XA 1DE7H 1GI8B 3RXKA 4IW4E 4E7NA 1LHFH 3U1JB 3MQKC 1CHGA 1NZQH 4XSKU 1Y59T 4HZHA 1ELGA 1TMBH 4IMZA 1AZ8A 1AE5A 3DCLA 1L2EA 1AMHA 1EZSC 2OLGA 4GCHG 5G4BA 3A85A 1JRSA 1FNIA 4MPXA 4IC5A 1MCVA 3SNAA 3PO1B 3TH2H 1EKBB 2GDEH 1ARCA 2PHBA 1GGDB 3F2FA 2BY9X 1ELVA 2IPHA 4B1TA 2ZHWH 3U98H 1O3OA 2AGEX 1MTNC 2WPLS 4J1YA 1GJ7B 1EP5A 4FUFA 1O5EH 1GHZA 1ZMNA 4YO9A 1TNKA 2O8MA 1KTSB 1UVTH 1JMOH 4FOUC 2TPIZ 2FIRH 1C1OA 4X2YA 1RTLA 3PO1C 2FLRH 1KIGH 1MKXH 4DG4A 1C4Y2 5C20A 1SOTA 4FUIA 3KQEA 1DUEA 2PWXA 1HAZB 2BLWA 1O5FH 3F68H 1RRKA 1UMAH 3MH6A 2VVVA 3BTHE 1TX8A 3LJOA 1QTFA 2YNAA 1DWDH 1ETRH 5C1YA 1QA7A 1Z8GA 3RM2H 3F3BA 3DSOA 3CS0A 4DGJA 3S9AA 3PLPA 1TQ0B 2QE7D 1P03A 1LHCH 1NN6A 2WPKS 4OM9A 3VB7A 1TOCB 2BOKA 1Y3YA 1NM6A 3GY4A 4F55A 1MBMA 1GJ5H 2H5DA 1PJPA 4ZHMU 2KCYA 1SG8B 1BJUA 1AVWA 1S6FA 3KF2A 4I31A 1DT2A 1C1QA 3SZEA 2OCVB 2AIQA 3TGJE 1FPHH 3C1KA 1EAXA 3GY5A 5FXLA 1AY6H 1HAVB 3A7XA 2KZ4A 1GCDA 1O3FA 4OS7A 3GCOA 1ZPZA 2A5AA 1GI7B 2FS9A 4DOQA 4JYTA 1O5BB 2WSSD 3DSPA 2BB4A 5GXPA 2GCHG 4CHAB 3PWBA 4M7GA 1MCTA 4FUHA 1VJAU 3WWBA 2A5IA 1WYKA 3HPTB 1QHRB 5FPTA 3ZZ8A 1C2KA 1KDQB 4X1QU 1XUKA 4AC9A 2WYJA 1KXFA 3A7TA 4TYDA 1V3XA 4WH8A 2G4UA 3R0FA 1IQFA 1LMWB 1TE0A 3OEHD 2BXTH 1GJ9B 3NUMA 6CHAB 4I7YH 1O3CA 2HWLB 5KECA 4AFUA 1TPSA 1NESE 5SGAE 1OWDA 1J15A 2HNTC 1WDIA 3HKIB 1G3EA 3OTPA 4CRBA 3QTOH 4B75A 4K2YA 2FYQA 4XBDA 2OUAA 4B6EA 3M5MA 3LGYA 3M7TA 5JBCS 2PP6A 3EE7A 1GVKB 3O8BA 3FN8A 4ISLA 2JDID 4IC6A 1QR3E 1QJ7B 4UDWH 3TIUA 1HBTH 4K1EA 5E8EH 2QCYA 2VIOA 1SB1H 3T5FH 1QNJA 2ZQ2A 1MD8A 2NU2E 4D9QA 2BD7A 8LPRA 1C1PA 1FX0B 5FPSA 2FI5E 1P05A 3KQBA 2Z6BD 3ZZ6A 3DT0H 1KLJH 5EG4A 1VKYA 4AX9H 4FU7A 3B8JA 3QZRA 2QXIA 2C8WB 3TLOA 1NU7B 1HJAB 1HJ8A 1O3EA 4NWLA 1OWIA 3A8AA 1EZXC 1ZPBA 3U28C 1DSTA 2V3HH 1SHYA 2Y80A 3V7TA 4NFFA 1EOJA 2UUJB 8GCHF 1CVWH 2VVUA 4J2YB 1NO9H 4THNH 2XWAA 2D1JA 2Y5GA 3EBNA 2HPPH 3HK3B 4FETA 1GHAF 1FONA 1LKAA 1MBQA 2FX6A 1K1NA 2F91A 3BEUA 1FXYA 4I8JA 3TGKE 2G00A 2PSXA 4ZKRU 3ZVEA 3D62A 1TNLA 5EJLA 5CHAC 1UK2A 1VITF 3RUOA 5K7RA 1KXEA 3RLYH 3OYPA 1GPZA 1C5MD 3T27A 1QJ1B 1W11U 3MU4A 3RXOA 2OC1A 1P10A 2R2WU 1GHYH 4ABGA 4YT7H 5EXNA 2B7DH 1O3DA 1MAXA 3URDA 1TFXA 3UY9A 1COWD 2ZCKP 1THSH 3F9HA 3BG8A 1E1QD 1OYTH 1T8LA 3WY8A 1QBVH 4JZ1A 1QZ8A 2BX3A 1C1UH 1MQ6A 2BD8A 4F4OC 4INKA 2H1UA 3QUMP 4FVDA 1UTJA 2NU0E 1ZSJA 1DS2E 1CHOG 4ACAA 2J95A 1PPBH 1UVOA 1GI0A 1XXDA 2Z3CA 1A2CH 2STBE
chains in the Genus database with same CATH topology
2B8OH 2LNCA 2BY7X 3ESTA 4Q80A 4ZAEA 4HI3A 1LTOA 1SGEE 2OXSA 1FIWA 3MNCA 1J14A 3FZZA 4U2WA 1ANCA 4MPVA 1O5AB 2BDBA 1BCUH 3GCTG 2TBSA 3W95A 8ESTE 2VB0A 2FODA 3A8CA 1CA8B 2BLVA 4RKOB 2FESH 2ZHDA 4UFEH 1KYNA 3LGWA 1IHTH 3RXMA 2W26A 1ESAA 1QL8A 2GX4A 1HNEE 2I6QA 1SGIB 1C9TA 2FOHA 4IN2A 5FAHA 4Y76A 1C9PA 2GV7A 1SHHB 1WTGH 4Y0ZE 1ZGIA 2AGGX 2Z94A 1GMHF 1S6HA 3MNXA 4NG9H 2A45B 1Y3UA 4Y8ZA 1BDAA 1THPB 2ZC9H 1BJVA 3UWIA 1A5GH 2C8ZB 2AFQB 4FUBA 1BTPA 3SNBA 1TBRH 4A1VA 5GIBA 3RXTA 1J16A 3A80A 4MG3A 4D9RA 2BD3A 1P3CA 4AYYB 5C1XA 2BQ6B 3E3TA 4U32A 5LPRA 1SI5H 3SJ9A 1O2YA 3VB6A 1YBWA 1F0TA 2B9LA 2ZTXA 1GHVH 3SO3A 1LPGB 1FAXA 2A1DB 1HAHH 1P11E 2JKHA 3A83A 3ATKA 2BX4A 3KHVA 2ZFTA 5E2OA 1O35A 1O38A 4LOYH 1DOJA 4ABAA 1DSUA 3NK8A 2FI4E 3ZYEA 3SNDA 4Y7BA 4OS5A 2ZU4A 6GCHG 2GMTC 4XBBA 3MTYA 1Y3VA 1FY1A 1O0DH 1W0YH 5L2YH 1XKBC 2J34A 1DFPA 5C3NA 3PM3A 8KME2 1Z1IA 1CO7E 3M35A 2A7JA 4NIVA 1O2VA 1ABIH 2ZDLA 3M7QA 1WAYB 3SGQE 4LZ4B 2AMQA 1H4WA 3LC5A 4B71A 3VGCC 1O2WA 1V2QT 1PQ7A 4X0WU 1SGCA 1TQ7B 1GBAA 2ANKH 3SUGA 5B6OA 1W2KH 1C2LA 3GY2A 5DP5A 1YCPK 1QY6A 4ESTE 1S82A 3NKKA 3RXVA 2GP9B 1SOZA 1B5GH 3LDXH 3RXBA 1GG6C 3ENSB 5IDKA 2OBOA 1KXBA 2GKVE 3VB3A 1OSSA 1C2MA 2F9NA 1INCA 4NWKA 4K69A 1HAXB 2ZTZA 3TJOA 2ZQ1A 1Y3XA 5LPFA 1BMNH 1E38B 1HV7A 1UHBB 1B0EA 4YOGA 1TYNA 1P12E 2Q6DA 2Q6FA 1GVZA 1SGDE 1YYY1 3GOVB 1YCPH 1W7GH 1ARBA 1SGYE 5HYOA 3RXAA 1SQAA 2ALVA 3MU1A 4AG1A 1GWAA 1PFXC 1YPEH 1CBWB 1W13U 3E0PB 1J8AA 1C5TA 1P02A 4E05H 3E8LA 5GDSH 1X7AC 2A4OA 2G51A 2IN2A 3SI4H 1S85A 1O2LA 2VIQA 2SGEE 1RTKA 1BZXE 1XVOA 2ZHEH 4I8GA 1UVSH 1GMDF 4JK6A 4MTBA 3F6UH 4OS1A 2ALPA 2Z3DA 1AFQB 3SI3H 1O2ZA 2P95A 1TGTA 2FX4A 1LQDB 7GCHG 1TRNA 4TPYA 2BY6X 3PYHA 2Y7XA 1D3PB 4FU8A 1ZSLA 1CQQA 4X6MA 1BQYA 4AZ2B 3E16B 5JB9S 2EI8A 4B2AA 1ZR0A 3SGBE 1EUFA 3ZZCA 1BTWA 3OY5U 2A31A 2CGAA 3A7YA 4H6TA 3NPSA 2Y6TA 5AHGH 1ZRKA 1D3DB 1GMCG 1EAIA 3M3VA 2BDHA 2GV6A 1SGRE 2QF3A 1C5SA 3HATH 1Z8JB 3GDVA 1EATA 2HLCA 2CHAB 2HGTH 3QWCH 1TGCA 4GAWA 4Y71A 2ZU2A 3SV8A 2BD5A 3PMBB 4BTTB 4DVAU 3D49H 1UVUH 1AGJA 5AFZH 1SL3A 3RU4T 1G37A 2VGCC 1HDTH 5BPEA 2FDAA 2D26C 2P3TB 2THFB 1SBWA 5A0AE 1ORFA 1F7ZA 2OD3B 3GY6A 3LT3A 1A4WH 4AORA 1C5VA 2AERH 4CRCA 1V2LT 2HALA 2P94A 1YPGH 1U6QA 1LHDH 1P9SA 1LVMA 2AIPA 2ZDNA 3S9BA 1YM0A 3E1XB 2Z7FE 5GPIB 1P2NA 1DLKB 2GZ7A 5ESTE 2G81E 1TNIA 3RM0H 1O2KA 2VIVA 3SGAE 3UR6A 1A0LA 1C2HA 1ZHRA 3A82A 4KTSA 4CR5A 4UD9H 1YGCH 2ZPQA 1AHTH 1G36A 4B74A 2G5NA 1KLTA 1GBTA 1MQ5A 4NA9H 1BTUA 1MKWH 3MNSA 7ESTE 3TJVA 1XVMA 3TITA 2CMYA 2Z9IA 5CMXH 5I46H 4Q7ZA 1TNGA 4GHQA 1IQJA 1MTSA 3ZV9A 1K28D 1ZOMA 1W14U 2C4FH 1H8IH 5FCKA 1T31A 2C93B 2ILNA 1ZGVA 2WUBA 1QBNA 3P95A 3MU5A 1YC0A 1F5KU 1DLEA 3MH7A 9LPRA 1EPTA 1GHBF 1AKSA 3BIUH 4I8LA 1JRTA 3SNEA 4O3UA 1V2KT 1OWEA 3OY6U 2NWNA 4SGBE 1W3CA 1G2MA 1O3PB 4GCHF 1TGSZ 1H9LB 4NA8A 4ZKSU 3QX5H 3ODDA 4JK5A 2BD4A 2TIOA 1EZQA 2PFEA 3RXEA 2Z9KA 1WBGB 5CE1A 1WSSH 2JETC 1GHWH 1VGCB 2VU8E 3SU4A 3SU6A 4PROA 1GI3A 3M3TA 3QO6A 5J4QA 1UK4A 5A8XA 3NXPA 1RIWB 1GJDB 2GVFA 4XOJA 2BVSH 5JBBS 2DUCA 2FZZA 3ATLA 1TMTH 1UCYE 1WQVH 3U8OH 3EAJA 2ZFPH 3BTFE 2ASUB 4NSVA 2ZCLP 1PPGE 3VEQB 4AOQA 3BTME 2QXHA 5L6NH 1J9CH 2BLQA 2EI6A 4O3TA 5AVDA 3KEEA 3B9FH 2QXJA 1JWTA 1GGDC 3STIA 1GI9B 3GY8A 1C1WH 1S83A 1QRXA 1GBDA 2Q1JA 1F5LA 4BAMB 1V2PT 2ZG0H 4WMFA 1P06A 3RLWH 4GVUA 3O8CA 1GBFA 5HMAA 4YZUA 1BRBE 1OX1A 3SJKA 1UTNA 1G32B 4K3JA 1MUEB 1JOUB 3LGUA 4OS4A 1E37B 1C5YB 4AB8A 1O33A 4K5ZA 5HXFA 1TA2A 3KQDA 1O3MA 1ZSKA 2VIWA 1EJNA 1P2QA 3BIVH 4K60A 1NRSH 5FX6A 2PTCE 3HKJB 3E0NB 1NFWA 1GI2A 1O2SA 4H42U 1EAUA 3GY7A 3P70B 1V2NT 3O8RA 1D6RA 4R0IA 1YP9A 2ZECA 1C1RA 5JBAS 3U1IB 3BTQE 2ZFRH 1Z1JA 2ZGXH 1OS8A 1UTPA 1MTVA 1TALA 7LPRA 3OSYA 3ZVFA 2GCHF 1S81A 3Q3YA 5F8TA 3FANA 1K1LA 2VNTA 3MH4A 1QJ6B 2ESTE 5JYIA 1RXPA 1G3BA 3ZZ9A 4TWWA 4Y0YE 1V2ST 4DCDA 1AVXA 1ELAA 4NIYA 4BANB 2PLXA 1ANDA 2SFAA 3NZIA 3S0NA 3I77A 1TPAE 2ZKSA 3MFJA 5L2ZH 3QLPH 4YLQH 1C2IA 1HYLA 1SGQE 3LGIA 3BN9A 1UTQA 1W0ZU 1W10U 1MU8B 3M61U 4WXIA 4Y7AA 5JB8S 3SUEA 5DP3A 4ZMAH 3TNTA 2WUCA 2QIQA 3UFAA 4YT6H 4CHAC 1KXCA 2P3UB 2FLBH 2D8WA 2ZZUH 3GCHB 1C1TA 5I25A 3MYWA 1GJ4H 2TGAA 4CRAA 1GJ8B 4BXSA 2FOMB 5E0JA 1TMUH 2HNTF 4I8KA 1G2LA 2SGAA 4Q2KA 4DIHH 1CA0B 6CHAC 3QGJA 4X2WA 3P8OA 5EW1H 4MQAA 4GUXA 1AQ7A 2PGQB 1A5HA 2ANYA 1ELEE 1PQAA 3AAVA 2ZIQH 2H9TH 3P92A 2AEIH 1NFXA 3SZNA 1O32A 5T6DA 3V3MA 5T6FA 1N1LA 3Q3KA 3RU4D 3RXUA 3A88A 4BTUB 1J17T 3IWMA 3MO9A 1GJCB 5LPEA 1HXEH 5FHTA 1ACBE 1H9HE 4DJZB 4Y8YA 2Z9GA 1GBIA 2WV4A 3M5NA 2KAIA 1AN1E 3LC3A 4AFZA 1BTHH 1RJXB 4JZDH 1N8OB 4Q7YA 2HRVA 3EQ0H 1O2XA 4ZH8A 3TVJB 1GDQA 1OP8A 1O2TA 1HJAC 3BTWE 5T6GA 4O97A 1BMAA 2AGIX 5E0HA 1T8NA 3PMJA 2G52A 1OPHB 3M5OA 3SV9A 2P8OB 1LVBA 3M37A 1A0JA 4OS2A 1DXWA 1C5XB 1GVLA 5J4SA 1DXPA 2SGFE 4MNXA 1MMJN 4WJG2 2JH6D 1P2JA 1TPPA 1JBUH 1NY22 4KKDA 2BD9A 1VITG 1XXFA 1A5IA 1KLIH 3F1SB 1NS3A 4WXVA 2ZGBH 1GI1A 1BOQA 2Z9LA 1CHOF 2F9UA 3RXDA 3UREA 5ABWA 1TABE 2ZI2H 2UUFB 5C1UA 2EI7A 1SLVB 1SFQB 2OBQA 1LDTT 1NT1A 4FVBA 1AWHB 1NFUA 1BBRE 1BTXA 3SU2A 1P2MA 1F0UA 3GCTF 5DP6A 4HFPB 3S7KB 3ZZDA 1W12U 2VJ1A 3BG4B 5DGJA 5DP4A 3LKWA 3TJNA 2QN5T 2YNBA 2A2QH 5C2ZA 4NFEA 4XFQA 3SOSA 3U8TH 3MHWU 3PMAB 1ZJDA 4ZHLU 4YOJA 1Z6JH 1BHXB 2XRCA 1XMNB 2ANWA 1F5RA 3SV2H 4E7RG 2VH6A 3EA9A 2VIPA 1K21H 3QTVH 3A7ZA 4X2XA 2W5EA 1EZUC 4UONA 3EYDA 2PKAA 1EOLA 2A32A 4YLUA 3TH3H 1AFEH 2FOEA 3ZVAA 1Q31A 1QCPA 1TA6A 3RMOH 4CREA 2F9BH 3EGKH 2XBYA 1PPCE 1YPKH 5BRRE 1GHXH 2WINI 1TPOA 4R8TB 2OP9A 1C5ZB 3U8RH 2TRMA 2F83A 4YESB 1E0FD 2V3OH 1ZHMA 2P59A 3H7OA 4LK4A 1FAKH 3GYMA 3STJA 2BDCA 3M7UA 1BITA 3SNCA 1QL9A 2F9OA 3K65B 2ZP0H 5LH8A 3IITA 2ZCHP 1V2JT 2C3SA 1L0ZA 1Z7KA 1C5PA 3FP6E 3ZV8A 2ZFSA 5AF9H 1VCQA 6GCHF 1EXFA 1QRZA 4I32A 2WYGA 2WPJS 2ODPA 4FXGH 1H8DH 2RG3A 2PKSB 3R3GB 4U30A 3FVFB 3E6PH 1E36B 4ABIA 1G9IE 1F92A 2QF0A 2ZHQH 3BTTE 2QC2A 3SU0A 1RS0A 5C67A 4ABEA 3LOXA 1O2GH 2YOLA 2QA9E 1ZYOA 3T25A 1OYQA 1GDNA 2GTBA 1ZHPA 1GI4A 1DANH 2VIDA 1FIZA 1Y5UT 1BTYA 1C2FA 3NWUA 5IYTA 1LPZB 2FTMA 5A09A 4I33A 1L4ZA 1FY4A 3ZVDA 2A0QB 2XC4A 4X8TH 2PV9B 1P8VC 3ZZ3A 2STAE 3AW1A 2FM2A 3FFGA 1DM4B 2TGPZ 2H9EH 3MU0A 1QB9A 3PB1E 1HGTH 2B5TB 1O2IA 4UE7H 1ELTA 1HB0B 2G55A 1BB0B 1CU1A 4NCYA 1ZTLA 1TRYA 2ZPSA 5EQSA 2H2ZA 1N6YA 1TLDA 2Y82A 3SV6A 1K2I1 3ZZ5A 1SMFE 2A4RA 2FOFA 3V0XA 4LXBH 1A7SA 2BY5X 4E06H 1P2IA 3HGPA 3MOCA 2GCTB 1CGIE 2CF8H 3BTDE 3MH5A 2J2UA 1QQUA 3AASA 1O2JA 4KGAA 1G30B 1D3QB 2FP7B 2UWLA 5GWZA 1T8MA 4DY7B 3A8BA 3URCA 4GHTA 3U9AH 1O2NA 3HK6B 3SJ8A 4K8YA 1NROH 1AB9B 1C1SA 4ISNA 3RXHA 3GYLB 5DP9A 1SQTA 3L3TA 3W94A 3PTNA 1NRRH 1YKTA 7GCHF 3F9FA 4H6SB 1O3LA 1SGFG 4B76A 2OQ5A 1DICA 1CBWC 2GT8A 3BV9B 2VH0A 1EPTB 1AKSB 1O2HA 2OC8A 2AMDA 2V6NA 4OGYA 3QK1A 2XNIA 3RXIA 3UR9A 9ESTA 5TCAA 1JXPA 4KTCA 3VB5A 3Q00A 1EAWA 3UTUH 1NRNH 1O5GH 2F9PA 3U69H 3EE0B 1CGHA 1N6XA 1SQOA 1ZMJA 3RXJA 1AB9C 1WV7H 1GMCF 1HAIH 2F3CE 4ZKOU 1L1NA 4B2BA 1O3BA 3PTBA 1AFQC 1K1PA 3VPKA 3TU7H 1O30A 3V12A 2EEKA 2Z3EA 2XTTB 1L1GA 1EB1H 3Q76A 2CN0H 1UK3A 2ZEBA 2PW8H 1OP2A 2HOBA 1O3HA 3ATMA 5JBTA 4NZQA 3EA7A 2R0KA 3MMGA 3K6ZA 3RXPA 4X2VA 4YM9A 1V6DA 4VGCB 4XDEA 2ZTYA 1SFIA 4Z0KA 2Z9JA 1C5UA 1T4UH 4FUDA 1HUTH 4MLFB 3KL6A 5GJ4B 1EJAA 2DE8A 1E34B 2FOBA 2P3FH 1VCPA 2BM2A 2CHAC 2ZDKA 3C27B 1AVGH 2BXUH 3P17H 1O2UA 4AYVB 1VCWA 1OWJA 1ZRBA 4TPIZ 5GCHG 1C5QA 1G3DA 1FMGA 1EQ9A 4DW2U 1ELCA 5F8XA 3RMLH 3LIWA 3A7WA 3OX7U 2FPZA 3I78A 5HM2A 2RCEA 2Q6GA 4DT7B 3L33A 3QN7A 3FP7E 1C2JA 3L6PA 2PGBB 1O5CB 3UQVA 1AU8A 3PWCA 1C1MA 3A87A 1IQKA 1WOFA 2XYAA 1SGPE 1YCPM 4K1TA 1TWXB 4WF8A 3S7HB 1GBCA 4MNVA 4AN7A 2J94A 1L4DA 2QY0B 1C1NA 1UHBA 3UOUA 1HAGE 2A7HA 1ELFA 2G4TA 3QGNB 1FPCH 3AAUA 3PMHB 1GL0E 1PYTD 3T29A 1AWFH 4AB9A 3TNSA 3LJJA 4FU9A 5A8ZA 3ITIA 2VVCA 4ISIH 2FS8A 2BVXH 3P8GA 4NGAH 1H9IE 2O8WA 3ZVCA 2BY8X 4GSOA 3RC6A 3ZZAA 2FWWA 1FLEE 1OKXA 1QQ4A 1YPJH 3QDZB 1NPMA 1Y5AT 1TBQH 2G5VA