1GI5A

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi5A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi5A02
2FDAA 3RXAA 1UTNA 1BJVA 1FY1A 1Y3UA 3LGIA 3O8RA 3F6UH 1S84A 1QA0A 4TPIZ 2ZDKA 1PPCE 1EB1H 2ZHQH 1LVOA 1HV7A 1NFWA 3M36A 1UTOA 1GMHF 2G4UA 2W7UA 2FESH 3JZ2B 1G2LA 1UO6A 4AX9H 1OP2A 6GCHF 1LVBA 3LGUA 3O8DA 1NFYA 5EG4A 1MU8B 1C5NH 3RXBA 4UFFH 4Y10E 4JYUH 3ZZ9A 4ISHH 3BF6H 1MTSA 2OINA 2ZDNA 3RMMH 1V3XA 1LHDH 4Y76A 4SGBE 1TALA 5IYTA 3ZVAA 1FY5A 3P6ZB 2F91A 1DM4B 1V2PT 1EZUC 4JMYA 1RIWC 2QN5T 2F83A 1ZMJA 1W0ZU 2ALPA 4TPYA 1AD8H 2A4RA 4JZ1A 1C5RA 2AMQA 1F7ZA 1AFEH 1NO9H 3PMAB 2HOBA 3QWCH 3SQEE 1VGCB 5HGGA 1KLIH 1GI7B 1TPSA 4ZROA 1P2KA 3SV2H 2BZAA 4I8JA 2RG3A 1C5LH 5JYIA 3UQVA 2BDYA 4IN2A 1TBZH 4ZHLU 5T3HA 4FUIA 5E2OA 2A31A 2OUAA 3RC6A 1L0ZA 3BTFE 2B7DH 4FUEA 4H42U 1GBAA 1O2PA 1CGIE 3A89A 1V2VT 4A5TS 4Q7XA 2A7JA 1W3CA 2QXJA 3LC5A 1SQOA 3IG6B 2VINA 3PLPA 4NA8A 1EX3A 2FI4E 4HZHA 1CQQA 2H1UA 4X6NA 1P57B 3EA8A 3F9EA 5AHGH 3EGKH 5DP8A 3A80A 3UWIA 2RA0A 3AAUA 1ACBE 1T32A 2J95A 2TGAA 1DPOA 1FY3A 4KTUA 1DSUA 1ZJDA 1QRZA 4OS5A 1LVYA 1BHXF 4K1SA 1OPHB 1TIOA 1WUNH 1NT1A 3TK6A 4Y7AA 3DD2H 1YCPK 4ISIH 4MQAA 4AFZA 4E7NA 1CU1A 3PROA 1YGCH 2ZFPH 1BTYA 2A7CA 3M5NA 1MMJN 4Y79A 3OTJE 1O31A 3EYDA 1UTKA 4J2YB 4MPWA 3BTDE 1NRPH 1AMHA 4Y11E 1NRNH 2Q1JA 1F0SA 3K65B 3T28A 1UCYE 1O3LA 1UTLM 2P93A 1W7GH 1JRSA 1GBEA 3T29A 4Y8YA 2ALVA 1BB0B 5DO4H 1GHXH 4ZHAA 1DWEH 3U98H 1GMCG 1LO6A 5C67A 4ESTE 1K1JA 4JK6A 3S7HB 1FQ3A 2G5VA 1CGJE 3MTYA 5SGAE 1C1TA 1MZAA 5LH8A 1AE8H 2HRVA 4VGCC 1DLKB 2SFAA 3BTWE 2ZTYA 5GXPA 3F9FA 1ZTJA 2ZA5A 1V2UT 3M3VA 5L30H 5EODA 5EW1H 3VB4A 4MNYA 1KLJH 1GI5A 2AMDA 4U01A 1AO5A 4OGXA 1BOQA 4E05H 2BHGA 1GBKA 2EI7A 1DDJA 3TJUA 1XKBC 4DGJA 4LXBH 1TX7A 1TA2A 1PPEE 2GMTC 2J4IA 3SV8A 2Z3EA 1W7XH 2PKSC 1Y3VA 4THNH 1C5YB 5K0HA 2FOEA 3BG4C 1QB6A 1AU8A 1TYNA 3TGJE 2G51A 2J94A 2A4OA 3SNCA 2TRMA 1C5QA 3ATIA 4WVPE 5BRRE 1JRTA 3M5OA 3TK5A 1HJ8A 2O9QA 1G30B 1BITA 1E36B 1ARCA 4NSYA 5DP4A 3RC4A 3A83A 2GCHF 4ISLA 1EAUA 1TGBA 4B75A 1EZXC 1BBRK 3E6PH 2ZPQA 4FUFA 1FAKH 1YBWA 2TGPZ 3HKJB 3RXKA 2W26A 2Q6FA 5C1UA 1EPTC 5L2ZH 3SU4A 2P3TB 6ESTA 3QZRA 3VB5A 3PYHA 2P3FH 8GCHF 3L33A 3NCLA 4CHAB 3M35A 2NU3E 4KELA 1SGCA 5FX6A 1GJAB 4UFGH 1GHYH 1SGPE 3UUZA 2XXLA 3VFEA 1EXFA 4F49A 2A45B 4CRAA 3KQEA 2GTBA 1HRTH 2GT8A 4YM9A 4AFUA 2I6QA 4UFEH 1GBTA 3M5LA 4BNRA 5DGJA 2OXSA 1O30A 2OQ5A 2QYIA 3MI4A 3NK8A 4X6MA 4O03A 1C2IA 1BRAA 1YYY1 3VB6A 4NWLA 1ESBA 3LH1A 5E2PA 1B0EA 4YTAA 2VGCC 1XUJA 4X8TH 1O5BB 3RXGA 2ZCLP 2HPQH 3UOPA 1VCPA 1XM1A 1PYTC 2HGTH 3OX7U 1F5LA 1SGQE 1YP9A 4ZAEA 4A92A 2R9PA 1V2JT 1O5EH 2ZDAH 4DCDA 2IN2A 3RC5A 5FAHA 2FS8A 2V35A 9LPRA 2ZFTA 3RM2H 1U6QA 1O2MA 4OS7A 1ZSJA 2VU8E 4R8TB 1N6YA 1SOTA 3SJKA 3SGQE 4B2CA 1HJAC 3A81A 4H6TA 1H8IH 1LDTT 4AG1A 1E35B 1GMCF 2QXHA 1UK3A 1MKXK 1NN6A 2BYAX 2Z7FE 4BTUB 1GJCB 4NCYA 2F3CE 2B0FA 3P95A 4INKA 1AQ7A 1B5GH 1MQ6A 1Z8RA 2NWNA 1C9PA 2ULLA 4O3TA 2EA3A 4Z0KA 9ESTA 1GG6C 2FOMB 4DOQA 1WSSH 2PKAB 1BMMH 3SUFA 3IWMA 2ZG0H 1O2IA 2ZGBH 3BN9A 1ELVA 1HXEH 2BB4A 4O9VA 2ZTZA 2EI8A 7GCHG 3MH7A 1V2LT 3PMJA 1K22H 4NFEA 1GHVH 2BD5A 5ESTE 1ZZZA 1HYLA 1FY8E 1EJMA 1RD3B 2P94A 2VVVA 2BD7A 1XVMA 1MTVA 3TJVA 1C1OA 1AUTC 1SGFG 2CHAC 3P8NA 5F8TA 3RXEA 3PWBA 2BD4A 3CENA 1C5WB 2BLOA 1PJPA 4MPUA 1MKWH 3PTBA 3DUXH 5H4IB 1ETSH 1SGEE 1MAXA 2GCTB 1SR5C 3ZZAA 4FUJA 2ZFRH 1O32A 1J8AA 2HNTC 1LQDB 4B71A 1AVGH 1LTOA 7LPRA 1HNEE 3AW1A 1ABIH 1ZTKA 1EATA 1LQEA 5FPYA 3SU5A 1QBNA 1ELDE 1HGTH 2GZ7A 4ABIA 1ELTA 1G37A 1C1SA 2QY0B 2SGQE 2D8WA 2YNAA 1GDUA 1T8OA 2OC7A 1DT2A 3K6ZA 1HFDA 1ZMNA 3HATH 4D76A 4ZKRU 1ZGVA 3LIWA 2GGVB 3BTQE 2OC1A 2XWAA 4BAKB 3LT3A 1YPKH 4X1PU 1H9IE 1YKTA 1DY9A 1D3PB 2AH4X 3BV9B 1IQJA 2AIQA 2ZU5A 3PMBB 1BQYA 4IC6A 5CHAC 5C5NA 2HVXA 1SGRE 5J4QA 2AGEX 4CRCA 1OP8A 3FP8E 1OS8A 1MD7A 3LPRA 1MQ5A 1V2TT 1HB0B 4NWKA 2GDDA 2QA9E 4I8GA 3ATLA 1TE0A 1MTWA 2G4TA 2FYRA 1T4UH 2ZDVH 3RXOA 1UCYH 1EAXA 2M5TA 1DS2E 1GGDC 2FTMA 2R2MB 1GI6A 1UTQA 1ELBA 1UTJA 3E8LA 2PR3A 1C5OH 4K2YA 3ZZ6A 1SLUB 2ZWLH 4DT7B 4ZUHA 3GCTG 5ETXA 1XUHA 1CA0B 1O3CA 1ZHPA 8KME2 1MTNB 4U32A 3AASA 1UK4A 1AE5A 2PKAA 3FP6E 4BOHA 4INHA 2JETB 3AVZA 1HCGA 1TABE 3E1XB 1QURH 3SUGA 4WWYA 2GKVE 4WXVA 3UQOA 2UUKB 3VPKA 3UNQA 5A8XA 1QJ1B 1A2CH 1DWBH 5L2YH 3P70B 2BQWB 2VVCA 1GBCA 2TIOA 1KXDA 1GI4A 5FPTA 2SGEE 1SQTA 4X8UH 1P02A 3A7XA 3GYLB 2JH6D 3EQ0H 1UVUH 3SN8A 3ENSB 3MNCA 1GI3A 2XBVA 1IQNA 1QL8A 3HPTB 1DFPA 1S5SA 3BSQA 2FWWA 1KYNA 2D26C 3P8FA 2VIVA 1UTMA 1C9TA 1L4DA 5E0GA 2BY6X 1BTZA 1W0YH 4BAQB 4HTCH 4GAWA 1IQFA 1P8VC 3RU4D 1GBHA 1G2MA 2SNWA 3UPEA 1SPJA 1A5GH 7GCHF 3ZZ3A 5FCRA 1THSH 2PTNA 3A7TA 3SNEA 1EJAA 2FODA 3MYWA 4DIIH 1ZRBA 3LU9B 4CRBA 2BD2A 1EZQA 1AZ8A 1RXPA 1SOZA 2XCFA 1O3NA 6CHAB 1NS3A 1GHAG 1AVWA 3QGJA 1TRNA 1CT2E 1C5TA 3U8RH 1GCTB 5T6FA 2GX4A 3A8DA 1UVOA 3KIDU 3ODFA 4ISOA 4CR9A 2BQ7B 2A32A 1RRKA 2O8LA 2ZO3H 1C5MD 3RXFA 3ZZ4A 1TRMA 5AFYH 3BTKE 3SU3A 1CA8B 1KXEA 2JH0D 1H4WA 3CS7A 1D6WA 1ZPCA 3MU5A 2ZU3A 4Y8ZA 1O2KA 2WPLS 3RXUA 3MO6A 1YF4A 4NA7A 1K1NA 5EW2H 5J4SA 1T8MA 1LPZB 2C8XB 2O8TA 4ZXXH 1WAYB 1A5IA 2JH5D 4AYYB 1B7XB 1C5XB 1LCYA 1F0UA 1GBIA 3U8TH 4YOGA 3BTHE 3EA7A 4DURA 1ESTA 1FLEE 1KSNA 1V2RT 2OP9A 3GCHC 2FX4A 1ELFA 3TPIZ 1ZHMA 2LNCA 1FN8A 1WTGH 2UUYA 1N6XA 3BEIB 4SGAE 3A87A 3JZ1B 2VWMA 1O2TA 3IITA 3T27A 4IS5A 2Z3CA 1Y59T 3A8AA 1S6FA 1INCA 1BRUP 2R3YA 5JPMH 2QGRA 1Z7KA 3QDZB 3A82A 5C1YA 2K1QA 1O2ZA 1HAXB 2BD3A 3P8GA 1V2NT 1LHGH 2QXIA 1OWKA 3M5MA 1O38A 1OWJA 1MUEB 3P92A 1MCVA 2CN0H 5EQSA 3TITA 1BZXE 1EQ9A 2AGGX 2FOGA 4JZEH 2BQ6B 6LPRA 3STIA 1AHTH 1AWFH 4XE4A 2Q6GA 1XXDA 5PTPA 2OTVA 1YPEH 2V3OH 4JCNA 3NUMA 2ANMH 5GCHG 3RXVA 1CBWB 1QQ4A 3URDA 1TMUH 1O2QA 1CGHA 1KY9A 3RXQA 2BY9X 1MU6B 3I29A 1KTTB 4IN1A 2P8OB 5CMXH 5T6GA 1FJSA 4AN7A 1GJ9B 4KP0A 5JDUB 2JKHA 3PWCA 4FU8A 4FUBA 1BCUH 3KHVA 5EQQA 1YPLH 4TWYA 5A0BA 1VGCC 3A84A 3ZVEA 5JBCS 1NU9A 1NU7B 3MO3A 3SU2A 2Y6TA 3TJOA 3UR6A 3M37A 2ZKSA 2G8TA 1BMNH 1TMBH 4BAHB 1QR3E 4J1YA 5EQRA 3K2UA 1HAOH 1Y3YA 1JWTA 1ANDA 4D7GA 3U69H 2BTCE 4LK4A 1C1QA 1TLDA 2A2QH 4K3JA 3W94A 2FLRH 2ZPSA 4DY7B 2FZZA 2BLWA 1TGNA 4YT6H 4AZ2B 2Z9LA 1ZMLA 3KF2A 3M7UA 4YZUA 2PUXB 1AUJA 4PROA 2VH0A 2XC0A 1C5VA 1T31A 3EAJA 1VITG 3UR9A 1EUFA 1GHAF 4NZLA 1SB1H 1PPHE 1THRH 2CMYA 2KAIA 2GV7A 4K69A 1ETRH 1V2ST 2BD9A 1O3IA 4A6LA 1A7SA 3KN2A 1P2NA 1FONA 1DWDH 3SORA 2WYJA 1C2MA 2F9UA 4ZKNU 3BG8A 1A3EH 2V3HH 1KLTA 1QY6A 4MDSA 4OS2A 1BTHH 1SFIA 1HLTH 2BVSH 1O3KA 1P03A 1HJ9A 4AB8A 2Z9JA 1EB2A 1BUIA 2Y5FA 4RN6A 3FVFB 5C1XA 1PYTD 1CE5A 3S9BA 3SUEA 4I8KA 4CH8B 2D2DA 4NIYA 2PHBA 2HALA 1K28D 1EASA 3MH6A 1TBRH 3ZVGA 5HM2A 4ZMAH 1FUJA 1OXGA 4ABHA 1AFQB 2Z9GA 3OY5U 1YCPM 4Q2KA 1F5RA 2R0KA 5GIBA 3SJOA 1H1BA 2OQUA 3K6YA 2PSYA 2HNTF 2SGAA 3TGKE 3LONA 1SI5H 4D9RA 1DUAA 2WPJS 2ZTXA 3KCGH 1Z8GA 1HAZB 3MHWU 3ZVFA 1PFXC 2C8WB 2QAAA 2ZEBA 5AFZH 3UNRA 1ZSKA 3MU4A 2VNTA 1TQ0B 3SV6A 2C3SA 1C2HA 2TBSA 4Y6DA 1GI9B 4B2BA 1QQUA 3Q00A 3A88A 3BTGE 4X2XA 1HUTH 3ZVBA 3ZVDA 1GDNA 1S85A 2GMTB 1P9UA 1N8OC 3BIUH 4JZFH 4WMFA 4DIHH 1QGFA 1NM6A 1AN1E 1TPAE 2HWLB 2RCEA 1GVZA 5GCHF 1MH0A 5DKMA 3H5CB 1ANCA 1F2SE 1FIZA 2QIQA 4AGJA 3A86A 3TVJB 1GBDA 1QJ6B 2HNTE 4RSPA 1NRRH 1EP6A 1C1WH 3HGPA 3LGWA 2OLGA 1Y3XA 1RTKA 1J14A 4TYDA 4X6PA 4B2AA 1P2OA 1VJAU 1YM0A 1BMAA 1LVMA 4YO9A 1Q31A 3UY9A 4IGDA 1C1VH 1O2VA 1SMFE 5AF9H 1HAPH 2GT7A 1TX6A 4XBBA 1T8LA 1K2I1 2DE9A 1TX8A 4A1VA 2STAE 2P59A 2P3UB 1GL1A 2WPKS 3ZZ5A 3KQBA 1ARBA 3LJOA 3N7OA 3QK1A 4GUXA 2ANYA 4AGKA 1ZHRA 2ZQ2A 3GY5A 2SGDE 1P2IA 1GHWH 2XBWA 1KXBA 4D9QA 4OGYA 1D3TB 4XBCA 1BTXA 4CHAC 1HAHH 1TB6H 2GDEH 3RXMA 5K7RA 4D8NA 3FAOA 3H7TA 1KXCA 1QJ7B 3V0XA 1IQHA 4IBLH 3GCOA 3GY2A 1IHTH 3GCNA 1O2HA 2AMPA 4MVNA 1ELCA 2BDBA 3B23B 4OS6A 3RXTA 3U1JB 3P17H 1RGQA 2AS9A 4ABAA 2GP9B 3TJNA 3T5FH 4LOYH 2ZGJA 4TWWA 3URCA 1J15A 2G5NA 2ZI2H 2Y7ZA 3ZV8A 5TCAA 1GL0E 1GHZA 2B9LA 4GCHG 3NZIA 1G36A 5I46H 2FOHA 1CHOG 3BEFB 4MTBA 2Y81A 3MMGA 1ORFA 3QLPH 4I7YH 1NFXA 1AWHB 1VCWA 4B74A 1GBMA 3ATMA 3TH2H 1TAWA 2UUJB 1MKXH 2P95A 4X8SH 2BDHA 1PPBH 4CBNA 1O3AA 5JB9S 1TNGA 1HAIH 1L1JA 3SNBA 1HJAB 2V0BA 1WQSA 1S0QA 1SHHB 7KMEH 1A0HB 1YC0A 2C93B 3B8JA 4GSOA 3RXDA 1S82A 1Q3XA 5EXNA 2SGPE 1E0FD 4ZKSU 2FI5E 4OS1A 1BHXB 2R2WU 1BTWA 2BY7X 2FXRA 1GHBG 2VVUA 2QV1A 3S69A 2ODQA 1RS0A 1Z6JH 1EAIA 2FPZA 2RA3A 3MH5A 3SGAE 8ESTE 3ZZCA 4WF8A 3KEEA 1GJ6A 1THPB 2BXTH 2EC9H 4HGCA 1XUGA 1P06A 1P3CA 1Z8JB 1H9LB 3KQCA 3O8CA 2YOLA 3GY7A 2Y5HA 2ODPA 1L1GA 2QC2A 1QBVH 2FTLE 2ZCKP 3H7OA 1EPTA 2NU2E 1ETTH 1MTUA 3OSYA 4MG3A 1P2QA 1QL9A 3F68H 3Q3YA 3FZDA 3SO3A 1ZJKA 4IW4E 3TH4H 2SNVA 1DOJA 3RXRA 2UWLA 3EE0B 3A7VA 2CHAB 3Q77A 2J9NA 3HK6B 4Y71A 1BRCE 5JBAS 4WH8A 4GLYA 4WMDA 1GMDG 5DP3A 1YPMH 3UWJH 2ZHWH 1UK2A 3GY6A 1YPHC 4UE7H 4O97A 3VXEH 1UJ1A 3ATWA 2DE8A 2D1JA 1T8NA 4MLFB 1MBMA 1QB1A 1NZQH 1XMNB 2FOCA 1AKSB 1S81A 3G01A 4NG9H 2GCTC 1RJXB 4MNVA 1DUEA 2Z9IA 2FIRH 1GJBB 1P2JA 2BD8A 2ZPRA 4QT8C 3RLWH 4YT7H 3PO1C 2Z3DA 1MKWK 1BDAA 5C20A 4ISNA 1TNHA 4UD9H 5DP6A 3RXHA 1C2GA 1T4VH 3GY3A 1P01A 1YPJH 3RXJA 4DW2U 1TONA 1AIXH 4KTCA 2H5DA 3MU0A 4MNWA 1GI8B 1AB9B 3A8CA 1QIXB 3SU0A 1O2GH 1K21H 3ATKA 4FUHA 1AZZA 1NTPA 2GZ8A 1Q2WA 1YLCA 4CRDA 1KTSB 3ZVCA 4I8LA 4O3UA 1GGDB 5JBTA 3WY8A 1SHYA 1G3DA 1PPGE 4DVAU 1O36A 4AOQA 1JBUH 4ABBA 2CXVA 4M7GA 1LPGB 1A0LA 1NFUA 3LDXH 4B76A 1VZQH 3SJ8A 4B1TA 1TNIA 3VEQB 1F5KU 3GDUA 1O3PB 4AYVB 4CRGA 1UCYK 1DSTA 1SLVB 1CA0C 2SGFE 1LHCH 3Q76A 5DP5A 1GJ5H 4CBOA 1TPPA 2H2ZA 1JIMA 1OP0A 4R0IA 2JETC 4IC5A 1ANEA 3A85A 4X2YA 1A1RA 2ZZUH 1A5HA 1SGYE 1TBQH 2F9OA 2Y7XA 3BTEE 1FY4A 1MZDA 1K1MA 1BTUA 1G3CA 2G55A 4YLQH 1MBQA 1G3BA 1ZOMA 2F9PA 1H9HE 1Y3WA 2C90B 2Y80A 3HGNA 3LJJA 4ABEA 2ILNA 2PGBB 1GHBF 1TRYA 1NPMA 1C2FA 5AVDA 4UEHH 3PMHB 3I78A 1IQEA 3E0NB 3VXFH 5A0CA 2I6SA 3SV7A 3C27B 5FCKA 2BLQA 2ZGCA 2VJ1A 1XUFA 2FMJA 1O5DH 1AVXA 1O39A 2G52A 1B0FA 1O0DH 1O37A 3NPSA 1AKSA 4AFQA 5F8ZA 1C4U2 3L6PA 4E7RG 2BOKA 2FP7B 3VB3A 1WCZA 2Q6DA 4FUCA 3VGCC 4H6SB 1QBOA 1ZPBA 2ZQ1A 2GV6A 6CHAC 4BTTB 1NRSH 2A5KA 1E37B 1X7AC 1CHGA 1A4WH 4GHTA 3FZZA 2FOBA 3RXLA 7ESTE 4AB9A 1JIRA 1C4Y2 5E8EH 5FBIA 4TY7A 1GCTC 3F9HA 1KXAA 2VWNA 1KIGH 3MFJA 2XC4A 1GBBA 3RXSA 1C1MA 1Y5AT 5DK1A 1O5CB 3GY4A 2GVFA 1O2UA 4A1TA 3PB1E 4K5ZA 1O2JA 3QUMP 1DVAH 4WJG2 2PW8H 3T25A 5C5OA 3UOUA 2VWOA 1GPZA 3MU1A 5A8ZA 1MCTA 2ZDMA 1BA8B 3A7YA 2ZDLA 1PQ7A 1EZSC 2KAIB 4GPGA 4X0WU 5LPRA 1HIAB 3B9FH 5EPNA 1V2QT 5LPFA 2FM2A 2XBYA 4Y8XA 1G9IE 2H9TH 2XW9A 2GD4B 4X8VH 2BY8X 4LZ1H 1P9SA 1W8BH 2ZU2A 5EPYA 2VB0A 1D6RA 1Z1JA 3S9CA 1EJNA 3ZZ7A 2CF9H 2J2UA 4B73A 4XFQA 1QHRB 1GDQA 4CREA 4NGAH 1C1RA 3DFJA 1K9OE 1ZGIA 4TY6A 1SVPA 3NXPA 4U30A 4DG4A 3RM0H 2ZHEH 1BMLA 1T7CA 2WUCA 1HAVB 5TJXA 4Y0YE 3RUOA 1ABJH 1TNKA 2ANWA 1DE7H 3GCTF 1E38B 2OBQA 3KQDA 4ZXYH 1UVPA 2STBE 4JZDH 2F9NA 1RIWB 1EOJA 1OSSA 2A5AA 2EI6A 2UUFB 4YOIA 1VITH 3T2NA 1FNIA 1K1OA 2H9HA 1O3GA 5G4BA 1OX1A 1NY22 1C2DA 2PLXA 2AERH 2VIQA 2IPHA 5EGMA 2CJIA 3E91A 1AI8H 1PQAA 3ZZDA 3F1SB 2OCVB 3FANA 1C1UH 1CBWC 4F4OC 1A46H 2EEKA 1C1PA 3MH4A 1YPGH 2P8OC 1EAWA 5BPEA 1XKAC 4ZKOU 1SC8U 1GBFA 2ZFSA 3ODDA 4FXGH 4ASHA 2ZU1A 4RKOB 1ELAA 3RP2A 2GCHG 2IOTA 4ABGA 1WU1A 3QZQA 2XTTB 1UTPA 1P3EA 3MO9A 1OWIA 4XOJA 1L2EA 5HM9A 5F8XA 1C5UA 1HBTH 5GDSH 3HKIB 1S83A 5GWZA 2O8WA 4I32A 4MPXA 3NWUA 1KDQA 4I8HA 2VIWA 2XCNA 8GCHG 3UNSA 2TPIZ 3LC3A 2XNIA 1AGJA 1GBLA 2Y82A 3OU0A 1LKBA 4IMQA 1UHBB 4NIXA 5HXFA 1YCPH 1O2OA 1GJ4H 1WTHD 2H5CA 1QNJA 2BZ6H 3QTVH 2FYQA 4Q7YA 5FXLA 3LGTA 1HIAA 3PLBA 4IMZA 5E0JA 1FIWA 1LMWB 1OYQA 1SLWB 2FOAA 3RXPA 3SHAH 2W3KA 3S9AA 2PV9B 3SU6A 2R3UA 1QB9A 2OD3B 2NU1E 3D49H 1SGTA 1TMTH 4ABFA 1CVWH 1KXFA 2A1DB 2BX4A 3K9XB 5EXMA 2OBOA 2FO9A 1F0TA 2ZECA 1JMOH 2ZC9H 1NRQH 3CS0A 1DY8A 1GBJA 1MD8A 3SW2B 4YOJA 1ANBA 2ZF0H 1FPHH 1K1PA 1C2JA 1P0SH 4X2WA 2ZGXH 4Z6AH 4KTSA 1HAVA 2UWOA 3SI3H 2WPIS 1DICA 3E0PB 2ZFQH 5HMAA 2IJOB 4Q7ZA 4FVDA 1L4ZA 4YESB 3TK9A 2F9BH 2LPRA 2ZHDA 3KL6A 2J92A 2FOFA 2AGIX 5LGOA 2GZ9A 1IQIA 5DP7A 1XXFA 2OC0A 5E0HA 4VGCB 3UIRA 4K1TA 1D3DB 5HYOA 1JOUB 3QX5H 1XUIA 4X1RU 2XRCA 2BMGB 1VR1H 2PFEA 1HAGE 2Z9KA 1AFQC 2AEIH 2H6MA 4CRFA 1O2XA 2FEQH 1O5GH 1UVTH 5FPSA 1OWDA 1TGSZ 2WPMS 3GISB 4K60A 3ZZ8A 1C2KA 2W3IA 1TGCA 5L6NH 5DPAA 1O3MA 1SL3A 2NU4E 2G81E 2UWPA 1IQKA 2FLBH 3SUDA 4U2WA 1ELGA 2ESTE 2CV3A 3E16B 3TGIE 1ID5H 2ANKH 1P04A 1IQLA 3Q3XA 1GJDB 2PKSB 4UONA 3DFLA 4X1QU 3DHKH 1O3OA 4LZ4B 2PSXA 1N8OB 3BG4B 3BTTE 1ELEE 2HLCA 1FAXA 1BT7A 1TNJA 5A09A 3O8BA 4JYVH 3TU7H 1HXFH 1YPHE 4A7IB 2QXGA 2BOHB 4ABJA 4X6OA 4BXSA 3SV9A 1BBRH 2C4FH 2J34A 3CP7A 1WV7H 3A7WA 1O3DA 1TOMH 2VIPA 1O2LA 2QCYA 2P16A 1O2WA 1CT0E 1TNLA 1UHBA 3OY6U 3SBKA 4FUDA 3Q3KA 4I31A 3RMLH 1F0RA 4NSVA 4YLUA 1K1IA 4FU7A 4FUGA 1EPTB 1PQ5A 1RTLA 1OWEA 3M3TA 1IOEA 3D23A 4ZHMU 4FU9A 1Y5BT 1P10A 3SI4H 4DJZB 4BXWA 3TLOA 1EKBB 1E34B 1FV9A 1YLDA 1LHFH 1L1NA 2AFQB 4A1XA 1NC6A 3BIVH 2PWXA 1V6DA 3MNSA 2ZCHP 1O2SA 8LPRA 3TH3H 4BTIB 2A5IA 1F92A 1QFKH 1TA6A 1BIOA 3S0NA 4Y0ZE 2XC5A 1G3EA 1VITF 1EP5A 3C1KA 3MNXA 1GCDA 2BDCA 3U1IB 3SJIA 1P11E 3ZZBA 3ZYDA 4AG2A 1Z8IB 1LHEH 2BDAA 2VGCB 5GJ4B 5F6MA 1C5ZB 1WQVH 1GI0A 1SBWA 1O3EA 4E06H 3TIUA 2A2XH 1W10U 1QA7A 1GVLA 1FI8A 1FN6A 1O5AB 3V13A 5B6OA 2PTCE 2B8OH 4JZIA 1SGIB 1CSOE 3LGYA 4H4FA 1W14U 1SGFA 1D3QB 3F9GA 4HI3A 1O2RA 1J9CH 5A2MH 3ESTA 1OKXA 4CH2B 5F03A 2BM2A 5C3NA 3BEUA 1A61H 3KNXA 2W7SA 1XVOA 4WXIA 2FI3E 3LH3A 4UDWH 5EXLA 2A4GA 1FXYA 5FBEA 2DUCA 1BRBE 1V2WT 1H8DH 3A8BA 2BDIA 1QL7A 1V2MT 1ZSLA 1BTPA 3RXIA 1BJUA 5DG6A 3RDZA 1IQGA 1GI2A 1IHSH 2VWLA 4I33A 1O35A 2QF3A 5GPIB 2THFB 1C5PA 2BVXH 5LPEA 3L3TA 3SNAA 3ZV9A 3RU4T 2NU0E 1GG6B 2VIOA 4AFSA 2ZIQH 1W11U 1OWHA 1TPOA 3SOSA 2Z6BD 1C2EA 5DJ7A 1ZTLA 1A0JA 1J17T 2H9EH 1O34A 3GY8A 3RLYH 3T26A 3R3GB 1DWCH 2ZGHA 1DXWA 4KKDA 1UVSH 3DT0H 4AORA 1XUKA 3SNDA 5JB8S 4INLA 2O8UA 1P2MA 1O3HA 3BTME 1SGNE 1FMGA 2ZFFH 1P09A 1S0RA 3LGVA 2BXUH 1QTFA 1LPKB 2A4QA 3S7KB 3OYPA 5I25A 3E90B 3M3SA 3GICB 1PPZA 2J38A 2A7HA 3VB7A 1O3FA 4NIWA 3UFAA 3PV4A 5T6DA 3QN7A 3V12A 3V3MA 3SJ9A 4X2VA 1DITH 4NA9H 2QF0A 1O5FH 1Y8TA 3FP7E 2WUBA 4GHQA 2V6NA 3SQHE 3KGPA 1TFXA 1NROH 2O8MA 5A8YA 1AY6H 3PO1B 3RMOH 1SSXA 1GJ7B 4BAMB 3ZYEA 3M7TA 1P12E 3FFGA 3EA9A 5EOKA 1TWXB 1QRXA 2ZNKH 2WINI 1C4V2 2ASUB 4CR5A 5CHAB 2VIDA 4MPVA 1FPCH 2AIPA 1XX9A 5IDKA 2BX3A 1W12U 3U8OH 1TGTA 4X1SU 3PTNA 3RMNH 1QRWA 2TGDA 2PGQB 3AAVA 1MAYA 1HPGA 3PLKA 1DANH 1GMHG 1O33A 1W2KH 1GJ8B 1ZLRA 1A3BH 4X1NU 6GCHG 4GVUA 1O2NA 1V2OT 1AB9C 2WV4A 3SHCH 5DP9A 4WH6A 1FDPA 1WYKA 4GCHF 4BANB 4ZH8A 1C2LA 5JBBS 2CF8H 1CHOF 2FS9A 3A7ZA 3M61U 1CO7E 1ZPZA 1QCPA 3AW0A 4XDEA 1VCQA 2BY5X 4BAOB 2ZHFH 2BDGA 1Z71A 2OC8A 3U9AH 3V7TA 1IQMA 2F9VA 4MNXA 1V2KT 2PUQH 1G32B 1MTNC 3GOVB 4KGAA 1O3JA 4NZQA 3TNTA 2CGAA 1SLXB 3LOXA 3EDXB 5FHTA 1SGDE 1GI1A 1K1LA 2ZU4A 1JXPA 1VJ9U 2BLVA 3I77A 4UFDH 1ZRKA 3ITIA 1GWAA 3SGBE 1W13U 1EOLA 1HAYB 1BBRE 1O2YA 3QTOH 2AYWA 3TNSA 4ABDA 1P05A 1FZZA 3RU4E 5FX5A 3SU1A 3GYMA 4K8YA 2R0LA 1DXPA 5ESBA 1HDTH 2VH6A 4JYTA 3NKKA 1SQAA 3DA9B 4JK5A 3MOCA 5CE1A 3GDVA 3D65E 4K1EA 5TCCA 5EU8A 1DLEA 2A0QB 4NIVA 1D4PB 1RTFB 1CT4E 4D7FA 1UMAH 2G00A 3M7QA 4Y7BA 3SZNA 1OOKB 1PQ8A 2C8YB 2Y5GA 1LKAA 3D62A 4XBDA 3QO6A 1J16A 2TGTA 3VGCB 3P8OA 3STJA 1S6HA 2XBXA 2HPPH 2W5EA 3RXCA 1GVKB 1M9UA 1TOCB 1WBGB 4FVBA 4K8BA 4RKJB 1OYTH 1ZR0A 2C8ZB 3T62A 1TQ7B 1IAUA 3QGNB 1GMDF 1KDQB 1Y5UT 1WOFA 1NESE 2BVRH 4XSKU 1RFNA 2XYAA 4HFPB 2WV5A 1DX5M 2RDLA 1ESAA 2YNBA 1Z1IA 3PM3A 4OS4A 1N1LA 2ZP0H 3GDSA 5A0AE 4Q80A 3R0FA 2B5TB 3UREA 3MWIU 5ABWA 3ELAH 1SG8B 4NFFA 1SFQB 1PPFE 2FX6A 3E3TA 4WMEA 3HK3B 3GCHB 2WYGA 2Z94A 3MNBA 3UTUH 1D9IA 2WPHS 1Z6EA 4WY3A 3LKWA 5C2ZA 2ODYB 1C1NA 1ZYOA 3MU8A 1O3BA 2XWBI 1C5SA 3W95A
chains in the Genus database with same CATH superfamily
2FDAA 3RXAA 1UTNA 1BJVA 1FY1A 1Y3UA 3LGIA 3O8RA 3F6UH 1S84A 2QF4A 1QA0A 4TPIZ 2ZDKA 1K0HA 1PPCE 1EB1H 1QZ8A 2ZHQH 1LVOA 1HV7A 1NFWA 3M36A 1UTOA 1GMHF 2G4UA 2W7UA 2FESH 3JZ2B 1G2LA 1UO6A 4AX9H 1OP2A 6GCHF 1LVBA 3LGUA 3O8DA 1NFYA 5EG4A 1MU8B 1C5NH 3RXBA 4UFFH 4Y10E 4JYUH 3ZZ9A 4ISHH 3BF6H 1MTSA 2OINA 2ZDNA 3RMMH 1V3XA 1LHDH 2OK5A 4Y76A 4SGBE 1TALA 5IYTA 3ZVAA 1FY5A 3P6ZB 2F91A 1H8ED 1DM4B 1V2PT 5DN6D 1EZUC 4JMYA 1RIWC 2QN5T 2JIZD 2V3MA 2F83A 1ZMJA 1W0ZU 2ALPA 4TPYA 1AD8H 2A4RA 2J5UA 1C5RA 2AMQA 4JZ1A 1F7ZA 1AFEH 1NO9H 3PMAB 2HOBA 3QWCH 3SQEE 1VGCB 5HGGA 1KLIH 1GI7B 1TPSA 4ZROA 1P2KA 5B6LA 3SV2H 2BZAA 4I8JA 2RG3A 2KCAA 1C5LH 5JYIA 3UQVA 2BDYA 4IN2A 1TBZH 4ZHLU 5T3HA 4FUIA 5E2OA 2A31A 2OUAA 3RC6A 1L0ZA 3BTFE 2B7DH 4FUEA 4H42U 1GBAA 1O2PA 1CGIE 3A89A 4XD7D 3DSOA 1V2VT 3DCLA 1VKYA 4A5TS 4Q7XA 2A7JA 1W3CA 2QXJA 3LC5A 1SQOA 3IG6B 2VINA 3PLPA 4NA8A 1EX3A 2FI4E 4HZHA 1CQQA 2H1UA 4X6NA 1P57B 3EA8A 3F9EA 5AHGH 4M9FA 3EGKH 5DP8A 3A80A 3UWIA 2RA0A 3AAUA 1ACBE 1T32A 2J95A 2TGAA 1DPOA 1FY3A 4KTUA 1DSUA 1ZJDA 1QRZA 4OS5A 1LVYA 1BHXF 4K1SA 1OPHB 1TIOA 1WUNH 1NT1A 3TK6A 2HVYB 4AC9A 4Y7AA 3DD2H 1YCPK 4ISIH 4MQAA 4AFZA 4E7NA 1CU1A 3PROA 1YGCH 2ZFPH 1BTYA 2A7CA 3M5NA 1MMJN 4Y79A 3OTJE 1O31A 3EYDA 1UTKA 4J2YB 4MPWA 3BTDE 1NRPH 1AMHA 4Y11E 1NRNH 5HKKD 2Q1JA 1F0SA 3K65B 3T28A 1UCYE 1O3LA 1UTLM 2P93A 1W7GH 1JRSA 1GBEA 3T29A 4Y8YA 2ALVA 1BB0B 5DO4H 1GHXH 4ZHAA 1DWEH 3U98H 2JJ1D 1GMCG 1LO6A 5C67A 4ESTE 1K1JA 4JK6A 3S7HB 1FQ3A 2G5VA 1CGJE 3MTYA 5SGAE 1C1TA 1MZAA 5LH8A 1AE8H 2HRVA 4VGCC 1DLKB 2SFAA 3BTWE 2ZTYA 5GXPA 3F9FA 1ZTJA 3U28C 3VG8A 2ZA5A 1V2UT 3M3VA 5L30H 5EODA 5EW1H 3VB4A 4MNYA 1MABB 1KLJH 1GI5A 2AMDA 4U01A 1AO5A 4OGXA 1BOQA 4E05H 2BHGA 1GBKA 2EI7A 1DDJA 3TJUA 1XKBC 4DGJA 4LXBH 1TX7A 1TA2A 1PPEE 2GMTC 2J4IA 3SV8A 2Z3EA 1W7XH 2PKSC 1Y3VA 4THNH 1C5YB 5K0HA 2FOEA 3BG4C 1QB6A 1AU8A 1TYNA 3TGJE 2G51A 2J94A 2A4OA 3PRBA 3SNCA 2TRMA 1C5QA 3ATIA 4WVPE 2WSSD 5BRRE 1JRTA 3M5OA 3TK5A 1HJ8A 2O9QA 1G30B 1BITA 1E36B 1ARCA 4NSYA 5DP4A 3RC4A 3A83A 2J97A 2GCHF 4ISLA 1EAUA 1TGBA 4B75A 1EZXC 1BBRK 3E6PH 2ZPQA 4FUFA 1FAKH 1YBWA 2TGPZ 3HKJB 3RXKA 2W26A 2Q6FA 5C1UA 2JJ2D 1EPTC 5L2ZH 3SU4A 2P3TB 6ESTA 3QZRA 3VB5A 3PYHA 2P3FH 8GCHF 3L33A 3NCLA 4CHAB 3M35A 2NU3E 4KELA 1SGCA 5FX6A 1GJAB 4UFGH 2EQNA 1GHYH 1SGPE 3UUZA 2XXLA 3VFEA 1EXFA 4F49A 2A45B 4CRAA 3KQEA 2GTBA 1HRTH 2GT8A 4YM9A 4AFUA 2I6QA 4UFEH 1GBTA 3M5LA 4BNRA 5DGJA 2OXSA 1O30A 2OQ5A 2QYIA 3MI4A 3NK8A 1OHHD 4X6MA 4O03A 1C2IA 1BRAA 1YYY1 3VB6A 4NWLA 1ESBA 3LH1A 5E2PA 1B0EA 4YTAA 2VGCC 1XUJA 4X8TH 1O5BB 3RXGA 2ZCLP 2HPQH 3UOPA 1VCPA 1XM1A 1PYTC 2HGTH 3OX7U 1F5LA 1SGQE 1YP9A 4ZAEA 4A92A 2R9PA 1V2JT 1O5EH 2ZDAH 4DCDA 2IN2A 3RC5A 5FAHA 2FS8A 2KZ4A 2V35A 9LPRA 2ZFTA 3RM2H 1U6QA 1O2MA 4OS7A 1ZSJA 3OTPA 2VU8E 4R8TB 1N6YA 1SOTA 3SJKA 3SGQE 4B2CA 1HJAC 3A81A 4H6TA 1H8IH 1LDTT 4AG1A 1E35B 1GMCF 2QXHA 1UK3A 1MKXK 1NN6A 2BYAX 2Z7FE 4BTUB 1GJCB 4NCYA 2F3CE 2B0FA 3P95A 4INKA 1AQ7A 1B5GH 1MQ6A 1Z8RA 2NWNA 1C9PA 2ULLA 4O3TA 2EA3A 4Z0KA 9ESTA 1GG6C 2FOMB 4DOQA 1WSSH 2PKAB 1BMMH 3SUFA 3IWMA 2ZG0H 1O2IA 2L6OA 2ZGBH 3BN9A 1ELVA 1HXEH 2BB4A 4O9VA 2ZTZA 2EI8A 7GCHG 3MH7A 1V2LT 3PMJA 1K22H 4NFEA 1GHVH 2BD5A 5ESTE 1ZZZA 1HYLA 1FY8E 1EJMA 1RD3B 2P94A 2VVVA 2BD7A 1XVMA 1MTVA 3WWFA 3TJVA 1C1OA 3PV5A 1AUTC 1SGFG 2CHAC 3P8NA 5F8TA 3DSPA 3RXEA 3PWBA 1WXRA 2BD4A 3CENA 1C5WB 2BLOA 1PJPA 4MPUA 1MKWH 3PTBA 3DUXH 3FOAA 5H4IB 1ETSH 1SGEE 1MAXA 2GCTB 1SR5C 1WDIA 2PP6A 4FUJA 3ZZAA 2ZFRH 1O32A 1J8AA 2HNTC 1LQDB 4B71A 1AVGH 1LTOA 7LPRA 1HNEE 3AW1A 1ABIH 1ZTKA 1EATA 1LQEA 5FPYA 3SU5A 2KFWA 1QBNA 1NBME 1ELDE 1HGTH 2GZ7A 4ABIA 1ELTA 1G37A 1C1SA 2LELA 2QY0B 2SGQE 2D8WA 2AHME 1KMHB 1GDUA 1T8OA 2KCPA 2OC7A 2YNAA 1DT2A 3K6ZA 1HFDA 1ZMNA 3HATH 2KCOA 4ZKRU 1ZGVA 3LIWA 4D76A 2HLDD 2GGVB 3BTQE 2OC1A 2CK3D 2XWAA 4BAKB 3LT3A 1YPKH 4X1PU 2QF5A 1H9IE 1YKTA 3FO8D 1DY9A 1D3PB 2AH4X 3BV9B 1IQJA 2AIQA 2ZU5A 3PMBB 1BQYA 4IC6A 5CHAC 5C5NA 2HVXA 1SGRE 5J4QA 2AGEX 4CRCA 1OP8A 3FP8E 1OS8A 1MD7A 3LPRA 1MQ5A 1V2TT 1HB0B 4NWKA 2F43B 2GDDA 2QA9E 4I8GA 3ATLA 1TE0A 1MTWA 2G4TA 2FYRA 1T4UH 2ZDVH 5CDFE 1YY3A 3RXOA 1UCYH 1EAXA 2M5TA 1DS2E 1GGDC 2FTMA 2R2MB 1GI6A 1UTQA 1ELBA 1UTJA 3E8LA 2PR3A 1C5OH 4K2YA 3ZZ6A 1SLUB 2ZWLH 4DT7B 4ZUHA 3GCTG 5ETXA 1XUHA 1CA0B 1O3CA 1ZHPA 8KME2 1MTNB 4U32A 3AASA 1UK4A 1AE5A 2RFKC 2PKAA 3FP6E 4BOHA 4INHA 2JETB 3AVZA 1HCGA 1TABE 3E1XB 4F48B 1QURH 1E1QD 2VBCA 3SUGA 4WWYA 2GKVE 4WXVA 3UQOA 2UUKB 3VPKA 3UNQA 5A8XA 1QJ1B 1A2CH 1DWBH 5L2YH 3P70B 2BQWB 2VVCA 1GBCA 2TIOA 1KXDA 1GI4A 5FPTA 2SGEE 1SQTA 4X8UH 1P02A 3A7XA 3GYLB 2JH6D 3EQ0H 1UVUH 3SN8A 3ENSB 3MNCA 1GI3A 2XBVA 1IQNA 1QL8A 3HPTB 1DFPA 1S5SA 3BSQA 2FWWA 1KYNA 2D26C 3P8FA 2VIVA 1UTMA 1C9TA 1L4DA 5E0GA 2BY6X 1BTZA 1W0YH 4BAQB 4HTCH 4GAWA 1IQFA 1P8VC 3RU4D 1GBHA 1G2MA 2SNWA 3UPEA 1SPJA 1A5GH 7GCHF 3ZZ3A 5FCRA 1THSH 2PTNA 3A7TA 3SNEA 1EJAA 2FODA 3MYWA 4DIIH 1ZRBA 3LU9B 4CRBA 2BD2A 1EZQA 1AZ8A 1RXPA 1SOZA 2XCFA 1O3NA 6CHAB 1NS3A 1GHAG 1AVWA 3QGJA 1TRNA 1CT2E 1C5TA 3U8RH 1GCTB 5T6FA 2GX4A 3A8DA 1UVOA 3KIDU 3ODFA 4ISOA 4CR9A 2BQ7B 2A32A 1RRKA 2O8LA 2ZO3H 1C5MD 3RXFA 3ZZ4A 1TRMA 1FX0B 5AFYH 3BTKE 3SU3A 1CA8B 1KXEA 2JH0D 1H4WA 3CS7A 1D6WA 1ZPCA 3MU5A 2ZU3A 4Y8ZA 1O2KA 2WPLS 3RXUA 3MO6A 1YF4A 4NA7A 1K1NA 5EW2H 5J4SA 1T8MA 5KGOA 1LPZB 2C8XB 2O8TA 4ZXXH 1WAYB 1A5IA 2JH5D 4AYYB 1B7XB 1C5XB 1LCYA 1F0UA 1GBIA 3U8TH 4YOGA 3BTHE 3EA7A 4DURA 1ESTA 1FLEE 1KSNA 1V2RT 2OP9A 3GCHC 2FX4A 1ELFA 4Q63A 3TPIZ 1ZHMA 2LNCA 1FN8A 1W0KD 1WTGH 1N6XA 2UUYA 3BEIB 4SGAE 3A87A 3JZ1B 5F53A 2VWMA 1O2TA 3IITA 3T27A 4IS5A 2Z3CA 1Y59T 3A8AA 1S6FA 1INCA 1BRUP 3N7EA 2R3YA 5JPMH 2QGRA 1Z7KA 3QDZB 3A82A 5C1YA 2K1QA 1O2ZA 1HAXB 2BD3A 3P8GA 1V2NT 1LHGH 2QXIA 1OWKA 3M5MA 1O38A 1OWJA 1MUEB 3P92A 1MCVA 2CN0H 5EQSA 3TITA 1BZXE 1EQ9A 2AGGX 2FOGA 4JZEH 2BQ6B 6LPRA 3STIA 1AHTH 1AWFH 4XE4A 2Q6GA 1XXDA 5PTPA 2OTVA 1YPEH 2V3OH 4JCNA 3NUMA 2ANMH 5GCHG 3RXVA 1CBWB 3WWBA 1QQ4A 3URDA 1TMUH 1O2QA 1CGHA 1KY9A 3RXQA 2BY9X 1MU6B 2L74A 3I29A 1KTTB 4IN1A 2P8OB 5CMXH 5T6GA 1FJSA 4AN7A 1GJ9B 4KP0A 5JDUB 2JKHA 3PWCA 4FU8A 4FUBA 1BCUH 3KHVA 5EQQA 1YPLH 4TWYA 5A0BA 1VGCC 3A84A 3ZVEA 5JBCS 1NU9A 1NU7B 3MO3A 3SU2A 2Y6TA 3TJOA 3UR6A 3M37A 2ZKSA 2G8TA 1BMNH 2LP6A 1TMBH 4BAHB 1QR3E 4J1YA 5EQRA 3K2UA 1HAOH 1Y3YA 1JWTA 1ANDA 4D7GA 3U69H 2BTCE 4LK4A 1C1QA 1TLDA 2A2QH 1UW7A 4K3JA 3N7DA 2FLRH 2ZPSA 3OEHD 3W94A 2FZZA 4DY7B 2BLWA 1TGNA 4YT6H 4AZ2B 2Z9LA 1ZMLA 3KF2A 3PRDA 3M7UA 4YZUA 2KX4A 2PUXB 1AUJA 4PROA 2VH0A 2XC0A 1C5VA 1T31A 3EAJA 1VITG 3UR9A 1EUFA 1GHAF 4NZLA 1SB1H 1PPHE 1THRH 2CMYA 2KAIA 2GV7A 4K69A 1ETRH 1V2ST 2BD9A 1O3IA 4A6LA 1A7SA 3KN2A 1P2NA 1FONA 1DWDH 3SORA 2WYJA 1C2MA 2F9UA 4ZKNU 3BG8A 1A3EH 2V3HH 1KLTA 1QY6A 4MDSA 4OS2A 1BTHH 1SFIA 1HLTH 2BVSH 2V7QD 1O3KA 1P03A 1HJ9A 4AB8A 2Z9JA 1EB2A 1BUIA 2Y5FA 4RN6A 3FVFB 2K8IA 5C1XA 1PYTD 1CE5A 3S9BA 3SUEA 1SKYE 2YMSC 4I8KA 4CH8B 2D2DA 4NIYA 2PHBA 2HALA 1K28D 1EASA 3MH6A 1TBRH 3ZVGA 5HM2A 4ZMAH 1FUJA 1OXGA 4ABHA 1AFQB 4P02A 2Z9GA 3OY5U 1YCPM 4Q2KA 1F5RA 2R0KA 5GIBA 3SJOA 1H1BA 2OQUA 3K6YA 2PSYA 2HNTF 2SGAA 3TGKE 3LONA 1SI5H 4D9RA 1DUAA 2WPJS 2ZTXA 3KCGH 3DSGA 1Z8GA 1HAZB 3MHWU 3ZVFA 1PFXC 2C8WB 2QAAA 2ZEBA 5AFZH 3UNRA 1ZSKA 3MU4A 2EY4C 2VNTA 1TQ0B 3SV6A 2C3SA 1C2HA 2TBSA 4Y6DA 1GI9B 4B2BA 1QQUA 3Q00A 3A88A 1H8HD 3BTGE 4X2XA 1HUTH 3ZVBA 3ZVDA 1GDNA 1S85A 2GMTB 1P9UA 1N8OC 1E79D 3BIUH 4JZFH 4WMFA 1QGFA 4DIHH 1NM6A 1AN1E 1TPAE 2HWLB 2RCEA 2F4LA 1GVZA 5GNDA 5GCHF 1MH0A 5DKMA 3H5CB 1ANCA 1F2SE 1FIZA 2QIQA 4AGJA 3A86A 5C17A 3TVJB 1GBDA 1QJ6B 2HNTE 3OAAD 4RSPA 1NRRH 1EP6A 1C1WH 3HGPA 3W1EA 3LGWA 2OLGA 1Y3XA 1RTKA 1J14A 4TYDA 4X6PA 4B2AA 1P2OA 1VJAU 1YM0A 1BMAA 1LVMA 4YO9A 1Q31A 3UY9A 3AK5A 4IGDA 1C1VH 1O2VA 1SMFE 5AF9H 1HAPH 2GT7A 2QE7D 1TX6A 4XBBA 1T8LA 1K2I1 2DE9A 1TX8A 4A1VA 2STAE 2P3UB 2P59A 1GL1A 2WPKS 3ZZ5A 3KQBA 1ARBA 3LJOA 3N7OA 3QK1A 4GUXA 2ANYA 4AGKA 1ZHRA 2ZQ2A 3GY5A 2SGDE 1P2IA 1GHWH 2XBWA 1KXBA 4D9QA 4Q4LA 4OGYA 1D3TB 4XBCA 1BTXA 4CHAC 1HAHH 1TB6H 2GDEH 3RXMA 5K7RA 4D8NA 3FAOA 3H7TA 1KXCA 1QJ7B 3V0XA 1IQHA 4IBLH 3GCOA 3GY2A 1IHTH 3GCNA 1O2HA 2AMPA 4MVNA 1ELCA 2BDBA 3B23B 4OS6A 3RXTA 3U1JB 3P17H 1RGQA 2AS9A 4ABAA 2GP9B 3TJNA 3T5FH 4LOYH 2ZGJA 4TWWA 3URCA 1J15A 2G5NA 2ZI2H 2Y7ZA 3ZV8A 5TCAA 1GL0E 1GHZA 2B9LA 4GCHG 1E1RD 3NZIA 1G36A 3KQ5A 5I46H 2FOHA 1CHOG 3BEFB 4MTBA 5EIYA 2Y81A 3MMGA 1ORFA 3QLPH 4I7YH 1NFXA 1AWHB 1VCWA 4B74A 1GBMA 3ATMA 3TH2H 1TAWA 2UUJB 1MKXH 2P95A 4X8SH 2BDHA 1PPBH 4CBNA 1O3AA 5JB9S 1TNGA 1HAIH 1L1JA 3SNBA 1HJAB 2V0BA 3KYGA 1WQSA 1S0QA 1SHHB 7KMEH 1A0HB 1YC0A 2C93B 3B8JA 4GSOA 3RXDA 1S82A 1Q3XA 3F3BA 5EXNA 2SGPE 1E0FD 4ZKSU 2FI5E 4OS1A 1BHXB 2R2WU 1BTWA 2BY7X 2FXRA 1GHBG 2VVUA 2QV1A 3S69A 2ODQA 1RS0A 1Z6JH 5DSFA 3NRLA 1EAIA 2FPZA 2RA3A 3MH5A 3SGAE 8ESTE 3ZZCA 4WF8A 3KEEA 5KEDA 1GJ6A 1THPB 2BXTH 2EC9H 4HGCA 1XUGA 1P06A 1P3CA 2XOKD 1Z8JB 1H9LB 3KQCA 3O8CA 2YOLA 3GY7A 2Y5HA 2ODPA 1L1GA 2QC2A 1QBVH 2FTLE 2ZCKP 3H7OA 1EPTA 2NU2E 1ETTH 1MTUA 3OSYA 4MG3A 1P2QA 1QL9A 3F68H 3Q3YA 3FZDA 2WPDD 3SO3A 1ZJKA 4IW4E 3TH4H 2SNVA 1DOJA 3RXRA 2UWLA 3EE0B 4TT3D 3A7VA 2CHAB 2M2AA 3Q77A 2J9NA 3HK6B 4Y71A 1BRCE 5JBAS 4WH8A 5FL7D 4GLYA 4WMDA 1GMDG 5DP3A 1YPMH 3UWJH 2ZHWH 1UK2A 3GY6A 1YPHC 4UE7H 4O97A 3VXEH 1UJ1A 3ATWA 5T1VA 2DE8A 3GS9A 2D1JA 1T8NA 4MLFB 1MBMA 1QB1A 1NZQH 1EFRD 1XMNB 2FOCA 1AKSB 1S81A 3G01A 4NG9H 2GCTC 1RJXB 4MNVA 1DUEA 2Z9IA 2FIRH 1GJBB 1P2JA 2BD8A 2ZPRA 4QT8C 3RLWH 4YT7H 3PO1C 2Z3DA 1MKWK 1BDAA 5C20A 4ISNA 5HIYA 4ACBA 1TNHA 4UD9H 5DP6A 3RXHA 1C2GA 1T4VH 3GY3A 1P01A 1YPJH 3RXJA 4DW2U 1TONA 1AIXH 1NBMD 4KTCA 2H5DA 3MU0A 4MNWA 1GI8B 1AB9B 3A8CA 1QIXB 3SU0A 1O2GH 1K21H 3ATKA 4FUHA 1AZZA 1NTPA 4ZCNA 2GZ8A 1Q2WA 1YLCA 4CRDA 1KTSB 3ZVCA 4I8LA 4O3UA 1GGDB 5JBTA 3WY8A 1SHYA 1G3DA 1PPGE 4DVAU 1O36A 4FETA 4AOQA 1JBUH 4ABBA 2CXVA 4M7GA 1LPGB 1A0LA 1NFUA 3LDXH 4B76A 1VZQH 3SJ8A 4B1TA 4I86A 1TNIA 2KCYA 3VEQB 1F5KU 3GDUA 1O3PB 4AYVB 2XNDD 4CRGA 5KECA 1UCYK 1DSTA 1SLVB 1CA0C 2SGFE 1LHCH 3Q76A 5DP5A 1GJ5H 4CBOA 4TSFD 1TPPA 2H2ZA 1JIMA 1OP0A 4R0IA 2JETC 4IC5A 1ANEA 3A85A 4X2YA 1A1RA 2ZZUH 1A5HA 1SGYE 1TBQH 2KR7A 5EJZA 2F9OA 2Y7XA 3BTEE 1FY4A 1MZDA 1K1MA 1BTUA 1G3CA 2G55A 4YLQH 3FN8A 1MBQA 1G3BA 1ZOMA 2F9PA 1H9HE 1Y3WA 2C90B 2Y80A 3HGNA 3LJJA 4ABEA 2ILNA 2PGBB 1GHBF 1TRYA 1NPMA 5HIZA 1C2FA 5AVDA 4UEHH 3PMHB 3I78A 1IQEA 3E0NB 3VXFH 5A0CA 2I6SA 3SV7A 3C27B 3F2FA 5FCKA 2BLQA 2ZGCA 2VJ1A 1XUFA 2FMJA 1O5DH 1AVXA 1O39A 2G52A 1B0FA 3FKSD 1O0DH 1O37A 3NPSA 1AKSA 4AFQA 5F8ZA 1C4U2 3L6PA 4E7RG 2BOKA 2FP7B 3VB3A 1WCZA 2Q6DA 2WHXA 4FUCA 4RT0A 3VGCC 4H6SB 1QBOA 1ZPBA 2ZQ1A 2GV6A 6CHAC 4BTTB 1NRSH 2A5KA 1E37B 1X7AC 1CHGA 1A4WH 4GHTA 3FZZA 2FOBA 3RXLA 7ESTE 4AB9A 1JIRA 1C4Y2 5E8EH 5FBIA 4TY7A 1GCTC 3F9HA 1KXAA 2VWNA 1KIGH 3MFJA 2XC4A 1GBBA 3OE7D 3RXSA 1C1MA 1Y5AT 5DK1A 1O5CB 3GY4A 2GVFA 1O2UA 4A1TA 3PB1E 4K5ZA 1O2JA 3QUMP 1DVAH 4WJG2 2PW8H 3T25A 5C5OA 3UOUA 1SQRA 2VWOA 1GPZA 3MU1A 5A8ZA 1MCTA 2ZDMA 1BA8B 3A7YA 2ZDLA 1PQ7A 1EZSC 2KAIB 4GPGA 4X0WU 5LPRA 1HIAB 3B9FH 5EPNA 1V2QT 5LPFA 1YWUA 3F2HA 2FM2A 2XBYA 2YMSD 4Y8XA 1G9IE 2H9TH 2XW9A 2GD4B 4X8VH 2BY8X 4LZ1H 1P9SA 1W8BH 2ZU2A 3N99A 5EPYA 2VB0A 1D6RA 2WV9A 1Z1JA 3S9CA 1EJNA 3ZZ7A 2CF9H 2J2UA 4B73A 4XFQA 1QHRB 1GDQA 4CREA 4NGAH 1C1RA 4F55A 3DFJA 1K9OE 1ZGIA 4TY6A 1SVPA 3NXPA 4U30A 4DG4A 3RM0H 2ZHEH 1BMLA 1T7CA 2WUCA 1HAVB 5TJXA 4Y0YE 3RUOA 1ABJH 1TNKA 2ANWA 1DE7H 3GCTF 2RDEA 1E38B 2OBQA 3KQDA 4ZXYH 1UVPA 2STBE 3MQKC 4JZDH 2F9NA 1RIWB 1EOJA 1OSSA 2A5AA 2EI6A 2UUFB 4YOIA 1VITH 3T2NA 1FNIA 1K1OA 2H9HA 1O3GA 5G4BA 1OX1A 1NY22 1C2DA 2PLXA 2AERH 2VIQA 3F0PA 2IPHA 5EGMA 2CJIA 3E91A 1AI8H 1PQAA 3ZZDA 3F1SB 2OCVB 3FANA 4ACAA 1C1UH 1CBWC 4F4OC 1A46H 2EEKA 1C1PA 3MH4A 1YPGH 2P8OC 1EAWA 5BPEA 1XKAC 2K0QA 4ZKOU 1SC8U 1GBFA 2ZFSA 3ODDA 4FXGH 4ASHA 2ZU1A 4RKOB 1ELAA 3RP2A 2GCHG 2IOTA 4ABGA 1WU1A 3QZQA 2W6JD 2XTTB 1UTPA 1P3EA 3MO9A 1OWIA 4XOJA 1L2EA 5HM9A 1YLNA 1C5UA 5F8XA 1HBTH 5GDSH 3HKIB 1S83A 5C0TA 5GWZA 2O8WA 4I32A 4MPXA 3NWUA 1KDQA 4I8HA 2VIWA 2XCNA 8GCHG 3UNSA 2TPIZ 3LC3A 2XNIA 1AGJA 1GBLA 2Y82A 3OU0A 1LKBA 4IMQA 1UHBB 4NIXA 5HXFA 1YCPH 1O2OA 1GJ4H 1WTHD 2H5CA 1QNJA 2BZ6H 3QTVH 2FYQA 4Q7YA 5FXLA 1COWD 3LGTA 1HIAA 3PLBA 4IMZA 5E0JA 3SZEA 1FIWA 1LMWB 1OYQA 1SLWB 2FOAA 2IPQX 3RXPA 3SHAH 2W3KA 3S9AA 2PV9B 3SU6A 2R3UA 1QB9A 2OD3B 2NU1E 3D49H 1SGTA 1TMTH 4ABFA 1CVWH 2KM0A 1KXFA 2A1DB 2BX4A 3K9XB 5EXMA 2OBOA 2FO9A 2JDID 1F0TA 2J98B 2ZECA 1JMOH 2ZC9H 1NRQH 3CS0A 1DY8A 1GBJA 1MD8A 3SW2B 4YOJA 1ANBA 2ZF0H 2YMSB 1FPHH 1K1PA 1C2JA 1P0SH 4X2WA 2ZGXH 4Z6AH 4KTSA 1HAVA 2UWOA 3SI3H 2WPIS 1DICA 3E0PB 2ZFQH 5HMAA 2IJOB 4Q7ZA 4FVDA 1L4ZA 4YESB 3TK9A 2F9BH 2LPRA 2ZHDA 3KL6A 2J92A 2FOFA 2AGIX 5LGOA 2GZ9A 1IQIA 5DP7A 1XXFA 2OC0A 5E0HA 4VGCB 3UIRA 4K1TA 1D3DB 5HYOA 1JOUB 3QX5H 1XUIA 4X1RU 2XRCA 2BMGB 1VR1H 2PFEA 1HAGE 2Z9KA 4B6EA 1AFQC 2AEIH 2H6MA 4CRFA 1O2XA 2FEQH 1O5GH 1UVTH 5FPSA 1OWDA 1TGSZ 2WPMS 3GISB 4K60A 3ZZ8A 1C2KA 2W3IA 1TGCA 5L6NH 5DPAA 1O3MA 1SL3A 2NU4E 2G81E 2UWPA 1IQKA 2FLBH 3SUDA 4U2WA 1ELGA 2ESTE 4ASUD 2CV3A 3E16B 3TGIE 1ID5H 2ANKH 1P04A 1IQLA 3Q3XA 5IK2D 1GJDB 2PKSB 4UONA 3DFLA 4X1QU 3DHKH 1O3OA 4LZ4B 2PSXA 1N8OB 3BG4B 3BTTE 4B6FA 1ELEE 2HLCA 1FAXA 1BT7A 1TNJA 5A09A 3O8BA 4JYVH 3TU7H 1HXFH 1YPHE 4A7IB 2QXGA 2BOHB 4ABJA 4X6OA 4BXSA 3SV9A 1BBRH 2C4FH 2J34A 3CP7A 1WV7H 5C94A 3A7WA 1O3DA 1TOMH 2VIPA 1O2LA 2QCYA 2P16A 1O2WA 1CT0E 1TNLA 1UHBA 3OY6U 3SBKA 4FUDA 3Q3KA 4I31A 3RMLH 1F0RA 4NSVA 4OM9A 4YLUA 1K1IA 4FU7A 4FUGA 1EPTB 1PQ5A 1RTLA 1OWEA 3M3TA 1IOEA 3D23A 4ZHMU 4FU9A 1Y5BT 1P10A 3SI4H 4DJZB 4BXWA 3TLOA 1EKBB 1E34B 1FV9A 1YLDA 1LHFH 1L1NA 2AFQB 4A1XA 1NC6A 3BIVH 2PWXA 1V6DA 3MNSA 2ZCHP 2J98A 1O2SA 8LPRA 3TH3H 4BTIB 2A5IA 1F92A 1QFKH 1TA6A 1BIOA 3S0NA 4Y0ZE 2XC5A 1G3EA 1VITF 1EP5A 3C1KA 3MNXA 1GCDA 2BDCA 3U1IB 3SJIA 1P11E 3ZZBA 3ZYDA 4AG2A 1Z8IB 1LHEH 2BDAA 2VGCB 5GJ4B 5F6MA 1C5ZB 1WQVH 1GI0A 4Z1MD 1SBWA 3UAIC 1O3EA 4E06H 3TIUA 2A2XH 1W10U 1QA7A 1GVLA 1FI8A 1FN6A 1O5AB 3V13A 5B6OA 2PTCE 2B8OH 4JZIA 1SGIB 1CSOE 3LGYA 4H4FA 1W14U 1SGFA 1D3QB 3F9GA 4HI3A 1O2RA 1J9CH 5A2MH 3ESTA 1OKXA 4CH2B 5F03A 2BM2A 4HG6A 5C3NA 3BEUA 1A61H 3KNXA 4P00A 2W7SA 1XVOA 4WXIA 3SYJA 2FI3E 3LH3A 4UDWH 5EXLA 2A4GA 1FXYA 5FBEA 2DUCA 1BRBE 1V2WT 1H8DH 3A8BA 2BDIA 1QL7A 1V2MT 1ZSLA 1BTPA 3RXIA 1BJUA 5DG6A 3RDZA 1IQGA 1GI2A 1IHSH 2VWLA 4I33A 1O35A 2QF3A 5GPIB 2THFB 1C5PA 2BVXH 5LPEA 3L3TA 3SNAA 3ZV9A 3RU4T 2NU0E 1GG6B 2VIOA 4AFSA 2ZIQH 1W11U 1OWHA 1TPOA 3SOSA 2Z6BD 1C2EA 5DJ7A 1ZTLA 1A0JA 1J17T 2H9EH 4RI0A 1O34A 3GY8A 3RLYH 3T26A 3R3GB 1DWCH 2ZGHA 3OEED 3H09A 3F2GA 1DXWA 4XRNA 4KKDA 1UVSH 3DT0H 4AORA 1XUKA 1W0JD 3SNDA 5JB8S 3EE7A 2O8UA 1P2MA 4INLA 1O3HA 3BTME 1SGNE 1FMGA 2ZFFH 1P09A 5EJ1A 1S0RA 2WZQA 3LGVA 3UB0A 2BXUH 1QTFA 1LPKB 2A4QA 3S7KB 3OYPA 5I25A 3E90B 3M3SA 3GICB 4YXWD 2J38A 1PPZA 2IJD1 2A7HA 3VB7A 1O3FA 4NIWA 3UFAA 3PV4A 5T6DA 3PV2A 3QN7A 3V12A 3V3MA 3SJ9A 4X2VA 1DITH 4NA9H 2QF0A 1O5FH 3ZIAD 1Y8TA 3FP7E 2WUBA 4GHQA 2V6NA 3SQHE 3KGPA 1TFXA 1NROH 1BMFD 2O8MA 5A8YA 1AY6H 3PO1B 3RMOH 1SSXA 1GJ7B 4BAMB 3ZYEA 3M7TA 1P12E 3FFGA 3EA9A 5EOKA 1TWXB 1QRXA 2ZNKH 5CHBA 2WINI 1C4V2 2ASUB 4CR5A 5CHAB 2VIDA 4MPVA 1FPCH 2AIPA 1XX9A 5IDKA 2BX3A 1W12U 3U8OH 1TGTA 2GJGA 4X1SU 3PTNA 3RMNH 1QRWA 2TGDA 2PGQB 3AAVA 1MAYA 1HPGA 3PLKA 1DANH 1GMHG 1O33A 1W2KH 1GJ8B 1ZLRA 1A3BH 4X1NU 6GCHG 4GVUA 1O2NA 1V2OT 1AB9C 2WV4A 3SHCH 5DP9A 4WH6A 1FDPA 1WYKA 4GCHF 4BANB 4ZH8A 1C2LA 5JBBS 2CF8H 1CHOF 2FS9A 3A7ZA 3M61U 1CO7E 1ZPZA 1QCPA 3AW0A 4XDEA 1VCQA 2BY5X 4BAOB 2ZHFH 2BDGA 1Z71A 2OC8A 3U9AH 3V7TA 1IQMA 2F9VA 4MNXA 1V2KT 2PUQH 1G32B 1MTNC 3GOVB 2W6ID 4KGAA 1O3JA 4NZQA 3TNTA 2CGAA 1SLXB 3LOXA 3EDXB 5FHTA 1SGDE 1GI1A 1K1LA 2ZU4A 1JXPA 1VJ9U 2BLVA 3I77A 4UFDH 1ZRKA 3ITIA 1GWAA 3SGBE 1W13U 1EOLA 1HAYB 1BBRE 1O2YA 3QTOH 2AYWA 3KYFA 3TNSA 5EJLA 4ABDA 1P05A 1FZZA 3RU4E 5FX5A 3SU1A 3GYMA 4K8YA 2R0LA 1DXPA 5ESBA 1HDTH 2VH6A 4JYTA 3NKKA 1SQAA 3DA9B 4JK5A 3MOCA 5CE1A 3GDVA 3WW7A 3D65E 4K1EA 5TCCA 5EU8A 1DLEA 2A0QB 4NIVA 1D4PB 1RTFB 1CT4E 4D7FA 3OFND 1UMAH 2G00A 3M7QA 4Y7BA 3SZNA 3F0OA 1OOKB 1PQ8A 2C8YB 2Y5GA 1LKAA 3D62A 4XBDA 3QO6A 1J16A 2TGTA 3VGCB 3P8OA 3STJA 1S6HA 2XBXA 2HPPH 2W5EA 3RXCA 1GVKB 1M9UA 1TOCB 1WBGB 4FVBA 4K8BA 4RKJB 1OYTH 1ZR0A 2C8ZB 3T62A 1TQ7B 1IAUA 3QGNB 1GMDF 1KDQB 1Y5UT 1WOFA 1NESE 2BVRH 4XSKU 1RFNA 2XYAA 4HFPB 2WV5A 1DX5M 5C0UA 4RT1A 2RDLA 1ESAA 2YNBA 1Z1IA 3PM3A 4OS4A 1N1LA 2ZP0H 3GDSA 5A0AE 4DT4A 4Q80A 3R0FA 2B5TB 3UREA 3MWIU 5ABWA 3ELAH 1SG8B 4NFFA 1SFQB 1PPFE 2FX6A 3E3TA 4WMEA 3HK3B 3GCHB 4FOUC 2WYGA 2Z94A 3MNBA 3UTUH 1D9IA 2WPHS 1S6LA 1Z6EA 4WY3A 3CNRA 3LKWA 5C2ZA 2ODYB 1C1NA 1ZYOA 3MU8A 1O3BA 2XWBI 1C5SA 3W95A
chains in the Genus database with same CATH topology
2FDAA 3RXAA 1UTNA 1BJVA 1FY1A 1Y3UA 3LGIA 3O8RA 3F6UH 1S84A 1QA0A 4TPIZ 2ZDKA 1PPCE 1EB1H 2ZHQH 1LVOA 1HV7A 1NFWA 3M36A 1UTOA 1GMHF 2G4UA 2W7UA 2FESH 3JZ2B 1G2LA 1UO6A 4AX9H 1OP2A 6GCHF 1LVBA 3LGUA 3O8DA 1NFYA 5EG4A 1MU8B 1C5NH 3RXBA 4UFFH 4Y10E 4JYUH 3ZZ9A 4ISHH 3BF6H 1MTSA 2OINA 2ZDNA 3RMMH 1V3XA 1LHDH 4Y76A 4SGBE 1TALA 5IYTA 3ZVAA 1FY5A 3P6ZB 2F91A 1DM4B 1V2PT 1EZUC 4JMYA 1RIWC 2QN5T 2F83A 1ZMJA 1W0ZU 2ALPA 4TPYA 1AD8H 2A4RA 4JZ1A 1C5RA 2AMQA 1F7ZA 1AFEH 1NO9H 3PMAB 2HOBA 3QWCH 3SQEE 1VGCB 5HGGA 1KLIH 1GI7B 1TPSA 4ZROA 1P2KA 3SV2H 2BZAA 4I8JA 2RG3A 1C5LH 5JYIA 3UQVA 2BDYA 4IN2A 1TBZH 4ZHLU 5T3HA 4FUIA 5E2OA 2A31A 2OUAA 3RC6A 1L0ZA 3BTFE 2B7DH 4FUEA 4H42U 1GBAA 1O2PA 1CGIE 3A89A 1V2VT 4A5TS 4Q7XA 2A7JA 1W3CA 2QXJA 3LC5A 1SQOA 3IG6B 2VINA 3PLPA 4NA8A 1EX3A 2FI4E 4HZHA 1CQQA 2H1UA 4X6NA 1P57B 3EA8A 3F9EA 5AHGH 3EGKH 5DP8A 3A80A 3UWIA 2RA0A 3AAUA 1ACBE 1T32A 2J95A 2TGAA 1DPOA 1FY3A 4KTUA 1DSUA 1ZJDA 1QRZA 4OS5A 1LVYA 1BHXF 4K1SA 1OPHB 1TIOA 1WUNH 1NT1A 3TK6A 4Y7AA 3DD2H 1YCPK 4ISIH 4MQAA 4AFZA 4E7NA 1CU1A 3PROA 1YGCH 2ZFPH 1BTYA 2A7CA 3M5NA 1MMJN 4Y79A 3OTJE 1O31A 3EYDA 1UTKA 4J2YB 4MPWA 3BTDE 1NRPH 1AMHA 4Y11E 1NRNH 2Q1JA 1F0SA 3K65B 3T28A 1UCYE 1O3LA 1UTLM 2P93A 1W7GH 1JRSA 1GBEA 3T29A 4Y8YA 2ALVA 1BB0B 5DO4H 1GHXH 4ZHAA 1DWEH 3U98H 1GMCG 1LO6A 5C67A 4ESTE 1K1JA 4JK6A 3S7HB 1FQ3A 2G5VA 1CGJE 3MTYA 5SGAE 1C1TA 1MZAA 5LH8A 1AE8H 2HRVA 4VGCC 1DLKB 2SFAA 3BTWE 2ZTYA 5GXPA 3F9FA 1ZTJA 2ZA5A 1V2UT 3M3VA 5L30H 5EODA 5EW1H 3VB4A 4MNYA 1KLJH 1GI5A 2AMDA 4U01A 1AO5A 4OGXA 1BOQA 4E05H 2BHGA 1GBKA 2EI7A 1DDJA 3TJUA 1XKBC 4DGJA 4LXBH 1TX7A 1TA2A 1PPEE 2GMTC 2J4IA 3SV8A 2Z3EA 1W7XH 2PKSC 1Y3VA 4THNH 1C5YB 5K0HA 2FOEA 3BG4C 1QB6A 1AU8A 1TYNA 3TGJE 2G51A 2J94A 2A4OA 3SNCA 2TRMA 1C5QA 3ATIA 4WVPE 5BRRE 1JRTA 3M5OA 3TK5A 1HJ8A 2O9QA 1G30B 1BITA 1E36B 1ARCA 4NSYA 5DP4A 3RC4A 3A83A 2GCHF 4ISLA 1EAUA 1TGBA 4B75A 1EZXC 1BBRK 3E6PH 2ZPQA 4FUFA 1FAKH 1YBWA 2TGPZ 3HKJB 3RXKA 2W26A 2Q6FA 5C1UA 1EPTC 5L2ZH 3SU4A 2P3TB 6ESTA 3QZRA 3VB5A 3PYHA 2P3FH 8GCHF 3L33A 3NCLA 4CHAB 3M35A 2NU3E 4KELA 1SGCA 5FX6A 1GJAB 4UFGH 1GHYH 1SGPE 3UUZA 2XXLA 3VFEA 1EXFA 4F49A 2A45B 4CRAA 3KQEA 2GTBA 1HRTH 2GT8A 4YM9A 4AFUA 2I6QA 4UFEH 1GBTA 3M5LA 4BNRA 5DGJA 2OXSA 1O30A 2OQ5A 2QYIA 3MI4A 3NK8A 4X6MA 4O03A 1C2IA 1BRAA 1YYY1 3VB6A 4NWLA 1ESBA 3LH1A 5E2PA 1B0EA 4YTAA 2VGCC 1XUJA 4X8TH 1O5BB 3RXGA 2ZCLP 2HPQH 3UOPA 1VCPA 1XM1A 1PYTC 2HGTH 3OX7U 1F5LA 1SGQE 1YP9A 4ZAEA 4A92A 2R9PA 1V2JT 1O5EH 2ZDAH 4DCDA 2IN2A 3RC5A 5FAHA 2FS8A 2V35A 9LPRA 2ZFTA 3RM2H 1U6QA 1O2MA 4OS7A 1ZSJA 2VU8E 4R8TB 1N6YA 1SOTA 3SJKA 3SGQE 4B2CA 1HJAC 3A81A 4H6TA 1H8IH 1LDTT 4AG1A 1E35B 1GMCF 2QXHA 1UK3A 1MKXK 1NN6A 2BYAX 2Z7FE 4BTUB 1GJCB 4NCYA 2F3CE 2B0FA 3P95A 4INKA 1AQ7A 1B5GH 1MQ6A 1Z8RA 2NWNA 1C9PA 2ULLA 4O3TA 2EA3A 4Z0KA 9ESTA 1GG6C 2FOMB 4DOQA 1WSSH 2PKAB 1BMMH 3SUFA 3IWMA 2ZG0H 1O2IA 2ZGBH 3BN9A 1ELVA 1HXEH 2BB4A 4O9VA 2ZTZA 2EI8A 7GCHG 3MH7A 1V2LT 3PMJA 1K22H 4NFEA 1GHVH 2BD5A 5ESTE 1ZZZA 1HYLA 1FY8E 1EJMA 1RD3B 2P94A 2VVVA 2BD7A 1XVMA 1MTVA 3TJVA 1C1OA 1AUTC 1SGFG 2CHAC 3P8NA 5F8TA 3RXEA 3PWBA 2BD4A 3CENA 1C5WB 2BLOA 1PJPA 4MPUA 1MKWH 3PTBA 3DUXH 5H4IB 1ETSH 1SGEE 1MAXA 2GCTB 1SR5C 3ZZAA 4FUJA 2ZFRH 1O32A 1J8AA 2HNTC 1LQDB 4B71A 1AVGH 1LTOA 7LPRA 1HNEE 3AW1A 1ABIH 1ZTKA 1EATA 1LQEA 5FPYA 3SU5A 1QBNA 1ELDE 1HGTH 2GZ7A 4ABIA 1ELTA 1G37A 1C1SA 2QY0B 2SGQE 2D8WA 2YNAA 1GDUA 1T8OA 2OC7A 1DT2A 3K6ZA 1HFDA 1ZMNA 3HATH 4D76A 4ZKRU 1ZGVA 3LIWA 2GGVB 3BTQE 2OC1A 2XWAA 4BAKB 3LT3A 1YPKH 4X1PU 1H9IE 1YKTA 1DY9A 1D3PB 2AH4X 3BV9B 1IQJA 2AIQA 2ZU5A 3PMBB 1BQYA 4IC6A 5CHAC 5C5NA 2HVXA 1SGRE 5J4QA 2AGEX 4CRCA 1OP8A 3FP8E 1OS8A 1MD7A 3LPRA 1MQ5A 1V2TT 1HB0B 4NWKA 2GDDA 2QA9E 4I8GA 3ATLA 1TE0A 1MTWA 2G4TA 2FYRA 1T4UH 2ZDVH 3RXOA 1UCYH 1EAXA 2M5TA 1DS2E 1GGDC 2FTMA 2R2MB 1GI6A 1UTQA 1ELBA 1UTJA 3E8LA 2PR3A 1C5OH 4K2YA 3ZZ6A 1SLUB 2ZWLH 4DT7B 4ZUHA 3GCTG 5ETXA 1XUHA 1CA0B 1O3CA 1ZHPA 8KME2 1MTNB 4U32A 3AASA 1UK4A 1AE5A 2PKAA 3FP6E 4BOHA 4INHA 2JETB 3AVZA 1HCGA 1TABE 3E1XB 1QURH 3SUGA 4WWYA 2GKVE 4WXVA 3UQOA 2UUKB 3VPKA 3UNQA 5A8XA 1QJ1B 1A2CH 1DWBH 5L2YH 3P70B 2BQWB 2VVCA 1GBCA 2TIOA 1KXDA 1GI4A 5FPTA 2SGEE 1SQTA 4X8UH 1P02A 3A7XA 3GYLB 2JH6D 3EQ0H 1UVUH 3SN8A 3ENSB 3MNCA 1GI3A 2XBVA 1IQNA 1QL8A 3HPTB 1DFPA 1S5SA 3BSQA 2FWWA 1KYNA 2D26C 3P8FA 2VIVA 1UTMA 1C9TA 1L4DA 5E0GA 2BY6X 1BTZA 1W0YH 4BAQB 4HTCH 4GAWA 1IQFA 1P8VC 3RU4D 1GBHA 1G2MA 2SNWA 3UPEA 1SPJA 1A5GH 7GCHF 3ZZ3A 5FCRA 1THSH 2PTNA 3A7TA 3SNEA 1EJAA 2FODA 3MYWA 4DIIH 1ZRBA 3LU9B 4CRBA 2BD2A 1EZQA 1AZ8A 1RXPA 1SOZA 2XCFA 1O3NA 6CHAB 1NS3A 1GHAG 1AVWA 3QGJA 1TRNA 1CT2E 1C5TA 3U8RH 1GCTB 5T6FA 2GX4A 3A8DA 1UVOA 3KIDU 3ODFA 4ISOA 4CR9A 2BQ7B 2A32A 1RRKA 2O8LA 2ZO3H 1C5MD 3RXFA 3ZZ4A 1TRMA 5AFYH 3BTKE 3SU3A 1CA8B 1KXEA 2JH0D 1H4WA 3CS7A 1D6WA 1ZPCA 3MU5A 2ZU3A 4Y8ZA 1O2KA 2WPLS 3RXUA 3MO6A 1YF4A 4NA7A 1K1NA 5EW2H 5J4SA 1T8MA 1LPZB 2C8XB 2O8TA 4ZXXH 1WAYB 1A5IA 2JH5D 4AYYB 1B7XB 1C5XB 1LCYA 1F0UA 1GBIA 3U8TH 4YOGA 3BTHE 3EA7A 4DURA 1ESTA 1FLEE 1KSNA 1V2RT 2OP9A 3GCHC 2FX4A 1ELFA 3TPIZ 1ZHMA 2LNCA 1FN8A 1WTGH 2UUYA 1N6XA 3BEIB 4SGAE 3A87A 3JZ1B 2VWMA 1O2TA 3IITA 3T27A 4IS5A 2Z3CA 1Y59T 3A8AA 1S6FA 1INCA 1BRUP 2R3YA 5JPMH 2QGRA 1Z7KA 3QDZB 3A82A 5C1YA 2K1QA 1O2ZA 1HAXB 2BD3A 3P8GA 1V2NT 1LHGH 2QXIA 1OWKA 3M5MA 1O38A 1OWJA 1MUEB 3P92A 1MCVA 2CN0H 5EQSA 3TITA 1BZXE 1EQ9A 2AGGX 2FOGA 4JZEH 2BQ6B 6LPRA 3STIA 1AHTH 1AWFH 4XE4A 2Q6GA 1XXDA 5PTPA 2OTVA 1YPEH 2V3OH 4JCNA 3NUMA 2ANMH 5GCHG 3RXVA 1CBWB 1QQ4A 3URDA 1TMUH 1O2QA 1CGHA 1KY9A 3RXQA 2BY9X 1MU6B 3I29A 1KTTB 4IN1A 2P8OB 5CMXH 5T6GA 1FJSA 4AN7A 1GJ9B 4KP0A 5JDUB 2JKHA 3PWCA 4FU8A 4FUBA 1BCUH 3KHVA 5EQQA 1YPLH 4TWYA 5A0BA 1VGCC 3A84A 3ZVEA 5JBCS 1NU9A 1NU7B 3MO3A 3SU2A 2Y6TA 3TJOA 3UR6A 3M37A 2ZKSA 2G8TA 1BMNH 1TMBH 4BAHB 1QR3E 4J1YA 5EQRA 3K2UA 1HAOH 1Y3YA 1JWTA 1ANDA 4D7GA 3U69H 2BTCE 4LK4A 1C1QA 1TLDA 2A2QH 4K3JA 3W94A 2FLRH 2ZPSA 4DY7B 2FZZA 2BLWA 1TGNA 4YT6H 4AZ2B 2Z9LA 1ZMLA 3KF2A 3M7UA 4YZUA 2PUXB 1AUJA 4PROA 2VH0A 2XC0A 1C5VA 1T31A 3EAJA 1VITG 3UR9A 1EUFA 1GHAF 4NZLA 1SB1H 1PPHE 1THRH 2CMYA 2KAIA 2GV7A 4K69A 1ETRH 1V2ST 2BD9A 1O3IA 4A6LA 1A7SA 3KN2A 1P2NA 1FONA 1DWDH 3SORA 2WYJA 1C2MA 2F9UA 4ZKNU 3BG8A 1A3EH 2V3HH 1KLTA 1QY6A 4MDSA 4OS2A 1BTHH 1SFIA 1HLTH 2BVSH 1O3KA 1P03A 1HJ9A 4AB8A 2Z9JA 1EB2A 1BUIA 2Y5FA 4RN6A 3FVFB 5C1XA 1PYTD 1CE5A 3S9BA 3SUEA 4I8KA 4CH8B 2D2DA 4NIYA 2PHBA 2HALA 1K28D 1EASA 3MH6A 1TBRH 3ZVGA 5HM2A 4ZMAH 1FUJA 1OXGA 4ABHA 1AFQB 2Z9GA 3OY5U 1YCPM 4Q2KA 1F5RA 2R0KA 5GIBA 3SJOA 1H1BA 2OQUA 3K6YA 2PSYA 2HNTF 2SGAA 3TGKE 3LONA 1SI5H 4D9RA 1DUAA 2WPJS 2ZTXA 3KCGH 1Z8GA 1HAZB 3MHWU 3ZVFA 1PFXC 2C8WB 2QAAA 2ZEBA 5AFZH 3UNRA 1ZSKA 3MU4A 2VNTA 1TQ0B 3SV6A 2C3SA 1C2HA 2TBSA 4Y6DA 1GI9B 4B2BA 1QQUA 3Q00A 3A88A 3BTGE 4X2XA 1HUTH 3ZVBA 3ZVDA 1GDNA 1S85A 2GMTB 1P9UA 1N8OC 3BIUH 4JZFH 4WMFA 4DIHH 1QGFA 1NM6A 1AN1E 1TPAE 2HWLB 2RCEA 1GVZA 5GCHF 1MH0A 5DKMA 3H5CB 1ANCA 1F2SE 1FIZA 2QIQA 4AGJA 3A86A 3TVJB 1GBDA 1QJ6B 2HNTE 4RSPA 1NRRH 1EP6A 1C1WH 3HGPA 3LGWA 2OLGA 1Y3XA 1RTKA 1J14A 4TYDA 4X6PA 4B2AA 1P2OA 1VJAU 1YM0A 1BMAA 1LVMA 4YO9A 1Q31A 3UY9A 4IGDA 1C1VH 1O2VA 1SMFE 5AF9H 1HAPH 2GT7A 1TX6A 4XBBA 1T8LA 1K2I1 2DE9A 1TX8A 4A1VA 2STAE 2P59A 2P3UB 1GL1A 2WPKS 3ZZ5A 3KQBA 1ARBA 3LJOA 3N7OA 3QK1A 4GUXA 2ANYA 4AGKA 1ZHRA 2ZQ2A 3GY5A 2SGDE 1P2IA 1GHWH 2XBWA 1KXBA 4D9QA 4OGYA 1D3TB 4XBCA 1BTXA 4CHAC 1HAHH 1TB6H 2GDEH 3RXMA 5K7RA 4D8NA 3FAOA 3H7TA 1KXCA 1QJ7B 3V0XA 1IQHA 4IBLH 3GCOA 3GY2A 1IHTH 3GCNA 1O2HA 2AMPA 4MVNA 1ELCA 2BDBA 3B23B 4OS6A 3RXTA 3U1JB 3P17H 1RGQA 2AS9A 4ABAA 2GP9B 3TJNA 3T5FH 4LOYH 2ZGJA 4TWWA 3URCA 1J15A 2G5NA 2ZI2H 2Y7ZA 3ZV8A 5TCAA 1GL0E 1GHZA 2B9LA 4GCHG 3NZIA 1G36A 5I46H 2FOHA 1CHOG 3BEFB 4MTBA 2Y81A 3MMGA 1ORFA 3QLPH 4I7YH 1NFXA 1AWHB 1VCWA 4B74A 1GBMA 3ATMA 3TH2H 1TAWA 2UUJB 1MKXH 2P95A 4X8SH 2BDHA 1PPBH 4CBNA 1O3AA 5JB9S 1TNGA