1GI5A

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
molecule tags Hydrolase
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi5A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi5A02
4CRCA 2WYJA 1FXYA 4BXWA 4SGAE 1KLTA 1O5CB 1HV7A 2BYAX 3A7XA 4X1NU 2Q6DA 4YLUA 3M3TA 1FQ3A 2ZC9H 2VIVA 3M5NA 1YCPM 2A1DB 3UR6A 4OS2A 4FU9A 1C5YB 5GPIB 3RU4E 1YPLH 5FCRA 3U69H 1NO9H 1O32A 1P10A 4MPWA 5FPTA 2ZGJA 2H9EH 5JB9S 1P3CA 4AG2A 5ESBA 2WPKS 1EX3A 1O5FH 4IMQA 4JZ1A 3ZZ8A 1JBUH 1DANH 2ZQ1A 3KF2A 3RMOH 2SNVA 1DE7H 2OLGA 2CF8H 3T5FH 1GJCB 2WPHS 1NRPH 2Z9GA 6LPRA 3SJIA 2ZCLP 1C2JA 4H4FA 1UVPA 1GDNA 2F9PA 1QB6A 1BBRE 1AQ7A 4Q2KA 1LKBA 1P02A 1P2MA 2SGPE 5DG6A 4ZHMU 2XCNA 2BXUH 2PGQB 2Y7ZA 2D2DA 3A82A 1GBIA 3C1KA 2EA3A 1JOUB 3A7WA 1ACBE 3VB6A 4OS1A 4KGAA 2BY9X 3SU4A 2F9OA 1O3BA 1TBZH 1UTPA 4AGJA 1LKAA 1LHDH 3MNSA 1GL0E 1GHXH 1GI2A 4D9QA 1EAUA 1MKWH 1DLEA 2B7DH 1CHOF 2Q1JA 4GPGA 2FM2A 1FV9A 3QDZB 3SHCH 1FAKH 1O3OA 3VB7A 2STAE 3P8GA 1UTQA 1BITA 1EB1H 3E90B 2QXIA 3SV8A 3FP8E 1MD7A 2V3HH 1ZZZA 1K22H 2VH0A 1W11U 2C8WB 2D8WA 2OP9A 3A88A 1O3IA 1H9LB 5C1XA 1GDUA 1ABJH 4I31A 2CF9H 5E0HA 2A4RA 3AASA 2A0QB 3RM2H 2BLVA 1X7AC 1SOZA 1Z8JB 3TNSA 1GHZA 4DY7B 3LPRA 2ZGBH 2ANWA 2VIWA 3V3MA 3S7KB 5AFZH 1HIAA 1TMTH 1FY4A 2BVXH 5HYOA 2FOAA 2BZAA 1FNIA 1GJBB 1DOJA 4NZLA 4ZMAH 1T31A 1SQTA 2GKVE 2CMYA 2QN5T 4YM9A 2RA0A 3U1IB 4O97A 3ZV9A 1AUJA 9ESTA 4B76A 3PMHB 9LPRA 1AD8H 1N6XA 3EDXB 1J14A 2Z94A 1PJPA 1MTWA 1IQHA 3OY6U 1BTWA 3ZZ3A 1SMFE 2UUFB 4XOJA 1GI5A 5SGAE 3OU0A 1ZTJA 2P3TB 4H6TA 5JDUB 4Q7YA 2P8OC 2QF3A 3SW2B 3LGWA 1G30B 1GBBA 1JIRA 1HIAB 1JIMA 1SGIB 2BD5A 3K6YA 5LPEA 3PMBB 1UHBA 3TVJB 2FOEA 1ELGA 1CT2E 1DWDH 2J38A 5FPYA 2HVXA 4MVNA 4B2CA 1S0QA 3QTOH 1KYNA 4DJZB 4AFZA 3TGKE 2PSYA 3U98H 4Y6DA 1UJ1A 1WQVH 4ZKNU 3T29A 1LPGB 1Z1JA 2P59A 1KDQA 2UUKB 1EPTA 3AW1A 1GBCA 3SU5A 3SJOA 8ESTE 1QIXB 2Y5HA 3B23B 5CHAB 1BJVA 1O34A 1BHXF 4I8LA 1DSTA 2BDYA 2ANMH 3RC5A 5J4SA 1SHHB 1SB1H 4DURA 3S9CA 3M7UA 1A7SA 3UY9A 1UHBB 1ZGIA 1DITH 2W7SA 3LIWA 1O2YA 3M5OA 1TABE 1CT0E 3M5MA 1KXFA 5DP9A 4YOJA 2WYGA 1A0JA 2C8YB 1P05A 4FUIA 2VB0A 1E0FD 2P94A 1O3LA 2GD4B 5DJ7A 1HJ8A 4BANB 1OX1A 3S0NA 2CGAA 1B5GH 1DVAH 2BMGB 1C5XB 2HPQH 1TNLA 1JXPA 4GHQA 4OS4A 1EPTB 2WINI 2G5NA 1GBEA 4TPYA 1C2KA 1FUJA 5E8EH 4HZHA 1XVOA 3PMAB 2OTVA 2ILNA 2ZCKP 3AAUA 1XUIA 4A5TS 2HNTF 1RRKA 2AEIH 1UCYH 2FDAA 1GI4A 3MH4A 1AB9C 1EZXC 3ZZ6A 2ZKSA 2AMDA 3AAVA 4NA7A 4VGCB 3JZ1B 1VCPA 1WU1A 1GJDB 2GZ8A 3K65B 1SLVB 2SGDE 3KQCA 3SU1A 1K1OA 4X1SU 1BTZA 1QBVH 4ISLA 5EXLA 1FIZA 1DT2A 4AGKA 3ATLA 2F9UA 1UVSH 1XUJA 2ZECA 4AN7A 1ETSH 5EW2H 1UTOA 4AYVB 2ZFPH 3MH5A 1FAXA 3GCNA 1AWFH 4ISOA 1O3HA 1HCGA 2BOHB 2PLXA 3RXMA 5B6OA 7KMEH 2BTCE 3QLPH 1AVXA 4NA8A 3O8RA 2Q6FA 1BRUP 4GVUA 1Z8IB 3SNCA 1OPHB 3ZV8A 3ATKA 3DFJA 1GI3A 1LQDB 2B0FA 2A7CA 1VZQH 2V6NA 1HAXB 1EJNA 1TE0A 1EOJA 1BBRK 3UWIA 1QRZA 1O5DH 3ATMA 4FUDA 3EGKH 1A2CH 2UUYA 3GOVB 1V2LT 2XW9A 2FOBA 2FTLE 3GY2A 1ARCA 1TMUH 1SVPA 3H7OA 2G00A 1G2LA 1C4Y2 3ZZAA 1GJ9B 2LNCA 1V2OT 3SU2A 3ELAH 2A5AA 1TGCA 5HXFA 1PPHE 4CBNA 1WBGB 2H2ZA 3RUOA 5EODA 2P95A 1FY1A 1KXEA 4X0WU 1GBKA 7GCHF 3A7ZA 2WV4A 1EPTC 1O2KA 3HATH 2PWXA 1IQGA 1IQIA 3DHKH 4JZDH 3ZVGA 1A4WH 1C2HA 1GBTA 3OSYA 1FPCH 4K5ZA 3I78A 1Z6JH 4AZ2B 1EATA 2C93B 1F5LA 5LGOA 2TGDA 1AWHB 4Y7BA 3GCHB 1MCTA 3UREA 1LHGH 4Y11E 1EJAA 1GHBG 2FYQA 2J34A 3Q3XA 2BHGA 1ETTH 2PHBA 1ZSLA 4YESB 1OKXA 3U8TH 1QFKH 5JBAS 1K1IA 1ZHRA 4VGCC 1TQ7B 5E2OA 1C1TA 1LHFH 1G3DA 1O3NA 1YBWA 2H6MA 3ODFA 2QGRA 1ZTLA 1OP2A 1O3JA 1WQSA 1W14U 3F9HA 3M3SA 1F5RA 1O5EH 3F9GA 4WWYA 1T4VH 1HPGA 1IAUA 2P16A 1LDTT 4I32A 1C5PA 1P12E 2FPZA 1O3KA 1YM0A 2ULLA 2ZDAH 3A80A 1HAZB 1K1PA 3PLBA 4XFQA 3GY3A 3A8CA 3UR9A 3W94A 1YPHC 1Y59T 3RXOA 3TK6A 4BAHB 1HFDA 1BA8B 2VWLA 2R0KA 2G81E 1CSOE 5DP8A 2DUCA 3E0PB 3EE0B 1JWTA 1GJ7B 4YTAA 3W95A 2A45B 2H5CA 1V2PT 4CRFA 2HOBA 5L30H 4Y10E 1KSNA 4MPUA 4Y71A 1W8BH 4Q7XA 3PTBA 1KY9A 2XWAA 1VJ9U 3GCTG 3UPEA 1D3QB 1YPHE 3F9EA 1O39A 2G4UA 3ATIA 1KIGH 1TONA 1NROH 1H9HE 3P6ZB 2VIQA 1UO6A 1TGBA 4BNRA 1HAIH 1V2JT 3AVZA 5A0BA 1D3DB 2GMTB 1DY8A 1QJ1B 1BRBE 1SGFG 2FLRH 1YPKH 1HJAB 2V35A 2W3KA 6GCHG 3QN7A 1TPSA 1XUFA 1C9PA 1O2LA 2QXHA 3MU1A 5T6FA 3SV9A 5FBEA 1PYTD 3R3GB 2ZDNA 4MG3A 4K2YA 2PUQH 1A5HA 1D4PB 1V2ST 2ZA5A 5L6NH 1TALA 1OWJA 1P11E 1Y3WA 5DP3A 2BZ6H 3GY4A 4B71A 4THNH 1IQNA 3TK5A 1V6DA 1D6WA 2C4FH 1OWKA 2SNWA 3E1XB 3GCHC 4OS6A 2PTCE 1O2HA 3PWCA 1SFIA 4JK6A 4UE7H 4R8TB 2VIDA 4K8YA 3A7TA 4E7NA 3KQEA 4GLYA 1EAWA 3RXCA 1ZR0A 3BV9B 5FX5A 3TJNA 1SQOA 3GY5A 2NU0E 4MQAA 2FIRH 5L2YH 5HM2A 3ZYEA 4JZIA 1EKBB 1OWDA 4UDWH 1O37A 1DICA 1P9SA 1YF4A 3O8BA 1C5TA 4FUGA 2ASUB 3PYHA 1IHSH 1P0SH 3EQ0H 1AIXH 1C2MA 4DIIH 1L0ZA 1HXEH 1GDQA 1S81A 2J95A 2BVSH 1EZUC 4PROA 1ELBA 3SQEE 2H5DA 1PPGE 2BQ6B 2V0BA 5F8TA 2A2QH 3RXLA 4GSOA 5FBIA 3O8CA 3GICB 1IQMA 2OCVB 3T2NA 1GI1A 1PPCE 1IHTH 1ELFA 1F92A 2A31A 2ZFQH 1NFUA 3KCGH 4LXBH 1Q2WA 3MO9A 2QF0A 2FXRA 4A7IB 4JYVH 1UK2A 4JMYA 4YO9A 4AG1A 3EAJA 2VIPA 1BRCE 4K1SA 1ARBA 2ZFRH 2ZDVH 5J4QA 4K69A 3SU6A 1S6HA 2GT7A 1T8NA 3A86A 1SLXB 4XE4A 1W7GH 4O03A 1W0ZU 2GMTC 1LVYA 1GHAG 2ZF0H 3MH6A 1HJAC 4HGCA 4CR9A 5BPEA 1IQKA 1SGDE 1CGIE 1NT1A 5HMAA 4ZKSU 2JH0D 3URDA 4AB8A 3RMLH 3SV7A 1O38A 2Z3EA 5EQQA 5A0CA 1Y3YA 3TJVA 1S0RA 4JCNA 1C9TA 1OYTH 2FI3E 1QY6A 1O2OA 5DP6A 1QJ6B 2G8TA 5ETXA 3A87A 4Q7ZA 5JBCS 2GVFA 4NSVA 4WY3A 4BTTB 1K28D 2XNIA 3D49H 2Q6GA 5GXPA 2PW8H 1OP8A 1AE5A 1LTOA 1O2JA 3E3TA 1TNIA 3SUEA 4XSKU 1LQEA 1LVBA 1AKSA 4FUFA 1HAOH 2G55A 3NXPA 1C4U2 3K2UA 3Q3KA 1AFQB 1C5MD 2O8TA 2ZDLA 1NFXA 5E0GA 6CHAB 1PYTC 2ZFFH 2J92A 2NU2E 1P03A 1O5BB 1RXPA 1YPGH 1YC0A 3TH4H 1MAYA 3QZQA 1O2SA 4I33A 3S7HB 3ZZDA 2HWLB 2AGGX 5F03A 1BT7A 2P8OB 2J2UA 1MKXH 1YLDA 4UONA 4MLFB 1E34B 4JYUH 1TA2A 4D7GA 3T27A 4KELA 3RM0H 1BUIA 1HXFH 2TBSA 1PQ5A 2QAAA 4KP0A 2EI6A 3QGNB 4DOQA 1FDPA 1O2UA 2AH4X 2GGVB 1DPOA 4NIWA 4GCHG 2B9LA 2ZDMA 1TFXA 1ZPCA 1OOKB 3MOCA 4FUEA 2BDGA 1G36A 1SFQB 1AKSB 1EUFA 3UTUH 1GPZA 1ANCA 1UK3A 1ZPBA 1C2EA 1Q31A 1LCYA 1RTFB 4X2WA 5T6DA 4FVBA 3ESTA 4J2YB 1QQ4A 4B73A 5GWZA 1AFEH 1Z7KA 3QGJA 3TPIZ 4NZQA 4RN6A 4GUXA 3SHAH 2BM2A 3BG4B 2OQ5A 2WPMS 1DFPA 5DK1A 4IS5A 4Y0YE 2DE9A 5C3NA 1BB0B 1ZTKA 1DSUA 1O2GH 3GYMA 1O31A 1IQLA 5AF9H 2IPHA 1C4V2 3GYLB 5C20A 3ZYDA 1O2IA 3MHWU 1UCYK 1T8OA 2AS9A 2VGCB 1VGCB 1C5ZB 2GX4A 3FAOA 1EZQA 2Y5GA 3HK3B 2BLQA 3NUMA 2ALPA 2G5VA 2VH6A 2VWMA 1K1MA 5ABWA 2WPJS 3A7YA 2TIOA 2PUXB 5DGJA 2XC4A 1SR5C 3VXFH 1KLJH 1NFYA 1Q3XA 1BMMH 3RXJA 4MNVA 4BXSA 1AFQC 5JBTA 5DP7A 1RS0A 6CHAC 1H8IH 3HKJB 2BY7X 2Y81A 3LONA 4X8VH 4FXGH 4IN1A 4M7GA 1S84A 5LPFA 3F68H 2AMQA 3MO6A 3DD2H 5T3HA 1A5IA 1QRXA 1EAIA 1GHBF 2XBYA 4ZKOU 2XC5A 1AB9B 3BTTE 5EGMA 2AIQA 3A8DA 3RXTA 1Y5AT 2OC1A 1ZSJA 1V2NT 2CJIA 2PKSB 1C1MA 3SGAE 1MBMA 4WMFA 4O3TA 4XBDA 5EPNA 3H7TA 1F5KU 4ABIA 3CP7A 2UUJB 5DP4A 2H9TH 1YPEH 4CBOA 1YCPH 1CA0B 1K2I1 4CRDA 3V13A 3FP7E 1L1JA 2VVUA 1WSSH 1ELCA 2B8OH 1QL8A 3BTDE 4OS5A 5FAHA 1YPJH 1V3XA 1O2WA 1VCQA 1L2EA 2FYRA 1QA0A 5FPSA 2WUBA 3BG4C 1WTHD 1QQUA 1W2KH 1A3EH 3NWUA 3VGCB 2ZHQH 4Y0ZE 1OWHA 3M35A 4WJG2 3RMNH 4ISHH 3GDSA 1TGNA 2LPRA 4NG9H 2FOFA 4TY7A 1F2SE 1C1SA 1S5SA 1P2JA 1QNJA 1WV7H 5F8ZA 1GBHA 4IC5A 1GBAA 1AZZA 2UWPA 4NIXA 2VGCC 1VGCC 3GCTF 1ABIH 2THFB 1MU8B 3KNXA 3TIUA 4H6SB 2HNTC 1GG6B 1BMLA 3DA9B 1F0TA 1TNKA 4TPIZ 3QTVH 1NS3A 4ABDA 1KDQB 2GV6A 5C1YA 6GCHF 3SGQE 5DPAA 5C5NA 3LH3A 1AGJA 3OTJE 1DLKB 1NU9A 1NU7B 5EPYA 1FPHH 3K9XB 3DT0H 5EQRA 1AMHA 1GMHG 2F3CE 4A1TA 5A8ZA 2PGBB 4I8HA 1CQQA 2UWOA 2Z3CA 3P92A 2HNTE 3LC5A 3ENSB 3RXIA 1C1NA 3T25A 3LH1A 1FY8E 4SGBE 4CRGA 1KXBA 1MQ6A 2G52A 1GCDA 1GBLA 1OXGA 4INLA 5A8YA 1ETRH 2GDEH 4ZHLU 1LO6A 1L4DA 4XBCA 4JYTA 3SZNA 2G4TA 4I8KA 1AZ8A 2PKSC 1QURH 1SL3A 2NU4E 4FU8A 2J9NA 3L6PA 3P95A 5A8XA 3MFJA 3RXRA 1ZSKA 4ZH8A 4I8GA 3RC4A 1NN6A 3MH7A 1CT4E 2ZWLH 3HPTB 2WUCA 4NA9H 3OYPA 1CA0C 4X8SH 1F0RA 2VNTA 2IOTA 4AORA 4UFFH 1C1RA 2FP7B 1C2DA 4INHA 4ISIH 1HJ9A 1ZHPA 1FY3A 1E37B 1O2QA 4H42U 1MZDA 2HGTH 3ZVCA 1ELVA 1TAWA 3UNQA 1L1NA 3LC3A 3GDVA 3VGCC 1UTKA 1KTTB 1P06A 3RXGA 1MTUA 4DT7B 5LPRA 2BVRH 2ZQ2A 3TGJE 1Y8TA 5GCHG 2OUAA 1M9UA 4FU7A 3L33A 1NZQH 1O3PB 1TPAE 3MTYA 1SSXA 4ABBA 4AFSA 4K1EA 1D6RA 2ZU4A 5LH8A 1BQYA 4B1TA 3BTHE 1C5LH 1EASA 1W0YH 1VITG 2ZHFH 4B2AA 8KME2 2BQWB 4HFPB 1GG6C 3URCA 3BG8A 1PPFE 1XVMA 2OBQA 1W10U 1WCZA 2DE8A 1GHAF 1N1LA 5I46H 1TIOA 2GDDA 2BY5X 4HI3A 1C5OH 1Y5UT 3M5LA 1GMCG 1EQ9A 1J16A 4CREA 1GMDG 2AFQB 1ESTA 2Z9KA 5IDKA 1AVGH 1TOMH 4IW4E 1K1JA 1ANEA 1P57B 2OC7A 2WPLS 3BTME 1UTJA 5C5OA 2C3SA 4A6LA 1Z8RA 3UFAA 2ZHDA 3VXEH 5DKMA 1KXAA 1LPKB 1IQEA 4A92A 3U8RH 1GWAA 1GBDA 2A5IA 5TCAA 7LPRA 2BD3A 1DM4B 5FHTA 4I8JA 1ZMJA 3MNCA 3MO3A 2ZTZA 4MDSA 2A4GA 4HTCH 1DWBH 2BB4A 1O33A 3RXEA 1OYQA 1QCPA 3KL6A 1JRSA 1ID5H 2A4OA 2ZU5A 3MMGA 3SNEA 3RXHA 3ZVEA 1QB1A 2OINA 1S83A 2VVVA 3N7OA 3QZRA 1A0HB 1LHEH 5EG4A 3UQOA 2R3UA 3WY8A 3E16B 1A5GH 4A1VA 1N6YA 2W5EA 1MTVA 2VU8E 3UIRA 3F9FA 1O3AA 1SC8U 2NU3E 2GV7A 5A0AE 2Y7XA 2FOGA 3EA9A 1UCYE 2A7JA 3RXAA 1UTMA 1SGYE 3V0XA 4DG4A 1CHGA 1PPBH 1SGNE 2OC0A 1RD3B 4ABHA 3BTQE 3SN8A 4ABEA 2FOCA 1BMAA 2ZFSA 2ZTYA 2R0LA 4GCHF 3ZZ4A 1O2TA 3SV2H 4X8TH 4INKA 1HLTH 3PLPA 4ZROA 3SUDA 2BLOA 3RU4D 1QJ7B 1TRNA 1TNHA 1UVUH 1LHCH 1TLDA 3S9AA 2FEQH 3MWIU 2PR3A 2XXLA 1XKBC 1J9CH 3UNSA 3GY7A 4FUJA 1C1VH 1P2OA 2A2XH 2C8ZB 1O2XA 2FS8A 4AX9H 3RU4T 1ZOMA 1FMGA 2GCHG 2XCFA 2OBOA 3EYDA 3LGUA 4A1XA 2NWNA 2VJ1A 1O5GH 2ZU1A 3MU4A 1H8DH 2YNAA 4YOGA 2HLCA 1ZJKA 1GCTB 1FN8A 2ZPSA 4X2YA 5EU8A 1O3DA 2BLWA 1C1UH 3DFLA 1W3CA 3MI4A 3FVFB 3SU3A 1THPB 4ZHAA 2HALA 4B75A 4LOYH 3LJJA 3Q00A 1BBRH 2ANKH 5TJXA 2I6SA 4X6PA 1EOLA 1GVZA 2STBE 1NESE 5AFYH 3D62A 4WH6A 1XUKA 1BOQA 1H1BA 1MKWK 2R2MB 1Y5BT 3SNAA 8GCHG 1CO7E 2CXVA 1OWIA 3B8JA 2BD9A 1O3GA 1D3TB 2CHAB 2R3YA 3EA7A 4DVAU 3E8LA 2OQUA 1YLCA 1BMNH 7ESTE 1MBQA 4B74A 3LKWA 1Y3VA 2J94A 1O35A 1ZPZA 3RXUA 5C2ZA 1XKAC 1TX7A 2IJOB 3MNBA 3RXKA 1NRRH 1O2VA 1P8VC 4X1PU 1DUAA 4R0IA 1MTNB 1ESAA 2VVCA 1P2QA 3QX5H 3U8OH 5JPMH 5JYIA 3SQHE 1VITH 2RG3A 3UOPA 2Z7FE 3Q3YA 4AB9A 1C5WB 1CGHA 2R9PA 1FY5A 1SHYA 2OD3B 1MMJN 4F49A 4X2VA 5A2MH 1GGDB 5H4IB 1UVOA 3SO3A 4CRAA 4AFUA 2PSXA 4E7RG 1RIWB 2Y5FA 5K7RA 1Z6EA 1MTSA 4AFQA 4ASHA 4JZEH 1GHWH 3HGPA 5EXMA 2Y82A 3RLYH 2BD8A 3TNTA 1C5RA 2QYIA 3RXVA 3ZZ9A 3V7TA 1V2WT 2AGIX 1SGTA 3BTFE 3I29A 4U30A 3RXSA 4OS7A 3KIDU 2FO9A 3ZZBA 4DCDA 1HYLA 1V2QT 1CVWH 1RJXB 1F0SA 1G32B 1MD8A 4K60A 1K9OE 3BIVH 2ZDKA 3CENA 2WPIS 1P04A 1QL7A 1WTGH 1GCTC 3Q77A 3A7VA 1SG8B 1E36B 1B0FA 1GI9B 1GI0A 4WMDA 4XBBA 3NK8A 3FFGA 1DWEH 3LGTA 2SGEE 1G3CA 4IN2A 2SGFE 4BAMB 1HUTH 1MH0A 4Q80A 4ZKRU 4X6OA 3V12A 2B5TB 1QL9A 1CA8B 3TU7H 2BX4A 1C5NH 2A5KA 1TMBH 2FI4E 1YCPK 2Z9LA 1ELEE 3FZZA 1QRWA 1BTYA 1GMHF 1KLIH 1NFWA 4K3JA 2CHAC 2ZFTA 3BTGE 3HGNA 2ZGXH 1BJUA 3RDZA 2BY6X 2FOMB 3MU0A 1SGFA 1T8LA 1C5QA 4ZXXH 1MTNC 1BTUA 2F9BH 2EEKA 1SGEE 1XM1A 1BHXB 2W26A 3M7QA 2ZP0H 3UWJH 1A0LA 4TWYA 3ATWA 1N8OB 2AMPA 1DXPA 3KHVA 2ZTXA 1GGDC 4YLQH 5L2ZH 1DUEA 1RIWC 2XBWA 3PTNA 1DY9A 2JH5D 3GCOA 1G3BA 3A8BA 3A81A 3PWBA 1O2MA 1SI5H 4YZUA 1HAVA 5EOKA 1TPPA 2ZU2A 1AY6H 1J15A 4QT8C 4NIVA 1UVTH 3P8NA 2A32A 3SUFA 1QA7A 5GCHF 2CN0H 5C1UA 1O5AB 5F6MA 2PV9B 2TGPZ 1NTPA 1L4ZA 2HPPH 3RLWH 2W7UA 2QA9E 1O2RA 1TX8A 3M61U 1K1NA 2ODYB 3JZ2B 2H9HA 1TBQH 1Y3XA 2QY0B 3KEEA 1YGCH 1VITF 4DGJA 3ZVFA 1V2VT 3FZDA 4OGXA 1YKTA 3GY8A 3ZVDA 2BD7A 1O2ZA 5T6GA 1C1QA 3LDXH 2GZ9A 4UFDH 4WXVA 3NPSA 1HAVB 4UFGH 4NWLA 4Z0KA 1TGTA 1O36A 1GMCF 2FX4A 1NY22 1S6FA 2KAIA 1HNEE 1GMDF 1ZRBA 2EC9H 4MPXA 2RA3A 1BDAA 1GI6A 1GL1A 1HB0B 2Y6TA 1QGFA 1A61H 1C2IA 3R0FA 1O3MA 1GBJA 4GAWA 1MUEB 2ANYA 1C5SA 1PQAA 1NRQH 1P2NA 1RTKA 3ITIA 1QBOA 2ALVA 1ELTA 3PMJA 4ESTE 1KTSB 3E0NB 2PFEA 2BXTH 2ZCHP 4UEHH 1LPZB 3M36A 5FX6A 3U9AH 3VFEA 3TK9A 1XX9A 2XYAA 2J4IA 3SJ8A 2ZNKH 5FCKA 3PV4A 2TGAA 1UMAH 1A46H 1UTNA 2Z6BD 3F6UH 5FXLA 4X6NA 3EA8A 3SOSA 1GVKB 1ZHMA 2RDLA 1W12U 2SFAA 3LJOA 1N8OC 2W3IA 1B7XB 1NRNH 1KXDA 4CH8B 3HK6B 1G2MA 1C2LA 2ZI2H 3B9FH 4NWKA 5PTPA 2KAIB 1XMNB 1XUHA 3KQDA 1EP6A 1HAGE 2HRVA 3SORA 1O0DH 4BAKB 3TH2H 1MU6B 2QXGA 3VPKA 3TJOA 1G3EA 1T32A 2GCTB 2M5TA 3PM3A 3SNBA 4BAOB 1TGSZ 1OS8A 5A09A 2R2WU 1CU1A 3E91A 4X1RU 3T62A 4TWWA 3SJKA 3LT3A 1ZMNA 1P2IA 1BZXE 3NZIA 3P70B 4NFEA 1AHTH 3IWMA 2A7HA 3BEIB 3BEFB 1O3CA 3F1SB 5TCCA 3STJA 1SLUB 2JETB 4NCYA 4CH2B 3Q76A 3UQVA 3BTWE 3LGYA 1T8MA 1W7XH 3ZZ7A 1AUTC 1FLEE 3VB3A 1S82A 2P3UB 4CR5A 1C1OA 2FODA 3BTKE 4LZ4B 1PPEE 1EP5A 4XDEA 2GP9B 2ZHWH 2GCHF 1OWEA 3LGVA 1THSH 1V2UT 2FWWA 3K6ZA 3UUZA 3S69A 4AOQA 2TPIZ 3TITA 3E6PH 3A85A 1QR3E 2FMJA 4TY6A 1TPOA 2FS9A 1EB2A 1HBTH 3SNDA 1YPMH 1A3BH 1V2RT 3TJUA 3VB4A 4E05H 2PTNA 1P09A 1Z8GA 2F9VA 4UFEH 3RXQA 4MNXA 1V2TT 4WXIA 2QXJA 1C1PA 2BDBA 4AYYB 4D8NA 1O2PA 4K8BA 4RSPA 3KGPA 2FZZA 3TLOA 1ESBA 1TB6H 4MNWA 1UK4A 4D76A 1O3EA 5HGGA 3TGIE 3QK1A 1AO5A 2QIQA 8GCHF 4FUHA 3PB1E 1LVOA 4X8UH 1BRAA 4JK5A 3IG6B 2GT8A 2WV5A 3M37A 4IMZA 5GDSH 2FI5E 2YNBA 2TRMA 1AVWA 3BIUH 3RXFA 3BEUA 4B2BA 5I25A 2UWLA 2FOHA 1AI8H 4U01A 3LOXA 4D7FA 1CHOG 2G51A 2GCTC 3PO1B 2BDCA 2ESTE 3STIA 5JB8S 1SGPE 1DS2E 1PQ8A 3RXPA 2ZGHA 1V2MT 3O8DA 3ZZ5A 1DX5M 2ZIQH 1J17T 2QC2A 4K1TA 3BSQA 3MYWA 1OP0A 4X1QU 5CHAC 5E2PA 1DDJA 3M3VA 3GY6A 1SGQE 2JETC 1PFXC 3BF6H 2P3FH 1ELDE 2BX3A 2ZHEH 1DXWA 2F91A 5F8XA 5JBBS 5CE1A 3KQBA 4YT6H 1A1RA 3SI4H 1WOFA 1BTXA 2ZG0H 1L1GA 1GJ4H 2ZPQA 4DW2U 1INCA 1QHRB 1PPZA 2BD2A 1HDTH 2FTMA 3RP2A 4IC6A 2F9NA 2BDIA 2XC0A 3SUGA 4BTIB 4I7YH 4NGAH 3VEQB 1P9UA 2ZZUH 1H4WA 1CBWB 3RXDA 2VWNA 1H9IE 1HAHH 2BQ7B 3MU5A 1GHVH 2PKAA 3FP6E 3ODDA 2QV1A 4LK4A 5G4BA 2JKHA 1JRTA 1TQ0B 3I77A 3L3TA 1O30A 4F4OC 1PQ7A 1ZJDA 4YT7H 5GIBA 1GJ5H 5EXNA 1T4UH 4ABAA 2SGQE 3P8FA 4U32A 1VCWA 2C8XB 4Y8ZA 3RMMH 5DP5A 4ABGA 1YYY1 2VIOA 2XRCA 3UOUA 5ESTE 1NC6A 5DO4H 3OX7U 2Z9IA 1C2FA 3GISB 2D26C 3SV6A 1GJ6A 3A89A 4YOIA 4ZUHA 1BCUH 1TRMA 1TNGA 2GZ7A 3HKIB 2SGAA 3SU0A 2IN2A 1CGJE 2AGEX 4MNYA 3SBKA 1HAYB 1GHYH 2ODQA 4ISNA 4MTBA 1C5VA 3LU9B 2V3OH 4MPVA 2PKAB 4RKJB 3BN9A 4X2XA 1AN1E 4Y79A 1C2GA 4KTSA 2O8MA 3PO1C 2Z9JA 2JH6D 1HGTH 2BDHA 2ZGCA 5AHGH 3LGIA 3ZZCA 4FUBA 1NRSH 1GBFA 5AVDA 3ZVAA 1P3EA 1ELAA 3D65E 4ABFA 1YP9A 4LZ1H 3DUXH 2VINA 1QB9A 2OXSA 1U6QA 2ZEBA 3A8AA 4KTUA 3QUMP 3MU8A 1IOEA 1HAPH 1OSSA 4ZAEA 4Y8XA 3IITA 2AERH 2P93A 1MCVA 5EW1H 2XBXA 4FUCA 1Y3UA 3D23A 1FZZA 4TYDA 1NPMA 1JMOH 1QBNA 1WAYB 4WF8A 1XXDA 1BIOA 1IQFA 1ZYOA 1LVMA 3SGBE 2Y80A 1W13U 1TA6A 1V2KT 1O2NA 2O8UA 4GHTA 4CHAB 1XUGA 4UD9H 4CRBA 4WH8A 1UTLM 3A84A 1EJMA 1FI8A 1C5UA 1GI7B 1TRYA 4RKOB 1ZRKA 1BTHH 1CBWC 1MKXK 4NSYA 2AIPA 4Y7AA 1GJAB 1HRTH 1Z71A 4U2WA 3CS0A 4BOHA 3SJ9A 2NU1E 4ABJA 5HM9A 2EI8A 5E0JA 4DIHH 3BTEE 1TBRH 1MAXA 3AW0A 3GDUA 4WVPE 1EXFA 1E35B 4J1YA 1D3PB 4D9RA 4O3UA 2H1UA 1ZGVA 5BRRE 1K21H 2FLBH 1FN6A 1SGCA 1TNJA 4NIYA 1ZLRA 3ZVBA 3C27B 1ANDA 2XTTB 1NM6A 4Y8YA 3QO6A 1DWCH 3S9BA 1SLWB 3UNRA 1WUNH 1GI8B 3NCLA 2AYWA 8LPRA 1ZMLA 1Z1IA 2A4QA 1B0EA 1J8AA 2BD4A 3VB5A 1C1WH 5EQSA 3P17H 4BTUB 1P2KA 2BOKA 5GJ4B 4X6MA 4BAQB 1SPJA 1GVLA 4ZXYH 6ESTA 4Y76A 4FVDA 3P8OA 1RGQA 4KKDA 2ODPA 2ZPRA 3PROA 2O9QA 1AE8H 1SOTA 3T26A 3MNXA 3PLKA 1ORFA 3G01A 4OGYA 1TYNA 1VR1H 1FONA 1FIWA 2BY8X 1F7ZA 4KTCA 2XBVA 1EZSC 1SBWA 5C67A 5CMXH 4NFFA 2C90B 3KN2A 2I6QA 2OC8A 1RTLA 4O9VA 1S85A 2ZU3A 2XWBI 1WYKA 2FX6A 1E38B 2EI7A 2F83A 2RCEA 2K1QA 4IGDA 3T28A 1VJAU 4E06H 4WMEA 1TX6A 2D1JA 1SQAA 2VWOA 2FESH 1TWXB 1T7CA 1FJSA 5K0HA 1GJ8B 2GTBA 2QCYA 1SGRE 3RC6A 1P01A 1G9IE 1BTPA 1F0UA 1CE5A 1RFNA 1LMWB 2Z3DA 3A83A 4IBLH 4CHAC 2TGTA 1MQ5A 4JZFH 1AU8A 1D9IA 3OY5U 3RXBA 5IYTA 1KXCA 4Z6AH 1IQJA 3M7TA 7GCHG 1GBMA 1K1LA 3FANA 3NKKA 3CS7A 2YOLA 1G37A 1EAXA 3TH3H 3SI3H 1XXFA 2O8LA 3QWCH 1ANBA 1QTFA 1O3FA 2ZO3H 1TOCB 2O8WA 2BDAA 3U1JB 1MZAA 2CV3A 3H5CB 1THRH
chains in the Genus database with same CATH superfamily
4CRCA 2WYJA 1FXYA 4BXWA 2PP6A 4SGAE 1KLTA 1O5CB 1HV7A 2BYAX 3A7XA 4X1NU 2Q6DA 4YLUA 3M3TA 1FQ3A 2ZC9H 2VIVA 3M5NA 1YCPM 2A1DB 5HKKD 3UR6A 4OS2A 4FU9A 1C5YB 5GPIB 3RU4E 1YPLH 5FCRA 3U69H 1NO9H 1O32A 1P10A 4MPWA 5FPTA 2ZGJA 2H9EH 5JB9S 1P3CA 4AG2A 5ESBA 2WPKS 1EX3A 1O5FH 2KX4A 4IMQA 4JZ1A 1JBUH 5KGOA 3ZZ8A 1DANH 4RI0A 2ZQ1A 3KF2A 3RMOH 2SNVA 1DE7H 2OLGA 5B6LA 2CF8H 3T5FH 1GJCB 4ACBA 2WPHS 1NRPH 2Z9GA 6LPRA 3SJIA 2ZCLP 1C2JA 5C94A 4H4FA 1UVPA 1GDNA 2F9PA 1QB6A 5CDFE 1BBRE 1AQ7A 4Q2KA 1LKBA 1P02A 2IJD1 1P2MA 2SGPE 5DG6A 4ZHMU 2XCNA 2BXUH 2PGQB 2Y7ZA 2D2DA 2KR7A 3A82A 1GBIA 3C1KA 3W1EA 2EA3A 1JOUB 3A7WA 1ACBE 3VB6A 4OS1A 4KGAA 2BY9X 3SU4A 2F9OA 1O3BA 1TBZH 1UTPA 3H09A 4AGJA 1LKAA 1LHDH 3MNSA 1GL0E 1YY3A 1GHXH 1GI2A 4D9QA 1EAUA 1MKWH 2LP6A 1DLEA 2B7DH 1CHOF 2Q1JA 4GPGA 2FM2A 1FV9A 3QDZB 3SHCH 1FAKH 1O3OA 3VB7A 2STAE 2QF5A 1UTQA 1BITA 3P8GA 1EB1H 3E90B 2QXIA 3SV8A 3FP8E 2J98A 1MD7A 2V3HH 1ZZZA 4RT0A 1K22H 2VH0A 1W11U 2C8WB 2D8WA 2OP9A 3A88A 1O3IA 5KECA 1H9LB 5C1XA 1GDUA 1ABJH 4I31A 2CF9H 5E0HA 2A4RA 3AASA 2A0QB 3RM2H 2BLVA 1X7AC 1SOZA 1Z8JB 3TNSA 1GHZA 4DY7B 3LPRA 2ZGBH 2ANWA 2VIWA 3V3MA 3S7KB 5AFZH 1HIAA 1TMTH 1FY4A 2BVXH 5HYOA 2FOAA 2BZAA 1FNIA 1GJBB 1DOJA 4NZLA 4ZMAH 1T31A 1SQTA 2GKVE 2CMYA 2QN5T 4YM9A 2RA0A 3U1IB 4O97A 3ZV9A 1AUJA 9ESTA 4B76A 3PMHB 2J98B 9LPRA 1AD8H 1N6XA 3EDXB 1J14A 2Z94A 1PJPA 3U28C 1MTWA 1IQHA 3OY6U 1BTWA 3ZZ3A 1SMFE 2UUFB 4XOJA 1GI5A 5SGAE 3OU0A 1ZTJA 2P3TB 4AC9A 4H6TA 5JDUB 4Q7YA 2P8OC 2QF3A 1NBME 3SW2B 3LGWA 1G30B 1GBBA 1JIRA 1HIAB 1JIMA 1SGIB 2BD5A 3K6YA 5LPEA 3PMBB 1UHBA 3TVJB 2FOEA 1ELGA 1CT2E 2F4LA 2XNDD 1DWDH 2J38A 5FPYA 2HVXA 1QZ8A 4MVNA 4B2CA 1S0QA 3QTOH 1KYNA 4DJZB 4AFZA 3TGKE 2PSYA 3U98H 4Y6DA 1UJ1A 1WQVH 4ZKNU 3T29A 1LPGB 1Z1JA 2P59A 1KDQA 2UUKB 1EPTA 2LELA 3AW1A 1GBCA 3SU5A 3SJOA 8ESTE 1QIXB 2Y5HA 3B23B 5CHAB 1BJVA 1O34A 1BHXF 4I8LA 1DSTA 1OHHD 1YLNA 2ANMH 2BDYA 3RC5A 5J4SA 1SHHB 1SB1H 4DURA 2F43B 3S9CA 3M7UA 1A7SA 3UY9A 1UHBB 1ZGIA 1DITH 2W7SA 3F2FA 3FOAA 3LIWA 1O2YA 3M5OA 1TABE 1CT0E 3M5MA 1KXFA 5DP9A 4YOJA 2WYGA 1A0JA 2C8YB 1P05A 4FUIA 2L74A 2VB0A 1E0FD 2P94A 1O3LA 2GD4B 5DJ7A 1HJ8A 4BANB 1OX1A 3S0NA 2CGAA 1B5GH 1DVAH 2BMGB 2K0QA 3DCLA 1C5XB 4XRNA 2HPQH 1TNLA 1JXPA 4GHQA 4OS4A 1EPTB 2WINI 4B6FA 3F3BA 2G5NA 1GBEA 4TPYA 1C2KA 1FUJA 5E8EH 4HZHA 1XVOA 3PMAB 2OTVA 2ILNA 2ZCKP 3AAUA 1XUIA 4A5TS 2HNTF 1RRKA 2AEIH 1UCYH 2FDAA 1GI4A 3MH4A 4TT3D 1AB9C 1EZXC 3ZZ6A 2ZKSA 2AMDA 3AK5A 3AAVA 4NA7A 4VGCB 3JZ1B 1VCPA 1WU1A 1GJDB 2GZ8A 3K65B 1SLVB 2SGDE 3KQCA 4P02A 3SU1A 1K1OA 4X1SU 1BTZA 1QBVH 4ISLA 5EXLA 2V3MA 1FIZA 1DT2A 4AGKA 3ATLA 2F9UA 1UVSH 1XUJA 2ZECA 4AN7A 1ETSH 3FKSD 5EW2H 1UTOA 4AYVB 2ZFPH 3MH5A 1FAXA 3GCNA 1AWFH 4ISOA 1O3HA 1HCGA 2BOHB 2PLXA 3RXMA 5B6OA 7KMEH 2BTCE 5EJZA 3QLPH 1AVXA 4NA8A 4RT1A 2Q6FA 1BRUP 2QE7D 4GVUA 3O8RA 1Z8IB 3SNCA 1OPHB 3ZV8A 3ATKA 3DFJA 1GI3A 3DSGA 1LQDB 2B0FA 2A7CA 1VZQH 2V6NA 1HAXB 1EJNA 1TE0A 1EOJA 1BBRK 3UWIA 1QRZA 1O5DH 3ATMA 4FUDA 3EGKH 1A2CH 2UUYA 3GOVB 1V2LT 2XW9A 2FOBA 2FTLE 3GY2A 1ARCA 1TMUH 1SVPA 3H7OA 2GJGA 2G00A 1G2LA 1C4Y2 3ZZAA 1GJ9B 2LNCA 1V2OT 3SU2A 3ELAH 4FETA 2A5AA 5EIYA 1TGCA 5HXFA 1PPHE 4CBNA 1WBGB 2H2ZA 3RUOA 5EODA 2P95A 1FY1A 1H8ED 1KXEA 4X0WU 1GBKA 7GCHF 3A7ZA 2WV4A 1EPTC 1O2KA 3HATH 2PWXA 1IQGA 1IQIA 5HIYA 3DHKH 4JZDH 1MABB 3ZVGA 1A4WH 1C2HA 1GBTA 3OSYA 1FPCH 4K5ZA 3I78A 1Z6JH 4AZ2B 1EATA 2C93B 1F5LA 5DN6D 5LGOA 2TGDA 1AWHB 4Y7BA 2JJ1D 3GCHB 1MCTA 3F2HA 3UREA 1LHGH 4Y11E 1EJAA 1GHBG 2FYQA 2J34A 3Q3XA 2BHGA 1ETTH 2PHBA 1ZSLA 4YESB 1OKXA 1H8HD 3U8TH 1QFKH 5JBAS 1K1IA 1ZHRA 4VGCC 1TQ7B 5E2OA 1C1TA 1LHFH 1G3DA 1O3NA 1YBWA 2H6MA 3ODFA 2QGRA 1ZTLA 1OP2A 1O3JA 1WQSA 1W14U 3F9HA 3M3SA 1F5RA 1O5EH 4F48B 3F9GA 4WWYA 1T4VH 1HPGA 1IAUA 2P16A 1LDTT 3PV2A 4I32A 1C5PA 1P12E 2FPZA 1O3KA 1YM0A 2ULLA 2ZDAH 3A80A 1HAZB 1K1PA 3PLBA 4XFQA 3GY3A 3A8CA 3UR9A 3W94A 3KYGA 1YPHC 1Y59T 3RXOA 3TK6A 4BAHB 2KM0A 1HFDA 1BA8B 2VWLA 2R0KA 2G81E 1CSOE 5DP8A 2DUCA 4Z1MD 3E0PB 3EE0B 1JWTA 1GJ7B 4YTAA 3W95A 2A45B 2H5CA 1V2PT 4CRFA 2HOBA 5L30H 4Y10E 1KSNA 4MPUA 4Y71A 1W8BH 4Q7XA 3PTBA 1KY9A 2XWAA 1VJ9U 3GCTG 3UPEA 1D3QB 1YPHE 3F9EA 1O39A 2G4UA 3ATIA 1KIGH 1TONA 1NROH 1H9HE 3P6ZB 2VIQA 1UO6A 1TGBA 4BNRA 1HAIH 2QF4A 1V2JT 3AVZA 3WW7A 5A0BA 1D3DB 1COWD 3MQKC 2GMTB 1DY8A 1QJ1B 1BRBE 1SGFG 2FLRH 1YPKH 1HJAB 2V35A 2W3KA 6GCHG 3QN7A 1TPSA 1XUFA 1C9PA 1O2LA 2QXHA 3MU1A 5T6FA 3SV9A 5FBEA 1PYTD 3R3GB 2ZDNA 4MG3A 4K2YA 2PUQH 1A5HA 1D4PB 1V2ST 2ZA5A 5L6NH 1TALA 1OWJA 1P11E 1Y3WA 5DP3A 3WWBA 2BZ6H 3GY4A 4B71A 4THNH 1IQNA 3TK5A 1V6DA 1D6WA 2C4FH 1OWKA 2SNWA 3E1XB 3GCHC 4OS6A 2PTCE 1O2HA 3PWCA 1SFIA 4JK6A 4UE7H 4R8TB 2VIDA 3FO8D 4K8YA 3A7TA 4E7NA 3KQEA 4GLYA 1EAWA 3RXCA 1ZR0A 3BV9B 5FX5A 3TJNA 1SQOA 3GY5A 2NU0E 4MQAA 2FIRH 5L2YH 5HM2A 3ZYEA 4JZIA 1EKBB 1OWDA 4UDWH 1O37A 1DICA 1P9SA 1YF4A 3OTPA 3O8BA 1C5TA 4FUGA 2ASUB 3PYHA 1IHSH 1P0SH 3EQ0H 1AIXH 1C2MA 4DIIH 1L0ZA 1HXEH 1GDQA 1S81A 1UW7A 2J95A 2BVSH 1EZUC 4PROA 1ELBA 3SQEE 2H5DA 1PPGE 2BQ6B 2V0BA 2W6JD 5F8TA 2A2QH 3RXLA 4GSOA 5FBIA 3O8CA 3GICB 1IQMA 2OCVB 3T2NA 1GI1A 1PPCE 1IHTH 1ELFA 1F92A 2A31A 2ZFQH 1NFUA 3KCGH 4LXBH 1BMFD 1Q2WA 3MO9A 2QF0A 2FXRA 4A7IB 4JYVH 1UK2A 4JMYA 4YO9A 4AG1A 3EAJA 2VIPA 1BRCE 4K1SA 1ARBA 2ZFRH 2ZDVH 5J4QA 4K69A 3SU6A 3PRBA 1S6HA 3F0OA 1SKYE 2GT7A 1T8NA 3A86A 1K0HA 1SLXB 4XE4A 1W7GH 4O03A 1W0ZU 2GMTC 1LVYA 1GHAG 2ZF0H 3MH6A 1HJAC 4HGCA 4CR9A 5BPEA 1IQKA 1SGDE 1CGIE 1NT1A 5HMAA 4ZKSU 2JH0D 5F53A 3URDA 4AB8A 3RMLH 3SV7A 1O38A 2Z3EA 5EQQA 5A0CA 1Y3YA 3TJVA 1S0RA 4JCNA 1C9TA 2HVYB 1OYTH 2FI3E 1QY6A 1O2OA 5DP6A 1QJ6B 2G8TA 5ETXA 3A87A 4Q7ZA 5JBCS 2GVFA 4NSVA 4WY3A 4BTTB 1K28D 2XNIA 3D49H 2Q6GA 5GXPA 2PW8H 1OP8A 1AE5A 1LTOA 1O2JA 3E3TA 1TNIA 3SUEA 3OEHD 4XSKU 1LQEA 1LVBA 1AKSA 4FUFA 1HAOH 2G55A 3NXPA 1C4U2 3K2UA 3Q3KA 1AFQB 1C5MD 2O8TA 2ZDLA 1NFXA 5E0GA 6CHAB 1PYTC 2ZFFH 2J92A 2NU2E 1P03A 1O5BB 1RXPA 1YPGH 1YC0A 3TH4H 1MAYA 3QZQA 1O2SA 4I33A 3S7HB 3ZZDA 2HWLB 2AGGX 5F03A 1BT7A 2P8OB 2J2UA 1MKXH 1YLDA 4UONA 4MLFB 1E34B 4JYUH 1TA2A 4D7GA 3T27A 4KELA 3RM0H 1BUIA 1HXFH 1E1RD 2TBSA 1PQ5A 2QAAA 4KP0A 2EI6A 3QGNB 4DOQA 1FDPA 1O2UA 2AH4X 2GGVB 1DPOA 4NIWA 4GCHG 2B9LA 2ZDMA 1TFXA 1ZPCA 1OOKB 3MOCA 4FUEA 2BDGA 1G36A 1SFQB 1AKSB 1EUFA 3UTUH 1GPZA 1ANCA 1UK3A 1ZPBA 1C2EA 1Q31A 1LCYA 1RTFB 4X2WA 5T6DA 3OAAD 3DSPA 4FVBA 3ESTA 4J2YB 1QQ4A 4B73A 5GWZA 1AFEH 1Z7KA 3QGJA 3N7EA 3TPIZ 2KFWA 4NZQA 4RN6A 4GUXA 3SHAH 2BM2A 5T1VA 3BG4B 2OQ5A 2WPMS 1DFPA 5DK1A 4Q4LA 4IS5A 4Y0YE 2DE9A 5C3NA 1BB0B 1ZTKA 1DSUA 1O2GH 3GYMA 1O31A 1IQLA 5AF9H 2IPHA 1C4V2 3GYLB 5C20A 3ZYDA 4TSFD 1O2IA 3MHWU 1UCYK 1T8OA 2VBCA 3PRDA 2AS9A 2VGCB 1VGCB 1C5ZB 2GX4A 3FAOA 1EZQA 2Y5GA 3HK3B 2BLQA 3NUMA 4ASUD 2ALPA 2G5VA 2VH6A 2VWMA 1K1MA 5ABWA 2WPJS 3A7YA 2TIOA 2PUXB 5DGJA 2XC4A 1SR5C 3VXFH 1KLJH 1NFYA 1Q3XA 1BMMH 3RXJA 4MNVA 4BXSA 1AFQC 5JBTA 1E1QD 1RS0A 5DP7A 6CHAC 1H8IH 3HKJB 2KCAA 2BY7X 2Y81A 3LONA 4X8VH 4FXGH 4IN1A 4M7GA 4ZCNA 1S84A 5LPFA 3F68H 2AMQA 3MO6A 3DD2H 5T3HA 1A5IA 1QRXA 1EAIA 1GHBF 2XBYA 4ZKOU 2XC5A 1AB9B 2WV9A 3BTTE 5EGMA 2AIQA 3A8DA 3RXTA 1Y5AT 2OC1A 1ZSJA 1V2NT 2CJIA 2PKSB 1C1MA 3SGAE 1MBMA 4WMFA 4O3TA 4XBDA 5EPNA 3H7TA 1F5KU 4ABIA 3CP7A 2UUJB 5DP4A 2H9TH 1YPEH 4CBOA 1YCPH 1CA0B 1K2I1 4CRDA 3V13A 3FP7E 1L1JA 2VVUA 1WSSH 1ELCA 2B8OH 1QL8A 3BTDE 4OS5A 5FAHA 1YPJH 1V3XA 1O2WA 1VCQA 1L2EA 2FYRA 1QA0A 5FPSA 2WUBA 3BG4C 1WTHD 1QQUA 1W2KH 1A3EH 3NWUA 3VGCB 2ZHQH 4Y0ZE 1OWHA 3M35A 4WJG2 3KYFA 3RMNH 4ISHH 3GDSA 1TGNA 2LPRA 4NG9H 2FOFA 4TY7A 1F2SE 1C1SA 1S5SA 1P2JA 1QNJA 1WV7H 5F8ZA 1GBHA 4IC5A 1GBAA 1AZZA 2UWPA 4NIXA 2VGCC 1VGCC 3GCTF 1ABIH 2RDEA 2THFB 1MU8B 3KNXA 4Q63A 3TIUA 4H6SB 2HNTC 1GG6B 1BMLA 3DA9B 1F0TA 1TNKA 4TPIZ 3QTVH 1NS3A 4ABDA 1KDQB 2GV6A 5C1YA 6GCHF 3SGQE 5DPAA 1KMHB 5C5NA 3LH3A 1AGJA 3OTJE 1DLKB 1NU9A 1NU7B 5EPYA 1FPHH 5EJLA 3K9XB 3DT0H 5EQRA 1AMHA 1GMHG 2F3CE 4A1TA 5A8ZA 2PGBB 4I8HA 1CQQA 2UWOA 2Z3CA 4FOUC 3P92A 2HNTE 3LC5A 3ENSB 3RXIA 1C1NA 3T25A 3LH1A 1FY8E 4SGBE 4CRGA 1KXBA 1MQ6A 2G52A 1GCDA 1GBLA 2KCPA 1OXGA 4INLA 1ETRH 5A8YA 2GDEH 4ZHLU 1LO6A 1L4DA 4XBCA 4JYTA 3SZNA 2G4TA 3KQ5A 4I8KA 1AZ8A 2PKSC 1QURH 4HG6A 1SL3A 2NU4E 4FU8A 2J9NA 3L6PA 3P95A 5A8XA 3MFJA 3RXRA 1ZSKA 4ZH8A 4I8GA 3RC4A 1NN6A 3MH7A 1CT4E 2ZWLH 3HPTB 2WUCA 4NA9H 3OYPA 1CA0C 2V7QD 4X8SH 1F0RA 2VNTA 2IOTA 4AORA 4UFFH 1C1RA 2FP7B 1C2DA 4INHA 4ISIH 1HJ9A 1ZHPA 1FY3A 1E37B 1O2QA 4H42U 1SQRA 1MZDA 2HGTH 2JIZD 3ZVCA 1ELVA 1TAWA 3UNQA 1L1NA 3LC3A 3GDVA 3VGCC 1UTKA 1KTTB 1P06A 3RXGA 1MTUA 4DT7B 2OK5A 5LPRA 2BVRH 2ZQ2A 3TGJE 1Y8TA 5GCHG 2OUAA 1M9UA 4FU7A 3L33A 1NZQH 1O3PB 3SZEA 1TPAE 3MTYA 4XD7D 1SSXA 4ABBA 4AFSA 4K1EA 1D6RA 2ZU4A 5LH8A 1BQYA 4B1TA 3BTHE 1C5LH 1EASA 1W0YH 1VITG 2ZHFH 4B2AA 3OEED 8KME2 2BQWB 4HFPB 1GG6C 3URCA 3BG8A 1PPFE 1W0KD 1XVMA 2OBQA 1W10U 1WCZA 2DE8A 1GHAF 1N1LA 5I46H 1TIOA 2GDDA 2BY5X 4HI3A 1C5OH 1Y5UT 3M5LA 1GMCG 1EQ9A 1J16A 4CREA 1GMDG 2AFQB 1ESTA 2Z9KA 5IDKA 1AVGH 1TOMH 4IW4E 1K1JA 1ANEA 1P57B 2OC7A 2WPLS 3BTME 1UTJA 5C5OA 3FN8A 2C3SA 4A6LA 1Z8RA 3UFAA 2ZHDA 3VXEH 5DKMA 1KXAA 1LPKB 1IQEA 4A92A 3U8RH 1GWAA 1GBDA 2J97A 2A5IA 5TCAA 7LPRA 2BD3A 1DM4B 5FHTA 4I8JA 1ZMJA 4B6EA 3MNCA 3MO3A 2ZTZA 4MDSA 2A4GA 4HTCH 1DWBH 2BB4A 1O33A 3RXEA 1OYQA 1QCPA 3KL6A 1JRSA 5KEDA 1ID5H 2A4OA 2ZU5A 3MMGA 3SNEA 3RXHA 3ZVEA 1QB1A 2OINA 1S83A 2VVVA 3N7OA 3QZRA 1A0HB 1LHEH 5EG4A 3UQOA 2R3UA 4DT4A 3WY8A 3E16B 1A5GH 4A1VA 1N6YA 2W5EA 1MTVA 2VU8E 3UIRA 1W0JD 3F9FA 1O3AA 1SC8U 2NU3E 2EY4C 2GV7A 2JDID 5A0AE 2Y7XA 2FOGA 3EA9A 1UCYE 2A7JA 3RXAA 1UTMA 1SGYE 3V0XA 4DG4A 1CHGA 1PPBH 1SGNE 2OC0A 1RD3B 4ABHA 3BTQE 3SN8A 4ABEA 2CK3D 2FOCA 1BMAA 2ZFSA 2ZTYA 2R0LA 4GCHF 3ZZ4A 1O2TA 5HIZA 3SV2H 4X8TH 4INKA 1HLTH 3PLPA 4ZROA 3SUDA 2BLOA 3RU4D 1QJ7B 1TRNA 1TNHA 1UVUH 1LHCH 1TLDA 3S9AA 2FEQH 3MWIU 2PR3A 2XXLA 1XKBC 1J9CH 3UNSA 3GY7A 4FUJA 1C1VH 1P2OA 2A2XH 2C8ZB 2RFKC 1O2XA 2FS8A 4AX9H 3RU4T 1ZOMA 1FMGA 2GCHG 2XCFA 2OBOA 3EYDA 3LGUA 4A1XA 2NWNA 2VJ1A 1O5GH 2ZU1A 3MU4A 1H8DH 2KCYA 2YNAA 4YOGA 2HLCA 1ZJKA 1GCTB 5C0TA 1FN8A 2ZPSA 4X2YA 5EU8A 1O3DA 2BLWA 1C1UH 3DFLA 1W3CA 3MI4A 3FVFB 3SU3A 1THPB 4ZHAA 2HALA 4B75A 4LOYH 3LJJA 3Q00A 1BBRH 2ANKH 5TJXA 2I6SA 4X6PA 1EOLA 1GVZA 2STBE 1NESE 5AFYH 3D62A 4WH6A 1XUKA 1BOQA 1H1BA 1MKWK 2R2MB 1Y5BT 3SNAA 8GCHG 1CO7E 2CXVA 1OWIA 3B8JA 2BD9A 1O3GA 1D3TB 2CHAB 2R3YA 3EA7A 4DVAU 3E8LA 2OQUA 1YLCA 1BMNH 7ESTE 1MBQA 4B74A 3LKWA 1Y3VA 2J94A 1O35A 1ZPZA 3RXUA 5C2ZA 1XKAC 1TX7A 2IJOB 3MNBA 2YMSD 3RXKA 1NRRH 1O2VA 1P8VC 4X1PU 1DUAA 4R0IA 1MTNB 1ESAA 2VVCA 1P2QA 3QX5H 3U8OH 5JPMH 1EFRD 5JYIA 3SQHE 1VITH 2RG3A 3UOPA 2Z7FE 3Q3YA 4AB9A 1C5WB 1CGHA 2R9PA 1FY5A 1SHYA 2OD3B 1MMJN 4F49A 4X2VA 5A2MH 1GGDB 5H4IB 1UVOA 3SO3A 4CRAA 4AFUA 2PSXA 4E7RG 1RIWB 2Y5FA 5K7RA 1Z6EA 1MTSA 4AFQA 4ASHA 4JZEH 1GHWH 3HGPA 5EXMA 2Y82A 3RLYH 2BD8A 2M2AA 3TNTA 1C5RA 2QYIA 3RXVA 3ZZ9A 3V7TA 1V2WT 2AGIX 1SGTA 3BTFE 3I29A 4U30A 3RXSA 4OS7A 3KIDU 2FO9A 3ZZBA 4DCDA 1HYLA 4OM9A 1V2QT 1CVWH 1RJXB 1F0SA 1G32B 1MD8A 4K60A 1K9OE 3BIVH 2ZDKA 3CENA 2WPIS 1P04A 1QL7A 1WTGH 1GCTC 5CHBA 3Q77A 3A7VA 1SG8B 1E36B 1B0FA 1GI9B 1GI0A 4WMDA 4XBBA 3NK8A 3FFGA 1DWEH 3LGTA 2SGEE 1G3CA 4IN2A 2SGFE 4BAMB 1HUTH 1MH0A 4Q80A 4ZKRU 4X6OA 3V12A 2B5TB 5C17A 1QL9A 1CA8B 3TU7H 2BX4A 1C5NH 2A5KA 1TMBH 2FI4E 1YCPK 2Z9LA 1ELEE 3FZZA 1QRWA 1BTYA 1GMHF 1KLIH 1NFWA 4K3JA 2CHAC 2ZFTA 3BTGE 3HGNA 2JJ2D 2ZGXH 1BJUA 3RDZA 2BY6X 2FOMB 3MU0A 1SGFA 5EJ1A 1T8LA 1C5QA 2WHXA 4ZXXH 1MTNC 1BTUA 2F9BH 2KCOA 2EEKA 1SGEE 1XM1A 1BHXB 2W26A 3M7QA 2ZP0H 3UWJH 1A0LA 4TWYA 3ATWA 1N8OB 2AMPA 1DXPA 3KHVA 2ZTXA 1GGDC 4YLQH 5L2ZH 1DUEA 1RIWC 2XBWA 3PTNA 1DY9A 2JH5D 3GCOA 1G3BA 3A8BA 3A81A 3PWBA 1O2MA 1SI5H 4YZUA 1HAVA 5EOKA 1TPPA 2ZU2A 1AY6H 1J15A 1WXRA 2YMSC 4QT8C 4NIVA 1UVTH 3P8NA 2A32A 3SUFA 1QA7A 5GCHF 2CN0H 5C1UA 1O5AB 5F6MA 2PV9B 2TGPZ 1NTPA 1L4ZA 5IK2D 2HPPH 3RLWH 2W7UA 2QA9E 1O2RA 1TX8A 3M61U 1K1NA 2ODYB 3JZ2B 2H9HA 1TBQH 1Y3XA 2QY0B 3KEEA 1YGCH 1VITF 4DGJA 3ZVFA 1V2VT 3FZDA 4OGXA 1YKTA 3GY8A 3ZVDA 2BD7A 1O2ZA 2EQNA 5T6GA 1C1QA 3LDXH 2GZ9A 4UFDH 4WXVA 3NPSA 1HAVB 4UFGH 4NWLA 4Z0KA 1TGTA 1O36A 1GMCF 2FX4A 4I86A 1WDIA 1NY22 1S6FA 2KAIA 1HNEE 1GMDF 1ZRBA 1FX0B 3GS9A 2EC9H 4MPXA 2RA3A 1BDAA 1GI6A 1GL1A 1HB0B 3N99A 2Y6TA 3CNRA 1QGFA 1A61H 1C2IA 3R0FA 1O3MA 1GBJA 4GAWA 1MUEB 2ANYA 1C5SA 1PQAA 1NRQH 1P2NA 1RTKA 3ITIA 1QBOA 2ALVA 1ELTA 3PMJA 4ESTE 1KTSB 3E0NB 2PFEA 2BXTH 2ZCHP 4UEHH 1LPZB 3M36A 5FX6A 3U9AH 3VFEA 3TK9A 1XX9A 2XYAA 2J4IA 3SJ8A 2ZNKH 5FCKA 3PV4A 2TGAA 1UMAH 1A46H 1UTNA 2Z6BD 3F6UH 5FXLA 4X6NA 3EA8A 3SOSA 1GVKB 1ZHMA 2RDLA 1W12U 2SFAA 3LJOA 1N8OC 2W3IA 1B7XB 1NRNH 1KXDA 4CH8B 3HK6B 1G2MA 1C2LA 2ZI2H 3B9FH 4NWKA 5PTPA 2KAIB 1XMNB 1XUHA 2W6ID 3KQDA 1EP6A 1HAGE 2HRVA 3SORA 1O0DH 4BAKB 3TH2H 1MU6B 2QXGA 3VPKA 3TJOA 1G3EA 1T32A 2GCTB 2M5TA 3PM3A 3SNBA 4BAOB 1TGSZ 1OS8A 5A09A 2R2WU 1CU1A 3E91A 4X1RU 3T62A 4TWWA 3SJKA 3LT3A 1ZMNA 1P2IA 1BZXE 3NZIA 3P70B 4NFEA 1AHTH 3IWMA 2WSSD 3UAIC 2A7HA 3BEIB 3BEFB 1O3CA 3F1SB 5TCCA 3STJA 1SLUB 2XOKD 2JETB 4NCYA 4CH2B 3Q76A 3UQVA 3BTWE 3LGYA 1T8MA 1W7XH 3ZZ7A 1AUTC 1FLEE 3VB3A 5GNDA 1S82A 2P3UB 4CR5A 1C1OA 2FODA 3BTKE 4LZ4B 1PPEE 1EP5A 2K8IA 4YXWD 4XDEA 2GP9B 2ZHWH 3F2GA 2GCHF 1OWEA 3LGVA 1THSH 1V2UT 2FWWA 3K6ZA 3UUZA 3S69A 4AOQA 2TPIZ 3TITA 3E6PH 3A85A 1QR3E 2FMJA 4TY6A 1TPOA 2FS9A 1EB2A 5DSFA 1HBTH 3SNDA 1YPMH 1A3BH 1V2RT 3TJUA 3VB4A 4E05H 2PTNA 2WZQA 1P09A 1Z8GA 2F9VA 4UFEH 3RXQA 2HLDD 4MNXA 1V2TT 4WXIA 2QXJA 1C1PA 2BDBA 4AYYB 4D8NA 1O2PA 4K8BA 5C0UA 4RSPA 3KGPA 2FZZA 3TLOA 1ESBA 1TB6H 4MNWA 1UK4A 3ZIAD 4D76A 1O3EA 5HGGA 3TGIE 3QK1A 1AO5A 2QIQA 8GCHF 4FUHA 3PB1E 1LVOA 4X8UH 1BRAA 4JK5A 3IG6B 2GT8A 2WV5A 3M37A 4IMZA 5GDSH 2FI5E 2YNBA 2TRMA 1AVWA 3BIUH 3RXFA 2KZ4A 3BEUA 4B2BA 5I25A 2UWLA 2FOHA 1AI8H 4U01A 3LOXA 4D7FA 1CHOG 2AHME 2G51A 2GCTC 3PO1B 2BDCA 2ESTE 3STIA 5JB8S 1SGPE 1DS2E 1PQ8A 3RXPA 2ZGHA 1V2MT 3O8DA 3ZZ5A 1DX5M 2ZIQH 1J17T 2QC2A 4K1TA 3BSQA 3MYWA 1OP0A 4X1QU 5CHAC 5E2PA 1DDJA 3M3VA 3GY6A 1SGQE 2JETC 1PFXC 3BF6H 2P3FH 1ELDE 2BX3A 2ZHEH 1DXWA 2F91A 5F8XA 5JBBS 5CE1A 2J5UA 3KQBA 4YT6H 1A1RA 3SI4H 1WOFA 1BTXA 2ZG0H 1L1GA 1GJ4H 2ZPQA 3EE7A 4DW2U 1INCA 1QHRB 1PPZA 2BD2A 1HDTH 2FTMA 3RP2A 4IC6A 2F9NA 2BDIA 2XC0A 3SUGA 3UB0A 4BTIB 4I7YH 4NGAH 3VEQB 1P9UA 2ZZUH 1H4WA 1CBWB 3RXDA 3DSOA 2VWNA 1H9IE 1HAHH 2BQ7B 3MU5A 5FL7D 1GHVH 2PKAA 3FP6E 3ODDA 2QV1A 4LK4A 5G4BA 2JKHA 1JRTA 1TQ0B 2L6OA 3I77A 3L3TA 1O30A 4F4OC 1PQ7A 1ZJDA 4YT7H 5GIBA 1GJ5H 5EXNA 1T4UH 4ABAA 2SGQE 3P8FA 3F0PA 4U32A 1VCWA 2C8XB 4Y8ZA 3RMMH 5DP5A 4ABGA 1YYY1 2VIOA 2XRCA 3UOUA 5ESTE 1NC6A 5DO4H 3OX7U 2Z9IA 1C2FA 3GISB 2D26C 3SV6A 1GJ6A 3OFND 3A89A 4YOIA 4ZUHA 1BCUH 1TRMA 1TNGA 2GZ7A 3HKIB 2SGAA 3SU0A 2IN2A 1CGJE 2AGEX 4MNYA 3SBKA 1HAYB 1GHYH 2ODQA 3NRLA 4ISNA 4MTBA 1C5VA 3LU9B 2V3OH 4MPVA 2PKAB 4RKJB 3BN9A 4X2XA 1S6LA 4F55A 1AN1E 4Y79A 1C2GA 4KTSA 2O8MA 3PO1C 2Z9JA 2JH6D 1HGTH 2BDHA 2ZGCA 5AHGH 3LGIA 3ZZCA 4FUBA 1NRSH 1GBFA 5AVDA 3ZVAA 1P3EA 1ELAA 3D65E 4ABFA 1YP9A 4LZ1H 3DUXH 2VINA 1QB9A 2OXSA 1U6QA 2ZEBA 3A8AA 4KTUA 3QUMP 3MU8A 1IOEA 1HAPH 1OSSA 1VKYA 4ZAEA 4Y8XA 4M9FA 3IITA 2AERH 2P93A 1MCVA 5EW1H 2XBXA 4FUCA 1Y3UA 3D23A 1FZZA 4TYDA 1NPMA 1JMOH 1QBNA 1WAYB 4WF8A 3VG8A 1XXDA 1BIOA 1IQFA 1ZYOA 1LVMA 2WPDD 3SGBE 2Y80A 1W13U 1TA6A 1V2KT 1O2NA 2O8UA 4GHTA 3SYJA 4CHAB 1XUGA 4UD9H 4CRBA 4WH8A 1UTLM 3A84A 1EJMA 1FI8A 1C5UA 1GI7B 1TRYA 4RKOB 1ZRKA 1BTHH 1CBWC 1MKXK 4NSYA 2AIPA 4Y7AA 1GJAB 1HRTH 1Z71A 4U2WA 3CS0A 4BOHA 3SJ9A 2NU1E 4ABJA 5HM9A 2EI8A 5E0JA 4DIHH 3BTEE 1TBRH 1MAXA 3AW0A 3GDUA 4WVPE 1EXFA 2IPQX 1E35B 1E79D 4J1YA 1D3PB 4D9RA 4O3UA 2H1UA 1ZGVA 5BRRE 1K21H 1YWUA 2FLBH 1FN6A 1SGCA 1TNJA 4NIYA 1ZLRA 3ZVBA 3C27B 1ANDA 2XTTB 1NM6A 4Y8YA 3QO6A 1DWCH 3S9BA 1SLWB 3UNRA 1WUNH 1GI8B 3NCLA 2AYWA 8LPRA 1ZMLA 1Z1IA 2A4QA 1B0EA 1J8AA 2BD4A 3VB5A 1C1WH 5EQSA 3P17H 4BTUB 1P2KA 2BOKA 5GJ4B 4X6MA 4BAQB 1SPJA 1GVLA 4ZXYH 6ESTA 4Y76A 4FVDA 3N7DA 3P8OA 1RGQA 4KKDA 2ODPA 2ZPRA 3PROA 2O9QA 1AE8H 1SOTA 3T26A 3MNXA 3PLKA 1ORFA 3G01A 4OGYA 1TYNA 4P00A 1VR1H 1FONA 1FIWA 2BY8X 1F7ZA 4KTCA 2XBVA 1EZSC 1SBWA 5C67A 5CMXH 4NFFA 2C90B 3KN2A 2I6QA 2OC8A 1RTLA 4O9VA 3WWFA 1S85A 2ZU3A 2XWBI 1WYKA 2FX6A 1E38B 2EI7A 2F83A 2RCEA 2K1QA 4IGDA 3PV5A 1VJAU 3T28A 4E06H 4WMEA 1TX6A 2D1JA 1SQAA 2VWOA 2FESH 1TWXB 1T7CA 2YMSB 1FJSA 5K0HA 1GJ8B 2GTBA 2QCYA 1SGRE 3RC6A 1P01A 1G9IE 1BTPA 1F0UA 1CE5A 1RFNA 1LMWB 2Z3DA 3A83A 4IBLH 4CHAC 2TGTA 1MQ5A 4JZFH 1AU8A 1D9IA 3OY5U 3RXBA 5IYTA 1KXCA 4Z6AH 1IQJA 1NBMD 3M7TA 7GCHG 1GBMA 1K1LA 3FANA 3NKKA 3CS7A 2YOLA 4ACAA 1G37A 1EAXA 3TH3H 3SI3H 3OE7D 1XXFA 2O8LA 3QWCH 1ANBA 1QTFA 1O3FA 2ZO3H 1TOCB 2BDAA 2O8WA 3U1JB 1MZAA 2CV3A 3H5CB 1THRH
chains in the Genus database with same CATH topology
4CRCA 2WYJA 1FXYA 4BXWA 4SGAE 1KLTA 1O5CB 1HV7A 2BYAX 3A7XA 4X1NU 2Q6DA 4YLUA 3M3TA 1FQ3A 2ZC9H 2VIVA 3M5NA 1YCPM 2A1DB 3UR6A 4OS2A 4FU9A 1C5YB 5GPIB 3RU4E 1YPLH 5FCRA 3U69H 1NO9H 1O32A 1P10A 4MPWA 5FPTA 2ZGJA 2H9EH 5JB9S 1P3CA 4AG2A 5ESBA 2WPKS 1EX3A 1O5FH 4IMQA 4JZ1A 3ZZ8A 1JBUH 1DANH 2ZQ1A 3KF2A 3RMOH 2SNVA 1DE7H 2OLGA 2CF8H 3T5FH 1GJCB 2WPHS 1NRPH 2Z9GA 6LPRA 3SJIA 2ZCLP 1C2JA 4H4FA 1UVPA 1GDNA 2F9PA 1QB6A 1BBRE 1AQ7A 4Q2KA 1LKBA 1P02A 1P2MA 2SGPE 5DG6A 4ZHMU 2XCNA 2BXUH 2PGQB 2Y7ZA 2D2DA 3A82A 1GBIA 3C1KA 2EA3A 1JOUB 3A7WA 1ACBE 3VB6A 4OS1A 4KGAA 2BY9X 3SU4A 2F9OA 1O3BA 1TBZH 1UTPA 4AGJA 1LKAA 1LHDH 3MNSA 1GL0E 1GHXH 1GI2A 4D9QA 1EAUA 1MKWH 1DLEA 2B7DH 1CHOF 2Q1JA 4GPGA 2FM2A 1FV9A 3QDZB 3SHCH 1FAKH 1O3OA 3VB7A 2STAE 3P8GA 1UTQA 1BITA 1EB1H 3E90B 2QXIA 3SV8A 3FP8E 1MD7A 2V3HH 1ZZZA 1K22H 2VH0A 1W11U 2C8WB 2D8WA 2OP9A 3A88A 1O3IA 1H9LB 5C1XA 1GDUA 1ABJH 4I31A 2CF9H 5E0HA 2A4RA 3AASA 2A0QB 3RM2H 2BLVA 1X7AC 1SOZA 1Z8JB 3TNSA 1GHZA 4DY7B 3LPRA 2ZGBH 2ANWA 2VIWA 3V3MA 3S7KB 5AFZH 1HIAA 1TMTH 1FY4A 2BVXH 5HYOA 2FOAA 2BZAA 1FNIA 1GJBB 1DOJA 4NZLA 4ZMAH 1T31A 1SQTA 2GKVE 2CMYA 2QN5T 4YM9A 2RA0A 3U1IB 4O97A 3ZV9A 1AUJA 9ESTA 4B76A 3PMHB 9LPRA 1AD8H 1N6XA 3EDXB 1J14A 2Z94A 1PJPA 1MTWA 1IQHA 3OY6U 1BTWA 3ZZ3A 1SMFE 2UUFB 4XOJA 1GI5A 5SGAE 3OU0A 1ZTJA 2P3TB 4H6TA 5JDUB 4Q7YA 2P8OC 2QF3A 3SW2B 3LGWA 1G30B 1GBBA 1JIRA 1HIAB 1JIMA 1SGIB 2BD5A 3K6YA 5LPEA 3PMBB 1UHBA 3TVJB 2FOEA 1ELGA 1CT2E 1DWDH 2J38A 5FPYA 2HVXA 4MVNA 4B2CA 1S0QA 3QTOH 1KYNA 4DJZB 4AFZA 3TGKE 2PSYA 3U98H 4Y6DA 1UJ1A 1WQVH 4ZKNU 3T29A 1LPGB 1Z1JA 2P59A 1KDQA 2UUKB 1EPTA 3AW1A 1GBCA 3SU5A 3SJOA 8ESTE 1QIXB 2Y5HA 3B23B 5CHAB 1BJVA 1O34A 1BHXF 4I8LA 1DSTA 2BDYA 2ANMH 3RC5A 5J4SA 1SHHB 1SB1H 4DURA 3S9CA 3M7UA 1A7SA 3UY9A 1UHBB 1ZGIA 1DITH 2W7SA 3LIWA 1O2YA 3M5OA 1TABE 1CT0E 3M5MA 1KXFA 5DP9A 4YOJA 2WYGA 1A0JA 2C8YB 1P05A 4FUIA 2VB0A 1E0FD 2P94A 1O3LA 2GD4B 5DJ7A 1HJ8A 4BANB 1OX1A 3S0NA 2CGAA 1B5GH 1DVAH 2BMGB 1C5XB 2HPQH 1TNLA 1JXPA 4GHQA 4OS4A 1EPTB 2WINI 2G5NA 1GBEA 4TPYA 1C2KA 1FUJA 5E8EH 4HZHA 1XVOA 3PMAB 2OTVA 2ILNA 2ZCKP 3AAUA 1XUIA 4A5TS 2HNTF 1RRKA 2AEIH 1UCYH 2FDAA 1GI4A 3MH4A 1AB9C 1EZXC 3ZZ6A 2ZKSA 2AMDA 3AAVA 4NA7A 4VGCB 3JZ1B 1VCPA 1WU1A 1GJDB 2GZ8A 3K65B 1SLVB 2SGDE 3KQCA 3SU1A 1K1OA 4X1SU 1BTZA 1QBVH 4ISLA 5EXLA 1FIZA 1DT2A 4AGKA 3ATLA 2F9UA 1UVSH 1XUJA 2ZECA 4AN7A 1ETSH 5EW2H 1UTOA 4AYVB 2ZFPH 3MH5A 1FAXA 3GCNA 1AWFH 4ISOA 1O3HA 1HCGA 2BOHB 2PLXA 3RXMA 5B6OA 7KMEH 2BTCE 3QLPH 1AVXA 4NA8A 3O8RA 2Q6FA 1BRUP 4GVUA 1Z8IB 3SNCA 1OPHB 3ZV8A 3ATKA 3DFJA 1GI3A 1LQDB 2B0FA 2A7CA 1VZQH 2V6NA 1HAXB 1EJNA 1TE0A 1EOJA 1BBRK 3UWIA 1QRZA 1O5DH 3ATMA 4FUDA 3EGKH 1A2CH 2UUYA 3GOVB 1V2LT 2XW9A 2FOBA 2FTLE 3GY2A 1ARCA 1TMUH 1SVPA 3H7OA 2G00A 1G2LA 1C4Y2 3ZZAA 1GJ9B 2LNCA 1V2OT 3SU2A 3ELAH 2A5AA 1TGCA 5HXFA 1PPHE 4CBNA 1WBGB 2H2ZA 3RUOA 5EODA 2P95A 1FY1A 1KXEA 4X0WU 1GBKA 7GCHF 3A7ZA 2WV4A 1EPTC 1O2KA 3HATH 2PWXA 1IQGA 1IQIA 3DHKH 4JZDH 3ZVGA 1A4WH 1C2HA 1GBTA 3OSYA 1FPCH 4K5ZA 3I78A 1Z6JH 4AZ2B 1EATA 2C93B 1F5LA 5LGOA 2TGDA 1AWHB 4Y7BA 3GCHB 1MCTA 3UREA 1LHGH 4Y11E 1EJAA 1GHBG 2FYQA 2J34A 3Q3XA 2BHGA 1ETTH 2PHBA 1ZSLA 4YESB 1OKXA 3U8TH 1QFKH 5JBAS 1K1IA 1ZHRA 4VGCC 1TQ7B 5E2OA 1C1TA 1LHFH 1G3DA 1O3NA 1YBWA 2H6MA 3ODFA 2QGRA 1ZTLA 1OP2A 1O3JA 1WQSA 1W14U 3F9HA 3M3SA 1F5RA 1O5EH 3F9GA 4WWYA 1T4VH 1HPGA 1IAUA 2P16A 1LDTT 4I32A 1C5PA 1P12E 2FPZA 1O3KA 1YM0A 2ULLA 2ZDAH 3A80A 1HAZB 1K1PA 3PLBA 4XFQA 3GY3A 3A8CA 3UR9A 3W94A 1YPHC 1Y59T 3RXOA 3TK6A 4BAHB 1HFDA 1BA8B 2VWLA 2R0KA 2G81E 1CSOE 5DP8A 2DUCA 3E0PB 3EE0B 1JWTA 1GJ7B 4YTAA 3W95A 2A45B 2H5CA 1V2PT 4CRFA 2HOBA 5L30H 4Y10E 1KSNA 4MPUA 4Y71A 1W8BH 4Q7XA 3PTBA 1KY9A 2XWAA 1VJ9U 3GCTG 3UPEA 1D3QB 1YPHE 3F9EA 1O39A 2G4UA 3ATIA 1KIGH 1TONA 1NROH 1H9HE 3P6ZB 2VIQA 1UO6A 1TGBA 4BNRA 1HAIH 1V2JT 3AVZA 5A0BA 1D3DB 2GMTB 1DY8A 1QJ1B 1BRBE 1SGFG 2FLRH 1YPKH 1HJAB 2V35A 2W3KA 6GCHG 3QN7A 1TPSA 1XUFA 1C9PA 1O2LA 2QXHA 3MU1A 5T6FA 3SV9A 5FBEA 1PYTD 3R3GB 2ZDNA 4MG3A 4K2YA 2PUQH 1A5HA 1D4PB 1V2ST 2ZA5A 5L6NH 1TALA 1OWJA 1P11E 1Y3WA 5DP3A 2BZ6H 3GY4A 4B71A 4THNH 1IQNA 3TK5A 1V6DA 1D6WA 2C4FH 1OWKA 2SNWA 3E1XB 3GCHC 4OS6A 2PTCE 1O2HA 3PWCA 1SFIA 4JK6A 4UE7H 4R8TB 2VIDA 4K8YA 3A7TA 4E7NA 3KQEA 4GLYA 1EAWA 3RXCA 1ZR0A 3BV9B 5FX5A 3TJNA 1SQOA 3GY5A 2NU0E 4MQAA 2FIRH 5L2YH 5HM2A 3ZYEA 4JZIA 1EKBB 1OWDA 4UDWH 1O37A 1DICA 1P9SA 1YF4A 3O8BA 1C5TA 4FUGA 2ASUB 3PYHA 1IHSH 1P0SH 3EQ0H 1AIXH 1C2MA 4DIIH 1L0ZA 1HXEH 1GDQA 1S81A 2J95A 2BVSH 1EZUC 4PROA 1ELBA 3SQEE 2H5DA 1PPGE 2BQ6B 2V0BA 5F8TA 2A2QH 3RXLA 4GSOA 5FBIA 3O8CA 3GICB 1IQMA 2OCVB 3T2NA 1GI1A 1PPCE 1IHTH 1ELFA 1F92A 2A31A 2ZFQH 1NFUA 3KCGH 4LXBH 1Q2WA 3MO9A 2QF0A 2FXRA 4A7IB 4JYVH 1UK2A 4JMYA 4YO9A 4AG1A 3EAJA 2VIPA 1BRCE 4K1SA 1ARBA 2ZFRH 2ZDVH 5J4QA 4K69A 3SU6A 1S6HA 2GT7A 1T8NA 3A86A 1SLXB 4XE4A 1W7GH 4O03A 1W0ZU 2GMTC 1LVYA 1GHAG 2ZF0H 3MH6A 1HJAC 4HGCA 4CR9A 5BPEA 1IQKA 1SGDE 1CGIE 1NT1A 5HMAA 4ZKSU 2JH0D 3URDA 4AB8A 3RMLH 3SV7A 1O38A 2Z3EA 5EQQA 5A0CA 1Y3YA 3TJVA 1S0RA 4JCNA 1C9TA 1OYTH 2FI3E 1QY6A 1O2OA 5DP6A 1QJ6B 2G8TA 5ETXA 3A87A 4Q7ZA 5JBCS 2GVFA 4NSVA 4WY3A 4BTTB 1K28D 2XNIA 3D49H 2Q6GA 5GXPA 2PW8H 1OP8A 1AE5A 1LTOA 1O2JA 3E3TA 1TNIA 3SUEA 4XSKU 1LQEA 1LVBA 1AKSA 4FUFA 1HAOH 2G55A 3NXPA 1C4U2 3K2UA 3Q3KA 1AFQB 1C5MD 2O8TA 2ZDLA 1NFXA 5E0GA 6CHAB 1PYTC 2ZFFH 2J92A 2NU2E 1P03A 1O5BB 1RXPA 1YPGH 1YC0A 3TH4H 1MAYA 3QZQA 1O2SA 4I33A 3S7HB 3ZZDA 2HWLB 2AGGX 5F03A 1BT7A 2P8OB 2J2UA 1MKXH 1YLDA 4UONA 4MLFB 1E34B 4JYUH 1TA2A 4D7GA 3T27A 4KELA 3RM0H 1BUIA 1HXFH 2TBSA 1PQ5A 2QAAA 4KP0A 2EI6A 3QGNB 4DOQA 1FDPA 1O2UA 2AH4X 2GGVB 1DPOA 4NIWA 4GCHG 2B9LA 2ZDMA 1TFXA 1ZPCA 1OOKB 3MOCA 4FUEA 2BDGA 1G36A 1SFQB 1AKSB 1EUFA 3UTUH 1GPZA 1ANCA 1UK3A 1ZPBA 1C2EA 1Q31A 1LCYA 1RTFB 4X2WA 5T6DA 4FVBA 3ESTA 4J2YB 1QQ4A 4B73A 5GWZA 1AFEH 1Z7KA 3QGJA 3TPIZ 4NZQA 4RN6A 4GUXA 3SHAH 2BM2A 3BG4B 2OQ5A 2WPMS 1DFPA 5DK1A 4IS5A 4Y0YE 2DE9A 5C3NA 1BB0B 1ZTKA 1DSUA 1O2GH 3GYMA 1O31A 1IQLA 5AF9H 2IPHA 1C4V2 3GYLB 5C20A 3ZYDA 1O2IA 3MHWU 1UCYK 1T8OA 2AS9A 2VGCB 1VGCB 1C5ZB 2GX4A 3FAOA 1EZQA 2Y5GA 3HK3B 2BLQA 3NUMA 2ALPA 2G5VA 2VH6A 2VWMA 1K1MA 5ABWA 2WPJS 3A7YA 2TIOA 2PUXB 5DGJA 2XC4A 1SR5C 3VXFH 1KLJH 1NFYA 1Q3XA 1BMMH 3RXJA 4MNVA 4BXSA 1AFQC 5JBTA 5DP7A 1RS0A 6CHAC 1H8IH 3HKJB 2BY7X 2Y81A 3LONA 4X8VH 4FXGH 4IN1A 4M7GA 1S84A 5LPFA 3F68H 2AMQA 3MO6A 3DD2H 5T3HA 1A5IA 1QRXA 1EAIA 1GHBF 2XBYA 4ZKOU 2XC5A 1AB9B 3BTTE 5EGMA 2AIQA 3A8DA 3RXTA 1Y5AT 2OC1A 1ZSJA 1V2NT 2CJIA 2PKSB 1C1MA 3SGAE 1MBMA 4WMFA 4O3TA 4XBDA 5EPNA 3H7TA 1F5KU 4ABIA 3CP7A 2UUJB 5DP4A 2H9TH 1YPEH 4CBOA 1YCPH 1CA0B 1K2I1 4CRDA 3V13A 3FP7E 1L1JA 2VVUA 1WSSH 1ELCA 2B8OH 1QL8A 3BTDE 4OS5A 5FAHA 1YPJH 1V3XA 1O2WA 1VCQA 1L2EA 2FYRA 1QA0A 5FPSA 2WUBA 3BG4C 1WTHD 1QQUA 1W2KH 1A3EH 3NWUA 3VGCB 2ZHQH 4Y0ZE 1OWHA 3M35A 4WJG2 3RMNH 4ISHH 3GDSA 1TGNA 2LPRA 4NG9H 2FOFA 4TY7A 1F2SE 1C1SA 1S5SA 1P2JA 1QNJA 1WV7H 5F8ZA 1GBHA 4IC5A 1GBAA 1AZZA 2UWPA 4NIXA 2VGCC 1VGCC 3GCTF 1ABIH 2THFB 1MU8B 3KNXA 3TIUA 4H6SB 2HNTC 1GG6B 1BMLA 3DA9B 1F0TA 1TNKA 4TPIZ 3QTVH 1NS3A 4ABDA 1KDQB 2GV6A 5C1YA 6GCHF 3SGQE 5DPAA 5C5NA 3LH3A 1AGJA 3OTJE 1DLKB 1NU9A 1NU7B 5EPYA 1FPHH 3K9XB 3DT0H 5EQRA 1AMHA 1GMHG 2F3CE 4A1TA 5A8ZA 2PGBB 4I8HA 1CQQA 2UWOA 2Z3CA 3P92A 2HNTE 3LC5A 3ENSB 3RXIA 1C1NA 3T25A 3LH1A 1FY8E 4SGBE 4CRGA 1KXBA 1MQ6A 2G52A 1GCDA 1GBLA 1OXGA 4INLA 5A8YA 1ETRH 2GDEH 4ZHLU 1LO6A 1L4DA 4XBCA 4JYTA 3SZNA 2G4TA 4I8KA 1AZ8A 2PKSC 1QURH 1SL3A 2NU4E 4FU8A 2J9NA 3L6PA 3P95A 5A8XA 3MFJA 3RXRA 1ZSKA 4ZH8A 4I8GA 3RC4A 1NN6A 3MH7A 1CT4E 2ZWLH 3HPTB 2WUCA 4NA9H 3OYPA 1CA0C 4X8SH 1F0RA 2VNTA 2IOTA 4AORA 4UFFH 1C1RA 2FP7B 1C2DA 4INHA 4ISIH 1HJ9A 1ZHPA 1FY3A 1E37B 1O2QA 4H42U 1MZDA 2HGTH 3ZVCA 1ELVA 1TAWA 3UNQA 1L1NA 3LC3A 3GDVA 3VGCC 1UTKA 1KTTB 1P06A 3RXGA 1MTUA 4DT7B 5LPRA 2BVRH 2ZQ2A 3TGJE 1Y8TA 5GCHG 2OUAA 1M9UA 4FU7A 3L33A 1NZQH 1O3PB