1GI5A

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
molecule tags Hydrolase
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi5A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi5A02
3LGYA 1P02A 4GHTA 1ZPCA 4Q7XA 1C5UA 3PM3A 3V3MA 1MKWK 2WINI 4KKDA 4D8NA 3ZVGA 1QRZA 2GCTC 3LGUA 2W7SA 1Z8RA 1BDAA 1DS2E 4BAHB 5GCHG 4R0IA 3P8NA 1A1RA 2VVUA 3MNXA 4X1QU 4XDEA 5LH8A 2R3UA 3TJUA 1ZRBA 2Y5GA 3A81A 1EZXC 2EI6A 2ZU4A 3GCNA 3U8OH 3VB5A 2J9NA 1GDQA 1O2WA 1HAVA 4UEHH 3I78A 1ANDA 4ASHA 4A1XA 5GPIB 3RXOA 1J9CH 1ZMJA 4DVAU 4AGJA 4DURA 1QNJA 1W12U 1O2GH 2PUXB 4M7GA 3P70B 1QBNA 2HGTH 1PPEE 4H6SB 5A09A 3S0NA 1YPGH 1C1NA 3G01A 3KIDU 4D7FA 2GT7A 3SNBA 1Y3YA 1TQ0B 2J92A 1EPTA 3GY3A 1D6WA 1W7GH 9ESTA 3PMBB 5GJ4B 2G52A 5FXLA 2YNBA 2ZFRH 4NWLA 1PQ5A 3SI4H 3FZZA 3KN2A 1KLTA 2ANMH 1YLCA 1QBVH 1O3MA 2UWOA 4INLA 1NRRH 2BX4A 4B2CA 1VGCB 3HATH 4Q7YA 2A4QA 2BDCA 1GMHF 5T6FA 1K2I1 1O2HA 2PR3A 1GI4A 4AYVB 2Y7ZA 1NRPH 1NFXA 1M9UA 1VCPA 3GY8A 3MI4A 4OGYA 4I32A 2JH0D 2WV5A 3H5CB 1AB9B 4Y8ZA 1XUJA 5EG4A 2FPZA 1G36A 4NA9H 1MTWA 2P8OC 5A8XA 1QRWA 1P03A 1Y5AT 4AX9H 8KME2 3LH3A 4I8LA 4Y71A 4Y7BA 1SGCA 1HNEE 1ARCA 2I6SA 2D2DA 5LPEA 1QL7A 3T27A 2A5KA 3MHWU 2ZDVH 1AGJA 1FPHH 3U9AH 3P95A 5F6MA 1LHCH 2VB0A 5F03A 1ID5H 2IN2A 1C5RA 1SGEE 4GCHG 2B8OH 5FX6A 2BDGA 3AW0A 4A7IB 1ZPBA 1VR1H 1S84A 1O3FA 3P6ZB 5EGMA 1WSSH 1GBCA 1GMCF 1OP2A 5SGAE 3OY6U 4MPUA 3ZVAA 5DP3A 1Z8GA 2F83A 2NU1E 1AD8H 1W3CA 1HAHH 4CRGA 1F5KU 2ZHEH 1E34B 1K1PA 2V3OH 1SI5H 1BHXF 1PPGE 1C1QA 3BTKE 3TJVA 3ATLA 3DUXH 4FVDA 1VJ9U 3RC5A 1C1MA 2GKVE 1TB6H 2G00A 2BXUH 1P11E 1UTOA 3U1JB 3NWUA 4YT7H 2BDBA 2XTTB 3PTNA 1IQMA 2WYJA 1KXEA 3A82A 1TABE 4CRDA 1V2LT 2TPIZ 1O3DA 2IOTA 1Y5UT 3RXUA 1EAIA 1TGCA 1RIWC 2JKHA 1DLEA 5EU8A 3A86A 4RKJB 3KHVA 3AASA 1UCYE 3F9EA 3W94A 7GCHG 2ZU5A 4K8YA 2WPMS 1UVSH 2F9VA 4FUFA 2G55A 1HPGA 3BTHE 3U8TH 1TFXA 2DE9A 1YLDA 4BAMB 4ISLA 4NFEA 5DP6A 5DGJA 1GJDB 2XBVA 3EA9A 3QZQA 3U69H 3U8RH 1B5GH 4ISOA 5JDUB 3GOVB 2NU2E 3Q3XA 3DFLA 3UR9A 1GJCB 3HKIB 3SUEA 3TPIZ 3TGIE 1GGDC 3SOSA 1XUFA 3RU4T 3PLBA 1GHYH 1V2NT 4GSOA 1WBGB 2W5EA 3LC3A 1TE0A 3A83A 2P93A 3K2UA 3LJOA 1NZQH 1GMDG 4WMFA 5EXNA 1UK2A 3L6PA 1H9LB 2GZ8A 1F0TA 2P59A 2P94A 1O2JA 2SGEE 2ZQ2A 2O8WA 1NPMA 1MU8B 2BLWA 3M5OA 2QXJA 1NROH 2QXHA 1C2LA 4BTTB 2WYGA 2PLXA 1EP6A 2P3TB 1ESBA 2P8OB 1EJAA 1BA8B 1SGDE 5EXMA 5FPSA 1A0JA 2ZI2H 1MTNB 4DW2U 4TY6A 1YPKH 1DM4B 4NWKA 4BOHA 4WXVA 5DKMA 1RTLA 3V13A 1AQ7A 1CQQA 2ZPSA 5HGGA 1EAWA 1MMJN 1ZGVA 2ODPA 4YO9A 1HUTH 3GCHB 3BTFE 4BAOB 1INCA 1FUJA 5JBAS 3RXHA 1Z1JA 1GHAG 1VJAU 1P3EA 1T4UH 3BTWE 1CHOF 1O3JA 3PO1C 1ESAA 1W0YH 4O03A 2R2MB 1A46H 1S5SA 1TX8A 3ATKA 4IW4E 4RN6A 1FXYA 2FMJA 4ZROA 2BQ7B 4NZQA 1IQGA 3EA8A 3MU4A 3RUOA 5PTPA 4D9RA 4CH8B 4NIWA 2BX3A 1HAOH 2AEIH 1O37A 1C5QA 2O8UA 2PHBA 2QF0A 1ZYOA 2GDDA 1NFUA 2ZTYA 4GVUA 3SU3A 5EQQA 1J14A 3KQCA 1OWIA 4ESTE 2Y81A 3AAUA 4ABFA 1NU7B 4XSKU 2TGDA 3BTQE 4B73A 1C1WH 2WPHS 4F49A 5EODA 1TWXB 3RMMH 1MKXK 1GHZA 1H9HE 2LPRA 5FAHA 1RIWB 1GBJA 1NFWA 4GAWA 1SHHB 5EW1H 2FXRA 2Y5FA 1C2GA 4B71A 1D3PB 2ZFTA 1PYTD 1TQ7B 1AVXA 1AMHA 1RGQA 2THFB 3RXLA 5TCAA 1Z6EA 3BEUA 4X0WU 1NU9A 2A32A 1LVYA 3RMLH 2CHAC 2H9EH 4Y6DA 3UOPA 1GJAB 3BSQA 3SU4A 1QA0A 1O2NA 1W11U 4OS5A 6CHAC 1LHEH 7LPRA 2BM2A 3K6ZA 3TK9A 2G5VA 2FI4E 4YESB 2GVFA 3VB3A 3RU4E 1DITH 1GGDB 4A5TS 1O2ZA 1GI2A 5ABWA 3VFEA 3FP7E 3E8LA 3RXIA 3STIA 2AMQA 2QF3A 2ZPQA 2BB4A 1C5SA 1ARBA 2CV3A 1XVOA 2FOCA 3QGNB 1D3QB 3SV9A 2NU4E 1SGQE 1AZ8A 3RM2H 1GI6A 1NT1A 4RSPA 4Y8YA 2ODYB 2H9TH 3GY6A 1TNLA 1KTSB 1P0SH 1O3GA 3VXEH 4NSVA 1IQJA 2ANYA 1NTPA 2G51A 3SU2A 4FUEA 1CGHA 2SNWA 2ZHWH 1Y3XA 1QJ6B 3FVFB 4A6LA 1O5FH 4X1SU 1W0ZU 1FY4A 2G8TA 1GVKB 3T26A 3FP6E 4XBBA 3F9FA 4XOJA 2FEQH 4CR5A 1LTOA 1UVOA 1O3PB 5TCCA 3F9GA 1SLVB 1PYTC 1O2UA 3MO3A 2BD2A 1BJUA 3RU4D 2AGIX 1H9IE 1QR3E 2UUFB 1SGFA 1IQIA 1HYLA 4MNYA 4X8SH 1ANCA 2VIQA 4BXWA 1KXBA 1UJ1A 3PO1B 3PLPA 2ALVA 3LIWA 1L0ZA 2BOKA 5IDKA 3OU0A 2WV4A 4DIIH 3P8GA 5DG6A 1O2KA 1W10U 3TGJE 1JRSA 4DY7B 1SBWA 5C1XA 3ZVDA 1SQAA 1TMBH 1O38A 2A7HA 3WY8A 3ZV8A 4ABAA 2WUBA 1BZXE 2Y80A 4AFQA 2ZGXH 3ZYEA 1TPPA 2J95A 3ATMA 1JBUH 1OP8A 1SFIA 3RXDA 4X1PU 2XXLA 4GCHF 4UFEH 1TOCB 4Y76A 1FQ3A 2ZCLP 2XC4A 3TIUA 2OC0A 2VVVA 2QGRA 2BD4A 3ZZBA 2GMTC 3ZV9A 3T25A 3TNSA 1ZSLA 1YYY1 1AI8H 2CHAB 1QL8A 2WUCA 3FAOA 2F9PA 3MFJA 3LOXA 4JYUH 1NRSH 2ZDKA 2FESH 3KF2A 2ZFSA 2BY9X 1MH0A 3MU1A 1YP9A 4TPIZ 3K65B 5JB8S 3SJ8A 2I6QA 1V2UT 1SPJA 1H8IH 3MWIU 1O2XA 5EXLA 3E6PH 1FLEE 2UWPA 3ZZCA 1S83A 3T2NA 1CBWC 1C2DA 1V2OT 4INKA 4NCYA 1NC6A 2FZZA 3M36A 1L4ZA 1J15A 8ESTE 1TGSZ 4K1SA 1EB2A 1GBFA 1BTXA 5A0AE 1HIAA 1ZGIA 3S69A 4AG2A 4HGCA 1J8AA 1C2EA 4ZHLU 1Z8IB 1XUHA 7GCHF 3TK6A 2A2XH 1DXWA 1TMUH 1GHBF 2FOEA 1K1JA 3GYMA 3ZZ7A 1FMGA 3SU6A 4ZKRU 2VNTA 2GGVB 4NIVA 3UPEA 2VIWA 1BTZA 3A7XA 2C8ZB 1QFKH 2XBYA 4YOJA 3UQOA 1T8LA 3RXBA 1GJ9B 2BY8X 1TA6A 2FOHA 1GI7B 4CREA 1C1UH 1O5AB 5DP7A 1AWFH 5HM9A 1V6DA 1DT2A 2GD4B 1W14U 1ZHMA 1T8OA 5T6DA 1S81A 1DPOA 2H2ZA 3KQBA 1DY9A 1A5IA 3FP8E 4JYVH 4K1TA 1TNHA 2BLVA 3T28A 2AMDA 1CGJE 1NY22 1CGIE 1L4DA 4X2WA 6LPRA 1CA8B 1BRAA 1QTFA 1XM1A 1ORFA 2G4UA 4OS4A 1Y3VA 1A3BH 1SG8B 1DDJA 1E0FD 1VITG 3MTYA 1O31A 3MU8A 1KXAA 1V2WT 2RA3A 2QIQA 2AYWA 2FO9A 2SGPE 1RS0A 1QQUA 1UK3A 1OWJA 4ABHA 3ZZAA 1AVWA 1ZMLA 2ALPA 3Q00A 4CRCA 1YPJH 3SNDA 1FZZA 3UFAA 4CRBA 3RXEA 2ZIQH 2NU3E 1CT2E 4DOQA 4D9QA 1MBMA 3D65E 3A7WA 2OP9A 4JZIA 1AHTH 1CHGA 2BOHB 3W95A 1C5PA 3GISB 3RXSA 2ZGHA 1EZQA 1EASA 4WMEA 2FX6A 1ELBA 2BTCE 2GMTB 1HXFH 2TRMA 1XUKA 1MZDA 4AZ2B 1SGFG 1FY5A 1EB1H 6GCHG 2R0LA 1C2KA 4BAQB 4JZ1A 1CA0C 4CBOA 5E2OA 1ZTLA 1K1MA 1GL1A 2QN5T 2BD5A 1C2HA 1ETTH 1ELTA 4K3JA 2JH5D 4TYDA 3K6YA 1FY8E 2F91A 1HV7A 2SGAA 1O3EA 1IHTH 3MU5A 1J16A 3SW2B 1CBWB 1AY6H 1O2RA 3M37A 3QZRA 1K1NA 2CXVA 4VGCC 2Z94A 1SLUB 1V3XA 1C2FA 2AH4X 1ELDE 2ANWA 3EQ0H 2BY7X 1V2TT 2UUKB 1ANEA 1KXFA 2CJIA 1EX3A 4IGDA 3SN8A 5K0HA 2QCYA 2VIOA 3ELAH 1BCUH 1ZOMA 1WQVH 1O3BA 1V2KT 1O2IA 5HYOA 1HAYB 2GCHG 2Z3CA 2QYIA 1B0FA 4I33A 1MKXH 1O2MA 1Z7KA 1X7AC 2A7CA 4MVNA 1P9SA 1ESTA 4H42U 3ENSB 2ZZUH 3HGPA 5JYIA 1SOTA 1WUNH 3ODDA 2PW8H 1PJPA 1GBHA 1O2TA 5JB9S 5FPTA 1P12E 1O5EH 1OWEA 1GBBA 1SLXB 4KTSA 1BBRH 1BMMH 3LH1A 4O9VA 1IQHA 3CS7A 1AU8A 3O8RA 2ZFQH 4DT7B 1GBLA 2AIPA 3SNCA 1DWEH 2TGPZ 1EJNA 2OQ5A 1DICA 2A2QH 3SUDA 2FI3E 2ZGJA 1O30A 1SQOA 5DP8A 3M3SA 1BT7A 1WQSA 3SUGA 2RA0A 3UIRA 2HPQH 4XBDA 5C1YA 1GDUA 1TRYA 3I29A 3MO6A 1MU6B 4HTCH 1T8MA 2BZAA 3UY9A 3V12A 3VGCC 2SNVA 4A1TA 4U01A 1C1PA 3FZDA 2GCTB 1ZSKA 3PV4A 2IPHA 4LZ4B 3LJJA 3QTOH 4MDSA 1O2VA 2ZGCA 1BOQA 2ANKH 4E7NA 4FVBA 1O2LA 1DX5M 1YCPH 4FUCA 1BTYA 4AFZA 4X6MA 2OXSA 1YM0A 3BG4C 4MQAA 3BTDE 4B76A 1RFNA 1NFYA 1C4Y2 1V2QT 1GJ6A 1AE5A 4NGAH 3SO3A 3SV8A 1SGYE 5T6GA 1J17T 1QB1A 3B23B 3A8AA 2A1DB 1SLWB 1TONA 2STBE 1S0RA 3M7UA 1YPMH 5FPYA 5L2YH 1SL3A 2ZDNA 4WY3A 4TWYA 1FI8A 3ZZ9A 3MH5A 3M5NA 4UFGH 3RXPA 3U98H 2DE8A 3IG6B 1K1OA 2AGGX 1Y3UA 4KGAA 1QJ1B 1FIWA 3PB1E 2Z3DA 1G2LA 1TRNA 3MYWA 1RTFB 3I77A 3V0XA 5JBCS 1MTVA 1ZPZA 4OGXA 1HB0B 2FTMA 4Q7ZA 4B2AA 4K5ZA 2ZPRA 3SGAE 3A89A 1FJSA 1W8BH 1A3EH 1SVPA 4AYYB 4VGCB 4X8UH 4B1TA 4X1NU 1YC0A 3VB7A 1MAYA 3UREA 1ACBE 1HJ9A 1FY3A 4GPGA 1PPZA 2EEKA 5C20A 2Q6FA 1LMWB 1ETSH 3IITA 2D8WA 3NPSA 3UUZA 1ZLRA 1HGTH 1T8NA 1C5YB 2ZEBA 2RG3A 4IN1A 3AVZA 4UONA 2HNTF 1DWCH 3GCTG 5CMXH 1XX9A 4JZFH 4RKOB 1MAXA 5AHGH 1TGTA 1C4U2 1PPBH 4UDWH 2Z9LA 5DK1A 3TJNA 1WTGH 3SUFA 2R9PA 2BQ6B 1SGTA 1ZTJA 1HIAB 1W13U 1BRCE 2HRVA 1YF4A 1C5NH 3GDUA 1W2KH 1HFDA 4JZDH 1G3BA 1PQAA 1G9IE 1EP5A 2GTBA 2STAE 5AFYH 4FUHA 3OTJE 3GDSA 2BQWB 2PUQH 1EXFA 4WH6A 4GUXA 1O32A 1O5DH 3KNXA 5C2ZA 1BBRE 3AAVA 1MD8A 1GVLA 1TX7A 1P2IA 1O2PA 1JIRA 1TNGA 3LGVA 2BDHA 1FAKH 1BIOA 1WV7H 1DANH 1WYKA 3TK5A 4ZKSU 1ZZZA 1QBOA 2FOAA 2AERH 1C1SA 1B0EA 1EAUA 3SU5A 1O2OA 4UE7H 5CE1A 5GWZA 4IC5A 4CHAC 4K69A 3P8FA 1RJXB 4BXSA 1GBAA 4X6PA 1XMNB 1HLTH 1THSH 2ZP0H 1ELAA 4ZXXH 3PMAB 2ILNA 1TGNA 1BMNH 1MQ5A 1BMAA 4JYTA 4NFFA 2PTNA 3BG4B 1DSUA 5E2PA 2R3YA 2G5NA 3P8OA 7ESTE 1FNIA 2QC2A 2J2UA 2ZG0H 1UK4A 2XCNA 4I8HA 1S6HA 2A4GA 1B7XB 1S82A 8GCHG 4OS2A 2XBWA 4B2BA 1BBRK 1ABIH 3QDZB 1WU1A 1P2MA 4WJG2 1TAWA 4YOGA 1NN6A 1DSTA 1BB0B 1ELFA 1V2VT 1ZRKA 1VITF 2B9LA 3BF6H 1C1RA 3UQVA 3ATWA 2ZF0H 2WPIS 2OBOA 2XYAA 2TBSA 3LU9B 3ZVBA 2OCVB 1P8VC 3TJOA 1RD3B 2Q6DA 4XFQA 1LO6A 2BMGB 3EYDA 5F8ZA 3SV7A 4LXBH 5GCHF 4YT6H 3E3TA 5L2ZH 2VIDA 4OS6A 2A7JA 1IQKA 1BTUA 2XC5A 1C5MD 2FOBA 2Y7XA 3LPRA 1WCZA 4MLFB 2ZKSA 4DCDA 3VEQB 1DFPA 1YCPK 4OS7A 1K9OE 1H8DH 1EOJA 5BRRE 2C3SA 2O8LA 2WPJS 1ETRH 1G2MA 4THNH 1C9PA 1DUEA 1LHDH 4ZHAA 1JRTA 1C1OA 6GCHF 1A4WH 2V35A 3RXVA 4O3TA 2FYQA 5FCRA 1BTWA 1QRXA 2W26A 1D3DB 3PMHB 3S9BA 4QT8C 1GMCG 3GY7A 2D26C 2VGCC 3MH7A 3PTBA 5A0CA 4AN7A 1OS8A 5HXFA 1N8OC 2FIRH 2FYRA 2J34A 1TBQH 3A88A 1ZHPA 2AMPA 1AE8H 2QV1A 1Y3WA 2BVXH 1O3AA 1N6XA 4WMDA 2ZHFH 1PQ8A 3Q3KA 2D1JA 1AFQC 2QY0B 1HXEH 1BTPA 1T4VH 2Z7FE 1A61H 2QA9E 1ELGA 5K7RA 1NS3A 2EA3A 2O9QA 4YZUA 1MTSA 3RC4A 2A4OA 2FS9A 2TGTA 3CP7A 1KY9A 3UNQA 1TNJA 1XVMA 3KGPA 3LGIA 2BD3A 1O0DH 3TH2H 4JMYA 1L1NA 2SGFE 3NKKA 1SGIB 1UTQA 2Y5HA 5DJ7A 1LCYA 4YM9A 1TA2A 1P01A 3H7OA 1TRMA 4CBNA 4Z0KA 1Y5BT 3T29A 1ZMNA 3RMNH 4MG3A 3BTGE 3KEEA 3V7TA 4AB9A 1Z8JB 3RXGA 3EA7A 1F0SA 1O3HA 2ESTE 1O5BB 5J4SA 5C5NA 2BY5X 5HMAA 2F9OA 2PKSC 1EQ9A 1QL9A 3SHCH 1SOZA 3Q77A 1FDPA 1QQ4A 4X1RU 3QUMP 1UTMA 5BPEA 1H1BA 3F6UH 1G3CA 1O33A 1WAYB 1YPEH 1SFQB 1Z71A 2BXTH 2VINA 2SGQE 4TWWA 5EPNA 3QWCH 3UWJH 6CHAB 1FIZA 3QTVH 1AIXH 3P92A 2GZ9A 2VWOA 4AG1A 1F0UA 1DUAA 1C5LH 2Y6TA 2A31A 1QIXB 5ESTE 2WPLS 4O3UA 2H5CA 5J4QA 1DE7H 3SJ9A 1ZJKA 1G30B 2P95A 1Y8TA 1PPFE 1P04A 1MCTA 2FLBH 3GCOA 3MNSA 1UTPA 1BMLA 2PGQB 4Y10E 1N1LA 1GJ5H 4K1EA 1BHXB 2W3KA 3FFGA 3RM0H 4AOQA 1XUIA 1VCWA 5DP9A 3URDA 3UNRA 4E06H 3M5LA 2FODA 1TPSA 3ZZDA 1JOUB 3MO9A 2BZ6H 1RTKA 1K1LA 5LGOA 1VGCC 1XKAC 4WXIA 1CHOG 2A5IA 2UUYA 3GY5A 3EDXB 2H5DA 3PWCA 1IQNA 1GBEA 1MZAA 1N8OB 3UTUH 1JWTA 7KMEH 4HI3A 4I8JA 1E38B 1BRBE 3ZVEA 4NG9H 1HJ8A 1GPZA 1O3KA 4AGKA 1TGBA 2V6NA 4FU8A 2FOGA 2OINA 3LONA 1K28D 1PFXC 1GMDF 3SV2H 1VZQH 2ZCKP 1MUEB 1UTJA 1C2JA 1Q31A 1IQFA 1AFQB 1A0HB 1OYQA 4X2VA 1O34A 1UMAH 2JETC 2B7DH 2ZA5A 4WWYA 5A8ZA 4FU9A 1UVTH 2HPPH 3DT0H 1HAGE 3C27B 3UWIA 2CF9H 4YOIA 3Q76A 1PPHE 1P3CA 2C8XB 4FUJA 1P2QA 3A87A 5GIBA 1DLKB 1LHFH 2VH6A 4Q80A 2BD9A 3O8CA 2ZECA 1EATA 4X6NA 1TOMH 4CRAA 2OC1A 4NSYA 3PMJA 4BNRA 3URCA 4ISIH 4H6TA 3D62A 4Y8XA 2PKSB 2XNIA 2H1UA 5ESBA 4A1VA 2OD3B 4YTAA 3NXPA 2Q6GA 1F92A 1GHAF 2J94A 1HAZB 1YPHC 2GV6A 1SHYA 4NZLA 1LVBA 5B6OA 1UCYH 5I25A 1ABJH 2ZHQH 1GJ7B 1EUFA 5AVDA 5GXPA 4JK5A 2WPKS 3MNCA 9LPRA 1LVMA 1GL0E 1RXPA 3HK3B 3MH6A 3L33A 3E0PB 1HBTH 1P9UA 4IS5A 1K22H 1KTTB 3RLWH 2PGBB 1SGRE 3MMGA 5T3HA 4ABIA 4IC6A 2J38A 2R2WU 1THRH 3BIUH 3RXMA 1BRUP 1SSXA 1H4WA 1O2SA 1QB6A 3BTEE 2HLCA 4MPXA 1GG6C 1WOFA 4ISHH 4K60A 4AB8A 1NRQH 1PPCE 2R0KA 1A5GH 1FN8A 1GI9B 1UO6A 2VWMA 2A45B 1C5OH 1C2IA 4GLYA 8GCHF 1G3DA 1A0LA 1P2NA 4Y11E 1C5TA 4O97A 1BQYA 3SI3H 2PSYA 3A7YA 4ISNA 1TPOA 2VJ1A 4DJZB 1GBDA 4Y0ZE 1DOJA 3SJOA 1BTHH 2VIPA 2Z9IA 4X6OA 3U1IB 5JBBS 2BVRH 2G4TA 1VCQA 2BLOA 4MTBA 3LGTA 1QURH 2C90B 2PWXA 1QCPA 3QLPH 3ZYDA 1TBZH 1UHBA 1YPLH 3A8CA 1SC8U 2DUCA 1Z1IA 1AZZA 1TBRH 5LPFA 3M7TA 1KSNA 1QGFA 3SHAH 5JPMH 4JZEH 2QAAA 4HZHA 1GI1A 4CR9A 1RRKA 1KIGH 1OSSA 3ITIA 1E36B 4Y79A 2CGAA 2JETB 3HGNA 1F2SE 1MTNC 4MNVA 3TNTA 2F9NA 4B74A 2FI5E 1TLDA 1EJMA 3BG8A 4CH2B 3PLKA 1E35B 2GDEH 1IAUA 2F9BH 3KL6A 5E0HA 1QA7A 3TVJB 2GP9B 1TX6A 2ZNKH 3M5MA 3GCHC 4J1YA 2ZDAH 1KXDA 2AIQA 3EGKH 4INHA 1IQEA 4X8VH 4U30A 1T31A 1THPB 1IQLA 2CF8H 1GJ8B 3A7VA 4AFUA 1XKBC 1O3LA 5L6NH 2VIVA 5C5OA 2YNAA 2FS8A 1T32A 2BDIA 2F9UA 1SR5C 1Q2WA 2OUAA 5DPAA 1NRNH 4ABEA 1UVPA 2Z6BD 2M5TA 1DVAH 3RDZA 4CRFA 3A8BA 1G32B 1EZUC 4SGBE 4MPWA 2P16A 2C8YB 1Z6JH 2BYAX 1LDTT 1A7SA 1SGNE 1O39A 3M61U 3QK1A 4NIYA 3SNEA 2FOMB 2UUJB 1GDNA 1CA0B 2BDYA 3HK6B 4ABJA 1GHVH 1P57B 1TALA 1AFEH 1CU1A 5DP4A 5C1UA 3A84A 4FU7A 3VB6A 2YOLA 3PWBA 1C5WB 4FUDA 3O8BA 5E0JA 1GHBG 2ZO3H 1EOLA 3VPKA 2SGDE 2ZGBH 3SZNA 4UD9H 1TPAE 3O8DA 1GG6B 3TH4H 3RXCA 4JK6A 3UOUA 2FM2A 1TIOA 4ABGA 3M35A 2O8TA 1GI3A 4ZUHA 2QXGA 1MQ6A 5FCKA 4MNXA 2ZFPH 1HAPH 2PKAB 2ZDMA 4PROA 2GV7A 1F5LA 1OXGA 2EC9H 2LNCA 2K1QA 4NA7A 1O5GH 1P05A 3IWMA 1A2CH 4AFSA 1OWHA 2VWLA 4ZMAH 5A0BA 3ODFA 3M3VA 4NIXA 4A92A 1KDQB 3OY5U 1AO5A 1C5ZB 1DY8A 3QN7A 2FTLE 1OKXA 3RLYH 1YCPM 2OC7A 3L3TA 1UTLM 3MOCA 5A2MH 2VU8E 5E0GA 5F8XA 2C8WB 1UCYK 4TPYA 1GJ4H 2XC0A 1NM6A 3GICB 2ASUB 1MTUA 2Z3EA 1KYNA 1O2QA 1C4V2 3TLOA 1F0RA 1ZR0A 1EPTC 1CT0E 3PROA 1S85A 1FPCH 3HKJB 1L1JA 3M7QA 2BDAA 2XBXA 1HDTH 1UTKA 1FY1A 1OX1A 4IBLH 4X8TH 4I7YH 5FHTA 1VITH 4ZKNU 2ZU1A 1QJ7B 3M3TA 4X2XA 1YKTA 4WF8A 2EI8A 1V2RT 3AW1A 3ZZ6A 2P3UB 1BITA 2HALA 2HOBA 3GYLB 5AFZH 5EW2H 3A80A 3A7TA 2Z9GA 3RXQA 1L1GA 1EAXA 4YLUA 3VGCB 1F5RA 1O5CB 2TIOA 5AF9H 2FDAA 3EE0B 3RXFA 4U32A 1SMFE 1C9TA 1XXDA 2PSXA 1O3OA 2ZFFH 1D6RA 1GCTC 2ZU3A 1FN6A 2ZDLA 1AKSB 2F3CE 1ZTKA 1IHSH 1YGCH 3ZZ3A 4R8TB 1QY6A 5CHAC 2XWAA 2ZC9H 1AN1E 1P06A 2G81E 2PTCE 1LHGH 1ELCA 2JH6D 1YBWA 3TGKE 2ZHDA 1NESE 1JIMA 1HJAC 3ATIA 1WTHD 3LC5A 5E8EH 2RCEA 3STJA 3SU0A 2ZCHP 3QGJA 1LVOA 3E0NB 1D4PB 2Y82A 4KP0A 3SNAA 1GCDA 1GI5A 2OQUA 4TY7A 3ZVFA 2FOFA 2ZQ1A 2HNTE 3BEFB 4IMQA 2KAIB 1Q3XA 3SORA 3DFJA 1MD7A 1HAXB 1GMHG 1SQTA 2OBQA 3DA9B 3NZIA 1EZSC 3T5FH 1ELEE 2H6MA 4X2YA 1PQ7A 5FBIA 2FLRH 4FXGH 1HAIH 1ELVA 3S9AA 4WH8A 4DGJA 1C5XB 1CVWH 4B75A 1AVGH 1K1IA 2QXIA 1AWHB 5ETXA 3NUMA 1P2OA 5TJXA 2BVSH 1GWAA 3H7TA 3VB4A 4UFFH 1LKBA 3CS0A 4E05H 2CMYA 3ZZ4A 1C1TA 1LPGB 5C3NA 1XXFA 4ZXYH 1HAVB 1GVZA 4Z6AH 5I46H 3OSYA 3K9XB 3DHKH 3MU0A 3R0FA 4K2YA 4IN2A 3TH3H 2XRCA 2Q1JA 2IJOB 5DO4H 1O36A 3E1XB 4FUIA 3SJIA 2TGAA 1V2PT 2NWNA 3MH4A 2UWLA 3ZVCA 1DWDH 1MKWH 2BD7A 1D9IA 1O35A 2VH0A 3LDXH 3ZZ8A 1JMOH 3GDVA 2EI7A 1OOKB 5GDSH 1EPTB 1O3IA 3A7ZA 3SGBE 3S7KB 1OYTH 1CE5A 2B0FA 1E37B 4GHQA 3LKWA 4NA8A 4FUBA 1LPKB 5HM2A 1V2MT 3P17H 4I8KA 1KLJH 1OP0A 4ZH8A 1TNIA 5F8TA 3RXTA 1GHXH 2GT8A 2GX4A 1OPHB 1O3NA 1GI0A 3OYPA 1GBKA 1K21H 3B8JA 1ZHRA 4KTUA 5L30H 1KXCA 5EQRA 3ESTA 1XUGA 4BAKB 2V3HH 2H9HA 3E90B 1UHBB 2GCHF 3LT3A 1SB1H 3NK8A 2GZ7A 4MNWA 4KTCA 4CHAB 2O8MA 3R3GB 1LQEA 3FANA 3BEIB 1LKAA 4K8BA 1CO7E 1D3TB 5LPRA 3BIVH 1GCTB 1FV9A 4UFDH 4Y0YE 1W7XH 3S7HB 1SGPE 5CHAB 4ZHMU 5FX5A 3D23A 1TNKA 2XCFA 3B9FH 1BJVA 3C1KA 1BUIA 1GBIA 2NU0E 2VVCA 4WVPE 1P09A 1HJAB 4JCNA 4KELA 5A8YA 2BY6X 2Z9JA 1ZSJA 3DD2H 1V2JT 2CN0H 3RMOH 2HNTC 1IOEA 1OWDA 2ODQA 1TMTH 1N6YA 5DP5A 3OX7U 1DWBH 1TYNA 4ZKOU 2PKAA 3TITA 1A5HA 1O2YA 1YPHE 3EAJA 3SV6A 1LQDB 4IMZA 5EOKA 1DXPA 3ZZ5A 1UTNA 2BLQA 1HRTH 3SQHE 1FONA 1CSOE 1KDQA 4XE4A 3VXFH 1G37A 1MCVA 4LZ1H 1O3CA 1UVUH 4BANB 2PV9B 5EQSA 2A4RA 1T7CA 2ZTZA 6ESTA 1ANBA 3GY2A 1FAXA 3CENA 3KQDA 1C2MA 2J4IA 4AORA 3A85A 3LGWA 5H4IB 4MPVA 3RXJA 1Y59T 2A5AA 3GY4A 4Q2KA 4BTUB 4DG4A 3T62A 3Q3YA 4ABDA 1C1VH 3RC6A 4D7GA 5IYTA 4DIHH 1L2EA 3D49H 1GI8B 1LPZB 1QHRB 4J2YB 2A0QB 2VWNA 2HVXA 2OLGA 2OC8A 2FX4A 4ZAEA 3RXKA 3UR6A 1P2JA 2FP7B 3N7OA 5C67A 3KQEA 2AS9A 4Y7AA 3QO6A 4F4OC 2AGEX 3SU1A 4H4FA 1S6FA 4HFPB 3E91A 3HPTB 2P3FH 1C5VA 2AFQB 2VGCB 4XBCA 3JZ2B 2C93B 3PYHA 5FBEA 1G3EA 3UNSA 1AUTC 1AUJA 4I31A 2OTVA 2Z9KA 1V2ST 1EKBB 8LPRA 3A8DA 3NCLA 3BN9A 2FWWA 3KCGH 1GHWH 3BTME 1AB9C 4E7RG 2B5TB 1U6QA 1GJBB 3QX5H 5EPYA 2W3IA 1AKSA 1P2KA 5JBTA 3F9HA 1GBTA 2HWLB 3S9CA 1NO9H 1QB9A 5G4BA 1CT4E 1JXPA 3SJKA 4D76A 2RDLA 4I8GA 4U2WA 1HCGA 2V0BA 2ZWLH 3GCTF 1ZJDA 3SBKA 1OWKA 3JZ1B 1F7ZA 1P10A 2XWBI 2ZTXA 2ZU2A 3RP2A 4SGAE 3SQEE 2ULLA 3RXAA 3BTTE 2W7UA 4LK4A 3SGQE 4BTIB 1KLIH 2BD8A 3MNBA 4ABBA 3F68H 3E16B 4YLQH 3TU7H 2XW9A 2BHGA 4FUGA 2KAIA 2PFEA 3RXRA 4LOYH 3F1SB 4OS1A 2SFAA 3BV9B 2C4FH 1MBQA 1GBMA 1S0QA
chains in the Genus database with same CATH superfamily
3LGYA 1P02A 4GHTA 1ZPCA 4Q7XA 1C5UA 3PM3A 3V3MA 1MKWK 2WINI 4KKDA 4D8NA 3ZVGA 2LELA 1QRZA 2GCTC 2QE7D 3LGUA 2W7SA 1Z8RA 3PV5A 1BDAA 1DS2E 4BAHB 5GCHG 4R0IA 3P8NA 1A1RA 2PP6A 2VVUA 3MNXA 4X1QU 4XDEA 5LH8A 2R3UA 3TJUA 1ZRBA 2Y5GA 3A81A 1EZXC 1K0HA 2EI6A 2ZU4A 3GCNA 1VKYA 3U8OH 3VB5A 2J9NA 1GDQA 1O2WA 4Q4LA 1HAVA 4UEHH 3I78A 1ANDA 4ASHA 4A1XA 5GPIB 2V3MA 3RXOA 1J9CH 5EIYA 1ZMJA 4DVAU 4AGJA 4DURA 1QNJA 1W12U 1O2GH 2PUXB 4M7GA 3P70B 1QBNA 2HGTH 1PPEE 4H6SB 5EJ1A 5A09A 3S0NA 1YPGH 1C1NA 1KMHB 3G01A 3KIDU 4D7FA 2GT7A 3SNBA 4HG6A 1Y3YA 3N7DA 1TQ0B 2J92A 1EPTA 3GY3A 1D6WA 1W7GH 9ESTA 2KCAA 3PMBB 5GJ4B 2G52A 5FXLA 2YNBA 4AC9A 2ZFRH 4NWLA 1PQ5A 3SI4H 3FZZA 3KN2A 1KLTA 2ANMH 1YLCA 1QBVH 1O3MA 2UWOA 4INLA 1NRRH 2BX4A 1UW7A 4B2CA 1VGCB 3AK5A 3HATH 4Q7YA 2A4QA 2BDCA 1GMHF 5F53A 5T6FA 1K2I1 1O2HA 2PR3A 1GI4A 4AYVB 2Y7ZA 1NRPH 1NFXA 1M9UA 1VCPA 3GY8A 3MI4A 4OGYA 4I32A 2JH0D 2WV5A 3H5CB 1AB9B 4Y8ZA 1XUJA 5EG4A 2FPZA 1G36A 4NA9H 1MTWA 2P8OC 5A8XA 1QRWA 1P03A 1Y5AT 4AX9H 8KME2 3LH3A 4I8LA 4Y71A 4Y7BA 1SGCA 1HNEE 3SZEA 4FOUC 1ARCA 2I6SA 2D2DA 5LPEA 1QL7A 3T27A 2A5KA 3MHWU 2ZDVH 1AGJA 1FPHH 3U9AH 3P95A 5F6MA 1LHCH 2VB0A 5F03A 1ID5H 2IN2A 1C5RA 1SGEE 4GCHG 2B8OH 5FX6A 2BDGA 3AW0A 4A7IB 1ZPBA 1VR1H 1S84A 1O3FA 3P6ZB 5EGMA 1WSSH 1GBCA 1GMCF 1OP2A 5SGAE 2IPQX 3OY6U 4MPUA 3ZVAA 5DP3A 1Z8GA 2F83A 2NU1E 1AD8H 1W3CA 1HAHH 4F55A 4CRGA 1F5KU 2ZHEH 1E34B 1K1PA 2V3OH 1SI5H 1BHXF 1PPGE 1C1QA 3BTKE 3TJVA 3ATLA 3DUXH 4FVDA 1VJ9U 3RC5A 1C1MA 2GKVE 1TB6H 2G00A 2BXUH 1P11E 1UTOA 3U1JB 3NWUA 4YT7H 2BDBA 2XTTB 3PTNA 1IQMA 2WYJA 1KXEA 3A82A 1TABE 4CRDA 1V2LT 2TPIZ 1O3DA 2IOTA 3DSGA 1Y5UT 3RXUA 1EAIA 1TGCA 1RIWC 2JKHA 1DLEA 5EU8A 3A86A 4RKJB 3KHVA 3AASA 1UCYE 2J98B 3F9EA 3W94A 3DSOA 7GCHG 2ZU5A 4K8YA 2WPMS 1UVSH 2F9VA 4FUFA 2G55A 1HPGA 3BTHE 3U8TH 1TFXA 2DE9A 1YLDA 4OM9A 4BAMB 4ISLA 4NFEA 5DP6A 5DGJA 1GJDB 2XBVA 3EA9A 3QZQA 3U69H 3U8RH 1B5GH 4ISOA 5JDUB 3GOVB 2NU2E 2M2AA 3Q3XA 3DFLA 3UR9A 1GJCB 3HKIB 3SUEA 3TPIZ 3TGIE 1GGDC 3SOSA 1XUFA 3RU4T 3PLBA 1GHYH 1V2NT 4GSOA 1YWUA 1WBGB 2W5EA 3LC3A 1TE0A 3A83A 2P93A 3K2UA 3LJOA 1NZQH 1GMDG 4WMFA 5EXNA 1UK2A 3L6PA 1H9LB 2GZ8A 1F0TA 2P59A 2RDEA 2P94A 1O2JA 2SGEE 2ZQ2A 2O8WA 1NPMA 1MU8B 2BLWA 3M5OA 2QXJA 1NROH 2QXHA 1C2LA 4BTTB 1W0KD 2WYGA 2PLXA 1EP6A 2P3TB 1ESBA 2P8OB 1EJAA 1BA8B 1SGDE 5EXMA 5FPSA 1A0JA 2ZI2H 1MTNB 4DW2U 2YMSC 4TY6A 1YPKH 1DM4B 4NWKA 4BOHA 4WXVA 5DKMA 1RTLA 3V13A 1AQ7A 1CQQA 2ZPSA 5HGGA 1EAWA 1MMJN 1ZGVA 2ODPA 4YO9A 1HUTH 3GCHB 3BTFE 4BAOB 1INCA 1FUJA 5JBAS 3RXHA 1Z1JA 1GHAG 1VJAU 1P3EA 1T4UH 3BTWE 1CHOF 1O3JA 3PO1C 1ESAA 1W0YH 4O03A 2R2MB 1A46H 1S5SA 1TX8A 3ATKA 4IW4E 4RN6A 1FXYA 2FMJA 4ZROA 2BQ7B 4NZQA 1IQGA 3EA8A 3MU4A 3RUOA 5PTPA 4D9RA 4CH8B 4NIWA 2BX3A 1HAOH 2AEIH 1O37A 1C5QA 2O8UA 2PHBA 2QF0A 1ZYOA 2GDDA 1NFUA 2ZTYA 4GVUA 3SU3A 5EQQA 1J14A 3KQCA 1OWIA 4ESTE 2Y81A 3AAUA 4ABFA 1NU7B 4XSKU 3W1EA 2TGDA 3BTQE 4B73A 1C1WH 2WPHS 4F49A 5EODA 1TWXB 3RMMH 1MKXK 1GHZA 1H9HE 2LPRA 5FAHA 1RIWB 1GBJA 1NFWA 5C94A 2KM0A 4GAWA 1SHHB 5EW1H 2FXRA 2F43B 2Y5FA 1C2GA 4B71A 1D3PB 2ZFTA 1PYTD 1TQ7B 1AVXA 1AMHA 3KYFA 1RGQA 2THFB 3RXLA 5TCAA 1Z6EA 3BEUA 4X0WU 3ZIAD 1NU9A 2A32A 1LVYA 5HKKD 3RMLH 2CHAC 2H9EH 4Y6DA 3UOPA 1GJAB 3BSQA 3SU4A 1QA0A 1O2NA 1W11U 4OS5A 6CHAC 1LHEH 7LPRA 2BM2A 3K6ZA 3TK9A 2G5VA 2FI4E 4YESB 2GVFA 3VB3A 3RU4E 1DITH 1GGDB 4A5TS 1O2ZA 1GI2A 5ABWA 3VFEA 3FP7E 3E8LA 3RXIA 3STIA 2AMQA 2QF3A 2ZPQA 2BB4A 1C5SA 1ARBA 2CV3A 1XVOA 2FOCA 3QGNB 1D3QB 3SV9A 2NU4E 1SGQE 1AZ8A 3RM2H 1GI6A 4FETA 1NT1A 4RSPA 4Y8YA 2ODYB 2H9TH 3GY6A 1TNLA 1KTSB 1P0SH 1O3GA 3VXEH 4NSVA 1IQJA 2ANYA 1NTPA 2G51A 2XNDD 3SU2A 4FUEA 1CGHA 2SNWA 2ZHWH 1Y3XA 1QJ6B 3FVFB 4A6LA 1O5FH 4X1SU 1W0ZU 1FY4A 2G8TA 1GVKB 3T26A 3FP6E 4XBBA 3F9FA 4XOJA 2FEQH 4CR5A 2YMSB 1LTOA 1UVOA 1O3PB 5TCCA 3F9GA 2WHXA 1SLVB 1PYTC 1O2UA 3MO3A 2BD2A 2JJ2D 1BJUA 3RU4D 2AGIX 1H9IE 1QR3E 2UUFB 1SGFA 1IQIA 1HYLA 4MNYA 3WWBA 4X8SH 1ANCA 2VIQA 4BXWA 1KXBA 1UJ1A 3PO1B 1FX0B 3PLPA 2ALVA 3LIWA 1L0ZA 2BOKA 4Z1MD 5IDKA 3OU0A 2WV4A 3OAAD 4P02A 4DIIH 3P8GA 5DG6A 1O2KA 2WPDD 1W10U 4ASUD 3TGJE 1JRSA 4DY7B 1SBWA 5C1XA 3ZVDA 1SQAA 1TMBH 1O38A 2A7HA 3WY8A 3ZV8A 4ABAA 3PV2A 2WUBA 1BZXE 2Y80A 1EFRD 4AFQA 2ZGXH 3ZYEA 1TPPA 1NBMD 2J95A 3ATMA 1JBUH 1OP8A 1SFIA 3RXDA 4X1PU 2XXLA 1YY3A 4GCHF 4UFEH 1TOCB 4Y76A 1FQ3A 2ZCLP 2XC4A 5B6LA 3TIUA 2OC0A 2VVVA 2QGRA 2BD4A 3ZZBA 2GMTC 3ZV9A 3T25A 3TNSA 1ZSLA 1YYY1 1AI8H 2CHAB 1QL8A 2WUCA 3FAOA 2F9PA 3MFJA 3LOXA 4JYUH 2HVYB 1NRSH 2ZDKA 2FESH 3KF2A 2ZFSA 2BY9X 1MH0A 3MU1A 1YP9A 4TPIZ 3K65B 5JB8S 3SJ8A 2I6QA 1V2UT 1SPJA 1H8IH 3MWIU 1O2XA 5EXLA 3E6PH 1FLEE 2UWPA 3ZZCA 1S83A 3T2NA 1CBWC 1C2DA 1V2OT 4INKA 4NCYA 1NC6A 2FZZA 3M36A 1L4ZA 1J15A 8ESTE 1TGSZ 4K1SA 3F2GA 1EB2A 1GBFA 1BTXA 5A0AE 2IJD1 1HIAA 1ZGIA 3S69A 4AG2A 4HGCA 1J8AA 1C2EA 4ZHLU 1Z8IB 1XUHA 7GCHF 3TK6A 2A2XH 1DXWA 1TMUH 1GHBF 2FOEA 1K1JA 3GYMA 3ZZ7A 1FMGA 3SU6A 4ZKRU 2VNTA 2GGVB 4NIVA 3UPEA 2VIWA 1BTZA 3A7XA 2C8ZB 1QFKH 2XBYA 4YOJA 3UQOA 1T8LA 3RXBA 1GJ9B 2BY8X 1TA6A 2FOHA 1GI7B 4CREA 4RI0A 1C1UH 1O5AB 5DP7A 1AWFH 5HM9A 1V6DA 1DT2A 2GD4B 1W14U 1ZHMA 1T8OA 5T6DA 1S81A 1DPOA 2H2ZA 3KQBA 1DY9A 1A5IA 3FP8E 4JYVH 4K1TA 1TNHA 2BLVA 3T28A 2AMDA 1CGJE 1NY22 5HIYA 1CGIE 1L4DA 4X2WA 6LPRA 1CA8B 1BRAA 1QTFA 1XM1A 1ORFA 2G4UA 4OS4A 1Y3VA 1A3BH 1SG8B 1DDJA 1E0FD 1VITG 3MTYA 1W0JD 1O31A 3MU8A 1KXAA 1V2WT 2RA3A 2QIQA 2AYWA 2JJ1D 2FO9A 2SGPE 1RS0A 1QQUA 1UK3A 1OWJA 4ABHA 3ZZAA 2CK3D 1AVWA 1ZMLA 2ALPA 3PRDA 3Q00A 2K0QA 4RT1A 4CRCA 1YPJH 3SNDA 1FZZA 3UFAA 4CRBA 3RXEA 2ZIQH 2NU3E 1CT2E 4DOQA 4D9QA 1MBMA 3D65E 3A7WA 2OP9A 4JZIA 2JIZD 1AHTH 1CHGA 2BOHB 2KZ4A 3W95A 1C5PA 3GISB 3RXSA 2ZGHA 1EZQA 1EASA 4WMEA 2FX6A 1ELBA 5C0UA 2BTCE 2GMTB 1HXFH 2TRMA 1XUKA 1MZDA 4AZ2B 1SGFG 1FY5A 1EB1H 6GCHG 2R0LA 1C2KA 4BAQB 4JZ1A 1CA0C 4CBOA 5E2OA 1ZTLA 2F4LA 1K1MA 1GL1A 2QN5T 2BD5A 1C2HA 1ETTH 1ELTA 4K3JA 2JH5D 4TYDA 3K6YA 1FY8E 2F91A 1HV7A 2SGAA 1O3EA 1IHTH 3MU5A 1J16A 2KX4A 3SW2B 1CBWB 1AY6H 1O2RA 2WV9A 3M37A 3QZRA 1K1NA 2CXVA 4VGCC 2Z94A 1SLUB 1V3XA 1C2FA 2AH4X 1ELDE 2ANWA 3EQ0H 2BY7X 1V2TT 2UUKB 1ANEA 1KXFA 2CJIA 1EX3A 4IGDA 3SN8A 5K0HA 2QCYA 2VIOA 3ELAH 1BCUH 1ZOMA 1WQVH 1O3BA 1V2KT 1O2IA 5HYOA 1HAYB 2GCHG 2Z3CA 2QYIA 1B0FA 4I33A 2LP6A 1MKXH 1O2MA 1Z7KA 1X7AC 2A7CA 4MVNA 1P9SA 1ESTA 2L6OA 3ENSB 2ZZUH 3HGPA 4H42U 5JYIA 1SOTA 1WUNH 3ODDA 2PW8H 1PJPA 1GBHA 1O2TA 5JB9S 5FPTA 1P12E 1O5EH 1OWEA 1GBBA 1SLXB 4KTSA 1BBRH 1BMMH 5C17A 3LH1A 4O9VA 1IQHA 3CS7A 1AU8A 3O8RA 2ZFQH 4DT7B 1GBLA 2AIPA 3SNCA 1DWEH 2TGPZ 1QZ8A 1EJNA 2OQ5A 4TSFD 1DICA 2A2QH 3SUDA 2FI3E 2ZGJA 1O30A 1SQOA 5DP8A 3M3SA 1BT7A 1WQSA 3SUGA 2RA0A 3UIRA 2HPQH 4XBDA 5C1YA 1GDUA 4B6EA 1TRYA 3I29A 3MO6A 1MU6B 4HTCH 1T8MA 4ACAA 2BZAA 3UY9A 3V12A 3VGCC 3VG8A 2SNVA 4A1TA 4U01A 1C1PA 3FZDA 2GCTB 1ZSKA 3PV4A 2IPHA 4LZ4B 3LJJA 3QTOH 4MDSA 1O2VA 2ZGCA 1BOQA 2ANKH 4E7NA 4FVBA 1O2LA 1DX5M 1YCPH 4FUCA 1BTYA 4AFZA 4X6MA 2OXSA 1YM0A 3BG4C 4MQAA 2OK5A 3BTDE 4B76A 1RFNA 1NFYA 1C4Y2 1V2QT 1GJ6A 1AE5A 4NGAH 2YMSD 3SO3A 1SGYE 3SV8A 4XRNA 2QF5A 5T6GA 1J17T 1QB1A 3B23B 3A8AA 2A1DB 1SLWB 1WXRA 1TONA 2STBE 1S0RA 3M7UA 1YPMH 2VBCA 5FPYA 5L2YH 1SL3A 2ZDNA 4WY3A 4TWYA 1FI8A 3ZZ9A 3MH5A 3M5NA 4UFGH 3RXPA 3U98H 2DE8A 3FO8D 3IG6B 1K1OA 2AGGX 1Y3UA 4KGAA 5DN6D 1QJ1B 1FIWA 3PB1E 2Z3DA 1G2LA 1TRNA 3MYWA 1RTFB 3I77A 3V0XA 5JBCS 1MTVA 1ZPZA 4OGXA 1HB0B 2FTMA 4Q7ZA 4B2AA 4K5ZA 2ZPRA 3SGAE 3A89A 1FJSA 1W8BH 1A3EH 1SVPA 4AYYB 4VGCB 4X8UH 4B1TA 4X1NU 1YC0A 3VB7A 1MAYA 3UREA 1ACBE 1HJ9A 1FY3A 4GPGA 1PPZA 2EEKA 5C20A 2Q6FA 1LMWB 3F0OA 1ETSH 3IITA 2D8WA 3NPSA 3UUZA 1ZLRA 1HGTH 1T8NA 1C5YB 4F48B 2ZEBA 2RG3A 4IN1A 2KCYA 3AVZA 4UONA 2HNTF 1DWCH 3GCTG 5CMXH 1XX9A 4JZFH 4RKOB 1MAXA 5AHGH 1TGTA 1C4U2 1PPBH 4UDWH 2Z9LA 5DK1A 3TJNA 1WTGH 3SUFA 2R9PA 2BQ6B 1SGTA 1ZTJA 2L74A 1HIAB 1W13U 1BRCE 2HRVA 1YF4A 1C5NH 3GDUA 1W2KH 1HFDA 4JZDH 5T1VA 1G3BA 1PQAA 1G9IE 1EP5A 2GTBA 2STAE 5AFYH 4FUHA 3OTJE 3GDSA 2BQWB 2PUQH 1EXFA 4WH6A 4GUXA 1O32A 1O5DH 3KNXA 5C2ZA 1BBRE 3AAVA 1MD8A 1GVLA 1TX7A 2EY4C 1P2IA 3CNRA 1O2PA 1JIRA 1TNGA 3LGVA 2BDHA 1FAKH 1BIOA 1WV7H 1DANH 1WYKA 3TK5A 4ZKSU 1ZZZA 1QBOA 2FOAA 2WZQA 2AERH 1C1SA 1B0EA 1EAUA 3SU5A 1O2OA 4UE7H 5CE1A 5GWZA 4IC5A 4CHAC 4K69A 3P8FA 1RJXB 4BXSA 1GBAA 4X6PA 1XMNB 1HLTH 1THSH 2ZP0H 1ELAA 4ZXXH 3PMAB 2ILNA 1TGNA 4TT3D 1BMNH 1MQ5A 1BMAA 4JYTA 4NFFA 2PTNA 3BG4B 1DSUA 5E2PA 2R3YA 2G5NA 3P8OA 7ESTE 5EJLA 5HIZA 1FNIA 2QC2A 2J2UA 2ZG0H 1UK4A 2XCNA 4M9FA 4I8HA 1S6HA 2A4GA 1B7XB 1S82A 8GCHG 4OS2A 2XBWA 3OFND 4B2BA 1BBRK 1ABIH 3QDZB 1WU1A 1P2MA 4WJG2 1TAWA 4YOGA 1NN6A 1DSTA 1BB0B 1ELFA 1SQRA 1V2VT 1ZRKA 1VITF 2B9LA 3BF6H 1C1RA 3UQVA 3ATWA 2ZF0H 2WPIS 2OBOA 2XYAA 5FL7D 2TBSA 3LU9B 3ZVBA 2OCVB 1P8VC 3TJOA 1RD3B 2Q6DA 4XFQA 1LO6A 2BMGB 3EYDA 5F8ZA 3SV7A 5IK2D 4LXBH 5GCHF 4YT6H 3E3TA 5L2ZH 2VIDA 4OS6A 2A7JA 1IQKA 1BTUA 2XC5A 1C5MD 2FOBA 2Y7XA 3LPRA 1WCZA 4MLFB 2ZKSA 4DCDA 3VEQB 1DFPA 1YCPK 4OS7A 1K9OE 1H8DH 1EOJA 5BRRE 2C3SA 2O8LA 2WPJS 1ETRH 1G2MA 4THNH 1C9PA 1DUEA 1LHDH 4ZHAA 1JRTA 1C1OA 3GS9A 6GCHF 1A4WH 2V35A 3RXVA 4O3TA 2FYQA 5FCRA 1BTWA 1QRXA 2W26A 1D3DB 3PMHB 3S9BA 4QT8C 1GMCG 3GY7A 2D26C 2VGCC 1NBME 3MH7A 3PTBA 5A0CA 4AN7A 1OS8A 5HXFA 1N8OC 2FIRH 2FYRA 2J34A 1TBQH 3A88A 1ZHPA 2AMPA 1AE8H 2QV1A 1Y3WA 2BVXH 1O3AA 1N6XA 4WMDA 2ZHFH 1PQ8A 3Q3KA 2D1JA 3UB0A 1AFQC 2QY0B 1HXEH 3KQ5A 1BTPA 1T4VH 2Z7FE 1A61H 2QA9E 1ELGA 5K7RA 1NS3A 2EA3A 2O9QA 4YZUA 1MTSA 3RC4A 2A4OA 2FS9A 2TGTA 3CP7A 1KY9A 3UNQA 1TNJA 3OEED 1XVMA 3KGPA 3LGIA 2BD3A 1O0DH 3TH2H 4JMYA 1L1NA 2SGFE 3NKKA 1SGIB 1UTQA 2Y5HA 5DJ7A 1LCYA 4YM9A 1TA2A 1P01A 3H7OA 1TRMA 4CBNA 4Z0KA 1Y5BT 3T29A 1ZMNA 4ZCNA 3RMNH 4MG3A 3BTGE 3KEEA 3V7TA 4AB9A 1Z8JB 3RXGA 3EA7A 1F0SA 1O3HA 2ESTE 1O5BB 5J4SA 5C5NA 2BY5X 5HMAA 2F9OA 2PKSC 1EQ9A 1QL9A 3SHCH 1SOZA 3Q77A 1FDPA 1OHHD 1QQ4A 4X1RU 3QUMP 3N99A 1UTMA 5BPEA 1H1BA 3F6UH 1G3CA 1O33A 1WAYB 1YPEH 1SFQB 1Z71A 2BXTH 2VINA 2SGQE 4TWWA 5EPNA 3QWCH 3UWJH 6CHAB 1FIZA 3QTVH 1AIXH 3P92A 2GZ9A 2VWOA 4AG1A 1F0UA 1DUAA 1C5LH 2Y6TA 2A31A 1QIXB 5ESTE 2WPLS 4O3UA 2H5CA 5J4QA 1DE7H 3SJ9A 1ZJKA 1G30B 2P95A 1Y8TA 5KGOA 1PPFE 1P04A 1MCTA 2FLBH 3GCOA 3MNSA 1UTPA 1BMLA 3FKSD 3UAIC 1H8ED 2PGQB 4Y10E 1N1LA 1GJ5H 4K1EA 1BHXB 2W3KA 3N7EA 4P00A 3FFGA 3RM0H 4AOQA 1XUIA 1VCWA 5DP9A 3URDA 3UNRA 4E06H 3M5LA 2FODA 1TPSA 3ZZDA 1JOUB 3MO9A 2BZ6H 1RTKA 1K1LA 2KCPA 1VGCC 5LGOA 1XKAC 4WXIA 1CHOG 2A5IA 2UUYA 5KECA 3GY5A 3EDXB 2H5DA 3PWCA 1IQNA 1GBEA 1MZAA 1N8OB 3UTUH 1JWTA 7KMEH 4HI3A 4I8JA 1E38B 1BRBE 3ZVEA 4NG9H 1HJ8A 1GPZA 1O3KA 4AGKA 1TGBA 2V6NA 4FU8A 2FOGA 3OEHD 2OINA 3LONA 1K28D 1PFXC 1GMDF 3SV2H 1VZQH 2ZCKP 1MUEB 1UTJA 1C2JA 1Q31A 1IQFA 1AFQB 1A0HB 1OYQA 4X2VA 1O34A 1UMAH 2JETC 2B7DH 2ZA5A 4WWYA 5A8ZA 4FU9A 1UVTH 2HPPH 3DT0H 1HAGE 3C27B 3UWIA 2CF9H 4YOIA 3Q76A 1PPHE 1P3CA 2C8XB 4FUJA 1P2QA 3A87A 5GIBA 1DLKB 1LHFH 2VH6A 4Q80A 2BD9A 3O8CA 2ZECA 1EATA 4X6NA 1TOMH 4CRAA 2OC1A 4NSYA 3PMJA 4BNRA 3URCA 4ACBA 4ISIH 4H6TA 3D62A 4Y8XA 2PKSB 2XNIA 2H1UA 5ESBA 4A1VA 2OD3B 4YTAA 3NXPA 2Q6GA 1F92A 1GHAF 2J94A 1HAZB 1YPHC 2GV6A 1SHYA 4NZLA 3U28C 1LVBA 5B6OA 2WSSD 1UCYH 5I25A 1ABJH 2ZHQH 1GJ7B 1EUFA 5AVDA 5GXPA 4JK5A 2RFKC 2WPKS 3MNCA 9LPRA 1LVMA 1GL0E 1RXPA 3HK3B 3MH6A 3L33A 3E0PB 1HBTH 1P9UA 4IS5A 1K22H 1KTTB 1SKYE 3RLWH 2PGBB 1SGRE 3MMGA 5T3HA 4ABIA 4IC6A 2J38A 4XD7D 2R2WU 1THRH 3BIUH 3RXMA 1BRUP 1SSXA 1H4WA 1O2SA 1QB6A 3BTEE 2HLCA 4MPXA 1GG6C 1WOFA 4ISHH 4K60A 4AB8A 1NRQH 1PPCE 2R0KA 1A5GH 1FN8A 1GI9B 1UO6A 2VWMA 3KYGA 2A45B 1C5OH 1C2IA 4GLYA 8GCHF 1G3DA 1A0LA 1P2NA 4Y11E 1C5TA 4O97A 1BQYA 3SI3H 2PSYA 3A7YA 4ISNA 1TPOA 2VJ1A 4DJZB 1GBDA 3FOAA 4Y0ZE 1DOJA 3SJOA 1BTHH 2VIPA 2Z9IA 4X6OA 3U1IB 5JBBS 2BVRH 2G4TA 1VCQA 2BLOA 4MTBA 3LGTA 5DSFA 1QURH 2C90B 2PWXA 1QCPA 3QLPH 3ZYDA 1TBZH 1UHBA 1YPLH 3A8CA 1SC8U 2DUCA 1Z1IA 1AZZA 2EQNA 1TBRH 5LPFA 3M7TA 1KSNA 1QGFA 3SHAH 5JPMH 4JZEH 5GNDA 2QAAA 1WDIA 4HZHA 1GI1A 4CR9A 1RRKA 1KIGH 1OSSA 3ITIA 1E36B 4Y79A 2CGAA 2JETB 3HGNA 1F2SE 1MTNC 4MNVA 3TNTA 2F9NA 4B74A 2FI5E 1TLDA 1EJMA 3BG8A 4CH2B 3PLKA 1E35B 2GDEH 1IAUA 2F9BH 3KL6A 5E0HA 2KCOA 1QA7A 3TVJB 2GP9B 1TX6A 2ZNKH 3M5MA 3GCHC 4J1YA 2ZDAH 1KXDA 2AIQA 3EGKH 4INHA 1IQEA 4X8VH 4U30A 1T31A 1THPB 1IQLA 2CF8H 1GJ8B 3A7VA 4AFUA 1XKBC 1O3LA 5L6NH 2VIVA 3EE7A 2YNAA 5C5OA 2FS8A 1T32A 2BDIA 2F9UA 1SR5C 1Q2WA 2OUAA 5DPAA 1NRNH 4ABEA 1UVPA 2Z6BD 2M5TA 1DVAH 3RDZA 4CRFA 3A8BA 1G32B 1EZUC 4SGBE 4MPWA 2P16A 2C8YB 1Z6JH 2BYAX 1LDTT 1A7SA 1SGNE 1O39A 3M61U 3QK1A 4NIYA 3SNEA 2FOMB 2UUJB 1GDNA 2XOKD 1CA0B 2BDYA 3HK6B 4ABJA 1GHVH 1P57B 1TALA 1AFEH 1CU1A 5CDFE 4B6FA 5DP4A 5C1UA 3A84A 4FU7A 3VB6A 2YOLA 3PWBA 1C5WB 4FUDA 1MABB 3O8BA 5E0JA 1GHBG 2ZO3H 1EOLA 3VPKA 2SGDE 2ZGBH 3SZNA 4UD9H 1TPAE 3O8DA 1GG6B 3TH4H 3RXCA 4JK6A 3UOUA 2FM2A 1TIOA 4ABGA 3M35A 2O8TA 1GI3A 4ZUHA 2QXGA 1MQ6A 5FCKA 4MNXA 2ZFPH 3FN8A 1HAPH 2PKAB 2ZDMA 4PROA 2GV7A 1F5LA 1OXGA 2EC9H 4I86A 2LNCA 2K1QA 4NA7A 1O5GH 1E1RD 1P05A 2GJGA 3IWMA 1A2CH 4AFSA 1OWHA 2VWLA 4ZMAH 5A0BA 3ODFA 3M3VA 4NIXA 4A92A 1KDQB 3OY5U 1AO5A 1C5ZB 1DY8A 1E1QD 2FTLE 1OKXA 3QN7A 3RLYH 1YCPM 2OC7A 3L3TA 1UTLM 3MOCA 5CHBA 4YXWD 2VU8E 5A2MH 5E0GA 5F8XA 2C8WB 1UCYK 4TPYA 1GJ4H 4Q63A 3F2HA 2XC0A 2QF4A 1NM6A 3GICB 2ASUB 1MTUA 2Z3EA 1KYNA 1O2QA 1C4V2 3TLOA 1F0RA 1ZR0A 1EPTC 1CT0E 3PROA 1S85A 1FPCH 3HKJB 1L1JA 3M7QA 2BDAA 2XBXA 1HDTH 2J5UA 1UTKA 1FY1A 1OX1A 3F0PA 4IBLH 4X8TH 4I7YH 5FHTA 1VITH 4ZKNU 2ZU1A 1QJ7B 3M3TA 4X2XA 1YKTA 4WF8A 5EJZA 2EI8A 1V2RT 3AW1A 3ZZ6A 2JDID 1BITA 2P3UB 2HALA 2HOBA 3GYLB 5AFZH 5EW2H 3A80A 3A7TA 2Z9GA 3RXQA 1L1GA 1EAXA 4YLUA 3VGCB 1F5RA 1O5CB 2TIOA 5AF9H 2FDAA 3EE0B 3RXFA 1YLNA 4U32A 1E79D 1C9TA 1SMFE 1XXDA 2PSXA 1O3OA 2ZFFH 1D6RA 1GCTC 2ZU3A 1FN6A 2ZDLA 1AKSB 2F3CE 1ZTKA 1IHSH 1YGCH 3ZZ3A 4R8TB 1QY6A 5CHAC 2XWAA 2ZC9H 1AN1E 1P06A 2G81E 2PTCE 1LHGH 1ELCA 2JH6D 1YBWA 3TGKE 2ZHDA 1NESE 1JIMA 1HJAC 3ATIA 1WTHD 3WW7A 3LC5A 5E8EH 2RCEA 3STJA 3SU0A 2ZCHP 3QGJA 1LVOA 3E0NB 1D4PB 2Y82A 4KP0A 3SNAA 1GCDA 1GI5A 1BMFD 2OQUA 4TY7A 3ZVFA 2FOFA 2ZQ1A 2HNTE 3BEFB 4IMQA 2KAIB 1Q3XA 3SORA 3DFJA 1MD7A 1HAXB 1GMHG 1SQTA 2OBQA 3DA9B 3NZIA 1EZSC 2V7QD 3T5FH 1ELEE 2H6MA 4X2YA 1PQ7A 5FBIA 2FLRH 4FXGH 1HAIH 1ELVA 3S9AA 3F3BA 4WH8A 4DGJA 1C5XB 1CVWH 4B75A 1AVGH 1K1IA 2QXIA 1AWHB 5ETXA 3NUMA 1P2OA 5TJXA 2BVSH 1GWAA 3H7TA 3VB4A 4UFFH 1LKBA 3CS0A 4E05H 2CMYA 3ZZ4A 1C1TA 1LPGB 5C3NA 1XXFA 1H8HD 4ZXYH 1HAVB 1GVZA 4Z6AH 5I46H 3OSYA 3K9XB 3DHKH 3MU0A 3R0FA 4K2YA 4IN2A 3TH3H 2XRCA 2Q1JA 2IJOB 5DO4H 1O36A 2HLDD 3E1XB 4FUIA 3SJIA 2TGAA 2AHME 1V2PT 2NWNA 3MH4A 2UWLA 4DT4A 3ZVCA 1DWDH 1MKWH 2BD7A 1D9IA 1O35A 2VH0A 3LDXH 3ZZ8A 1JMOH 3GDVA 3MQKC 2EI7A 1OOKB 5GDSH 1EPTB 1O3IA 3A7ZA 3SGBE 3S7KB 1OYTH 1CE5A 2B0FA 1E37B 4GHQA 3LKWA 4NA8A 4FUBA 1LPKB 5HM2A 1V2MT 2W6ID 3P17H 4I8KA 1S6LA 1KLJH 1OP0A 4ZH8A 1TNIA 5F8TA 3RXTA 1GHXH 2GT8A 2GX4A 1OPHB 1O3NA 1GI0A 3OYPA 1GBKA 1K21H 3B8JA 1ZHRA 4KTUA 5L30H 1KXCA 5EQRA 3ESTA 1XUGA 4BAKB 2V3HH 2H9HA 3E90B 1UHBB 2GCHF 3LT3A 1SB1H 3NK8A 2GZ7A 4MNWA 4KTCA 4CHAB 2O8MA 3R3GB 1LQEA 3FANA 3BEIB 1LKAA 4K8BA 1CO7E 1D3TB 5LPRA 3BIVH 1GCTB 1FV9A 3F2FA 4UFDH 4Y0YE 1W7XH 3SYJA 1SGPE 3S7HB 5CHAB 4ZHMU 5FX5A 3D23A 2J98A 1TNKA 2XCFA 3B9FH 2K8IA 1BJVA 3C1KA 1BUIA 1GBIA 2NU0E 2VVCA 4WVPE 1P09A 1HJAB 4JCNA 4KELA 4RT0A 2BY6X 5A8YA 2Z9JA 1ZSJA 3DD2H 1V2JT 2CN0H 3RMOH 3NRLA 2HNTC 1IOEA 1OWDA 2ODQA 1TMTH 1N6YA 5DP5A 5KEDA 3OX7U 1DWBH 1TYNA 4ZKOU 2PKAA 3TITA 1A5HA 1O2YA 1YPHE 3EAJA 3SV6A 1LQDB 4IMZA 5EOKA 1DXPA 3ZZ5A 1UTNA 2BLQA 3DSPA 1HRTH 3SQHE 1FONA 1CSOE 1KDQA 4XE4A 3VXFH 1G37A 1MCVA 4LZ1H 1O3CA 1UVUH 4BANB 2PV9B 5EQSA 2A4RA 1T7CA 2ZTZA 6ESTA 1ANBA 3GY2A 1FAXA 3CENA 3KQDA 1C2MA 2J4IA 4AORA 3A85A 3LGWA 5H4IB 4MPVA 3RXJA 1Y59T 2A5AA 3GY4A 4Q2KA 4BTUB 4DG4A 3T62A 3Q3YA 4ABDA 1C1VH 3RC6A 4D7GA 5IYTA 4DIHH 1L2EA 3D49H 3H09A 1GI8B 1LPZB 1QHRB 4J2YB 5C0TA 2A0QB 3WWFA 2KFWA 2VWNA 2HVXA 2OLGA 2OC8A 2FX4A 4ZAEA 3RXKA 3UR6A 1P2JA 2FP7B 3N7OA 5C67A 3KQEA 2AS9A 3PRBA 4Y7AA 3QO6A 4F4OC 2AGEX 3SU1A 4H4FA 1S6FA 4HFPB 3E91A 3HPTB 2P3FH 1C5VA 2AFQB 2VGCB 3OTPA 4XBCA 3JZ2B 2C93B 3PYHA 5FBEA 1G3EA 3UNSA 1AUTC 1AUJA 4I31A 2OTVA 2Z9KA 1V2ST 1EKBB 8LPRA 3A8DA 3NCLA 3BN9A 2FWWA 3KCGH 1GHWH 2J97A 3BTME 1AB9C 4E7RG 2B5TB 1U6QA 3DCLA 1GJBB 3QX5H 5EPYA 2W3IA 1AKSA 2W6JD 1P2KA 5JBTA 3F9HA 1GBTA 2HWLB 3S9CA 1NO9H 1QB9A 5G4BA 1CT4E 1JXPA 3SJKA 4D76A 2RDLA 4I8GA 4U2WA 1HCGA 2V0BA 2ZWLH 3GCTF 1ZJDA 3SBKA 1OWKA 3JZ1B 1F7ZA 1P10A 2XWBI 2ZTXA 2ZU2A 3RP2A 4SGAE 3SQEE 2ULLA 3RXAA 3BTTE 2W7UA 4LK4A 3SGQE 4BTIB 3OE7D 1KLIH 2BD8A 3MNBA 4ABBA 3F68H 3E16B 4YLQH 3TU7H 2XW9A 1COWD 2BHGA 4FUGA 2KAIA 2KR7A 2PFEA 3RXRA 4LOYH 3F1SB 4OS1A 2SFAA 3BV9B 2C4FH 1MBQA 1GBMA 1S0QA
chains in the Genus database with same CATH topology
3LGYA 1P02A 4GHTA 1ZPCA 4Q7XA 1C5UA 3PM3A 3V3MA 1MKWK 2WINI 4KKDA 4D8NA 3ZVGA 1QRZA 2GCTC 3LGUA 2W7SA 1Z8RA 1BDAA 1DS2E 4BAHB 5GCHG 4R0IA 3P8NA 1A1RA 2VVUA 3MNXA 4X1QU 4XDEA 5LH8A 2R3UA 3TJUA 1ZRBA 2Y5GA 3A81A 1EZXC 2EI6A 2ZU4A 3GCNA 3U8OH 3VB5A 2J9NA 1GDQA 1O2WA 1HAVA 4UEHH 3I78A 1ANDA 4ASHA 4A1XA 5GPIB 3RXOA 1J9CH 1ZMJA 4DVAU 4AGJA 4DURA 1QNJA 1W12U 1O2GH 2PUXB 4M7GA 3P70B 1QBNA 2HGTH 1PPEE 4H6SB 5A09A 3S0NA 1YPGH 1C1NA 3G01A 3KIDU 4D7FA 2GT7A 3SNBA 1Y3YA 1TQ0B 2J92A 1EPTA 3GY3A 1D6WA 1W7GH 9ESTA 3PMBB 5GJ4B 2G52A 5FXLA 2YNBA 2ZFRH 4NWLA 1PQ5A 3SI4H 3FZZA 3KN2A 1KLTA 2ANMH 1YLCA 1QBVH 1O3MA 2UWOA 4INLA 1NRRH 2BX4A 4B2CA 1VGCB 3HATH 4Q7YA 2A4QA 2BDCA 1GMHF 5T6FA 1K2I1 1O2HA 2PR3A 1GI4A 4AYVB 2Y7ZA 1NRPH 1NFXA 1M9UA 1VCPA 3GY8A 3MI4A 4OGYA 4I32A 2JH0D 2WV5A 3H5CB 1AB9B 4Y8ZA 1XUJA 5EG4A 2FPZA 1G36A 4NA9H 1MTWA 2P8OC 5A8XA 1QRWA 1P03A 1Y5AT 4AX9H 8KME2 3LH3A 4I8LA 4Y71A 4Y7BA 1SGCA 1HNEE 1ARCA 2I6SA 2D2DA 5LPEA 1QL7A 3T27A 2A5KA 3MHWU 2ZDVH 1AGJA 1FPHH 3U9AH 3P95A 5F6MA 1LHCH 2VB0A 5F03A 1ID5H 2IN2A 1C5RA 1SGEE 4GCHG 2B8OH 5FX6A 2BDGA 3AW0A 4A7IB 1ZPBA 1VR1H 1S84A 1O3FA 3P6ZB 5EGMA 1WSSH 1GBCA 1GMCF 1OP2A 5SGAE 3OY6U 4MPUA 3ZVAA 5DP3A 1Z8GA 2F83A 2NU1E 1AD8H 1W3CA 1HAHH 4CRGA 1F5KU 2ZHEH 1E34B 1K1PA 2V3OH 1SI5H 1BHXF 1PPGE 1C1QA 3BTKE 3TJVA 3ATLA 3DUXH 4FVDA 1VJ9U 3RC5A 1C1MA 2GKVE 1TB6H 2G00A 2BXUH 1P11E 1UTOA 3U1JB 3NWUA 4YT7H 2BDBA 2XTTB 3PTNA 1IQMA 2WYJA 1KXEA 3A82A 1TABE 4CRDA 1V2LT 2TPIZ 1O3DA 2IOTA 1Y5UT 3RXUA 1EAIA 1TGCA 1RIWC 2JKHA 1DLEA 5EU8A 3A86A 4RKJB 3KHVA 3AASA 1UCYE 3F9EA 3W94A 7GCHG 2ZU5A 4K8YA 2WPMS 1UVSH 2F9VA 4FUFA 2G55A 1HPGA 3BTHE 3U8TH 1TFXA 2DE9A 1YLDA 4BAMB 4ISLA 4NFEA 5DP6A 5DGJA 1GJDB 2XBVA 3EA9A 3QZQA 3U69H 3U8RH 1B5GH 4ISOA 5JDUB 3GOVB 2NU2E 3Q3XA 3DFLA 3UR9A 1GJCB 3HKIB 3SUEA 3TPIZ 3TGIE 1GGDC 3SOSA 1XUFA 3RU4T 3PLBA 1GHYH 1V2NT 4GSOA 1WBGB 2W5EA 3LC3A 1TE0A 3A83A 2P93A 3K2UA 3LJOA 1NZQH 1GMDG 4WMFA 5EXNA 1UK2A 3L6PA 1H9LB 2GZ8A 1F0TA 2P59A 2P94A 1O2JA 2SGEE 2ZQ2A 2O8WA 1NPMA 1MU8B 2BLWA 3M5OA 2QXJA 1NROH 2QXHA 1C2LA 4BTTB 2WYGA 2PLXA 1EP6A 2P3TB 1ESBA 2P8OB 1EJAA 1BA8B 1SGDE 5EXMA 5FPSA 1A0JA 2ZI2H 1MTNB 4DW2U 4TY6A 1YPKH 1DM4B 4NWKA 4BOHA 4WXVA 5DKMA 1RTLA 3V13A 1AQ7A 1CQQA 2ZPSA 5HGGA 1EAWA 1MMJN 1ZGVA 2ODPA 4YO9A 1HUTH 3GCHB 3BTFE 4BAOB 1INCA 1FUJA 5JBAS 3RXHA 1Z1JA 1GHAG 1VJAU 1P3EA 1T4UH 3BTWE 1CHOF 1O3JA 3PO1C 1ESAA 1W0YH 4O03A 2R2MB 1A46H 1S5SA 1TX8A 3ATKA 4IW4E 4RN6A 1FXYA 2FMJA 4ZROA 2BQ7B 4NZQA 1IQGA 3EA8A 3MU4A 3RUOA 5PTPA 4D9RA 4CH8B 4NIWA 2BX3A 1HAOH 2AEIH 1O37A 1C5QA 2O8UA 2PHBA 2QF0A 1ZYOA 2GDDA 1NFUA 2ZTYA 4GVUA 3SU3A 5EQQA 1J14A 3KQCA 1OWIA 4ESTE 2Y81A 3AAUA 4ABFA 1NU7B 4XSKU 2TGDA 3BTQE 4B73A 1C1WH 2WPHS 4F49A 5EODA 1TWXB 3RMMH 1MKXK 1GHZA 1H9HE 2LPRA 5FAHA 1RIWB 1GBJA 1NFWA 4GAWA 1SHHB 5EW1H 2FXRA 2Y5FA 1C2GA 4B71A 1D3PB 2ZFTA 1PYTD 1TQ7B 1AVXA 1AMHA 1RGQA 2THFB 3RXLA 5TCAA 1Z6EA 3BEUA 4X0WU 1NU9A 2A32A 1LVYA 3RMLH 2CHAC 2H9EH 4Y6DA 3UOPA 1GJAB 3BSQA 3SU4A 1QA0A 1O2NA 1W11U 4OS5A 6CHAC 1LHEH 7LPRA 2BM2A 3K6ZA 3TK9A 2G5VA 2FI4E 4YESB 2GVFA 3VB3A 3RU4E 1DITH 1GGDB 4A5TS 1O2ZA 1GI2A 5ABWA 3VFEA 3FP7E 3E8LA 3RXIA 3STIA 2AMQA 2QF3A 2ZPQA 2BB4A 1C5SA 1ARBA 2CV3A 1XVOA 2FOCA 3QGNB 1D3QB 3SV9A 2NU4E 1SGQE 1AZ8A 3RM2H 1GI6A 1NT1A 4RSPA 4Y8YA 2ODYB 2H9TH 3GY6A 1TNLA 1KTSB 1P0SH 1O3GA 3VXEH 4NSVA 1IQJA 2ANYA 1NTPA 2G51A 3SU2A 4FUEA 1CGHA 2SNWA 2ZHWH 1Y3XA 1QJ6B 3FVFB 4A6LA 1O5FH 4X1SU 1W0ZU 1FY4A 2G8TA 1GVKB 3T26A 3FP6E 4XBBA 3F9FA 4XOJA 2FEQH 4CR5A 1LTOA 1UVOA 1O3PB 5TCCA 3F9GA 1SLVB 1PYTC 1O2UA 3MO3A 2BD2A 1BJUA 3RU4D 2AGIX 1H9IE 1QR3E 2UUFB 1SGFA 1IQIA 1HYLA 4MNYA 4X8SH 1ANCA 2VIQA 4BXWA 1KXBA 1UJ1A 3PO1B 3PLPA 2ALVA 3LIWA 1L0ZA 2BOKA 5IDKA 3OU0A 2WV4A 4DIIH 3P8GA 5DG6A 1O2KA 1W10U 3TGJE 1JRSA 4DY7B 1SBWA 5C1XA 3ZVDA 1SQAA 1TMBH 1O38A 2A7HA 3WY8A 3ZV8A 4ABAA 2WUBA 1BZXE 2Y80A 4AFQA 2ZGXH 3ZYEA 1TPPA 2J95A 3ATMA 1JBUH 1OP8A 1SFIA 3RXDA 4X1PU 2XXLA 4GCHF 4UFEH 1TOCB 4Y76A 1FQ3A 2ZCLP 2XC4A 3TIUA 2OC0A 2VVVA 2QGRA 2BD4A 3ZZBA 2GMTC 3ZV9A 3T25A 3TNSA 1ZSLA 1YYY1 1AI8H 2CHAB 1QL8A 2WUCA 3FAOA 2F9PA 3MFJA 3LOXA 4JYUH 1NRSH 2ZDKA 2FESH 3KF2A 2ZFSA 2BY9X 1MH0A 3MU1A 1YP9A 4TPIZ 3K65B 5JB8S 3SJ8A 2I6QA 1V2UT 1SPJA 1H8IH 3MWIU 1O2XA 5EXLA 3E6PH 1FLEE 2UWPA 3ZZCA 1S83A 3T2NA 1CBWC 1C2DA 1V2OT 4INKA 4NCYA 1NC6A 2FZZA 3M36A 1L4ZA 1J15A 8ESTE 1TGSZ 4K1SA 1EB2A 1GBFA 1BTXA 5A0AE 1HIAA 1ZGIA 3S69A 4AG2A 4HGCA 1J8AA 1C2EA 4ZHLU 1Z8IB 1XUHA 7GCHF 3TK6A 2A2XH 1DXWA 1TMUH 1GHBF 2FOEA 1K1JA 3GYMA 3ZZ7A 1FMGA 3SU6A 4ZKRU 2VNTA 2GGVB 4NIVA 3UPEA 2VIWA 1BTZA 3A7XA 2C8ZB 1QFKH 2XBYA 4YOJA 3UQOA 1T8LA 3RXBA 1GJ9B 2BY8X 1TA6A 2FOHA 1GI7B 4CREA 1C1UH 1O5AB 5DP7A 1AWFH 5HM9A 1V6DA 1DT2A 2GD4B 1W14U 1ZHMA 1T8OA 5T6DA 1S81A 1DPOA 2H2ZA 3KQBA 1DY9A 1A5IA 3FP8E 4JYVH 4K1TA 1TNHA 2BLVA 3T28A 2AMDA 1CGJE 1NY22 1CGIE 1L4DA 4X2WA 6LPRA 1CA8B 1BRAA 1QTFA 1XM1A 1ORFA 2G4UA 4OS4A 1Y3VA 1A3BH 1SG8B 1DDJA 1E0FD 1VITG 3MTYA 1O31A 3MU8A 1KXAA 1V2WT 2RA3A 2QIQA 2AYWA 2FO9A 2SGPE 1RS0A 1QQUA 1UK3A 1OWJA 4ABHA 3ZZAA 1AVWA 1ZMLA 2ALPA 3Q00A 4CRCA 1YPJH 3SNDA 1FZZA 3UFAA 4CRBA 3RXEA 2ZIQH 2NU3E 1CT2E 4DOQA 4D9QA 1MBMA 3D65E 3A7WA 2OP9A 4JZIA 1AHTH 1CHGA 2BOHB 3W95A 1C5PA 3GISB 3RXSA 2ZGHA 1EZQA 1EASA 4WMEA 2FX6A 1ELBA 2BTCE 2GMTB 1HXFH 2TRMA 1XUKA 1MZDA 4AZ2B 1SGFG 1FY5A 1EB1H 6GCHG 2R0LA 1C2KA 4BAQB 4JZ1A 1CA0C 4CBOA 5E2OA 1ZTLA 1K1MA 1GL1A 2QN5T 2BD5A 1C2HA 1ETTH 1ELTA 4K3JA 2JH5D 4TYDA 3K6YA 1FY8E 2F91A 1HV7A 2SGAA 1O3EA 1IHTH 3MU5A 1J16A 3SW2B 1CBWB 1AY6H 1O2RA 3M37A 3QZRA 1K1NA 2CXVA 4VGCC 2Z94A 1SLUB 1V3XA 1C2FA 2AH4X 1ELDE 2ANWA 3EQ0H 2BY7X 1V2TT 2UUKB 1ANEA 1KXFA 2CJIA 1EX3A 4IGDA 3SN8A 5K0HA 2QCYA 2VIOA 3ELAH 1BCUH 1ZOMA 1WQVH 1O3BA 1V2KT 1O2IA 5HYOA 1HAYB 2GCHG 2Z3CA 2QYIA 1B0FA 4I33A 1MKXH 1O2MA 1Z7KA 1X7AC 2A7CA 4MVNA 1P9SA 1ESTA 4H42U 3ENSB 2ZZUH 3HGPA 5JYIA 1SOTA 1WUNH 3ODDA 2PW8H 1PJPA 1GBHA 1O2TA 5JB9S 5FPTA 1P12E 1O5EH 1OWEA 1GBBA 1SLXB 4KTSA 1BBRH 1BMMH 3LH1A 4O9VA 1IQHA 3CS7A 1AU8A 3O8RA 2ZFQH 4DT7B 1GBLA 2AIPA 3SNCA 1DWEH 2TGPZ 1EJNA 2OQ5A 1DICA 2A2QH 3SUDA 2FI3E 2ZGJA 1O30A 1SQOA 5DP8A 3M3SA 1BT7A 1WQSA 3SUGA 2RA0A 3UIRA 2HPQH 4XBDA 5C1YA 1GDUA 1TRYA 3I29A 3MO6A 1MU6B 4HTCH 1T8MA 2BZAA 3UY9A 3V12A 3VGCC 2SNVA 4A1TA 4U01A 1C1PA 3FZDA 2GCTB 1ZSKA 3PV4A 2IPHA 4LZ4B 3LJJA 3QTOH 4MDSA 1O2VA 2ZGCA 1BOQA 2ANKH 4E7NA 4FVBA 1O2LA 1DX5M 1YCPH 4FUCA 1BTYA 4AFZA 4X6MA 2OXSA 1YM0A 3BG4C 4MQAA 3BTDE 4B76A 1RFNA 1NFYA 1C4Y2 1V2QT 1GJ6A 1AE5A 4NGAH 3SO3A 3SV8A 1SGYE 5T6GA 1J17T 1QB1A 3B23B 3A8AA 2A1DB 1SLWB 1TONA 2STBE 1S0RA 3M7UA 1YPMH 5FPYA 5L2YH 1SL3A 2ZDNA 4WY3A 4TWYA 1FI8A 3ZZ9A 3MH5A 3M5NA 4UFGH 3RXPA 3U98H 2DE8A 3IG6B 1K1OA 2AGGX 1Y3UA 4KGAA 1QJ1B 1FIWA 3PB1E 2Z3DA 1G2LA 1TRNA 3MYWA 1RTFB 3I77A 3V0XA 5JBCS 1MTVA 1ZPZA 4OGXA 1HB0B 2FTMA 4Q7ZA 4B2AA 4K5ZA 2ZPRA 3SGAE 3A89A 1FJSA 1W8BH 1A3EH 1SVPA 4AYYB 4VGCB 4X8UH 4B1TA 4X1NU 1YC0A 3VB7A 1MAYA 3UREA 1ACBE 1HJ9A 1FY3A 4GPGA 1PPZA 2EEKA 5C20A 2Q6FA 1LMWB 1ETSH 3IITA 2D8WA 3NPSA 3UUZA 1ZLRA 1HGTH 1T8NA 1C5YB 2ZEBA 2RG3A 4IN1A 3AVZA 4UONA 2HNTF 1DWCH 3GCTG 5CMXH 1XX9A 4JZFH 4RKOB 1MAXA 5AHGH 1TGTA 1C4U2 1PPBH 4UDWH 2Z9LA 5DK1A 3TJNA 1WTGH 3SUFA 2R9PA 2BQ6B 1SGTA 1ZTJA 1HIAB 1W13U 1BRCE 2HRVA 1YF4A 1C5NH 3GDUA 1W2KH 1HFDA 4JZDH 1G3BA 1PQAA 1G9IE 1EP5A 2GTBA 2STAE 5AFYH 4FUHA 3OTJE 3GDSA 2BQWB 2PUQH 1EXFA 4WH6A 4GUXA 1O32A 1O5DH 3KNXA 5C2ZA 1BBRE 3AAVA 1MD8A 1GVLA 1TX7A 1P2IA 1O2PA 1JIRA 1TNGA 3LGVA 2BDHA 1FAKH 1BIOA 1WV7H 1DANH 1WYKA 3TK5A 4ZKSU 1ZZZA 1QBOA 2FOAA 2AERH 1C1SA 1B0EA 1EAUA 3SU5A 1O2OA 4UE7H 5CE1A 5GWZA 4IC5A 4CHAC 4K69A 3P8FA 1RJXB 4BXSA 1GBAA 4X6PA 1XMNB 1HLTH 1THSH 2ZP0H 1ELAA 4ZXXH 3PMAB 2ILNA 1TGNA 1BMNH 1MQ5A 1BMAA 4JYTA 4NFFA 2PTNA 3BG4B 1DSUA 5E2PA 2R3YA 2G5NA 3P8OA 7ESTE 1FNIA 2QC2A 2J2UA 2ZG0H 1UK4A 2XCNA 4I8HA 1S6HA 2A4GA 1B7XB 1S82A 8GCHG 4OS2A 2XBWA 4B2BA 1BBRK 1ABIH 3QDZB 1WU1A 1P2MA 4WJG2