1GBDA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by ala complex with methoxysuccinyl-ala-ala-pro-phenylalanine boronic acid
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGANVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
total genus 52
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbdA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbdA01
3P6ZB 2A4RA 1LHCH 1O2HA 1INCA 1RIWB 1C1SA 1NRPH 1BCUH 1A5IA 1QBNA 2DUCA 4JZDH 3BG4C 3H5CB 2Z3EA 1CT2E 3EDXB 5GWZA 5JDUB 1K2I1 1GMHF 4MPWA 1SSXA 3ZVAA 4OS6A 3VPKA 3SV6A 1TWXB 4B71A 1UVPA 2GMTC 2TPIZ 1C1UH 2GT8A 1O3KA 4UONA 3P8FA 2R2WU 1OKXA 3MU5A 1ABIH 2D8WA 2PGBB 4X2WA 2UWLA 4DGJA 4MVNA 2M5TA 3RP2A 1ZMJA 2VB0A 3EYDA 1THPB 1GCDA 2CHAB 1RRKA 1FJSA 1O2VA 2PSXA 2TIOA 4IC5A 1DWDH 2OC0A 1MAXA 3UWJH 2TGTA 2Z9GA 3A7TA 4BXWA 1DS2E 1ELFA 4OGXA 5CE1A 3JZ2B 1GI6A 3SJ8A 1HB0B 3PTNA 4B2BA 1RGQA 4ABDA 2SFAA 2GCTB 1TQ7B 2CXVA 3A8CA 3E16B 3NPSA 5FX5A 4MNWA 3LONA 1V2MT 4FVDA 3P8NA 4B2CA 1EP5A 1MKWK 2P94A 2FS8A 1TRYA 4R8TB 2CGAA 1V2VT 1ETSH 4IS5A 3RXRA 1C2KA 1P10A 3BEFB 4INHA 2ZU5A 1GJ7B 4AFZA 3FZDA 3PLKA 1L1JA 3T28A 2P59A 1MQ5A 5EQQA 5FCRA 5LPEA 4IBLH 2ODYB 2J95A 2Y81A 3P17H 3ZZBA 2GV6A 1F2SE 1BTPA 3UOPA 6LPRA 1C5QA 3A83A 2BM2A 1BTYA 3T25A 2PHBA 2TGDA 1QQUA 1IOEA 1UTJA 2F9PA 1K22H 1Z1IA 2BOKA 3UQOA 3HK3B 1QTFA 2A1DB 4DG4A 4NG9H 5JBCS 4Y8XA 2Y7XA 2ZECA 3FFGA 1NFUA 4YZUA 1WUNH 2G4UA 5E8EH 1YM0A 4IGDA 2Y5GA 1FMGA 1WOFA 1IQHA 2FOCA 1SVPA 1MZAA 4K1EA 1OYQA 5L6NH 1ANCA 4GVUA 1QRWA 4AX9H 1TPSA 1GPZA 3OYPA 3SI4H 4FUGA 1NRNH 1GHAG 3KL6A 1HAVA 1SGCA 2GX4A 1NTPA 2H9TH 3M36A 1XVMA 3GICB 3TNSA 2UWOA 3S9CA 3VGCB 4KTSA 3RXFA 1N8OB 1AIXH 1O2PA 4A1XA 1PQ7A 2H5CA 3M7QA 4THNH 1QA7A 1V2JT 1W7GH 1RIWC 3SV2H 3U9AH 5EGMA 2QAAA 3ZVCA 7LPRA 5EODA 1FPHH 3UY9A 2B7DH 4FUDA 1GJ8B 1PPCE 2WPIS 2OINA 2ZDAH 2LPRA 1ZMLA 2ODPA 1LQDB 1HGTH 1O2YA 1MKXH 1O5GH 4FUIA 3RXEA 4CRDA 1KDQB 2FYRA 2XNIA 3KN2A 1O2QA 1O0DH 2BY7X 3UR6A 6CHAC 1O3LA 1F5LA 3BTKE 1HLTH 1V2ST 4BNRA 1J14A 1GHXH 3W95A 3RXDA 3KF2A 3GDVA 5TCCA 2FYQA 1UMAH 3U8OH 1TGNA 3JZ1B 1Y3UA 2WPKS 3C1KA 3UIRA 1EZXC 1OWHA 1A2CH 1O2ZA 1BJUA 1KXEA 1OX1A 2SGQE 1QBOA 2C8WB 3M37A 1PPFE 2Z9LA 5DK1A 4Y71A 4D8NA 1SLXB 5C2ZA 3QK1A 1BRAA 3BF6H 1ZHPA 1AZZA 3E6PH 3GY3A 3BTTE 1C5PA 1BRUP 3U1IB 1B0EA 4JYUH 1ZPZA 1IQGA 4O97A 2VINA 7ESTE 4NIVA 4H6SB 5DP6A 1H9HE 3VXFH 4NA8A 3TJOA 2FX6A 2VVCA 1TNGA 1U6QA 1O2LA 3VGCC 1ESAA 2ZFTA 3MWIU 2PKAB 2QXJA 1NU7B 1T4VH 1MKXK 4I8GA 4RKOB 3TH4H 1X7AC 3SN8A 4MTBA 3TH2H 1GHZA 1O3PB 4XBBA 3S7HB 4B2AA 5EXLA 3TJNA 2XBWA 1OPHB 1Z8IB 4HI3A 4KTUA 4ZKSU 5EXNA 5K7RA 2QCYA 1QB9A 3QZRA 3U69H 3ZZ3A 5IDKA 4YOGA 5DPAA 1P0SH 4B76A 5DP9A 1G3CA 4YLQH 2J92A 1BZXE 1OP8A 2YNBA 3NKKA 4ZHAA 3Q3YA 1AD8H 2ZKSA 1P2NA 1KXCA 1FAKH 2BDCA 1SLWB 3P8GA 1H9LB 2BD4A 1KTSB 2BVRH 1UCYE 3PYHA 2STAE 3ESTA 4JYVH 4X6PA 3ZVEA 3QLPH 3RLYH 1GDQA 1EPTB 3RM2H 3A7WA 5A09A 1LVOA 3OY6U 3RMOH 2W5EA 4WH8A 4Y79A 3GCHB 5K0HA 2P3UB 2ZGXH 1LPKB 3BG4B 3ATWA 2XCNA 3RXUA 1ORFA 1GJCB 2VIPA 4TYDA 5E0JA 4MPVA 4DT7B 5E2OA 3B8JA 1BA8B 1Z6JH 3ELAH 3GY7A 1C2HA 1S82A 1GVZA 1H1BA 4BANB 2ILNA 5T6DA 3A87A 1C5ZB 2EEKA 1BT7A 1HPGA 1GI0A 1THSH 1GBCA 1P03A 2PKAA 4VGCC 4J1YA 2F9UA 1O5CB 1OSSA 2GD4B 2GMTB 3KQCA 3B23B 1BBRK 1LHDH 4CH2B 5F8TA 1UTNA 1BHXB 2ESTE 1EATA 2GCHG 3MHWU 4Y10E 1XUJA 3S9BA 4AZ2B 1K9OE 4X2YA 1AGJA 1O3EA 4ABBA 4CH8B 1AN1E 1RTFB 1P8VC 5DP8A 1TOMH 3EA9A 1KSNA 1GVKB 1MU8B 2Y82A 5C5OA 5C1XA 2TGPZ 2HRVA 3O8CA 4NSVA 4IN2A 3V0XA 5J4QA 1A4WH 1G36A 1Z8RA 2EA3A 4NWKA 1NRQH 2XC0A 3OX7U 2EC9H 1EOLA 1QY6A 3A80A 1MKWH 3R0FA 2B0FA 1YPHC 2FLRH 1FY3A 3KQEA 3RXOA 1EAIA 1EPTC 1KYNA 2I6QA 1HDTH 3VB6A 5LH8A 4XSKU 1KDQA 1CO7E 3MU4A 3E3TA 1QNJA 4NIYA 5LPRA 4B73A 4NFFA 4ABEA 4A92A 3RC5A 1VJAU 1G3DA 1YPHE 3HK6B 3RU4T 2VIVA 1XUKA 3LIWA 4YTAA 4O3UA 1HNEE 5F8XA 1ANEA 1DLKB 3U8RH 4MNVA 4MNXA 4GPGA 2V0BA 3QO6A 5A2MH 3S9AA 1QB6A 1S81A 2V3HH 1AUTC 5T6FA 2C8YB 5C5NA 1V6DA 1K1NA 4NGAH 5ETXA 1C5UA 2VVUA 3UNSA 1HAVB 4X1PU 1B0FA 4YT6H 3GY6A 2EI8A 4IN1A 1QRXA 2Q6FA 2STBE 1HAIH 1AVXA 3ZZCA 3MU0A 2O8MA 3TK6A 4X6MA 3IG6B 4AORA 1A5HA 3HKJB 6GCHF 1T8LA 4TWWA 4Q80A 1C4U2 1F5RA 4A6LA 3RXAA 1DUAA 2Z9IA 1NU9A 5DP5A 1SHHB 5HM9A 4NCYA 1O3OA 1ZPCA 2BD7A 1OYTH 1D6WA 3FZZA 1TFXA 3QGJA 4Y0YE 1DANH 3TJVA 1WTHD 1LHGH 3RM0H 3S69A 1TIOA 4BAHB 1BHXF 1TE0A 3KHVA 2F9NA 1ELVA 3A81A 4UDWH 3D62A 3PLPA 3M7UA 3A8AA 4CRFA 3L33A 4ZUHA 1O3NA 2FI3E 1TNIA 3A7YA 1MCTA 2GZ7A 3QX5H 2NWNA 1C5MD 4A7IB 3RXHA 5HYOA 2ZHDA 4GUXA 2G51A 2P95A 3P95A 4UFFH 3A88A 2FI5E 1VZQH 4E05H 1FZZA 1HAGE 1SI5H 4H4FA 2F9BH 1DSTA 2UUJB 1K1LA 3SJOA 4Y6DA 2ZPSA 1O2KA 2ZHWH 2QF0A 1GHVH 2H5DA 2UUFB 1ZHRA 2TRMA 4AGJA 3TGKE 1G3EA 1GMCG 3IITA 1ETTH 2GZ8A 1PQAA 1C2FA 4WVPE 1DWEH 1TNKA 1OP0A 1H9IE 4A5TS 3SZNA 1CHGA 1BTUA 3RU4D 2ZTYA 3M3TA 4YT7H 1ZJDA 5C20A 1IAUA 1W11U 4OGYA 1GBFA 2BXTH 2TBSA 4OS1A 3SUEA 3F9FA 4MDSA 2PUQH 4B74A 3A7ZA 3GYLB 4WWYA 1GL1A 2BDBA 1NFXA 2HLCA 2GGVB 4ZXYH 1Q3XA 1AO5A 2GP9B 4JZIA 1TGSZ 4B1TA 1GDNA 3GY5A 3SNCA 3TIUA 3BTQE 3P70B 3PTBA 2XWBI 3SUDA 2AS9A 3FP7E 1A0HB 1KLIH 5GPIB 1YYY1 3SUFA 3FP6E 1BMNH 4Y8YA 3MTYA 1MAYA 3MNSA 3PM3A 4LOYH 1L1GA 2FEQH 2QXHA 4YESB 1BRBE 2ZGJA 1RS0A 4IW4E 2R3UA 1GGDC 2B8OH 5LPFA 1C1MA 4A1TA 3GY2A 2VH0A 2ODQA 4H6TA 2ZCKP 3HPTB 1O2GH 1DWBH 3LPRA 2O8WA 3SORA 2FOBA 1LVYA 1EJMA 1MTNB 3T29A 3GDUA 1C5YB 1HIAA 1IQEA 2THFB 1O3MA 1T8MA 1HUTH 4GLYA 1UVTH 4Y7AA 5DJ7A 2ZFSA 2OC7A 2Z3CA 2HNTE 3BTFE 3SJIA 2UWPA 1N1LA 3ZZ9A 1AUJA 1NO9H 2G52A 2FI4E 5B6OA 3LOXA 3V12A 2FZZA 2XWAA 4NWLA 5HM2A 1PPZA 1ABJH 2ZGHA 1YPEH 1ELCA 4NZQA 1A0JA 3VB3A 3SU1A 3ZVFA 4O9VA 2VVVA 4AYYB 2P8OB 3ZZ7A 1BB0B 1WYKA 1W2KH 3QZQA 3M3VA 3GCTG 1VR1H 2AEIH 4BAQB 4U30A 1J16A 4X8TH 5GCHF 5EQRA 4Y8ZA 3LH1A 2ZFRH 1Y59T 1W0YH 8GCHF 1BMMH 5EG4A 1UO6A 4D7GA 3KNXA 2CF9H 4NIWA 3SI3H 1Q31A 2BX4A 1AU8A 1TLDA 2H9HA 1UTPA 2ZG0H 1N6YA 3BN9A 5H4IB 1AFQB 1SQTA 1EZSC 1G2LA 1TNJA 1GI5A 4DVAU 4ISIH 1TA6A 1T8OA 1D3PB 4NA7A 1P2KA 1DY9A 3V3MA 2HWLB 1AE8H 1QRZA 1YKTA 2QF3A 1KXBA 1WTGH 1M9UA 3VB5A 1IQMA 1Y5UT 5TCAA 2NU0E 3ZZ4A 1QL8A 2KAIA 1O5BB 4AYVB 1JWTA 1IHSH 1ELTA 1TRMA 1A1RA 1ID5H 1GMDG 1WU1A 2I6SA 3VFEA 1D4PB 2BDAA 2XBVA 2YNAA 1ZR0A 4BTIB 1TPPA 1ACBE 1O35A 3KQDA 3LDXH 1TOCB 2BQWB 2A4OA 4MPXA 3ITIA 1PQ5A 2ZO3H 4X0WU 4ABHA 1GGDB 1SGEE 1C5OH 1GBDA 3PO1C 2BY5X 4K60A 4ZAEA 5G4BA 5GJ4B 4CRCA 1LDTT 4XOJA 3E91A 1DICA 2AYWA 5GCHG 2BB4A 3QTVH 4IMQA 1QCPA 1CA0B 2ZTXA 1UTMA 4ABAA 3IWMA 3GCNA 1OP2A 4NSYA 3MOCA 4K1SA 1CU1A 4WXIA 3F9HA 5DKMA 1OS8A 1C2JA 3ZZDA 2G8TA 2OXSA 3MH6A 2FOGA 2XBXA 3GCOA 1ZGVA 1HAZB 3H7OA 1YPLH 2ZGCA 1QHRB 2HVXA 2HOBA 4HZHA 2QA9E 2D1JA 4FUJA 2ZA5A 1C4V2 5FX6A 2JH6D 1YP9A 1VGCB 1SMFE 1IQIA 1EB1H 2WYJA 4JZFH 5JBBS 3FP8E 4FUCA 1GI4A 1MUEB 1HJAC 1CBWB 1SFIA 2G81E 3DD2H 1SOTA 3TGJE 3LJJA 4SGAE 2LNCA 3K6ZA 4FU8A 4LZ4B 3MNXA 3TITA 2K1QA 1RTLA 2HNTC 3M5OA 5TJXA 5AHGH 1V2WT 2ZHQH 2R3YA 2A7HA 1SGIB 2H9EH 4NIXA 1T4UH 3RXPA 2ZCLP 1PPHE 1P04A 2CMYA 1QURH 4GAWA 1A0LA 1UCYH 2AIQA 4Q7YA 3DHKH 2NU3E 3LGUA 4GCHF 2O8LA 4WJG2 3C27B 1PPGE 5C3NA 1GI8B 2SGFE 2PKSB 1LTOA 1NS3A 1C2GA 3ENSB 3STJA 1FI8A 1GBTA 5CMXH 1HXEH 1TMTH 4YM9A 1V2TT 4Y7BA 4H42U 1Z71A 4K69A 4ZMAH 2JETB 1BRCE 8GCHG 2W7SA 5FPTA 3EQ0H 2RA3A 4ZKOU 4Q7ZA 2OD3B 2QV1A 3AW1A 1NZQH 2AGEX 1YPKH 1ARBA 3SV8A 2RG3A 1ZRBA 1RTKA 2QY0B 1Z7KA 2FP7B 2V35A 3SU0A 4HGCA 1C5XB 2FOMB 3TPIZ 2A32A 2PTNA 5FBIA 5BPEA 3MO3A 3F1SB 2XC5A 2Z9KA 1KLJH 3CP7A 1LHEH 1CGJE 2BD9A 4CRAA 4F4OC 3I77A 1BTWA 1C1PA 1EP6A 1TX7A 1A61H 1SC8U 2A2XH 1NPMA 1GMDF 2PLXA 2VWNA 3DUXH 5HMAA 4U32A 1UCYK 2ZGBH 1G37A 4X1RU 3QTOH 1IQKA 9LPRA 1VITG 3A84A 1D9IA 1YPGH 1AWFH 2CHAC 4NFEA 1GBKA 5FCKA 3NK8A 3O8BA 1O3DA 3V13A 3SGQE 4DOQA 3SQEE 2ZU1A 1V2RT 1HFDA 2OP9A 2W26A 1O36A 5EPYA 1WQVH 1CA0C 4DCDA 5I25A 3UUZA 3A89A 3W94A 4AB8A 4AB9A 1YPMH 4E06H 1SGFG 1V2LT 1L2EA 1GVLA 2Y5HA 1HAYB 1GBAA 1P2OA 3S0NA 3ZVDA 1ZOMA 1P11E 4FUFA 5AFYH 2FWWA 2Y7ZA 3ZZ6A 4A1VA 4YO9A 4UFGH 3RLWH 1EZUC 1LQEA 4CHAC 1AB9C 1L0ZA 1W0ZU 2A7CA 2C4FH 2Y6TA 1O2NA 1BMAA 1JIRA 3TU7H 3KQBA 1KXFA 1AZ8A 3U98H 1LO6A 3E90B 2UUYA 3BTDE 4D9QA 3K65B 4XDEA 1EUFA 1F7ZA 2ANWA 1ZTKA 2BDIA 1FQ3A 4O3TA 2ALVA 2G4TA 3QGNB 1SLUB 1EQ9A 1A3EH 1C1NA 1CBWC 3UOUA 5BRRE 5AFZH 3MO9A 2FS9A 1SBWA 2GV7A 5JPMH 4WXVA 1HXFH 1IQNA 1S5SA 1C5TA 3B9FH 4YOIA 1O2RA 1ZJKA 2A2QH 5A8YA 1O30A 4I33A 1Z1JA 6CHAB 2VIDA 2Z94A 3BIUH 3RC4A 3TJUA 2A4QA 3SJ9A 1DPOA 1GL0E 3AVZA 1YC0A 4I7YH 1XKBC 1GJ9B 1SGNE 4X2XA 3M35A 2VJ1A 3RXBA 1GCTB 5EXMA 1GJAB 1FY5A 1PJPA 5J4SA 1O2WA 5ESTE 4RSPA 4DIHH 3K6YA 9ESTA 4CBOA 1UJ1A 1ZHMA 1P3EA 2XCFA 5FAHA 3RXSA 3BTWE 4CRBA 1AFQC 5T3HA 3SBKA 1P09A 1O5AB 1PPEE 1AVWA 1HAXB 1YCPH 1YCPK 1G9IE 1XMNB 5ABWA 1AQ7A 1SGDE 2SGAA 2WINI 3M5NA 2VWOA 3SO3A 1ESTA 1FN6A 1O3BA 2P93A 5C1UA 2GDDA 1Y3WA 2HPQH 4O03A 2Z3DA 1EB2A 3RMNH 2OC8A 3ZYDA 1TNHA 1K21H 1VJ9U 3Q00A 1SG8B 7KMEH 2ZCHP 5E0HA 2RCEA 3SGAE 2WPMS 2J34A 4KP0A 2ZU2A 4RKJB 1TBQH 3AW0A 1ZZZA 1N8OC 4DW2U 4Q2KA 4R0IA 3GOVB 1H4WA 2WPHS 3PLBA 3ATIA 1FAXA 1FUJA 4OS4A 3F68H 3OTJE 3Q3KA 4TY6A 5GIBA 1D6RA 1WV7H 2QN5T 4ISHH 1RXPA 1MH0A 1DXPA 1HBTH 3VXEH 2ZF0H 1FXYA 1F0RA 1T31A 8ESTE 1O37A 1W12U 1AI8H 1C2EA 1O32A 2ZP0H 4NA9H 4M7GA 1D3DB 1ZYOA 3M7TA 3ODDA 1NN6A 1EZQA 4JZ1A 1TABE 1C5WB 1QJ6B 1FV9A 1C1WH 1W10U 1DFPA 3D23A 1NROH 3F9GA 1SHYA 3D49H 2ZFQH 1C9PA 1GI3A 2ZDKA 2J38A 1QL7A 3SW2B 2AMPA 1YCPM 3PMHB 1AKSB 2WPLS 1Y5AT 4MNYA 1THRH 1P02A 1O2JA 3PMAB 4D9RA 3E1XB 2DE9A 3BV9B 3PO1B 1UK4A 2Q6GA 5JB8S 1S0QA 2FIRH 4U2WA 1BTZA 1DM4B 3MNBA 5JB9S 1TPOA 1SGYE 1S6FA 2FODA 1OWEA 3SNAA 1O5FH 2BZAA 2GDEH 2XXLA 1EAWA 1XM1A 4YOJA 1C1TA 1CT4E 5A8ZA 2R0LA 1H8DH 2WPJS 4XBDA 3BTME 1GMHG 3VEQB 2J94A 1P9SA 1UHBA 3SHAH 3O8DA 1LKAA 2O9QA 5C1YA 2YOLA 3U1JB 2VNTA 1ANDA 1TMBH 4SGBE 5C67A 2BTCE 3DA9B 3MU8A 1GI9B 2ZNKH 1EAUA 4LXBH 1XUGA 2GCHF 3EAJA 3RXCA 3TVJB 1P2JA 3DT0H 1Z8JB 2JH0D 1LPGB 3LC3A 1G30B 2P3TB 3EA7A 3HATH 3PV4A 2BMGB 1DT2A 1ZPBA 2FESH 3HKIB 4ZXXH 2F83A 1L1NA 3KGPA 1O38A 2RDLA 1GJBB 1UVOA 1SQOA 4WF8A 3SV9A 1C5NH 1ELEE 1NRSH 2FX4A 1GG6B 3RXVA 1GBEA 2EI7A 1O2XA 1SQAA 1BOQA 1S84A 1OWIA 3NCLA 4GSOA 3GCTF 1Y3YA 5L30H 1GBHA 1MTUA 5FBEA 1IQFA 2NU2E 1V3XA 5ESBA 4X6NA 3E8LA 3T26A 3FAOA 4X1SU 2A5AA 4X8SH 1CA8B 1LVMA 1EJNA 1WSSH 2XYAA 3T5FH 1Q2WA 1TGTA 2GZ9A 1FONA 2CV3A 5JBAS 1JIMA 4K1TA 4JMYA 1FPCH 3FANA 1DWCH 1K1OA 1G2MA 4XE4A 1EASA 1GHBF 2OUAA 4F49A 2Z9JA 3MU1A 4ABJA 2J4IA 1ZSJA 2VWLA 1TYNA 3ZYEA 4UEHH 1NESE 2C8XB 4BTUB 5GDSH 1XX9A 1KIGH 1TPAE 1ZSLA 2PSYA 3RXJA 3I29A 2VIOA 3PMJA 1HRTH 5PTPA 1OOKB 5HGGA 5FPYA 5GXPA 2D26C 1ZTLA 4UFEH 2KAIB 1CGIE 1B7XB 2ZWLH 1SB1H 1WAYB 1FLEE 5L2ZH 2BZ6H 3RMLH 1E37B 1SLVB 3MH4A 4GCHG 2UUKB 5FXLA 1CE5A 3H7TA 4FXGH 1ZLRA 3EA8A 5CHAC 3LKWA 3UTUH 2A5IA 1GJ4H 1O3HA 2IPHA 1P2QA 3ZZAA 1AVGH 1HJ9A 3DFLA 1EAXA 2IOTA 3M5MA 3UREA 3SU2A 1SFQB 3RUOA 3RXTA 4IC6A 2VGCB 1BBRH 2BHGA 4MQAA 1SGRE 1WBGB 2CJIA 2Z6BD 4D7FA 2ZZUH 3U8TH 1C2IA 4BXSA 2FLBH 2H6MA 4MPUA 1T32A 4FUBA 4ISNA 2G55A 1O5EH 3V7TA 1ZMNA 4JCNA 4LZ1H 1DUEA 4JK5A 3K2UA 1OWJA 4Q7XA 1QA0A 5I46H 2CF8H 2FMJA 3RXGA 1TONA 2BDGA 2WYGA 2AFQB 2OQUA 1J8AA 2ANYA 4IMZA 2JETC 4WY3A 3BEUA 2R0KA 1CGHA 1PYTC 4ZHMU 2BQ7B 1V2NT 1SGPE 1PYTD 1P05A 2BQ6B 4KTCA 4FU7A 5F03A 4K2YA 3OSYA 8KME2 2ANMH 1TX6A 1ETRH 1TGBA 1H8IH 2V6NA 3A8DA 2EI6A 2BLWA 2WV5A 5EOKA 3Q77A 1C5SA 2ASUB 1C1OA 2HALA 4DJZB 4K5ZA 1PQ8A 1TALA 4WMFA 2AMQA 1C5LH 3NWUA 1MTVA 1MZDA 3NXPA 3SJKA 2GCTC 1QGFA 3KEEA 3LGWA 4K3JA 2D2DA 3UNRA 1K1JA 1DE7H 1CHOG 2FDAA 1HJAB 3TK5A 2OLGA 1GHYH 2BY6X 5CHAB 1ESBA 4ZH8A 1K1PA 4VGCB 3MFJA 3ZV8A 3MNCA 1MQ6A 3SU6A 3I78A 5EW1H 4OS7A 1TAWA 4MG3A 3VB4A 5JBTA 3A7XA 4NZLA 3URDA 4Z6AH 1UHBB 1GBMA 1W13U 3OY5U 4ISLA 1GDUA 4HFPB 2B9LA 2VIQA 1FY8E 2GTBA 3BSQA 1C2MA 2OBQA 1P01A 1J15A 1Y3VA 3SU4A 2OC1A 4FUHA 2PTCE 2NU1E 1QL9A 2BDYA 4I8JA 1T8NA 5FHTA 3URCA 1B5GH 3SU5A 5EQSA 1DVAH 1PFXC 5LGOA 1AKSA 2DE8A 3RXMA 3ZVGA 4BAOB 2BY8X 1K1MA 1HAOH 1UTOA 1NT1A 1O2SA 1AWHB 3R3GB 3ODFA 4QT8C 1GMCF 2BVXH 1Z8GA 3MO6A 4FUEA 1TX8A 3GYMA 2ZC9H 1ZGIA 5AF9H 2PWXA 1TB6H 3AASA 1VITF 1GI2A 1E38B 5EPNA 1AY6H 3ATKA 5FPSA 4X8UH 1TBRH 1JRSA 2SNVA 3SQHE 2VGCC 3PMBB 4TPYA 4AFSA 1NC6A 3DFJA 4ZHLU 1TMUH 1MBQA 1C5RA 1V2QT 4KELA 2XBYA 2BOHB 2QXGA 2R2MB 1FN8A 4AG2A 4I8KA 1QB1A 3QDZB 2AH4X 4B75A 3E0PB 2Z7FE 3SV7A 5DP7A 3UNQA 2HGTH 2C3SA 1J17T 1BQYA 3TGIE 4AOQA 1UTLM 1QQ4A 3S7KB 1DLEA 4ZROA 2R9PA 1ANBA 2BY9X 1W7XH 4U01A 4CRGA 2ZDNA 1BDAA 4BAMB 3UPEA 1GBLA 4DURA 2P3FH 5A0CA 1MCVA 3UWIA 2XTTB 2BYAX 1L4ZA 3RU4E 3VB7A 4ASHA 1P2IA 1K1IA 3MI4A 1S0RA 3SU3A 1LPZB 5F6MA 1JMOH 1EX3A 3L6PA 1YGCH 3RDZA 1LHFH 1RJXB 1XKAC 4FVBA 1OXGA 1C4Y2 2SGEE 3LGIA 4X1QU 7GCHF 1E35B 1GBIA 1F0TA 2G5NA 2JH5D 3QWCH 1NM6A 1KXAA 2BD3A 4AGKA 2ZU4A 5HXFA 2GVFA 3FVFB 2FTMA 1O39A 1E34B 3UR9A 4UD9H 2F3CE 4UFDH 4GHQA 2A31A 1C1RA 4CR5A 3F6UH 1O31A 1FY1A 1JOUB 1VCWA 2QC2A 1S85A 1CVWH 2PW8H 3RXQA 2FOFA 3BTHE 2P8OC 1GG6C 1XUFA 1ZTJA 3RC6A 1BITA 1D3TB 1XVOA 5EW2H 2F9OA 1NFYA 1A5GH 4WMEA 1L4DA 3ZZ8A 1A7SA 4ZKNU 1MBMA 2BDHA 1Y8TA 1JXPA 2ZQ1A 2ZDMA 1HYLA 3NUMA 1Z6EA 3GY4A 2BLVA 3OU0A 3UFAA 4UE7H 2AMDA 3MYWA 5DGJA 5DG6A 5E2PA 2BD2A 3AAUA 2P16A 2ZDVH 2ZEBA 3SNDA 2ZTZA 3SNBA 3BG8A 2GT7A 1QJ1B 3L3TA 3SNEA 4YLUA 1LVBA 1GJ6A 2A7JA 1XXFA 3GDSA 3LH3A 1GCTC 4JYTA 4AN7A 2FOEA 1F0SA 2ZIQH 2PV9B 4ABIA 1AMHA 1UVUH 3ZVBA 1Y3XA 3PROA 3G01A 4FU9A 4Y0ZE 2ZI2H 3A86A 1FNIA 3GCHC 3GISB 3LJOA 2IN2A 3LC5A 1ELAA 4TPIZ 1KTTB 1MTWA 2VH6A 1FY4A 2QYIA 4TY7A 2A4GA 1TRNA 1UVSH 1AHTH 1C1VH 2FTLE 3D65E 4K8YA 4BTTB 1MTNC 1UTQA 1CT0E 5DP4A 3STIA 2FO9A 3SGBE 1QIXB 3ZZ5A 1AFEH 1QJ7B 2C90B 1IQJA 1TQ0B 2NU4E 1XXDA 1EXFA 1C9TA 1V2KT 2AERH 4CHAB 1P3CA 1A3BH 5IYTA 1HAHH 2ZHEH 1O33A 1W3CA 1BIOA 1SL3A 3QN7A 1J9CH 4D76A 1LMWB 1ELBA 1NY22 4CREA 4KKDA 2BD5A 2ZPRA 2PR3A 3WY8A 6ESTA 3BTEE 1GHBG 1C1QA 2BVSH 4CBNA 1V2OT 3T27A 2VIWA 1HJ8A 4J2YB 1S83A 7GCHG 2ZQ2A 2A0QB 3A7VA 1EPTA 2FOHA 4GHTA 3M3SA 1O2OA 3CS0A 4OS2A 1F0UA 4JZEH 4X1NU 2F9VA 3K9XB 4I8HA 4DY7B 2A45B 4WMDA 1EOJA 2BX3A 2H2ZA 1O2IA 2HNTF 2OCVB 1O34A 1V2UT 3LGYA 1VCQA 2WUCA 1A46H 1TGCA 3SOSA 4LK4A 1V2PT 4I31A 1TA2A 1E0FD 1DX5M 1MD7A 1GWAA 2OBOA 2IJOB 2XRCA 2F91A 2J9NA 2FM2A 1DDJA 1GBBA 1O3CA 2G00A 1MMJN 4X8VH 3RXLA 1UK3A 4WH6A 1W8BH 2BLOA 2Q1JA 1YLDA 3NZIA 3M61U 1MU6B 1BTHH 2XW9A 4E7NA 2FPZA 3M5LA 4X6OA 4Z0KA 4I8LA 4INLA 1KY9A 2CN0H 4I32A 1D3QB 1SGTA 2QXIA 1S6HA 1O2UA 3A8BA 2H1UA 2ZPQA 1QR3E 1KXDA 2SGPE 2TGAA 2VU8E 1YLCA 2WV4A 3EGKH 2W3KA 3HGPA 5SGAE 2ZFFH 1W14U 2C93B 3GY8A 1O3FA 4ZKRU 3O8RA 1BMLA 1DSUA 3SUGA 4X2VA 2C8ZB 2FOAA 1C2LA 1IHTH 2HPPH 3QUMP 3A82A 1EKBB 2PKSC 1XUHA 4DIIH 2WUBA 1SPJA 2SNWA 1NFWA 5T6GA 2ZFPH 1NRRH 2ZU3A 4ESTE 1N6XA 1ELDE 2B5TB 1SGFA 1EJAA 2ULLA 4ABFA 1BUIA 3LGVA 1WCZA 4CR9A 5A0AE 5DO4H 5JYIA 1GJ5H 3HGNA 3T2NA 1OWKA 4XFQA 2JKHA 2RA0A 5F8ZA 1SR5C 3TNTA 4ISOA 1O5DH 1MTSA 3N7OA 1F5KU 1OWDA 2ZDLA 3PB1E 4ABGA 4Y11E 1XUIA 3MMGA 1HV7A 1HAPH 3RXKA 3CS7A 2V3OH 1P9UA 2ANKH 1SGQE 2OTVA 4HTCH 1BBRE 1DOJA 1O2MA 1WQSA 2AGIX 3Q3XA 1LCYA 3MH5A 3LT3A 1Y5BT 3BEIB 1ARCA 4AG1A 5DP3A 2G5VA 2O8TA 3PWCA 1F92A 3BTGE 1GBJA 2ALPA 4BOHA 1BJVA 5EU8A 4MLFB 2W7UA 3ATMA 3ZV9A 1YPJH 4AFQA 1RD3B 1T7CA 1GJDB 2GKVE 3P92A 2O8UA 4AFUA 1G3BA 1FIWA 2QGRA 5A0BA 1AB9B 3LU9B 3LGTA 2AGGX 3RMMH 3E0NB 1LKBA 1GI1A 3TK9A 1QBVH 3RXIA 1DXWA 1IQLA 1PPBH 4XBCA 1C5VA 1K28D 1O3IA 1VCPA 4Y76A 4BAKB 5A8XA 1VGCC 2VWMA 1GI7B 1O3JA 3Q76A 1BTXA 3TLOA 1YF4A 1O3GA 1DY8A 1VITH 6GCHG 2BLQA 3KIDU 4PROA 4OS5A 4JK6A 2SGDE 2PFEA 2Y80A 3TH3H 2BD8A 2OQ5A 1GHWH 4E7RG 3EE0B 1RFNA 3SHCH 1E36B 8LPRA 1SOZA 4K8BA 2Q6DA 2A5KA 1QFKH 1HCGA 1MD8A 1CHOF 1C2DA 1O3AA 1YBWA 4KGAA 3UQVA 1UTKA 5E0GA 3MH7A 2XC4A 3KCGH 1G32B 4TWYA 3P8OA 5L2YH 1P06A 1FDPA 3PWBA 2ZHFH 1HIAB 3BIVH 1CSOE 1TBZH 4INKA 1ZSKA 3T62A 2PGQB 1UK2A 2FXRA 1DITH 2BXUH 3F9EA 1P12E 2W3IA 5AVDA 1JRTA 1TNLA 1P57B 1AE5A 1CQQA 2QIQA 1O2TA 1JBUH 2J2UA 1KLTA 1FIZA 1GHAF 1ELGA 1P2MA 2Y5FA 3A85A 4RN6A 1ZRKA 3CENA 2PUXB 3AAVA 2AIPA 3ATLA
chains in the Genus database with same CATH superfamily
3P6ZB 2A4RA 2KR7A 4OM9A 1LHCH 1O2HA 1INCA 1RIWB 1C1SA 1NRPH 1BCUH 1A5IA 5B6LA 1QBNA 2DUCA 4JZDH 3BG4C 3H5CB 2Z3EA 1CT2E 3EDXB 5GWZA 5JDUB 1K2I1 1GMHF 4MPWA 1SSXA 3ZVAA 4OS6A 3VPKA 3SV6A 1TWXB 4B71A 1UVPA 2GMTC 2TPIZ 1C1UH 2GT8A 1O3KA 4UONA 1SQRA 3P8FA 2R2WU 1OKXA 3MU5A 1ABIH 2D8WA 2PGBB 4X2WA 2UWLA 4DGJA 4MVNA 2M5TA 3RP2A 1ZMJA 2VB0A 3EYDA 1THPB 1GCDA 2CHAB 1RRKA 1FJSA 1O2VA 2PSXA 2TIOA 2QF5A 4IC5A 1DWDH 2OC0A 5GNDA 1MAXA 3UWJH 2TGTA 2Z9GA 3A7TA 4BXWA 1DS2E 5C94A 1ELFA 4OGXA 5CE1A 3JZ2B 1GI6A 3SJ8A 1HB0B 3PTNA 4B2BA 1RGQA 4ABDA 2SFAA 2GCTB 1TQ7B 2CXVA 3A8CA 3E16B 3NPSA 5FX5A 4MNWA 3LONA 1V2MT 4FVDA 3P8NA 4B2CA 1EP5A 1MKWK 2P94A 2FS8A 1TRYA 4R8TB 2CGAA 1V2VT 1ETSH 4IS5A 3RXRA 1C2KA 1P10A 3BEFB 4INHA 2ZU5A 1GJ7B 4AFZA 5C0TA 3FZDA 3PLKA 4B6EA 1L1JA 3T28A 2P59A 1MQ5A 5EQQA 5FCRA 5LPEA 4IBLH 2ODYB 2J95A 2Y81A 3P17H 3ZZBA 2GV6A 1F2SE 1BTPA 3UOPA 6LPRA 1C5QA 3A83A 3AK5A 2BM2A 1BTYA 3T25A 2PHBA 2TGDA 1QQUA 1IOEA 1UTJA 2F9PA 1K22H 1Z1IA 1E1QD 2BOKA 3UQOA 3HK3B 1QTFA 5F53A 2A1DB 2J98B 4DG4A 4NG9H 5JBCS 4Y8XA 2Y7XA 2ZECA 3FFGA 1NFUA 4YZUA 1WUNH 2G4UA 5E8EH 1YM0A 4IGDA 2Y5GA 1FMGA 1BMFD 1WOFA 1IQHA 2FOCA 1SVPA 1MZAA 4K1EA 1OYQA 5L6NH 1ANCA 4GVUA 1QRWA 4AX9H 1TPSA 1GPZA 3OYPA 3SI4H 4FUGA 1NRNH 1GHAG 3KL6A 4ZCNA 1HAVA 1SGCA 2GX4A 1NTPA 2H9TH 3M36A 1XVMA 3GICB 3TNSA 2UWOA 3N99A 3S9CA 3VGCB 4KTSA 3RXFA 5FL7D 1N8OB 1AIXH 1O2PA 4A1XA 1PQ7A 2H5CA 3M7QA 4THNH 1QA7A 1V2JT 1W7GH 1RIWC 3SV2H 3U9AH 5EGMA 2QAAA 3ZVCA 7LPRA 5EODA 1FPHH 3UY9A 2B7DH 4FUDA 1GJ8B 1PPCE 2OINA 2WPIS 2ZDAH 2LPRA 1ZMLA 2ODPA 1LQDB 1HGTH 1O2YA 1MKXH 1O5GH 4FUIA 3RXEA 3KYGA 1KDQB 4CRDA 2FYRA 2XNIA 3KN2A 1O2QA 1O0DH 2BY7X 3UR6A 6CHAC 2RDEA 1O3LA 1F5LA 3BTKE 1HLTH 1V2ST 4BNRA 1J14A 1GHXH 3W95A 3RXDA 3KF2A 3GDVA 5TCCA 2FYQA 1UMAH 3U8OH 1TGNA 3JZ1B 1Y3UA 2WPKS 3C1KA 3UIRA 1EZXC 1OWHA 1A2CH 1O2ZA 1BJUA 4DT4A 1KXEA 1OX1A 2SGQE 1H8HD 1QBOA 2C8WB 3M37A 1PPFE 2Z9LA 5DK1A 4Y71A 4D8NA 1SLXB 5C2ZA 3QK1A 1BRAA 3BF6H 1ZHPA 1AZZA 1COWD 3E6PH 3GY3A 3BTTE 1C5PA 1BRUP 3U1IB 1B0EA 4JYUH 5CHBA 1ZPZA 4XRNA 1IQGA 4O97A 2VINA 4Q4LA 7ESTE 4NIVA 4H6SB 5DP6A 1H9HE 3VXFH 4NA8A 3TJOA 2FX6A 1TNGA 1U6QA 2VVCA 1O2LA 3VGCC 1ESAA 2ZFTA 3MWIU 2XNDD 2PKAB 2QXJA 1NU7B 1T4VH 1MKXK 4I8GA 4RKOB 3TH4H 1X7AC 3SN8A 4MTBA 3TH2H 1GHZA 1O3PB 4XBBA 3S7HB 4B2AA 5EXLA 3TJNA 2XBWA 1OPHB 1Z8IB 4HI3A 4KTUA 4ZKSU 5EXNA 5K7RA 2QCYA 1QB9A 3QZRA 3U69H 3ZZ3A 5IDKA 4YOGA 5DPAA 1P0SH 4B76A 5DP9A 1G3CA 4YLQH 2J92A 1BZXE 1QZ8A 1OP8A 2YNBA 3NKKA 4ZHAA 3Q3YA 1AD8H 2ZKSA 1P2NA 1KXCA 1FAKH 2BDCA 1SLWB 3P8GA 1H9LB 2BD4A 1KTSB 2BVRH 1UCYE 3PYHA 2STAE 3ESTA 4JYVH 4X6PA 5T1VA 3ZVEA 3QLPH 3RLYH 1GDQA 1EPTB 3RM2H 3A7WA 5A09A 1LVOA 3OY6U 3RMOH 2W5EA 4WH8A 4Y79A 3GCHB 5K0HA 2P3UB 2ZGXH 1LPKB 3BG4B 3ATWA 2IPQX 2XCNA 3RXUA 1ORFA 1GJCB 4TT3D 2VIPA 4TYDA 5E0JA 4MPVA 4DT7B 5E2OA 3B8JA 1BA8B 1Z6JH 3ELAH 3GY7A 1C2HA 1S82A 1GVZA 1H1BA 4BANB 2ILNA 5T6DA 3A87A 1C5ZB 2EEKA 1BT7A 1HPGA 4F55A 1GI0A 1THSH 1GBCA 1P03A 2PKAA 4VGCC 4J1YA 2F9UA 1O5CB 1OSSA 2GD4B 2GMTB 3KQCA 3B23B 1BBRK 1LHDH 4CH2B 5F8TA 1UTNA 2VBCA 1BHXB 2ESTE 1EATA 3OTPA 2GCHG 3MHWU 4Y10E 1XUJA 3S9BA 4AZ2B 1K9OE 4X2YA 1AGJA 4ASUD 1O3EA 4ABBA 4CH8B 1AN1E 1RTFB 1P8VC 5DP8A 1TOMH 3EA9A 1KSNA 1GVKB 1MU8B 2Y82A 5C5OA 5C1XA 2TGPZ 2HRVA 2L74A 3O8CA 2LELA 4NSVA 4IN2A 3WW7A 3V0XA 5J4QA 1A4WH 1G36A 1Z8RA 2EA3A 4NWKA 1NRQH 2XC0A 5HIYA 3OX7U 2EC9H 1EOLA 1QY6A 3A80A 1MKWH 3R0FA 2B0FA 1YPHC 2FLRH 1FY3A 3KQEA 3RXOA 1EAIA 1EPTC 1KYNA 2I6QA 1HDTH 3VB6A 5LH8A 4XSKU 1KDQA 5KGOA 2WPDD 1CO7E 2WHXA 3MU4A 3E3TA 1QNJA 4NIYA 5LPRA 4B73A 4NFFA 1UW7A 4ABEA 4A92A 3RC5A 1VJAU 1G3DA 1YPHE 3HK6B 3RU4T 2VIVA 1XUKA 3LIWA 4YTAA 4O3UA 1HNEE 5F8XA 1ANEA 1DLKB 3U8RH 4MNVA 4MNXA 4GPGA 2V0BA 3QO6A 5A2MH 3S9AA 1QB6A 1S81A 2V3HH 1AUTC 5T6FA 2C8YB 5C5NA 1V6DA 1K1NA 4NGAH 5ETXA 1C5UA 2VVUA 3UNSA 1HAVB 4X1PU 1B0FA 4YT6H 3GY6A 2EI8A 4IN1A 1QRXA 2Q6FA 2STBE 1HAIH 1AVXA 3ZZCA 3MU0A 2O8MA 3PRBA 3TK6A 4X6MA 3IG6B 4AORA 1A5HA 3HKJB 6GCHF 1T8LA 4TWWA 4Q80A 1C4U2 1F5RA 1NBME 4A6LA 3RXAA 1DUAA 2Z9IA 1NU9A 5DP5A 1SHHB 5HM9A 4NCYA 3VG8A 1O3OA 1ZPCA 2BD7A 1OYTH 1D6WA 3FZZA 1TFXA 3QGJA 4Y0YE 1DANH 3TJVA 1WTHD 1LHGH 3RM0H 3S69A 1TIOA 3NRLA 4BAHB 1BHXF 1TE0A 3KHVA 2F9NA 1ELVA 3A81A 4UDWH 3D62A 3PLPA 3M7UA 3A8AA 4CRFA 3L33A 4ZUHA 1O3NA 2FI3E 1TNIA 3A7YA 1MCTA 2GZ7A 3QX5H 2NWNA 1C5MD 4A7IB 3RXHA 5HYOA 2ZHDA 4GUXA 2G51A 2P95A 3P95A 4UFFH 5IK2D 3A88A 2FI5E 1VZQH 4E05H 1FZZA 1HAGE 1SI5H 4H4FA 2F9BH 1DSTA 2UUJB 1K1LA 3SJOA 4Y6DA 2ZPSA 1O2KA 3F0PA 2ZHWH 2QF0A 1GHVH 2H5DA 2UUFB 1ZHRA 1VKYA 2TRMA 4AGJA 3TGKE 1G3EA 1GMCG 3IITA 1ETTH 2GZ8A 1PQAA 1C2FA 4WVPE 1DWEH 1TNKA 1OP0A 1H9IE 4A5TS 3SZNA 1CHGA 1BTUA 3RU4D 5HKKD 2ZTYA 3M3TA 4YT7H 1ZJDA 5C20A 1IAUA 1W11U 4OGYA 1GBFA 2BXTH 2TBSA 4OS1A 2KCOA 3SUEA 3F9FA 4MDSA 2PUQH 4B74A 3A7ZA 3GYLB 4WWYA 1GL1A 2BDBA 1NFXA 2HLCA 2GGVB 4ZXYH 1Q3XA 1AO5A 2GP9B 4JZIA 1TGSZ 5HIZA 4B1TA 1GDNA 3GY5A 3SNCA 3TIUA 3BTQE 3P70B 3PTBA 2XWBI 2JJ1D 2AS9A 3SUDA 3FP7E 1A0HB 1KLIH 5GPIB 1YYY1 3SUFA 3FP6E 1BMNH 4Y8YA 3MTYA 1MAYA 3MNSA 3PM3A 4LOYH 1L1GA 2FEQH 2QXHA 4YESB 1BRBE 2ZGJA 1RS0A 4IW4E 2R3UA 1GGDC 2B8OH 5LPFA 1C1MA 4A1TA 3UB0A 3GY2A 2VH0A 2ODQA 4H6TA 2ZCKP 3HPTB 1O2GH 1DWBH 3LPRA 2O8WA 3SORA 2FOBA 1LVYA 1EJMA 4YXWD 1MTNB 3T29A 3GDUA 1C5YB 1HIAA 1IQEA 2THFB 1O3MA 1T8MA 1HUTH 4GLYA 1UVTH 2JIZD 4Y7AA 5DJ7A 2ZFSA 2OC7A 2Z3CA 2HNTE 3BTFE 3SJIA 2UWPA 1N1LA 3ZZ9A 1AUJA 1NO9H 2G52A 2FI4E 5B6OA 3LOXA 3V12A 2FZZA 2XWAA 4NWLA 5HM2A 1PPZA 1ABJH 2ZGHA 1YPEH 1ELCA 4NZQA 1A0JA 3VB3A 3SU1A 3ZVFA 4O9VA 2VVVA 4AYYB 2P8OB 2W6ID 3ZZ7A 1BB0B 1WYKA 1W2KH 3QZQA 3M3VA 3GCTG 1VR1H 2AEIH 4BAQB 4U30A 1J16A 4X8TH 5GCHF 5EQRA 4Y8ZA 3LH1A 2ZFRH 1Y59T 3OEED 1W0YH 8GCHF 1BMMH 5EG4A 1UO6A 4D7GA 3KNXA 2CF9H 4NIWA 3SI3H 1Q31A 2BX4A 1AU8A 1TLDA 2H9HA 1UTPA 2ZG0H 1N6YA 3BN9A 5H4IB 1AFQB 1SQTA 1EZSC 1G2LA 1TNJA 1GI5A 4DVAU 4ISIH 4ACBA 1TA6A 3UAIC 1T8OA 1D3PB 4NA7A 1P2KA 1DY9A 3V3MA 2HWLB 1AE8H 1QRZA 1YKTA 2QF3A 1KXBA 1WTGH 1M9UA 3VB5A 4M9FA 1IQMA 1Y5UT 2JJ2D 5TCAA 2NU0E 3ZZ4A 1QL8A 3F2HA 2KAIA 1O5BB 4AYVB 1JWTA 1IHSH 1ELTA 1TRMA 1A1RA 1ID5H 1GMDG 1WU1A 2I6SA 3VFEA 1D4PB 2BDAA 2XBVA 2YNAA 1ZR0A 4BTIB 1TPPA 1ACBE 1O35A 3KQDA 3LDXH 1TOCB 2BQWB 2A4OA 4MPXA 3ITIA 1PQ5A 3MQKC 2ZO3H 3FOAA 4X0WU 4ABHA 1GGDB 1SGEE 1C5OH 1GBDA 3PO1C 2BY5X 4K60A 4ZAEA 3PV2A 5G4BA 5GJ4B 4CRCA 1LDTT 4XOJA 3E91A 1DICA 2AYWA 5GCHG 2BB4A 3QTVH 4IMQA 1QCPA 1CA0B 2ZTXA 1UTMA 4ABAA 3SZEA 3IWMA 3GCNA 1OP2A 4NSYA 3MOCA 4K1SA 1CU1A 4WXIA 3F9HA 5DKMA 1OS8A 1C2JA 3ZZDA 2G8TA 2OXSA 3MH6A 2FOGA 2XBXA 3GCOA 1ZGVA 1HAZB 3H7OA 1YPLH 4AC9A 2ZGCA 1QHRB 2HVXA 2HOBA 4HZHA 2QA9E 2D1JA 4FUJA 2ZA5A 1C4V2 5FX6A 2JH6D 1YP9A 1VGCB 1SMFE 2EY4C 1IQIA 4I86A 1EB1H 2WYJA 4JZFH 5JBBS 3FP8E 4FUCA 1GI4A 1MUEB 1HJAC 1CBWB 1SFIA 2G81E 3DD2H 1SOTA 3TGJE 3LJJA 3F2FA 2LNCA 3K6ZA 4FU8A 4SGAE 1YWUA 4LZ4B 3MNXA 3TITA 2K1QA 1RTLA 2HNTC 3M5OA 5TJXA 5AHGH 1K0HA 1V2WT 2ZHQH 2R3YA 2A7HA 1SGIB 2H9EH 4NIXA 1T4UH 3RXPA 2ZCLP 1PPHE 1P04A 2CMYA 1QURH 1YLNA 4GAWA 2K8IA 1A0LA 1UCYH 2AIQA 4Q7YA 3DHKH 2NU3E 3LGUA 4GCHF 2O8LA 4WJG2 3C27B 1PPGE 5C3NA 1GI8B 2SGFE 2PKSB 1LTOA 1NS3A 3GS9A 1C2GA 4B6FA 3ENSB 3STJA 2RFKC 1FI8A 1GBTA 5CMXH 1HXEH 1TMTH 4YM9A 1V2TT 4Y7BA 4H42U 3W1EA 1Z71A 4K69A 4ZMAH 2JETB 1BRCE 8GCHG 2W7SA 5FPTA 3EQ0H 2RA3A 4ZKOU 4Q7ZA 2OD3B 2QV1A 3AW1A 4Z1MD 1NZQH 2AGEX 1YPKH 1ARBA 3SV8A 2RG3A 1ZRBA 1RTKA 2QY0B 1Z7KA 2FP7B 2V35A 3SU0A 4HGCA 1C5XB 2FOMB 3TPIZ 2A32A 2PTNA 5FBIA 2YMSB 5BPEA 3MO3A 3WWFA 1KMHB 3F1SB 2XC5A 2Z9KA 1KLJH 5EIYA 2LP6A 3CP7A 2J97A 1LHEH 1CGJE 2QF4A 2BD9A 4CRAA 4F4OC 3I77A 1BTWA 1C1PA 1EP6A 1TX7A 1A61H 1SC8U 2A2XH 1NPMA 1GMDF 2PLXA 2VWNA 3DUXH 5HMAA 4U32A 1UCYK 1YY3A 2ZGBH 1G37A 4X1RU 3QTOH 1IQKA 9LPRA 1VITG 3A84A 1D9IA 1YPGH 1AWFH 2CHAC 4NFEA 1GBKA 5FCKA 3NK8A 3O8BA 3SYJA 1O3DA 3V13A 3SGQE 4DOQA 3SQEE 2ZU1A 1V2RT 1HFDA 2OP9A 2W26A 1O36A 5EPYA 2OK5A 1WQVH 1CA0C 2JDID 4DCDA 3UUZA 5I25A 3A89A 3W94A 4AB8A 4AB9A 1YPMH 4E06H 1SGFG 1V2LT 1L2EA 1GVLA 2Y5HA 1HAYB 1GBAA 1P2OA 3S0NA 3ZVDA 1ZOMA 1P11E 4FUFA 3DSOA 5AFYH 2FWWA 2Y7ZA 3ZZ6A 4ACAA 4A1VA 4YO9A 4UFGH 3RLWH 1EZUC 1LQEA 4CHAC 1AB9C 1L0ZA 1W0ZU 2A7CA 2C4FH 2Y6TA 1O2NA 1BMAA 1JIRA 3TU7H 3KQBA 1KXFA 1AZ8A 3U98H 1LO6A 3E90B 2UUYA 3BTDE 2HLDD 4D9QA 3K65B 1W0KD 4XDEA 1EUFA 1F7ZA 2ANWA 1ZTKA 2BDIA 1FQ3A 4O3TA 2ALVA 2G4TA 3QGNB 1SLUB 1EQ9A 1A3EH 1C1NA 1CBWC 3UOUA 5BRRE 5AFZH 3MO9A 2FS9A 1SBWA 2GV7A 5JPMH 3PRDA 4WXVA 1HXFH 1IQNA 1S5SA 1C5TA 3B9FH 4YOIA 1O2RA 1ZJKA 2A2QH 5A8YA 4RI0A 1O30A 4I33A 1Z1JA 6CHAB 2VIDA 2Z94A 3BIUH 3RC4A 3TJUA 2A4QA 3SJ9A 1DPOA 1GL0E 3AVZA 1YC0A 4I7YH 1XKBC 1GJ9B 1SGNE 4X2XA 2J5UA 3M35A 2VJ1A 3RXBA 1GCTB 5EXMA 1GJAB 1FY5A 1PJPA 5J4SA 1O2WA 5ESTE 4RSPA 4DIHH 3K6YA 9ESTA 4CBOA 1UJ1A 1ZHMA 1P3EA 2XCFA 5FAHA 3RXSA 2QE7D 3BTWE 4CRBA 1AFQC 5T3HA 3SBKA 1P09A 1O5AB 1PPEE 1AVWA 1HAXB 1YCPH 1YCPK 1G9IE 1XMNB 5ABWA 4TSFD 1AQ7A 1SGDE 2SGAA 2WINI 3M5NA 2VWOA 3SO3A 2KFWA 1ESTA 1FN6A 1O3BA 2P93A 2KZ4A 5C1UA 2GDDA 1Y3WA 2F4LA 2HPQH 4O03A 2Z3DA 1EB2A 3RMNH 2OC8A 3N7DA 3ZYDA 1TNHA 1K21H 1VJ9U 3Q00A 1SG8B 7KMEH 2ZCHP 5E0HA 2RCEA 3SGAE 2WPMS 2J34A 4KP0A 2ZU2A 4RKJB 1TBQH 3AW0A 1ZZZA 1N8OC 4DW2U 4Q2KA 4R0IA 3GOVB 1H4WA 2WPHS 3PLBA 3ATIA 1FAXA 1FUJA 4OS4A 3F68H 2IJD1 2WV9A 3OTJE 3Q3KA 4TY6A 5GIBA 1D6RA 1WV7H 2QN5T 4ISHH 1RXPA 1MH0A 1DXPA 1HBTH 3VXEH 2ZF0H 1FXYA 1F0RA 1T31A 8ESTE 1O37A 1W12U 1AI8H 2KM0A 1C2EA 1O32A 2ZP0H 4NA9H 4M7GA 1D3DB 1ZYOA 3M7TA 3ODDA 1NN6A 5EJZA 1EZQA 4JZ1A 1TABE 1C5WB 1QJ6B 1FV9A 1C1WH 1W10U 1DFPA 3D23A 1NROH 3F9GA 1SHYA 3D49H 2ZFQH 3F0OA 1C9PA 1GI3A 2ZDKA 2J38A 1QL7A 3SW2B 2AMPA 1YCPM 3PMHB 1AKSB 2WPLS 1Y5AT 4MNYA 1THRH 1P02A 1O2JA 1WDIA 3PMAB 4D9RA 3E1XB 2DE9A 3BV9B 3PO1B 1UK4A 2Q6GA 5JB8S 1S0QA 2FIRH 4U2WA 1BTZA 1DM4B 3MNBA 5JB9S 1TPOA 1SGYE 1S6FA 2FODA 1OWEA 3SNAA 1O5FH 2BZAA 2GDEH 2XXLA 1EAWA 1XM1A 4YOJA 1C1TA 1CT4E 5A8ZA 2R0LA 1H8DH 2WPJS 4XBDA 3BTME 1GMHG 3VEQB 2J94A 1P9SA 1UHBA 3DSGA 3SHAH 3O8DA 1LKAA 2O9QA 5C1YA 2YOLA 3U1JB 2VNTA 1ANDA 1TMBH 4SGBE 5C67A 2BTCE 3DA9B 3MU8A 1GI9B 2ZNKH 1EAUA 4LXBH 1XUGA 2GCHF 3EAJA 3RXCA 5DN6D 3TVJB 1P2JA 3DT0H 1Z8JB 5CDFE 2JH0D 1LPGB 3LC3A 1G30B 2P3TB 3EA7A 3HATH 3PV4A 2BMGB 1DT2A 1ZPBA 2FESH 3HKIB 4ZXXH 2F83A 4HG6A 1L1NA 3KGPA 1O38A 3CNRA 2RDLA 3OEHD 1GJBB 1UVOA 1SQOA 4WF8A 3SV9A 1C5NH 1ELEE 1NRSH 5EJLA 2FX4A 1GG6B 3RXVA 1GBEA 2EI7A 1O2XA 1SQAA 1BOQA 1S84A 1OWIA 3NCLA 4GSOA 3GCTF 1Y3YA 5L30H 1GBHA 1MTUA 5FBEA 1IQFA 2NU2E 1V3XA 5ESBA 4X6NA 3E8LA 3T26A 3FAOA 4X1SU 2A5AA 4X8SH 1CA8B 1LVMA 1EJNA 1WSSH 2XYAA 3T5FH 1Q2WA 1TGTA 2GZ9A 1FONA 2CV3A 5JBAS 2KCYA 1JIMA 2WZQA 3FKSD 4K1TA 4JMYA 1FPCH 3FANA 1DWCH 1K1OA 1G2MA 4XE4A 1EASA 1GHBF 2OUAA 4F49A 2Z9JA 3MU1A 4ABJA 2J4IA 1ZSJA 2VWLA 2HVYB 1TYNA 3ZYEA 4UEHH 1NESE 2C8XB 4BTUB 5GDSH 1XX9A 1KIGH 1TPAE 1ZSLA 2PSYA 3RXJA 5C0UA 3I29A 2VIOA 3PMJA 1HRTH 5PTPA 1OOKB 5HGGA 5FPYA 5GXPA 2D26C 1ZTLA 4UFEH 2KAIB 1CGIE 1B7XB 2ZWLH 1SB1H 3OE7D 1WAYB 1FLEE 5L2ZH 2BZ6H 1H8ED 3RMLH 1E37B 1SLVB 3MH4A 4GCHG 2UUKB 5FXLA 1CE5A 3H7TA 4FXGH 1ZLRA 3EA8A 4P00A 5CHAC 3LKWA 3UTUH 2A5IA 1GJ4H 1O3HA 2IPHA 1P2QA 3ZZAA 3ZIAD 1AVGH 1HJ9A 3DFLA 1EAXA 2IOTA 3M5MA 3UREA 3SU2A 1SFQB 3RUOA 3RXTA 4IC6A 2VGCB 1BBRH 2BHGA 4MQAA 1SGRE 1WBGB 2CJIA 2Z6BD 2EQNA 4D7FA 2ZZUH 3U8TH 1C2IA 4BXSA 2FLBH 2H6MA 4MPUA 1T32A 4FUBA 4ISNA 2G55A 1O5EH 3V7TA 1ZMNA 4JCNA 4LZ1H 1DUEA 4JK5A 2GJGA 3K2UA 1OWJA 4Q7XA 1QA0A 5I46H 2CF8H 2FMJA 3RXGA 1TONA 2BDGA 2WYGA 2AFQB 2OQUA 1J8AA 2ANYA 4IMZA 2JETC 4WY3A 3BEUA 2R0KA 1CGHA 1PYTC 4ZHMU 2BQ7B 1V2NT 1SGPE 1PYTD 1P05A 2BQ6B 4KTCA 4FU7A 5F03A 4K2YA 3OSYA 8KME2 1EFRD 2ANMH 1TX6A 2AHME 1ETRH 1TGBA 4RT1A 1H8IH 2V6NA 3A8DA 2EI6A 2BLWA 2WV5A 5EOKA 3Q77A 1C5SA 3DSPA 2ASUB 1C1OA 2HALA 4DJZB 4K5ZA 1PQ8A 1TALA 4WMFA 2AMQA 1C5LH 3NWUA 1MTVA 1MZDA 3NXPA 3SJKA 2GCTC 1SKYE 1QGFA 3KEEA 3LGWA 4K3JA 2D2DA 3UNRA 1K1JA 1DE7H 1CHOG 2FDAA 1HJAB 3TK5A 2OLGA 1GHYH 2BY6X 5CHAB 1ESBA 4ZH8A 1K1PA 4VGCB 3MFJA 3ZV8A 3MNCA 1MQ6A 2L6OA 3SU6A 3I78A 5EW1H 4OS7A 1TAWA 4MG3A 3VB4A 5JBTA 3A7XA 4NZLA 3URDA 4Z6AH 1UHBB 1GBMA 1W13U 3OY5U 4ISLA 1GDUA 4HFPB 2B9LA 2VIQA 1FY8E 2GTBA 3BSQA 1C2MA 2OBQA 1P01A 1J15A 1Y3VA 3SU4A 2OC1A 4FUHA 2PTCE 2NU1E 1QL9A 2BDYA 4I8JA 4P02A 1T8NA 5FHTA 3URCA 1B5GH 3SU5A 5EQSA 1DVAH 1PFXC 5LGOA 1AKSA 2DE8A 3RXMA 3ZVGA 4BAOB 2BY8X 1K1MA 1HAOH 1UTOA 1NT1A 1O2SA 1AWHB 3R3GB 3ODFA 4QT8C 1GMCF 2BVXH 1Z8GA 3MO6A 4FUEA 1TX8A 3GYMA 2ZC9H 1ZGIA 5AF9H 2PWXA 1TB6H 2YMSC 1VITF 3AASA 1GI2A 1E38B 5EPNA 1AY6H 3ATKA 5FPSA 2F43B 4X8UH 1TBRH 1JRSA 2SNVA 3SQHE 2K0QA 2VGCC 3PMBB 4TPYA 4AFSA 1NC6A 3DFJA 4ZHLU 1TMUH 1MBQA 1C5RA 1V2QT 4KELA 2XBYA 3FO8D 2BOHB 2QXGA 3H09A 2R2MB 1FN8A 4AG2A 4I8KA 1QB1A 3QDZB 2AH4X 4B75A 3E0PB 2W6JD 2Z7FE 5DP7A 3SV7A 3UNQA 2HGTH 2C3SA 1J17T 1BQYA 3TGIE 4AOQA 1UTLM 1QQ4A 3S7KB 1DLEA 1E1RD 4ZROA 2R9PA 1ANBA 2BY9X 1W7XH 4U01A 1W0JD 2ZDNA 4CRGA 1BDAA 4BAMB 3UPEA 5DSFA 3KYFA 1GBLA 4DURA 2P3FH 5A0CA 1MCVA 3UWIA 2XTTB 2BYAX 1L4ZA 3RU4E 3VB7A 4ASHA 1P2IA 1K1IA 3MI4A 3N7EA 3F3BA 1S0RA 3SU3A 1LPZB 5F6MA 1JMOH 1EX3A 3L6PA 1YGCH 3RDZA 1LHFH 1RJXB 1XKAC 4FVBA 1OXGA 2XOKD 4FOUC 1C4Y2 2SGEE 3LGIA 4X1QU 3DCLA 7GCHF 1E35B 1GBIA 1F0TA 2G5NA 2JH5D 3QWCH 1NM6A 1KXAA 2BD3A 4AGKA 2ZU4A 5HXFA 2GVFA 3FVFB 2FTMA 1O39A 1E34B 3UR9A 4UD9H 2F3CE 4UFDH 4GHQA 2A31A 1C1RA 4CR5A 3F6UH 1O31A 1FY1A 1JOUB 1VCWA 2QC2A 1S85A 1CVWH 2PW8H 3RXQA 2FOFA 3BTHE 2P8OC 1GG6C 1XUFA 1ZTJA 3RC6A 1BITA 1D3TB 1XVOA 5EW2H 2F9OA 1NFYA 1A5GH 4WMEA 1L4DA 3ZZ8A 1A7SA 4ZKNU 1MBMA 2BDHA 1Y8TA 1JXPA 2ZQ1A 2ZDMA 1HYLA 3NUMA 1Z6EA 3GY4A 2BLVA 3OU0A 2PP6A 3UFAA 4UE7H 2AMDA 3MYWA 5DGJA 5DG6A 5E2PA 2BD2A 3AAUA 2P16A 2ZDVH 2ZEBA 3SNDA 2ZTZA 3SNBA 3BG8A 2GT7A 1QJ1B 3L3TA 3SNEA 4YLUA 1LVBA 1GJ6A 2A7JA 1XXFA 3EE7A 3GDSA 1MABB 3LH3A 1GCTC 4JYTA 4AN7A 2FOEA 1F0SA 2ZIQH 2PV9B 4ABIA 1AMHA 1UVUH 3ZVBA 1Y3XA 3PROA 3G01A 4FU9A 4Y0ZE 2ZI2H 3A86A 1FNIA 3GCHC 3GISB 3LJOA 2IN2A 2KCAA 1ELAA 3LC5A 4TPIZ 1KTTB 1MTWA 2VH6A 1FY4A 2QYIA 4TY7A 2A4GA 1TRNA 1UVSH 1AHTH 1C1VH 2FTLE 3D65E 4K8YA 4BTTB 1MTNC 1UTQA 1CT0E 5DP4A 3STIA 2FO9A 3SGBE 1QIXB 3ZZ5A 1AFEH 1QJ7B 2C90B 1IQJA 1TQ0B 2NU4E 1XXDA 1EXFA 1C9TA 1V2KT 2AERH 4CHAB 3OAAD 1P3CA 1A3BH 5IYTA 1HAHH 2ZHEH 1O33A 1W3CA 1BIOA 1SL3A 3QN7A 1J9CH 4D76A 1LMWB 1ELBA 1NY22 4CREA 4KKDA 2BD5A 2ZPRA 2PR3A 4F48B 3WY8A 6ESTA 3BTEE 1GHBG 1C1QA 1S6LA 2BVSH 1V2OT 4CBNA 3T27A 2VIWA 1HJ8A 4J2YB 1S83A 7GCHG 2ZQ2A 2A0QB 3A7VA 1EPTA 2FOHA 4GHTA 3M3SA 1O2OA 3CS0A 4OS2A 5C17A 1F0UA 4JZEH 4X1NU 2F9VA 3K9XB 4I8HA 4DY7B 2A45B 4WMDA 1EOJA 2BX3A 2HNTF 1O2IA 2H2ZA 2OCVB 1O34A 1V2UT 3LGYA 1VCQA 2WUCA 1A46H 1TGCA 2CK3D 1OHHD 3SOSA 3WWBA 4LK4A 1V2PT 4I31A 1TA2A 1E0FD 1DX5M 1MD7A 1GWAA 2OBOA 2IJOB 2XRCA 2F91A 2J9NA 2FM2A 3KQ5A 1DDJA 1GBBA 1O3CA 2G00A 1MMJN 4X8VH 3PV5A 3RXLA 1UK3A 4WH6A 1W8BH 2BLOA 2Q1JA 1FX0B 1YLDA 3NZIA 3M61U 1MU6B 1WXRA 1BTHH 2XW9A 4E7NA 2FPZA 3M5LA 4X6OA 4Z0KA 4I8LA 4INLA 1KY9A 2CN0H 3U28C 4I32A 1D3QB 1SGTA 2QXIA 1S6HA 1O2UA 3A8BA 2H1UA 2ZPQA 1QR3E 1KXDA 2SGPE 2TGAA 2VU8E 2YMSD 1YLCA 2WV4A 3EGKH 2W3KA 3HGPA 5SGAE 2ZFFH 1W14U 2C93B 3GY8A 1O3FA 4ZKRU 3O8RA 1BMLA 1DSUA 5KECA 3SUGA 4X2VA 2C8ZB 2FOAA 1C2LA 1IHTH 2HPPH 3QUMP 3A82A 1EKBB 2PKSC 1E79D 1XUHA 4DIIH 2WUBA 1SPJA 2SNWA 1NFWA 5T6GA 2ZFPH 1NRRH 2ZU3A 4ESTE 1N6XA 1ELDE 2B5TB 1SGFA 1EJAA 2ULLA 4ABFA 1BUIA 3LGVA 1WCZA 4CR9A 5A0AE 5DO4H 5JYIA 1GJ5H 3HGNA 4FETA 1OWKA 3T2NA 4XFQA 2JKHA 2RA0A 5F8ZA 1SR5C 3TNTA 4ISOA 1O5DH 1MTSA 3N7OA 1F5KU 1OWDA 2ZDLA 3PB1E 4ABGA 4Y11E 1XUIA 3MMGA 1HV7A 1HAPH 3RXKA 3CS7A 2V3OH 1P9UA 2ANKH 1SGQE 2OTVA 4HTCH 1BBRE 1DOJA 1O2MA 1WQSA 2AGIX 3Q3XA 1LCYA 3MH5A 3LT3A 1Y5BT 3BEIB 1ARCA 4AG1A 5DP3A 2G5VA 2O8TA 3PWCA 1F92A 3BTGE 1GBJA 2ALPA 4BOHA 1BJVA 5EU8A 4MLFB 2W7UA 3ATMA 3ZV9A 1YPJH 4AFQA 1RD3B 1T7CA 5EJ1A 1GJDB 2GKVE 3P92A 2O8UA 4AFUA 1G3BA 1FIWA 2QGRA 5A0BA 1AB9B 3LU9B 3LGTA 2AGGX 3RMMH 2KX4A 3E0NB 1LKBA 1GI1A 3TK9A 1QBVH 2J98A 3FN8A 3RXIA 1DXWA 1IQLA 1PPBH 4XBCA 1C5VA 1K28D 1O3IA 1VCPA 4Y76A 4BAKB 5A8XA 1VGCC 2VWMA 1GI7B 1O3JA 3Q76A 1BTXA 3TLOA 1YF4A 1O3GA 1DY8A 1VITH 6GCHG 2BLQA 3KIDU 4PROA 4OS5A 4JK6A 2SGDE 2PFEA 2Y80A 3TH3H 2BD8A 2OQ5A 1GHWH 4E7RG 3EE0B 1RFNA 2M2AA 3SHCH 1E36B 4RT0A 8LPRA 1SOZA 4K8BA 2Q6DA 2A5KA 1QFKH 1HCGA 1MD8A 1CHOF 1C2DA 1O3AA 1YBWA 4KGAA 3UQVA 1UTKA 5E0GA 3MH7A 2XC4A 3KCGH 1G32B 4TWYA 1NBMD 3P8OA 5L2YH 1P06A 1FDPA 3PWBA 4XD7D 2ZHFH 3OFND 1HIAB 3BIVH 1CSOE 1TBZH 4INKA 1ZSKA 3T62A 2PGQB 1UK2A 2FXRA 4Q63A 1DITH 2BXUH 3F9EA 1P12E 2W3IA 5KEDA 5AVDA 1JRTA 1TNLA 1P57B 1AE5A 1CQQA 2QIQA 1O2TA 2V7QD 1JBUH 2J2UA 1KLTA 2V3MA 1FIZA 1GHAF 1ELGA 1P2MA 2KCPA 2WSSD 2Y5FA 3A85A 4RN6A 3F2GA 1ZRKA 3CENA 2PUXB 3AAVA 2AIPA 3ATLA
chains in the Genus database with same CATH topology
3P6ZB 2A4RA 1LHCH 1O2HA 1INCA 1RIWB 1C1SA 1NRPH 1BCUH 1A5IA 1QBNA 2DUCA 4JZDH 3BG4C 3H5CB 2Z3EA 1CT2E 3EDXB 5GWZA 5JDUB 1K2I1 1GMHF 4MPWA 1SSXA 3ZVAA 4OS6A 3VPKA 3SV6A 1TWXB 4B71A 1UVPA 2GMTC 2TPIZ 1C1UH 2GT8A 1O3KA 4UONA 3P8FA 2R2WU 1OKXA 3MU5A 1ABIH 2D8WA 2PGBB 4X2WA 2UWLA 4DGJA 4MVNA 2M5TA 3RP2A 1ZMJA 2VB0A 3EYDA 1THPB 1GCDA 2CHAB 1RRKA 1FJSA 1O2VA 2PSXA 2TIOA 4IC5A 1DWDH 2OC0A 1MAXA 3UWJH 2TGTA 2Z9GA 3A7TA 4BXWA 1DS2E 1ELFA 4OGXA 5CE1A 3JZ2B 1GI6A 3SJ8A 1HB0B 3PTNA 4B2BA 1RGQA 4ABDA 2SFAA 2GCTB 1TQ7B 2CXVA 3A8CA 3E16B 3NPSA 5FX5A 4MNWA 3LONA 1V2MT 4FVDA 3P8NA 4B2CA 1EP5A 1MKWK 2P94A 2FS8A 1TRYA 4R8TB 2CGAA 1V2VT 1ETSH 4IS5A 3RXRA 1C2KA 1P10A 3BEFB 4INHA 2ZU5A 1GJ7B 4AFZA 3FZDA 3PLKA 1L1JA 3T28A 2P59A 1MQ5A 5EQQA 5FCRA 5LPEA 4IBLH 2ODYB 2J95A 2Y81A 3P17H 3ZZBA 2GV6A 1F2SE 1BTPA 3UOPA 6LPRA 1C5QA 3A83A 2BM2A 1BTYA 3T25A 2PHBA 2TGDA 1QQUA 1IOEA 1UTJA 2F9PA 1K22H 1Z1IA 2BOKA 3UQOA 3HK3B 1QTFA 2A1DB 4DG4A 4NG9H 5JBCS 4Y8XA 2Y7XA 2ZECA 3FFGA 1NFUA 4YZUA 1WUNH 2G4UA 5E8EH 1YM0A 4IGDA 2Y5GA 1FMGA 1WOFA 1IQHA 2FOCA 1SVPA 1MZAA 4K1EA 1OYQA 5L6NH 1ANCA 4GVUA 1QRWA 4AX9H 1TPSA 1GPZA 3OYPA 3SI4H 4FUGA 1NRNH 1GHAG 3KL6A 1HAVA 1SGCA 2GX4A 1NTPA 2H9TH 3M36A 1XVMA 3GICB 3TNSA 2UWOA 3S9CA 3VGCB 4KTSA 3RXFA 1N8OB 1AIXH 1O2PA 4A1XA 1PQ7A 2H5CA 3M7QA 4THNH 1QA7A 1V2JT 1W7GH 1RIWC 3SV2H 3U9AH 5EGMA 2QAAA 3ZVCA 7LPRA 5EODA 1FPHH 3UY9A 2B7DH 4FUDA 1GJ8B 1PPCE 2WPIS 2OINA 2ZDAH 2LPRA 1ZMLA 2ODPA 1LQDB 1HGTH 1O2YA 1MKXH 1O5GH 4FUIA 3RXEA 4CRDA 1KDQB 2FYRA 2XNIA 3KN2A 1O2QA 1O0DH 2BY7X 3UR6A 6CHAC 1O3LA 1F5LA 3BTKE 1HLTH 1V2ST 4BNRA 1J14A 1GHXH 3W95A 3RXDA 3KF2A 3GDVA 5TCCA 2FYQA 1UMAH 3U8OH 1TGNA 3JZ1B 1Y3UA 2WPKS 3C1KA 3UIRA 1EZXC 1OWHA 1A2CH 1O2ZA 1BJUA 1KXEA 1OX1A 2SGQE 1QBOA 2C8WB 3M37A 1PPFE 2Z9LA 5DK1A 4Y71A 4D8NA 1SLXB 5C2ZA 3QK1A 1BRAA 3BF6H 1ZHPA 1AZZA 3E6PH 3GY3A 3BTTE 1C5PA 1BRUP 3U1IB 1B0EA 4JYUH 1ZPZA 1IQGA 4O97A 2VINA 7ESTE 4NIVA 4H6SB 5DP6A 1H9HE 3VXFH 4NA8A 3TJOA 2FX6A 2VVCA 1TNGA 1U6QA 1O2LA 3VGCC 1ESAA 2ZFTA 3MWIU 2PKAB 2QXJA 1NU7B 1T4VH 1MKXK 4I8GA 4RKOB 3TH4H 1X7AC 3SN8A 4MTBA 3TH2H 1GHZA 1O3PB 4XBBA 3S7HB 4B2AA 5EXLA 3TJNA 2XBWA 1OPHB 1Z8IB 4HI3A 4KTUA 4ZKSU 5EXNA 5K7RA 2QCYA 1QB9A 3QZRA 3U69H 3ZZ3A 5IDKA 4YOGA 5DPAA 1P0SH 4B76A 5DP9A 1G3CA 4YLQH 2J92A 1BZXE 1OP8A 2YNBA 3NKKA 4ZHAA 3Q3YA 1AD8H 2ZKSA 1P2NA 1KXCA 1FAKH 2BDCA 1SLWB 3P8GA 1H9LB 2BD4A 1KTSB 2BVRH 1UCYE 3PYHA 2STAE 3ESTA 4JYVH 4X6PA 3ZVEA 3QLPH 3RLYH 1GDQA 1EPTB 3RM2H 3A7WA 5A09A 1LVOA 3OY6U 3RMOH 2W5EA 4WH8A 4Y79A 3GCHB 5K0HA 2P3UB 2ZGXH 1LPKB 3BG4B 3ATWA 2XCNA 3RXUA 1ORFA 1GJCB 2VIPA 4TYDA 5E0JA 4MPVA 4DT7B 5E2OA 3B8JA 1BA8B 1Z6JH 3ELAH 3GY7A 1C2HA 1S82A 1GVZA 1H1BA 4BANB 2ILNA 5T6DA 3A87A 1C5ZB 2EEKA 1BT7A 1HPGA 1GI0A 1THSH 1GBCA 1P03A 2PKAA 4VGCC 4J1YA 2F9UA 1O5CB 1OSSA 2GD4B 2GMTB 3KQCA 3B23B 1BBRK 1LHDH 4CH2B 5F8TA 1UTNA 1BHXB 2ESTE 1EATA 2GCHG 3MHWU 4Y10E 1XUJA 3S9BA 4AZ2B 1K9OE 4X2YA 1AGJA 1O3EA 4ABBA 4CH8B 1AN1E 1RTFB 1P8VC 5DP8A 1TOMH 3EA9A 1KSNA 1GVKB 1MU8B 2Y82A 5C5OA 5C1XA 2TGPZ 2HRVA 3O8CA 4NSVA 4IN2A 3V0XA 5J4QA 1A4WH 1G36A 1Z8RA 2EA3A 4NWKA 1NRQH 2XC0A 3OX7U 2EC9H 1EOLA 1QY6A 3A80A 1MKWH 3R0FA 2B0FA 1YPHC 2FLRH 1FY3A 3KQEA 3RXOA 1EAIA 1EPTC 1KYNA 2I6QA 1HDTH 3VB6A 5LH8A 4XSKU 1KDQA 1CO7E 3MU4A 3E3TA 1QNJA 4NIYA 5LPRA 4B73A 4NFFA 4ABEA 4A92A 3RC5A 1VJAU 1G3DA 1YPHE 3HK6B 3RU4T 2VIVA 1XUKA 3LIWA 4YTAA 4O3UA 1HNEE 5F8XA 1ANEA 1DLKB 3U8RH 4MNVA 4MNXA 4GPGA 2V0BA 3QO6A 5A2MH 3S9AA 1QB6A 1S81A 2V3HH 1AUTC 5T6FA 2C8YB 5C5NA 1V6DA 1K1NA 4NGAH 5ETXA 1C5UA 2VVUA 3UNSA 1HAVB 4X1PU 1B0FA 4YT6H 3GY6A 2EI8A 4IN1A 1QRXA 2Q6FA 2STBE 1HAIH 1AVXA 3ZZCA 3MU0A 2O8MA 3TK6A 4X6MA 3IG6B 4AORA 1A5HA 3HKJB 6GCHF 1T8LA 4TWWA 4Q80A 1C4U2 1F5RA 4A6LA 3RXAA 1DUAA 2Z9IA 1NU9A 5DP5A 1SHHB 5HM9A 4NCYA 1O3OA 1ZPCA 2BD7A 1OYTH 1D6WA 3FZZA 1TFXA 3QGJA 4Y0YE 1DANH 3TJVA 1WTHD 1LHGH 3RM0H 3S69A 1TIOA 4BAHB 1BHXF 1TE0A 3KHVA 2F9NA 1ELVA 3A81A 4UDWH 3D62A 3PLPA 3M7UA 3A8AA 4CRFA 3L33A 4ZUHA 1O3NA 2FI3E 1TNIA 3A7YA 1MCTA 2GZ7A 3QX5H 2NWNA 1C5MD 4A7IB 3RXHA 5HYOA 2ZHDA 4GUXA 2G51A 2P95A 3P95A 4UFFH 3A88A 2FI5E 1VZQH 4E05H 1FZZA 1HAGE 1SI5H 4H4FA 2F9BH 1DSTA 2UUJB 1K1LA 3SJOA 4Y6DA 2ZPSA 1O2KA 2ZHWH 2QF0A 1GHVH 2H5DA 2UUFB 1ZHRA 2TRMA 4AGJA 3TGKE 1G3EA 1GMCG 3IITA 1ETTH 2GZ8A 1PQAA 1C2FA 4WVPE 1DWEH 1TNKA 1OP0A 1H9IE 4A5TS 3SZNA 1CHGA 1BTUA 3RU4D 2ZTYA 3M3TA 4YT7H 1ZJDA 5C20A 1IAUA 1W11U 4OGYA 1GBFA 2BXTH 2TBSA 4OS1A 3SUEA 3F9FA 4MDSA 2PUQH 4B74A 3A7ZA 3GYLB 4WWYA 1GL1A 2BDBA 1NFXA 2HLCA 2GGVB 4ZXYH 1Q3XA 1AO5A 2GP9B 4JZIA 1TGSZ 4B1TA 1GDNA 3GY5A 3SNCA 3TIUA 3BTQE 3P70B 3PTBA 2XWBI 3SUDA 2AS9A 3FP7E 1A0HB 1KLIH 5GPIB 1YYY1 3SUFA 3FP6E 1BMNH 4Y8YA 3MTYA 1MAYA 3MNSA 3PM3A 4LOYH 1L1GA 2FEQH 2QXHA 4YESB 1BRBE 2ZGJA 1RS0A 4IW4E 2R3UA 1GGDC 2B8OH 5LPFA 1C1MA 4A1TA 3GY2A 2VH0A 2ODQA 4H6TA 2ZCKP 3HPTB 1O2GH 1DWBH 3LPRA 2O8WA 3SORA 2FOBA 1LVYA 1EJMA 1MTNB 3T29A 3GDUA 1C5YB 1HIAA 1IQEA 2THFB 1O3MA 1T8MA 1HUTH 4GLYA 1UVTH 4Y7AA 5DJ7A 2ZFSA 2OC7A 2Z3CA 2HNTE 3BTFE 3SJIA 2UWPA 1N1LA 3ZZ9A 1AUJA 1NO9H 2G52A 2FI4E 5B6OA 3LOXA 3V12A 2FZZA 2XWAA 4NWLA 5HM2A 1PPZA 1ABJH 2ZGHA 1YPEH 1ELCA 4NZQA 1A0JA 3VB3A 3SU1A 3ZVFA 4O9VA 2VVVA 4AYYB 2P8OB 3ZZ7A 1BB0B 1WYKA 1W2KH 3QZQA 3M3VA 3GCTG 1VR1H 2AEIH 4BAQB 4U30A 1J16A 4X8TH 5GCHF 5EQRA 4Y8ZA 3LH1A 2ZFRH 1Y59T 1W0YH 8GCHF 1BMMH 5EG4A 1UO6A 4D7GA 3KNXA 2CF9H 4NIWA 3SI3H 1Q31A 2BX4A 1AU8A 1TLDA 2H9HA 1UTPA 2ZG0H 1N6YA 3BN9A 5H4IB 1AFQB 1SQTA 1EZSC 1G2LA 1TNJA 1GI5A 4DVAU 4ISIH 1TA6A 1T8OA 1D3PB 4NA7A 1P2KA 1DY9A 3V3MA 2HWLB 1AE8H 1QRZA 1YKTA 2QF3A 1KXBA 1WTGH 1M9UA 3VB5A 1IQMA 1Y5UT 5TCAA 2NU0E 3ZZ4A 1QL8A 2KAIA 1O5BB 4AYVB 1JWTA 1IHSH 1ELTA 1TRMA 1A1RA 1ID5H 1GMDG 1WU1A 2I6SA 3VFEA 1D4PB 2BDAA 2XBVA 2YNAA 1ZR0A 4BTIB 1TPPA 1ACBE 1O35A 3KQDA 3LDXH 1TOCB 2BQWB 2A4OA 4MPXA 3ITIA 1PQ5A 2ZO3H 4X0WU 4ABHA 1GGDB 1SGEE 1C5OH 1GBDA 3PO1C 2BY5X 4K60A 4ZAEA 5G4BA 5GJ4B 4CRCA 1LDTT 4XOJA 3E91A 1DICA 2AYWA 5GCHG 2BB4A 3QTVH 4IMQA 1QCPA 1CA0B 2ZTXA 1UTMA 4ABAA 3IWMA 3GCNA 1OP2A 4NSYA 3MOCA 4K1SA 1CU1A 4WXIA 3F9HA 5DKMA 1OS8A 1C2JA 3ZZDA 2G8TA 2OXSA 3MH6A 2FOGA 2XBXA 3GCOA 1ZGVA 1HAZB 3H7OA 1YPLH 2ZGCA 1QHRB 2HVXA 2HOBA 4HZHA 2QA9E 2D1JA 4FUJA 2ZA5A 1C4V2 5FX6A 2JH6D 1YP9A 1VGCB 1SMFE 1IQIA 1EB1H 2WYJA 4JZFH 5JBBS 3FP8E 4FUCA 1GI4A 1MUEB 1HJAC 1CBWB 1SFIA 2G81E 3DD2H 1SOTA 3TGJE 3LJJA 4SGAE 2LNCA 3K6ZA 4FU8A 4LZ4B 3MNXA 3TITA 2K1QA 1RTLA 2HNTC 3M5OA 5TJXA 5AHGH 1V2WT 2ZHQH 2R3YA 2A7HA 1SGIB 2H9EH 4NIXA 1T4UH 3RXPA 2ZCLP 1PPHE 1P04A 2CMYA 1QURH 4GAWA 1A0LA 1UCYH 2AIQA 4Q7YA 3DHKH 2NU3E 3LGUA 4GCHF 2O8LA 4WJG2 3C27B 1PPGE 5C3NA 1GI8B 2SGFE 2PKSB 1LTOA 1NS3A 1C2GA 3ENSB 3STJA 1FI8A 1GBTA 5CMXH 1HXEH 1TMTH 4YM9A 1V2TT 4Y7BA 4H42U 1Z71A 4K69A 4ZMAH 2JETB 1BRCE 8GCHG 2W7SA 5FPTA 3EQ0H 2RA3A 4ZKOU 4Q7ZA 2OD3B 2QV1A 3AW1A 1NZQH 2AGEX 1YPKH 1ARBA 3SV8A 2RG3A 1ZRBA 1RTKA 2QY0B 1Z7KA 2FP7B 2V35A 3SU0A 4HGCA 1C5XB 2FOMB 3TPIZ 2A32A 2PTNA 5FBIA 5BPEA 3MO3A 3F1SB 2XC5A 2Z9KA 1KLJH 3CP7A 1LHEH 1CGJE 2BD9A 4CRAA 4F4OC 3I77A 1BTWA 1C1PA 1EP6A 1TX7A 1A61H 1SC8U 2A2XH 1NPMA 1GMDF 2PLXA 2VWNA 3DUXH 5HMAA 4U32A 1UCYK 2ZGBH 1G37A 4X1RU 3QTOH 1IQKA 9LPRA 1VITG 3A84A 1D9IA 1YPGH 1AWFH 2CHAC 4NFEA 1GBKA 5FCKA 3NK8A 3O8BA 1O3DA 3V13A 3SGQE 4DOQA 3SQEE 2ZU1A 1V2RT 1HFDA 2OP9A 2W26A 1O36A 5EPYA 1WQVH 1CA0C 4DCDA 5I25A 3UUZA 3A89A 3W94A 4AB8A 4AB9A 1YPMH 4E06H 1SGFG 1V2LT 1L2EA 1GVLA 2Y5HA 1HAYB 1GBAA 1P2OA 3S0NA 3ZVDA 1ZOMA 1P11E 4FUFA 5AFYH 2FWWA 2Y7ZA 3ZZ6A 4A1VA 4YO9A 4UFGH 3RLWH 1EZUC 1LQEA 4CHAC 1AB9C 1L0ZA 1W0ZU 2A7CA 2C4FH 2Y6TA 1O2NA 1BMAA 1JIRA 3TU7H 3KQBA 1KXFA 1AZ8A 3U98H 1LO6A 3E90B 2UUYA 3BTDE 4D9QA 3K65B 4XDEA 1EUFA 1F7ZA 2ANWA 1ZTKA 2BDIA 1FQ3A 4O3TA 2ALVA 2G4TA 3QGNB 1SLUB 1EQ9A 1A3EH 1C1NA 1CBWC 3UOUA 5BRRE 5AFZH 3MO9A 2FS9A 1SBWA 2GV7A 5JPMH 4WXVA 1HXFH 1IQNA 1S5SA 1C5TA 3B9FH 4YOIA 1O2RA 1ZJKA 2A2QH 5A8YA 1O30A