1GBDA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by ala complex with methoxysuccinyl-ala-ala-pro-phenylalanine boronic acid
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGANVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
total genus 52
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbdA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbdA01
1AUJA 1DLKB 2AH4X 1CT2E 2OUAA 2ZU5A 3OSYA 2D8WA 2R0LA 1BTPA 6GCHF 1B0FA 1E36B 1IQFA 1QA7A 2D1JA 1O2LA 1YYY1 1L4ZA 2BTCE 4ABBA 1GMCG 4K60A 2PW8H 5EODA 2VVVA 4U32A 1UTKA 4AOQA 3U8TH 1EPTB 1G3DA 1MKXK 2BM2A 2QXJA 3F9HA 1H8IH 3QUMP 4NIYA 2NU1E 3A7XA 1N8OC 1PPGE 2OINA 1ID5H 5C1XA 2XTTB 1WAYB 3RXLA 5CE1A 5K7RA 1O34A 3A7VA 4AGKA 2RDLA 1LPKB 2ZHEH 1A4WH 3NPSA 2Q6FA 2ZCKP 4Q7XA 3ZV8A 1O38A 2V3HH 5GIBA 1BOQA 2BB4A 1GI4A 3RXUA 1CA0B 2VWNA 2J34A 3A7TA 1BHXF 3A86A 2Z7FE 2HALA 3TJOA 3VB6A 3EDXB 3M5NA 2GP9B 4IC5A 4MTBA 4ASHA 2BXTH 4U30A 1G3BA 3UOUA 3SV6A 1ZMJA 4K69A 5DO4H 3SUDA 1LMWB 3SV7A 3H7OA 3QGJA 4OGYA 4NGAH 2H9EH 1C1WH 1T8OA 1O31A 3BN9A 4ZKSU 2THFB 1GBDA 2C8YB 8LPRA 1NRSH 2PFEA 3NXPA 1FZZA 5A0AE 2BDAA 3SZNA 4IN1A 3EYDA 4GUXA 3SNAA 1GL0E 2GGVB 1S85A 1RTLA 6ESTA 1DXPA 1QL9A 2P94A 2GDDA 3DD2H 4A7IB 2QF0A 4CRDA 2FI5E 1O2UA 3N7OA 1KXFA 1WSSH 3VXFH 2HNTE 5E0GA 4CHAB 3P8GA 1O2TA 2R3YA 5E8EH 1WOFA 4GHQA 1NRNH 1O3EA 3I77A 4ZMAH 1O2GH 2YOLA 3A8AA 1KSNA 4FUBA 2VIOA 2G51A 4CHAC 1P12E 1YP9A 2R3UA 4ZKRU 3T5FH 4YT7H 1MTNC 4O03A 4E05H 2GKVE 3MO6A 3SORA 1MKWK 5CMXH 4INKA 4LXBH 1AD8H 1UTMA 2UUJB 4X1RU 1EUFA 1SGRE 1C9PA 1NM6A 3RC5A 4CRBA 4GAWA 1MMJN 1GHVH 2GDEH 3PLBA 1SI5H 1Y3XA 4AFUA 1GI1A 4WF8A 1QFKH 3BTHE 2W3KA 7GCHG 1YKTA 1C5VA 2BD8A 5A8XA 2BLWA 3M5LA 6CHAC 5A0BA 3RC4A 3U8RH 1C5PA 3K65B 5HXFA 1LDTT 1XUKA 1F0TA 2QAAA 1ZMLA 1DDJA 1XUFA 1XKBC 5JDUB 3KIDU 5EXMA 1QL8A 2PR3A 4D8NA 1QURH 2O8MA 2Z3DA 1C5OH 1IQIA 1NS3A 4MVNA 5C3NA 1S83A 4OS1A 3MH7A 2OQUA 3E91A 1F0UA 3HPTB 3LC5A 1L1JA 2O8UA 2ZDVH 1QIXB 2CN0H 4O9VA 4GHTA 1O5BB 3DA9B 3RXMA 3SV9A 1YCPH 2WYJA 1UK4A 2QXIA 4X1SU 9LPRA 2BD2A 2FOEA 1C1QA 1QCPA 1SGNE 2ZO3H 3NZIA 2ZDMA 2FO9A 1YPKH 1O32A 3IITA 4XBDA 1HAIH 1GHYH 2BDBA 1SGIB 2V0BA 1C2FA 3SJKA 4BNRA 1DSTA 1OWDA 1T8NA 1ELFA 1BRCE 2ZDAH 1MZDA 1SR5C 1T8MA 1O2PA 1IQEA 3Q76A 4R0IA 1O35A 4UE7H 1ANDA 4KELA 2A45B 1G36A 1W3CA 2GMTB 3UR9A 1GJBB 2VIVA 3TVJB 2BD5A 4I31A 5DP7A 4Y79A 1SGPE 1DX5M 1TNJA 1PQAA 3DFLA 2FOMB 2AMPA 1DWEH 1O39A 2ZFQH 1Q2WA 5DP8A 4F49A 1QGFA 1GMHG 1V2PT 1D9IA 2V3OH 1ZGVA 3A7WA 1TWXB 4K5ZA 1GBFA 1LPGB 5AVDA 1P2IA 2QN5T 3TK6A 4CRAA 1BJVA 1KLJH 3RXTA 2V35A 1RXPA 1K1NA 3E3TA 1INCA 3RXFA 1V2MT 3AVZA 4CREA 3FZZA 2VIQA 1GHAG 1XX9A 3ZVBA 1AVXA 4ZKNU 1BTYA 1C2IA 2DE9A 2IPHA 1WQVH 3QO6A 4OS2A 1ANCA 1NESE 2PKAB 1O2WA 4BAMB 4CR5A 1IOEA 2ZU4A 2D26C 1BQYA 1E34B 1WYKA 4KTCA 4NCYA 2ZGJA 1UVUH 1W7XH 4ABFA 1TA6A 1ABJH 1SLXB 3BTGE 1Y3WA 4K8BA 3F9GA 4YOJA 1J14A 1P11E 1S81A 4X8SH 1L2EA 1VITF 1MBQA 3S9BA 1XUJA 5EGMA 3MU8A 4LZ4B 1H9IE 1BMNH 1CGJE 1RFNA 5FX5A 4BTIB 2JETC 4ZKOU 3TNTA 1XVOA 1PJPA 4UONA 2ZFRH 2ZQ2A 3SOSA 4FVBA 1SGTA 3P70B 1FUJA 4VGCC 4ZXYH 1V2KT 2D2DA 2Z9GA 3SI3H 2JETB 2LNCA 1THRH 2WUBA 1P05A 2RA3A 3HK6B 3SNCA 3SQHE 1V2JT 1TOCB 1GVKB 1P02A 3ZZ6A 3M35A 1GJ7B 2ZPSA 4TY6A 2G55A 4UDWH 1O3NA 2W26A 1GI2A 4B2CA 2ZGBH 2FOAA 4KKDA 5LPEA 1TIOA 3ATWA 1GJDB 2WV5A 2G00A 1C1NA 2H2ZA 1YPHE 4FUIA 4WMDA 3TH2H 4BOHA 3EGKH 1C1SA 1GBIA 1O3IA 1Q3XA 2AGEX 1C2DA 1ARCA 2OLGA 1BTWA 3A8BA 3S9CA 2VU8E 2ZFFH 2BX3A 1C5TA 1BRAA 1IQLA 1FPHH 4KP0A 2AIQA 1Y5AT 1K28D 1OYQA 1A46H 3UR6A 4O3UA 4OS6A 2BDIA 4Q7ZA 1FY8E 1MKWH 4NSVA 1WV7H 4A1TA 1GMCF 1KLTA 5AFYH 3SNBA 1TBRH 2QGRA 1A2CH 3SJOA 1QBOA 2FXRA 4OS4A 1XKAC 3K2UA 1ELEE 3LH3A 4Y6DA 1MTUA 3LGTA 1TALA 1HIAA 1L4DA 2GCHG 1O3PB 1P3CA 4ISHH 1JOUB 2Y5HA 4M7GA 2BVXH 2C8WB 4DG4A 1C2EA 4MG3A 4I8LA 3P17H 1Z6JH 1G32B 3MFJA 3VXEH 4YTAA 4E7NA 5HGGA 3CS7A 2QY0B 1AVWA 3ZVEA 4AYYB 1HLTH 5JB8S 5JPMH 1K21H 3BSQA 3RLWH 2GTBA 3RMNH 4F4OC 1ZTKA 1AZZA 2STAE 3S7KB 2UWPA 1UVPA 3GY4A 1YCPM 4Q7YA 1W0YH 3T26A 1TPPA 3LT3A 1C5NH 1YBWA 1GCTC 4H6TA 3UQVA 2GV6A 1C5WB 4YLQH 1QR3E 4MPWA 5LPRA 1A1RA 1JRSA 4MLFB 3UUZA 1TPSA 1KXEA 2EI6A 3D49H 1O3KA 2ZTZA 4A5TS 3PYHA 3F9FA 1TMTH 1GPZA 3KQEA 2TGDA 3PMBB 1GDQA 1MQ6A 3TJVA 3VEQB 3E0PB 1O0DH 1VZQH 3P8OA 1V2QT 3U1IB 4D7GA 4DT7B 3A83A 1Y3VA 1UTQA 4CR9A 1RJXB 1OOKB 1RD3B 1O5CB 3BTME 2M5TA 1V2TT 3RXVA 1GBCA 3T62A 1O2HA 4JYVH 1FAXA 2A5IA 1EASA 3TU7H 4IC6A 4O97A 8ESTE 1TQ0B 4AG2A 4RKJB 2R2WU 2WPMS 1TRMA 3SU5A 3KN2A 2ANYA 3ATMA 3JZ2B 3SUGA 5DP9A 1MKXH 1TONA 2XBXA 1V2VT 1GDNA 1DY9A 3GY7A 2PTCE 3VPKA 3MH6A 4Y0ZE 1C1MA 2SNVA 1THPB 1QRZA 1BHXB 1HAVA 4DOQA 3TH4H 3QGNB 4CH8B 1TX6A 2BDGA 2VJ1A 1QNJA 3DUXH 3PLPA 2OCVB 1EZQA 4J1YA 1O3BA 1P2MA 2XC4A 3BTTE 4NA9H 3IG6B 3I78A 1E0FD 1FXYA 1EZUC 1K2I1 2P95A 3STIA 3TJUA 1O2IA 1C1TA 1N1LA 2FOGA 2ANKH 1O2KA 1T32A 2JH5D 3LOXA 1G3CA 1C2LA 1N8OB 1S82A 1Y8TA 1WU1A 2Y82A 1J17T 2W7UA 1NO9H 1MAXA 1SFQB 3F68H 1MD7A 5F03A 1SQAA 4GCHG 1AWHB 1HCGA 1OPHB 2GV7A 1DWDH 1MU8B 2UWLA 3HKJB 3SQEE 2EA3A 1BRUP 1C1VH 3WY8A 1J9CH 4XBBA 3LKWA 1D3QB 3MNBA 3NKKA 3ZZ5A 3RXGA 4ESTE 2VIDA 4LK4A 4ABDA 2FOBA 1V2LT 1GBMA 3GOVB 3T2NA 2VH0A 2B0FA 3T29A 1A5IA 1BMLA 2F83A 4YESB 1TGCA 3SN8A 4MNXA 3HK3B 2J2UA 2BMGB 3V13A 2R0KA 1O3HA 1SLWB 1XVMA 3BIVH 2ASUB 1D3TB 1TGNA 2F9VA 1CT4E 1NFUA 4AB9A 1CHGA 2ZTXA 1EP5A 1KXDA 2ZDLA 1XUIA 3MNXA 1UTNA 2NU2E 3BEUA 1K22H 1GBEA 1W8BH 3M7QA 1HPGA 4JZIA 4A6LA 1RIWB 3VFEA 3U1JB 1CGIE 1HDTH 3LDXH 1SBWA 4GSOA 1DY8A 3GCTF 1MAYA 4X1QU 5A8ZA 1AB9C 2R2MB 4CRGA 1BUIA 3BG8A 3TPIZ 4H42U 2Y80A 1HUTH 3M37A 1EATA 1XUHA 4MPUA 4AG1A 1BTXA 2TIOA 1YLCA 2J38A 2PHBA 1LQDB 1MD8A 1DLEA 1K1MA 4JZ1A 1MH0A 1QBNA 4NA7A 3D23A 5GDSH 2ALPA 1O3OA 1G37A 2AYWA 2H1UA 4WJG2 1F0RA 4UFFH 1OS8A 1HNEE 1EX3A 1V3XA 1ZPZA 1SG8B 2BY5X 2TGAA 3LH1A 2GT7A 5DPAA 1GBLA 2TRMA 4UFEH 5FPSA 1GHBG 3A88A 5ABWA 5GXPA 1P01A 4JK5A 1H8DH 4LZ1H 1AO5A 2P16A 2PKAA 4I7YH 1IHSH 1GBBA 1QBVH 2VINA 3EE0B 4AN7A 1FN8A 2ZF0H 4AGJA 3MU4A 1XXFA 3KEEA 3KQCA 3ZVCA 4X2XA 4ISNA 4BAOB 4ISOA 1TNGA 1EKBB 3SUFA 3G01A 2WUCA 2XC0A 1YPEH 1GJ5H 1GJCB 2C3SA 1D3PB 4AFSA 1K1PA 2B7DH 3FP7E 4ABAA 1HB0B 2BD9A 1CQQA 2Z6BD 1HIAB 1BZXE 2Q6DA 2BX4A 3A82A 4KGAA 1W14U 3FVFB 4ABJA 3MNCA 1K1LA 3U98H 4QT8C 1PQ5A 5GCHG 1LO6A 4NWLA 1C1UH 2P8OC 5GJ4B 1G2LA 3RXIA 1FNIA 1AGJA 3KCGH 1Z7KA 1GHAF 2C8ZB 4Z6AH 1S0RA 4YM9A 2OP9A 1RS0A 3U9AH 1KYNA 1T4UH 7ESTE 2H9HA 1DICA 1P04A 3Q3KA 2SGAA 2HVXA 2ZFPH 2UUFB 4X2WA 1WTGH 1YGCH 5L30H 3RLYH 3RXAA 4AORA 2CGAA 2ODPA 2WYGA 1F5KU 1P9UA 5H4IB 3BEIB 3O8CA 1A3BH 4XSKU 1NFWA 1GHZA 1AMHA 2BLOA 3GDUA 4Y7BA 1IHTH 3M5MA 2HPPH 3SU2A 1O5GH 2IJOB 3ZZ3A 1XUGA 1GJ6A 1A61H 3PMAB 4HGCA 1EOJA 1O3LA 2ZU3A 1HV7A 2ZDKA 8KME2 1NU9A 2QV1A 3UTUH 1C4U2 1VGCB 1EZSC 3CS0A 4X2YA 1LKAA 1MQ5A 2W3IA 2NU4E 5DP5A 1P2NA 1QQ4A 2OD3B 4ISLA 5EQRA 2CJIA 3RM2H 1SLUB 4Y71A 1TGTA 4WXVA 2VIPA 2ANMH 5DJ7A 3SJIA 1AVGH 1VGCC 1NRRH 4MQAA 1LVYA 1AZ8A 3VB5A 3BV9B 4K2YA 1JBUH 2BD3A 3ATKA 2B9LA 1DWCH 4NIVA 1K1OA 2FEQH 2JKHA 4FUCA 3AW0A 2C93B 5EPNA 2YNAA 2SGPE 1YLDA 3UWIA 3EQ0H 3QZQA 4FVDA 4YO9A 3LGVA 2G52A 1SOTA 2ZGHA 2F9UA 3S0NA 3PMHB 4AFZA 1QQUA 2BOHB 1CGHA 2ZFSA 2A7HA 3LJJA 5C5OA 3PO1C 1P2OA 3M36A 2K1QA 1VR1H 2LPRA 1TMBH 4ZUHA 1MTWA 2VNTA 1KXAA 4FXGH 3SHAH 4CBNA 3Q3YA 1TAWA 2G4TA 1AUTC 3MH4A 1CSOE 1D4PB 1VJAU 1GGDC 5DK1A 4BAKB 5EW1H 1UVTH 3PO1B 5FCRA 2A1DB 5DKMA 2VIWA 1C2JA 1CE5A 2XBWA 1FY1A 1S84A 3A87A 3GYLB 3SV8A 4R8TB 2XCFA 1LVBA 4IW4E 3SUEA 2QA9E 1SHYA 4IN2A 2PUQH 2PV9B 2H5DA 1O37A 2FLRH 1ZSLA 3VGCB 2EI7A 3E90B 1HRTH 1CO7E 1GI3A 1DVAH 2QCYA 2ZP0H 2KAIA 3T28A 2Z9KA 3TNSA 3A81A 3F1SB 1QA0A 2FODA 4I32A 4Y8YA 4MNWA 2Z94A 2AMQA 1OP8A 5A09A 4BTTB 3SNDA 4WMEA 1OP0A 3VGCC 2BDYA 1B0EA 1TPAE 2ZCHP 4NWKA 3E8LA 1ZR0A 2XYAA 1EB2A 1O36A 5FXLA 1TOMH 1IQNA 1DT2A 1UCYH 1Z1JA 1SHHB 3MU0A 1OWEA 1QB6A 1TABE 1UJ1A 1BB0B 3M3VA 2VH6A 1LCYA 1LKBA 1OYTH 4BXSA 2OC8A 1LHFH 4FUDA 3LPRA 3TITA 2SGFE 6LPRA 2FP7B 5E2PA 1L1NA 1YCPK 5FHTA 1IQGA 3ATIA 1HFDA 1Z71A 3FANA 1YPHC 2VWLA 1SGEE 3KGPA 1ZJKA 3R3GB 1XM1A 3TK9A 1GL1A 2ZDNA 1X7AC 5HM9A 2ZPQA 4DJZB 1PYTD 1KTTB 3GY6A 4BAQB 1N6XA 4A92A 1QL7A 4THNH 3RU4T 1FAKH 1HGTH 4K3JA 1LHDH 1GHBF 2BQWB 4CRFA 4BAHB 2Q1JA 1ANEA 1O5FH 3L33A 3PROA 4TWWA 1D6WA 3P6ZB 4AFQA 4BANB 2B5TB 4GPGA 1DITH 4XE4A 4TPYA 4UD9H 1W0ZU 1YC0A 3B23B 4Y10E 2C8XB 1AE8H 1SQTA 1AKSB 4Y8XA 1UHBA 1TPOA 4Q2KA 4ABEA 1NZQH 1CT0E 2QC2A 1C5XB 3NWUA 1TB6H 1W10U 1W11U 1NC6A 5JYIA 1HXEH 1QB9A 3R0FA 2GCTC 4HFPB 2HNTF 2UUYA 1FMGA 1V2NT 1C1RA 1UMAH 1HAXB 2A7CA 1S6FA 3KQDA 3QX5H 5C1YA 1TA2A 2PGBB 4BXWA 2FI4E 3GY2A 3W94A 2WPKS 1RTKA 1WQSA 3I29A 1A7SA 1CHOG 2ZGCA 2G4UA 3GISB 3S7HB 2CV3A 3MU1A 1KXBA 1TRYA 1BBRH 1UTPA 3HGNA 1BTHH 2CHAC 3ZZ4A 1BCUH 1FQ3A 1BBRK 3A8DA 2BLQA 3URCA 3MMGA 4H4FA 3F9EA 5LPFA 1C5UA 1FV9A 2O9QA 1DUEA 2OXSA 5DG6A 2P3FH 1EAUA 4Z0KA 2ZNKH 2BVRH 4B73A 3MTYA 3QDZB 3RXQA 1CBWB 1OWIA 4D76A 1AU8A 3D65E 3NCLA 4WVPE 2F3CE 1O3AA 2ZECA 1KDQB 1KY9A 1LHCH 3BG4C 4WWYA 5C2ZA 3O8RA 4ABGA 5HMAA 3STJA 2AERH 2A2QH 4NIXA 1GMHF 2IOTA 2EEKA 7GCHF 1A0LA 1GBJA 5A0CA 1D3DB 2BD4A 4MPVA 4IBLH 3LU9B 4AB8A 1ESAA 1SGYE 3O8BA 4DVAU 2QXHA 5LGOA 3OX7U 3U69H 2XWAA 1O2NA 4HI3A 3MYWA 4X8UH 2F9PA 1AFEH 3CP7A 2BXUH 1FY3A 3BF6H 2O8WA 1K9OE 1ZHPA 3QK1A 3GCTG 1C5LH 3FP8E 3TGJE 4OGXA 1T8LA 1SGCA 1LVMA 2PGQB 1CHOF 3P8NA 4GLYA 4ZAEA 4I8KA 3QLPH 5JBBS 1QJ6B 4FUFA 4YLUA 4Y0YE 1TE0A 1F7ZA 5TJXA 3P95A 4B74A 5F8TA 4XOJA 4CBOA 5FPYA 1E38B 1UVSH 3UQOA 1EAXA 1EP6A 1UO6A 1KDQA 2BYAX 3ZV9A 1GVLA 3K6YA 2WPIS 3B8JA 2WPJS 3Q3XA 3LGUA 1SMFE 2PLXA 2XBYA 1ETTH 2GT8A 5CHAC 1LVOA 2ZGXH 4YZUA 1C1OA 1NPMA 2A4RA 2W5EA 2VWMA 2ZHQH 3SNEA 3M5OA 1OXGA 5JBCS 4D9RA 1MTSA 2NU0E 2ZHFH 1B5GH 3MNSA 3C27B 3PLKA 4TYDA 1NN6A 1MU6B 1XMNB 1C4Y2 2FIRH 3JZ1B 2J9NA 1SVPA 4WH6A 5FBIA 1O2ZA 3E1XB 5IDKA 3UOPA 3ODFA 3P8FA 1TNIA 1HJ9A 2HPQH 1QRXA 5EPYA 2RG3A 1TNHA 1C5RA 2BQ6B 2VGCB 2WPLS 3VB7A 1YF4A 1EJMA 2FMJA 1XXDA 5IYTA 4JYUH 3TJNA 1HAGE 1O5DH 2NU3E 1ZSJA 1W7GH 4ZHLU 1FY4A 2CHAB 2Z3CA 3QTVH 1KLIH 4IS5A 4Y8ZA 1SPJA 1TGSZ 5GPIB 5EG4A 5ETXA 7LPRA 1QJ7B 3PTNA 1DFPA 2A5AA 3GCNA 4XFQA 5LH8A 1C9TA 2WV4A 3QTOH 1GI5A 4NFEA 1QY6A 3ZVDA 5EXLA 1HJAC 2TGTA 2SNWA 1UCYE 1TNKA 1PPCE 1V2OT 3OY5U 3SU1A 5GWZA 3UNSA 1PQ8A 1Z8GA 2BQ7B 2HRVA 3OU0A 2ANWA 5AF9H 2A32A 1BA8B 2Z3EA 1QB1A 2QXGA 4BTUB 1IQKA 1NROH 2OQ5A 3QWCH 1W2KH 3PM3A 5DP6A 1O5EH 3V3MA 5K0HA 1TYNA 1SGFG 1PPEE 4JMYA 1SB1H 4E7RG 1Y5BT 1KXCA 1E35B 2AEIH 1P09A 2P93A 3V12A 2BY7X 1O2SA 1A0HB 4IMZA 2F91A 1Y59T 4TWYA 2BDHA 3L3TA 2Y6TA 1J15A 5T6FA 4Y76A 4UFGH 1WCZA 2FOHA 3VB3A 2GZ7A 3LGWA 2FLBH 5EXNA 1ORFA 1JXPA 1ZOMA 1Z8IB 2AMDA 3A7ZA 1C5MD 3OYPA 3TGIE 1UTOA 3EA7A 1JIRA 1Z1IA 2BY9X 2OC1A 3ZVGA 1JIMA 1NFYA 2HOBA 5J4QA 1YM0A 3PV4A 1U6QA 1ZTJA 2KAIB 1QJ1B 5F6MA 1GI9B 1BITA 1T4VH 5PTPA 4WMFA 2XRCA 1SOZA 3C1KA 5GCHF 1JRTA 3ZZDA 3LC3A 2J92A 2RA0A 1H4WA 5TCCA 3FAOA 3KNXA 1O2QA 2VVUA 3H5CB 3ZZAA 4AYVB 4X0WU 3AASA 3UNRA 5BPEA 3MO3A 2GD4B 2XW9A 1DANH 1GJ4H 4NG9H 2A0QB 1P8VC 5B6OA 2F9OA 5HM2A 2FWWA 1V6DA 2GZ8A 5A8YA 1FIZA 2ODYB 3FZDA 1ZRBA 1H1BA 1BMAA 1BTUA 2PWXA 1C2MA 1P10A 3ESTA 3SJ9A 3D62A 1ACBE 3NK8A 4B2BA 3NUMA 3RMMH 3RUOA 2RCEA 1SSXA 5AHGH 2H5CA 5FAHA 1ZYOA 2GZ9A 1TNLA 3RXEA 3M7UA 1EPTA 1ETRH 1ESTA 1FIWA 3RXPA 1A3EH 1O2VA 3KF2A 3RM0H 2DUCA 3ZZBA 1EAIA 1ZTLA 3FFGA 2ZTYA 4UFDH 1P2QA 2CMYA 1F2SE 1EZXC 1S5SA 3KL6A 1AI8H 5TCAA 1AY6H 1RGQA 1C5QA 1SC8U 2Y7ZA 4NZLA 3B9FH 1NT1A 2FZZA 1YPGH 4ZXXH 4U2WA 1GBTA 1AKSA 1GWAA 4JCNA 4X1PU 3SV2H 1ETSH 1THSH 3GY8A 2ZFTA 3PWCA 1GGDB 1ELBA 1IAUA 4XBCA 1UTJA 2FPZA 2CF8H 3AW1A 2IN2A 4GCHF 4I8HA 1IQHA 4B76A 1W12U 4OS5A 3E16B 4X8VH 1P06A 1YPLH 2XBVA 4Y7AA 1A5HA 1HJ8A 1HAZB 3ATLA 1GMDG 1O3DA 3HGPA 5E0HA 4NIWA 5G4BA 3EA8A 1IQMA 4IMQA 2TGPZ 4Q80A 3RXRA 1SL3A 1HAHH 4H6SB 2VWOA 4RKOB 1H9LB 1QTFA 2I6SA 1TFXA 1O33A 1ZHMA 3BTEE 3BTQE 1P57B 2F9NA 4I33A 6GCHG 1CBWC 4YOGA 4I8JA 2AIPA 2YNBA 4GVUA 1AE5A 4X6NA 3SGQE 2JH6D 3RMOH 5I25A 3ZZ7A 1AFQC 3SU0A 2BOKA 1PQ7A 1S0QA 2G5NA 1UCYK 4FUGA 4WY3A 2FTLE 1L0ZA 4NSYA 2GX4A 1ZSKA 5C67A 5A2MH 1ZLRA 2Z9JA 1ZZZA 4DCDA 1Q31A 3GDSA 1HBTH 3TH3H 3UNQA 3BIUH 2OTVA 3OY6U 1GJAB 1D6RA 2BVSH 1ELTA 3T25A 1PFXC 3LIWA 1N6YA 4ZHAA 5HYOA 3VB4A 2ZA5A 3OTJE 3EA9A 1NFXA 1GJ9B 5FCKA 2BDCA 1P0SH 3TK5A 5SGAE 1GI8B 1EB1H 1GJ8B 1V2UT 2BZ6H 1DE7H 1V2ST 3RDZA 3RXKA 4X6MA 1O2JA 4SGAE 3SI4H 4X6PA 1ZJDA 1TMUH 3QN7A 3BTKE 3DFJA 3U8OH 1A5GH 3TIUA 2O8LA 2BZAA 1FLEE 5BRRE 4E06H 1G30B 1ELGA 2XXLA 1P9SA 1LHEH 3ZYEA 4MNYA 1C2HA 1TX8A 1VITH 1Z8RA 1O2YA 3BTDE 1ELVA 1C5SA 1T31A 1C5ZB 3AAUA 1PPFE 1CA8B 1UTLM 2ESTE 3A7YA 1LQEA 1FN6A 1AIXH 1V2RT 1OWJA 2VGCC 2ZKSA 2ZCLP 3RXHA 1RIWC 1TBZH 2Y5GA 2A31A 3A8CA 5EQSA 1VCWA 3K9XB 3M3TA 5DGJA 3L6PA 2GCTB 2PKSB 1RTFB 1KIGH 3RXJA 4ABHA 3ZZ9A 2H9TH 4ZH8A 4UEHH 2J95A 1P2KA 4HTCH 2OC7A 3RU4D 1AQ7A 3IWMA 4DGJA 1O2RA 2HLCA 2ZC9H 3MO9A 2HNTC 1K1JA 3RXCA 3ODDA 3ZVAA 3ELAH 3KHVA 1DWBH 1AHTH 2Y7XA 1EJAA 2OC0A 2WPHS 3SU3A 1VJ9U 4WXIA 5ESBA 4ZROA 4CRCA 4B1TA 1EPTC 1Z8JB 5EOKA 3SU4A 1FDPA 2ALVA 4NA8A 1GHXH 1PPZA 1NRPH 1Y3UA 2FDAA 4FUHA 5DP4A 9ESTA 2EC9H 1UK3A 1MZAA 2ZU2A 3M7TA 3GCHB 2AGGX 1C2GA 1NY22 1OKXA 2STBE 1ELDE 1EOLA 1O2MA 1PPBH 1HXFH 2O8TA 4O3TA 2XC5A 2C4FH 2XNIA 4JZDH 2PUXB 5JB9S 2FS9A 1OSSA 3RMLH 3W95A 3MH5A 4IGDA 5F8XA 2VB0A 3A80A 3GCHC 3SGBE 4K1EA 1BMMH 5EW2H 1TGBA 1DOJA 1IQJA 4B71A 2F9BH 2DE8A 3MOCA 2ZPRA 1ZRKA 5C1UA 1MBMA 1EAWA 1H9HE 1WTHD 3S9AA 1OWHA 1DM4B 1BBRE 1GI6A 2PSXA 2GMTC 2AS9A 2GVFA 2R9PA 5F8ZA 2BHGA 4Y11E 3ZYDA 4NFFA 2P59A 3P92A 2FOCA 3PWBA 5T6DA 3BTFE 2A7JA 4FU8A 3FP6E 1LTOA 2SGEE 2J94A 1QRWA 3A84A 3RC6A 3ENSB 1PYTC 1SLVB 2BD7A 3H7TA 3GCOA 1SFIA 1O3CA 1DS2E 1YPJH 3DT0H 3PB1E 3V7TA 2ZWLH 1SGDE 1JWTA 1BJUA 3E0NB 3CENA 2G8TA 3PTBA 3HATH 4INHA 2VVCA 1VITG 3S69A 2ODQA 3GDVA 1O30A 4KTUA 1AB9B 1FY5A 2FS8A 3ZVFA 1OP2A 1G3EA 4RSPA 3URDA 5CHAB 3TLOA 2ZEBA 1G9IE 2AGIX 1B7XB 4DIHH 1L1GA 3MHWU 1HAOH 2TPIZ 1MCVA 3UY9A 1BRBE 1GBHA 1O3FA 2FOFA 1GCDA 4MDSA 4LOYH 4TPIZ 2A2XH 1C5YB 1TQ7B 3LONA 2A5KA 2BLVA 5E0JA 5L2ZH 1DSUA 2NWNA 1ZHRA 1KTSB 1EQ9A 3F6UH 3SBKA 3QZRA 1TLDA 4ZHMU 4JZEH 1G2MA 2Y5FA 4JK6A 2GCHF 3Q77A 4A1XA 4A1VA 1ZPCA 1SGFA 1MTNB 1V2WT 2ZHDA 2QYIA 1LHGH 2C90B 8GCHG 1GCTB 1O3GA 1C1PA 2Z9LA 4RN6A 1HAYB 3BG4B 2P3TB 4JYTA 1GDUA 3SHCH 4X1NU 2A4QA 3RXSA 4B75A 1DPOA 5FPTA 2FTMA 2ZI2H 1M9UA 4I8GA 4DY7B 2ZG0H 3ITIA 2BY8X 2Y81A 3RXDA 2ZU1A 1CU1A 1P3EA 2ZQ1A 3LGYA 2ZHWH 1UK2A 1P2JA 1A0JA 2OBOA 4J2YB 4AZ2B 4ISIH 4MPXA 4OS7A 3MI4A 3GY5A 3KQBA 1EJNA 1S6HA 1Z6EA 3RXOA 1MTVA 2J4IA 1P03A 2P8OB 2WINI 3RXBA 3V0XA 2FX6A 1MCTA 2TBSA 3SGAE 2FYRA 3EAJA 3RU4E 4ABIA 1EXFA 1F5RA 1MUEB 1F5LA 1WUNH 2ILNA 1AWFH 1ESBA 2Z9IA 4FUJA 1ARBA 5ESTE 5C5NA 2OBQA 3Q00A 2FI3E 1NU7B 1SQOA 3GYMA 2W7SA 3M61U 4DIIH 1GI0A 3LGIA 1W13U 5E2OA 5JBAS 5T6GA 1E37B 1BT7A 1AFQB 3HKIB 2CF9H 4AX9H 3GY3A 3E6PH 4NZQA 1J16A 4INLA 1O2OA 4JZFH 4X6OA 1Y3YA 1OWKA 3K6ZA 4B2AA 2ZIQH 5T3HA 4K1SA 3PMJA 2A4OA 1O5AB 1CA0C 1O3MA 3AAVA 2JH0D 5AFZH 2FX4A 2SFAA 2ULLA 1GHWH 1BTZA 5EQQA 4D9QA 4X2VA 1HAPH 3SO3A 8GCHF 1GBAA 1F0SA 1CVWH 4U01A 2A4GA 1VCPA 4TY7A 2QIQA 4PROA 4XDEA 4D7FA 3DHKH 1ABIH 1FPCH 5FX6A 2XCNA 2SGDE 3GICB 1SGQE 5JBTA 3ZZCA 3UWJH 1O2XA 3BTWE 1NRQH 2FYQA 2AFQB 1ELCA 1ZPBA 1BIOA 4YOIA 4CH2B 1T7CA 4WH8A 1O3JA 5L6NH 1Y5UT 3BEFB 1RRKA 1AN1E 2HGTH 5I46H 4HZHA 4DW2U 3UIRA 2I6QA 3SJ8A 2V6NA 2PSYA 3UREA 1BDAA 4SGBE 2P3UB 2HWLB 1PPHE 3MWIU 1JMOH 3TGKE 1UHBB 1DXWA 1C2KA 1F92A 1FJSA 2Q6GA 1GMDF 1HAVB 1YPMH 3SU6A 2FM2A 2EI8A 3M3SA 1FI8A 1OX1A 1TX7A 2XWBI 2UUKB 1FONA 1ELAA 2SGQE 4MNVA 1VCQA 1NTPA 1UVOA 3MU5A 1GVZA 4VGCB 1K1IA 4FU9A 3SW2B 1C4V2 1HYLA 4X8TH 1GBKA 1HJAB 2BY6X 2CXVA 4YT6H 1GG6C 2B8OH 2PTNA 4FU7A 5J4SA 3RP2A 3A85A 5L2YH 1LPZB 4DURA 5EU8A 1TRNA 2G5VA 2ZZUH 5DP3A 7KMEH 2QF3A 4FUEA 4K1TA 1DUAA 3O8DA 2PKSC 1WBGB 4KTSA 2UWOA 6CHAB 2H6MA 2FESH 1ZMNA 1GG6B 3ZZ8A 4K8YA 3A89A 5FBEA 1ZGIA 1J8AA 2G81E 3LJOA 1ANBA 3T27A 1QHRB 1GI7B 3UFAA 3UPEA 1TBQH 5C20A
chains in the Genus database with same CATH superfamily
1AUJA 1DLKB 2AH4X 1CT2E 2OUAA 2ZU5A 3OSYA 2D8WA 2R0LA 1BTPA 6GCHF 1B0FA 1E36B 1IQFA 1QA7A 2D1JA 1O2LA 1YYY1 1L4ZA 2BTCE 4ABBA 1GMCG 4K60A 2PW8H 5EODA 2VVVA 4U32A 1UTKA 4AOQA 3U8TH 1EPTB 1G3DA 1MKXK 2J97A 2BM2A 2QXJA 3F9HA 1H8IH 3QUMP 4NIYA 2NU1E 3A7XA 1N8OC 1PPGE 2OINA 1ID5H 5C1XA 2XTTB 1WAYB 3RXLA 5CE1A 5K7RA 1O34A 3A7VA 4AGKA 2RDLA 1LPKB 2ZHEH 1A4WH 3NPSA 2Q6FA 2ZCKP 4Q7XA 3ZV8A 1O38A 2V3HH 5GIBA 1BOQA 2BB4A 1GI4A 3RXUA 1CA0B 2VWNA 2J34A 1NBME 3A7TA 1BHXF 3A86A 2Z7FE 2HALA 3TJOA 3DSGA 3VB6A 1W0KD 3EDXB 3M5NA 2GP9B 4IC5A 4MTBA 4ASHA 2BXTH 4U30A 1G3BA 3UOUA 3SV6A 1ZMJA 4K69A 5DO4H 3SUDA 1LMWB 3SV7A 3H7OA 3QGJA 4OGYA 4NGAH 2H9EH 1C1WH 1T8OA 1O31A 3BN9A 4ZKSU 2THFB 1GBDA 2C8YB 8LPRA 1NRSH 2PFEA 3NXPA 1FZZA 5A0AE 2BDAA 3SZNA 2QF5A 4IN1A 3EYDA 4GUXA 3SNAA 1GL0E 2GGVB 1S85A 1RTLA 6ESTA 1DXPA 1QL9A 2P94A 2GDDA 3DD2H 4A7IB 2QF0A 4CRDA 2FI5E 1O2UA 3N7OA 1KXFA 1WSSH 3VXFH 2HNTE 5E0GA 4CHAB 3P8GA 2HVYB 1O2TA 2R3YA 5E8EH 1WOFA 4GHQA 1NRNH 1O3EA 3I77A 4ZMAH 1O2GH 2YOLA 2J5UA 3AK5A 3A8AA 1KSNA 4FUBA 2VIOA 2G51A 5T1VA 4CHAC 1P12E 1YP9A 2R3UA 4ZKRU 3T5FH 4YT7H 1MTNC 4O03A 4E05H 2GKVE 3MO6A 3SORA 1MKWK 5CMXH 4INKA 5C94A 4LXBH 1AD8H 1UTMA 2UUJB 4X1RU 1EUFA 1SGRE 2J98A 1C9PA 1NM6A 3RC5A 4CRBA 4GAWA 1MMJN 1GHVH 2GDEH 3PLBA 1SI5H 1Y3XA 4AFUA 1GI1A 4WF8A 1QFKH 3BTHE 2W3KA 7GCHG 1YKTA 1C5VA 2BD8A 5A8XA 2BLWA 3M5LA 2YMSB 6CHAC 5A0BA 3RC4A 3U8RH 1C5PA 3K65B 5HXFA 1LDTT 1XUKA 1F0TA 2QAAA 1ZMLA 1DDJA 4ZCNA 1XUFA 1XKBC 5JDUB 3KIDU 5EXMA 1QL8A 2PR3A 4D8NA 1QURH 2O8MA 2Z3DA 1C5OH 1IQIA 1NS3A 4MVNA 5C3NA 1S83A 4OS1A 3MH7A 2OQUA 3E91A 1F0UA 3HPTB 3LC5A 1L1JA 2O8UA 2W6ID 2ZDVH 1QIXB 2CN0H 4O9VA 4GHTA 1O5BB 3DA9B 3RXMA 3SV9A 1YCPH 2WYJA 1UK4A 2QXIA 4X1SU 9LPRA 2BD2A 2FOEA 1C1QA 1QCPA 1SGNE 2ZO3H 1BMFD 3NZIA 2ZDMA 2FO9A 1YPKH 1O32A 3IITA 4XBDA 1HAIH 1GHYH 2BDBA 1SGIB 2VBCA 2V0BA 1C2FA 3SJKA 4BNRA 1DSTA 1OWDA 1T8NA 1ELFA 1BRCE 2ZDAH 1MZDA 1SR5C 1T8MA 1O2PA 1IQEA 3Q76A 4R0IA 1O35A 4UE7H 1ANDA 4KELA 2A45B 1G36A 1W3CA 2GMTB 3UR9A 1GJBB 2VIVA 3TVJB 2BD5A 4I31A 5DP7A 4Y79A 1SGPE 1DX5M 1TNJA 1PQAA 3DFLA 2FOMB 2AMPA 1DWEH 1O39A 2ZFQH 1Q2WA 5DP8A 4F49A 1QGFA 1GMHG 1V2PT 1D9IA 2V3OH 1ZGVA 3A7WA 1TWXB 4K5ZA 1GBFA 1LPGB 5AVDA 3WWFA 1P2IA 2QN5T 3TK6A 4CRAA 1BJVA 1KLJH 3RXTA 2V35A 1RXPA 1K1NA 3E3TA 1INCA 2JDID 3RXFA 1V2MT 3AVZA 4CREA 3FZZA 2VIQA 1GHAG 1XX9A 3ZVBA 1AVXA 4ZKNU 1YY3A 1BTYA 1C2IA 2DE9A 2IPHA 1WQVH 3QO6A 4OS2A 1ANCA 1NESE 2PKAB 1O2WA 4BAMB 4CR5A 1IOEA 2ZU4A 2D26C 1BQYA 1E34B 1WYKA 4KTCA 4NCYA 2ZGJA 1UVUH 1W7XH 4ABFA 1TA6A 1ABJH 1SLXB 3BTGE 3W1EA 1Y3WA 4K8BA 5C17A 3F9GA 3ZIAD 4YOJA 1J14A 1P11E 1S81A 4X8SH 1L2EA 1VITF 1MBQA 3S9BA 1XUJA 2KCOA 5EGMA 3MU8A 4LZ4B 1H9IE 1BMNH 1CGJE 1RFNA 5FX5A 4BTIB 2JETC 4ZKOU 3TNTA 1XVOA 2LELA 1PJPA 4UONA 2ZFRH 2ZQ2A 2WV9A 3SOSA 4FVBA 1SGTA 3P70B 1FUJA 4VGCC 4ZXYH 1V2KT 2D2DA 2Z9GA 3SI3H 2JETB 2LNCA 1THRH 2WUBA 1P05A 2RA3A 3HK6B 3SNCA 3SQHE 1V2JT 1TOCB 3DSPA 1GVKB 5F53A 1P02A 4B6EA 1KMHB 3ZZ6A 3M35A 1GJ7B 2ZPSA 4TY6A 2G55A 4UDWH 1O3NA 2W26A 1GI2A 4B2CA 2ZGBH 2FOAA 4KKDA 5LPEA 3OAAD 1TIOA 3ATWA 1GJDB 2WV5A 2G00A 1C1NA 2H2ZA 1YPHE 4FUIA 4WMDA 3TH2H 4BOHA 5EJ1A 3EGKH 1C1SA 1GBIA 1O3IA 1Q3XA 2AGEX 1C2DA 1ARCA 2OLGA 1BTWA 3A8BA 3S9CA 2VU8E 2ZFFH 2BX3A 1C5TA 1BRAA 1IQLA 1FPHH 4KP0A 2AIQA 1Y5AT 1K28D 1OYQA 1A46H 3UR6A 4O3UA 4OS6A 2BDIA 4Q7ZA 1FY8E 1MKWH 4NSVA 1WV7H 4A1TA 1GMCF 1KLTA 5AFYH 3SNBA 1TBRH 2QGRA 1A2CH 3SJOA 1QBOA 2FXRA 4OS4A 1XKAC 3K2UA 1ELEE 3LH3A 4Y6DA 1MTUA 3LGTA 1TALA 1HIAA 1L4DA 2GCHG 1O3PB 1P3CA 4ISHH 1JOUB 2Y5HA 4M7GA 2BVXH 2C8WB 4DG4A 1C2EA 4MG3A 4I8LA 3P17H 1Z6JH 1G32B 3MFJA 3VXEH 4YTAA 4E7NA 5HGGA 3CS7A 2QY0B 1AVWA 3ZVEA 4AYYB 1HLTH 5JB8S 5JPMH 1K21H 2W6JD 3BSQA 3RLWH 4Q4LA 4F48B 2GTBA 3RMNH 4F4OC 1ZTKA 1AZZA 2STAE 3S7KB 2UWPA 1UVPA 3GY4A 1YCPM 4Q7YA 1W0YH 3T26A 1TPPA 3LT3A 1C5NH 1YBWA 1GCTC 4H6TA 3UQVA 2GV6A 1C5WB 4ACAA 4YLQH 5FL7D 1QR3E 3N7EA 4MPWA 5LPRA 1A1RA 1JRSA 4MLFB 3UUZA 1TPSA 1KXEA 2EI6A 3D49H 1O3KA 2ZTZA 4A5TS 3PYHA 3F9FA 1TMTH 4Q63A 1GPZA 3KQEA 2TGDA 3PMBB 1GDQA 1MQ6A 2HLDD 3TJVA 3VEQB 3E0PB 1O0DH 1VZQH 3P8OA 5KECA 1V2QT 3U1IB 4D7GA 4DT7B 3A83A 1Y3VA 1UTQA 4CR9A 1RJXB 1OOKB 1RD3B 1O5CB 3BTME 3WWBA 2M5TA 1V2TT 3RXVA 1GBCA 3T62A 1O2HA 4JYVH 1FAXA 2A5IA 1EASA 3TU7H 4IC6A 4O97A 8ESTE 1TQ0B 4AG2A 4RKJB 2R2WU 2WPMS 1TRMA 3SU5A 3KN2A 2ANYA 3ATMA 3JZ2B 3SUGA 5DP9A 1MKXH 1TONA 2XBXA 1V2VT 1GDNA 1DY9A 4FOUC 3GY7A 2PTCE 3VPKA 3MH6A 4Y0ZE 1C1MA 3CNRA 2SNVA 1THPB 1QRZA 1BHXB 1HAVA 4DOQA 3TH4H 3QGNB 4CH8B 1TX6A 2BDGA 2VJ1A 1QNJA 3DUXH 3PLPA 2OCVB 1EZQA 4J1YA 1O3BA 1P2MA 2XC4A 3BTTE 4NA9H 2PP6A 3IG6B 3I78A 1E0FD 1FXYA 2WPDD 1EZUC 1K2I1 2P95A 3STIA 3FN8A 3PRDA 3TJUA 1O2IA 1C1TA 1N1LA 2FOGA 2ANKH 1O2KA 1T32A 2JH5D 3LOXA 1G3CA 1C2LA 1N8OB 1S82A 1Y8TA 1WU1A 2Y82A 1J17T 2W7UA 1NO9H 1MAXA 1SFQB 3F68H 1MD7A 5F03A 1SQAA 4GCHG 1AWHB 1HCGA 1OPHB 2GV7A 4RT0A 1DWDH 1MU8B 2UWLA 3HKJB 3SQEE 2EA3A 4YXWD 1BRUP 1C1VH 3WY8A 1J9CH 4XBBA 3LKWA 1D3QB 3MNBA 3NKKA 3ZZ5A 3RXGA 4ESTE 2VIDA 4LK4A 4ABDA 2FOBA 1V2LT 1GBMA 3GOVB 3T2NA 2VH0A 2B0FA 3T29A 1A5IA 1BMLA 3F2FA 2F83A 4YESB 1TGCA 3SN8A 4MNXA 3HK3B 2J2UA 2BMGB 3V13A 2R0KA 1O3HA 1SLWB 1XVMA 3BIVH 2ASUB 1D3TB 1TGNA 2F9VA 2L74A 1CT4E 1NFUA 4AB9A 1CHGA 2ZTXA 1EP5A 1KXDA 2ZDLA 1XUIA 3MNXA 1UTNA 2NU2E 3BEUA 1K22H 3F2HA 1GBEA 1W8BH 3M7QA 1HPGA 4JZIA 4A6LA 1RIWB 3VFEA 3U1JB 1CGIE 2AHME 1HDTH 3LDXH 1SBWA 4GSOA 1DY8A 3GCTF 1MAYA 4X1QU 5GNDA 1AB9C 2R2MB 5A8ZA 4CRGA 1BUIA 3BG8A 3TPIZ 4H42U 2Y80A 1HUTH 3M37A 1EATA 1XUHA 4MPUA 4AG1A 1BTXA 2TIOA 1YLCA 2J38A 2PHBA 1LQDB 1MD8A 1DLEA 1K1MA 4JZ1A 1MH0A 1QBNA 4NA7A 3D23A 5GDSH 2ALPA 1O3OA 1G37A 2AYWA 2H1UA 4WJG2 1F0RA 4UFFH 1OS8A 1HNEE 1EX3A 1V3XA 1ZPZA 1SG8B 2BY5X 3KQ5A 2TGAA 3LH1A 2GT7A 5DPAA 1GBLA 4AC9A 2TRMA 4UFEH 3F2GA 5FPSA 1GHBG 3A88A 5ABWA 5GXPA 1P01A 4JK5A 1H8DH 4LZ1H 1AO5A 2P16A 2PKAA 4I7YH 1IHSH 1GBBA 1QBVH 2VINA 3EE0B 2YMSC 4AN7A 1FN8A 2ZF0H 3PV2A 4AGJA 3MU4A 1XXFA 3KEEA 3KQCA 3ZVCA 4X2XA 4ISNA 4BAOB 4ISOA 1TNGA 1EKBB 3SUFA 3G01A 2WUCA 1YPEH 2XC0A 1GJ5H 1GJCB 2C3SA 1D3PB 4AFSA 1K1PA 2B7DH 3FP7E 4ABAA 1HB0B 2BD9A 2YMSD 1CQQA 2Z6BD 1HIAB 1BZXE 2Q6DA 2BX4A 3A82A 4KGAA 1W14U 3FVFB 4ABJA 3MNCA 1YLNA 1K1LA 3U98H 4QT8C 1PQ5A 5GCHG 1LO6A 4NWLA 1C1UH 2P8OC 2XOKD 5GJ4B 1G2LA 2KM0A 3RXIA 5EJZA 4FETA 1FNIA 1AGJA 3KCGH 1Z7KA 1GHAF 2C8ZB 4Z6AH 1S0RA 5IK2D 4YM9A 2OP9A 1RS0A 3U9AH 1KYNA 1T4UH 7ESTE 2H9HA 1DICA 1P04A 3Q3KA 2SGAA 1H8ED 2HVXA 2ZFPH 2UUFB 4X2WA 1WTGH 1YGCH 5L30H 3RLYH 3RXAA 4AORA 2CGAA 2ODPA 2WYGA 1F5KU 1P9UA 5H4IB 3BEIB 3O8CA 1A3BH 4XSKU 1NFWA 1GHZA 1AMHA 2BLOA 3GDUA 4Y7BA 1IHTH 3M5MA 2HPPH 3SU2A 1O5GH 2IJOB 3ZZ3A 1XUGA 1GJ6A 1A61H 3PMAB 4HGCA 1EOJA 1O3LA 3SYJA 2WZQA 2ZU3A 1HV7A 2JJ1D 2ZDKA 8KME2 1NU9A 2QV1A 3UTUH 1C4U2 1VGCB 1EZSC 3CS0A 4X2YA 1LKAA 1MQ5A 2W3IA 3F3BA 2NU4E 5DP5A 1P2NA 1QQ4A 2OD3B 4ISLA 5EQRA 2CJIA 3RM2H 1SLUB 4Y71A 1TGTA 4WXVA 4RI0A 2VIPA 2ANMH 2LP6A 5DJ7A 3SJIA 1AVGH 1VGCC 1NRRH 4MQAA 1LVYA 1AZ8A 3VB5A 3BV9B 4ASUD 4K2YA 1JBUH 5DSFA 2BD3A 3ATKA 2B9LA 1DWCH 4NIVA 1K1OA 2FEQH 2JKHA 4FUCA 3AW0A 2C93B 5HIZA 5EPNA 2YNAA 2SGPE 3OE7D 1YLDA 3UWIA 3EQ0H 3QZQA 4FVDA 4YO9A 3LGVA 2G52A 1SOTA 2ZGHA 2F9UA 3S0NA 3PMHB 4AFZA 1QQUA 2BOHB 1CGHA 2ZFSA 2A7HA 3LJJA 5C5OA 3PO1C 1P2OA 3M36A 2K1QA 1VR1H 2LPRA 1TMBH 4ZUHA 1MTWA 2VNTA 1KXAA 4FXGH 3SHAH 4CBNA 3Q3YA 1TAWA 2G4TA 1AUTC 3MH4A 1CSOE 1D4PB 1VJAU 1GGDC 5DK1A 4BAKB 5EW1H 1UVTH 3PO1B 5FCRA 2A1DB 5DKMA 2VIWA 1C2JA 1CE5A 2XBWA 1FY1A 1S84A 3A87A 3GYLB 3SV8A 4R8TB 2XCFA 1LVBA 4IW4E 3SUEA 2QA9E 1SHYA 4IN2A 2PUQH 2PV9B 2H5DA 1O37A 2FLRH 1ZSLA 3VGCB 2EI7A 3E90B 1HRTH 3FKSD 1CO7E 1GI3A 1DVAH 2QCYA 2ZP0H 2KAIA 3T28A 2Z9KA 3TNSA 3A81A 3F1SB 2WSSD 1QA0A 2FODA 4I32A 4Y8YA 4MNWA 2Z94A 2AMQA 2QF4A 1OP8A 2V3MA 5A09A 4BTTB 3SNDA 4WMEA 1OP0A 2QE7D 3VGCC 2BDYA 1B0EA 1TPAE 2ZCHP 4NWKA 3E8LA 1ZR0A 2XYAA 1EB2A 1O36A 2M2AA 5FXLA 1TOMH 1IQNA 1DT2A 1UCYH 1Z1JA 1SHHB 3MU0A 1OWEA 1QB6A 1TABE 1UJ1A 1BB0B 3M3VA 2VH6A 1LCYA 1LKBA 1OYTH 4BXSA 2OC8A 1LHFH 4FUDA 3LPRA 3TITA 2SGFE 6LPRA 2FP7B 5E2PA 1L1NA 1YCPK 5FHTA 1IQGA 3ATIA 1HFDA 1Z71A 3FANA 1YPHC 2VWLA 1SGEE 3KGPA 1ZJKA 3R3GB 1XM1A 3TK9A 3OTPA 1GL1A 2ZDNA 1X7AC 1OHHD 5HM9A 2ZPQA 4DJZB 1PYTD 4TT3D 1KTTB 3GY6A 4BAQB 1N6XA 4A92A 1QL7A 4THNH 3RU4T 1FAKH 1HGTH 4K3JA 1LHDH 1GHBF 2BQWB 4CRFA 2KFWA 4BAHB 2Q1JA 1ANEA 1O5FH 2V7QD 2GJGA 3L33A 1D6WA 3P6ZB 3PROA 4TWWA 4AFQA 4BANB 2B5TB 4GPGA 1DITH 4XE4A 4TPYA 4UD9H 1W0ZU 1YC0A 3B23B 4Y10E 2C8XB 1AE8H 1SQTA 1AKSB 4Y8XA 1UHBA 1TPOA 4Q2KA 4ABEA 1NZQH 1CT0E 2QC2A 1C5XB 3NWUA 5KEDA 1TB6H 5C0UA 1W10U 1W11U 1NC6A 5JYIA 1SKYE 1HXEH 1QB9A 2RDEA 3R0FA 2GCTC 4HFPB 2HNTF 2UUYA 1FMGA 1V2NT 2KCYA 1C1RA 1UMAH 1HAXB 2A7CA 1S6FA 3KQDA 3QX5H 5C1YA 3SZEA 1TA2A 2PGBB 4BXWA 2FI4E 3GY2A 3W94A 2WPKS 1RTKA 1WQSA 3I29A 1A7SA 1CHOG 2ZGCA 2G4UA 3GISB 3S7HB 2CV3A 3MU1A 1KXBA 1TRYA 1BBRH 1UTPA 3HGNA 1BTHH 2CHAC 2F43B 3ZZ4A 1E1RD 1BCUH 1FQ3A 1BBRK 3A8DA 3FO8D 2BLQA 3URCA 3MMGA 1COWD 4H4FA 3F9EA 5LPFA 1C5UA 1FV9A 2O9QA 1DUEA 2OXSA 5DG6A 2P3FH 1EAUA 4Z0KA 2ZNKH 1MABB 2BVRH 4B73A 3MTYA 3QDZB 3RXQA 2J98B 1CBWB 1OWIA 4D76A 1AU8A 3D65E 3NCLA 4WVPE 2F3CE 1O3AA 2ZECA 1KDQB 1KY9A 5KGOA 1LHCH 3BG4C 4WWYA 5C2ZA 3O8RA 4ABGA 5HMAA 3STJA 2AERH 2A2QH 4NIXA 1GMHF 2IOTA 2EEKA 1VKYA 7GCHF 1A0LA 1GBJA 5A0CA 1D3DB 2BD4A 4MPVA 4IBLH 3LU9B 4AB8A 1ESAA 1SGYE 3O8BA 4DVAU 2QXHA 4I86A 3OX7U 4OM9A 2XWAA 3U69H 5LGOA 2K8IA 1O2NA 4HI3A 3MYWA 4X8UH 2F9PA 1AFEH 3CP7A 2BXUH 1FY3A 3DSOA 3BF6H 2XNDD 2O8WA 1W0JD 1K9OE 1ZHPA 3QK1A 3H09A 3GCTG 1C5LH 3FP8E 3TGJE 4OGXA 1T8LA 1SGCA 1LVMA 2PGQB 1CHOF 3P8NA 4GLYA 4ZAEA 2KCPA 4I8KA 3QLPH 5JBBS 1QJ6B 4FUFA 4YLUA 4Y0YE 1TE0A 3PRBA 1F7ZA 5TJXA 3P95A 4B74A 5F8TA 4XOJA 4CBOA 5FPYA 1E38B 3KYFA 1UVSH 3UQOA 1EAXA 1EP6A 1UO6A 1KDQA 2BYAX 3ZV9A 1GVLA 4B6FA 3K6YA 2WPIS 3B8JA 2WPJS 3Q3XA 3LGUA 1SMFE 2PLXA 2XBYA 1ETTH 2F4LA 2GT8A 3FOAA 5CHAC 1LVOA 2ZGXH 4YZUA 1C1OA 1NPMA 2A4RA 2W5EA 2VWMA 2ZHQH 3SNEA 3M5OA 1OXGA 2EY4C 4D9RA 5JBCS 1MTSA 2NU0E 2ZHFH 1B5GH 3MNSA 3C27B 2JIZD 3PLKA 2OK5A 4TYDA 4DT4A 1NN6A 1MU6B 1XMNB 1C4Y2 1NBMD 2FIRH 3JZ1B 2J9NA 1SVPA 4WH6A 5FBIA 1O2ZA 3E1XB 5IDKA 3UOPA 3ODFA 3P8FA 1TNIA 1HJ9A 2HPQH 1QRXA 5EPYA 2RG3A 1TNHA 1C5RA 2BQ6B 2VGCB 2WPLS 3VB7A 1YF4A 1EJMA 2FMJA 1XXDA 2KCAA 5IYTA 2KZ4A 4JYUH 3TJNA 1HAGE 1O5DH 2NU3E 1ZSJA 5EJLA 1W7GH 4ZHLU 1FY4A 2CHAB 2Z3CA 3QTVH 1KLIH 2IPQX 4IS5A 4Y8ZA 1SPJA 1TGSZ 3DCLA 5GPIB 5EG4A 5ETXA 7LPRA 1QJ7B 3PTNA 1DFPA 2A5AA 3GCNA 4XFQA 3OFND 5LH8A 1C9TA 2WV4A 3QTOH 1GI5A 4NFEA 1QY6A 3ZVDA 5EXLA 1HJAC 2TGTA 2SNWA 1UCYE 1TNKA 1PPCE 1V2OT 3OY5U 3SU1A 5GWZA 3UNSA 1PQ8A 1Z8GA 2BQ7B 2CK3D 2HRVA 3OU0A 2ANWA 5AF9H 2A32A 1BA8B 2Z3EA 1QB1A 2QXGA 4BTUB 1IQKA 1NROH 4XRNA 2OQ5A 3QWCH 1W2KH 3PM3A 5DP6A 1O5EH 3V3MA 5K0HA 1TYNA 1SGFG 1PPEE 3EE7A 4JMYA 1SB1H 4E7RG 1Y5BT 1KXCA 1E35B 5C0TA 2AEIH 1P09A 3U28C 2P93A 3V12A 2BY7X 1O2SA 1A0HB 3VG8A 4IMZA 2F91A 1Y59T 4TWYA 2BDHA 3L3TA 2Y6TA 1J15A 5T6FA 4Y76A 4UFGH 1WXRA 1WCZA 2FOHA 3VB3A 2GZ7A 3LGWA 2FLBH 5EXNA 1ORFA 1JXPA 1ZOMA 1Z8IB 2AMDA 3A7ZA 1C5MD 3OYPA 3TGIE 1UTOA 3EA7A 1JIRA 1Z1IA 2BY9X 2OC1A 3ZVGA 1JIMA 1NFYA 2HOBA 5J4QA 1YM0A 4F55A 3PV4A 1U6QA 1ZTJA 2KAIB 1QJ1B 5F6MA 1GI9B 1BITA 1T4VH 5PTPA 4WMFA 2XRCA 1SOZA 3C1KA 5GCHF 1JRTA 3ZZDA 3LC3A 2J92A 2RA0A 1H4WA 5TCCA 3FAOA 3KNXA 1O2QA 2VVUA 3H5CB 3ZZAA 4AYVB 4X0WU 3AASA 3UNRA 5BPEA 3MO3A 2GD4B 2XW9A 1DANH 1GJ4H 4NG9H 2A0QB 1P8VC 5B6OA 1K0HA 2F9OA 5HM2A 2FWWA 1V6DA 2GZ8A 5A8YA 1FIZA 2ODYB 3FZDA 1ZRBA 1H1BA 1BMAA 1BTUA 2PWXA 1C2MA 1P10A 3ESTA 3SJ9A 3D62A 1ACBE 3NK8A 4B2BA 3NUMA 2WHXA 3RMMH 3RUOA 2RCEA 1SSXA 5AHGH 2H5CA 1E79D 5FAHA 1ZYOA 2GZ9A 1TNLA 3RXEA 3M7UA 1EPTA 1ETRH 1ESTA 1FIWA 3RXPA 1A3EH 1O2VA 1YWUA 3KF2A 3RM0H 2DUCA 3ZZBA 1EAIA 1ZTLA 3FFGA 2ZTYA 4UFDH 1P2QA 2CMYA 1F2SE 1EZXC 1S5SA 3KL6A 1AI8H 5TCAA 1AY6H 1RGQA 1C5QA 1SC8U 2Y7ZA 4NZLA 3B9FH 1NT1A 2FZZA 1YPGH 4ZXXH 4U2WA 1GBTA 1AKSA 1GWAA 3UB0A 4JCNA 4X1PU 3SV2H 1ETSH 1THSH 3NRLA 3GY8A 2ZFTA 3PWCA 1GGDB 1ELBA 1IAUA 4XBCA 1UTJA 2FPZA 2CF8H 3AW1A 2IN2A 4GCHF 4I8HA 1IQHA 4B76A 4Z1MD 1W12U 4OS5A 3E16B 4X8VH 1P06A 1YPLH 2XBVA 4Y7AA 1A5HA 1HJ8A 1HAZB 3ATLA 1GMDG 1O3DA 3HGPA 5E0HA 4NIWA 5G4BA 3EA8A 1IQMA 4IMQA 2TGPZ 4Q80A 3RXRA 1SL3A 3WW7A 1HAHH 4H6SB 2VWOA 4RKOB 1H9LB 1QTFA 2I6SA 1TFXA 1O33A 1ZHMA 2IJD1 3BTEE 3BTQE 1P57B 2F9NA 4I33A 6GCHG 1CBWC 4YOGA 4I8JA 2AIPA 2YNBA 4GVUA 1AE5A 4X6NA 3SGQE 2JH6D 3RMOH 5I25A 3ZZ7A 1AFQC 3SU0A 2BOKA 1PQ7A 1S0QA 2G5NA 3OEED 1UCYK 4FUGA 4WY3A 2L6OA 2FTLE 1L0ZA 3F0OA 4NSYA 2GX4A 1ZSKA 5C67A 5A2MH 1ZLRA 2Z9JA 1ZZZA 4DCDA 1Q31A 2KX4A 3GDSA 1HBTH 3TH3H 3UNQA 3BIUH 2OTVA 3OY6U 1GJAB 4RT1A 1D6RA 2BVSH 1ELTA 3T25A 1PFXC 1H8HD 3LIWA 1N6YA 5EIYA 4ZHAA 5HYOA 3VB4A 2ZA5A 3OTJE 3EA9A 1NFXA 1GJ9B 5FCKA 2BDCA 1P0SH 3TK5A 5SGAE 1GI8B 1EB1H 1GJ8B 1V2UT 2BZ6H 1DE7H 1V2ST 3RDZA 5CDFE 3RXKA 4X6MA 1O2JA 4SGAE 3SI4H 4X6PA 1ZJDA 1TMUH 3QN7A 3BTKE 3DFJA 3U8OH 4XD7D 1A5GH 3TIUA 2O8LA 2BZAA 1FLEE 5BRRE 4E06H 1G30B 1ELGA 2XXLA 1P9SA 1LHEH 3ZYEA 4MNYA 1C2HA 1TX8A 1VITH 1Z8RA 1O2YA 3BTDE 1ELVA 1C5SA 1T31A 1C5ZB 3AAUA 1PPFE 1CA8B 1UTLM 2ESTE 3A7YA 1LQEA 1FN6A 1AIXH 1V2RT 1OWJA 2VGCC 2ZKSA 2ZCLP 3RXHA 1RIWC 1TBZH 2Y5GA 2A31A 3A8CA 5EQSA 1VCWA 3K9XB 3M3TA 5DGJA 3L6PA 2GCTB 2PKSB 1RTFB 1KIGH 3RXJA 4ABHA 3ZZ9A 2H9TH 4ZH8A 4UEHH 2J95A 1P2KA 4HTCH 2OC7A 3RU4D 1AQ7A 3IWMA 4DGJA 1O2RA 2HLCA 2ZC9H 3MO9A 2HNTC 1K1JA 3RXCA 3ODDA 3ZVAA 3ELAH 3KHVA 4ACBA 1DWBH 1AHTH 2Y7XA 1EJAA 2OC0A 2WPHS 5CHBA 3SU3A 1VJ9U 4WXIA 5ESBA 4ZROA 4CRCA 3UAIC 4B1TA 1EPTC 1Z8JB 5EOKA 3SU4A 1FDPA 2ALVA 4NA8A 1GHXH 1PPZA 1NRPH 1Y3UA 2FDAA 4FUHA 5DP4A 9ESTA 2EC9H 1UK3A 1MZAA 2ZU2A 3M7TA 3GCHB 2AGGX 1C2GA 5HIYA 1NY22 1OKXA 2STBE 1ELDE 1EOLA 1O2MA 1PPBH 1HXFH 3PV5A 2O8TA 4O3TA 2XC5A 2C4FH 2XNIA 4JZDH 2PUXB 5JB9S 2FS9A 1OSSA 3RMLH 3W95A 3MH5A 4IGDA 5F8XA 2VB0A 3A80A 3GCHC 3SGBE 4K1EA 1BMMH 5EW2H 1TGBA 1DOJA 1IQJA 4B71A 2F9BH 2DE8A 3MOCA 2ZPRA 1ZRKA 5C1UA 1MBMA 1EAWA 1H9HE 1WTHD 3F0PA 3S9AA 1OWHA 1DM4B 1BBRE 1GI6A 2PSXA 2GMTC 2AS9A 2GVFA 2R9PA 5F8ZA 2BHGA 4Y11E 3ZYDA 4NFFA 2P59A 3P92A 2FOCA 3PWBA 5T6DA 3BTFE 2A7JA 4FU8A 4P02A 3FP6E 1LTOA 2SGEE 2J94A 1QRWA 3A84A 3RC6A 3ENSB 1PYTC 1SLVB 2BD7A 3H7TA 3GCOA 1SQRA 1SFIA 1O3CA 1DS2E 1YPJH 3DT0H 3PB1E 3V7TA 2ZWLH 1SGDE 1JWTA 1BJUA 3E0NB 3CENA 2G8TA 3PTBA 3HATH 4INHA 2VVCA 1VITG 3S69A 2ODQA 3GDVA 1O30A 4KTUA 1AB9B 1FY5A 2FS8A 3ZVFA 1OP2A 1G3EA 4RSPA 3URDA 5CHAB 3TLOA 2ZEBA 1G9IE 2AGIX 1B7XB 4DIHH 1L1GA 3N7DA 3MHWU 1HAOH 2TPIZ 1MCVA 3UY9A 1BRBE 1GBHA 1O3FA 2FOFA 1GCDA 4MDSA 4LOYH 4TPIZ 2A2XH 1C5YB 1TQ7B 1E1QD 3LONA 2A5KA 2BLVA 5E0JA 5L2ZH 1DSUA 2NWNA 1ZHRA 1KTSB 1EQ9A 3F6UH 3SBKA 3QZRA 1TLDA 4ZHMU 4JZEH 1G2MA 2Y5FA 4JK6A 2GCHF 3Q77A 4A1XA 4A1VA 1ZPCA 1SGFA 1MTNB 1V2WT 2ZHDA 2K0QA 2QYIA 1LHGH 2C90B 8GCHG 2JJ2D 2RFKC 1GCTB 1O3GA 1C1PA 2Z9LA 4RN6A 1HAYB 3BG4B 1S6LA 2P3TB 4JYTA 3N99A 1GDUA 3SHCH 4X1NU 2A4QA 3RXSA 1UW7A 4B75A 1DPOA 5FPTA 2FTMA 2ZI2H 1M9UA 4I8GA 4DY7B 2ZG0H 3ITIA 2BY8X 2Y81A 3RXDA 2ZU1A 1CU1A 1P3EA 2ZQ1A 1FX0B 2KR7A 3LGYA 2ZHWH 4M9FA 1UK2A 1P2JA 1A0JA 2OBOA 4J2YB 4AZ2B 4ISIH 4MPXA 4OS7A 3MI4A 3GY5A 3KQBA 1EJNA 1S6HA 1Z6EA 3RXOA 1MTVA 2J4IA 1P03A 2P8OB 2WINI 3RXBA 3V0XA 2FX6A 1MCTA 2TBSA 3SGAE 2FYRA 3EAJA 4HG6A 3RU4E 4ABIA 1EXFA 1F5RA 1MUEB 1F5LA 1WUNH 2ILNA 1AWFH 1ESBA 2Z9IA 4FUJA 4P00A 1ARBA 1WDIA 5ESTE 5C5NA 2OBQA 3Q00A 2FI3E 1NU7B 1SQOA 3GYMA 2W7SA 1QZ8A 3GS9A 3M61U 4DIIH 1GI0A 3LGIA 1W13U 5E2OA 5JBAS 5T6GA 1E37B 1BT7A 1AFQB 3HKIB 2CF9H 4AX9H 3GY3A 3E6PH 4NZQA 1J16A 4INLA 1O2OA 4JZFH 4X6OA 1EFRD 1Y3YA 1OWKA 3K6ZA 4B2AA 2ZIQH 5T3HA 4K1SA 3PMJA 2A4OA 1O5AB 1CA0C 1O3MA 3AAVA 2JH0D 5AFZH 2FX4A 2SFAA 5HKKD 2ULLA 1GHWH 1BTZA 5EQQA 4D9QA 4X2VA 1HAPH 3SO3A 8GCHF 1GBAA 1F0SA 1CVWH 4U01A 2A4GA 1VCPA 4TY7A 2QIQA 4PROA 4XDEA 4D7FA 3DHKH 1ABIH 1FPCH 5FX6A 3MQKC 2XCNA 2SGDE 3GICB 1SGQE 5JBTA 3ZZCA 3UWJH 1O2XA 3BTWE 1NRQH 2FYQA 2AFQB 1ELCA 1ZPBA 1BIOA 4YOIA 4CH2B 1T7CA 4WH8A 1O3JA 5L6NH 1Y5UT 3BEFB 1RRKA 1AN1E 2HGTH 5I46H 4HZHA 4DW2U 3UIRA 2I6QA 3KYGA 3SJ8A 2V6NA 2PSYA 3UREA 1BDAA 4SGBE 2P3UB 2HWLB 1PPHE 3MWIU 1JMOH 3TGKE 1UHBB 1DXWA 1C2KA 1F92A 1FJSA 2Q6GA 1GMDF 2EQNA 1HAVB 1YPMH 3SU6A 2FM2A 2EI8A 3M3SA 1FI8A 1OX1A 1TX7A 2XWBI 2UUKB 5DN6D 1FONA 1ELAA 2SGQE 4MNVA 1VCQA 1NTPA 1UVOA 3MU5A 1GVZA 4VGCB 1K1IA 4FU9A 3SW2B 1C4V2 1HYLA 4X8TH 1GBKA 1HJAB 2BY6X 2CXVA 4YT6H 1GG6C 2B8OH 2PTNA 4FU7A 5J4SA 3RP2A 3A85A 5L2YH 1LPZB 3OEHD 4DURA 5EU8A 1TRNA 2G5VA 2ZZUH 5DP3A 7KMEH 2QF3A 5B6LA 4FUEA 4K1TA 1DUAA 3O8DA 2PKSC 4TSFD 1WBGB 4KTSA 2UWOA 6CHAB 2H6MA 2FESH 1ZMNA 1GG6B 3ZZ8A 4K8YA 3A89A 5FBEA 1ZGIA 1J8AA 2G81E 3LJOA 1ANBA 3T27A 1QHRB 1GI7B 3UFAA 3UPEA 1TBQH 5C20A
chains in the Genus database with same CATH topology
1AUJA 1DLKB 2AH4X 1CT2E 2OUAA 2ZU5A 3OSYA 2D8WA 2R0LA 1BTPA 6GCHF 1B0FA 1E36B 1IQFA 1QA7A 2D1JA 1O2LA 1YYY1 1L4ZA 2BTCE 4ABBA 1GMCG 4K60A 2PW8H 5EODA 2VVVA 4U32A 1UTKA 4AOQA 3U8TH 1EPTB 1G3DA 1MKXK 2BM2A 2QXJA 3F9HA 1H8IH 3QUMP 4NIYA 2NU1E 3A7XA 1N8OC 1PPGE 2OINA 1ID5H 5C1XA 2XTTB 1WAYB 3RXLA 5CE1A 5K7RA 1O34A 3A7VA 4AGKA 2RDLA 1LPKB 2ZHEH 1A4WH 3NPSA 2Q6FA 2ZCKP 4Q7XA 3ZV8A 1O38A 2V3HH 5GIBA 1BOQA 2BB4A 1GI4A 3RXUA 1CA0B 2VWNA 2J34A 3A7TA 1BHXF 3A86A 2Z7FE 2HALA 3TJOA 3VB6A 3EDXB 3M5NA 2GP9B 4IC5A 4MTBA 4ASHA 2BXTH 4U30A 1G3BA 3UOUA 3SV6A 1ZMJA 4K69A 5DO4H 3SUDA 1LMWB 3SV7A 3H7OA 3QGJA 4OGYA 4NGAH 2H9EH 1C1WH 1T8OA 1O31A 3BN9A 4ZKSU 2THFB 1GBDA 2C8YB 8LPRA 1NRSH 2PFEA 3NXPA 1FZZA 5A0AE 2BDAA 3SZNA 4IN1A 3EYDA 4GUXA 3SNAA 1GL0E 2GGVB 1S85A 1RTLA 6ESTA 1DXPA 1QL9A 2P94A 2GDDA 3DD2H 4A7IB 2QF0A 4CRDA 2FI5E 1O2UA 3N7OA 1KXFA 1WSSH 3VXFH 2HNTE 5E0GA 4CHAB 3P8GA 1O2TA 2R3YA 5E8EH 1WOFA 4GHQA 1NRNH 1O3EA 3I77A 4ZMAH 1O2GH 2YOLA 3A8AA 1KSNA 4FUBA 2VIOA 2G51A 4CHAC 1P12E 1YP9A 2R3UA 4ZKRU 3T5FH 4YT7H 1MTNC 4O03A 4E05H 2GKVE 3MO6A 3SORA 1MKWK 5CMXH 4INKA 4LXBH 1AD8H 1UTMA 2UUJB 4X1RU 1EUFA 1SGRE 1C9PA 1NM6A 3RC5A 4CRBA 4GAWA 1MMJN 1GHVH 2GDEH 3PLBA 1SI5H 1Y3XA 4AFUA 1GI1A 4WF8A 1QFKH 3BTHE 2W3KA 7GCHG 1YKTA 1C5VA 2BD8A 5A8XA 2BLWA 3M5LA 6CHAC 5A0BA 3RC4A 3U8RH 1C5PA 3K65B 5HXFA 1LDTT 1XUKA 1F0TA 2QAAA 1ZMLA 1DDJA 1XUFA 1XKBC 5JDUB 3KIDU 5EXMA 1QL8A 2PR3A 4D8NA 1QURH 2O8MA 2Z3DA 1C5OH 1IQIA 1NS3A 4MVNA 5C3NA 1S83A 4OS1A 3MH7A 2OQUA 3E91A 1F0UA 3HPTB 3LC5A 1L1JA 2O8UA 2ZDVH 1QIXB 2CN0H 4O9VA 4GHTA 1O5BB 3DA9B 3RXMA 3SV9A 1YCPH 2WYJA 1UK4A 2QXIA 4X1SU 9LPRA 2BD2A 2FOEA 1C1QA 1QCPA 1SGNE 2ZO3H 3NZIA 2ZDMA 2FO9A 1YPKH 1O32A 3IITA 4XBDA 1HAIH 1GHYH 2BDBA 1SGIB 2V0BA 1C2FA 3SJKA 4BNRA 1DSTA 1OWDA 1T8NA 1ELFA 1BRCE 2ZDAH 1MZDA 1SR5C 1T8MA 1O2PA 1IQEA 3Q76A 4R0IA 1O35A 4UE7H 1ANDA 4KELA 2A45B 1G36A 1W3CA 2GMTB 3UR9A 1GJBB 2VIVA 3TVJB 2BD5A 4I31A 5DP7A 4Y79A 1SGPE 1DX5M 1TNJA 1PQAA 3DFLA 2FOMB 2AMPA 1DWEH 1O39A 2ZFQH 1Q2WA 5DP8A 4F49A 1QGFA 1GMHG 1V2PT 1D9IA 2V3OH 1ZGVA 3A7WA 1TWXB 4K5ZA 1GBFA 1LPGB 5AVDA 1P2IA 2QN5T 3TK6A 4CRAA 1BJVA 1KLJH 3RXTA 2V35A 1RXPA 1K1NA 3E3TA 1INCA 3RXFA 1V2MT 3AVZA 4CREA 3FZZA 2VIQA 1GHAG 1XX9A 3ZVBA 1AVXA 4ZKNU 1BTYA 1C2IA 2DE9A 2IPHA 1WQVH 3QO6A 4OS2A 1ANCA 1NESE 2PKAB 1O2WA 4BAMB 4CR5A 1IOEA 2ZU4A 2D26C 1BQYA 1E34B 1WYKA 4KTCA 4NCYA 2ZGJA 1UVUH 1W7XH 4ABFA 1TA6A 1ABJH 1SLXB 3BTGE 1Y3WA 4K8BA 3F9GA 4YOJA 1J14A 1P11E 1S81A 4X8SH 1L2EA 1VITF 1MBQA 3S9BA 1XUJA 5EGMA 3MU8A 4LZ4B 1H9IE 1BMNH 1CGJE 1RFNA 5FX5A 4BTIB 2JETC 4ZKOU 3TNTA 1XVOA 1PJPA 4UONA 2ZFRH 2ZQ2A 3SOSA 4FVBA 1SGTA 3P70B 1FUJA 4VGCC 4ZXYH 1V2KT 2D2DA 2Z9GA 3SI3H 2JETB 2LNCA 1THRH 2WUBA 1P05A 2RA3A 3HK6B 3SNCA 3SQHE 1V2JT 1TOCB 1GVKB 1P02A 3ZZ6A 3M35A 1GJ7B 2ZPSA 4TY6A 2G55A 4UDWH 1O3NA 2W26A 1GI2A 4B2CA 2ZGBH 2FOAA 4KKDA 5LPEA 1TIOA 3ATWA 1GJDB 2WV5A 2G00A 1C1NA 2H2ZA 1YPHE 4FUIA 4WMDA 3TH2H 4BOHA 3EGKH 1C1SA 1GBIA 1O3IA 1Q3XA 2AGEX 1C2DA 1ARCA 2OLGA 1BTWA 3A8BA 3S9CA 2VU8E 2ZFFH 2BX3A 1C5TA 1BRAA 1IQLA 1FPHH 4KP0A 2AIQA 1Y5AT 1K28D 1OYQA 1A46H 3UR6A 4O3UA 4OS6A 2BDIA 4Q7ZA 1FY8E 1MKWH 4NSVA 1WV7H 4A1TA 1GMCF 1KLTA 5AFYH 3SNBA 1TBRH 2QGRA 1A2CH 3SJOA 1QBOA 2FXRA 4OS4A 1XKAC 3K2UA 1ELEE 3LH3A 4Y6DA 1MTUA 3LGTA 1TALA 1HIAA 1L4DA 2GCHG 1O3PB 1P3CA 4ISHH 1JOUB 2Y5HA 4M7GA 2BVXH 2C8WB 4DG4A 1C2EA 4MG3A 4I8LA 3P17H 1Z6JH 1G32B 3MFJA 3VXEH 4YTAA 4E7NA 5HGGA 3CS7A 2QY0B 1AVWA 3ZVEA 4AYYB 1HLTH 5JB8S 5JPMH 1K21H 3BSQA 3RLWH 2GTBA 3RMNH 4F4OC 1ZTKA 1AZZA 2STAE 3S7KB 2UWPA 1UVPA 3GY4A 1YCPM 4Q7YA 1W0YH 3T26A 1TPPA 3LT3A 1C5NH 1YBWA 1GCTC 4H6TA 3UQVA 2GV6A 1C5WB 4YLQH 1QR3E 4MPWA 5LPRA 1A1RA 1JRSA 4MLFB 3UUZA 1TPSA 1KXEA 2EI6A 3D49H 1O3KA 2ZTZA 4A5TS 3PYHA 3F9FA 1TMTH 1GPZA 3KQEA 2TGDA 3PMBB 1GDQA 1MQ6A 3TJVA 3VEQB 3E0PB 1O0DH 1VZQH 3P8OA 1V2QT 3U1IB 4D7GA 4DT7B 3A83A 1Y3VA 1UTQA 4CR9A 1RJXB 1OOKB 1RD3B 1O5CB 3BTME 2M5TA 1V2TT 3RXVA 1GBCA 3T62A 1O2HA 4JYVH 1FAXA 2A5IA 1EASA 3TU7H 4IC6A 4O97A 8ESTE 1TQ0B 4AG2A 4RKJB 2R2WU 2WPMS 1TRMA 3SU5A 3KN2A 2ANYA 3ATMA 3JZ2B 3SUGA 5DP9A 1MKXH 1TONA 2XBXA 1V2VT 1GDNA 1DY9A 3GY7A 2PTCE 3VPKA 3MH6A 4Y0ZE 1C1MA 2SNVA 1THPB 1QRZA 1BHXB 1HAVA 4DOQA 3TH4H 3QGNB 4CH8B 1TX6A 2BDGA 2VJ1A 1QNJA 3DUXH 3PLPA 2OCVB 1EZQA 4J1YA 1O3BA 1P2MA 2XC4A 3BTTE 4NA9H 3IG6B 3I78A 1E0FD 1FXYA 1EZUC 1K2I1 2P95A 3STIA 3TJUA 1O2IA 1C1TA 1N1LA 2FOGA 2ANKH 1O2KA 1T32A 2JH5D 3LOXA 1G3CA 1C2LA 1N8OB 1S82A 1Y8TA 1WU1A 2Y82A 1J17T 2W7UA 1NO9H 1MAXA 1SFQB 3F68H 1MD7A 5F03A 1SQAA 4GCHG 1AWHB 1HCGA 1OPHB 2GV7A 1DWDH 1MU8B 2UWLA 3HKJB 3SQEE 2EA3A 1BRUP 1C1VH 3WY8A 1J9CH 4XBBA 3LKWA 1D3QB 3MNBA 3NKKA 3ZZ5A 3RXGA 4ESTE 2VIDA 4LK4A 4ABDA 2FOBA 1V2LT 1GBMA 3GOVB 3T2NA 2VH0A 2B0FA 3T29A 1A5IA 1BMLA 2F83A 4YESB 1TGCA 3SN8A 4MNXA 3HK3B 2J2UA 2BMGB 3V13A 2R0KA 1O3HA 1SLWB 1XVMA 3BIVH 2ASUB 1D3TB 1TGNA 2F9VA 1CT4E 1NFUA 4AB9A 1CHGA 2ZTXA 1EP5A 1KXDA 2ZDLA 1XUIA 3MNXA 1UTNA 2NU2E 3BEUA 1K22H 1GBEA 1W8BH 3M7QA 1HPGA 4JZIA 4A6LA 1RIWB 3VFEA 3U1JB 1CGIE 1HDTH 3LDXH 1SBWA 4GSOA 1DY8A 3GCTF 1MAYA 4X1QU 5A8ZA 1AB9C 2R2MB 4CRGA 1BUIA 3BG8A 3TPIZ 4H42U 2Y80A 1HUTH 3M37A 1EATA 1XUHA 4MPUA 4AG1A 1BTXA 2TIOA 1YLCA 2J38A 2PHBA 1LQDB 1MD8A 1DLEA 1K1MA 4JZ1A 1MH0A 1QBNA 4NA7A 3D23A 5GDSH 2ALPA 1O3OA 1G37A 2AYWA 2H1UA 4WJG2 1F0RA 4UFFH 1OS8A 1HNEE 1EX3A 1V3XA 1ZPZA 1SG8B 2BY5X 2TGAA 3LH1A 2GT7A 5DPAA 1GBLA 2TRMA 4UFEH 5FPSA 1GHBG 3A88A 5ABWA 5GXPA 1P01A 4JK5A 1H8DH 4LZ1H 1AO5A 2P16A 2PKAA 4I7YH 1IHSH 1GBBA 1QBVH 2VINA 3EE0B 4AN7A 1FN8A 2ZF0H 4AGJA 3MU4A 1XXFA 3KEEA 3KQCA 3ZVCA 4X2XA 4ISNA 4BAOB 4ISOA 1TNGA 1EKBB 3SUFA 3G01A 2WUCA 2XC0A 1YPEH 1GJ5H 1GJCB 2C3SA 1D3PB 4AFSA 1K1PA 2B7DH 3FP7E 4ABAA 1HB0B 2BD9A 1CQQA 2Z6BD 1HIAB 1BZXE 2Q6DA 2BX4A 3A82A 4KGAA 1W14U 3FVFB 4ABJA 3MNCA 1K1LA 3U98H 4QT8C 1PQ5A 5GCHG 1LO6A 4NWLA 1C1UH 2P8OC 5GJ4B 1G2LA 3RXIA 1FNIA 1AGJA 3KCGH 1Z7KA 1GHAF 2C8ZB 4Z6AH 1S0RA 4YM9A 2OP9A 1RS0A 3U9AH 1KYNA 1T4UH 7ESTE 2H9HA 1DICA 1P04A 3Q3KA 2SGAA 2HVXA 2ZFPH 2UUFB 4X2WA 1WTGH 1YGCH 5L30H 3RLYH 3RXAA 4AORA 2CGAA 2ODPA 2WYGA 1F5KU 1P9UA 5H4IB 3BEIB 3O8CA 1A3BH 4XSKU 1NFWA 1GHZA 1AMHA 2BLOA 3GDUA 4Y7BA 1IHTH 3M5MA 2HPPH 3SU2A 1O5GH 2IJOB 3ZZ3A 1XUGA 1GJ6A 1A61H 3PMAB 4HGCA 1EOJA 1O3LA 2ZU3A 1HV7A 2ZDKA 8KME2 1NU9A 2QV1A 3UTUH 1C4U2 1VGCB 1EZSC 3CS0A 4X2YA 1LKAA 1MQ5A 2W3IA 2NU4E 5DP5A 1P2NA 1QQ4A 2OD3B 4ISLA 5EQRA 2CJIA 3RM2H 1SLUB 4Y71A 1TGTA 4WXVA 2VIPA 2ANMH 5DJ7A 3SJIA 1AVGH 1VGCC 1NRRH 4MQAA 1LVYA 1AZ8A 3VB5A 3BV9B 4K2YA 1JBUH 2BD3A 3ATKA 2B9LA 1DWCH 4NIVA 1K1OA 2FEQH 2JKHA 4FUCA 3AW0A 2C93B 5EPNA 2YNAA 2SGPE 1YLDA 3UWIA 3EQ0H 3QZQA 4FVDA 4YO9A 3LGVA 2G52A 1SOTA 2ZGHA 2F9UA 3S0NA 3PMHB 4AFZA 1QQUA 2BOHB 1CGHA 2ZFSA 2A7HA 3LJJA 5C5OA 3PO1C 1P2OA 3M36A 2K1QA 1VR1H 2LPRA 1TMBH 4ZUHA 1MTWA 2VNTA 1KXAA 4FXGH 3SHAH 4CBNA 3Q3YA 1TAWA 2G4TA 1AUTC 3MH4A 1CSOE 1D4PB 1VJAU 1GGDC 5DK1A 4BAKB 5EW1H 1UVTH 3PO1B 5FCRA 2A1DB 5DKMA 2VIWA 1C2JA 1CE5A 2XBWA 1FY1A 1S84A 3A87A 3GYLB 3SV8A 4R8TB 2XCFA 1LVBA 4IW4E 3SUEA 2QA9E 1SHYA 4IN2A 2PUQH 2PV9B 2H5DA 1O37A 2FLRH 1ZSLA 3VGCB 2EI7A 3E90B 1HRTH 1CO7E 1GI3A 1DVAH 2QCYA 2ZP0H 2KAIA 3T28A 2Z9KA 3TNSA 3A81A 3F1SB 1QA0A 2FODA 4I32A 4Y8YA 4MNWA 2Z94A 2AMQA 1OP8A 5A09A 4BTTB 3SNDA 4WMEA 1OP0A 3VGCC 2BDYA 1B0EA 1TPAE 2ZCHP 4NWKA 3E8LA 1ZR0A 2XYAA 1EB2A 1O36A 5FXLA 1TOMH 1IQNA 1DT2A 1UCYH 1Z1JA 1SHHB 3MU0A 1OWEA 1QB6A 1TABE 1UJ1A 1BB0B 3M3VA 2VH6A 1LCYA 1LKBA 1OYTH 4BXSA 2OC8A 1LHFH 4FUDA 3LPRA 3TITA 2SGFE 6LPRA 2FP7B 5E2PA 1L1NA 1YCPK 5FHTA 1IQGA 3ATIA 1HFDA 1Z71A 3FANA 1YPHC 2VWLA 1SGEE 3KGPA 1ZJKA 3R3GB 1XM1A 3TK9A 1GL1A 2ZDNA 1X7AC 5HM9A 2ZPQA 4DJZB 1PYTD 1KTTB 3GY6A 4BAQB 1N6XA 4A92A 1QL7A 4THNH 3RU4T 1FAKH 1HGTH 4K3JA 1LHDH 1GHBF 2BQWB 4CRFA 4BAHB 2Q1JA 1ANEA 1O5FH 3L33A 3PROA 4TWWA 1D6WA 3P6ZB 4AFQA 4BANB 2B5TB 4GPGA 1DITH 4XE4A 4TPYA 4UD9H 1W0ZU 1YC0A 3B23B 4Y10E