1GBDA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by ala complex with methoxysuccinyl-ala-ala-pro-phenylalanine boronic acid
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGANVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbdA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbdA01
1BTWA 3RXMA 1H8IH 2ODQA 4XFQA 5DK1A 2WUBA 1C5RA 4IBLH 1TBZH 4TWWA 1TIOA 5EG4A 3M3SA 2ANYA 4QT8C 7GCHF 2ZDNA 3TITA 2ZDLA 2GMTC 2LNCA 1BITA 2I6SA 1WTHD 2ZHWH 1KTTB 1HUTH 3A82A 3A8BA 2GZ9A 1TRNA 4XBCA 1DS2E 2A7HA 1TGCA 4WY3A 5GDSH 4ZROA 2C8YB 2C90B 3F68H 1KXEA 3UNSA 2F9NA 1CA0C 4UE7H 5EPYA 1BDAA 3GCNA 1BRCE 1KXDA 1SVPA 3GDVA 1NRNH 1FNIA 3RP2A 5GIBA 2AMQA 1X7AC 1EJNA 1BHXB 3UNQA 5GXPA 1TWXB 1VJAU 3U98H 2CHAB 1DE7H 2FOEA 1NU9A 5BPEA 1EP5A 1A5IA 1TRMA 2FS9A 4MNYA 3MNCA 3SU3A 1GHZA 3SV2H 1CO7E 1TMUH 3Q3YA 1O3EA 2AIPA 3BN9A 3U8OH 2OC8A 4THNH 2B8OH 4NSYA 5C1YA 1EP6A 1HAXB 2TGAA 3ZVBA 4X2VA 3NK8A 1ARCA 5LPRA 2ZFSA 4FUBA 1CA0B 2BTCE 1W11U 3GY7A 4X1QU 3P6ZB 1EX3A 5DPAA 1EAIA 3UR9A 1MZAA 4WH6A 1Z8IB 3UPEA 4AYYB 1O36A 2BDHA 3GY6A 1UCYK 1AHTH 3M7TA 1UCYE 2FO9A 3SV7A 3S9CA 4D9RA 5TCCA 1WUNH 3NUMA 3SI4H 2G8TA 3D23A 1PQAA 1ZR0A 3FFGA 1UVTH 2BZ6H 4ZAEA 5CMXH 1QQUA 4WXVA 2CMYA 1W7XH 2W5EA 5GCHF 3SI3H 4AFQA 1ID5H 3RXTA 2CJIA 1G3DA 1TPOA 3UUZA 1ZRBA 3MFJA 1ZSLA 5FX5A 2FI3E 2STBE 1Q3XA 3RXPA 5JBAS 4BTUB 2O9QA 1T8NA 4Y7AA 3O8BA 1C5NH 1TX7A 1O5AB 1VITF 1O3CA 2AEIH 3LGWA 1RRKA 4OGXA 3ATWA 2PFEA 1KY9A 4MPXA 4NFEA 1ARBA 2A4GA 3ZYEA 1IOEA 1C5YB 1GJ8B 2ZGXH 3LU9B 1O2TA 3CS0A 1QA7A 1GJ9B 2NWNA 1QNJA 1Y5AT 4MNXA 2UUFB 1T8MA 2Y7ZA 1P06A 1OX1A 3TJOA 3R0FA 4CH2B 1HNEE 3FP7E 2BM2A 2A4RA 3AAUA 3CS7A 1ZJKA 4CRBA 2OP9A 1KXFA 1YPGH 4HI3A 5TJXA 1Y8TA 1B5GH 3QLPH 1EQ9A 1C5XB 3BTHE 1MBQA 3QTOH 2Q6DA 1RTLA 3BTEE 1H4WA 3M5OA 1S84A 1G32B 1OP0A 1ELDE 1ZJDA 3V7TA 2SGAA 3NPSA 3FVFB 3PTBA 1NRSH 1UVSH 2JKHA 2AFQB 1S0RA 1T31A 2VIVA 4CR5A 4NIYA 4INHA 1NU7B 2A32A 1TBQH 2Z94A 4DT7B 2QF0A 3D49H 5A0AE 1K28D 4INLA 1NTPA 2F3CE 2ZF0H 4MDSA 3MU4A 1JIMA 3T2NA 1RXPA 1NESE 1O35A 1LPZB 3MMGA 3LDXH 2VIWA 3ZVAA 1Q31A 1QBOA 1P03A 3ZYDA 4CBOA 2Z3CA 3LPRA 1HPGA 3T25A 1PPCE 2HLCA 2UUKB 3ZV9A 2O8WA 1SI5H 1IQMA 4AORA 1DOJA 3ZZBA 3KIDU 1P2IA 2JETC 1WU1A 1V2KT 4H6TA 3UTUH 1EZQA 3RXOA 3B23B 4Z0KA 3IWMA 1K1JA 4ISLA 2ANKH 4BTTB 2ZTYA 1YPLH 1BQYA 2ZDKA 3LC5A 5DKMA 1TONA 3SNCA 1CGIE 1UTPA 1LHCH 1ACBE 1TNLA 2A7JA 3VEQB 2BZAA 1FQ3A 4K69A 1RD3B 2VJ1A 4O9VA 1XUFA 1K9OE 1CT0E 3A7VA 2GX4A 2BD3A 2GZ8A 2R3UA 2Y80A 1MTWA 4JZDH 2WPKS 4MPUA 1MU6B 4Y6DA 1Y3WA 1YPMH 3UNRA 6GCHG 3UOPA 1FN8A 1FY1A 1Z8GA 2QXJA 1K21H 1BCUH 3RXCA 1V2TT 2PR3A 3MH7A 2BXTH 3L33A 4BNRA 1O39A 2VINA 3U69H 1O31A 2A5AA 5FX6A 1U6QA 3UWJH 1KXCA 1VGCC 4I8JA 5E2OA 5L30H 2A5KA 1GBDA 1P2KA 2ILNA 3MO9A 1ZZZA 2FOFA 1BMAA 1QJ6B 1ELBA 4RKOB 2V6NA 4BAQB 1XUHA 1FN6A 1XMNB 3A85A 3KQEA 5H4IB 2VWOA 1DUAA 1NPMA 1SQOA 2OCVB 1J8AA 1OWIA 5DP8A 3EGKH 3BEIB 1XUJA 4I8KA 1EAXA 1HAGE 1TGTA 2FEQH 2THFB 4NCYA 2JH6D 3SU0A 1ANDA 1LHFH 1O2HA 2TPIZ 2XBWA 1AY6H 3GCHC 1C5OH 1BBRK 3URDA 1BBRE 1D9IA 4LK4A 2EEKA 2BDIA 1HAIH 1SPJA 1TQ7B 3F9EA 1VGCB 1OPHB 3F1SB 4H6SB 2BQWB 2ZFQH 3RXHA 1E34B 1V2UT 1T4VH 2C8WB 4FUGA 3M3TA 1O30A 3MO6A 3HATH 1P57B 1CHOG 2FPZA 9LPRA 3PLKA 1PPBH 2ZDMA 1SLXB 4UFGH 3Q3KA 1A5GH 1A4WH 1TAWA 1AVGH 2FOHA 1UO6A 1O2ZA 1A61H 3SN8A 5A8ZA 1LVBA 5DP3A 5E8EH 5L2ZH 5EXLA 5C1UA 1P2MA 2GVFA 4R0IA 2J34A 1JWTA 1MCVA 3SU2A 3GCHB 3RC4A 1ZMLA 1DSTA 1IQGA 4NA7A 4DIIH 2EI6A 2BMGB 1S85A 2VWNA 1GMHF 3RUOA 3FANA 3RXGA 1UMAH 2ZU2A 1TMBH 1NY22 2WPLS 1UTNA 1EJMA 2EI7A 1V2WT 3QGJA 5F6MA 3TGIE 2ZPRA 1QBVH 1IQEA 3O8CA 4O3UA 1XM1A 2WPIS 3A86A 3SORA 1G3EA 2J92A 3BG8A 5HGGA 1DWDH 1LPGB 1QB6A 2OUAA 2Y6TA 2VU8E 4ZHLU 4MLFB 1EOJA 2GT7A 1B7XB 2Q6FA 5FCRA 1HFDA 1GBHA 3UWIA 2HPQH 3ZZ3A 1MTNC 1TPPA 4YOGA 1SMFE 2FP7B 3GY5A 2NU2E 1SGDE 2VIOA 3MH5A 3ZVEA 2Y81A 1QJ7B 1ELGA 2PSXA 3QX5H 3RXIA 2BOHB 1GL0E 3STJA 1W3CA 4AOQA 2ZFPH 1Z1IA 2TBSA 3TK6A 2F9PA 3UY9A 2Y5GA 1AZ8A 1J15A 4FUIA 1TOCB 2P3FH 1F92A 3E3TA 1O37A 2ALPA 4NG9H 2K1QA 4K60A 3SNAA 4BXSA 1A1RA 2FS8A 1P12E 4AG1A 1QR3E 1O2SA 2H2ZA 1P2NA 3RXKA 8GCHG 1XUGA 1RIWC 3K2UA 4AGKA 2WUCA 4IN2A 1IQJA 2RA3A 1YCPM 1W2KH 1GI3A 2J95A 1NFUA 3FZZA 1VR1H 1QHRB 4MQAA 3RM0H 1ZGIA 2AYWA 4ABDA 2BD5A 1EB2A 5CE1A 3K65B 1DXPA 1GHBG 1EZSC 1F7ZA 1QY6A 4Y0YE 1C5WB 2ZTXA 3PM3A 4CBNA 4I31A 1GHAF 3A88A 4GUXA 4Q80A 3ZZCA 1UVUH 4LZ4B 3V0XA 2NU4E 3SNBA 4D7GA 2W3IA 3KGPA 2A2QH 5LPEA 4IN1A 1AD8H 2B5TB 1C2LA 2W7UA 2NU3E 4FUFA 1RIWB 2ZU1A 3BIUH 3MH6A 5J4SA 4CRFA 3BTWE 3MHWU 1MCTA 2FI5E 4MTBA 3ESTA 1ORFA 1E0FD 2A45B 4MVNA 5DP6A 3H5CB 3LJOA 3A8CA 1O2MA 2ZGJA 1Z8RA 7GCHG 3RXQA 2VIQA 2Z3DA 1SGYE 1C1PA 1ZTLA 1CA8B 1JXPA 3LOXA 4A5TS 3U1JB 2CGAA 4GVUA 3RXAA 2GZ7A 1NFYA 1RS0A 1HLTH 1HXFH 1V2QT 4X1RU 1EJAA 2HPPH 2M5TA 5EW2H 1XXDA 4IW4E 1D4PB 8KME2 3SU6A 1AU8A 2BLWA 1AB9C 1H9HE 4NWKA 3ZVCA 2PUXB 4NFFA 4B73A 2FYQA 2ZPSA 1GVZA 1SGCA 4H42U 4FU7A 3SHAH 1TFXA 1OP8A 1C1TA 1HGTH 1LHDH 1ZSJA 4YLQH 3A8AA 3ZZAA 2C3SA 1DVAH 1MUEB 5FPTA 3TIUA 5HYOA 1C2KA 2D2DA 2A0QB 1FMGA 1NT1A 2SGQE 3BTGE 4FXGH 5DJ7A 1LTOA 4U2WA 3BG4C 1O5FH 2GD4B 3A7ZA 3MOCA 4MG3A 5JYIA 3ZVDA 1O2NA 1TBRH 4HTCH 8GCHF 1LVMA 1O5GH 5A0BA 1V2VT 2FLRH 4NIXA 1O2RA 1YP9A 1DY9A 2G52A 4ZKSU 4NA9H 1ZSKA 3BSQA 4R8TB 4WMDA 1VCWA 1LO6A 5A09A 1O3DA 3SJOA 1MAYA 4BOHA 1O32A 4JMYA 4ZKOU 1GHBF 1LCYA 2J9NA 3L3TA 1GBTA 1OWHA 1FIZA 1O2VA 3SUEA 1C1SA 3TK5A 1CHGA 3BEFB 5GCHG 3BG4B 2FODA 3PMJA 2ZHDA 1GJBB 2ZGHA 1SHHB 1T32A 1QURH 1GMDG 1GBKA 3AW0A 4GAWA 4OS2A 1YPHE 1VITG 2QN5T 3C1KA 1C1MA 1O3MA 4E7RG 3M5NA 1J14A 1GI6A 2CHAC 1V3XA 1NROH 2AGGX 2GT8A 3EQ0H 2QAAA 2PGQB 1XUKA 2VVCA 3MU1A 2ZDVH 1O2LA 1C5UA 3ELAH 4JCNA 3BIVH 3OY5U 3SJ9A 1GGDC 1RFNA 3KCGH 2Q1JA 3RU4T 1O5EH 1UK3A 5EQQA 1TA6A 3T27A 1XVOA 4X2WA 1GMCG 1EAWA 2D26C 4AFUA 1AWFH 3SNDA 1LHGH 1L4ZA 3UIRA 2R0LA 3U8RH 5EXMA 1SGNE 1NRPH 2SNWA 1B0FA 3V3MA 1OXGA 1C5QA 3P17H 2WV4A 1S5SA 2Y5HA 2AMDA 2ODYB 2QY0B 1KIGH 1A5HA 3RMLH 5I46H 1P0SH 1H9IE 4WXIA 1MQ5A 1TB6H 1PPZA 4MNWA 1SOTA 4DG4A 3W95A 1V6DA 5JB9S 3E90B 3KNXA 1GI4A 1GGDB 3EAJA 2FZZA 1ANCA 2FM2A 3S9BA 1FY3A 2ZCLP 3GY3A 2F83A 3NCLA 3DA9B 2ZG0H 4Q7YA 3E0NB 1SR5C 7ESTE 3ZVFA 1TX8A 1WQVH 1C5VA 1NRQH 1S0QA 2H5DA 5ABWA 1GBEA 2C8XB 1WAYB 1ESBA 1SFQB 2AMPA 2R3YA 1C2GA 3S0NA 2ZHEH 3K6YA 1D3QB 2OINA 4NSVA 1OSSA 4KKDA 1O3OA 1YM0A 3A7TA 3KF2A 3TH3H 1N8OB 1UK4A 2SFAA 4OGYA 1GWAA 4NZQA 1LVYA 2B9LA 1GBAA 1TPSA 4I8LA 5E0HA 4Y76A 1C5ZB 4CH8B 3W94A 4UFDH 2ANWA 4Y8YA 1WBGB 4Z6AH 1TRYA 3OTJE 5EXNA 1HAYB 1HB0B 2XYAA 1GJ7B 4ZUHA 4NWLA 3A89A 1AN1E 3KQCA 1GVKB 4DURA 1DXWA 5AVDA 1GBBA 5DP7A 5A8XA 1QTFA 1AKSA 1GMDF 3V13A 1W12U 4ABFA 3TNSA 3SUGA 1OWEA 3GYLB 3MH4A 2BX4A 3QO6A 1ZPZA 4X6MA 1T8OA 3HK3B 2FOAA 5CHAC 3RXVA 3T29A 1P2OA 4X8UH 1F0RA 2A2XH 1LPKB 2ZFRH 1GDNA 4ISHH 4DVAU 1O3IA 1A3BH 4D8NA 1T8LA 4ZKRU 1S83A 2OTVA 2RA0A 4JK5A 4VGCC 3A84A 4Y8XA 1SGFG 2XXLA 2Y82A 2ZPQA 1TNKA 2CN0H 1IQNA 2BY8X 4GHTA 1GMCF 3ZZ7A 1O3NA 4A1TA 1FPCH 1TABE 1NC6A 1PYTC 5K0HA 1GPZA 1N6XA 2IPHA 1G30B 1F5LA 2XC4A 3SHCH 3UREA 3T62A 4WF8A 1BTPA 1HIAA 3B8JA 1BRAA 1BA8B 1AE5A 5C5OA 5C3NA 3FAOA 1TGNA 1A0JA 1THPB 5CHAB 2CV3A 3B9FH 1GCTC 2BY7X 2J38A 4YESB 1P05A 2CF9H 3BTKE 2ZCHP 5LPFA 3V12A 5DP5A 1SGQE 1EKBB 2H9HA 1C5MD 4F4OC 4FUDA 4VGCB 1HAOH 2QGRA 4ABJA 4DCDA 1TOMH 1IQFA 1QRWA 2HNTE 3GY4A 1YPJH 4UFEH 4BAOB 1AMHA 4DOQA 1O3JA 4KGAA 5TCAA 2ZZUH 2XCNA 4INKA 3TJUA 1C2DA 1P02A 4AFZA 4ZHMU 1XKAC 3Q77A 1ZRKA 3S9AA 1GHXH 3G01A 1C5SA 1DWBH 2QIQA 3GCOA 3MTYA 3ATKA 3ATIA 3GISB 5LH8A 2QC2A 1BTXA 2ZTZA 3JZ2B 1GCTB 1EXFA 1Z6EA 1QIXB 1SGIB 1GHYH 4UFFH 1KLTA 3A80A 2ANMH 1VCPA 2HWLB 3ATMA 3BF6H 2R9PA 3TK9A 1BB0B 2ZHFH 1EPTA 1GBJA 4K8YA 1P2JA 1GMHG 1C4Y2 3SBKA 4ZXXH 4GCHF 1TQ0B 5DP4A 1F0UA 1MKXH 1CGHA 3C27B 1O33A 5K7RA 1L1GA 2DUCA 1YBWA 3PO1C 2OXSA 1LQEA 2VB0A 1AKSB 1AFQC 1UTKA 3BEUA 3PMBB 1SLWB 3H7TA 3PLBA 4ZXYH 2HALA 2DE8A 2Z9GA 2ZEBA 3K6ZA 3LH3A 1BOQA 4WH8A 4X1PU 1C5TA 4TWYA 1BMLA 5EQSA 1V2OT 1SC8U 1QBNA 1HCGA 5C5NA 2AH4X 2GCHF 3KHVA 1NFWA 1ANEA 3SU4A 2O8LA 2F91A 2Z9LA 3M7UA 3OYPA 4FUEA 5EODA 2VH0A 1G9IE 2G5NA 1CVWH 2FI4E 2VIDA 1P3CA 4CRGA 1ELAA 1EUFA 3PO1B 1BJUA 5IYTA 2FOBA 1OWJA 1AFQB 2ZWLH 3A87A 1GHVH 4B75A 5EPNA 2OQ5A 1C1OA 3O8RA 4AFSA 3SV6A 2IOTA 4X8TH 1KXAA 1O2JA 3P95A 2BLOA 4WMEA 2A4QA 3D65E 1SGPE 2AGIX 1BJVA 1BMNH 1C1WH 1QCPA 1NFXA 5E0GA 1QL8A 3OSYA 4U30A 3KQDA 2XC0A 1DWCH 3RXDA 1EPTC 1P10A 3DT0H 2XBXA 1AWHB 1PYTD 4OS4A 2GGVB 1E38B 1UHBA 2ZNKH 4AZ2B 2Z3EA 1GHAG 2Z7FE 1GCDA 3NWUA 3MU5A 1KLIH 3MNSA 2NU0E 3A83A 1TGSZ 1W0ZU 4H4FA 3MYWA 4MNVA 2HNTF 5C1XA 3E1XB 1Z8JB 3LT3A 3LIWA 3U8TH 2TIOA 5BRRE 2LPRA 1UTQA 1XKBC 2ODPA 1FUJA 1DITH 3T28A 4B76A 1GI7B 3M5LA 3P8OA 1VCQA 1MKWK 4YT6H 3UQOA 4JZ1A 2W3KA 1EPTB 2G00A 3QZQA 1AE8H 1GI8B 1ZTKA 4DGJA 1O2UA 1MBMA 1CGJE 1SQAA 1GDQA 1P3EA 2QYIA 3QDZB 3RXUA 1PPGE 2QXHA 4YT7H 5JPMH 1JIRA 1QL9A 3SV9A 2F9OA 3TH4H 4Y7BA 6LPRA 3ZVGA 4WJG2 2Z9IA 5G4BA 1PPHE 1TLDA 1V2MT 2V0BA 2FX6A 1MTSA 4Q2KA 5T6FA 4O97A 2Z6BD 3M37A 4U32A 1MU8B 3KEEA 3VB5A 2ZO3H 1K1LA 3D62A 2OC1A 2BVSH 4IS5A 1EZUC 2XWBI 1AFEH 3ENSB 1ZMJA 2QF3A 4I32A 1F0SA 1CQQA 1DFPA 1WQSA 2HRVA 3QTVH 5A8YA 1HAPH 5JBTA 1C1RA 4B2BA 1WCZA 3AW1A 9ESTA 3IG6B 3FZDA 4Q7XA 1WSSH 2VH6A 4JYTA 3KQBA 3SOSA 1LDTT 2B7DH 1G3BA 2SGEE 4NIVA 2BDAA 3ODFA 1D3DB 3PROA 4SGBE 3F9FA 1HDTH 1Y3YA 2QXIA 1TNJA 3GYMA 3MNBA 4TY7A 2P3UB 4RKJB 4GHQA 2PGBB 5L2YH 3NZIA 3SU1A 1ZHRA 1YPHC 2FLBH 3OX7U 1O3HA 4D7FA 1TPAE 1XXFA 1S82A 3AASA 2Z9JA 2Z9KA 3OY6U 1O3AA 1M9UA 1AUJA 1BRUP 4LZ1H 1Y5BT 4I7YH 5SGAE 1UHBB 1W7GH 4FU8A 3GY8A 1BT7A 3PYHA 1YPKH 1LKAA 2GCTB 3I77A 1KXBA 2ZDAH 5FBEA 2AGEX 1F5RA 1DT2A 1J17T 3QK1A 4RN6A 5JB8S 2GTBA 1PFXC 1QRZA 3RXFA 4E06H 4E7NA 4XDEA 2PUQH 1SGFA 1G3CA 2J94A 4XE4A 2P8OC 3SJ8A 5JBBS 4JZEH 2F9UA 1TE0A 4ISOA 4B2AA 4CREA 5FHTA 2WINI 1WYKA 3EA9A 5EU8A 4J2YB 1SSXA 1DWEH 1V2RT 3LGVA 1T7CA 2P59A 5FCKA 2B0FA 5ETXA 1DPOA 4F49A 4CHAC 2G55A 4UEHH 3U1IB 1UVOA 2BY6X 4XBDA 1FI8A 3ODDA 1ELCA 1H1BA 4LXBH 1FZZA 3SGAE 3QGNB 1K1OA 2P8OB 2W26A 4GSOA 2BD4A 1FXYA 1TALA 1GJCB 1QGFA 3M7QA 5F8ZA 1TNHA 2BD8A 3A7WA 3NKKA 1HYLA 1C4U2 1GJAB 2ZGBH 4A1XA 1AVWA 2VGCB 2D8WA 5L6NH 1YLCA 1A3EH 2BLVA 1O2PA 3P92A 1L1NA 1LMWB 4UDWH 5AFZH 2FOMB 1DM4B 2UWLA 2XBYA 3S7HB 4LOYH 4CHAB 3TNTA 2XNIA 2PV9B 5EGMA 1C1NA 2G51A 5T6DA 1SLVB 3JZ1B 1BZXE 1HV7A 1HAZB 2PKSC 2I6QA 1C2HA 3TGJE 3DFLA 5LGOA 1IQLA 1BTZA 3Q00A 2OC0A 1IQHA 2YNBA 5EQRA 4YO9A 3GICB 4BXWA 3M35A 1IQKA 1UCYH 1LVOA 4K1TA 2STAE 4KTUA 3LGUA 5E2PA 3RM2H 3RMMH 2AERH 3MO3A 3KL6A 3P8FA 4I8GA 3BTDE 1C2FA 3SUDA 1IHSH 1JOUB 2TGTA 1GBIA 1PJPA 2AS9A 1LQDB 1C1UH 3VXEH 5AF9H 2UWPA 3S69A 2XTTB 2Y7XA 4GPGA 3VB7A 2PKSB 1DSUA 2RDLA 4YZUA 1ETSH 3ZZ9A 2XCFA 4K3JA 4U01A 1SQTA 1HRTH 2UUJB 1FY8E 2XWAA 5FXLA 1O3KA 1HBTH 2G4TA 1HJ9A 2EI8A 1W0YH 5T3HA 1EZXC 2SGPE 4TPYA 2DE9A 2FDAA 1TMTH 2BY5X 3ZZ6A 2V3OH 3HK6B 1OWKA 3VFEA 1Y3VA 2HNTC 3Q3XA 2FYRA 1YGCH 2A31A 5I25A 1SGTA 2R2MB 4X6PA 1YPEH 2R2WU 2ZC9H 4WVPE 1FY5A 3E91A 1N8OC 2JH5D 3SZNA 3T26A 2BY9X 4M7GA 4NIWA 1FAXA 1A7SA 4D9QA 2F9BH 1V2ST 5J4QA 3GDSA 1Y3XA 2CXVA 3T5FH 1O3PB 1O2QA 1P01A 4JZFH 1UVPA 1G2LA 1OYTH 1EOLA 1GVLA 4X6OA 1YCPK 3SU5A 4YLUA 3BTQE 4Y10E 1D6RA 3L6PA 3PWCA 3CENA 1QL7A 3HKIB 5E0JA 2FOGA 1P11E 2GMTB 4BTIB 2JH0D 1MAXA 1MH0A 3LH1A 1KTSB 5FPSA 2QA9E 4AB9A 1ZMNA 4AB8A 2ZECA 4X6NA 1DLKB 2PHBA 2P3TB 2OLGA 1RTKA 1W10U 2TRMA 1MZDA 1BTHH 3RXRA 3DD2H 5GPIB 1G36A 5JBCS 2PKAA 2VVVA 4K1EA 4DW2U 2D1JA 2BDYA 3R3GB 3RXJA 3DHKH 1H8DH 1A46H 5HM2A 2BB4A 4HFPB 3E16B 3PB1E 3TVJB 3U9AH 5FBIA 4GCHG 1TNGA 2F9VA 4Y0ZE 1JRTA 3URCA 5B6OA 1SB1H 5A0CA 1BTYA 3I78A 2QXGA 1C2EA 1AO5A 3RC6A 4NZLA 3EA7A 5C20A 1CSOE 2P94A 1P09A 2FTLE 2H1UA 3FP6E 4TPIZ 2FTMA 1G2MA 2QCYA 1ELTA 3RU4E 1P04A 3M3VA 1AQ7A 4NGAH 2UWOA 3F6UH 1KDQA 1QJ1B 2GCHG 3GDUA 4YOJA 1SOZA 1ZHMA 2ASUB 1HJ8A 2BD2A 4ABHA 1GI5A 1KSNA 1K22H 1C1QA 2EC9H 3RU4D 3SNEA 3H7OA 1ZLRA 1HAHH 1NO9H 1L0ZA 1FPHH 1VZQH 3FP8E 2P93A 1THRH 1TYNA 4SGAE 1QRXA 1D6WA 1UTMA 1W8BH 4B1TA 3PV4A 4DJZB 2XRCA 3BTTE 1BIOA 2NU1E 1SFIA 1NZQH 3TLOA 4Y79A 1C2IA 2BVRH 4I33A 3ATLA 1Z7KA 1MQ6A 4JYVH 2H5CA 1EASA 1E35B 2GV7A 2C93B 4HGCA 1PPEE 4ZH8A 8LPRA 1O2WA 3TJVA 1GI9B 1OS8A 2A1DB 2BDGA 3PMHB 5F03A 3A7XA 1BMMH 2J2UA 5C2ZA 3HGNA 5A2MH 1BBRH 1V2JT 2PTNA 1OYQA 1ETTH 1O2IA 1O34A 2GP9B 1E37B 1NN6A 1O0DH 1P9UA 1O38A 2HGTH 4Y8ZA 2IN2A 3RXEA 1S6FA 3EA8A 6CHAC 4KELA 3PWBA 2PSYA 1Y3UA 2ALVA 3F9GA 4IC5A 4O03A 4OS1A 2H9TH 4K8BA 1KLJH 1XVMA 3OU0A 1GJ6A 1E36B 3ZZ5A 1MMJN 2PKAB 2A5IA 2FIRH 1GJDB 4JYUH 4B2CA 1S6HA 1GG6C 4MPWA 2KAIA 1THSH 1WTGH 4CRCA 3TJNA 2EA3A 5DO4H 1K1PA 1MKWH 3N7OA 3UR6A 4A1VA 3RXSA 1K2I1 1CT2E 2ZHQH 1PPFE 2ZU4A 1J16A 1C4V2 1L1JA 1QFKH 1ESTA 3K9XB 3ITIA 4KTCA 3SO3A 4TY6A 3LKWA 6CHAB 2RCEA 1ZYOA 1GBMA 1ZOMA 4UONA 1QB9A 2XC5A 1ANBA 2ZQ2A 3P8NA 1GBFA 1ZPCA 4FUJA 1Z71A 3TPIZ 4AGJA 1L2EA 1DDJA 1P9SA 1KDQB 1B0EA 1YLDA 1AZZA 1C2JA 5DP9A 4X8VH 1ZPBA 3EE0B 2TGDA 4X1NU 4OS7A 2ZU3A 1C5LH 2SNVA 1GG6B 3A8DA 2TGPZ 1MD8A 4ZMAH 4HZHA 3VB6A 1INCA 2BXUH 1O3BA 1EB1H 1O2KA 2WPHS 3ZV8A 1GDUA 2BQ7B 4JK6A 1S81A 3M5MA 1HXEH 2JETB 1ZGVA 2GDDA 4X8SH 5ESBA 1HIAB 2BDBA 2ZIQH 2Y5FA 1TNIA 2XBVA 2P95A 3DFJA 1UTOA 5ESTE 4ABAA 1UK2A 1W13U 4ABBA 2WPJS 3A81A 1O2OA 1DX5M 4GLYA 3BTME 2A7CA 2ZI2H 2YNAA 3HKJB 1GI0A 3QN7A 4J1YA 2ZGCA 1O2YA 3BV9B 4B71A 1C9PA 2BYAX 1ESAA 4YOIA 1SL3A 1SGRE 2G4UA 2H9EH 2GDEH 1BUIA 2PTCE 1K1MA 4A7IB 1OWDA 2C4FH 2ZFFH 1SBWA 3NXPA 1CBWC 1LHEH 1BHXF 3F9HA 3M61U 1F0TA 1OP2A 1DANH 1KYNA 5F8XA 3SGQE 2FOCA 4OS5A 3TH2H 3LGYA 1DLEA 1BTUA 1YC0A 3S7KB 1Q2WA 1QA0A 2OBQA 4A6LA 3M36A 3GCTG 2BOKA 3CP7A 1AUTC 7LPRA 1Z1JA 3QZRA 3QWCH 3SQHE 1O2XA 3SGBE 1O3LA 1AIXH 2ZP0H 1PQ7A 5HMAA 5DGJA 5FPYA 3RMOH 2KAIB 2OD3B 2ULLA 1GL1A 1MKXK 4Y71A 4YTAA 1CBWB 1EATA 2VNTA 2SGFE 2CF8H 3ZZ4A 1FY4A 1A0HB 1H9LB 3VB3A 1JBUH 2J4IA 2VIPA 4K2YA 3RLWH 5HXFA 5AFYH 4AX9H 2FESH 1D3PB 1DICA 3SJKA 3MNXA 3QUMP 3SJIA 1G37A 1IHTH 5GWZA 2FXRA 3BTFE 4Q7ZA 4X0WU 4FVBA 1O5BB 5JDUB 1IAUA 2HOBA 1FDPA 1V2NT 4X2YA 1JMOH 4FU9A 4AG2A 4FUHA 2BHGA 1SLUB 2BQ6B 3AVZA 1D3TB 3RXLA 6GCHF 1XX9A 4XBBA 3SV8A 1F2SE 3UFAA 5GJ4B 1N6YA 3SW2B 3UOUA 3KN2A 4KP0A 5C67A 1L4DA 3ZZ8A 1V2LT 1FAKH 1O3GA 2C8ZB 2GCTC 5PTPA 1C9TA 1AGJA 3LJJA 4XSKU 3DUXH 2HVXA 3VXFH 4ESTE 1ETRH 1TA2A 1YYY1 1F5KU 2G81E 3STIA 1GBLA 1QQ4A 1UJ1A 1K1NA 4ABIA 5EW1H 3RMNH 1TX6A 1T4UH 1MD7A 3EYDA 4B74A 2ZCKP 3VGCC 2ZFTA 4DIHH 3TGKE 3UQVA 4AN7A 5HM9A 1ABJH 1JRSA 1P2QA 1QB1A 1GI1A 1HJAC 6ESTA 2PW8H 1K1IA 3EDXB 2FMJA 4CRAA 4K1SA 2YOLA 1TGBA 1MTNB 2G5VA 1O2GH 3PLPA 1N1LA 4AYVB 1UTLM 1CT4E 1AVXA 2RG3A 1VITH 3LGIA 1HAVA 2ZKSA 3P70B 2ESTE 1C2MA 1UTJA 1NM6A 2WYGA 1CHOF 3GCTF 3MWIU 3VGCB 3SQEE 7KMEH 2R0KA 2P16A 1PQ8A 4ABEA 1P8VC 1ABIH 2UUYA 4I8HA 3P8GA 1Z6JH 1ZHPA 4K5ZA 1GJ4H 1HJAB 1EAUA 1RTFB 4BAHB 4D76A 4O3TA 2ZQ1A 2VGCC 3A7YA 2V35A 3LONA 4FVDA 3RXBA 1FJSA 3MU8A 1RJXB 3VPKA 2O8TA 1LKBA 3RC5A 4YM9A 1ZTJA 1BRBE 1V2PT 4NA8A 1YF4A 1MTUA 2VVUA 3GOVB 4RSPA 1MTVA 4IMZA 4IGDA 3WY8A 2A4OA 1ELEE 2VWMA 1NRRH 2GKVE 5EOKA 1ELFA 2WYJA 1C1VH 4CR9A 4ASHA 3I29A 1O5CB 1VJ9U 4ABGA 3HGPA 1IQIA 1DY8A 4A92A 4ISNA 4WMFA 4X1SU 4WWYA 3SUFA 3Q76A 5FAHA 1SG8B 2IJOB 1SGEE 4PROA 1XUIA 2ZU5A 3E0PB 2OC7A 4JZIA 3TU7H 2H6MA 3IITA 1GBCA 5F8TA 2BX3A 2W7SA 4IC6A 1C5PA 2FWWA 1OOKB 4FUCA 1DUEA 1WV7H 4UD9H 3RLYH 3PMAB 1RGQA 4E05H 2BVXH 4KTSA 4MPVA 1YCPH 2BD7A 1YKTA 1O3FA 4CRDA 3ZZDA 3GY2A 1WOFA 2SGDE 1Y59T 2FX4A 5IDKA 1GI2A 2BLQA 5AHGH 4BAKB 2WV5A 3AAVA 1J9CH 3MI4A 2GV6A 4X2XA 5T6GA 2XW9A 1NS3A 2WPMS 1CU1A 3E6PH 1AB9B 3RDZA 1OKXA 1CE5A 1FLEE 2O8UA 1PQ5A 4BANB 4ISIH 2PWXA 1O5DH 1A2CH 2QV1A 2AIQA 3LC3A 1AI8H 4OS6A 4IMQA 1ELVA 1Y5UT 3LGTA 4ZKNU 3MU0A 1W14U 4ZHAA 1GHWH 3O8DA 2ZA5A 1HAVB 3PTNA 2O8MA 4TYDA 1SHYA 4Y11E 2PLXA 3E8LA 2BDCA 4DY7B 1FONA 2VWLA 1FV9A 3VB4A 4XOJA 2V3HH 8ESTE 4BAMB 1FIWA 1GJ5H 5DG6A 3HPTB 2BD9A 2OQUA 2OBOA 2Q6GA 1A0LA
chains in the Genus database with same CATH superfamily
1BTWA 3RXMA 1H8IH 2ODQA 4XFQA 5DK1A 2WUBA 1C5RA 4IBLH 2J98B 1TBZH 3PV2A 4TWWA 1TIOA 5EG4A 3M3SA 2ANYA 4QT8C 7GCHF 2ZDNA 3TITA 2ZDLA 2GMTC 2LNCA 1BITA 2I6SA 1WTHD 2ZHWH 1KTTB 1HUTH 3A82A 3A8BA 2GZ9A 1TRNA 4XBCA 1DS2E 2A7HA 1TGCA 4WY3A 5GDSH 4ZROA 2C8YB 2C90B 3F68H 1KXEA 3UNSA 3FOAA 2F9NA 1CA0C 4UE7H 5EPYA 5EIYA 1BDAA 3GCNA 1BRCE 1KXDA 1SVPA 2M2AA 3GDVA 1NRNH 1FNIA 3RP2A 5GIBA 2AMQA 1EJNA 1BHXB 3UNQA 5GXPA 1TWXB 1VJAU 3U98H 2CHAB 1DE7H 2FOEA 1NU9A 1YLNA 5BPEA 1EP5A 1A5IA 1TRMA 2FS9A 4MNYA 3MNCA 3SU3A 1GHZA 3SV2H 1CO7E 1TMUH 3Q3YA 1O3EA 2AIPA 3BN9A 3U8OH 2OC8A 4THNH 2B8OH 4NSYA 5C1YA 1EP6A 1HAXB 2TGAA 3ZVBA 4X2VA 3NK8A 1ARCA 5LPRA 2ZFSA 4FUBA 1CA0B 2BTCE 1W11U 3GY7A 4X1QU 3P6ZB 1EX3A 5DPAA 1EAIA 3UR9A 1MZAA 4WH6A 1Z8IB 3UPEA 4AYYB 1O36A 2BDHA 3GY6A 1UCYK 1AHTH 3M7TA 1UCYE 2FO9A 3SV7A 3S9CA 4D9RA 5TCCA 1WUNH 3NUMA 3SI4H 2G8TA 3D23A 1PQAA 1ZR0A 3FFGA 1UVTH 2BZ6H 2YMSC 4ZAEA 5CMXH 1QQUA 4FETA 4WXVA 2KM0A 2CMYA 1W7XH 2W5EA 5GCHF 3SI3H 4AFQA 4RI0A 1ID5H 3RXTA 2CJIA 1G3DA 1TPOA 2XNDD 3UUZA 1ZRBA 3MFJA 1ZSLA 5FX5A 2FI3E 2STBE 1Q3XA 3RXPA 5JBAS 4BTUB 3KYGA 2O9QA 1T8NA 4Y7AA 3O8BA 1C5NH 4OM9A 1TX7A 1O5AB 1VITF 1O3CA 2AEIH 3LGWA 1RRKA 4OGXA 3ATWA 2PFEA 1KY9A 2KZ4A 4MPXA 4NFEA 1ARBA 2A4GA 3OEED 3ZYEA 1IOEA 1C5YB 1GJ8B 2ZGXH 3LU9B 2YMSB 1O2TA 3CS0A 1QA7A 1GJ9B 2NWNA 1QNJA 1Y5AT 4MNXA 2UUFB 1T8MA 2Y7ZA 1P06A 1OX1A 3TJOA 3R0FA 4CH2B 1HNEE 3FP7E 2BM2A 2A4RA 3AAUA 3CS7A 1ZJKA 4CRBA 2OP9A 1KXFA 1YPGH 4HI3A 5TJXA 1Y8TA 1B5GH 3QLPH 1EQ9A 1C5XB 3BTHE 1MBQA 3QTOH 2Q6DA 1RTLA 3BTEE 1H4WA 3M5OA 1S84A 1G32B 1OP0A 1ELDE 1ZJDA 3N7EA 3V7TA 2SGAA 3NPSA 5C17A 3FVFB 3PTBA 1NRSH 1UVSH 2JKHA 2AFQB 1S0RA 1T31A 2VIVA 4CR5A 4NIYA 4INHA 1OHHD 1NU7B 2A32A 1TBQH 2Z94A 4DT7B 2QF0A 3D49H 5A0AE 1K28D 4INLA 1NTPA 2F3CE 2ZF0H 4MDSA 3MU4A 1UW7A 1JIMA 3T2NA 1RXPA 1NESE 1O35A 1LPZB 3MMGA 3LDXH 2VIWA 3ZVAA 1Q31A 1QBOA 1P03A 3ZYDA 4CBOA 2Z3CA 3LPRA 1HPGA 3T25A 1PPCE 2HLCA 2UUKB 3ZV9A 2O8WA 1SI5H 1IQMA 4AORA 1DOJA 3ZZBA 3KIDU 1P2IA 2JETC 1WU1A 1V2KT 4H6TA 3SYJA 3UTUH 1EZQA 3RXOA 3B23B 1W0KD 4Z0KA 3IWMA 1K1JA 4ISLA 2ANKH 4BTTB 2ZTYA 1YPLH 1BQYA 2ZDKA 3OTPA 3LC5A 5DKMA 1TONA 3SNCA 1CGIE 1UTPA 1LHCH 1ACBE 1TNLA 2A7JA 3VEQB 2BZAA 1FQ3A 4K69A 1RD3B 2VJ1A 4O9VA 1XUFA 1K9OE 1CT0E 3A7VA 2GX4A 4DT4A 2BD3A 2GZ8A 2R3UA 2Y80A 1MTWA 2QF5A 4JZDH 2WPKS 4MPUA 1MU6B 4Y6DA 1Y3WA 1YPMH 3UNRA 6GCHG 3UOPA 1FN8A 1FY1A 1Z8GA 2QXJA 1K21H 1BCUH 3RXCA 1V2TT 2PR3A 2YMSD 3MH7A 2BXTH 3L33A 4BNRA 1O39A 2VINA 3U69H 1O31A 2A5AA 5FX6A 1U6QA 3UWJH 1KXCA 1VGCC 4I8JA 5E2OA 5L30H 2A5KA 1GBDA 1P2KA 2K8IA 2ILNA 3MQKC 3MO9A 1ZZZA 2FOFA 4I86A 1BMAA 1QJ6B 3DSPA 1ELBA 4RKOB 2V6NA 3WW7A 4BAQB 1XUHA 3OE7D 1FN6A 1XMNB 3A85A 3KQEA 5H4IB 2VWOA 1DUAA 1NPMA 1SQOA 2OCVB 1J8AA 1OWIA 5DP8A 3EGKH 3BEIB 1XUJA 4I8KA 1EAXA 1HAGE 1TGTA 2FEQH 2THFB 4NCYA 2JH6D 3SU0A 1ANDA 1LHFH 1O2HA 2TPIZ 2XBWA 1AY6H 3GCHC 1C5OH 3FO8D 1BBRK 3URDA 2KCAA 1BBRE 1D9IA 4LK4A 2J5UA 2EEKA 2BDIA 1HAIH 1SPJA 1TQ7B 3F9EA 1VGCB 1OPHB 3F1SB 4H6SB 2BQWB 1BMFD 2ZFQH 3RXHA 1E34B 1V2UT 1T4VH 2C8WB 4FUGA 3M3TA 1O30A 3MO6A 3HATH 1P57B 1CHOG 2FPZA 9LPRA 3PLKA 1PPBH 2ZDMA 1SLXB 4UFGH 3Q3KA 1A5GH 1A4WH 1TAWA 2VBCA 1AVGH 2FOHA 1UO6A 1O2ZA 1A61H 3SN8A 5A8ZA 1LVBA 5DP3A 5E8EH 5L2ZH 5EXLA 5C1UA 1P2MA 2GVFA 4R0IA 2J34A 1JWTA 1MCVA 3SU2A 3GCHB 3RC4A 1ZMLA 1DSTA 1IQGA 4NA7A 4DIIH 2EI6A 2BMGB 1S85A 2VWNA 1GMHF 3RUOA 3FANA 3RXGA 1UMAH 2ZU2A 1MABB 1TMBH 1NY22 2WPLS 1UTNA 1EJMA 2EI7A 1V2WT 3QGJA 5F6MA 3TGIE 2ZPRA 1QBVH 1IQEA 3O8CA 4O3UA 1XM1A 2WPIS 3A86A 3SORA 1G3EA 2J92A 4ACAA 3BG8A 5HGGA 1DWDH 1LPGB 1QB6A 2OUAA 2Y6TA 2VU8E 4ZHLU 4MLFB 1EOJA 2GT7A 1B7XB 2Q6FA 5FCRA 1HFDA 1GBHA 3UWIA 2HPQH 3ZZ3A 1MTNC 1TPPA 4YOGA 1SMFE 2FP7B 3GY5A 5C0UA 2NU2E 1SGDE 2VIOA 1K0HA 3MH5A 3ZVEA 2Y81A 1QJ7B 1ELGA 2PSXA 3QX5H 3RXIA 2BOHB 1GL0E 3STJA 1W3CA 4AOQA 2ZFPH 1Z1IA 2TBSA 3TK6A 2F9PA 3UY9A 2Y5GA 1AZ8A 1J15A 5HKKD 4FUIA 1TOCB 2P3FH 2EQNA 1F92A 3E3TA 1O37A 2ALPA 4NG9H 2K1QA 4K60A 3SNAA 4BXSA 1A1RA 2FS8A 1P12E 4AG1A 1QR3E 1O2SA 2H2ZA 1P2NA 3RXKA 8GCHG 1XUGA 1RIWC 3K2UA 4AGKA 2WUCA 4IN2A 1IQJA 2RA3A 1YCPM 1W2KH 1VKYA 1GI3A 2J95A 1NFUA 3FZZA 1VR1H 1QHRB 4MQAA 3RM0H 1ZGIA 2AYWA 2XOKD 4ABDA 2BD5A 1EB2A 5CE1A 3K65B 1DXPA 1GHBG 1EZSC 1F7ZA 1QY6A 4Y0YE 1C5WB 2ZTXA 3PM3A 4CBNA 4I31A 1GHAF 3A88A 4GUXA 4Q80A 3ZZCA 5GNDA 1UVUH 4LZ4B 3V0XA 2NU4E 3SNBA 4D7GA 2W3IA 3KGPA 2A2QH 5LPEA 4IN1A 1AD8H 2B5TB 1C2LA 2W7UA 2NU3E 3GS9A 4FUFA 1RIWB 2ZU1A 3BIUH 3MH6A 5J4SA 4CRFA 3BTWE 3MHWU 1MCTA 2FI5E 4MTBA 3ESTA 4F48B 1ORFA 1E0FD 2A45B 1NBME 4MVNA 5DP6A 3F0PA 4ACBA 3H5CB 3LJOA 3A8CA 1O2MA 2ZGJA 1NBMD 1Z8RA 7GCHG 3RXQA 2VIQA 2Z3DA 1SGYE 1C1PA 1ZTLA 1CA8B 1JXPA 3LOXA 4A5TS 3CNRA 3U1JB 2CGAA 4GVUA 3RXAA 2GZ7A 1NFYA 1RS0A 1HLTH 1HXFH 3KQ5A 1V2QT 4X1RU 1EJAA 2HPPH 2M5TA 5EW2H 1XXDA 4IW4E 1D4PB 8KME2 3SU6A 1AU8A 2BLWA 1AB9C 1H9HE 4NWKA 3ZVCA 2PUXB 4NFFA 4B73A 2FYQA 2ZPSA 1GVZA 1SGCA 4H42U 4FU7A 2L6OA 3SHAH 1TFXA 1OP8A 1C1TA 1HGTH 1LHDH 1ZSJA 1W0JD 3A8AA 4YLQH 3ZZAA 2C3SA 1DVAH 1MUEB 5FPTA 3TIUA 5HYOA 1C2KA 2D2DA 2A0QB 1FMGA 1NT1A 2SGQE 3BTGE 4FXGH 5DJ7A 1LTOA 4U2WA 3BG4C 1O5FH 2GD4B 3A7ZA 3MOCA 4MG3A 5JYIA 3ZVDA 1O2NA 1TBRH 4HTCH 8GCHF 1LVMA 1O5GH 5A0BA 1V2VT 2FLRH 4NIXA 1O2RA 1YP9A 1DY9A 2G52A 4ZKSU 4NA9H 1ZSKA 3BSQA 4R8TB 4WMDA 1VCWA 1LO6A 5A09A 1O3DA 3SJOA 2JDID 1MAYA 4BOHA 1O32A 4JMYA 4ZKOU 1GHBF 1LCYA 1H8ED 2J9NA 3L3TA 1GBTA 1OWHA 2PP6A 2EY4C 1FIZA 1O2VA 3SUEA 1C1SA 3PRDA 3TK5A 4FOUC 1CHGA 2K0QA 3BEFB 5GCHG 3BG4B 2FODA 3PMJA 2ZHDA 1GJBB 2ZGHA 1SHHB 1T32A 1QURH 1GMDG 1GBKA 2RDEA 3AW0A 4GAWA 4OS2A 1YPHE 1VITG 2QN5T 3C1KA 1C1MA 1O3MA 4E7RG 3M5NA 1J14A 1GI6A 2CHAC 1V3XA 1NROH 2AGGX 2GT8A 3EQ0H 2QAAA 2PGQB 1XUKA 2VVCA 3MU1A 2ZDVH 1O2LA 1C5UA 3ELAH 4JCNA 3BIVH 3OY5U 3SJ9A 1GGDC 1RFNA 3KCGH 2Q1JA 3RU4T 1O5EH 1UK3A 5EQQA 1TA6A 3T27A 1XVOA 4X2WA 1GMCG 1EAWA 2D26C 4AFUA 1AWFH 3SNDA 1LHGH 2HVYB 1L4ZA 3UIRA 2R0LA 3U8RH 5EXMA 1SGNE 3UAIC 1NRPH 2SNWA 5CHBA 1B0FA 3V3MA 1OXGA 1C5QA 3P17H 2WV4A 1S5SA 2Y5HA 2AMDA 2ODYB 2QY0B 1KIGH 1A5HA 4P00A 3RMLH 5I46H 1P0SH 1H9IE 4WXIA 1MQ5A 1TB6H 1PPZA 4MNWA 1SOTA 4DG4A 3W95A 1V6DA 2WSSD 5JB9S 3E90B 3KNXA 1GI4A 1GGDB 3EAJA 2FZZA 1ANCA 2JJ2D 2FM2A 3S9BA 1FY3A 2ZCLP 3GY3A 2F83A 1E1RD 3DA9B 3NCLA 1WDIA 2ZG0H 4Q7YA 3E0NB 1SR5C 7ESTE 3ZVFA 1TX8A 1WQVH 1C5VA 1NRQH 5IK2D 1S0QA 2H5DA 5ABWA 1GBEA 2C8XB 1WAYB 1ESBA 1SFQB 2AMPA 2R3YA 1C2GA 3S0NA 2ZHEH 2KCOA 3K6YA 1D3QB 2OINA 4NSVA 1OSSA 4KKDA 1O3OA 1YM0A 3OAAD 4Q63A 3A7TA 3KF2A 3TH3H 1N8OB 1UK4A 2SFAA 4OGYA 1GWAA 4NZQA 1LVYA 2B9LA 2KCPA 1GBAA 1TPSA 4I8LA 5E0HA 4Y76A 1C5ZB 4CH8B 3W94A 4UFDH 2ANWA 4Y8YA 1WBGB 4Z6AH 1TRYA 3OTJE 5EXNA 1HAYB 1HB0B 2XYAA 1GJ7B 5C94A 4ZUHA 4NWLA 3A89A 1AN1E 3KQCA 1GVKB 4DURA 1DXWA 5AVDA 1GBBA 5DP7A 5A8XA 1QTFA 1AKSA 1GMDF 3V13A 1W12U 4ABFA 3TNSA 3SUGA 1OWEA 3GYLB 3MH4A 2BX4A 3QO6A 1ZPZA 4X6MA 1T8OA 3HK3B 2FOAA 5CHAC 3RXVA 3T29A 1P2OA 4X8UH 1F0RA 2A2XH 1LPKB 2ZFRH 1GDNA 4ISHH 4DVAU 1O3IA 1A3BH 4D8NA 1T8LA 4ZKRU 1S83A 2OTVA 2RA0A 4JK5A 4VGCC 3A84A 4Y8XA 1SGFG 2XXLA 2Y82A 5EJZA 2ZPQA 1TNKA 2LP6A 2CN0H 1IQNA 2BY8X 4GHTA 1GMCF 3ZZ7A 1O3NA 4A1TA 1FPCH 1TABE 1NC6A 1PYTC 3NRLA 4XD7D 1GPZA 5K0HA 1N6XA 2IPHA 1G30B 1F5LA 2XC4A 3SHCH 3UREA 3T62A 4WF8A 1BTPA 1HIAA 3B8JA 1BRAA 1BA8B 1AE5A 2F4LA 5C5OA 5C3NA 3FAOA 1TGNA 1A0JA 1THPB 5CHAB 2CV3A 3B9FH 1GCTC 2BY7X 2J38A 4YESB 1P05A 2CF9H 3BTKE 2ZCHP 5LPFA 3V12A 5DP5A 1SGQE 1EKBB 2H9HA 1C5MD 4F4OC 5FL7D 4FUDA 4VGCB 1HAOH 3F3BA 2QGRA 4ABJA 4DCDA 1TOMH 1IQFA 1QRWA 4B6EA 2HNTE 3GY4A 1YPJH 4UFEH 5HIZA 4BAOB 1AMHA 4DOQA 1O3JA 4KGAA 5TCAA 2ZZUH 2XCNA 4INKA 3TJUA 1C2DA 1P02A 4AFZA 4ZHMU 1XKAC 3Q77A 1ZRKA 3S9AA 1GHXH 3G01A 1C5SA 1DWBH 2QIQA 3GCOA 3MTYA 3ATKA 3ATIA 3GISB 5LH8A 2QC2A 1BTXA 2ZTZA 3JZ2B 2RFKC 1GCTB 4TT3D 1EXFA 1Z6EA 1QIXB 1SGIB 1GHYH 4UFFH 1KLTA 3A80A 2ANMH 1VCPA 2HWLB 3ATMA 3BF6H 2R9PA 3TK9A 1BB0B 2ZHFH 1EPTA 1GBJA 4K8YA 1P2JA 1GMHG 5F53A 1C4Y2 3SBKA 4ZXXH 4GCHF 1TQ0B 5DP4A 1F0UA 1MKXH 1CGHA 3C27B 1O33A 5K7RA 1L1GA 2DUCA 1YBWA 3PO1C 2OXSA 1LQEA 2VB0A 1AKSB 1AFQC 1UTKA 3BEUA 3PMBB 1SLWB 2KR7A 3H7TA 3PLBA 4ZXYH 2HALA 2DE8A 3WWFA 2Z9GA 3FKSD 2ZEBA 3K6ZA 3LH3A 1BOQA 4WH8A 4X1PU 1C5TA 4TWYA 1BMLA 5EQSA 1V2OT 1SC8U 1QBNA 1HCGA 5C5NA 2AH4X 2GCHF 3KHVA 1NFWA 1ANEA 3SU4A 2O8LA 2WZQA 2F91A 2Z9LA 3M7UA 3OYPA 4FUEA 5EODA 2VH0A 1G9IE 2G5NA 1CVWH 2FI4E 2VIDA 1P3CA 4CRGA 1ELAA 1EUFA 3PO1B 1BJUA 5IYTA 2FOBA 1OWJA 1AFQB 2ZWLH 2V3MA 3A87A 1GHVH 4B75A 5EPNA 2OQ5A 1C1OA 3O8RA 3H09A 4AFSA 3SV6A 2IOTA 4X8TH 1KXAA 1O2JA 3P95A 2BLOA 4WMEA 2A4QA 3D65E 1SGPE 2AGIX 4AC9A 1BJVA 1BMNH 1C1WH 1QCPA 1NFXA 5E0GA 1QL8A 3OSYA 4U30A 3KQDA 2XC0A 1DWCH 3RXDA 1EPTC 1P10A 3DT0H 2XBXA 1AWHB 1PYTD 4OS4A 2GGVB 1E38B 4B6FA 1UHBA 2ZNKH 4AZ2B 2Z3EA 1GHAG 3N7DA 2Z7FE 1GCDA 3NWUA 3MU5A 1KLIH 3MNSA 3KYFA 2NU0E 3A83A 1TGSZ 1W0ZU 4H4FA 3MYWA 4MNVA 2HNTF 5C1XA 3E1XB 1Z8JB 3LT3A 3LIWA 3U8TH 2TIOA 5BRRE 2LPRA 1UTQA 1XKBC 2ODPA 1FUJA 1DITH 3T28A 4B76A 1GI7B 3M5LA 3P8OA 4TSFD 1VCQA 1MKWK 4YT6H 3UQOA 4JZ1A 2W3KA 1EPTB 2G00A 3QZQA 1AE8H 1GI8B 1ZTKA 4DGJA 1O2UA 1MBMA 1CGJE 1SQAA 1GDQA 1P3EA 2QYIA 3QDZB 3RXUA 1PPGE 2QXHA 4YT7H 5JPMH 1JIRA 1QL9A 3SV9A 2F9OA 3TH4H 4Y7BA 6LPRA 3ZVGA 4WJG2 2IPQX 2Z9IA 5G4BA 1PPHE 1TLDA 1V2MT 2V0BA 2FX6A 1MTSA 4Q2KA 5T6FA 4O97A 2Z6BD 3M37A 4U32A 1MU8B 3KEEA 3VB5A 2ZO3H 1K1LA 3D62A 2OC1A 3OFND 2BVSH 5HIYA 4IS5A 1EZUC 2XWBI 1AFEH 3ENSB 1ZMJA 2W6JD 2QF3A 4I32A 1F0SA 2KCYA 1CQQA 1DFPA 1WQSA 2HRVA 3QTVH 1YY3A 5A8YA 1HAPH 5JBTA 1C1RA 4B2BA 1WCZA 3AW1A 9ESTA 3IG6B 3FZDA 4Q7XA 1WXRA 1WSSH 2VH6A 4JYTA 3KQBA 3SOSA 1LDTT 2B7DH 1G3BA 2SGEE 4NIVA 2BDAA 3ODFA 2IJD1 1D3DB 3PROA 4SGBE 3F9FA 1HDTH 1Y3YA 2QXIA 1TNJA 3GYMA 3MNBA 4TY7A 2P3UB 4RKJB 4GHQA 2PGBB 5L2YH 3NZIA 3SU1A 1ZHRA 1YPHC 2FLBH 3OX7U 1O3HA 4D7FA 1TPAE 1XXFA 1S82A 3AASA 2Z9JA 2Z9KA 3OY6U 1O3AA 1M9UA 1AUJA 1BRUP 4LZ1H 1Y5BT 4I7YH 5SGAE 1UHBB 1W7GH 4FU8A 3GY8A 1BT7A 3PYHA 3F2FA 1YPKH 1LKAA 2GCTB 3I77A 1KXBA 4F55A 2ZDAH 5FBEA 4M9FA 2AGEX 1F5RA 1DT2A 1J17T 3QK1A 4RN6A 5JB8S 2GTBA 1PFXC 1QRZA 3RXFA 4E06H 4E7NA 4Q4LA 4XDEA 2PUQH 1SGFA 1G3CA 2J94A 4XE4A 2P8OC 3SJ8A 5JBBS 4JZEH 2F9UA 1SKYE 1TE0A 4ISOA 3DSGA 4B2AA 4CREA 5FHTA 2WINI 1WYKA 3EA9A 5EU8A 4J2YB 2J98A 2WPDD 1SSXA 1DWEH 1V2RT 3LGVA 1T7CA 2P59A 5FCKA 2B0FA 5ETXA 1DPOA 4F49A 4CHAC 2G55A 4UEHH 3U1IB 1UVOA 2BY6X 4XBDA 1FI8A 3ODDA 1ELCA 1H1BA 4LXBH 2QE7D 1FZZA 3SGAE 3QGNB 1K1OA 1SQRA 2P8OB 2W26A 4GSOA 2BD4A 1FXYA 1TALA 1GJCB 4ASUD 1QGFA 3M7QA 5F8ZA 1TNHA 2BD8A 3A7WA 3NKKA 1HYLA 1C4U2 1GJAB 1H8HD 2ZGBH 4A1XA 1AVWA 2VGCB 2D8WA 5L6NH 1YLCA 1YWUA 1A3EH 2BLVA 1O2PA 3P92A 1L1NA 2L74A 1LMWB 4UDWH 5AFZH 2FOMB 1DM4B 2UWLA 2XBYA 3S7HB 4LOYH 4CHAB 3TNTA 2XNIA 2PV9B 5EGMA 1C1NA 2G51A 5T6DA 1SLVB 3JZ1B 1BZXE 1HV7A 1HAZB 2PKSC 3PV5A 2I6QA 1C2HA 3N99A 3TGJE 3DFLA 5LGOA 1IQLA 1BTZA 3Q00A 2OC0A 1IQHA 2YNBA 5EQRA 4YO9A 3GICB 4BXWA 3M35A 1IQKA 1UCYH 1LVOA 4K1TA 2STAE 4KTUA 3LGUA 5E2PA 3RM2H 3RMMH 2AERH 3MO3A 3KL6A 3P8FA 4I8GA 3BTDE 1C2FA 3SUDA 1IHSH 1JOUB 2TGTA 1GBIA 1PJPA 2AS9A 1LQDB 1C1UH 3VXEH 5AF9H 2UWPA 3S69A 2XTTB 2Y7XA 4GPGA 3VB7A 1DSUA 2PKSB 2RDLA 4YZUA 1ETSH 3ZZ9A 2XCFA 4K3JA 4U01A 2AHME 1SQTA 1HRTH 2UUJB 1FY8E 2XWAA 5FXLA 1S6LA 1O3KA 1HBTH 2G4TA 1HJ9A 2EI8A 1W0YH 5T3HA 3W1EA 1EZXC 2SGPE 4TPYA 2DE9A 2FDAA 1TMTH 2J97A 2BY5X 3ZZ6A 2V3OH 3HK6B 1OWKA 3VFEA 1Y3VA 2HNTC 3Q3XA 2FYRA 1YGCH 2A31A 4Z1MD 5I25A 1SGTA 2R2MB 4X6PA 1YPEH 2R2WU 2ZC9H 4WVPE 1FY5A 3E91A 1N8OC 2JH5D 3SZNA 3T26A 2BY9X 4M7GA 4NIWA 1FAXA 1A7SA 4D9QA 2F9BH 1V2ST 5J4QA 3GDSA 1Y3XA 2CXVA 3T5FH 5EJ1A 1O3PB 1O2QA 1P01A 4JZFH 1UVPA 1G2LA 1OYTH 1EOLA 1GVLA 4X6OA 1YCPK 3SU5A 4YLUA 3BTQE 4Y10E 1D6RA 3L6PA 3PWCA 3CENA 1QL7A 3HKIB 5E0JA 2FOGA 1P11E 2GMTB 4BTIB 2JH0D 1MAXA 1MH0A 3LH1A 1KTSB 5FPSA 2QA9E 3FN8A 4AB9A 1ZMNA 4AB8A 2LELA 2ZECA 4X6NA 1DLKB 5EJLA 2PHBA 2P3TB 2OLGA 1RTKA 1W10U 2TRMA 1MZDA 1BTHH 3RXRA 3VG8A 3DD2H 5GPIB 1G36A 5JBCS 2PKAA 2VVVA 4K1EA 4DW2U 2D1JA 2BDYA 3R3GB 3RXJA 3DHKH 1H8DH 1A46H 5HM2A 2BB4A 4HFPB 3E16B 3PB1E 3TVJB 3U9AH 5FBIA 4GCHG 1TNGA 2F9VA 4Y0ZE 1JRTA 3URCA 5B6OA 1SB1H 5A0CA 1BTYA 3I78A 2QXGA 1C2EA 1AO5A 3RC6A 4NZLA 3EA7A 5C20A 1CSOE 2P94A 1P09A 2FTLE 2H1UA 3FP6E 4TPIZ 2OK5A 2FTMA 1G2MA 2QCYA 1ELTA 3RU4E 1P04A 3M3VA 1AQ7A 4NGAH 2UWOA 3F6UH 1KDQA 1QJ1B 2GCHG 3GDUA 4YOJA 1SOZA 1ZHMA 2ASUB 1HJ8A 2BD2A 4ABHA 1GI5A 2EC9H 1KSNA 1C1QA 1K22H 3RU4D 3SNEA 3H7OA 1ZLRA 1HAHH 1NO9H 1L0ZA 1FPHH 1VZQH 3FP8E 2P93A 1THRH 1TYNA 4SGAE 1QRXA 1D6WA 1UTMA 1W8BH 4B1TA 3PV4A 4DJZB 2XRCA 3DCLA 3BTTE 1BIOA 2NU1E 1SFIA 1NZQH 3TLOA 4Y79A 1C2IA 2BVRH 4I33A 2KFWA 3ATLA 1Z7KA 1MQ6A 2W6ID 4JYVH 2H5CA 1EASA 1E35B 2GV7A 2C93B 4HGCA 3WWBA 1PPEE 4ZH8A 5DSFA 8LPRA 1O2WA 3TJVA 1GI9B 1OS8A 2A1DB 2BDGA 3PMHB 5F03A 5CDFE 3A7XA 1BMMH 2J2UA 5C2ZA 3HGNA 5A2MH 1BBRH 3SZEA 1V2JT 2PTNA 1OYQA 1ETTH 1O2IA 3EE7A 1O34A 2GP9B 1E37B 1NN6A 1O0DH 1P9UA 1O38A 2HGTH 4Y8ZA 2IN2A 3RXEA 1S6FA 3EA8A 6CHAC 4KELA 3PWBA 5KECA 2PSYA 1Y3UA 2ALVA 3F9GA 4IC5A 4O03A 4OS1A 2H9TH 4K8BA 1KLJH 1XVMA 3OU0A 1GJ6A 1E36B 3ZZ5A 3PRBA 1MMJN 2PKAB 2A5IA 4P02A 2FIRH 1GJDB 4JYUH 4B2CA 1S6HA 1GG6C 4MPWA 2JIZD 2KAIA 1THSH 1WTGH 2V7QD 4CRCA 3TJNA 2EA3A 5DO4H 1K1PA 1MKWH 3N7OA 3UR6A 4A1VA 3RXSA 1E1QD 1K2I1 1CT2E 2ZHQH 1PPFE 2ZU4A 1J16A 1C4V2 1L1JA 1QFKH 1ESTA 3K9XB 3ITIA 4KTCA 3SO3A 4TY6A 3LKWA 2JJ1D 6CHAB 2RCEA 1ZYOA 1GBMA 1ZOMA 4UONA 1EFRD 1QB9A 2XC5A 1ANBA 2ZQ2A 3AK5A 3P8NA 1GBFA 1ZPCA 4FUJA 1Z71A 3TPIZ 4AGJA 1L2EA 1DDJA 1P9SA 1KDQB 1B0EA 1YLDA 1AZZA 1C2JA 5DP9A 4X8VH 1ZPBA 3EE0B 2TGDA 4X1NU 4OS7A 2ZU3A 1C5LH 1QZ8A 1GG6B 2SNVA 3A8DA 2TGPZ 1MD8A 4ZMAH 4HZHA 3VB6A 1INCA 2BXUH 1O3BA 1EB1H 1O2KA 2WPHS 3ZV8A 1GDUA 2BQ7B 4JK6A 1COWD 1S81A 3M5MA 1HXEH 2JETB 1ZGVA 2GDDA 4X8SH 5ESBA 1HIAB 2BDBA 2ZIQH 2Y5FA 1TNIA 2XBVA 4ZCNA 2P95A 3U28C 3DFJA 1UTOA 5ESTE 4ABAA 1UK2A 1W13U 4ABBA 2WPJS 3A81A 1O2OA 1DX5M 4GLYA 3BTME 2A7CA 2ZI2H 2YNAA 3HKJB 1GI0A 3QN7A 4J1YA 2ZGCA 1O2YA 3BV9B 2KX4A 4B71A 1C9PA 2BYAX 1ESAA 4YOIA 1SL3A 1SGRE 2G4UA 2H9EH 2F43B 2GDEH 1BUIA 2PTCE 1K1MA 4A7IB 1OWDA 2C4FH 2ZFFH 1SBWA 3NXPA 1CBWC 1LHEH 1BHXF 3F9HA 3M61U 1F0TA 1OP2A 3OEHD 1DANH 1KMHB 1KYNA 5F8XA 3SGQE 2FOCA 4OS5A 3TH2H 3LGYA 1DLEA 1BTUA 1YC0A 3S7KB 1Q2WA 2CK3D 1QA0A 2OBQA 4A6LA 5B6LA 3M36A 3GCTG 2BOKA 3CP7A 1AUTC 7LPRA 1Z1JA 3QZRA 3QWCH 3SQHE 1O2XA 3SGBE 1O3LA 1AIXH 2ZP0H 1PQ7A 5HMAA 5DGJA 4RT0A 5FPYA 3RMOH 2KAIB 2OD3B 5KEDA 2ULLA 1GL1A 1MKXK 4Y71A 4YTAA 1CBWB 3UB0A 1EATA 2VNTA 2SGFE 2CF8H 3ZZ4A 1FY4A 1A0HB 1H9LB 3VB3A 1JBUH 2J4IA 2VIPA 4K2YA 3RLWH 5HXFA 5AFYH 4AX9H 2FESH 1D3PB 1DICA 3SJKA 3MNXA 3QUMP 3SJIA 1G37A 1IHTH 5GWZA 2FXRA 3BTFE 4HG6A 4Q7ZA 4X0WU 4FVBA 1O5BB 5JDUB 1IAUA 2HOBA 1FDPA 1V2NT 4X2YA 1JMOH 4FU9A 4AG2A 4FUHA 2BQ6B 1SLUB 2BHGA 3AVZA 1D3TB 3RXLA 6GCHF 1XX9A 4XBBA 3SV8A 1F2SE 3UFAA 5GJ4B 1N6YA 3SW2B 3UOUA 3KN2A 4KP0A 5C67A 1L4DA 3ZZ8A 2GJGA 1V2LT 1FAKH 1O3GA 2C8ZB 2GCTC 5PTPA 4RT1A 1C9TA 1AGJA 3LJJA 4XSKU 3DUXH 3DSOA 2HVXA 3VXFH 4ESTE 1ETRH 1TA2A 1YYY1 1F5KU 2G81E 3STIA 1GBLA 1QQ4A 1UJ1A 1K1NA 4ABIA 5EW1H 2WHXA 3RMNH 1TX6A 1T4UH 1MD7A 3EYDA 4B74A 2ZCKP 3VGCC 2ZFTA 4DIHH 3TGKE 3UQVA 4AN7A 5HM9A 2OBOA 1ABJH 1JRSA 1P2QA 1QB1A 1GI1A 1HJAC 5DN6D 6ESTA 2PW8H 1K1IA 3EDXB 2FMJA 4CRAA 4K1SA 2YOLA 2HLDD 1TGBA 1MTNB 2G5VA 1O2GH 3PLPA 1N1LA 4AYVB 1UTLM 1CT4E 1AVXA 2RG3A 1VITH 3LGIA 1HAVA 2ZKSA 3P70B 2ESTE 1C2MA 1UTJA 1NM6A 2WYGA 1CHOF 3GCTF 3MWIU 3VGCB 3SQEE 7KMEH 2R0KA 5C0TA 2P16A 1PQ8A 4ABEA 1P8VC 1ABIH 2UUYA 4I8HA 3P8GA 2QF4A 1Z6JH 1ZHPA 4K5ZA 1GJ4H 1HJAB 1EAUA 1RTFB 4BAHB 4D76A 4O3TA 3F2GA 2ZQ1A 2VGCC 3A7YA 3F2HA 2V35A 3LONA 4FVDA 3RXBA 1FJSA 3MU8A 1RJXB 3VPKA 2O8TA 1LKBA 3RC5A 4YM9A 1ZTJA 1BRBE 1V2PT 4NA8A 1YF4A 1MTUA 2VVUA 3GOVB 4RSPA 1MTVA 4IMZA 4IGDA 3WY8A 2A4OA 1ELEE 2VWMA 1NRRH 2GKVE 4YXWD 5EOKA 1ELFA 2WYJA 1C1VH 4CR9A 4ASHA 3I29A 1O5CB 1VJ9U 5KGOA 4ABGA 3HGPA 1IQIA 1DY8A 5T1VA 4ISNA 3ZIAD 4A92A 4WMFA 4X1SU 4XRNA 4WWYA 3SUFA 3Q76A 5FAHA 1SG8B 2IJOB 1SGEE 4PROA 1XUIA 2ZU5A 3E0PB 2OC7A 4JZIA 3TU7H 2H6MA 3IITA 1GBCA 5F8TA 2BX3A 2W7SA 4IC6A 1C5PA 2FWWA 1OOKB 4FUCA 1DUEA 1WV7H 4UD9H 3RLYH 3PMAB 1RGQA 4E05H 2BVXH 4KTSA 4MPVA 1YCPH 2BD7A 1YKTA 1O3FA 4CRDA 3ZZDA 1E79D 3GY2A 1WOFA 2SGDE 1Y59T 2FX4A 5IDKA 1GI2A 2BLQA 5AHGH 1FX0B 4BAKB 2WV5A 3AAVA 1J9CH 3MI4A 2GV6A 4X2XA 5T6GA 2XW9A 1NS3A 2WPMS 1CU1A 3E6PH 1AB9B 3RDZA 1OKXA 1CE5A 1FLEE 2O8UA 1PQ5A 4BANB 4ISIH 2PWXA 1O5DH 1A2CH 2QV1A 2AIQA 3F0OA 3LC3A 1AI8H 4OS6A 4IMQA 1ELVA 1Y5UT 3LGTA 4ZKNU 3MU0A 2WV9A 1W14U 4ZHAA 1GHWH 3O8DA 2ZA5A 1HAVB 3PTNA 2O8MA 4TYDA 1SHYA 4Y11E 2PLXA 3E8LA 2BDCA 4DY7B 1FONA 2VWLA 1FV9A 3VB4A 4XOJA 2V3HH 8ESTE 4BAMB 1FIWA 1GJ5H 5DG6A 3HPTB 2BD9A 2OQUA 1X7AC 2Q6GA 1A0LA
chains in the Genus database with same CATH topology
1BTWA 3RXMA 1H8IH 2ODQA 4XFQA 5DK1A 2WUBA 1C5RA 4IBLH 1TBZH 4TWWA 1TIOA 5EG4A 3M3SA 2ANYA 4QT8C 7GCHF 2ZDNA 3TITA 2ZDLA 2GMTC 2LNCA 1BITA 2I6SA 1WTHD 2ZHWH 1KTTB 1HUTH 3A82A 3A8BA 2GZ9A 1TRNA 4XBCA 1DS2E 2A7HA 1TGCA 4WY3A 5GDSH 4ZROA 2C8YB 2C90B 3F68H 1KXEA 3UNSA 2F9NA 1CA0C 4UE7H 5EPYA 1BDAA 3GCNA 1BRCE 1KXDA 1SVPA 3GDVA 1NRNH 1FNIA 3RP2A 5GIBA 2AMQA 1X7AC 1EJNA 1BHXB 3UNQA 5GXPA 1TWXB 1VJAU 3U98H 2CHAB 1DE7H 2FOEA 1NU9A 5BPEA 1EP5A 1A5IA 1TRMA 2FS9A 4MNYA 3MNCA 3SU3A 1GHZA 3SV2H 1CO7E 1TMUH 3Q3YA 1O3EA 2AIPA 3BN9A 3U8OH 2OC8A 4THNH 2B8OH 4NSYA 5C1YA 1EP6A 1HAXB 2TGAA 3ZVBA 4X2VA 3NK8A 1ARCA 5LPRA 2ZFSA 4FUBA 1CA0B 2BTCE 1W11U 3GY7A 4X1QU 3P6ZB 1EX3A 5DPAA 1EAIA 3UR9A 1MZAA 4WH6A 1Z8IB 3UPEA 4AYYB 1O36A 2BDHA 3GY6A 1UCYK 1AHTH 3M7TA 1UCYE 2FO9A 3SV7A 3S9CA 4D9RA 5TCCA 1WUNH 3NUMA 3SI4H 2G8TA 3D23A 1PQAA 1ZR0A 3FFGA 1UVTH 2BZ6H 4ZAEA 5CMXH 1QQUA 4WXVA 2CMYA 1W7XH 2W5EA 5GCHF 3SI3H 4AFQA 1ID5H 3RXTA 2CJIA 1G3DA 1TPOA 3UUZA 1ZRBA 3MFJA 1ZSLA 5FX5A 2FI3E 2STBE 1Q3XA 3RXPA 5JBAS 4BTUB 2O9QA 1T8NA 4Y7AA 3O8BA 1C5NH 1TX7A 1O5AB 1VITF 1O3CA 2AEIH 3LGWA 1RRKA 4OGXA 3ATWA 2PFEA 1KY9A 4MPXA 4NFEA 1ARBA 2A4GA 3ZYEA 1IOEA 1C5YB 1GJ8B 2ZGXH 3LU9B 1O2TA 3CS0A 1QA7A 1GJ9B 2NWNA 1QNJA 1Y5AT 4MNXA 2UUFB 1T8MA 2Y7ZA 1P06A 1OX1A 3TJOA 3R0FA 4CH2B 1HNEE 3FP7E 2BM2A 2A4RA 3AAUA 3CS7A 1ZJKA 4CRBA 2OP9A 1KXFA 1YPGH 4HI3A 5TJXA 1Y8TA 1B5GH 3QLPH 1EQ9A 1C5XB 3BTHE 1MBQA 3QTOH 2Q6DA 1RTLA 3BTEE 1H4WA 3M5OA 1S84A 1G32B 1OP0A 1ELDE 1ZJDA 3V7TA 2SGAA 3NPSA 3FVFB 3PTBA 1NRSH 1UVSH 2JKHA 2AFQB 1S0RA 1T31A 2VIVA 4CR5A 4NIYA 4INHA 1NU7B 2A32A 1TBQH 2Z94A 4DT7B 2QF0A 3D49H 5A0AE 1K28D 4INLA 1NTPA 2F3CE 2ZF0H 4MDSA 3MU4A 1JIMA 3T2NA 1RXPA 1NESE 1O35A 1LPZB 3MMGA 3LDXH 2VIWA 3ZVAA 1Q31A 1QBOA 1P03A 3ZYDA 4CBOA 2Z3CA 3LPRA 1HPGA 3T25A 1PPCE 2HLCA 2UUKB 3ZV9A 2O8WA 1SI5H 1IQMA 4AORA 1DOJA 3ZZBA 3KIDU 1P2IA 2JETC 1WU1A 1V2KT 4H6TA 3UTUH 1EZQA 3RXOA 3B23B 4Z0KA 3IWMA 1K1JA 4ISLA 2ANKH 4BTTB 2ZTYA 1YPLH 1BQYA 2ZDKA 3LC5A 5DKMA 1TONA 3SNCA 1CGIE 1UTPA 1LHCH 1ACBE 1TNLA 2A7JA 3VEQB 2BZAA 1FQ3A 4K69A 1RD3B 2VJ1A 4O9VA 1XUFA 1K9OE 1CT0E 3A7VA 2GX4A 2BD3A 2GZ8A 2R3UA 2Y80A 1MTWA 4JZDH 2WPKS 4MPUA 1MU6B 4Y6DA 1Y3WA 1YPMH 3UNRA 6GCHG 3UOPA 1FN8A 1FY1A 1Z8GA 2QXJA 1K21H 1BCUH 3RXCA 1V2TT 2PR3A 3MH7A 2BXTH 3L33A 4BNRA 1O39A 2VINA 3U69H 1O31A 2A5AA 5FX6A 1U6QA 3UWJH 1KXCA 1VGCC 4I8JA 5E2OA 5L30H 2A5KA 1GBDA 1P2KA 2ILNA 3MO9A 1ZZZA 2FOFA 1BMAA 1QJ6B 1ELBA 4RKOB 2V6NA 4BAQB 1XUHA 1FN6A 1XMNB 3A85A 3KQEA 5H4IB 2VWOA 1DUAA 1NPMA 1SQOA 2OCVB 1J8AA 1OWIA 5DP8A 3EGKH 3BEIB 1XUJA 4I8KA 1EAXA 1HAGE 1TGTA 2FEQH 2THFB 4NCYA 2JH6D 3SU0A 1ANDA 1LHFH 1O2HA 2TPIZ 2XBWA 1AY6H 3GCHC 1C5OH 1BBRK 3URDA 1BBRE 1D9IA 4LK4A 2EEKA 2BDIA 1HAIH 1SPJA 1TQ7B 3F9EA 1VGCB 1OPHB 3F1SB 4H6SB 2BQWB 2ZFQH 3RXHA 1E34B 1V2UT 1T4VH 2C8WB 4FUGA 3M3TA 1O30A 3MO6A 3HATH 1P57B 1CHOG 2FPZA 9LPRA 3PLKA 1PPBH 2ZDMA 1SLXB 4UFGH 3Q3KA 1A5GH 1A4WH 1TAWA 1AVGH 2FOHA 1UO6A 1O2ZA 1A61H 3SN8A 5A8ZA 1LVBA 5DP3A 5E8EH 5L2ZH 5EXLA 5C1UA 1P2MA 2GVFA 4R0IA 2J34A 1JWTA 1MCVA 3SU2A 3GCHB 3RC4A 1ZMLA 1DSTA 1IQGA 4NA7A 4DIIH 2EI6A 2BMGB 1S85A 2VWNA 1GMHF 3RUOA 3FANA 3RXGA 1UMAH 2ZU2A 1TMBH 1NY22 2WPLS 1UTNA 1EJMA 2EI7A 1V2WT 3QGJA 5F6MA 3TGIE 2ZPRA 1QBVH 1IQEA 3O8CA 4O3UA 1XM1A 2WPIS 3A86A 3SORA 1G3EA 2J92A 3BG8A 5HGGA 1DWDH 1LPGB 1QB6A 2OUAA 2Y6TA 2VU8E 4ZHLU 4MLFB 1EOJA 2GT7A 1B7XB 2Q6FA 5FCRA 1HFDA 1GBHA 3UWIA 2HPQH 3ZZ3A 1MTNC 1TPPA 4YOGA 1SMFE 2FP7B 3GY5A 2NU2E 1SGDE 2VIOA 3MH5A 3ZVEA 2Y81A 1QJ7B 1ELGA 2PSXA 3QX5H 3RXIA 2BOHB 1GL0E 3STJA 1W3CA 4AOQA 2ZFPH 1Z1IA 2TBSA 3TK6A 2F9PA 3UY9A 2Y5GA 1AZ8A 1J15A 4FUIA 1TOCB 2P3FH 1F92A 3E3TA 1O37A 2ALPA 4NG9H 2K1QA 4K60A 3SNAA 4BXSA 1A1RA 2FS8A 1P12E 4AG1A 1QR3E 1O2SA 2H2ZA 1P2NA 3RXKA 8GCHG 1XUGA 1RIWC 3K2UA 4AGKA 2WUCA 4IN2A 1IQJA 2RA3A 1YCPM 1W2KH 1GI3A 2J95A 1NFUA 3FZZA 1VR1H 1QHRB 4MQAA 3RM0H 1ZGIA 2AYWA 4ABDA 2BD5A 1EB2A 5CE1A 3K65B 1DXPA 1GHBG 1EZSC 1F7ZA 1QY6A 4Y0YE 1C5WB 2ZTXA 3PM3A 4CBNA 4I31A 1GHAF 3A88A 4GUXA 4Q80A 3ZZCA 1UVUH 4LZ4B 3V0XA 2NU4E 3SNBA 4D7GA 2W3IA 3KGPA 2A2QH 5LPEA 4IN1A 1AD8H 2B5TB 1C2LA 2W7UA 2NU3E 4FUFA 1RIWB 2ZU1A 3BIUH 3MH6A 5J4SA 4CRFA 3BTWE 3MHWU 1MCTA 2FI5E 4MTBA 3ESTA 1ORFA 1E0FD 2A45B 4MVNA 5DP6A 3H5CB 3LJOA 3A8CA 1O2MA 2ZGJA 1Z8RA 7GCHG 3RXQA 2VIQA 2Z3DA 1SGYE 1C1PA 1ZTLA 1CA8B 1JXPA 3LOXA 4A5TS 3U1JB 2CGAA 4GVUA 3RXAA 2GZ7A 1NFYA 1RS0A 1HLTH 1HXFH 1V2QT 4X1RU 1EJAA 2HPPH 2M5TA 5EW2H 1XXDA 4IW4E 1D4PB 8KME2 3SU6A 1AU8A 2BLWA 1AB9C 1H9HE 4NWKA 3ZVCA 2PUXB 4NFFA 4B73A 2FYQA 2ZPSA 1GVZA 1SGCA 4H42U 4FU7A 3SHAH 1TFXA 1OP8A 1C1TA 1HGTH 1LHDH 1ZSJA 4YLQH 3A8AA 3ZZAA 2C3SA 1DVAH 1MUEB 5FPTA 3TIUA 5HYOA 1C2KA 2D2DA 2A0QB 1FMGA 1NT1A 2SGQE 3BTGE 4FXGH 5DJ7A 1LTOA 4U2WA 3BG4C 1O5FH 2GD4B 3A7ZA 3MOCA 4MG3A 5JYIA 3ZVDA 1O2NA 1TBRH 4HTCH 8GCHF 1LVMA 1O5GH 5A0BA 1V2VT 2FLRH 4NIXA 1O2RA 1YP9A 1DY9A 2G52A 4ZKSU 4NA9H 1ZSKA 3BSQA 4R8TB 4WMDA 1VCWA 1LO6A 5A09A 1O3DA 3SJOA 1MAYA 4BOHA 1O32A 4JMYA 4ZKOU 1GHBF 1LCYA 2J9NA 3L3TA 1GBTA 1OWHA 1FIZA 1O2VA 3SUEA 1C1SA 3TK5A 1CHGA 3BEFB 5GCHG 3BG4B 2FODA 3PMJA 2ZHDA 1GJBB 2ZGHA 1SHHB 1T32A 1QURH 1GMDG 1GBKA 3AW0A 4GAWA 4OS2A 1YPHE 1VITG 2QN5T 3C1KA 1C1MA 1O3MA 4E7RG 3M5NA 1J14A 1GI6A 2CHAC 1V3XA 1NROH 2AGGX 2GT8A 3EQ0H 2QAAA 2PGQB 1XUKA 2VVCA 3MU1A 2ZDVH 1O2LA 1C5UA 3ELAH 4JCNA 3BIVH 3OY5U 3SJ9A 1GGDC 1RFNA 3KCGH 2Q1JA 3RU4T 1O5EH 1UK3A 5EQQA 1TA6A 3T27A 1XVOA 4X2WA 1GMCG 1EAWA 2D26C 4AFUA 1AWFH 3SNDA 1LHGH 1L4ZA 3UIRA 2R0LA 3U8RH 5EXMA 1SGNE 1NRPH 2SNWA 1B0FA 3V3MA 1OXGA 1C5QA 3P17H 2WV4A 1S5SA 2Y5HA 2AMDA 2ODYB 2QY0B 1KIGH 1A5HA 3RMLH 5I46H 1P0SH 1H9IE 4WXIA 1MQ5A 1TB6H 1PPZA 4MNWA 1SOTA 4DG4A 3W95A 1V6DA 5JB9S 3E90B 3KNXA 1GI4A 1GGDB 3EAJA 2FZZA 1ANCA 2FM2A 3S9BA 1FY3A 2ZCLP 3GY3A 2F83A 3NCLA 3DA9B 2ZG0H 4Q7YA 3E0NB 1SR5C 7ESTE 3ZVFA 1TX8A 1WQVH 1C5VA 1NRQH 1S0QA 2H5DA 5ABWA 1GBEA 2C8XB 1WAYB 1ESBA 1SFQB 2AMPA 2R3YA 1C2GA 3S0NA 2ZHEH 3K6YA 1D3QB 2OINA 4NSVA 1OSSA 4KKDA 1O3OA 1YM0A 3A7TA 3KF2A 3TH3H 1N8OB 1UK4A 2SFAA 4OGYA 1GWAA 4NZQA 1LVYA 2B9LA 1GBAA 1TPSA 4I8LA 5E0HA 4Y76A 1C5ZB 4CH8B 3W94A 4UFDH 2ANWA 4Y8YA 1WBGB 4Z6AH 1TRYA 3OTJE 5EXNA 1HAYB 1HB0B 2XYAA 1GJ7B 4ZUHA 4NWLA 3A89A 1AN1E 3KQCA 1GVKB 4DURA 1DXWA 5AVDA 1GBBA 5DP7A 5A8XA 1QTFA 1AKSA 1GMDF 3V13A 1W12U 4ABFA 3TNSA 3SUGA 1OWEA 3GYLB 3MH4A 2BX4A 3QO6A 1ZPZA 4X6MA 1T8OA 3HK3B 2FOAA 5CHAC 3RXVA 3T29A 1P2OA 4X8UH 1F0RA 2A2XH 1LPKB 2ZFRH 1GDNA 4ISHH 4DVAU 1O3IA 1A3BH 4D8NA 1T8LA 4ZKRU 1S83A 2OTVA 2RA0A 4JK5A 4VGCC 3A84A 4Y8XA 1SGFG 2XXLA 2Y82A 2ZPQA 1TNKA 2CN0H 1IQNA 2BY8X 4GHTA 1GMCF 3ZZ7A 1O3NA 4A1TA 1FPCH 1TABE 1NC6A 1PYTC 5K0HA 1GPZA 1N6XA 2IPHA 1G30B 1F5LA 2XC4A 3SHCH 3UREA 3T62A 4WF8A 1BTPA 1HIAA 3B8JA 1BRAA 1BA8B 1AE5A 5C5OA 5C3NA 3FAOA 1TGNA 1A0JA 1THPB 5CHAB 2CV3A 3B9FH 1GCTC 2BY7X 2J38A 4YESB 1P05A 2CF9H 3BTKE 2ZCHP 5LPFA 3V12A 5DP5A 1SGQE 1EKBB 2H9HA 1C5MD 4F4OC 4FUDA 4VGCB 1HAOH 2QGRA 4ABJA 4DCDA 1TOMH 1IQFA 1QRWA 2HNTE 3GY4A 1YPJH 4UFEH 4BAOB 1AMHA 4DOQA 1O3JA 4KGAA 5TCAA 2ZZUH 2XCNA 4INKA 3TJUA 1C2DA 1P02A 4AFZA 4ZHMU 1XKAC 3Q77A 1ZRKA 3S9AA 1GHXH 3G01A 1C5SA 1DWBH 2QIQA 3GCOA 3MTYA 3ATKA 3ATIA 3GISB 5LH8A 2QC2A 1BTXA 2ZTZA 3JZ2B 1GCTB 1EXFA 1Z6EA 1QIXB 1SGIB 1GHYH 4UFFH 1KLTA 3A80A 2ANMH 1VCPA 2HWLB 3ATMA 3BF6H 2R9PA 3TK9A 1BB0B 2ZHFH 1EPTA 1GBJA 4K8YA 1P2JA 1GMHG 1C4Y2 3SBKA 4ZXXH 4GCHF 1TQ0B 5DP4A 1F0UA 1MKXH 1CGHA 3C27B 1O33A 5K7RA 1L1GA 2DUCA 1YBWA 3PO1C 2OXSA 1LQEA 2VB0A 1AKSB 1AFQC 1UTKA 3BEUA 3PMBB 1SLWB 3H7TA 3PLBA 4ZXYH 2HALA 2DE8A 2Z9GA 2ZEBA 3K6ZA 3LH3A 1BOQA 4WH8A 4X1PU 1C5TA 4TWYA 1BMLA 5EQSA 1V2OT 1SC8U 1QBNA 1HCGA 5C5NA 2AH4X 2GCHF 3KHVA 1NFWA 1ANEA 3SU4A 2O8LA 2F91A 2Z9LA 3M7UA 3OYPA 4FUEA 5EODA 2VH0A 1G9IE 2G5NA 1CVWH 2FI4E 2VIDA 1P3CA 4CRGA 1ELAA 1EUFA 3PO1B 1BJUA 5IYTA 2FOBA 1OWJA 1AFQB 2ZWLH 3A87A 1GHVH 4B75A 5EPNA 2OQ5A 1C1OA 3O8RA 4AFSA 3SV6A 2IOTA 4X8TH