1GBDA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by ala complex with methoxysuccinyl-ala-ala-pro-phenylalanine boronic acid
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGANVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
molecule keywords ALPHA-LYTIC PROTEASE
molecule tags Hydrolase/hydrolase inhibitor
source organism Lysobacter enzymogenes
total genus 52
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbdA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbdA01
1DFPA 2ZFFH 3TJVA 3M5LA 4KKDA 1CBWC 3BIVH 1O3MA 2ZDAH 2A2XH 4AOQA 1MU8B 3U9AH 1AHTH 2R3UA 2FYQA 1LQEA 3ZVCA 1MQ6A 1Y8TA 2XNIA 1UTMA 1EJNA 3EAJA 4MNXA 1VZQH 4GSOA 5GIBA 4FVBA 3V12A 4U30A 1A61H 1A5GH 4ZMAH 2XC5A 3ZVGA 1ZLRA 3EA8A 1L4DA 2XBVA 2V3OH 4B74A 3QK1A 3RUOA 4GLYA 1TNLA 2VWNA 3M7TA 1H9IE 1QRXA 1GHWH 1HAZB 4I32A 4D76A 1NESE 3U8TH 1UTPA 1P05A 3VGCC 3MYWA 3ZVBA 1V6DA 3AAUA 2ZGCA 3ZZDA 5JBCS 3BSQA 1SOTA 2BD3A 4A92A 1TNKA 3LONA 4I8JA 3ZVFA 2XBYA 2WUCA 4NWKA 5EOKA 1P0SH 3M3SA 1O2OA 3TGKE 1C5TA 1EOJA 1QTFA 1NC6A 1S0RA 1C1OA 2FI4E 4Y8XA 3FP7E 1YLCA 2PKAA 3QWCH 1HDTH 1P3CA 2P93A 1FI8A 2QIQA 1P2MA 1QY6A 3IITA 3SUGA 4Y79A 1SGIB 1NFUA 1FUJA 3QO6A 1EXFA 3SBKA 4WXVA 2BD4A 1BBRH 3UFAA 1BHXB 1GI2A 1TE0A 3E6PH 1WSSH 2LNCA 1WQVH 2QV1A 3A7TA 4E7NA 1GHAF 4JYVH 1Y5BT 2QXGA 2AH4X 1YC0A 7GCHF 2ZGHA 1C4U2 3EDXB 1PPBH 3RXQA 2WYGA 1GMCF 3PM3A 1XVOA 1CGIE 2F3CE 5EPNA 1OWDA 1B5GH 4X2YA 1G3EA 1RJXB 2BY6X 1IQFA 1FN8A 5DPAA 3QLPH 2ODPA 2PKSB 1LKAA 2ZGBH 5C1UA 3TH2H 2Z9LA 3GYLB 1C1RA 4D9RA 1K1NA 5GXPA 2QA9E 2XCFA 4Y0YE 2BDBA 4WVPE 5JDUB 1VITF 2GT8A 4THNH 1A0LA 1LMWB 1GBAA 2AIPA 3TH3H 3PMBB 1DLEA 2ESTE 3FANA 3QGNB 3HK3B 1Z8JB 4GVUA 1C4V2 1O2IA 1FXYA 1ZJDA 3BTTE 3LGUA 1QRZA 3B9FH 1NY22 1GI0A 4DURA 2F9VA 4RN6A 2J34A 1GJCB 1O2SA 3KQDA 1AIXH 1K1PA 2RG3A 2CGAA 3SNEA 4O3TA 4Y8YA 1RXPA 2C3SA 4O03A 1INCA 1DX5M 3BF6H 2SGFE 3RMLH 1ABJH 2GDEH 1ELCA 2H2ZA 2ZQ1A 1F0RA 2TRMA 4BXWA 2G51A 3BIUH 5EXMA 4IN1A 2I6QA 5K7RA 4A5TS 3HKIB 1G37A 3SV8A 5FPYA 1SI5H 2XWBI 2ALVA 4ABBA 1H9HE 1AY6H 4K8BA 2CN0H 1O39A 2VH0A 1GL0E 1HB0B 2B0FA 1C2LA 1ORFA 4D9QA 2SGAA 2ZFTA 4BAKB 1BT7A 3SU0A 1FY8E 3URDA 1KDQB 3Q3YA 3GY3A 1AO5A 3TU7H 1SBWA 3E8LA 2QYIA 3SNCA 5I25A 1C9TA 5DG6A 2J92A 3E0PB 2G52A 4ZXYH 3UOPA 1BHXF 2ZF0H 3ENSB 1UVPA 5C2ZA 2GTBA 4A7IB 4B73A 1XUIA 4E06H 2VWMA 2XRCA 1ANDA 1C5OH 2QXJA 5FPTA 1P04A 1VGCB 2ZDNA 1EAIA 1DXWA 1MUEB 1FV9A 1XKBC 4A1XA 3A82A 1UTQA 1Z1JA 1TB6H 4GHQA 4ZROA 5LGOA 1TPPA 1WV7H 1GVKB 1YPHC 2OQ5A 2VGCB 1TA6A 1L1NA 1ZRBA 5EW1H 3DT0H 2BLOA 2O8TA 5K0HA 4INHA 3RXIA 9LPRA 1TOCB 1U6QA 5EGMA 1W8BH 5HGGA 3SGAE 1OPHB 1UK4A 4OS1A 5AHGH 2QF0A 1Z7KA 9ESTA 1A3EH 5EQSA 3STIA 2PFEA 1KXBA 3RC5A 1F7ZA 1HCGA 2XXLA 1VJAU 1C5VA 4JZFH 2FOFA 1W14U 3GDVA 1NFXA 1P2OA 2FOEA 1T8LA 1PQAA 1T32A 1YF4A 2AYWA 3A7YA 3FVFB 3JZ1B 4XFQA 1SL3A 2CJIA 3C1KA 2VINA 2OC0A 3VPKA 4GAWA 3A8AA 2G5VA 3D23A 3P8NA 1GI7B 1QL8A 2VIVA 4ZKNU 2PGBB 3ZYEA 2EA3A 1YKTA 2OCVB 2ZEBA 3MU5A 5DP8A 1AZ8A 1NFWA 1YPMH 1Z8GA 1G3BA 5HMAA 3B23B 3O8DA 2WPLS 4YOIA 3S9AA 2WPKS 3A7WA 4JK5A 2FWWA 1O2NA 5TJXA 3LC3A 1EKBB 1A0HB 1GJBB 1JOUB 1SFIA 3GISB 1C5WB 2UUKB 1CHOF 1XKAC 1YM0A 2Y81A 1LDTT 4Y7AA 4WH8A 1ARCA 3MI4A 1VGCC 1SSXA 1TQ0B 1ZSLA 3P6ZB 3NPSA 1K28D 5T3HA 3VXFH 1CT4E 1H4WA 1O3PB 1O2LA 3Q77A 5FAHA 1DOJA 1EOLA 4JMYA 3KEEA 4Y6DA 4KP0A 2VNTA 3GY7A 2C8XB 1ANEA 2H9TH 4CRCA 3F6UH 4IC6A 2VB0A 4Z6AH 2BDGA 2Y5HA 3M36A 1E34B 3MTYA 4MDSA 1B0EA 1ABIH 1GI4A 1DWDH 4IBLH 4TY7A 4KTSA 1UVOA 3UUZA 1ELEE 1TFXA 2WV5A 2ZFRH 2AGEX 2FOHA 1O3LA 4ABAA 1NFYA 1GBMA 1ZHRA 3SUFA 2FZZA 1ETSH 2OC8A 2C8YB 5LPRA 1DS2E 1VCQA 2GV6A 4X8UH 1GMDG 3BTWE 4Q7ZA 5GPIB 3RXJA 4K3JA 3ESTA 1MBQA 1A3BH 2C8WB 1KTTB 3PYHA 2A7HA 4O97A 1EAUA 2G4TA 1O3KA 3RM0H 5DKMA 4UFDH 5JBTA 3GOVB 2BDAA 3RXFA 1BRUP 1ZHMA 5AFYH 3VB5A 1TALA 1EASA 1V2JT 3SORA 1UTLM 1LHDH 4YLQH 2R2WU 2FIRH 4AGKA 1A5HA 1KLTA 3F68H 1HXFH 2V3HH 2AMQA 1AB9C 4DG4A 2F83A 4CRGA 2VVCA 1D3QB 1GGDB 1KYNA 1FIZA 1SGDE 5C20A 2D26C 3RXAA 3LC5A 5LPFA 3V13A 1J16A 5T6DA 2Y82A 2BXTH 4NCYA 2GVFA 1HAYB 3LGIA 2TIOA 2ZGXH 4DIHH 1G9IE 1THSH 1HAXB 1KSNA 3P95A 1T8MA 5E0JA 2GMTB 3SO3A 1MZAA 2A5AA 1O3NA 1A7SA 1MBMA 1G36A 2AGGX 3BTME 3HATH 2BTCE 3SI4H 3PMJA 1GJ7B 1K1JA 1HIAB 4MNWA 5FXLA 3T26A 1CT2E 2P3TB 2A4RA 4MNYA 3UWIA 1N8OB 3TIUA 4CREA 3MFJA 1A46H 1PFXC 1PPFE 1ANCA 3V7TA 3SN8A 1VITH 4X6OA 4Y10E 1LPGB 1BITA 3EA7A 2ZO3H 2ZU1A 5TCCA 4OGYA 4NGAH 3PB1E 4CBNA 3PWCA 3M3TA 5B6OA 1NROH 1RTFB 6CHAC 2EC9H 3F9HA 4NSVA 3VB6A 2QCYA 2STAE 4AZ2B 3S69A 1EZSC 2BDCA 2ZTYA 5F6MA 1L1GA 2FESH 2Q6DA 1SOZA 1C2EA 2Z6BD 1O2UA 3L6PA 5FPSA 1OOKB 5EU8A 1OWIA 2WPMS 1AQ7A 3RU4D 1HPGA 4CRFA 1V2WT 4CR5A 5HM9A 5BRRE 2XBWA 1DDJA 2ZU4A 4K1SA 4AFUA 1HBTH 2GD4B 1OP8A 1CHGA 2A5IA 4OS2A 1TPSA 1AUJA 1TX6A 1A4WH 2BQ7B 4Y71A 2HNTF 4GCHG 1WYKA 1GGDC 1Q2WA 3FFGA 1QGFA 3RXLA 4K2YA 2GCTC 2NU1E 3ZV9A 3LT3A 3D65E 1BIOA 5AFZH 1BMAA 1TIOA 1J17T 3A8CA 5DP3A 1LKBA 4BTUB 4LOYH 1ZOMA 1DWCH 1O2KA 1FZZA 2XC0A 2XTTB 4ASHA 3HPTB 3ZZAA 2C4FH 1PPCE 4AG1A 4K8YA 1OYTH 3GDUA 2FX4A 2FS9A 1NS3A 3U8OH 4A1TA 3BV9B 1K1LA 1YYY1 1Y3XA 2VWOA 4ZAEA 1DUEA 5A8YA 2BQ6B 4X8SH 1TRMA 2ZU5A 1GBIA 1V2RT 5DJ7A 1RFNA 4MPWA 1TRNA 2ZPSA 4WJG2 3BTEE 3KL6A 3C27B 2SNVA 1G3DA 1SGQE 2XBXA 1XUGA 1O3BA 4R8TB 1TLDA 5C1XA 3CS0A 1N8OC 3SHAH 3S7KB 2BYAX 1EUFA 3KIDU 2BZAA 2F91A 3ZVEA 1XVMA 3ZV8A 3UY9A 1ZPZA 2WUBA 2ZP0H 4YESB 4DW2U 4IC5A 1C1VH 1GDNA 2VJ1A 3SV7A 1SQAA 2AEIH 3KN2A 3MU4A 2HPQH 1C5UA 3ZVAA 2TGTA 1WBGB 1NU7B 3DHKH 3MWIU 5GWZA 3RMMH 3SV2H 4X2WA 1D6RA 1ETTH 4ABDA 2PKAB 1WUNH 1W7GH 1GJ4H 1O2HA 3MNBA 1ZMJA 2PUQH 3MNCA 3RXOA 2Y7XA 1V2VT 4ZKSU 1C2FA 4B71A 3A87A 3KNXA 3MHWU 4YM9A 2XC4A 4PROA 4ZKOU 3M37A 2P3FH 2FOCA 1T8NA 2I6SA 7ESTE 5DK1A 1QQUA 3ZZBA 1IQEA 2XW9A 2FLBH 3BEUA 1TWXB 4IN2A 1TGTA 5E2PA 1X7AC 3FP6E 2Z3DA 1KXEA 1P10A 2Z9JA 4ZHAA 3SHCH 3LGVA 1HV7A 1YPLH 2W3IA 2C8ZB 4TY6A 1GHBG 5E8EH 3E1XB 4BAHB 1AKSA 1JBUH 3TK5A 3N7OA 8LPRA 1P2IA 2TGAA 4INKA 2ZIQH 3Q3XA 3GCHC 2BLWA 3GCTG 4NIYA 1Y5UT 3E0NB 1C2KA 1P2NA 1MKWH 4LXBH 2FDAA 1FY5A 5EXLA 3LKWA 1NTPA 1KIGH 3H5CB 1RRKA 1IOEA 4J2YB 2GZ7A 2GT7A 2GCHG 1C1QA 2FYRA 3KGPA 3L33A 4YOJA 1O32A 2ANKH 2H1UA 1P2KA 3BN9A 2B5TB 5IYTA 2J2UA 4FU8A 2JH6D 3H7OA 1S0QA 4CHAB 2H5DA 1K1IA 4A1VA 3ATLA 2ZWLH 1GBKA 4JK6A 1AU8A 1MTWA 3D62A 4AN7A 3A7VA 4Z0KA 4X1SU 1EPTA 1T4UH 4UONA 3SZNA 1HXEH 1AWHB 4Y0ZE 3RP2A 1OP0A 5A8ZA 3O8BA 1QURH 3M3VA 1GG6B 1QHRB 1P2QA 1ZPBA 2PGQB 2FP7B 2BDIA 5C5NA 1W13U 3QDZB 4NA8A 2CHAB 3EA9A 2ZFQH 1AUTC 1P01A 3QTOH 1F5KU 1ESBA 1C1UH 1SLVB 3MNXA 2ZCHP 1HUTH 1UK2A 3GICB 1O3OA 1DVAH 2NU2E 5L2ZH 1O34A 4X8TH 3A89A 2A4GA 1GJ8B 1V2UT 3TGIE 1GBCA 2VIOA 4BANB 4UFEH 2GV7A 4ABGA 3QX5H 3TNTA 1DWEH 1O2QA 1ZSJA 3CS7A 2OD3B 1XX9A 2TBSA 1GMHG 1EP5A 1BQYA 1PPZA 4WMEA 1BTZA 3SI3H 2BX4A 4NZLA 1ZMNA 5E0HA 1SFQB 2ZDVH 3BTHE 1THRH 1AMHA 1FDPA 2Z7FE 4AYVB 2QY0B 3QGJA 6ESTA 2ANMH 1TA2A 2OLGA 4AFZA 3M7QA 1YPHE 3T28A 3U69H 4KGAA 1MKXH 1LO6A 4BOHA 1L0ZA 1GDQA 2STBE 3B8JA 3A8BA 4AB8A 4FXGH 5FHTA 4FU9A 1ELFA 4I8HA 4FUHA 2PHBA 3GY4A 4AGJA 4B76A 4Y11E 2FOBA 2OBQA 1WQSA 5E2OA 2OUAA 1C5LH 4NG9H 3LJOA 1HJAB 3E16B 1ACBE 3ELAH 1PYTD 2FM2A 5EPYA 2FOGA 2ZDLA 1P12E 1CU1A 1NO9H 3GCNA 2BDHA 1FN6A 1DWBH 1GG6C 3RLWH 1ID5H 1AVGH 4D7GA 3UQOA 2AS9A 2XYAA 3TJOA 1IQNA 2CHAC 1TGNA 5AF9H 1AZZA 1K21H 3P8OA 1OX1A 3FZZA 4ZH8A 1DITH 3LDXH 3PMAB 3EYDA 4JZ1A 4NWLA 3U98H 5JB8S 4I8KA 3TLOA 2AMPA 2G4UA 5ETXA 3ITIA 1VITG 8ESTE 3SJKA 2ALPA 3RXEA 5JYIA 4DCDA 2VH6A 2ZDMA 3BTDE 2SGDE 1UJ1A 4ZXXH 2WPIS 4JYUH 1UCYK 2D1JA 4GUXA 2W5EA 3S9BA 1F0UA 1D9IA 4HI3A 4TWWA 1C1TA 1V2TT 1KTSB 1V3XA 2PKSC 4ZHLU 1C1NA 1LQDB 1BRAA 1TMUH 2SGPE 2ZKSA 3BEIB 1OWEA 4XSKU 4CRDA 4BNRA 4Q7YA 4NIVA 3QUMP 1ZGVA 1IHTH 2Y6TA 2BB4A 4B1TA 4F4OC 3KHVA 3KQCA 3ZZ8A 2OXSA 5C5OA 1QCPA 3RXRA 1J8AA 1ZMLA 2JKHA 1BJVA 1ZTLA 3LGTA 1QB9A 1C5SA 1SLWB 4VGCB 1V2ST 2K1QA 3ATIA 5H4IB 3S0NA 3RMNH 2Q1JA 4JZDH 1W11U 1TGCA 1XM1A 4WXIA 1BRCE 2FTMA 2P16A 5F8ZA 1GJ5H 1P02A 6GCHG 4MQAA 4AFQA 1MTVA 4YT6H 2ILNA 4U2WA 3ZZ7A 1KXCA 4XOJA 1BTWA 7LPRA 1SLUB 3LGYA 1UHBA 1HJAC 2ZHWH 1YCPM 1L1JA 2QF3A 3P8GA 1QBNA 3I77A 3PLKA 4AFSA 3BTKE 4I8LA 5A2MH 6LPRA 1FY1A 1SGRE 4B75A 4CH2B 1E35B 3K6YA 2O8LA 1OXGA 2ZQ2A 1DY9A 1F0SA 1YPKH 1F2SE 3KQBA 1UTNA 1K9OE 2CMYA 4K1EA 1SQTA 1L4ZA 1O30A 1P8VC 4D8NA 5DP4A 2D8WA 1EZQA 3P92A 5EQRA 1ANBA 1UO6A 1E37B 1GMDF 2A7CA 2ZCLP 4X1RU 4DJZB 4R0IA 2Z9KA 2XWAA 2A4QA 4Q7XA 3E91A 1FMGA 3CP7A 1IQKA 2EEKA 3SU4A 2A45B 1BJUA 2GDDA 2A31A 4ABHA 1IHSH 2W7SA 3RXGA 2VGCC 1GJ6A 1BA8B 3RDZA 3R3GB 1H8DH 1SB1H 3RXHA 4ZUHA 3TITA 2BOHB 1C4Y2 5LPEA 2OQUA 1O2VA 1EQ9A 2FODA 2O8UA 4AG2A 3HGNA 4Q2KA 4ISNA 1GI9B 5GDSH 1ARBA 4ZHMU 2PSXA 2AERH 4X1QU 1DPOA 1NM6A 1ZHPA 4VGCC 3TJNA 4WMFA 1LVMA 1LPKB 5EG4A 4AYYB 2G55A 1TNIA 2SNWA 3NCLA 1O5BB 2ODYB 4ESTE 1O3CA 1TNHA 3UIRA 5BPEA 4IGDA 1W12U 3OTJE 1TQ7B 3ZZ9A 3IG6B 4FUIA 1AE5A 2J38A 2VIWA 3CENA 4H6SB 3MH4A 5C3NA 1P03A 1B7XB 1TRYA 1XMNB 5I46H 3RXKA 1Z6JH 1BDAA 1N6XA 1O3AA 1YCPK 3UOUA 7KMEH 1O5AB 2UWPA 1HAVA 2PR3A 4YTAA 1F5RA 3D49H 4H6TA 3HK6B 5FBIA 4IMQA 4K1TA 1TAWA 1AN1E 1AD8H 3NWUA 2Z9IA 1OYQA 5C67A 1DANH 3M5NA 3SU6A 2Y7ZA 1C5MD 4K60A 3LH1A 5G4BA 3SU3A 3LJJA 1IQGA 1C5RA 2WYJA 4ISOA 3AW0A 3MH7A 1O5CB 3VB3A 4B2AA 2H6MA 5ESBA 3RXPA 1P9SA 2AIQA 2Z3EA 5GCHG 1C2MA 3G01A 4WWYA 1GVLA 2HNTE 8GCHG 1YP9A 1E0FD 2ZU2A 3MOCA 1G30B 1LHCH 1XXDA 5HXFA 1S6FA 1TMTH 2FOAA 2YOLA 3RLYH 4BXSA 4GCHF 1P9UA 5A0CA 2ZHQH 1VJ9U 2B9LA 2CF8H 3UREA 1XUFA 1TABE 3SQHE 2HOBA 1ZYOA 1FJSA 5J4QA 3Q00A 1MD8A 1SHHB 1MD7A 1O37A 5SGAE 1XUJA 1SPJA 1P11E 2JH5D 1W10U 2BD7A 1O2WA 1FNIA 1QR3E 1JWTA 1VR1H 4AORA 1BTHH 5ESTE 4YT7H 1G3CA 2FX6A 1GWAA 1TNJA 2A2QH 1A2CH 2KAIA 1C2IA 4ZKRU 4FUFA 4XBDA 2W7UA 4FUJA 1CO7E 1CGJE 1GBLA 2M5TA 1HYLA 2TGDA 1YPEH 4FVDA 1AWFH 3VEQB 1O5EH 5TCAA 4AB9A 2OP9A 2G00A 5E0GA 3U1JB 2NU0E 2ZECA 1SGEE 3SUEA 1H9LB 1MZDA 2J9NA 3Q76A 1V2QT 3GCOA 2HNTC 3M35A 1W0ZU 2ZTZA 1KY9A 1YBWA 2P59A 2R0LA 5JB9S 1SGTA 2BZ6H 4IW4E 2IN2A 3P17H 2PTNA 2FXRA 1LVBA 1JMOH 1SGFA 2YNBA 4F49A 2TGPZ 3DFJA 5A0AE 3O8CA 5EXNA 1SR5C 3MMGA 1D3DB 2PWXA 3SU1A 2GMTC 1G2MA 2QN5T 5A8XA 1AKSB 2BD2A 2F9UA 3MU8A 3AVZA 5A09A 4UD9H 2CV3A 4HZHA 3RMOH 1AI8H 3RC4A 2HGTH 1ZRKA 1HNEE 1MQ5A 2EI8A 3R0FA 3MH5A 1C1MA 1TBQH 5HYOA 4JYTA 1EJMA 1H1BA 3MU1A 1Y3YA 2LPRA 5JPMH 2GP9B 1BOQA 1O2PA 3GDSA 4M7GA 1BBRK 4UFFH 3SGBE 3LGWA 3KCGH 5FX5A 2D2DA 3BTGE 3IWMA 3M61U 4HTCH 3A80A 1MMJN 1GHBF 3PLPA 3UNSA 3NZIA 2WINI 2ZG0H 1O33A 3UWJH 4U01A 2V35A 3GCTF 1K2I1 1O2JA 3PTBA 3DA9B 1C2DA 1EPTB 2ZHEH 2EI7A 4BTIB 1SGFG 3NUMA 4Y8ZA 5F03A 2GCHF 2NU3E 1NN6A 2GKVE 1BRBE 2GZ9A 1GI1A 1UMAH 1HFDA 3PO1B 1UCYE 1GDUA 1S83A 4SGAE 1ELAA 2ANWA 1EZXC 3K6ZA 1ZZZA 1P57B 3EGKH 3TPIZ 1V2PT 1L2EA 1NRRH 1S84A 3SV6A 3TJUA 1Z8RA 1TMBH 3OSYA 1E36B 1EJAA 1LVYA 4ISHH 3S9CA 3GY6A 3E90B 3AASA 1HJ9A 2R9PA 3LH3A 3QTVH 1MTSA 2DE9A 1EAWA 4CRBA 2GZ8A 3OY5U 3S7HB 2BVRH 1G2LA 1FIWA 1GBJA 2WPHS 1VCWA 5HM2A 1C5XB 4MNVA 1LHEH 1C1WH 2AGIX 2BLQA 2OTVA 3KF2A 3SU5A 1BTPA 3P70B 3VFEA 1IAUA 1MH0A 4H4FA 1Z1IA 3JZ2B 4RSPA 1HAOH 2BOKA 2ODQA 4D7FA 3SJ8A 2PSYA 1A1RA 1RIWB 2A7JA 2VU8E 2ASUB 3ATWA 3STJA 1QIXB 1C2JA 1SQOA 1EATA 3SQEE 1NRSH 1CVWH 2FLRH 1SGCA 2ZPRA 1BMLA 4X8VH 1UVUH 2ZU3A 2A0QB 4MG3A 5L30H 1EP6A 3T2NA 1V2KT 3MO9A 1RS0A 1BTYA 3ZZ4A 4J1YA 1GMHF 1GBBA 1T8OA 3RXCA 5CMXH 3SU2A 1GHXH 2F9PA 3UR9A 1O5GH 2VIDA 1F0TA 1EPTC 1XUKA 4OS5A 1C5NH 1ELGA 1BMNH 2TPIZ 2XCNA 2GGVB 1C5ZB 3RU4T 2BY5X 4YOGA 1PPEE 3RC6A 1J14A 1FLEE 2VVUA 3T5FH 3PO1C 1SGNE 2B7DH 1TBRH 1D3PB 3K65B 4B2CA 4RKOB 2UUFB 1AVXA 3QN7A 1WCZA 1GJ9B 1UTKA 2A32A 1XXFA 5DO4H 1CE5A 1Z71A 3EQ0H 4K5ZA 2BD5A 3UPEA 2BVXH 3GY2A 1QB1A 4XDEA 4MVNA 4DY7B 1DSUA 3ODDA 3T62A 1EX3A 1ELDE 1GBTA 3RXSA 5CE1A 1KXDA 2PTCE 1N1LA 2ZPQA 2IOTA 1BTXA 1E38B 2BD9A 3FAOA 4DVAU 5EQQA 3BTQE 2FS8A 1BUIA 1ELTA 1PPHE 3DFLA 1CGHA 1CA8B 3BG8A 3UR6A 3AW1A 2PV9B 2FMJA 1DY8A 1S5SA 3GY5A 3MO6A 4BAOB 5DP9A 1SVPA 2ZA5A 3T29A 1KXAA 1LVOA 1LPZB 5T6GA 3UTUH 1OS8A 2OC7A 3I29A 2J94A 5JBBS 1RIWC 1VCPA 1CQQA 1YPJH 1Z6EA 1QL9A 4A6LA 1LCYA 1J9CH 2RDLA 3WY8A 5FBEA 2P8OB 3ZZ3A 4CHAC 1P06A 2ZHFH 1C9PA 1KLIH 1S82A 4NIXA 3MO3A 3FZDA 4IMZA 3E3TA 5L2YH 1D3TB 3M5OA 1GPZA 3QZQA 4ABIA 2Z9GA 2ZCKP 5F8XA 3RXBA 4INLA 4YO9A 4KTCA 4SGBE 1SC8U 1GHAG 2R0KA 3F1SB 1EZUC 3FP8E 5CHAB 1GBHA 2F9OA 3Q3KA 7GCHG 4FUGA 1H8IH 4I31A 2FOMB 4MPUA 1UHBB 1YPGH 1TX7A 1ZTKA 4B2BA 2H5CA 1GMCG 2NWNA 4YLUA 4BAQB 4NFEA 2PLXA 1S85A 1Q3XA 2ANYA 3ZZ5A 2AMDA 1HLTH 1BTUA 3W95A 1Y5AT 4FUCA 4FUDA 1O0DH 1P2JA 3V0XA 1C2HA 6GCHF 2OINA 1O3DA 3BG4B 1NU9A 4I7YH 4NFFA 1MTUA 3ZYDA 3ATMA 1LHFH 2J4IA 3SJOA 1FAKH 1FQ3A 1MAYA 4LZ1H 3K9XB 1PQ8A 2HVXA 2ZI2H 1JRSA 1HAIH 1IQLA 3A85A 1EB1H 1N6YA 4ABJA 1FONA 2ZHDA 4NZQA 4H42U 2V6NA 1DICA 3RXMA 3V3MA 2BY7X 2WPJS 1F5LA 2RCEA 3W94A 2OC1A 1MCVA 3TNSA 3SV9A 1ZSKA 4TPIZ 2A5KA 1MCTA 3ZZCA 4NIWA 4Q80A 2HPPH 1QBVH 5LH8A 3H7TA 2HWLB 3ZZ6A 4X6MA 1AE8H 4DIIH 4TWYA 2SGQE 1C5QA 2OBOA 1O38A 2Y5FA 3PMHB 1XUHA 1QNJA 2VVVA 1O2RA 4LK4A 1JIRA 4X1NU 2ZFPH 2P8OC 5FCRA 2BQWB 2VIPA 2PUXB 2ZC9H 2Q6FA 1O36A 4GHTA 2BY9X 3VXEH 3TH4H 3OYPA 4I33A 4UDWH 2IPHA 3KQEA 1HRTH 5DP5A 4ABFA 1JXPA 5DP6A 1QJ7B 5T6FA 1DT2A 5F8TA 4ISLA 4OS6A 1LTOA 1GCDA 4Y7BA 1QL7A 1TONA 2BLVA 2SGEE 5CHAC 1GJDB 5PTPA 1TGSZ 1TBZH 1W2KH 2DE8A 4E05H 4U32A 1MAXA 4X2VA 1Y59T 3ATKA 2C90B 1MU6B 1HAVB 1Y3UA 4DGJA 2QC2A 1KDQA 2R3YA 1O2ZA 2EI6A 1W3CA 3A88A 1PPGE 1BMMH 3PLBA 1WTGH 3SJIA 4HFPB 1QRWA 1TPOA 2BY8X 1ZGIA 1S81A 1AB9B 1ZR0A 1QBOA 2Z3CA 1AFQB 3A84A 1JRTA 3BG4C 5AVDA 5JBAS 3TVJB 1B0FA 1OWKA 1LHGH 3F9GA 4CR9A 3SNBA 3GY8A 5ABWA 2P95A 1UTOA 3RXVA 4XE4A 2VWLA 1BBRE 1RTLA 2ZZUH 4TPYA 1PYTC 2A1DB 5FX6A 1KXFA 1SHYA 4WH6A 1ZJKA 1Z8IB 4Y76A 1UVSH 4ABEA 2UUJB 1ESAA 1RGQA 5FCKA 3RXDA 1OWJA 3RM2H 2VIQA 1K22H 3RXUA 1DE7H 1CA0B 1DXPA 3F9FA 1CT0E 4FU7A 4AX9H 1IQJA 1OP2A 1C5YB 2V0BA 3TK9A 1TX8A 4CRAA 2ZTXA 4XBBA 5GCHF 3U1IB 1ESTA 1T7CA 1HAGE 3EE0B 3PWBA 4UFGH 8KME2 1GI5A 4HGCA 1CHOG 1FPCH 8GCHF 1UCYH 1GBDA 4MLFB 1O2MA 1PJPA 1O2XA 1ELVA 4NSYA 6CHAB 1O5DH 4QT8C 2FI5E 1ZPCA 1NPMA 1GBEA 2G81E 2C93B 2YNAA 2W3KA 2KAIB 4ISIH 4BAMB 2ZDKA 1HAHH 4DOQA 1TNGA 2H9EH 2UUYA 3F9EA 3A8DA 1W7XH 1NRPH 5C1YA 3A86A 5L6NH 1AVWA 4FUEA 1SGPE 4GPGA 3AAVA 1OSSA 5DP7A 3UNQA 1FY3A 1QFKH 1C2GA 4O3UA 2FI3E 1AFEH 3OX7U 1A0JA 1W0YH 2HLCA 4UEHH 4LZ4B 1O3GA 2BDYA 1UK3A 2ULLA 2JH0D 3M5MA 1AFQC 4MTBA 2BXUH 1JIMA 1AGJA 2CF9H 1TGBA 2GCTB 1M9UA 2GX4A 1O3EA 1ZTJA 3LU9B 5EODA 2QXIA 5DGJA 4E7RG 4KELA 1ELBA 2UWOA 4WF8A 1FAXA 1GI6A 2SFAA 2FEQH 4KTUA 1GVZA 2ZGJA 1V2NT 3PTNA 2QGRA 3DUXH 1GHYH 1WAYB 1WTHD 4JCNA 1O3IA 1MTNB 4X1PU 4MPVA 3A81A 2W26A 1C5PA 1GBFA 1RD3B 2QAAA 1IQHA 3SOSA 2BX3A 1O2YA 4CH8B 1GI8B 1DUAA 2BHGA 3GYMA 3OY6U 1CA0C 1J15A 3O8RA 1GCTB 1TOMH 1O3FA 3RXTA 1O31A 1T31A 1SLXB 1NRNH 1O2TA 1O5FH 3NXPA 1O3JA 1HAPH 2HALA 1OKXA 3ODFA 3SNDA 4JZIA 1SG8B 3NKKA 1HJ8A 4BTTB 4RKJB 3L3TA 4NA9H 1NRQH 3PROA 1T4VH 1FPHH 1TYNA 2G8TA 1F92A 5EW2H 3MH6A 5GJ4B 2FTLE 1O2GH 2R2MB 1GHVH 2IJOB 1MKWK 5A0BA 3SJ9A 1GI3A 3K2UA 2BMGB 3A7XA 3P8FA 1RTKA 3MU0A 1Y3WA 2DUCA 1EB2A 3SW2B 2Q6GA 5J4SA 1PQ5A 2H9HA 2PW8H 1K1OA 1A5IA 4X0WU 4X6NA 2FO9A 1SMFE 1D6WA 3M7UA 2G5NA 3OU0A 3TGJE 3LPRA 1P3EA 1GL1A 1Q31A 4IS5A 1GHZA 3HGPA 3T25A 4K69A 1WOFA 2JETB 3URCA 4X6PA 4JZEH 1BCUH 3I78A 2Y80A 1IQIA 1KLJH 1QB6A 4YZUA 2ZNKH 1CBWB 1DSTA 1SGYE 1DM4B 1OWHA 4WY3A 2J95A 2O8MA 3LIWA 1P09A 4X2XA 1QA0A 1V2MT 3UQVA 1YLDA 1Y3VA 3SNAA 2NU4E 1WU1A 2HRVA 3BTFE 2Z94A 4OGXA 1QQ4A 4MPXA 2A4OA 1GJAB 3UNRA 4OS4A 3SGQE 2FPZA 3GCHB 1ETRH 3TK6A 3HKJB 3U8RH 1YCPH 3SUDA 4CBOA 1HGTH 1MTNC 2CXVA 1QA7A 1HIAA 1THPB 3VB7A 4TYDA 5IDKA 4DT7B 2UWLA 1BB0B 3VGCB 1S6HA 3A83A 1EAXA 1FY4A 1K1MA 1UTJA 3T27A 2P94A 1GCTC 3VB4A 2O9QA 1TPAE 3RU4E 2Y5GA 3BEFB 1PQ7A 1IQMA 2QXHA 2BM2A 2BVSH 1C1SA 3PV4A 2RA0A 3DD2H 3ZVDA 2F9NA 2F9BH 3LOXA 4FUBA 2AFQB 2THFB 2RA3A 2WV4A 3NK8A 1CSOE 1O3HA 1V2LT 1DLKB 1G32B 1QJ6B 3MNSA 1BZXE 1QJ1B 3QZRA 4XBCA 2BD8A 1YGCH 4OS7A 2B8OH 1NT1A 1MKXK 1NZQH 3A7ZA 4NA7A 1D4PB 1C1PA 1UVTH 2O8WA 4UE7H 4I8GA 1O35A 4O9VA 2P3UB 4WMDA 2ZFSA 2JETC 1V2OT
chains in the Genus database with same CATH superfamily
2W6ID 1DFPA 2ZFFH 3UAIC 3TJVA 3M5LA 4KKDA 1CBWC 3BIVH 1O3MA 2ZDAH 2A2XH 4AOQA 1MU8B 3U9AH 4F55A 1AHTH 2R3UA 2FYQA 1LQEA 3ZVCA 1MQ6A 1Y8TA 2F4LA 2XNIA 1UTMA 1EJNA 3EAJA 4MNXA 1VZQH 4GSOA 5GIBA 4FVBA 3V12A 4U30A 1A61H 1A5GH 4ZMAH 2XC5A 3ZVGA 4RT0A 1ZLRA 3EA8A 1L4DA 2XBVA 2V3OH 4B74A 3QK1A 3RUOA 4GLYA 1TNLA 2VWNA 3M7TA 1H9IE 1QRXA 1GHWH 1HAZB 4I32A 4D76A 1NESE 3U8TH 1UTPA 1P05A 3VGCC 3MYWA 3ZVBA 1V6DA 3AAUA 2ZGCA 3ZZDA 5JBCS 3BSQA 1SOTA 2BD3A 4A92A 1TNKA 3LONA 4I8JA 3ZVFA 2XBYA 2WUCA 4NWKA 2EY4C 5EOKA 1P0SH 3M3SA 1O2OA 3TGKE 1C5TA 1EOJA 1QTFA 1NC6A 1S0RA 1C1OA 2FI4E 4Y8XA 3FP7E 3DSOA 1YLCA 2PKAA 3QWCH 1HDTH 1P3CA 2P93A 2VBCA 1FI8A 2QIQA 1P2MA 1QY6A 3IITA 3SUGA 4Y79A 1SGIB 1NFUA 1FUJA 3QO6A 1EXFA 3SBKA 4WXVA 2BD4A 1BBRH 3UFAA 1BHXB 1GI2A 1TE0A 3E6PH 1WSSH 2LNCA 1WQVH 2QV1A 3A7TA 4E7NA 1W0JD 1GHAF 4JYVH 1Y5BT 2QXGA 2AH4X 1YC0A 7GCHF 2ZGHA 1C4U2 3EDXB 1PPBH 3RXQA 2WYGA 1GMCF 3PM3A 5FL7D 1XVOA 1CGIE 2F3CE 5EPNA 1OWDA 1B5GH 4X2YA 1G3EA 1RJXB 2BY6X 1IQFA 1FN8A 5DPAA 3QLPH 2ODPA 2PKSB 1LKAA 2ZGBH 5C1UA 3TH2H 2Z9LA 3GYLB 1C1RA 4D9RA 1K1NA 5GXPA 2QA9E 2XCFA 4Y0YE 2BDBA 4WVPE 5JDUB 1VITF 2GT8A 4THNH 1A0LA 1LMWB 1GBAA 2AIPA 2RFKC 3TH3H 3PMBB 1DLEA 2ESTE 3FANA 3QGNB 3HK3B 1Z8JB 4GVUA 1KMHB 1C4V2 3F2HA 1O2IA 1FXYA 1ZJDA 3BTTE 3LGUA 1QRZA 3B9FH 1NY22 1GI0A 4DURA 2F9VA 4RN6A 2J34A 1GJCB 1O2SA 3KQDA 1AIXH 1K1PA 2RG3A 2CGAA 3SNEA 4O3TA 4Y8YA 1RXPA 2C3SA 4O03A 1INCA 1DX5M 2KZ4A 3BF6H 2SGFE 3RMLH 1ABJH 2GDEH 1ELCA 2H2ZA 2ZQ1A 1F0RA 2TRMA 4BXWA 2G51A 3BIUH 3N7EA 5EXMA 4IN1A 2I6QA 5K7RA 4A5TS 3HKIB 1G37A 4TT3D 3SV8A 2JDID 5FPYA 1SI5H 2XWBI 2ALVA 4ABBA 1H9HE 1AY6H 4K8BA 2CN0H 1O39A 2VH0A 1GL0E 1HB0B 2B0FA 1C2LA 1ORFA 4D9QA 2SGAA 2ZFTA 4BAKB 1BT7A 3SU0A 1FY8E 3URDA 1KDQB 3Q3YA 3GY3A 1AO5A 3TU7H 1SBWA 3E8LA 2QYIA 3KYGA 3SNCA 5I25A 1C9TA 5DG6A 2J92A 3E0PB 2G52A 2J98B 4ZXYH 3UOPA 1BHXF 2ZF0H 3ENSB 1UVPA 2LELA 5C2ZA 2GTBA 4A7IB 4B73A 1XUIA 4E06H 2VWMA 2XRCA 1ANDA 1C5OH 2QXJA 5FPTA 1P04A 1VGCB 2ZDNA 1EAIA 1DXWA 1MUEB 1FV9A 1XKBC 4A1XA 3A82A 1UTQA 1Z1JA 1TB6H 4GHQA 4ZROA 5LGOA 1TPPA 1WV7H 1GVKB 1W0KD 1YPHC 2OQ5A 2VGCB 1TA6A 1L1NA 1ZRBA 2JJ1D 5EW1H 3DT0H 2BLOA 2O8TA 5K0HA 4INHA 3RXIA 3OEHD 9LPRA 1TOCB 1U6QA 5EGMA 1W8BH 5HGGA 3SGAE 1OPHB 1UK4A 4OS1A 5AHGH 2QF0A 1Z7KA 9ESTA 4M9FA 1A3EH 5EQSA 3STIA 2PFEA 1KXBA 3RC5A 1F7ZA 4AC9A 1HCGA 2XXLA 1VJAU 1C5VA 4JZFH 2FOFA 5KGOA 1W14U 3GDVA 1NFXA 1P2OA 2FOEA 1T8LA 1PQAA 1T32A 1YF4A 2AYWA 3A7YA 3FVFB 3JZ1B 4XFQA 1SL3A 2CJIA 3C1KA 2VINA 2OC0A 3VPKA 4GAWA 3A8AA 2G5VA 3D23A 3P8NA 1GI7B 1MABB 1QL8A 1SKYE 2VIVA 4ZKNU 2PGBB 3ZYEA 2EA3A 1YKTA 2OCVB 2ZEBA 3MU5A 3PV2A 5DP8A 1AZ8A 1NFWA 1YPMH 1Z8GA 1G3BA 5HMAA 3B23B 3O8DA 2WPLS 2YMSD 4YOIA 3S9AA 2WPKS 3A7WA 4JK5A 2FWWA 1O2NA 5TJXA 3LC3A 1EKBB 5C94A 1A0HB 1GJBB 1JOUB 1SFIA 3GISB 1C5WB 2UUKB 1CHOF 1XKAC 1YM0A 2Y81A 1LDTT 4Y7AA 4WH8A 1ARCA 3N99A 3MI4A 1VGCC 1SSXA 1TQ0B 1ZSLA 3P6ZB 5C17A 3NPSA 1K28D 5T3HA 3VXFH 1CT4E 1H4WA 1O3PB 1O2LA 3Q77A 5FAHA 1DOJA 1EOLA 4JMYA 5T1VA 3KEEA 4Y6DA 4KP0A 2VNTA 3GY7A 2C8XB 2IPQX 1ANEA 2H9TH 4CRCA 3F6UH 4IC6A 2VB0A 4Z6AH 2BDGA 2Y5HA 3M36A 1E34B 2JIZD 3MTYA 4MDSA 1B0EA 2KFWA 1ABIH 1GI4A 1DWDH 4IBLH 4TY7A 4KTSA 1UVOA 3UUZA 1ELEE 1TFXA 2WV5A 2ZFRH 2AGEX 2FOHA 1O3LA 4ABAA 2HVYB 1NFYA 1GBMA 1ZHRA 3SUFA 2FZZA 1ETSH 2OC8A 2C8YB 5LPRA 1DS2E 1VCQA 2GV6A 4X8UH 1GMDG 3UB0A 3BTWE 4Q7ZA 5GPIB 3RXJA 4K3JA 3ESTA 1MBQA 1A3BH 2C8WB 1KTTB 3PYHA 2A7HA 4O97A 1EAUA 2G4TA 1O3KA 3RM0H 5DKMA 4UFDH 5JBTA 3GOVB 2BDAA 3RXFA 1BRUP 1ZHMA 5AFYH 3VB5A 1TALA 1EASA 1V2JT 3SORA 1UTLM 1LHDH 4YLQH 2R2WU 2FIRH 4AGKA 1A5HA 1KLTA 3F68H 1HXFH 2V3HH 3FKSD 2AMQA 2QE7D 1AB9C 4DG4A 2F83A 4CRGA 2VVCA 1D3QB 1GGDB 1KYNA 1FIZA 1SGDE 5C20A 2D26C 3RXAA 3LC5A 5LPFA 3V13A 1J16A 5T6DA 2Y82A 2BXTH 4NCYA 2GVFA 1HAYB 3LGIA 2TIOA 2ZGXH 4DIHH 1G9IE 1THSH 1HAXB 1KSNA 3P95A 1T8MA 5E0JA 3EE7A 2GMTB 3SO3A 3CNRA 1MZAA 2A5AA 2KCYA 1O3NA 1A7SA 1MBMA 1G36A 2AGGX 4RT1A 3BTME 3HATH 2BTCE 3SI4H 3OE7D 3PMJA 1GJ7B 1K1JA 1HIAB 4MNWA 5FXLA 3T26A 1CT2E 2A4RA 2P3TB 4MNYA 3UWIA 1N8OB 3TIUA 2L74A 4CREA 3MFJA 1A46H 1PFXC 1PPFE 1ANCA 3V7TA 3SN8A 1VITH 4X6OA 4Y10E 1LPGB 1BITA 4HG6A 3EA7A 2ZO3H 2ZU1A 5TCCA 4OGYA 4NGAH 3PB1E 4CBNA 3PWCA 3M3TA 5B6OA 1NROH 1RTFB 6CHAC 2EC9H 3F9HA 4NSVA 3VB6A 2QCYA 2STAE 4AZ2B 3S69A 1EZSC 2BDCA 2ZTYA 5F6MA 1L1GA 2FESH 2Q6DA 1SOZA 1C2EA 2WZQA 2Z6BD 1O2UA 3L6PA 5FPSA 1OOKB 5EU8A 1OWIA 2WPMS 1AQ7A 3RU4D 1HPGA 1K0HA 3DCLA 4CRFA 1V2WT 4CR5A 5HM9A 5BRRE 2XBWA 1DDJA 2ZU4A 4K1SA 4AFUA 1HBTH 2GD4B 1OP8A 1CHGA 2A5IA 4OS2A 1TPSA 1AUJA 1TX6A 1A4WH 2BQ7B 4Y71A 2HNTF 3PRDA 4GCHG 1WYKA 1GGDC 1Q2WA 3FFGA 1QGFA 3RXLA 4K2YA 3U28C 4YXWD 2GCTC 2NU1E 3ZV9A 3LT3A 3D65E 1BIOA 5AFZH 1BMAA 4ACAA 1TIOA 1J17T 3A8CA 5DP3A 1LKBA 2V7QD 4LOYH 4BTUB 1ZOMA 3GS9A 1DWCH 1O2KA 1FZZA 2XC0A 2XTTB 4ASHA 3HPTB 3ZZAA 2C4FH 1PPCE 4AG1A 4K8YA 1OYTH 2KR7A 3GDUA 2FX4A 2FS9A 1NS3A 3U8OH 3WWFA 3BV9B 1K1LA 1YYY1 4A1TA 1Y3XA 2VWOA 4ZAEA 1DUEA 5A8YA 2BQ6B 4X8SH 1TRMA 2ZU5A 1GBIA 1V2RT 5DJ7A 1RFNA 4MPWA 1TRNA 2ZPSA 4WJG2 3BTEE 3FOAA 3KL6A 3C27B 2SNVA 1G3DA 1SGQE 2XBXA 1XUGA 1O3BA 4R8TB 1TLDA 5C1XA 3CS0A 1N8OC 3SHAH 3S7KB 2BYAX 1BMFD 1EUFA 3KIDU 1E1QD 2BZAA 1EFRD 2F91A 3ZVEA 1XVMA 3ZV8A 3UY9A 1ZPZA 2WUBA 2ZP0H 4YESB 4DW2U 4IC5A 3WW7A 1C1VH 5C0UA 1GDNA 2VJ1A 3SV7A 1SQAA 2AEIH 3KN2A 3MU4A 2HPQH 1C5UA 3ZVAA 2TGTA 1WBGB 1NU7B 3DHKH 3MWIU 5GWZA 3RMMH 3SV2H 4X2WA 1D6RA 2V3MA 1ETTH 4ABDA 2PKAB 1WUNH 1W7GH 1GJ4H 1O2HA 3MNBA 1ZMJA 3OFND 2PUQH 3MNCA 3RXOA 2Y7XA 1V2VT 4ZKSU 1C2FA 4B71A 3A87A 3KNXA 3MHWU 4YM9A 2XC4A 4PROA 4ZKOU 3M37A 3KYFA 2P3FH 2FOCA 1T8NA 2I6SA 7ESTE 5DK1A 1QQUA 2WV9A 3ZZBA 1IQEA 2XW9A 2FLBH 3BEUA 1TWXB 4IN2A 1TGTA 5E2PA 1X7AC 3FP6E 2Z3DA 1KXEA 1P10A 2Z9JA 4ZHAA 3SHCH 3LGVA 1HV7A 1YPLH 2W3IA 2C8ZB 4TY6A 1GHBG 5E8EH 3E1XB 4BAHB 1AKSA 1JBUH 4FETA 3TK5A 3N7OA 8LPRA 1P2IA 2TGAA 4INKA 2ZIQH 3Q3XA 3GCHC 2BLWA 3GCTG 4NIYA 1Y5UT 3E0NB 1C2KA 1P2NA 1MKWH 4LXBH 2FDAA 1FY5A 5EXLA 3LKWA 1NTPA 1KIGH 3H5CB 1RRKA 1IOEA 4J2YB 2GZ7A 2GT7A 2GCHG 1C1QA 1VKYA 2FYRA 3KGPA 3L33A 4YOJA 1O32A 2ANKH 2H1UA 1P2KA 3BN9A 2B5TB 5IYTA 2J2UA 5F53A 4FU8A 2JH6D 3H7OA 1S0QA 2EQNA 4CHAB 2H5DA 1K1IA 4A1VA 3ATLA 2ZWLH 4FOUC 1GBKA 4JK6A 1AU8A 1MTWA 3D62A 4AN7A 3A7VA 4Z0KA 4X1SU 1EPTA 1T4UH 4UONA 3SZNA 1HXEH 1AWHB 4Y0ZE 3RP2A 1OP0A 4I86A 5A8ZA 3O8BA 1QURH 3M3VA 1GG6B 1H8HD 1QHRB 1P2QA 1ZPBA 2FP7B 2PGQB 2BDIA 5C5NA 1WXRA 1W13U 3QDZB 4NA8A 2CHAB 3EA9A 2ZFQH 1AUTC 1P01A 3QTOH 1F5KU 1ESBA 3SZEA 1C1UH 1SLVB 3MNXA 2ZCHP 1HUTH 1UK2A 3GICB 1O3OA 1DVAH 2NU2E 5L2ZH 1O34A 4X8TH 3A89A 2A4GA 1GJ8B 1V2UT 3TGIE 1GBCA 2VIOA 4BANB 4UFEH 2GV7A 4ABGA 3QX5H 3TNTA 1DWEH 1O2QA 1ZSJA 3CS7A 2OD3B 1XX9A 2TBSA 1GMHG 1EP5A 1BQYA 1PPZA 4WMEA 1BTZA 3SI3H 2BX4A 4NZLA 1ZMNA 5E0HA 3N7DA 1SFQB 2ZDVH 3BTHE 1THRH 1AMHA 1FDPA 2Z7FE 4AYVB 2QY0B 2W6JD 3QGJA 6ESTA 2ANMH 1TA2A 2OLGA 4AFZA 3M7QA 1YPHE 3T28A 3U69H 4KGAA 1MKXH 1LO6A 4BOHA 1L0ZA 1GDQA 2STBE 3B8JA 3A8BA 2JJ2D 4AB8A 4FXGH 5FHTA 4FU9A 1ELFA 4I8HA 4FUHA 2PHBA 1YY3A 3GY4A 4AGJA 4B76A 4Y11E 2FOBA 2OBQA 1WQSA 5E2OA 2OUAA 1C5LH 4NG9H 3LJOA 1HJAB 3E16B 1ACBE 3ELAH 1PYTD 3W1EA 2FM2A 5EPYA 2FOGA 2ZDLA 1P12E 1CU1A 1NO9H 2J97A 3GCNA 2BDHA 1FN6A 1DWBH 1GG6C 3RLWH 1ID5H 1AVGH 4D7GA 3UQOA 2AS9A 2XYAA 3TJOA 1IQNA 2CHAC 1TGNA 5AF9H 1AZZA 1K21H 3P8OA 1OX1A 3FZZA 5HIYA 1DITH 4ZH8A 3LDXH 3PMAB 3EYDA 4JZ1A 4NWLA 3U98H 5JB8S 4I8KA 3TLOA 2AMPA 1NBME 2G4UA 5ETXA 3ITIA 1VITG 8ESTE 3SJKA 2ALPA 3RXEA 5JYIA 4DCDA 2VH6A 2ZDMA 4ACBA 3BTDE 2SGDE 1UJ1A 4ZXXH 2WPIS 4JYUH 1UCYK 2D1JA 4GUXA 2W5EA 3S9BA 1F0UA 1D9IA 4HI3A 4TWWA 1C1TA 1V2TT 1KTSB 1V3XA 2PKSC 4ZHLU 1C1NA 1LQDB 1BRAA 1TMUH 2SGPE 2ZKSA 3BEIB 1OWEA 2IJD1 4XSKU 4CRDA 4BNRA 4Q7YA 4NIVA 3QUMP 1ZGVA 1IHTH 2Y6TA 2BB4A 4B1TA 4F4OC 3KHVA 3KQCA 3ZZ8A 2OXSA 5C5OA 1QCPA 3RXRA 1J8AA 1ZMLA 2JKHA 1BJVA 1ZTLA 3LGTA 1QB9A 1C5SA 1SLWB 4VGCB 5EJZA 1V2ST 2K1QA 3ATIA 5H4IB 3S0NA 3RMNH 2Q1JA 4JZDH 1W11U 1TGCA 1XM1A 3KQ5A 4WXIA 1BRCE 2FTMA 2P16A 5F8ZA 1GJ5H 1P02A 6GCHG 4MQAA 4AFQA 1MTVA 4YT6H 2ILNA 4U2WA 3ZZ7A 1KXCA 4XOJA 1BTWA 7LPRA 1SLUB 3LGYA 5EJ1A 2LP6A 1UHBA 1HJAC 2ZHWH 1YCPM 1L1JA 2QF3A 2K8IA 3P8GA 1QBNA 3I77A 3PLKA 4AFSA 3BTKE 4I8LA 5A2MH 3MQKC 6LPRA 1FY1A 1SGRE 4B75A 4CH2B 1E35B 3K6YA 2M2AA 2O8LA 1OXGA 2ZQ2A 1DY9A 1F0SA 1YPKH 1F2SE 3KQBA 1UTNA 1K9OE 2CMYA 4K1EA 1SQTA 1L4ZA 1O30A 1P8VC 4D8NA 5DP4A 2D8WA 1EZQA 3P92A 5EQRA 1ANBA 1UO6A 1E37B 1GMDF 2A7CA 2ZCLP 4X1RU 4DJZB 4R0IA 2Z9KA 2XWAA 2A4QA 4Q7XA 3E91A 1FMGA 3CP7A 1IQKA 2EEKA 3SU4A 2A45B 1BJUA 2GDDA 2A31A 4ABHA 1IHSH 2W7SA 3RXGA 2VGCC 1GJ6A 1BA8B 3RDZA 3R3GB 1H8DH 1SB1H 3RXHA 4ZUHA 3TITA 3OAAD 2BOHB 5DN6D 1C4Y2 5LPEA 2OQUA 1O2VA 5KECA 3AK5A 2YMSB 1EQ9A 2FODA 2O8UA 4AG2A 3HGNA 4Q2KA 4ISNA 1GI9B 5GDSH 1ARBA 4ZHMU 2PSXA 2AERH 5KEDA 4X1QU 1DPOA 1NM6A 1COWD 1ZHPA 3F0PA 4VGCC 3TJNA 4WMFA 1LVMA 1LPKB 5EG4A 4AYYB 2G55A 1TNIA 2SNWA 3FN8A 3NCLA 1O5BB 2ODYB 4ESTE 1O3CA 1TNHA 3UIRA 5BPEA 4IGDA 1W12U 3ZIAD 3OTJE 1TQ7B 3ZZ9A 3IG6B 4FUIA 1AE5A 2J38A 2VIWA 2XNDD 3CENA 4H6SB 3MH4A 5C3NA 1P03A 1B7XB 1TRYA 1XMNB 5I46H 3RXKA 1Z6JH 1BDAA 1N6XA 1O3AA 1YCPK 3UOUA 7KMEH 1O5AB 2UWPA 1HAVA 2PR3A 4YTAA 1F5RA 3D49H 4H6TA 4Z1MD 3HK6B 5FBIA 4IMQA 4K1TA 1TAWA 1AN1E 1AD8H 3NWUA 2Z9IA 1OYQA 5C67A 1DANH 3M5NA 3SU6A 2Y7ZA 1C5MD 4K60A 2F43B 3LH1A 5G4BA 3SU3A 3LJJA 1IQGA 1C5RA 2WYJA 4ISOA 3AW0A 3MH7A 1O5CB 3VB3A 4B2AA 2H6MA 5ESBA 3RXPA 1P9SA 2AIQA 2Z3EA 5GCHG 1C2MA 2WPDD 3G01A 4WWYA 1GVLA 2HNTE 8GCHG 1YP9A 1E0FD 2ZU2A 4F48B 3MOCA 1G30B 1LHCH 1XXDA 5HXFA 2YMSC 1S6FA 1TMTH 2FOAA 2YOLA 3RLYH 4BXSA 4GCHF 1P9UA 5A0CA 2ZHQH 1VJ9U 2B9LA 2CF8H 4TSFD 3UREA 3OEED 1XUFA 1TABE 3H09A 3SQHE 2HOBA 1ZYOA 1FJSA 5J4QA 3Q00A 4B6EA 1MD8A 1SHHB 1MD7A 1QZ8A 1O37A 5SGAE 1XUJA 1SPJA 1P11E 2JH5D 1W10U 2BD7A 1O2WA 1FNIA 1QR3E 1JWTA 1VR1H 4AORA 1BTHH 5ESTE 4YT7H 1G3CA 2FX6A 1GWAA 1TNJA 2A2QH 1A2CH 2KAIA 1C2IA 4ZKRU 4FUFA 4XBDA 2W7UA 4FUJA 1CO7E 1CGJE 2WSSD 1GBLA 2M5TA 1HYLA 2TGDA 1YPEH 4FVDA 1AWFH 3VEQB 1O5EH 5TCAA 4AB9A 2OP9A 2G00A 5E0GA 3U1JB 2NU0E 2ZECA 1SGEE 3SUEA 1H9LB 1MZDA 2J9NA 3F2GA 1V2QT 3Q76A 3GCOA 2HNTC 5HIZA 3M35A 1W0ZU 2ZTZA 1KY9A 2KX4A 1YBWA 2P59A 2R0LA 5JB9S 1SGTA 2BZ6H 4IW4E 2PP6A 2IN2A 3P17H 2PTNA 2FXRA 1LVBA 1JMOH 1SGFA 4OM9A 2YNBA 4F49A 2TGPZ 3DFJA 5A0AE 3O8CA 5EXNA 1SR5C 3MMGA 1D3DB 2PWXA 1H8ED 3SU1A 2GMTC 1G2MA 2QN5T 2WHXA 5A8XA 1AKSB 2BD2A 2F9UA 3MU8A 3AVZA 3VG8A 5A09A 4UD9H 2CV3A 4HZHA 3RMOH 1AI8H 1SQRA 3RC4A 2HGTH 1ZRKA 1HNEE 1MQ5A 2EI8A 3R0FA 3MH5A 1C1MA 1TBQH 5HYOA 4JYTA 1EJMA 1H1BA 5GNDA 3MU1A 1Y3YA 2LPRA 5JPMH 2GP9B 1BOQA 1O2PA 3GDSA 4M7GA 1BBRK 4UFFH 3SGBE 5B6LA 3LGWA 3KCGH 5CDFE 5FX5A 2D2DA 3BTGE 3IWMA 3M61U 4HTCH 3A80A 1MMJN 1GHBF 3PLPA 3UNSA 3NZIA 2WINI 2ZG0H 1O33A 3UWJH 4U01A 2V35A 3GCTF 1K2I1 1O2JA 3PTBA 3DA9B 1C2DA 4XD7D 1EPTB 2ZHEH 2EI7A 4BTIB 1SGFG 3NUMA 4Y8ZA 5F03A 2GCHF 2NU3E 1NN6A 2GKVE 1BRBE 2GZ9A 1GI1A 1UMAH 1HFDA 3PO1B 1UCYE 1GDUA 1S83A 4SGAE 1ELAA 2ANWA 1EZXC 3K6ZA 1ZZZA 1P57B 5CHBA 3EGKH 3TPIZ 1V2PT 1L2EA 1NRRH 1S84A 3SV6A 3TJUA 1Z8RA 1TMBH 2K0QA 3OSYA 1E36B 1EJAA 1LVYA 4ISHH 3S9CA 3GY6A 3E90B 3AASA 2XOKD 3DSGA 1HJ9A 2R9PA 3LH3A 3QTVH 1MTSA 2DE9A 3SYJA 1EAWA 4CRBA 2GZ8A 3OY5U 3S7HB 2BVRH 4P02A 1G2LA 1FIWA 1GBJA 2WPHS 1VCWA 3OTPA 5HM2A 2L6OA 1C5XB 2KCOA 4MNVA 1LHEH 1C1WH 2AGIX 2BLQA 2OTVA 3KF2A 3SU5A 1BTPA 3P70B 3VFEA 1IAUA 1MH0A 4H4FA 1Z1IA 3JZ2B 4RSPA 1HAOH 2BOKA 2ODQA 4D7FA 3SJ8A 2PSYA 1A1RA 1RIWB 2A7JA 2VU8E 2ASUB 3ATWA 3STJA 1QIXB 1C2JA 1SQOA 1EATA 3SQEE 1NRSH 1CVWH 2FLRH 1SGCA 2ZPRA 1BMLA 4X8VH 1UVUH 2ZU3A 2A0QB 4MG3A 5L30H 1EP6A 3T2NA 1V2KT 3MO9A 1RS0A 1BTYA 3ZZ4A 4J1YA 1GMHF 1GBBA 1T8OA 3RXCA 5CMXH 3SU2A 1GHXH 2F9PA 3UR9A 1O5GH 2VIDA 1S6LA 1F0TA 1EPTC 1XUKA 4OS5A 1C5NH 1YWUA 1ELGA 1BMNH 2TPIZ 2XCNA 2GGVB 1C5ZB 3RU4T 2BY5X 4YOGA 1PPEE 3RC6A 1J14A 1FLEE 2VVUA 3T5FH 3PO1C 1SGNE 2B7DH 1TBRH 1D3PB 3K65B 4B2CA 4RKOB 2UUFB 1AVXA 3QN7A 1WCZA 1GJ9B 1UTKA 2A32A 1XXFA 5DO4H 1CE5A 1Z71A 3EQ0H 4K5ZA 2BD5A 3UPEA 2BVXH 3GY2A 1QB1A 4XDEA 4MVNA 4DY7B 1DSUA 3ODDA 3T62A 1EX3A 1ELDE 1GBTA 3RXSA 1E79D 1KXDA 5CE1A 2PTCE 1N1LA 2HLDD 3DSPA 2ZPQA 2IOTA 1BTXA 1E38B 2BD9A 3FAOA 4DVAU 5EQQA 3BTQE 2FS8A 1BUIA 1ELTA 1PPHE 3DFLA 1CGHA 1CA8B 3BG8A 3UR6A 3AW1A 2PV9B 2FMJA 1DY8A 1S5SA 3GY5A 3MO6A 4BAOB 5DP9A 1SVPA 2ZA5A 3T29A 1KXAA 1LVOA 1NBMD 1LPZB 4XRNA 5T6GA 3UTUH 1OS8A 2OC7A 3I29A 2J94A 5JBBS 1RIWC 1VCPA 1CQQA 1YPJH 1Z6EA 1QL9A 4A6LA 1LCYA 2AHME 1J9CH 2RDLA 3WY8A 5FBEA 2P8OB 3ZZ3A 4CHAC 1P06A 2ZHFH 1C9PA 1KLIH 1S82A 4NIXA 3MO3A 3FZDA 4IMZA 3E3TA 1E1RD 5L2YH 1D3TB 4ZCNA 3M5OA 1GPZA 3QZQA 4ABIA 2Z9GA 2ZCKP 5F8XA 3RXBA 4INLA 4YO9A 4KTCA 4SGBE 1SC8U 1GHAG 2R0KA 3F1SB 1EZUC 3FP8E 5CHAB 1GBHA 2F9OA 3Q3KA 7GCHG 4FUGA 1H8IH 4I31A 2FOMB 4MPUA 1UHBB 1YPGH 1TX7A 1ZTKA 4B2BA 2H5CA 1GMCG 2NWNA 4YLUA 4BAQB 4NFEA 2PLXA 1S85A 1Q3XA 2ANYA 3ZZ5A 4DT4A 2AMDA 1HLTH 1BTUA 3W95A 1Y5AT 4FUCA 4FUDA 5C0TA 1O0DH 1P2JA 3V0XA 1C2HA 6GCHF 2OINA 1O3DA 3BG4B 1NU9A 4I7YH 4NFFA 1MTUA 3ZYDA 3ATMA 1LHFH 2J4IA 3SJOA 1FAKH 1FQ3A 1MAYA 4LZ1H 3K9XB 1PQ8A 2HVXA 2ZI2H 1JRSA 1HAIH 1IQLA 1UW7A 1EB1H 1N6YA 3A85A 1FONA 2ZHDA 4NZQA 4ABJA 4H42U 2V6NA 1DICA 3RXMA 3V3MA 2BY7X 2WPJS 1F5LA 3WWBA 2RCEA 3W94A 2OC1A 1MCVA 3TNSA 3SV9A 1ZSKA 4TPIZ 2A5KA 1MCTA 3ZZCA 4NIWA 4Q80A 2HPPH 1QBVH 5LH8A 3H7TA 2HWLB 3ZZ6A 4X6MA 1AE8H 4DIIH 4TWYA 2SGQE 1C5QA 2OBOA 1O38A 2Y5FA 3PMHB 1XUHA 1QNJA 2VVVA 1O2RA 4LK4A 1JIRA 4X1NU 2ZFPH 2P8OC 5FCRA 2BQWB 2VIPA 2PUXB 2ZC9H 2Q6FA 1O36A 4GHTA 2BY9X 3VXEH 3TH4H 3OYPA 4I33A 4UDWH 2IPHA 3KQEA 1HRTH 5DP5A 4ABFA 1JXPA 5DP6A 1QJ7B 5T6FA 1DT2A 5F8TA 4ISLA 4OS6A 1LTOA 1GCDA 3PV5A 4Y7BA 1QL7A 1TONA 2BLVA 2SGEE 5IK2D 5CHAC 2OK5A 1GJDB 5PTPA 1TGSZ 1TBZH 1W2KH 2DE8A 4E05H 4U32A 1MAXA 4X2VA 1Y59T 3ATKA 2C90B 1MU6B 1HAVB 1Y3UA 4DGJA 2QC2A 1KDQA 2R3YA 1O2ZA 2EI6A 1W3CA 3A88A 1PPGE 1BMMH 2J98A 1WTGH 3PLBA 3SJIA 4HFPB 1QRWA 1TPOA 2BY8X 1ZGIA 1S81A 1AB9B 1ZR0A 1QBOA 2Z3CA 1AFQB 3A84A 1JRTA 3BG4C 5AVDA 5JBAS 3TVJB 1B0FA 1OHHD 1OWKA 1LHGH 3F9GA 4CR9A 3SNBA 2KCPA 3GY8A 5HKKD 5ABWA 2P95A 1UTOA 3RXVA 4XE4A 2VWLA 1BBRE 1RTLA 2ZZUH 4TPYA 1PYTC 2A1DB 5FX6A 3F2FA 1KXFA 1SHYA 4WH6A 1ZJKA 1Z8IB 4Y76A 1UVSH 2CK3D 4ABEA 2UUJB 1ESAA 1RGQA 5FCKA 3RXDA 1OWJA 3RM2H 2VIQA 2KCAA 1K22H 4P00A 3RXUA 1DE7H 1CA0B 1DXPA 3F9FA 1CT0E 4FU7A 4AX9H 1IQJA 1OP2A 4ASUD 1C5YB 2V0BA 3F3BA 3TK9A 1TX8A 3F0OA 4CRAA 2ZTXA 4XBBA 5GCHF 3U1IB 1ESTA 1T7CA 1HAGE 3EE0B 3PWBA 4UFGH 8KME2 1GI5A 4HGCA 1CHOG 1FPCH 8GCHF 1UCYH 1GBDA 4MLFB 1O2MA 2J5UA 1PJPA 1O2XA 1ELVA 4NSYA 6CHAB 1O5DH 4QT8C 2FI5E 1ZPCA 1NPMA 1GBEA 2G81E 2C93B 2YNAA 2W3KA 2KAIB 4ISIH 4BAMB 5DSFA 2ZDKA 1HAHH 4DOQA 1TNGA 2H9EH 2UUYA 3F9EA 3A8DA 1W7XH 1NRPH 5C1YA 3A86A 5L6NH 1AVWA 4FUEA 1SGPE 4GPGA 3AAVA 1OSSA 5DP7A 3UNQA 1FY3A 1QFKH 1C2GA 4O3UA 2FI3E 1AFEH 3OX7U 1A0JA 1W0YH 2HLCA 4UEHH 4LZ4B 1O3GA 2BDYA 1UK3A 2ULLA 2JH0D 3M5MA 1AFQC 4MTBA 2BXUH 1FX0B 3FO8D 1JIMA 1AGJA 2CF9H 1TGBA 2GCTB 1M9UA 2GX4A 1O3EA 1ZTJA 3LU9B 5EODA 2QXIA 5DGJA 4E7RG 4KELA 1ELBA 2QF5A 2UWOA 4WF8A 1FAXA 1GI6A 2SFAA 2FEQH 4KTUA 4RI0A 1GVZA 2ZGJA 1V2NT 3PTNA 2QGRA 5EJLA 3DUXH 1GHYH 1WAYB 1WTHD 4JCNA 1O3IA 1MTNB 4X1PU 4MPVA 3A81A 2W26A 1C5PA 1GBFA 1RD3B 2QAAA 1IQHA 3SOSA 1YLNA 1O2YA 2BX3A 4CH8B 1GI8B 1DUAA 2BHGA 3GYMA 3OY6U 1CA0C 1J15A 3O8RA 1GCTB 1TOMH 1O3FA 3RXTA 1O31A 1T31A 1SLXB 1NRNH 1O2TA 1O5FH 3NXPA 1O3JA 2RDEA 1HAPH 2HALA 1OKXA 3ODFA 3SNDA 4JZIA 1SG8B 3NKKA 1HJ8A 4BTTB 4RKJB 3NRLA 3L3TA 4NA9H 1NRQH 2GJGA 3PROA 1T4VH 1FPHH 2QF4A 1TYNA 2G8TA 4Q63A 1F92A 5EW2H 3MH6A 5GJ4B 2FTLE 1O2GH 2R2MB 1GHVH 2IJOB 1MKWK 5A0BA 3SJ9A 1GI3A 3K2UA 2BMGB 3A7XA 3P8FA 1RTKA 3MU0A 1Y3WA 2DUCA 1EB2A 3SW2B 2Q6GA 5J4SA 1PQ5A 2H9HA 2PW8H 1K1OA 1A5IA 4X0WU 4X6NA 2FO9A 1SMFE 1D6WA 3M7UA 2G5NA 3OU0A 3TGJE 3LPRA 1P3EA 1GL1A 1Q31A 4IS5A 1GHZA 3HGPA 3T25A 4K69A 1WOFA 2JETB 3URCA 4X6PA 4JZEH 4B6FA 1BCUH 3I78A 2Y80A 1IQIA 1KLJH 1QB6A 4YZUA 2ZNKH 1CBWB 1DSTA 1SGYE 1DM4B 1OWHA 4WY3A 2J95A 2O8MA 3LIWA 1P09A 4X2XA 1QA0A 1V2MT 3UQVA 1YLDA 1Y3VA 3SNAA 2NU4E 1WU1A 2HRVA 3BTFE 2Z94A 4OGXA 1QQ4A 4MPXA 2A4OA 1GJAB 3UNRA 4OS4A 3SGQE 2FPZA 3GCHB 1ETRH 3TK6A 3HKJB 3U8RH 1YCPH 3SUDA 4CBOA 1HGTH 1MTNC 3PRBA 2CXVA 1QA7A 1HIAA 1THPB 3VB7A 4TYDA 5IDKA 4DT7B 2UWLA 1BB0B 3VGCB 1S6HA 3A83A 1EAXA 1FY4A 1K1MA 1UTJA 3T27A 2P94A 1GCTC 3VB4A 2O9QA 1TPAE 5EIYA 3RU4E 2Y5GA 3BEFB 1PQ7A 1IQMA 2KM0A 2QXHA 2BM2A 2BVSH 1C1SA 3PV4A 2RA0A 3DD2H 3ZVDA 2F9NA 2F9BH 3LOXA 4FUBA 2AFQB 2THFB 2RA3A 2WV4A 3NK8A 1CSOE 1O3HA 1V2LT 1DLKB 1G32B 1QJ6B 3MNSA 1BZXE 1QJ1B 3QZRA 4XBCA 2BD8A 1YGCH 1WDIA 4OS7A 2B8OH 1NT1A 1MKXK 1NZQH 3A7ZA 4NA7A 1D4PB 1C1PA 1UVTH 2O8WA 4UE7H 4I8GA 4Q4LA 1O35A 4O9VA 2P3UB 4WMDA 2ZFSA 2JETC 1V2OT
chains in the Genus database with same CATH topology
1DFPA 2ZFFH 3TJVA 3M5LA 4KKDA 1CBWC 3BIVH 1O3MA 2ZDAH 2A2XH 4AOQA 1MU8B 3U9AH 1AHTH 2R3UA 2FYQA 1LQEA 3ZVCA 1MQ6A 1Y8TA 2XNIA 1UTMA 1EJNA 3EAJA 4MNXA 1VZQH 4GSOA 5GIBA 4FVBA 3V12A 4U30A 1A61H 1A5GH 4ZMAH 2XC5A 3ZVGA 1ZLRA 3EA8A 1L4DA 2XBVA 2V3OH 4B74A 3QK1A 3RUOA 4GLYA 1TNLA 2VWNA 3M7TA 1H9IE 1QRXA 1GHWH 1HAZB 4I32A 4D76A 1NESE 3U8TH 1UTPA 1P05A 3VGCC 3MYWA 3ZVBA 1V6DA 3AAUA 2ZGCA 3ZZDA 5JBCS 3BSQA 1SOTA 2BD3A 4A92A 1TNKA 3LONA 4I8JA 3ZVFA 2XBYA 2WUCA 4NWKA 5EOKA 1P0SH 3M3SA 1O2OA 3TGKE 1C5TA 1EOJA 1QTFA 1NC6A 1S0RA 1C1OA 2FI4E 4Y8XA 3FP7E 1YLCA 2PKAA 3QWCH 1HDTH 1P3CA 2P93A 1FI8A 2QIQA 1P2MA 1QY6A 3IITA 3SUGA 4Y79A 1SGIB 1NFUA 1FUJA 3QO6A 1EXFA 3SBKA 4WXVA 2BD4A 1BBRH 3UFAA 1BHXB 1GI2A 1TE0A 3E6PH 1WSSH 2LNCA 1WQVH 2QV1A 3A7TA 4E7NA 1GHAF 4JYVH 1Y5BT 2QXGA 2AH4X 1YC0A 7GCHF 2ZGHA 1C4U2 3EDXB 1PPBH 3RXQA 2WYGA 1GMCF 3PM3A 1XVOA 1CGIE 2F3CE 5EPNA 1OWDA 1B5GH 4X2YA 1G3EA 1RJXB 2BY6X 1IQFA 1FN8A 5DPAA 3QLPH 2ODPA 2PKSB 1LKAA 2ZGBH 5C1UA 3TH2H 2Z9LA 3GYLB 1C1RA 4D9RA 1K1NA 5GXPA 2QA9E 2XCFA 4Y0YE 2BDBA 4WVPE 5JDUB 1VITF 2GT8A 4THNH 1A0LA 1LMWB 1GBAA 2AIPA 3TH3H 3PMBB 1DLEA 2ESTE 3FANA 3QGNB 3HK3B 1Z8JB 4GVUA 1C4V2 1O2IA 1FXYA 1ZJDA 3BTTE 3LGUA 1QRZA 3B9FH 1NY22 1GI0A 4DURA 2F9VA 4RN6A 2J34A 1GJCB 1O2SA 3KQDA 1AIXH 1K1PA 2RG3A 2CGAA 3SNEA 4O3TA 4Y8YA 1RXPA 2C3SA 4O03A 1INCA 1DX5M 3BF6H 2SGFE 3RMLH 1ABJH 2GDEH 1ELCA 2H2ZA 2ZQ1A 1F0RA 2TRMA 4BXWA 2G51A 3BIUH 5EXMA 4IN1A 2I6QA 5K7RA 4A5TS 3HKIB 1G37A 3SV8A 5FPYA 1SI5H 2XWBI 2ALVA 4ABBA 1H9HE 1AY6H 4K8BA 2CN0H 1O39A 2VH0A 1GL0E 1HB0B 2B0FA 1C2LA 1ORFA 4D9QA 2SGAA 2ZFTA 4BAKB 1BT7A 3SU0A 1FY8E 3URDA 1KDQB 3Q3YA 3GY3A 1AO5A 3TU7H 1SBWA 3E8LA 2QYIA 3SNCA 5I25A 1C9TA 5DG6A 2J92A 3E0PB 2G52A 4ZXYH 3UOPA 1BHXF 2ZF0H 3ENSB 1UVPA 5C2ZA 2GTBA 4A7IB 4B73A 1XUIA 4E06H 2VWMA 2XRCA 1ANDA 1C5OH 2QXJA 5FPTA 1P04A 1VGCB 2ZDNA 1EAIA 1DXWA 1MUEB 1FV9A 1XKBC 4A1XA 3A82A 1UTQA 1Z1JA 1TB6H 4GHQA 4ZROA 5LGOA 1TPPA 1WV7H 1GVKB 1YPHC 2OQ5A 2VGCB 1TA6A 1L1NA 1ZRBA 5EW1H 3DT0H 2BLOA 2O8TA 5K0HA 4INHA 3RXIA 9LPRA 1TOCB 1U6QA 5EGMA 1W8BH 5HGGA 3SGAE 1OPHB 1UK4A 4OS1A 5AHGH 2QF0A 1Z7KA 9ESTA 1A3EH 5EQSA 3STIA 2PFEA 1KXBA 3RC5A 1F7ZA 1HCGA 2XXLA 1VJAU 1C5VA 4JZFH 2FOFA 1W14U 3GDVA 1NFXA 1P2OA 2FOEA 1T8LA 1PQAA 1T32A 1YF4A 2AYWA 3A7YA 3FVFB 3JZ1B 4XFQA 1SL3A 2CJIA 3C1KA 2VINA 2OC0A 3VPKA 4GAWA 3A8AA 2G5VA 3D23A 3P8NA 1GI7B 1QL8A 2VIVA 4ZKNU 2PGBB 3ZYEA 2EA3A 1YKTA 2OCVB 2ZEBA 3MU5A 5DP8A 1AZ8A 1NFWA 1YPMH 1Z8GA 1G3BA 5HMAA 3B23B 3O8DA 2WPLS 4YOIA 3S9AA 2WPKS 3A7WA 4JK5A 2FWWA 1O2NA 5TJXA 3LC3A 1EKBB 1A0HB 1GJBB 1JOUB 1SFIA 3GISB 1C5WB 2UUKB 1CHOF 1XKAC 1YM0A 2Y81A 1LDTT 4Y7AA 4WH8A 1ARCA 3MI4A 1VGCC 1SSXA 1TQ0B 1ZSLA 3P6ZB 3NPSA 1K28D 5T3HA 3VXFH 1CT4E 1H4WA 1O3PB 1O2LA 3Q77A 5FAHA 1DOJA 1EOLA 4JMYA 3KEEA 4Y6DA 4KP0A 2VNTA 3GY7A 2C8XB 1ANEA 2H9TH 4CRCA 3F6UH 4IC6A 2VB0A 4Z6AH 2BDGA 2Y5HA 3M36A 1E34B 3MTYA 4MDSA 1B0EA 1ABIH 1GI4A 1DWDH 4IBLH 4TY7A 4KTSA 1UVOA 3UUZA 1ELEE 1TFXA 2WV5A 2ZFRH 2AGEX 2FOHA 1O3LA 4ABAA 1NFYA 1GBMA 1ZHRA 3SUFA 2FZZA 1ETSH 2OC8A 2C8YB 5LPRA 1DS2E 1VCQA 2GV6A 4X8UH 1GMDG 3BTWE 4Q7ZA 5GPIB 3RXJA 4K3JA 3ESTA 1MBQA 1A3BH 2C8WB 1KTTB 3PYHA 2A7HA 4O97A 1EAUA 2G4TA 1O3KA 3RM0H 5DKMA 4UFDH 5JBTA 3GOVB 2BDAA 3RXFA 1BRUP 1ZHMA 5AFYH 3VB5A 1TALA 1EASA 1V2JT 3SORA 1UTLM 1LHDH 4YLQH 2R2WU 2FIRH 4AGKA 1A5HA 1KLTA 3F68H 1HXFH 2V3HH 2AMQA 1AB9C 4DG4A 2F83A 4CRGA 2VVCA 1D3QB 1GGDB 1KYNA 1FIZA 1SGDE 5C20A 2D26C 3RXAA 3LC5A 5LPFA 3V13A 1J16A 5T6DA 2Y82A 2BXTH 4NCYA 2GVFA 1HAYB 3LGIA 2TIOA 2ZGXH 4DIHH 1G9IE 1THSH 1HAXB 1KSNA 3P95A 1T8MA 5E0JA 2GMTB 3SO3A 1MZAA 2A5AA 1O3NA 1A7SA 1MBMA 1G36A 2AGGX 3BTME 3HATH 2BTCE 3SI4H 3PMJA 1GJ7B 1K1JA 1HIAB 4MNWA 5FXLA 3T26A 1CT2E 2P3TB 2A4RA 4MNYA 3UWIA 1N8OB 3TIUA 4CREA 3MFJA 1A46H 1PFXC 1PPFE 1ANCA 3V7TA 3SN8A 1VITH 4X6OA 4Y10E 1LPGB 1BITA 3EA7A 2ZO3H 2ZU1A 5TCCA 4OGYA 4NGAH 3PB1E 4CBNA 3PWCA 3M3TA 5B6OA 1NROH 1RTFB 6CHAC 2EC9H 3F9HA 4NSVA 3VB6A 2QCYA 2STAE 4AZ2B 3S69A 1EZSC 2BDCA 2ZTYA 5F6MA 1L1GA 2FESH 2Q6DA 1SOZA 1C2EA 2Z6BD 1O2UA 3L6PA 5FPSA 1OOKB 5EU8A 1OWIA 2WPMS 1AQ7A 3RU4D 1HPGA 4CRFA 1V2WT 4CR5A 5HM9A 5BRRE 2XBWA 1DDJA 2ZU4A 4K1SA 4AFUA 1HBTH 2GD4B 1OP8A 1CHGA 2A5IA 4OS2A 1TPSA 1AUJA 1TX6A 1A4WH 2BQ7B 4Y71A 2HNTF 4GCHG 1WYKA 1GGDC 1Q2WA 3FFGA 1QGFA 3RXLA 4K2YA 2GCTC 2NU1E 3ZV9A 3LT3A 3D65E 1BIOA 5AFZH 1BMAA 1TIOA 1J17T 3A8CA 5DP3A 1LKBA 4BTUB 4LOYH 1ZOMA 1DWCH 1O2KA 1FZZA 2XC0A 2XTTB 4ASHA 3HPTB 3ZZAA 2C4FH 1PPCE 4AG1A 4K8YA 1OYTH 3GDUA 2FX4A 2FS9A 1NS3A 3U8OH 4A1TA 3BV9B 1K1LA 1YYY1 1Y3XA 2VWOA 4ZAEA 1DUEA 5A8YA 2BQ6B 4X8SH 1TRMA 2ZU5A 1GBIA 1V2RT 5DJ7A 1RFNA 4MPWA 1TRNA 2ZPSA 4WJG2 3BTEE 3KL6A 3C27B 2SNVA 1G3DA 1SGQE 2XBXA 1XUGA 1O3BA 4R8TB 1TLDA 5C1XA 3CS0A 1N8OC 3SHAH 3S7KB 2BYAX 1EUFA 3KIDU 2BZAA 2F91A 3ZVEA 1XVMA 3ZV8A 3UY9A 1ZPZA 2WUBA 2ZP0H 4YESB 4DW2U 4IC5A 1C1VH 1GDNA 2VJ1A 3SV7A 1SQAA 2AEIH 3KN2A 3MU4A 2HPQH 1C5UA 3ZVAA 2TGTA 1WBGB 1NU7B 3DHKH 3MWIU 5GWZA 3RMMH 3SV2H 4X2WA 1D6RA 1ETTH 4ABDA 2PKAB 1WUNH 1W7GH 1GJ4H 1O2HA 3MNBA 1ZMJA 2PUQH 3MNCA 3RXOA 2Y7XA 1V2VT 4ZKSU 1C2FA 4B71A 3A87A 3KNXA 3MHWU 4YM9A 2XC4A 4PROA 4ZKOU 3M37A 2P3FH 2FOCA 1T8NA 2I6SA 7ESTE 5DK1A 1QQUA 3ZZBA 1IQEA 2XW9A 2FLBH 3BEUA 1TWXB 4IN2A 1TGTA 5E2PA 1X7AC 3FP6E 2Z3DA 1KXEA 1P10A 2Z9JA 4ZHAA 3SHCH 3LGVA 1HV7A 1YPLH 2W3IA 2C8ZB 4TY6A 1GHBG 5E8EH 3E1XB 4BAHB 1AKSA 1JBUH 3TK5A 3N7OA 8LPRA 1P2IA 2TGAA 4INKA 2ZIQH 3Q3XA 3GCHC 2BLWA 3GCTG 4NIYA 1Y5UT 3E0NB 1C2KA 1P2NA 1MKWH 4LXBH 2FDAA 1FY5A 5EXLA 3LKWA 1NTPA 1KIGH 3H5CB 1RRKA 1IOEA 4J2YB 2GZ7A 2GT7A 2GCHG 1C1QA 2FYRA 3KGPA 3L33A 4YOJA 1O32A 2ANKH 2H1UA 1P2KA 3BN9A 2B5TB 5IYTA 2J2UA 4FU8A 2JH6D 3H7OA 1S0QA 4CHAB 2H5DA 1K1IA 4A1VA 3ATLA 2ZWLH 1GBKA 4JK6A 1AU8A 1MTWA 3D62A 4AN7A 3A7VA 4Z0KA 4X1SU 1EPTA 1T4UH 4UONA 3SZNA 1HXEH 1AWHB 4Y0ZE 3RP2A 1OP0A 5A8ZA 3O8BA 1QURH 3M3VA 1GG6B 1QHRB 1P2QA 1ZPBA 2PGQB 2FP7B 2BDIA 5C5NA 1W13U 3QDZB 4NA8A 2CHAB 3EA9A 2ZFQH 1AUTC 1P01A 3QTOH 1F5KU 1ESBA 1C1UH 1SLVB 3MNXA 2ZCHP 1HUTH 1UK2A 3GICB 1O3OA 1DVAH 2NU2E 5L2ZH 1O34A 4X8TH 3A89A 2A4GA 1GJ8B 1V2UT 3TGIE 1GBCA 2VIOA 4BANB 4UFEH 2GV7A 4ABGA 3QX5H 3TNTA 1DWEH 1O2QA 1ZSJA 3CS7A 2OD3B 1XX9A 2TBSA 1GMHG 1EP5A 1BQYA 1PPZA 4WMEA 1BTZA 3SI3H 2BX4A 4NZLA 1ZMNA 5E0HA 1SFQB 2ZDVH 3BTHE 1THRH 1AMHA 1FDPA 2Z7FE 4AYVB 2QY0B 3QGJA 6ESTA 2ANMH 1TA2A 2OLGA 4AFZA 3M7QA 1YPHE 3T28A 3U69H 4KGAA 1MKXH 1LO6A 4BOHA 1L0ZA 1GDQA 2STBE 3B8JA 3A8BA 4AB8A 4FXGH 5FHTA 4FU9A 1ELFA 4I8HA 4FUHA 2PHBA 3GY4A 4AGJA 4B76A 4Y11E 2FOBA 2OBQA 1WQSA 5E2OA 2OUAA 1C5LH 4NG9H 3LJOA 1HJAB 3E16B 1ACBE 3ELAH 1PYTD 2FM2A 5EPYA 2FOGA 2ZDLA 1P12E 1CU1A 1NO9H 3GCNA 2BDHA 1FN6A 1DWBH 1GG6C 3RLWH 1ID5H 1AVGH 4D7GA 3UQOA 2AS9A 2XYAA 3TJOA 1IQNA 2CHAC 1TGNA 5AF9H 1AZZA 1K21H 3P8OA 1OX1A 3FZZA 4ZH8A 1DITH 3LDXH 3PMAB 3EYDA 4JZ1A 4NWLA 3U98H 5JB8S 4I8KA 3TLOA 2AMPA 2G4UA 5ETXA 3ITIA 1VITG 8ESTE 3SJKA 2ALPA 3RXEA 5JYIA 4DCDA 2VH6A 2ZDMA 3BTDE 2SGDE 1UJ1A 4ZXXH 2WPIS 4JYUH 1UCYK 2D1JA 4GUXA 2W5EA 3S9BA 1F0UA 1D9IA 4HI3A 4TWWA 1C1TA 1V2TT 1KTSB 1V3XA 2PKSC 4ZHLU 1C1NA 1LQDB 1BRAA 1TMUH 2SGPE 2ZKSA 3BEIB 1OWEA 4XSKU 4CRDA 4BNRA 4Q7YA 4NIVA 3QUMP 1ZGVA 1IHTH 2Y6TA 2BB4A 4B1TA 4F4OC 3KHVA 3KQCA 3ZZ8A 2OXSA 5C5OA 1QCPA 3RXRA 1J8AA 1ZMLA 2JKHA 1BJVA 1ZTLA 3LGTA 1QB9A 1C5SA 1SLWB 4VGCB 1V2ST 2K1QA 3ATIA 5H4IB 3S0NA 3RMNH 2Q1JA 4JZDH 1W11U 1TGCA 1XM1A 4WXIA 1BRCE 2FTMA 2P16A 5F8ZA 1GJ5H 1P02A 6GCHG 4MQAA 4AFQA 1MTVA 4YT6H 2ILNA 4U2WA 3ZZ7A 1KXCA 4XOJA 1BTWA 7LPRA 1SLUB 3LGYA 1UHBA 1HJAC 2ZHWH 1YCPM 1L1JA 2QF3A 3P8GA 1QBNA 3I77A 3PLKA 4AFSA 3BTKE 4I8LA 5A2MH 6LPRA 1FY1A 1SGRE 4B75A 4CH2B 1E35B 3K6YA 2O8LA 1OXGA 2ZQ2A 1DY9A 1F0SA 1YPKH 1F2SE 3KQBA 1UTNA 1K9OE 2CMYA 4K1EA 1SQTA 1L4ZA 1O30A 1P8VC 4D8NA 5DP4A 2D8WA 1EZQA 3P92A 5EQRA 1ANBA 1UO6A 1E37B 1GMDF 2A7CA 2ZCLP 4X1RU 4DJZB 4R0IA 2Z9KA 2XWAA 2A4QA 4Q7XA 3E91A 1FMGA 3CP7A 1IQKA 2EEKA 3SU4