4FUJA

Crystal structure of the urokinase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 63
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fujA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fujA01
4K1EA 1YM0A 1F5RA 4ABJA 3MFJA 4YOGA 3PLBA 2TRMA 1Z6EA 2P93A 3SV9A 3V7TA 5DO4H 4J1YA 1NROH 1O3JA 1TRNA 1UTJA 2AMDA 2A0QB 3ZVCA 2Q1JA 1FIWA 1UO6A 4MNWA 1SLUB 5GIBA 1MTWA 3SJKA 4OS6A 2ZWLH 2G81E 3GYLB 1EPTB 5T3HA 2ANYA 1DDJA 2R0LA 4FUGA 1AIXH 1S5SA 2F9OA 3SJ9A 3VGCC 1TOCB 3D23A 1GJCB 1B7XB 3K9XB 2TGPZ 2HOBA 5C5NA 5JYIA 1GI3A 3BEUA 4SGAE 4D9QA 1ELBA 2ANMH 4NZLA 3T28A 5HYOA 5HM9A 7LPRA 4D76A 1SGFG 1FI8A 3K2UA 4X2VA 5A8ZA 1QJ1B 3BTGE 1FAXA 1ORFA 3ZVDA 3RLWH 1GI6A 1EXFA 1BHXF 1YPGH 3SU2A 1ANCA 4ZKNU 2VWLA 1AMHA 1SG8B 1SPJA 3KHVA 4X1RU 2IN2A 4AB8A 3ITIA 5HXFA 1GMCF 1UK2A 3RC5A 3TJUA 1O37A 3RXDA 5DG6A 4XDEA 2GCHF 4ZHAA 1L0ZA 3NUMA 1C5LH 4TYDA 1NM6A 4NIXA 1AE8H 2AGGX 4DVAU 1UTOA 2TPIZ 1KTTB 3QTOH 1V2VT 2RA3A 3UWIA 3BV9B 1C4V2 2FI4E 2BD9A 2XTTB 3PROA 4JYUH 3VXEH 2PKAA 1FNIA 2QN5T 2XCNA 4WY3A 1D3DB 1EPTC 1W12U 1PQ8A 3PMJA 1O2LA 2Q6DA 2EC9H 1C1RA 2VWMA 1EPTA 1AKSB 1P9SA 1HAGE 2B9LA 8GCHF 2GMTC 1Q2WA 3BEIB 1CE5A 4JZEH 3ZZ3A 1O3LA 1O5GH 3M36A 1DM4B 2A7HA 2J4IA 5IYTA 2J92A 3UY9A 1SLXB 2WPIS 1G2MA 1HGTH 1OYTH 2BXUH 4FXGH 4YZUA 1GJ5H 2ZF0H 2QV1A 3C27B 4TWYA 1UCYE 3IWMA 1O2VA 1JXPA 1SGCA 1TNJA 2ZGBH 3MH7A 5EXLA 3RXIA 4O9VA 4AFZA 2ASUB 1TPPA 5DP9A 1AZZA 3P8GA 1MUEB 1O30A 4X6OA 1Z7KA 3ENSB 2Y82A 3UR6A 2CMYA 1BBRH 3KQCA 2XBXA 2CJIA 5L6NH 4CBOA 1MAYA 1W7XH 3AAVA 1LO6A 1P11E 1TQ7B 2ZPQA 1DUAA 5ABWA 1LPZB 1TLDA 1XUHA 2VJ1A 2XC0A 5T6GA 4YM9A 1A0JA 1UTPA 1WAYB 3EAJA 3EA9A 2O9QA 2XYAA 3GOVB 2W7SA 2VGCB 1GI9B 3MWIU 1NRQH 1Y5BT 2WINI 2ZU2A 2WYGA 2ZTYA 1C4Y2 1MCTA 1V2RT 3UOUA 3F9EA 1EZQA 3DFJA 1NZQH 3N7OA 1C2JA 1FZZA 2G51A 1D3PB 4CR5A 4B2AA 2R3UA 5C1XA 3U8TH 4GHQA 4ZKSU 3QO6A 1F92A 1ZJDA 3MU1A 3SI4H 2VWNA 1NTPA 4AGJA 1HAIH 3ZYDA 2Q6FA 2ZU4A 1KDQB 2A7CA 4ABBA 4AX9H 4LK4A 2WUBA 2J9NA 1THSH 3LJOA 4O03A 3E90B 1UJ1A 4O3TA 3RP2A 3O8DA 1P10A 4F4OC 1DVAH 2XBVA 1MQ5A 1P0SH 4NFFA 1OWDA 2FO9A 5C5OA 4AG1A 1ACBE 1MZAA 1ELTA 1C2KA 4B2CA 3RXAA 1YP9A 3SO3A 3P17H 1RD3B 4I8JA 4F49A 3RXGA 4O97A 2BD3A 1TOMH 1O2SA 1BRBE 1O3EA 1C1MA 3DFLA 3SUGA 3RLYH 1PPZA 3RMMH 1AUTC 5DP7A 1MH0A 2Y5GA 2DE8A 5E0JA 2VGCC 1TGSZ 2H9TH 3AW0A 3MU0A 1A7SA 1C5XB 4KTUA 1EAXA 2VU8E 1C5VA 2WYJA 1NU9A 2XWAA 2AS9A 1HFDA 4DGJA 1ARBA 1XVMA 3ZZ5A 3EQ0H 1LTOA 5CMXH 1GJ6A 7ESTE 1BIOA 1LKBA 1G3DA 2BLWA 3LGTA 3VB4A 2XRCA 5GXPA 2ZTZA 1X7AC 3GICB 2BD5A 3MH5A 4ABEA 3A85A 4X8TH 1XUGA 4U32A 2VWOA 4X1SU 2D26C 1J8AA 2BYAX 4YLUA 3Q77A 2A5KA 4JYVH 1KDQA 2GDEH 5E0GA 4FUFA 2ZHQH 4WWYA 3TK5A 1LHGH 2ZC9H 3T5FH 4RKOB 3ATLA 1A5GH 1LKAA 2YNAA 1W0YH 1GI5A 1P09A 6LPRA 3SU6A 3A87A 1BMNH 2A2XH 2F9VA 3U1JB 6ESTA 4K5ZA 3V3MA 1Y3WA 2ZU1A 3W94A 3MYWA 1HRTH 1FLEE 1TBZH 1XUIA 1GHXH 1YCPH 1GVZA 3FZZA 2I6SA 1O3GA 1P2NA 1HXEH 1ABIH 4VGCB 1MU6B 2P16A 3NKKA 2RCEA 1SGIB 3A8BA 4YLQH 3S7HB 2OBQA 2FYQA 3KQEA 2K1QA 2GCHG 3LDXH 1EUFA 4XBBA 3SNCA 4R0IA 4AFQA 1HAPH 1ZRKA 1QJ7B 2VNTA 1O2QA 4INLA 3ZYEA 2AGEX 3DT0H 3BF6H 1OYQA 4IMQA 1Y8TA 4NSYA 4A6LA 3NK8A 1CT4E 2PR3A 1GBIA 1BBRE 3FP8E 1PJPA 3BSQA 5DP3A 2FS8A 3ZZ4A 1XXFA 1C5ZB 4ZAEA 4JK6A 5TJXA 2J94A 4TPIZ 3ZVGA 1LHDH 5DP6A 1O2HA 2F9PA 5HGGA 1MKXH 1G32B 1LHFH 8GCHG 4CRDA 1TX6A 3HK3B 1P02A 3LH1A 2A7JA 1PFXC 2VVUA 2LPRA 1CT0E 2Z7FE 1DOJA 2ZHFH 1O32A 1O3HA 1W10U 2ESTE 2GT8A 3R3GB 4RN6A 3PWBA 2BOHB 4CRCA 2VB0A 2ZDKA 1VGCB 1HUTH 1C5UA 2HPQH 5FPYA 1AVXA 2OQ5A 3IG6B 1KLIH 1NESE 2XC4A 1J14A 1FMGA 1ZMNA 2QCYA 3GCOA 4VGCC 1ZHMA 3FAOA 1ZPZA 3BTHE 1V3XA 3SNAA 1AZ8A 2J34A 2R2MB 2QC2A 1A3BH 1QR3E 1P9UA 1HV7A 2ZIQH 5JB9S 3A8CA 3VXFH 2PTCE 3QGJA 4INHA 5BRRE 1O3CA 3A88A 4XBCA 5T6DA 5EGMA 2ZGHA 2AMPA 1HIAB 4MG3A 3UREA 2BM2A 5FPSA 3RMNH 4MDSA 3RM0H 1EB1H 2UUKB 1AQ7A 5C1UA 1IQNA 1WQSA 1EOLA 1CT2E 3OSYA 4BANB 1V2MT 1O2NA 2FEQH 5E2OA 5K7RA 1MBQA 2AIQA 4AORA 3RXOA 4AG2A 2BQWB 2P3TB 1DT2A 2ZFSA 1EQ9A 5LGOA 4GPGA 1B0FA 1C2LA 1V2TT 2NU3E 2NU2E 4UFFH 5A8YA 1AGJA 1PQAA 1YPHE 1SHYA 3SGQE 2ZDAH 3NPSA 4FU9A 1WYKA 1VGCC 1P2OA 1DLEA 4GUXA 1O2GH 2BD8A 5DPAA 1W2KH 1RFNA 1SB1H 2PGBB 1Z8RA 3K65B 4FVBA 4Q7YA 1BTUA 1YLDA 1LVBA 2CGAA 2Z6BD 3SJIA 1YLCA 1O2KA 3TH2H 2ILNA 1O5DH 3MO3A 1RXPA 1PQ7A 3LU9B 1QL7A 1JRSA 1U6QA 5CHAB 3I29A 4AGKA 2GV7A 3NCLA 5LPRA 1JIRA 2EI7A 3S9BA 4I31A 1KLTA 3FVFB 1ABJH 1GJ9B 3E16B 1NFYA 1WBGB 1GJ7B 5GJ4B 4QT8C 4ZMAH 5JBTA 1HIAA 1TNHA 2BY5X 2C8ZB 2FS9A 1TPSA 3SNBA 1CA8B 1HYLA 4TPYA 3KN2A 2BD7A 1AO5A 1WCZA 1O2MA 3JZ2B 1LVOA 1NFWA 1BTWA 2C8WB 2CHAB 2FOFA 1UMAH 4JZ1A 3SQEE 1BJUA 3BTWE 5A8XA 1ZLRA 4Y76A 2BLOA 1SQTA 3RXJA 2UWLA 5FBEA 3VEQB 1VCPA 4OS5A 2FWWA 1F0TA 3ATWA 1ZTJA 1ZZZA 5C20A 1C9PA 1J16A 1Y59T 2G00A 2UUJB 1CA0B 3S69A 1NY22 3NZIA 1VJAU 2ANKH 1ZPCA 1A2CH 3BTKE 3VGCB 3HPTB 2ZU3A 2HLCA 3A82A 5FCRA 1O2IA 2D1JA 1K9OE 2GCTB 2FOMB 3SZNA 1AD8H 4MVNA 1DWBH 1HLTH 1EZUC 5CHAC 4BAQB 3S9CA 1C5MD 4K2YA 4AYVB 1DY8A 2GT7A 1ZTLA 4FUEA 1LCYA 3GDSA 3M3TA 1SQAA 1YPMH 1ZMJA 3A7ZA 3RMOH 4H4FA 1G3EA 1TMUH 2B7DH 1MKWH 2BVRH 4CRBA 2LNCA 1ELEE 1TBQH 1O3FA 1UHBB 1KXBA 1CGIE 4BAMB 2A4GA 1SGTA 1W11U 2EA3A 2PSXA 1OX1A 3QDZB 3TJNA 1TNKA 1C1SA 2A5AA 2BB4A 2CHAC 3B23B 2ZO3H 1UTMA 3VB6A 3BTDE 4ASHA 4K60A 1HAYB 3UPEA 1WQVH 5DGJA 1FXYA 1O2JA 3SU4A 3A80A 1C5PA 1EJMA 2R0KA 3RXBA 3B9FH 1O3IA 4NWKA 2PLXA 1MBMA 5AFYH 2A31A 1FN6A 2ZGJA 4D7GA 4XOJA 1Y3XA 1T8OA 3TJVA 3UNSA 5JBBS 1GCDA 4MNVA 1K22H 2ULLA 3NXPA 3TJOA 1B5GH 1CA0C 3SI3H 1C1OA 2VIDA 1TYNA 2GMTB 3RXFA 5L2YH 3T26A 3LGYA 1GJDB 4Y79A 2H9EH 1G37A 2GCTC 3EDXB 1SGFA 4ISLA 5DKMA 2O8TA 1GBHA 4X6NA 1QL9A 4K1SA 3M37A 5LH8A 1UVPA 1Y3VA 5EPNA 3A84A 1O39A 1DY9A 1P57B 1J15A 2STBE 3H7TA 1GGDB 3SV7A 1GDNA 3LKWA 4JCNA 3RXTA 3A86A 1Q31A 4UEHH 3RMLH 4IN1A 4JYTA 1W13U 3RU4E 1DWEH 4KKDA 3EGKH 4GAWA 3MI4A 3UUZA 1L4DA 1D6WA 1GDQA 5EPYA 1QRXA 3A8AA 2WV5A 1UHBA 2XBWA 2C4FH 4TY7A 3MNSA 2VH6A 1E36B 2FLRH 3PO1B 3K6ZA 4BXWA 3MU4A 4HI3A 2ZPRA 2EEKA 1SGNE 1K1JA 5FCKA 4B76A 5G4BA 1L1JA 2QYIA 1S84A 2FOBA 3TU7H 2BTCE 2ODPA 4UE7H 1BJVA 4FUIA 1XKBC 3M7TA 1H4WA 2UUFB 3TITA 4DW2U 1O2WA 3SHAH 2FDAA 1FUJA 1IQFA 2TIOA 2PW8H 3AW1A 1QB6A 1ETSH 1PPGE 2AMQA 1S82A 2OCVB 4NSVA 1W7GH 1P2JA 3M3VA 1UK3A 2BHGA 1JRTA 3F68H 1DXWA 2O8MA 2SGQE 3H5CB 4GHTA 1TA6A 1S81A 5DJ7A 4DG4A 7GCHF 2IPHA 1ESTA 1PPFE 4Y71A 2R9PA 4WMDA 4AOQA 4LZ1H 1MU8B 1GGDC 1CSOE 2Y6TA 3H7OA 1A61H 1H9LB 5GPIB 4X8VH 1MCVA 1QGFA 3PMHB 3E8LA 5CE1A 2FTMA 2R2WU 3D49H 2QXHA 1GHVH 3Q00A 4ISHH 4UFEH 1GG6B 2XXLA 4JZDH 2XNIA 2A5IA 3KNXA 2ZGCA 4Y11E 5TCCA 1TPOA 1WOFA 1WV7H 2P95A 2HNTF 1K1LA 3O8CA 4I8GA 2UWOA 2PUXB 2BZ6H 3QLPH 1HAZB 3W95A 2ODQA 3PO1C 1T8MA 5C2ZA 2A4QA 1UCYK 2PFEA 5E8EH 2CN0H 1ESAA 4MQAA 1FPHH 2ZFQH 2FOCA 1KSNA 1TNLA 3OX7U 2CF8H 3TK6A 1S6HA 1DE7H 5GWZA 2V3OH 3U9AH 3ATIA 3MH4A 4YO9A 2F3CE 1MTNB 1Z8IB 3IITA 1D6RA 3VPKA 4X2XA 2ZZUH 1V2KT 1LVMA 2ZQ2A 2G4TA 3DUXH 1C2FA 3E6PH 1BTZA 4BAKB 1QRZA 1P2KA 1HCGA 1TMBH 3QZQA 4Y6DA 3SV6A 2A4OA 3FFGA 1ZHPA 1AKSA 2VVCA 2Y81A 1OWEA 4K1TA 1A4WH 1GBTA 2FI5E 4MTBA 2V3HH 3L3TA 4O3UA 3KF2A 1W8BH 3BIUH 2ZEBA 3SU1A 1IQKA 1GHBF 3ZZ9A 2PKSB 1HAVB 4WVPE 2ZPSA 3U98H 4MPXA 1MTSA 1EX3A 1CHOF 2ALVA 1L4ZA 4YT7H 4R8TB 9LPRA 4LOYH 3PB1E 1ELFA 3PLKA 1S0RA 5B6OA 1GG6C 1SFQB 1THRH 5F03A 1VITH 3KL6A 3SUEA 2QGRA 3LONA 2OP9A 4K8YA 2Q6GA 1BHXB 3BN9A 3RU4D 4ABAA 3TH3H 3RXRA 1ANBA 1NFXA 3MTYA 3LOXA 4WH8A 2V0BA 5ESTE 2FM2A 2GTBA 2CXVA 8KME2 1ANEA 1DSUA 3M61U 3RC4A 1EZSC 2HWLB 2M5TA 4MLFB 1ZGIA 3AASA 1UTNA 2GX4A 3RXMA 1TGCA 6GCHF 5JBAS 1CQQA 3TNSA 1INCA 1MTNC 2ZFRH 1T31A 1E0FD 2OQUA 2WUCA 3CS0A 5DP8A 1BT7A 1LMWB 1RTLA 1T8NA 2SFAA 1H8IH 4Y8YA 2H9HA 2BQ6B 1O38A 1H8DH 4IN2A 1BTYA 4X2YA 4H6SB 1K1OA 3RUOA 1C2EA 2ALPA 1YPHC 2ZCKP 1SL3A 1FIZA 1F0SA 3P6ZB 3TVJB 5F8XA 1WUNH 2ZCHP 5I46H 2PKSC 4OS1A 4X0WU 2Y7ZA 1SMFE 3JZ1B 3F6UH 2FOAA 5AFZH 3BEFB 4OGYA 4AN7A 2GZ7A 4B74A 1TX7A 1HAVA 3TPIZ 3HATH 1V6DA 1T8LA 2GVFA 1FPCH 3RXKA 4DIHH 4B73A 4JK5A 4OS4A 3A7XA 3LPRA 1IQMA 3BTTE 2G8TA 1QURH 3SU3A 3ZVAA 1GBMA 3V0XA 1RGQA 3GY3A 1GI4A 1OOKB 1OP8A 1LQDB 3ATMA 2A1DB 1OPHB 2OUAA 3SN8A 2OC8A 2SGEE 2G52A 4NA9H 1QHRB 5C67A 1SSXA 1SGEE 1KLJH 3AVZA 1IQJA 2SGPE 2W5EA 3T2NA 1A0LA 4NZQA 4ZXXH 1Y3YA 1P06A 1SLVB 2XW9A 4Y0ZE 1YGCH 3BG4B 3WY8A 1PPHE 1V2LT 1MTVA 5DP5A 1AFEH 4DIIH 4Y0YE 1JBUH 1GMHF 1QBOA 5A0AE 2ZHDA 3U69H 1BITA 2PHBA 2ZDVH 4A1VA 5DK1A 2F9UA 1IAUA 2O8UA 3UIRA 1GL1A 3GY6A 4WF8A 2BD2A 1Y5UT 2I6QA 2BMGB 1C1NA 4H42U 4BOHA 5E0HA 1O33A 1AY6H 2SGDE 3SGAE 5EOKA 1TAWA 1ZGVA 3SNDA 1BTPA 1TALA 1C2DA 2WPKS 2QXIA 1P05A 3Q3KA 5EW2H 2QY0B 1HAOH 4NIYA 1QL8A 2KAIB 4LXBH 3LGIA 1NT1A 5T6FA 1O2YA 1BZXE 1ELGA 1QB1A 1TQ0B 1C5NH 1C1TA 1JWTA 1GL0E 3FZDA 3ESTA 4ABFA 1P3CA 7GCHG 1TRYA 2PTNA 1C1WH 1BBRK 1ESBA 2G5VA 2ZU5A 2BXTH 4Y7AA 3ZZ7A 2HNTC 5EQQA 3ZZ8A 5E2PA 3RM2H 2BX4A 1FY1A 1PPCE 3M5LA 2YNBA 5FHTA 4DY7B 3SHCH 4Y7BA 1T4VH 3T27A 1THPB 1YPJH 1ZHRA 1HNEE 2C3SA 4ZKRU 2A32A 2Z3DA 1ZPBA 3BG4C 5I25A 4CH2B 1EOJA 1GBAA 1O5FH 3SU5A 3S7KB 1GJ8B 1YCPM 2BLQA 2OXSA 3F1SB 4KTCA 2JH6D 3ZZCA 2QAAA 1C5OH 1C2IA 1BRAA 1UVTH 1O3BA 1BMLA 1DWCH 2G4UA 2D2DA 4IMZA 4GSOA 1AVGH 3PWCA 1QY6A 2B0FA 3KGPA 2FMJA 1ANDA 5GCHF 2FODA 3R0FA 1O0DH 1GI1A 2HPPH 2UUYA 3UWJH 3MH6A 1C1VH 1LPGB 5EU8A 2P3UB 3Q76A 1GHWH 4IC6A 1Z71A 5H4IB 1V2QT 1ETRH 3V13A 1GBBA 1TONA 1GPZA 4KELA 4E7RG 1P03A 4BNRA 4MPUA 1BMAA 3LT3A 3SJ8A 3A7YA 4AB9A 1EAIA 2KAIA 1K1MA 2BY7X 4FUDA 2WV4A 1V2JT 5DP4A 2B8OH 1GI8B 1GHBG 3VB5A 2ZG0H 4Z6AH 1LPKB 1V2OT 2BDGA 4B75A 1CHOG 3MO9A 5A2MH 4ZHLU 2WPMS 5K0HA 4GCHF 2OC1A 1AI8H 1P8VC 2ZFTA 2ZKSA 1O3NA 1K21H 2ZFFH 3ATKA 2BX3A 3D62A 1Y5AT 2P59A 1XUKA 1GHYH 4OS7A 4Q7ZA 2A45B 2ODYB 2QIQA 2JETB 1XUFA 1D3TB 1UVUH 1Z1IA 1MQ6A 1WSSH 1EP5A 4ABGA 1A3EH 4H6TA 3KCGH 3VB3A 4FUJA 4X2WA 1CU1A 6GCHG 3UTUH 1ZSLA 1NC6A 4FUCA 3OTJE 4TWWA 1S0QA 4OS2A 2W3KA 1H1BA 2H1UA 3GY8A 4M7GA 5EQSA 4DJZB 4K8BA 1O5BB 3MO6A 3GDUA 3RXPA 1EP6A 3ZVBA 1TX8A 1YC0A 1MD8A 3SV8A 1JMOH 2STAE 1MTUA 1VJ9U 3E0PB 8ESTE 3TGJE 1GBKA 1S83A 3KQBA 1O5EH 2GV6A 3HKIB 2AERH 2A2QH 4JZIA 1IQEA 3SBKA 1OWIA 3LC5A 1YBWA 4NGAH 5EQRA 1TNIA 3SU0A 1T4UH 1NPMA 5EXNA 4ABDA 1QBVH 2Y5FA 1YCPK 3S0NA 1HJ9A 1HPGA 2CF9H 1K1PA 1EATA 1FY5A 1SGQE 1M9UA 1FQ3A 1TFXA 4YT6H 1AN1E 3OU0A 4WMFA 2BZAA 5J4SA 3ZVEA 3P92A 3RXEA 4PROA 2JETC 1O5AB 2FPZA 1TBRH 2HNTE 2VINA 4A7IB 3SUFA 3FP7E 1E34B 1KXCA 3A7TA 1FY3A 4AFSA 1T7CA 5JDUB 2SGAA 3TGKE 1YPEH 1GBDA 4X1QU 1L1GA 1P3EA 1GBLA 1GJ4H 3RC6A 2Z9KA 1FAKH 2AIPA 1O31A 3I78A 1QTFA 5F8ZA 1PPEE 3SOSA 3ZV9A 4HGCA 1VITF 1SBWA 1GMHG 3P8OA 3GCTF 2FOHA 1ZR0A 2RDLA 2EI6A 2B5TB 5J4QA 1K1IA 2ZHWH 3MHWU 4TY6A 1DPOA 4KTSA 3KIDU 1PYTC 3M7QA 4WH6A 1MKXK 2G55A 3AAUA 1H9IE 3KEEA 2HVXA 2H2ZA 2PKAB 3LJJA 4BTIB 3QWCH 1C1PA 2QF3A 3EA7A 9ESTA 2HGTH 1RIWB 2HALA 3ZZ6A 1Z1JA 4A92A 4Y8XA 3UFAA 3URCA 3G01A 4B71A 1O3KA 2TGTA 1KIGH 4NIWA 1F2SE 3VB7A 1GMDF 2UWPA 3E3TA 2C8YB 5JPMH 2RA0A 1QA7A 1QQUA 4AFUA 1H9HE 1O5CB 4WXIA 1ELAA 2OC7A 4GVUA 4JMYA 1DLKB 1SOZA 3S9AA 2PWXA 1ZMLA 2GP9B 1QIXB 1RS0A 4UFGH 1SHHB 3CENA 4KGAA 4WMEA 1D9IA 2BQ7B 2HRVA 1QNJA 2Y7XA 2BDIA 1A1RA 5A09A 2Z3CA 4MNYA 4UDWH 3O8RA 4BTUB 2ZP0H 4CH8B 3UNRA 5F6MA 3UQVA 1F0RA 1NRPH 4X6PA 4ISNA 5F8TA 3TLOA 5FPTA 2Y80A 3UQOA 4AYYB 2OD3B 1QFKH 3TK9A 1O2ZA 1G2LA 1LQEA 1OWKA 2VH0A 3HGNA 1C2HA 3M5OA 1SFIA 1YYY1 1K1NA 1V2WT 2FP7B 3MU5A 4ZUHA 1OXGA 2FYRA 1XMNB 1O2RA 3UOPA 1RIWC 1TIOA 3M3SA 2Z9LA 1CHGA 1GJAB 5GCHG 1NO9H 4CRFA 1J9CH 5L2ZH 4U30A 3I77A 2A4RA 1HB0B 5AF9H 1IOEA 2IJOB 5FXLA 4FU7A 1IQGA 3MNBA 4THNH 3RXCA 3A81A 1OSSA 1SQOA 1FY4A 3RXHA 1SGPE 4CBNA 2AFQB 2QXGA 1C9TA 4FVDA 3SUDA 1TE0A 1BDAA 2W26A 4BAOB 3STIA 1C5SA 1DSTA 1YF4A 1BOQA 1RTFB 4XBDA 1G3BA 1PQ5A 3PLPA 4GCHG 1AB9B 1QCPA 2BDHA 5C1YA 4HFPB 1BCUH 1HXFH 1FY8E 4I8LA 1YPKH 4Q2KA 3GISB 4A1XA 2CV3A 1O3DA 2RG3A 3RXUA 1LHCH 1G36A 4OGXA 4BXSA 4DURA 1GBFA 2WPJS 1BA8B 1ELDE 2ZA5A 4Q80A 3QTVH 1UVOA 1CVWH 2FXRA 5EODA 5LPEA 4INKA 1UTQA 3TIUA 3GDVA 2OINA 3TGIE 4ZXYH 1XUJA 1G9IE 4I8HA 1ZYOA 2ZDLA 1TGTA 4IS5A 1HBTH 4BTTB 3L33A 4X1PU 3URDA 4MPVA 3U8RH 3RXQA 1S85A 3EA8A 4X8SH 1O2UA 1HJ8A 3PYHA 1IQIA 2FTLE 4XE4A 5JB8S 2Z3EA 4RSPA 5FX6A 1WTHD 1OWJA 1QQ4A 3ZZBA 2F83A 1DITH 2FI3E 1YPLH 5L30H 3GCHB 2TBSA 1GHAF 3UNQA 1O36A 3F9HA 1BRCE 1NRSH 1C5QA 1LDTT 4D9RA 1NFUA 3E1XB 1F5LA 1ELVA 2Z9IA 3QX5H 1QRWA 1UK4A 1FV9A 3A89A 5ESBA 3TNTA 1AUJA 4RKJB 4IGDA 1BMMH 5BPEA 1AB9C 2FOEA 4I7YH 1EJAA 2Z9GA 1V2UT 3GY5A 3PTNA 1QJ6B 3PM3A 3SNEA 1GJBB 2QF0A 4ZKOU 1DS2E 2QXJA 1BQYA 2FLBH 1MKWK 3BG8A 2AH4X 2V6NA 2O8LA 3VFEA 2ZI2H 2WPHS 3QK1A 3MOCA 4X6MA 4D7FA 2ZECA 1N1LA 3BTFE 1N8OB 1V2PT 1CGHA 1BTXA 2GDDA 5A0BA 2FESH 2ZHEH 3F9FA 2VIQA 3ODFA 1GBCA 4XSKU 1DFPA 1C4U2 3ZZDA 1MZDA 2VIWA 1HJAB 1SGDE 2OLGA 3K6YA 1B0EA 1VITG 2NU0E 4UONA 3QZRA 4NFEA 3GCTG 1P2MA 1GI0A 3QGNB 2W3IA 1K2I1 5FAHA 1XXDA 3BTEE 2C90B 1OS8A 1DX5M 1PPBH 4K3JA 1W0ZU 8LPRA 3GCHC 3QN7A 1O34A 2BDCA 1MD7A 1AWHB 1C5WB 2XC5A 3HGPA 1SR5C 4E7NA 3PV4A 4NA7A 3MNXA 1EAWA 1J17T 3LH3A 2TGAA 2ZDNA 1A0HB 3TH4H 1TABE 4I8KA 4U2WA 5TCAA 1FN8A 3MU8A 3Q3XA 1AFQB 4IW4E 1XVOA 2PUQH 3SQHE 1BTHH 3SW2B 4DOQA 4E06H 4DCDA 1KTSB 1QA0A 1GMDG 3LGWA 3U8OH 2NU4E 1SOTA 4HZHA 4UD9H 5PTPA 1GWAA 1DWDH 4FU8A 1ELCA 1GI2A 4X1NU 2NU1E 1S6FA 1EASA 5LPFA 1C2GA 4WJG2 3T29A 1UTKA 1RTKA 1ZRBA 1O3OA 1N8OC 3PTBA 1C1UH 4IBLH 4YOIA 1GHZA 4CRAA 3B8JA 2BD4A 1O3AA 1EZXC 4GLYA 1NS3A 2VVVA 1KXAA 1IQLA 3A7WA 3Q3YA 3LGUA 1C1QA 4FUBA 2D8WA 1HJAC 1KXFA 2OBOA 4J2YB 1F0UA 1Z6JH 1P2IA 1DXPA 1GVKB 3ZVFA 4X8UH 4ISOA 7KMEH 1C5TA 1KXDA 6CHAB 1KXEA 1P01A 3LGVA 1TB6H 1DICA 3GY7A 4Q7XA 1UVSH 1GMCG 1SGRE 1ZSJA 3ELAH 3SGBE 2P94A 3CS7A 2GD4B 1EJNA 2O8WA 1MAXA 1A5IA 1PYTD 1AWFH 1HAXB 5SGAE 4B2BA 2GKVE 1L1NA 4CR9A 4Y10E 1V2ST 3T25A 3DD2H 4Y8ZA 4ABIA 1O3PB 3DA9B 1AFQC 1D4PB 4BAHB 1QB9A 1EAUA 4KP0A 1OP0A 3A83A 1TGNA 3SJOA 3RDZA 4ABHA 1GBJA 2FZZA 2AEIH 2IOTA 1NN6A 1O2OA 4WXVA 1NRRH 3GY2A 3RU4T 1AHTH 2H6MA 2P8OB 2THFB 2EI8A 1TGBA 4U01A 4LZ4B 1GCTB 4A5TS 2ZQ1A 2BLVA 1XKAC 3E0NB 1DUEA 5IDKA 2BOKA 4MNXA 3PMAB 2GZ8A 2Z9JA 1RJXB 4XFQA 1GDUA 1RRKA 2FIRH 3OY6U 1VCWA 4MPWA 4NA8A 2TGDA 1GBEA 1ID5H 1GI7B 6CHAC 2ANWA 2GGVB 1N6YA 1ETTH 3D65E 3EE0B 1XM1A 1SVPA 5HM2A 1ZTKA 1O3MA 2YOLA 3BIVH 3LC3A 1SC8U 1ZSKA 3LIWA 2W7UA 2ZGXH 3V12A 3QUMP 1Z8GA 1AE5A 1AU8A 1IHTH 3P8NA 3NWUA 3C1KA 3GYMA 1OWHA 1KYNA 5HMAA 1ARCA 4CHAB 3BTME 3HKJB 4NCYA 2ZTXA 2F91A 5AVDA 1P04A 1NU7B 4NWLA 5EXMA 3E91A 4CREA 1TRMA 1Q3XA 2DUCA 3P95A 1O2TA 5FBIA 4I33A 2WPLS 5GDSH 1JOUB 2BVSH 2VIVA 3M7UA 1AVWA 2Z94A 1CGJE 1YKTA 1O35A 1OKXA 1O2PA 1GHAG 1CBWB 2P8OC 1E38B 2XCFA 2C8XB 1K28D 2OTVA 2QA9E 1GCTC 3PMBB 1G3CA 3O8BA 1FONA 5EG4A 1TNGA 2ZNKH 1Y3UA 1ZOMA 3M5MA 1QBNA 4Z0KA 1HAHH 1N6XA 3M35A 3GY4A 4YTAA 4NIVA 1T32A 5FX5A 1BRUP 1KY9A 1LVYA 1E35B 3A7VA 2J2UA 4NG9H 4D8NA 2C93B 3SV2H 3OYPA 2XWBI 3FP6E 3OY5U 2XBYA 3A8DA 2PGQB 4UFDH 3SORA 2BY8X 4JZFH 2GZ9A 1XX9A 1D3QB 1IQHA 4ZH8A 1CO7E 2Y5HA 1L2EA 1BB0B 2F9NA 4IC5A 1VZQH 4YOJA 2OC0A 3U1IB 4ZHMU 5AHGH 2FX6A 3T62A 4ZROA 4CHAC 1FJSA 1FDPA 3CP7A 3ZZAA 3M5NA 4FUHA 2AGIX 2BDBA 4K69A 5ETXA 4A1TA 1UCYH 1W3CA 3UR9A 1TPAE 3P70B 1EB2A 2ZFPH 4YESB 2P3FH 1EKBB 5JBCS 1TA2A 4I32A 1NRNH 1C5RA 1P2QA 1VR1H 1TWXB 2BY9X 1GVLA 1IHSH 2VIOA 2ZCLP 4DT7B 2BDAA 3MMGA 1CBWC 4SGBE 3EYDA 3FANA 5A0CA 4B1TA 1SLWB 1WU1A 4HTCH 2R3YA 3L6PA 1A5HA 3BTQE 3MNCA 4CRGA 3F9GA 1Z8JB 1BUIA 3STJA 4E05H 2BY6X 3ODDA 4ESTE 2J95A 3GCNA 2JKHA 2VIPA 2FOGA 4ISIH 2BVXH 2JH5D 3HK6B 2NWNA 1OP2A 1V2NT 2SNVA 2AYWA 1W14U 1A46H 2H5DA 2H5CA 5C3NA 2JH0D 1G30B 3RXLA 1LHEH 1F7ZA 1SGYE 3RXVA 1WTGH 3RXSA 1SI5H 2SGFE 1DANH 1HDTH 1E37B 2ZDMA 1ZJKA 2FX4A 2F9BH 2J38A 1F5KU 2SNWA 3DHKH 1TMTH 2BDYA 1MMJN 1P12E 3KQDA 5EW1H 2G5NA 2PV9B 1O2XA 1C2MA 1VCQA 3P8FA 2PSYA 1JIMA 1C5YB 1UTLM 2V35A 4AZ2B 3ZV8A 2DE9A
chains in the Genus database with same CATH superfamily
4K1EA 1YM0A 3ZIAD 1F5RA 4ABJA 3MFJA 4YOGA 3PLBA 2TRMA 1Z6EA 2P93A 3SV9A 3V7TA 5DO4H 4J1YA 1NROH 1O3JA 1TRNA 1UTJA 3DSGA 2AMDA 2A0QB 3ZVCA 2Q1JA 1FIWA 1UO6A 4MNWA 1SLUB 5GIBA 1MTWA 3SJKA 4OS6A 2ZWLH 2G81E 3GYLB 1EPTB 2EY4C 5T3HA 2KCYA 2ANYA 1DDJA 2R0LA 4FUGA 1AIXH 1S5SA 2F9OA 3SJ9A 3VGCC 1TOCB 3D23A 1GJCB 1B7XB 3K9XB 2TGPZ 2HOBA 5C5NA 5JYIA 1GI3A 3BEUA 4I86A 4SGAE 4D9QA 1K0HA 1ELBA 2ANMH 4NZLA 3T28A 5HYOA 5HM9A 7LPRA 4D76A 1SGFG 1FI8A 3K2UA 4X2VA 5A8ZA 1QJ1B 3BTGE 1FAXA 1ORFA 3ZVDA 3RLWH 1GI6A 1EXFA 1BHXF 1YPGH 3SU2A 1ANCA 4ZKNU 2VWLA 1AMHA 1SG8B 1SPJA 3KHVA 3PV2A 2IN2A 4X1RU 3ITIA 4AB8A 5HXFA 1GMCF 1UK2A 3RC5A 3TJUA 1O37A 3RXDA 5DG6A 4XDEA 2GCHF 4ZHAA 1L0ZA 3NUMA 1C5LH 4TYDA 1NM6A 4NIXA 1AE8H 2AGGX 4DVAU 1UTOA 2TPIZ 1KTTB 3QTOH 1V2VT 2RA3A 3UWIA 3BV9B 1C4V2 2FI4E 2BD9A 2XTTB 3PROA 4JYUH 3VXEH 2PKAA 1FNIA 2QN5T 2XCNA 4WY3A 1D3DB 1EPTC 1W12U 1PQ8A 3PMJA 1O2LA 5EIYA 2Q6DA 2EC9H 1C1RA 2VWMA 1EPTA 1AKSB 1P9SA 1HAGE 2B9LA 8GCHF 2GMTC 1Q2WA 2JJ2D 1CE5A 2YMSD 3BEIB 4JZEH 3ZZ3A 1O3LA 1O5GH 3M36A 1DM4B 2A7HA 2J4IA 5IYTA 2J92A 3UY9A 1SLXB 3EE7A 2WPIS 1G2MA 1HGTH 1OYTH 2BXUH 4FXGH 4YZUA 1GJ5H 2ZF0H 2QV1A 3C27B 4Q63A 4TWYA 1UCYE 3IWMA 1O2VA 1JXPA 1SGCA 1TNJA 2ZGBH 3MH7A 5EXLA 3RXIA 4YXWD 4O9VA 4AFZA 2ASUB 1TPPA 5DP9A 1AZZA 2KM0A 3P8GA 1MUEB 1O30A 4X6OA 1Z7KA 3ENSB 2Y82A 3UR6A 2CMYA 1BBRH 3KQCA 2XBXA 2CJIA 2J98B 5L6NH 4CBOA 1MAYA 1W7XH 3AAVA 1LO6A 1P11E 1TQ7B 2ZPQA 1DUAA 3WWBA 2KCOA 5ABWA 1LPZB 1TLDA 1XUHA 2VJ1A 2XC0A 5T6GA 4RT0A 4YM9A 1A0JA 1UTPA 1WAYB 3EAJA 3EA9A 2O9QA 2XYAA 3GOVB 2W7SA 2VGCB 1GI9B 3MWIU 1NRQH 1Y5BT 2WINI 2ZU2A 2WYGA 2ZTYA 1C4Y2 1MCTA 1V2RT 3UOUA 3F9EA 1EZQA 3DFJA 1NZQH 3N7OA 1C2JA 1FZZA 2G51A 1D3PB 4CR5A 4B2AA 2R3UA 3UB0A 5C1XA 3U8TH 1BMFD 4GHQA 4ZKSU 3QO6A 1F92A 1ZJDA 3MU1A 3SI4H 2VWNA 1NTPA 4AGJA 2KZ4A 1HAIH 3ZYDA 2Q6FA 2ZU4A 1KDQB 2A7CA 4ABBA 4AX9H 4LK4A 2WUBA 2J9NA 1THSH 3LJOA 4O03A 3E90B 1UJ1A 4O3TA 3RP2A 3O8DA 1P10A 4F4OC 1DVAH 2XBVA 1MQ5A 1P0SH 4NFFA 1OWDA 2FO9A 5C5OA 4AG1A 1ACBE 1MZAA 3PRBA 1ELTA 1C2KA 4B2CA 3RXAA 1YP9A 3SO3A 2J98A 3P17H 1RD3B 4I8JA 4F49A 3RXGA 4O97A 2BD3A 1TOMH 1O2SA 1BRBE 1O3EA 1C1MA 3DFLA 5KECA 3SUGA 3RLYH 1PPZA 3RMMH 1AUTC 5DP7A 1MH0A 2Y5GA 2DE8A 5E0JA 2VGCC 1TGSZ 2H9TH 3AW0A 3MU0A 1A7SA 1C5XB 4KTUA 1EAXA 2VU8E 1C5VA 2WYJA 1NU9A 2XWAA 2AS9A 1HFDA 4DGJA 1ARBA 1XVMA 3ZZ5A 3EQ0H 1LTOA 5CMXH 1GJ6A 7ESTE 1BIOA 1LKBA 1G3DA 2BLWA 3LGTA 3VB4A 2XRCA 5GXPA 2ZTZA 1X7AC 3N7DA 3GICB 2BD5A 3MH5A 4ABEA 3A85A 4X8TH 1XUGA 4RI0A 4U32A 4HG6A 2VWOA 4X1SU 2D26C 1J8AA 2BYAX 4YLUA 3Q77A 2A5KA 4JYVH 1KDQA 2GDEH 5E0GA 4FUFA 2ZHQH 4WWYA 3TK5A 1LHGH 2ZC9H 3T5FH 4RKOB 3ATLA 1A5GH 1LKAA 2YNAA 1W0YH 1GI5A 1P09A 6LPRA 3SU6A 3A87A 1BMNH 2A2XH 2F9VA 3U1JB 6ESTA 4K5ZA 3V3MA 1Y3WA 2ZU1A 3W94A 3MYWA 4B6FA 1HRTH 1FLEE 1TBZH 1XUIA 1GHXH 1YCPH 1GVZA 3FZZA 2I6SA 1O3GA 1P2NA 3CNRA 5EJ1A 1HXEH 1ABIH 4VGCB 1MU6B 2P16A 3NKKA 2RCEA 1SGIB 3A8BA 4YLQH 3S7HB 2OBQA 2FYQA 3KQEA 2K1QA 2GCHG 3LDXH 1EUFA 4XBBA 3SNCA 4R0IA 4AFQA 1HAPH 1ZRKA 1QJ7B 2VNTA 1O2QA 4INLA 3ZYEA 2AGEX 3DT0H 3BF6H 1OYQA 4IMQA 1Y8TA 4NSYA 4A6LA 3NK8A 5KGOA 1CT4E 2PR3A 1GBIA 1BBRE 3FP8E 1PJPA 3BSQA 5DP3A 2FS8A 3ZZ4A 1XXFA 1NBME 1C5ZB 4ZAEA 4JK6A 5TJXA 2J94A 4TPIZ 3ZVGA 1LHDH 5DP6A 1O2HA 2F9PA 5HGGA 1MKXH 1G32B 1LHFH 8GCHG 3H09A 4CRDA 1TX6A 3HK3B 1P02A 3LH1A 2A7JA 1PFXC 2VVUA 2LPRA 1CT0E 2Z7FE 1DOJA 2ZHFH 1O32A 1O3HA 1W10U 2ESTE 2GT8A 3R3GB 3FKSD 4RN6A 3PWBA 2BOHB 4CRCA 2W6JD 2QF5A 2VB0A 2ZDKA 1VGCB 1HUTH 1C5UA 2HPQH 5FPYA 1AVXA 2OQ5A 3IG6B 3F3BA 1KLIH 1NESE 2XC4A 1J14A 1FMGA 1ZMNA 2QCYA 3GCOA 4VGCC 1ZHMA 3FAOA 1ZPZA 3BTHE 1V3XA 3SNAA 3KYFA 1AZ8A 2J34A 2R2MB 2QC2A 1A3BH 1QR3E 1P9UA 1HV7A 2ZIQH 5JB9S 3A8CA 3VXFH 2PTCE 3OFND 3QGJA 4INHA 5BRRE 1O3CA 3A88A 2VBCA 4XBCA 5T6DA 2XOKD 5EGMA 2ZGHA 2AMPA 1HIAB 4MG3A 3KQ5A 3UREA 2BM2A 5FPSA 3RMNH 4MDSA 3RM0H 1EB1H 2UUKB 1AQ7A 5C1UA 1IQNA 1WQSA 1EOLA 1CT2E 3OSYA 4BANB 1V2MT 1O2NA 2FEQH 5E2OA 5K7RA 1MBQA 2AIQA 4AORA 3RXOA 4AG2A 2BQWB 2P3TB 5F53A 1DT2A 2ZFSA 1EQ9A 5LGOA 4GPGA 1B0FA 1C2LA 1V2TT 2NU3E 2NU2E 4UFFH 1YLNA 5A8YA 1AGJA 1PQAA 1YPHE 1SHYA 3SGQE 2ZDAH 3NPSA 4FU9A 1WYKA 1VGCC 1P2OA 1DLEA 4GUXA 1O2GH 2BD8A 4OM9A 5DPAA 1W2KH 1RFNA 1SB1H 2PGBB 1Z8RA 3K65B 4ACAA 4FVBA 4Q7YA 4F48B 1BTUA 1YLDA 1LVBA 2CGAA 2Z6BD 3SJIA 1YLCA 1O2KA 3TH2H 2ILNA 1O5DH 3MO3A 1RXPA 1PQ7A 3LU9B 1QL7A 1JRSA 1U6QA 5CHAB 3I29A 4AGKA 2GV7A 3NCLA 5LPRA 1JIRA 3OTPA 2EI7A 3S9BA 4I31A 1KLTA 3FVFB 1ABJH 1GJ9B 3E16B 1NFYA 1WBGB 1GJ7B 5GJ4B 4QT8C 4ZMAH 5JBTA 2K8IA 1HIAA 1TNHA 2BY5X 2C8ZB 2FS9A 1TPSA 3SNBA 1CA8B 2IJD1 1HYLA 4TPYA 3KN2A 2BD7A 1AO5A 1WCZA 1O2MA 3JZ2B 1NBMD 1LVOA 2WV9A 1NFWA 1BTWA 2C8WB 2CHAB 2FOFA 1UMAH 4JZ1A 1KMHB 3SQEE 1BJUA 3BTWE 5A8XA 1ZLRA 2K0QA 4Y76A 2BLOA 1SQTA 3RXJA 2UWLA 5FBEA 3VEQB 1VCPA 1E1RD 4OS5A 5CHBA 2FWWA 1F0TA 3ATWA 1ZTJA 1ZZZA 3KYGA 5C20A 1C9PA 1J16A 1Y59T 2G00A 2J5UA 2UUJB 1CA0B 3S69A 1NY22 4B6EA 3NZIA 1VJAU 2ANKH 1ZPCA 1A2CH 3BTKE 3VGCB 3HPTB 2ZU3A 2HLCA 3A82A 5FCRA 1O2IA 2D1JA 1K9OE 2GCTB 2FOMB 3SZNA 1AD8H 4MVNA 1DWBH 1HLTH 1EZUC 1WDIA 5CHAC 4BAQB 3S9CA 1C5MD 4K2YA 4AYVB 1DY8A 2GT7A 1ZTLA 4FUEA 2WPDD 1LCYA 3GDSA 3M3TA 1SQAA 1YPMH 1ZMJA 3NRLA 3A7ZA 3RMOH 4H4FA 1G3EA 1TMUH 2B7DH 1MKWH 2BVRH 2LP6A 4CRBA 2LNCA 1ELEE 1TBQH 1O3FA 1UHBB 1KXBA 1CGIE 2J97A 4BAMB 2A4GA 1SGTA 1W11U 2EA3A 2PSXA 1OX1A 1VKYA 3QDZB 3TJNA 2KR7A 1TNKA 1C1SA 2A5AA 2BB4A 2CHAC 3B23B 2ZO3H 1UTMA 3VB6A 3BTDE 4ASHA 4K60A 1HAYB 3UPEA 1WQVH 5DGJA 1FXYA 1O2JA 2F43B 3SU4A 3A80A 1C5PA 1EJMA 2R0KA 3RXBA 3B9FH 1O3IA 4NWKA 2PLXA 1MBMA 5AFYH 2A31A 1FN6A 2ZGJA 4D7GA 4XOJA 3AK5A 1Y3XA 1T8OA 3TJVA 3UNSA 5JBBS 1GCDA 4MNVA 1K22H 2ULLA 3NXPA 3TJOA 1B5GH 1CA0C 3GS9A 3SI3H 1C1OA 2VIDA 1TYNA 2GMTB 3RXFA 5L2YH 3T26A 3LGYA 1GJDB 4Y79A 2H9EH 1G37A 2GCTC 3EDXB 1SGFA 4ISLA 5DKMA 2O8TA 1GBHA 4X6NA 1QL9A 4K1SA 3M37A 2XNDD 5LH8A 1UVPA 4FOUC 1Y3VA 5EPNA 3A84A 1O39A 1DY9A 3OAAD 1P57B 1J15A 2STBE 3H7TA 1GGDB 3N7EA 3SV7A 1GDNA 3LKWA 4JCNA 3RXTA 3A86A 1Q31A 4UEHH 3RMLH 4IN1A 4JYTA 1W13U 3RU4E 1DWEH 4KKDA 3EGKH 4GAWA 4AC9A 3MI4A 3UUZA 1L4DA 1D6WA 1GDQA 5EPYA 1QRXA 3A8AA 2WV5A 3OEHD 1UW7A 1UHBA 2XBWA 2C4FH 4TY7A 3MNSA 2VH6A 1E36B 2FLRH 3PO1B 3K6ZA 4BXWA 3MU4A 4HI3A 2ZPRA 2EEKA 1SGNE 1K1JA 5FCKA 4B76A 5G4BA 2WZQA 1L1JA 2QYIA 1S84A 2FOBA 3TU7H 2BTCE 2ODPA 4UE7H 1BJVA 4FUIA 1XKBC 3M7TA 1H4WA 2UUFB 3TITA 4DW2U 1O2WA 3SHAH 2FDAA 1FUJA 1IQFA 2TIOA 3DCLA 2PW8H 3AW1A 1QB6A 1ETSH 1PPGE 2AMQA 1S82A 2OCVB 4NSVA 1W7GH 1P2JA 3M3VA 1UK3A 2BHGA 1JRTA 3F68H 1DXWA 2O8MA 5KEDA 2SGQE 3H5CB 4GHTA 1TA6A 1S81A 5DJ7A 4DG4A 7GCHF 2IPHA 1ESTA 2RFKC 1PPFE 4Y71A 2R9PA 4WMDA 4AOQA 4LZ1H 1MU8B 1GGDC 1CSOE 3VG8A 2Y6TA 3H7OA 1A61H 1H9LB 5GPIB 4X8VH 1MCVA 1QGFA 3PMHB 3E8LA 4TT3D 5CE1A 2FTMA 2R2WU 3D49H 2QXHA 1GHVH 3Q00A 4ISHH 4UFEH 1GG6B 2XXLA 4JZDH 2XNIA 2A5IA 3KNXA 2ZGCA 4Y11E 5TCCA 1TPOA 1WOFA 1WV7H 2P95A 2HNTF 1K1LA 3O8CA 4I8GA 2UWOA 2PUXB 2BZ6H 3QLPH 1HAZB 3W95A 2ODQA 3PO1C 1T8MA 5C2ZA 2A4QA 1UCYK 2PFEA 5E8EH 2CN0H 1ESAA 4MQAA 1FPHH 2ZFQH 2FOCA 1KSNA 1TNLA 3OX7U 2CF8H 3TK6A 1S6HA 1DE7H 5GWZA 2V3OH 3U9AH 3ATIA 3MH4A 4YO9A 2F3CE 1MTNB 1Z8IB 3IITA 1D6RA 3VPKA 4X2XA 2ZZUH 1V2KT 1LVMA 2ZQ2A 2G4TA 3DUXH 1C2FA 3E6PH 1BTZA 4BAKB 1QRZA 1P2KA 1W0KD 1HCGA 1TMBH 3QZQA 4Y6DA 3SV6A 2A4OA 3FFGA 1ZHPA 1AKSA 2VVCA 2Y81A 1OWEA 4K1TA 1A4WH 1GBTA 2FI5E 4TSFD 4MTBA 2V3HH 3L3TA 4O3UA 3KF2A 2IPQX 1W8BH 3BIUH 2ZEBA 3SU1A 1IQKA 1GHBF 3ZZ9A 2PKSB 1HAVB 4WVPE 2ZPSA 3U98H 4MPXA 1MTSA 1EX3A 1CHOF 2ALVA 1L4ZA 4YT7H 4R8TB 9LPRA 5IK2D 5GNDA 4LOYH 3PB1E 1ELFA 3PLKA 1S0RA 5B6OA 1GG6C 1SFQB 1THRH 5F03A 1VITH 3KL6A 3SUEA 1MABB 2QGRA 3LONA 2OP9A 4K8YA 2Q6GA 1BHXB 3BN9A 3RU4D 3OE7D 4ABAA 3TH3H 3RXRA 1ANBA 1NFXA 3MTYA 3LOXA 4WH8A 2V0BA 5ESTE 2FM2A 2GTBA 2CXVA 8KME2 1ANEA 1DSUA 3M61U 3RC4A 1EZSC 2HWLB 2M5TA 4MLFB 1ZGIA 3AASA 1UTNA 1OHHD 2GX4A 3RXMA 1TGCA 6GCHF 5JBAS 1CQQA 3TNSA 1INCA 1MTNC 1E1QD 2ZFRH 1T31A 1E0FD 2OQUA 2WUCA 3CS0A 5DP8A 1BT7A 1LMWB 1RTLA 1T8NA 2SFAA 1H8IH 3FO8D 2H9HA 4Y8YA 2BQ6B 1O38A 1H8DH 4IN2A 1BTYA 4X2YA 4H6SB 1K1OA 3RUOA 1C2EA 2ALPA 1YPHC 2ZCKP 1SL3A 1FIZA 2HLDD 1F0SA 3P6ZB 3TVJB 5F8XA 1WUNH 2ZCHP 5I46H 2PKSC 4OS1A 4X0WU 2Y7ZA 5DSFA 1SMFE 3JZ1B 3F6UH 2FOAA 5AFZH 3BEFB 3F2HA 4OGYA 4AN7A 2GZ7A 4B74A 1TX7A 1HAVA 3TPIZ 3HATH 1V6DA 1T8LA 2GVFA 1FPCH 3RXKA 4DIHH 4B73A 4JK5A 4OS4A 3A7XA 3LPRA 1IQMA 3BTTE 2G8TA 1QURH 3SU3A 3ZVAA 1GBMA 3V0XA 1RGQA 3GY3A 1GI4A 1OOKB 1OP8A 1LQDB 2KX4A 3ATMA 2A1DB 1EFRD 1OPHB 2OUAA 3SN8A 2OC8A 2SGEE 2G52A 4NA9H 1QHRB 5C67A 1SSXA 1SGEE 1KLJH 5DN6D 3AVZA 1IQJA 2SGPE 2W5EA 3T2NA 1A0LA 4NZQA 4ZXXH 1Y3YA 1P06A 1SLVB 2XW9A 4Y0ZE 1YGCH 3BG4B 3WY8A 1PPHE 1V2LT 1MTVA 5DP5A 1AFEH 4DIIH 4Y0YE 1JBUH 1GMHF 1QBOA 5A0AE 2ZHDA 3U69H 1BITA 2PHBA 2ZDVH 4A1VA 5DK1A 2F9UA 1IAUA 3F0PA 4F55A 2O8UA 3UIRA 1GL1A 3GY6A 2PP6A 4WF8A 2BD2A 1Y5UT 2I6QA 2BMGB 3OEED 3UAIC 1C1NA 4H42U 4BOHA 5E0HA 1O33A 1AY6H 2SGDE 2KCPA 3SGAE 5EOKA 1TAWA 1ZGVA 3SNDA 1BTPA 1TALA 1C2DA 2WPKS 2QXIA 1P05A 3Q3KA 5EW2H 2QY0B 1HAOH 4NIYA 1QL8A 2KAIB 4LXBH 3LGIA 1NT1A 3FN8A 5T6FA 1O2YA 1BZXE 1ELGA 1QB1A 1TQ0B 1C5NH 1C1TA 1JWTA 1GL0E 3FZDA 3ESTA 4ABFA 1P3CA 7GCHG 1TRYA 2PTNA 1C1WH 1BBRK 1ESBA 2G5VA 2ZU5A 2BXTH 4Y7AA 3ZZ7A 2HNTC 5EQQA 3ZZ8A 5E2PA 3RM2H 2BX4A 1FY1A 1PPCE 3M5LA 2YNBA 5FHTA 4DY7B 5HIYA 3SHCH 4Y7BA 1T4VH 3T27A 1THPB 1YPJH 1ZHRA 1HNEE 2C3SA 4ZKRU 2A32A 2Z3DA 1ZPBA 3BG4C 5I25A 4CH2B 1EOJA 1GBAA 1O5FH 3SU5A 3S7KB 1GJ8B 1YCPM 2BLQA 3PRDA 2OXSA 4XRNA 3F1SB 4KTCA 2JH6D 2EQNA 3ZZCA 2QAAA 1C5OH 1C2IA 1BRAA 1UVTH 1W0JD 1O3BA 1BMLA 1DWCH 2G4UA 2D2DA 4IMZA 4GSOA 1AVGH 3PWCA 1QY6A 2B0FA 3KGPA 2FMJA 1ANDA 5GCHF 2FODA 3R0FA 1O0DH 1GI1A 2HPPH 2UUYA 3UWJH 3MH6A 1C1VH 1LPGB 5EU8A 2P3UB 3Q76A 1GHWH 4IC6A 1Z71A 5H4IB 1V2QT 1ETRH 3V13A 1GBBA 1TONA 1GPZA 4KELA 4E7RG 1P03A 4BNRA 4MPUA 1BMAA 3LT3A 3SJ8A 3A7YA 4AB9A 5HKKD 1EAIA 2KAIA 1K1MA 2BY7X 4FUDA 2WV4A 1V2JT 5DP4A 2B8OH 1GI8B 1GHBG 3VB5A 2ZG0H 4Z6AH 1LPKB 1V2OT 2BDGA 4B75A 1CHOG 3MO9A 5A2MH 4ZHLU 2WPMS 5K0HA 4GCHF 2OC1A 1AI8H 1P8VC 2ZFTA 2ZKSA 1O3NA 1K21H 2ZFFH 3ATKA 2JDID 2BX3A 3D62A 1Y5AT 2P59A 1XUKA 1GHYH 4OS7A 4Q7ZA 2A45B 2ODYB 2QIQA 2JETB 1XUFA 1D3TB 1UVUH 1Z1IA 2LELA 1MQ6A 1WSSH 1YY3A 1EP5A 4ABGA 1A3EH 4H6TA 5EJLA 3KCGH 3VB3A 4FUJA 4X2WA 4ASUD 1CU1A 6GCHG 3UTUH 1ZSLA 1NC6A 4FUCA 3OTJE 4TWWA 1S0QA 4OS2A 2W3KA 1H1BA 2H1UA 3GY8A 4M7GA 5EQSA 4DJZB 4K8BA 1O5BB 3MO6A 3N99A 3GDUA 3RXPA 1EP6A 3ZVBA 1TX8A 1YC0A 1MD8A 3SV8A 1JMOH 4ZCNA 2QF4A 2STAE 4Q4LA 1MTUA 1VJ9U 3E0PB 8ESTE 3TGJE 1GBKA 1S83A 3KQBA 1O5EH 2GV6A 3HKIB 2AERH 2A2QH 4JZIA 3U28C 1IQEA 3SBKA 1OWIA 3LC5A 1YBWA 4NGAH 5EQRA 1TNIA 3SU0A 1T4UH 1NPMA 5EXNA 2L74A 4ABDA 1QBVH 2Y5FA 1YCPK 3S0NA 1HJ9A 1HPGA 2CF9H 1K1PA 1EATA 1FY5A 1SGQE 1M9UA 1FQ3A 1TFXA 4YT6H 1AN1E 3OU0A 4WMFA 2BZAA 1FX0B 5J4SA 3ZVEA 3P92A 1YWUA 3RXEA 4PROA 2JETC 1O5AB 2FPZA 1TBRH 2HNTE 2VINA 4A7IB 3SUFA 3FP7E 1E34B 1KXCA 3A7TA 1FY3A 4AFSA 1T7CA 5JDUB 2SGAA 3TGKE 1YPEH 1GBDA 4X1QU 1L1GA 1P3EA 1GBLA 1GJ4H 3RC6A 2Z9KA 5C94A 1FAKH 2AIPA 1O31A 3I78A 1QTFA 2RDEA 5F8ZA 1PPEE 3SOSA 3ZV9A 4HGCA 1VITF 1SBWA 1GMHG 3P8OA 3GCTF 2FOHA 1ZR0A 2RDLA 2EI6A 2B5TB 5J4QA 1K1IA 2ZHWH 3MHWU 4TY6A 1DPOA 4KTSA 3KIDU 1PYTC 3M7QA 4WH6A 1MKXK 2G55A 3AAUA 1H9IE 3KEEA 2HVXA 2H2ZA 2PKAB 3LJJA 4BTIB 3QWCH 1C1PA 2QF3A 3EA7A 3W1EA 2HGTH 1RIWB 2HALA 9ESTA 3ZZ6A 1Z1JA 4A92A 4Y8XA 4M9FA 3UFAA 3URCA 3G01A 4B71A 1O3KA 2TGTA 1KIGH 4NIWA 1F2SE 3VB7A 1GMDF 2UWPA 3E3TA 2C8YB 5JPMH 2RA0A 1QA7A 1QQUA 5T1VA 4AFUA 1H9HE 1O5CB 4WXIA 1ELAA 2OC7A 4GVUA 4JMYA 1DLKB 1SOZA 3S9AA 2PWXA 1ZMLA 2GP9B 4ACBA 1QIXB 1RS0A 5FL7D 4UFGH 1SHHB 3CENA 4KGAA 4WMEA 1D9IA 2BQ7B 2HRVA 1QNJA 2Y7XA 2BDIA 1A1RA 1COWD 5A09A 2Z3CA 4MNYA 4UDWH 3O8RA 4BTUB 2ZP0H 4CH8B 5C0UA 3UNRA 5F6MA 3UQVA 1F0RA 1NRPH 4X6PA 4ISNA 5F8TA 3TLOA 5FPTA 4RT1A 2Y80A 3UQOA 4AYYB 2OD3B 1QFKH 3TK9A 1O2ZA 1G2LA 1LQEA 1OWKA 2VH0A 3HGNA 1C2HA 3M5OA 1SFIA 1YYY1 1K1NA 1V2WT 2FP7B 3MU5A 4ZUHA 1OXGA 2FYRA 1XMNB 1O2RA 3UOPA 1RIWC 1TIOA 3M3SA 2Z9LA 1CHGA 1GJAB 5GCHG 1NO9H 4CRFA 1J9CH 5L2ZH 4U30A 3F2GA 3I77A 2A4RA 1HB0B 5AF9H 2V3MA 1IOEA 2IJOB 5FXLA 4FU7A 1IQGA 3MNBA 4THNH 3RXCA 3A81A 1OSSA 1SQOA 5CDFE 1FY4A 3RXHA 1SGPE 4CBNA 2AFQB 2QXGA 1C9TA 4FVDA 3SUDA 1TE0A 1BDAA 2W26A 4BAOB 3STIA 1C5SA 1DSTA 1YF4A 1BOQA 1RTFB 4XBDA 1G3BA 1PQ5A 3PLPA 4GCHG 1AB9B 1QCPA 2BDHA 5C1YA 4HFPB 1E79D 1BCUH 1HXFH 1FY8E 4I8LA 1YPKH 4Q2KA 3GISB 4A1XA 2CV3A 1O3DA 2RG3A 3RXUA 1LHCH 2V7QD 1G36A 4OGXA 4BXSA 4DURA 1GBFA 2WPJS 1BA8B 1ELDE 2ZA5A 4Q80A 3QTVH 1UVOA 1CVWH 2FXRA 5EODA 5LPEA 3MQKC 4INKA 1UTQA 3WW7A 3TIUA 3GDVA 2OINA 3TGIE 4ZXYH 1XUJA 1G9IE 4I8HA 1ZYOA 2ZDLA 1TGTA 4IS5A 1HBTH 4BTTB 3L33A 4X1PU 3URDA 4MPVA 3U8RH 3RXQA 1S85A 3EA8A 4X8SH 1O2UA 1HJ8A 3PYHA 1IQIA 2FTLE 4XE4A 5JB8S 5EJZA 2Z3EA 4RSPA 5FX6A 1WTHD 1OWJA 1QQ4A 3ZZBA 2F83A 1DITH 2FI3E 1YPLH 5L30H 3GCHB 2TBSA 1GHAF 3UNQA 2L6OA 1O36A 3F9HA 1BRCE 1NRSH 1C5QA 1LDTT 4D9RA 1NFUA 3E1XB 1F5LA 1ELVA 3SYJA 2GJGA 2Z9IA 3QX5H 1SKYE 1QRWA 1UK4A 1FV9A 3A89A 5ESBA 3TNTA 1AUJA 4RKJB 4IGDA 1BMMH 5BPEA 1AB9C 2FOEA 4I7YH 1EJAA 2Z9GA 1V2UT 3GY5A 3PTNA 1QJ6B 3PM3A 3SNEA 1GJBB 2QF0A 4ZKOU 1DS2E 2QXJA 1BQYA 2FLBH 1MKWK 3BG8A 2AH4X 2V6NA 2O8LA 3VFEA 2ZI2H 2WPHS 3QK1A 3MOCA 4X6MA 4D7FA 2ZECA 1N1LA 5C17A 3BTFE 1N8OB 1V2PT 1CGHA 1BTXA 2GDDA 5A0BA 2FESH 2KFWA 2ZHEH 3F9FA 2VIQA 3ODFA 2JJ1D 1GBCA 4Z1MD 4XSKU 1DFPA 4DT4A 1C4U2 3ZZDA 1MZDA 2KCAA 2VIWA 1HJAB 1SGDE 2OLGA 3K6YA 1B0EA 1VITG 2NU0E 4UONA 3QZRA 4NFEA 3GCTG 1P2MA 1GI0A 3QGNB 2W3IA 1K2I1 5FAHA 1XXDA 3BTEE 2C90B 2M2AA 1OS8A 1DX5M 1PPBH 4K3JA 1W0ZU 8LPRA 3GCHC 3QN7A 1O34A 2BDCA 1MD7A 1AWHB 1C5WB 2XC5A 3HGPA 1SR5C 4E7NA 2HVYB 3PV4A 4NA7A 3MNXA 1EAWA 1J17T 3LH3A 2TGAA 2ZDNA 1A0HB 3TH4H 1TABE 4I8KA 4U2WA 5TCAA 1FN8A 3MU8A 3Q3XA 1AFQB 4IW4E 1XVOA 2AHME 2PUQH 3SQHE 1BTHH 3SW2B 4DOQA 4E06H 4DCDA 1KTSB 1QA0A 1GMDG 3LGWA 3U8OH 2NU4E 1SOTA 4HZHA 4UD9H 2YMSB 4FETA 5PTPA 1GWAA 1DWDH 4FU8A 1ELCA 1GI2A 4X1NU 2NU1E 1S6FA 1EASA 5LPFA 1C2GA 4WJG2 3T29A 1UTKA 1RTKA 1ZRBA 1O3OA 1N8OC 3PTBA 1C1UH 4IBLH 4YOIA 1GHZA 4CRAA 3B8JA 2BD4A 1O3AA 1EZXC 4GLYA 1NS3A 2F4LA 2VVVA 1KXAA 1IQLA 3A7WA 3Q3YA 3LGUA 1C1QA 2WSSD 4FUBA 2D8WA 1HJAC 1KXFA 2OBOA 2QE7D 4J2YB 1F0UA 1Z6JH 1P2IA 1DXPA 1GVKB 3ZVFA 4X8UH 4ISOA 7KMEH 1C5TA 1KXDA 2OK5A 6CHAB 1KXEA 1P01A 3LGVA 1TB6H 1DICA 3GY7A 4Q7XA 1UVSH 1GMCG 1SGRE 1ZSJA 3ELAH 3SGBE 2WHXA 2P94A 3CS7A 2GD4B 1EJNA 2O8WA 5B6LA 1MAXA 1A5IA 1PYTD 1AWFH 1HAXB 5SGAE 4B2BA 2GKVE 1L1NA 1H8ED 4CR9A 4Y10E 1V2ST 3T25A 3DD2H 4Y8ZA 4ABIA 1O3PB 3DA9B 1AFQC 1D4PB 4BAHB 1WXRA 3SZEA 1QB9A 1EAUA 4KP0A 1OP0A 3A83A 3DSOA 1TGNA 3SJOA 3RDZA 4ABHA 1GBJA 2FZZA 2YMSC 2AEIH 2IOTA 1NN6A 1O2OA 4WXVA 4XD7D 1NRRH 3GY2A 3RU4T 1AHTH 2H6MA 2P8OB 2THFB 2EI8A 1TGBA 1S6LA 4U01A 4LZ4B 1GCTB 1H8HD 5C0TA 4A5TS 2ZQ1A 2BLVA 1XKAC 3E0NB 1DUEA 5IDKA 2BOKA 4MNXA 3PMAB 2GZ8A 2Z9JA 1RJXB 4XFQA 1GDUA 1RRKA 2FIRH 3OY6U 1VCWA 4MPWA 4NA8A 2TGDA 1QZ8A 1GBEA 1ID5H 1GI7B 6CHAC 2JIZD 2ANWA 2GGVB 1N6YA 1ETTH 3D65E 3EE0B 1XM1A 1SVPA 5HM2A 1ZTKA 1O3MA 2YOLA 3F2FA 3BIVH 3LC3A 1SC8U 1ZSKA 3LIWA 2W7UA 2ZGXH 3V12A 3QUMP 1Z8GA 1AE5A 1AU8A 1IHTH 3P8NA 3NWUA 3C1KA 3GYMA 1OWHA 1KYNA 5HMAA 1ARCA 4CHAB 3BTME 3HKJB 4NCYA 2ZTXA 2F91A 5AVDA 3PV5A 1P04A 1NU7B 4NWLA 5EXMA 3E91A 4CREA 1TRMA 1Q3XA 2DUCA 3P95A 4P00A 1O2TA 5FBIA 4I33A 2WPLS 5GDSH 1JOUB 2BVSH 2VIVA 3M7UA 1AVWA 2Z94A 1CGJE 1YKTA 1O35A 1OKXA 1O2PA 1GHAG 1CBWB 2P8OC 1E38B 2XCFA 2C8XB 1K28D 2OTVA 2QA9E 1GCTC 3PMBB 1G3CA 3O8BA 1FONA 5EG4A 1TNGA 2ZNKH 1Y3UA 1ZOMA 3M5MA 1QBNA 4Z0KA 1HAHH 1N6XA 3M35A 3GY4A 4YTAA 4NIVA 1T32A 5FX5A 1BRUP 1KY9A 1LVYA 1E35B 3A7VA 2J2UA 4NG9H 4D8NA 2C93B 3SV2H 3OYPA 2XWBI 3FP6E 3OY5U 2XBYA 3A8DA 2PGQB 4UFDH 3SORA 2BY8X 4JZFH 2GZ9A 1XX9A 2W6ID 1D3QB 1IQHA 4ZH8A 1CO7E 2Y5HA 1L2EA 1BB0B 2F9NA 4IC5A 1VZQH 4YOJA 2OC0A 3U1IB 4ZHMU 5AHGH 2CK3D 2FX6A 3T62A 4ZROA 4CHAC 1FJSA 1FDPA 3CP7A 3ZZAA 3M5NA 4FUHA 2AGIX 2BDBA 4K69A 5ETXA 4A1TA 1UCYH 1W3CA 3UR9A 1TPAE 3P70B 1EB2A 3F0OA 2ZFPH 4YESB 2P3FH 1EKBB 5JBCS 1TA2A 4I32A 1NRNH 1C5RA 1P2QA 1VR1H 3WWFA 1TWXB 2BY9X 1GVLA 1IHSH 2VIOA 2ZCLP 4DT7B 2BDAA 3MMGA 1CBWC 4SGBE 3EYDA 3FANA 5A0CA 4B1TA 1SLWB 1WU1A 4HTCH 2R3YA 3L6PA 1A5HA 3BTQE 3MNCA 4CRGA 3F9GA 1Z8JB 1BUIA 3STJA 4E05H 2BY6X 3ODDA 4ESTE 2J95A 3GCNA 2JKHA 2VIPA 2FOGA 4ISIH 5HIZA 2BVXH 3FOAA 2JH5D 3HK6B 2NWNA 1OP2A 1V2NT 2SNVA 2AYWA 1W14U 1A46H 2H5DA 2H5CA 5C3NA 2JH0D 1G30B 3RXLA 1LHEH 1F7ZA 1SGYE 3RXVA 1WTGH 3RXSA 3DSPA 1SI5H 2SGFE 1DANH 1HDTH 1E37B 2ZDMA 1ZJKA 2FX4A 2F9BH 2J38A 1F5KU 2SNWA 3DHKH 1TMTH 2BDYA 1MMJN 1P12E 3KQDA 5EW1H 2G5NA 2PV9B 1O2XA 1C2MA 1VCQA 4P02A 3P8FA 2PSYA 1JIMA 1C5YB 1UTLM 2V35A 1SQRA 4AZ2B 3ZV8A 2DE9A
chains in the Genus database with same CATH topology
4K1EA 1YM0A 1F5RA 4ABJA 3MFJA 4YOGA 3PLBA 2TRMA 1Z6EA 2P93A 3SV9A 3V7TA 5DO4H 4J1YA 1NROH 1O3JA 1TRNA 1UTJA 2AMDA 2A0QB 3ZVCA 2Q1JA 1FIWA 1UO6A 4MNWA 1SLUB 5GIBA 1MTWA 3SJKA 4OS6A 2ZWLH 2G81E 3GYLB 1EPTB 5T3HA 2ANYA 1DDJA 2R0LA 4FUGA 1AIXH 1S5SA 2F9OA 3SJ9A 3VGCC 1TOCB 3D23A 1GJCB 1B7XB 3K9XB 2TGPZ 2HOBA 5C5NA 5JYIA 1GI3A 3BEUA 4SGAE 4D9QA 1ELBA 2ANMH 4NZLA 3T28A 5HYOA 5HM9A 7LPRA 4D76A 1SGFG 1FI8A 3K2UA 4X2VA 5A8ZA 1QJ1B 3BTGE 1FAXA 1ORFA 3ZVDA 3RLWH 1GI6A 1EXFA 1BHXF 1YPGH 3SU2A 1ANCA 4ZKNU 2VWLA 1AMHA 1SG8B 1SPJA 3KHVA 4X1RU 2IN2A 4AB8A 3ITIA 5HXFA 1GMCF 1UK2A 3RC5A 3TJUA 1O37A 3RXDA 5DG6A 4XDEA 2GCHF 4ZHAA 1L0ZA 3NUMA 1C5LH 4TYDA 1NM6A 4NIXA 1AE8H 2AGGX 4DVAU 1UTOA 2TPIZ 1KTTB 3QTOH 1V2VT 2RA3A 3UWIA 3BV9B 1C4V2 2FI4E 2BD9A 2XTTB 3PROA 4JYUH 3VXEH 2PKAA 1FNIA 2QN5T 2XCNA 4WY3A 1D3DB 1EPTC 1W12U 1PQ8A 3PMJA 1O2LA 2Q6DA 2EC9H 1C1RA 2VWMA 1EPTA 1AKSB 1P9SA 1HAGE 2B9LA 8GCHF 2GMTC 1Q2WA 3BEIB 1CE5A 4JZEH 3ZZ3A 1O3LA 1O5GH 3M36A 1DM4B 2A7HA 2J4IA 5IYTA 2J92A 3UY9A 1SLXB 2WPIS 1G2MA 1HGTH 1OYTH 2BXUH 4FXGH 4YZUA 1GJ5H 2ZF0H 2QV1A 3C27B 4TWYA 1UCYE 3IWMA 1O2VA 1JXPA 1SGCA 1TNJA 2ZGBH 3MH7A 5EXLA 3RXIA 4O9VA 4AFZA 2ASUB 1TPPA 5DP9A 1AZZA 3P8GA 1MUEB 1O30A 4X6OA 1Z7KA 3ENSB 2Y82A 3UR6A 2CMYA 1BBRH 3KQCA 2XBXA 2CJIA 5L6NH 4CBOA 1MAYA 1W7XH 3AAVA 1LO6A 1P11E 1TQ7B 2ZPQA 1DUAA 5ABWA 1LPZB 1TLDA 1XUHA 2VJ1A 2XC0A 5T6GA 4YM9A 1A0JA 1UTPA 1WAYB 3EAJA 3EA9A 2O9QA 2XYAA 3GOVB 2W7SA 2VGCB 1GI9B 3MWIU 1NRQH 1Y5BT 2WINI 2ZU2A 2WYGA 2ZTYA 1C4Y2 1MCTA 1V2RT 3UOUA 3F9EA 1EZQA 3DFJA 1NZQH 3N7OA 1C2JA 1FZZA 2G51A 1D3PB 4CR5A 4B2AA 2R3UA 5C1XA 3U8TH 4GHQA 4ZKSU 3QO6A 1F92A 1ZJDA 3MU1A 3SI4H 2VWNA 1NTPA 4AGJA 1HAIH 3ZYDA 2Q6FA 2ZU4A 1KDQB 2A7CA 4ABBA 4AX9H 4LK4A 2WUBA 2J9NA 1THSH 3LJOA 4O03A 3E90B 1UJ1A 4O3TA 3RP2A 3O8DA 1P10A 4F4OC 1DVAH 2XBVA 1MQ5A 1P0SH 4NFFA 1OWDA 2FO9A 5C5OA 4AG1A 1ACBE 1MZAA 1ELTA 1C2KA 4B2CA 3RXAA 1YP9A 3SO3A 3P17H 1RD3B 4I8JA 4F49A 3RXGA 4O97A 2BD3A 1TOMH 1O2SA 1BRBE 1O3EA 1C1MA 3DFLA 3SUGA 3RLYH 1PPZA 3RMMH 1AUTC 5DP7A 1MH0A 2Y5GA 2DE8A 5E0JA 2VGCC 1TGSZ 2H9TH 3AW0A 3MU0A 1A7SA 1C5XB 4KTUA 1EAXA 2VU8E 1C5VA 2WYJA 1NU9A 2XWAA 2AS9A 1HFDA 4DGJA 1ARBA 1XVMA 3ZZ5A 3EQ0H 1LTOA 5CMXH 1GJ6A 7ESTE 1BIOA 1LKBA 1G3DA 2BLWA 3LGTA 3VB4A 2XRCA 5GXPA 2ZTZA 1X7AC 3GICB 2BD5A 3MH5A 4ABEA 3A85A 4X8TH 1XUGA 4U32A 2VWOA 4X1SU 2D26C 1J8AA 2BYAX 4YLUA 3Q77A 2A5KA 4JYVH 1KDQA 2GDEH 5E0GA 4FUFA 2ZHQH 4WWYA 3TK5A 1LHGH 2ZC9H 3T5FH 4RKOB 3ATLA 1A5GH 1LKAA 2YNAA 1W0YH 1GI5A 1P09A 6LPRA 3SU6A 3A87A 1BMNH 2A2XH 2F9VA 3U1JB 6ESTA 4K5ZA 3V3MA 1Y3WA 2ZU1A 3W94A 3MYWA 1HRTH 1FLEE 1TBZH 1XUIA 1GHXH 1YCPH 1GVZA 3FZZA 2I6SA 1O3GA 1P2NA 1HXEH 1ABIH 4VGCB 1MU6B 2P16A 3NKKA 2RCEA 1SGIB 3A8BA 4YLQH 3S7HB 2OBQA 2FYQA 3KQEA 2K1QA 2GCHG 3LDXH 1EUFA 4XBBA 3SNCA 4R0IA 4AFQA 1HAPH 1ZRKA 1QJ7B 2VNTA 1O2QA 4INLA 3ZYEA 2AGEX 3DT0H 3BF6H 1OYQA 4IMQA 1Y8TA 4NSYA 4A6LA 3NK8A 1CT4E 2PR3A 1GBIA 1BBRE 3FP8E 1PJPA 3BSQA 5DP3A 2FS8A 3ZZ4A 1XXFA 1C5ZB 4ZAEA 4JK6A 5TJXA 2J94A 4TPIZ 3ZVGA 1LHDH 5DP6A 1O2HA 2F9PA 5HGGA 1MKXH 1G32B 1LHFH 8GCHG 4CRDA 1TX6A 3HK3B 1P02A 3LH1A 2A7JA 1PFXC 2VVUA 2LPRA 1CT0E 2Z7FE 1DOJA 2ZHFH 1O32A 1O3HA 1W10U 2ESTE 2GT8A 3R3GB 4RN6A 3PWBA 2BOHB 4CRCA 2VB0A 2ZDKA 1VGCB 1HUTH 1C5UA 2HPQH 5FPYA 1AVXA 2OQ5A 3IG6B 1KLIH 1NESE 2XC4A 1J14A 1FMGA 1ZMNA 2QCYA 3GCOA 4VGCC 1ZHMA 3FAOA 1ZPZA 3BTHE 1V3XA 3SNAA 1AZ8A 2J34A 2R2MB 2QC2A 1A3BH 1QR3E 1P9UA 1HV7A 2ZIQH 5JB9S 3A8CA 3VXFH 2PTCE 3QGJA 4INHA 5BRRE 1O3CA 3A88A 4XBCA 5T6DA 5EGMA 2ZGHA 2AMPA 1HIAB 4MG3A 3UREA 2BM2A 5FPSA 3RMNH 4MDSA 3RM0H 1EB1H 2UUKB 1AQ7A 5C1UA 1IQNA 1WQSA 1EOLA 1CT2E 3OSYA 4BANB 1V2MT 1O2NA 2FEQH 5E2OA 5K7RA 1MBQA 2AIQA 4AORA 3RXOA 4AG2A 2BQWB 2P3TB 1DT2A 2ZFSA 1EQ9A 5LGOA 4GPGA 1B0FA 1C2LA 1V2TT 2NU3E 2NU2E 4UFFH 5A8YA 1AGJA 1PQAA 1YPHE 1SHYA 3SGQE 2ZDAH 3NPSA 4FU9A 1WYKA 1VGCC 1P2OA 1DLEA 4GUXA 1O2GH 2BD8A 5DPAA 1W2KH 1RFNA 1SB1H 2PGBB 1Z8RA 3K65B 4FVBA 4Q7YA 1BTUA 1YLDA 1LVBA 2CGAA 2Z6BD 3SJIA 1YLCA 1O2KA 3TH2H 2ILNA 1O5DH 3MO3A 1RXPA 1PQ7A 3LU9B 1QL7A 1JRSA 1U6QA 5CHAB 3I29A 4AGKA 2GV7A 3NCLA 5LPRA 1JIRA 2EI7A 3S9BA 4I31A 1KLTA 3FVFB 1ABJH 1GJ9B 3E16B 1NFYA 1WBGB 1GJ7B 5GJ4B 4QT8C 4ZMAH 5JBTA 1HIAA 1TNHA 2BY5X 2C8ZB 2FS9A 1TPSA 3SNBA 1CA8B 1HYLA 4TPYA 3KN2A 2BD7A 1AO5A 1WCZA 1O2MA 3JZ2B 1LVOA 1NFWA 1BTWA 2C8WB 2CHAB 2FOFA 1UMAH 4JZ1A 3SQEE 1BJUA 3BTWE 5A8XA 1ZLRA 4Y76A 2BLOA 1SQTA 3RXJA 2UWLA 5FBEA 3VEQB 1VCPA 4OS5A 2FWWA 1F0TA 3ATWA 1ZTJA 1ZZZA 5C20A 1C9PA 1J16A 1Y59T 2G00A 2UUJB 1CA0B 3S69A 1NY22 3NZIA 1VJAU 2ANKH 1ZPCA 1A2CH 3BTKE 3VGCB 3HPTB 2ZU3A 2HLCA 3A82A 5FCRA 1O2IA 2D1JA 1K9OE 2GCTB 2FOMB 3SZNA 1AD8H 4MVNA 1DWBH 1HLTH 1EZUC 5CHAC 4BAQB 3S9CA 1C5MD 4K2YA 4AYVB 1DY8A 2GT7A 1ZTLA 4FUEA 1LCYA 3GDSA 3M3TA 1SQAA 1YPMH 1ZMJA 3A7ZA 3RMOH 4H4FA 1G3EA 1TMUH 2B7DH 1MKWH 2BVRH 4CRBA 2LNCA 1ELEE 1TBQH 1O3FA 1UHBB 1KXBA 1CGIE 4BAMB 2A4GA 1SGTA 1W11U 2EA3A 2PSXA 1OX1A 3QDZB 3TJNA 1TNKA 1C1SA 2A5AA 2BB4A 2CHAC 3B23B 2ZO3H 1UTMA 3VB6A 3BTDE 4ASHA 4K60A 1HAYB 3UPEA 1WQVH 5DGJA 1FXYA 1O2JA 3SU4A 3A80A 1C5PA 1EJMA 2R0KA 3RXBA 3B9FH 1O3IA 4NWKA 2PLXA 1MBMA 5AFYH 2A31A 1FN6A 2ZGJA 4D7GA 4XOJA 1Y3XA 1T8OA 3TJVA 3UNSA 5JBBS 1GCDA 4MNVA 1K22H 2ULLA 3NXPA 3TJOA 1B5GH 1CA0C 3SI3H 1C1OA 2VIDA 1TYNA 2GMTB 3RXFA 5L2YH 3T26A 3LGYA 1GJDB 4Y79A 2H9EH 1G37A 2GCTC 3EDXB 1SGFA 4ISLA 5DKMA 2O8TA 1GBHA 4X6NA 1QL9A 4K1SA 3M37A 5LH8A 1UVPA 1Y3VA 5EPNA 3A84A 1O39A 1DY9A 1P57B 1J15A 2STBE 3H7TA 1GGDB 3SV7A 1GDNA 3LKWA 4JCNA 3RXTA 3A86A 1Q31A 4UEHH 3RMLH 4IN1A 4JYTA 1W13U 3RU4E 1DWEH 4KKDA 3EGKH 4GAWA 3MI4A 3UUZA 1L4DA 1D6WA 1GDQA 5EPYA 1QRXA 3A8AA 2WV5A 1UHBA 2XBWA 2C4FH 4TY7A 3MNSA 2VH6A 1E36B 2FLRH 3PO1B 3K6ZA 4BXWA 3MU4A 4HI3A 2ZPRA 2EEKA 1SGNE 1K1JA 5FCKA 4B76A 5G4BA 1L1JA 2QYIA 1S84A 2FOBA 3TU7H 2BTCE 2ODPA 4UE7H 1BJVA 4FUIA 1XKBC 3M7TA 1H4WA 2UUFB 3TITA 4DW2U 1O2WA 3SHAH 2FDAA 1FUJA 1IQFA 2TIOA 2PW8H 3AW1A 1QB6A 1ETSH 1PPGE 2AMQA 1S82A 2OCVB 4NSVA 1W7GH 1P2JA 3M3VA 1UK3A 2BHGA 1JRTA 3F68H 1DXWA 2O8MA 2SGQE 3H5CB 4GHTA 1TA6A 1S81A 5DJ7A 4DG4A 7GCHF 2IPHA 1ESTA 1PPFE 4Y71A 2R9PA 4WMDA 4AOQA 4LZ1H 1MU8B 1GGDC 1CSOE 2Y6TA 3H7OA 1A61H 1H9LB 5GPIB 4X8VH 1MCVA 1QGFA 3PMHB 3E8LA 5CE1A 2FTMA 2R2WU 3D49H 2QXHA 1GHVH 3Q00A 4ISHH 4UFEH 1GG6B 2XXLA 4JZDH 2XNIA 2A5IA 3KNXA 2ZGCA 4Y11E 5TCCA 1TPOA 1WOFA 1WV7H 2P95A 2HNTF 1K1LA 3O8CA 4I8GA 2UWOA 2PUXB 2BZ6H 3QLPH 1HAZB 3W95A 2ODQA 3PO1C 1T8MA 5C2ZA 2A4QA 1UCYK 2PFEA 5E8EH 2CN0H 1ESAA 4MQAA 1FPHH 2ZFQH 2FOCA 1KSNA 1TNLA 3OX7U 2CF8H 3TK6A 1S6HA 1DE7H 5GWZA 2V3OH 3U9AH 3ATIA 3MH4A 4YO9A 2F3CE 1MTNB 1Z8IB 3IITA 1D6RA 3VPKA 4X2XA 2ZZUH 1V2KT 1LVMA 2ZQ2A 2G4TA 3DUXH 1C2FA 3E6PH 1BTZA 4BAKB 1QRZA 1P2KA 1HCGA 1TMBH 3QZQA 4Y6DA 3SV6A 2A4OA 3FFGA 1ZHPA 1AKSA 2VVCA 2Y81A 1OWEA 4K1TA 1A4WH 1GBTA 2FI5E 4MTBA 2V3HH 3L3TA 4O3UA 3KF2A 1W8BH 3BIUH 2ZEBA 3SU1A 1IQKA 1GHBF 3ZZ9A 2PKSB 1HAVB 4WVPE 2ZPSA 3U98H 4MPXA 1MTSA 1EX3A 1CHOF 2ALVA 1L4ZA 4YT7H 4R8TB 9LPRA 4LOYH 3PB1E 1ELFA 3PLKA 1S0RA 5B6OA 1GG6C 1SFQB 1THRH 5F03A 1VITH 3KL6A 3SUEA 2QGRA 3LONA 2OP9A 4K8YA 2Q6GA 1BHXB 3BN9A 3RU4D 4ABAA 3TH3H 3RXRA 1ANBA 1NFXA 3MTYA 3LOXA 4WH8A 2V0BA 5ESTE 2FM2A 2GTBA 2CXVA 8KME2 1ANEA 1DSUA 3M61U 3RC4A 1EZSC 2HWLB 2M5TA 4MLFB 1ZGIA 3AASA 1UTNA 2GX4A 3RXMA 1TGCA 6GCHF 5JBAS 1CQQA 3TNSA 1INCA 1MTNC 2ZFRH 1T31A 1E0FD 2OQUA 2WUCA 3CS0A 5DP8A 1BT7A 1LMWB 1RTLA 1T8NA 2SFAA 1H8IH 4Y8YA 2H9HA 2BQ6B 1O38A 1H8DH 4IN2A 1BTYA 4X2YA 4H6SB 1K1OA 3RUOA 1C2EA 2ALPA 1YPHC 2ZCKP 1SL3A 1FIZA 1F0SA 3P6ZB 3TVJB 5F8XA 1WUNH 2ZCHP 5I46H 2PKSC 4OS1A 4X0WU 2Y7ZA 1SMFE 3JZ1B 3F6UH 2FOAA 5AFZH 3BEFB 4OGYA 4AN7A 2GZ7A 4B74A 1TX7A 1HAVA 3TPIZ 3HATH 1V6DA 1T8LA 2GVFA 1FPCH 3RXKA 4DIHH 4B73A 4JK5A 4OS4A 3A7XA 3LPRA 1IQMA 3BTTE 2G8TA 1QURH 3SU3A 3ZVAA 1GBMA 3V0XA 1RGQA 3GY3A 1GI4A 1OOKB 1OP8A 1LQDB 3ATMA 2A1DB 1OPHB 2OUAA 3SN8A 2OC8A 2SGEE 2G52A 4NA9H 1QHRB 5C67A 1SSXA 1SGEE 1KLJH