4FUJA

Crystal structure of the urokinase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
total genus 63
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fujA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fujA01
1ZJKA 1EB1H 4Y6DA 2ODPA 4YM9A 2XBXA 3UUZA 1N6XA 3PLBA 1A5IA 3ZVDA 1WUNH 5T6DA 2O8MA 3BTGE 4X6MA 4H6SB 2OXSA 3MNXA 1TQ0B 3SJ9A 3MWIU 4NA7A 4B74A 4CRFA 4I7YH 3QGNB 4H42U 4E06H 2EEKA 2STAE 1PJPA 2V0BA 1ZYOA 3UPEA 1Z6EA 2ZDMA 5CMXH 4ABEA 1MBQA 4FUHA 5TCCA 2QF3A 1T7CA 4XDEA 2QGRA 1ETSH 5DJ7A 1VR1H 4NA8A 1DWBH 1VGCC 3GCTF 3ATMA 1XUJA 1VITF 4MLFB 3LIWA 1NM6A 1Y5UT 1OP2A 4NA9H 4ABIA 1GG6C 4Y11E 5FPYA 1XMNB 3LOXA 1SGPE 5I25A 3P70B 1SHYA 1HAVA 1O2WA 3STJA 1FDPA 3A7VA 2OC0A 5GPIB 1GGDC 1RTFB 1TRNA 1H4WA 4NWLA 2WUCA 1T8OA 3G01A 4K1SA 2IN2A 4WMFA 1D3TB 1P01A 2FOGA 3OTJE 4ZKSU 1GJDB 1GVZA 2A45B 4LZ4B 4JMYA 4CRDA 2BLOA 1MUEB 3A7WA 4H4FA 3VB7A 1BQYA 3SQEE 2FS9A 3ZVEA 1WAYB 4B75A 3SI3H 2WPJS 2Z9IA 4O3UA 2QA9E 4K3JA 3TJNA 3ELAH 1FAXA 5JDUB 1RIWB 2Z9KA 2ZGXH 3KNXA 4J1YA 2QV1A 2ZA5A 3EAJA 3GYLB 2QIQA 1CT2E 3RU4E 7LPRA 5DK1A 5DP5A 1CU1A 3ODDA 4GCHG 1KLIH 1TOCB 3FAOA 1SSXA 2PGQB 2BQ7B 1P9SA 1HJAC 3DT0H 5PTPA 2HWLB 3RXQA 4WJG2 5ETXA 4BTTB 1O38A 2ZZUH 3ATKA 2AFQB 1SOTA 2NU0E 3OSYA 1XUGA 1SMFE 2VVVA 1TX6A 4X8UH 1GBIA 1O5GH 1G9IE 3S0NA 1AIXH 3P6ZB 1MTVA 2B7DH 4B71A 2PKAB 1O3IA 2BVSH 3VGCC 5E8EH 5ESTE 1V2RT 1BJUA 4FUEA 6CHAC 1TMTH 3QTOH 1C2IA 4LK4A 2PW8H 2O8WA 2VIPA 3SNEA 4AG2A 1O2KA 1GBTA 2HLCA 1W10U 2ZECA 5LPRA 1CQQA 3ZVFA 4I8GA 2ZPSA 2R2MB 2VIOA 1O3PB 1GJ4H 1FZZA 2UUJB 1ZSLA 2WPKS 4A7IB 1OWDA 2R3YA 1ZTJA 3SU3A 3PO1C 1BTXA 3M35A 3MU4A 2P93A 3MU0A 2ZPRA 1GJ6A 1JXPA 2V6NA 1G3BA 4RN6A 1JWTA 3HPTB 1RJXB 2CF9H 1P2NA 3ZV9A 1C9PA 1FY3A 3SGAE 2J95A 2PSXA 4ISIH 3LH3A 3P8OA 2W5EA 1Z7KA 1Y59T 1XUHA 1W2KH 4BANB 1UVOA 1W7XH 1YPKH 1P2KA 1OWHA 4JZEH 1QIXB 2R0LA 4GSOA 4MNVA 5CHAB 5FAHA 1JIRA 2F83A 1DX5M 1O3LA 4CHAC 1A46H 1YLDA 1TE0A 2NU3E 5FBIA 1GBFA 3RXAA 1MZAA 1O2SA 3ZZDA 3ATWA 1UTNA 1EAXA 4Y8XA 4WMEA 4AFUA 1B5GH 2VGCC 4Y8ZA 4AYVB 3PWBA 1HLTH 3SHAH 5A2MH 2PR3A 4X6NA 1Y3WA 2PGBB 1TBRH 2P3FH 1O2TA 1YKTA 1KY9A 2ZCHP 4KKDA 4OS7A 1A2CH 4MPWA 1A0JA 3QWCH 1UK2A 2ZU2A 2BD5A 2ZGHA 5EXNA 4E05H 2KAIB 3KCGH 3BTFE 3HKJB 2BLWA 1ANCA 4X2YA 1TX8A 1MU8B 3AW0A 4PROA 3RXVA 3CP7A 2I6QA 2ZHEH 3SU4A 1DLKB 3TJUA 2AIPA 3URDA 5FCRA 3KQCA 1P11E 2DE8A 2VU8E 1ZHRA 1HDTH 1VJAU 3Q76A 2HRVA 4HTCH 3E0PB 4FXGH 1MQ5A 5FXLA 2GMTC 3P8FA 1YPMH 3LGUA 2STBE 4CR5A 1GHWH 2CN0H 1AWFH 2R0KA 1QL8A 9ESTA 3GY7A 5F8TA 4ABAA 1ZZZA 4MQAA 3SW2B 1FXYA 4SGBE 1AZZA 4YOIA 3B9FH 5A0AE 4I8LA 1BJVA 2CV3A 1GBEA 3F6UH 4D8NA 4UFDH 3DD2H 2A4GA 4X1QU 1L1JA 3UWJH 3BIVH 4ABGA 1ABJH 1W3CA 2OQ5A 3S9CA 4DIHH 3DFJA 3MFJA 3QN7A 1EAWA 1O3KA 3F9FA 4KTCA 2ZU4A 5BRRE 3KQDA 1P06A 1IAUA 1CA8B 4UFEH 1EOLA 1FIWA 1WTGH 3LPRA 2F9NA 3D62A 3P92A 1GHVH 1YPLH 1AO5A 2GD4B 1GHXH 4JCNA 3URCA 2Z7FE 1A7SA 1FY4A 2QC2A 3U98H 2JETC 1XXFA 2HPQH 2WPMS 1CGJE 1TYNA 1DWCH 2P94A 1V2OT 3UTUH 8GCHG 1HGTH 4X8TH 5E0GA 1ZRBA 1HAGE 1A61H 3PYHA 4YTAA 2AMPA 1XX9A 4JYTA 1A4WH 1EPTA 3AAVA 3Q77A 2CF8H 1UVTH 3BTQE 1FN8A 2GVFA 2FPZA 2QF0A 4X0WU 1ANDA 1C1MA 1TA2A 1O2OA 2R2WU 3BG4B 1DY8A 1TONA 3LC5A 1FLEE 1MAYA 1LVYA 2SGDE 1C2GA 4ZXYH 2GCHF 1QURH 4F4OC 2TPIZ 3V3MA 3GCOA 1DM4B 1SVPA 1OWJA 1C1TA 1H9LB 3A87A 2G51A 1SQTA 2ANWA 1C4U2 2ZHWH 3I78A 1TGBA 1SGNE 1QFKH 3PMJA 3GYMA 1P9UA 4K60A 2W3IA 1EQ9A 1J17T 1GMCG 4GVUA 4ABJA 3T5FH 1A3BH 1UVUH 3MMGA 3EQ0H 4R0IA 2BD8A 4M7GA 2G00A 4MTBA 4INLA 1V2ST 3SV7A 1G3DA 1LHDH 1HBTH 2QAAA 3E8LA 1L1NA 4INHA 3RXMA 4B2CA 4WH6A 3MTYA 4VGCB 1D3QB 1HPGA 1DY9A 1THSH 5E0HA 2WV5A 2Y5FA 1V2KT 1KDQA 1GBJA 2XCFA 2CHAB 1V2NT 4TYDA 1UTPA 5GJ4B 4ABHA 1CBWB 3MU8A 4JZFH 1ETTH 2A1DB 2ILNA 3LONA 1QJ1B 4TPIZ 1C1NA 3VXFH 1SGQE 3KN2A 3T2NA 4ABDA 2H2ZA 8ESTE 3TGKE 3T25A 5C1YA 1F5LA 3EA8A 1H9IE 4X6OA 3UWIA 5DP3A 1VITH 1SFIA 3GDVA 1PPZA 3M7UA 3BTME 3ZVBA 1T4UH 1QRWA 3SO3A 1ESTA 1G2MA 2A5IA 5JBCS 1K1LA 2C3SA 4MNXA 1ELTA 1NRNH 1LHGH 2TGAA 5T3HA 5JPMH 2J92A 3LC3A 1IQGA 2A4OA 3RXKA 3VXEH 4CRCA 3NWUA 1H8DH 2C8XB 5ABWA 4FUCA 2PWXA 5J4QA 1TLDA 4YO9A 2FOCA 4FUDA 1GJ8B 1L4ZA 1C5VA 2GGVB 3L6PA 6LPRA 2ASUB 1ZMNA 2OP9A 2P3UB 2XBVA 3RU4D 1S5SA 1DVAH 3TK5A 1YCPK 1JBUH 1HAXB 1TPSA 2F9OA 3FP7E 2BVXH 2FTMA 4ZHLU 5GDSH 3A7ZA 2PFEA 2OC7A 3H5CB 3UNQA 2D8WA 5E2OA 2CMYA 4RSPA 1O5EH 5H4IB 3SV8A 3K6ZA 4E7NA 2ZFFH 1OX1A 1IQNA 4WXVA 4AGJA 1TMUH 3VB6A 1W13U 1BDAA 1OWEA 2TGTA 1BITA 4IN2A 1P2MA 1L0ZA 3A85A 3HATH 1V2MT 2P16A 3U69H 2GCHG 3MO6A 1EAUA 2QN5T 2FEQH 3MU1A 1O2NA 4IBLH 3RDZA 1C2JA 1SG8B 2Q6DA 1O2XA 3BF6H 2BY5X 2XBYA 1EZXC 1GDNA 1YPHC 3SU1A 1NRRH 3SU6A 1YCPH 1HCGA 2XXLA 3RM0H 1FN6A 4BTIB 3TU7H 1P2JA 1P09A 1QY6A 2FYRA 3UFAA 3K9XB 1ZGIA 2OBOA 4DOQA 4Z0KA 1ID5H 2BYAX 3B8JA 2OC1A 1SGCA 1PPEE 4WY3A 1EATA 3K6YA 2ZFPH 3MO9A 2QYIA 1UTQA 2BD9A 3TGIE 1BHXF 1RIWC 3A81A 2ZFQH 3U1JB 1P3EA 3V0XA 1XUIA 5EW2H 1LQDB 4D7FA 1MAXA 2JKHA 5DP9A 2AS9A 3UQOA 1QHRB 2FTLE 2J94A 3VB5A 1D4PB 3M36A 1TGSZ 2Z3EA 1QA0A 5EQQA 2BHGA 2OCVB 1J14A 4FUJA 4NZQA 2C8ZB 1ZGVA 3JZ2B 5IYTA 3RXTA 1FQ3A 2ODQA 3ZZBA 4XBBA 1QQUA 1HAVB 2W7SA 3ITIA 5TCAA 2FZZA 3PB1E 1HB0B 3NCLA 3BTDE 3VEQB 3SJIA 4Y8YA 2JH0D 1QR3E 1SI5H 1P8VC 1ZPCA 1IQHA 4JK5A 3NKKA 1SGEE 1NRPH 1XM1A 2ZQ1A 4TY6A 5DO4H 4WWYA 3EDXB 2XYAA 3Q3XA 1QJ6B 1SBWA 2RCEA 1UCYE 1FMGA 1LQEA 2ZF0H 4I33A 1ESBA 1TPPA 1AUTC 4FU9A 1FV9A 2BY6X 1K1PA 3LU9B 1WQSA 3S69A 2OINA 4ZH8A 3C27B 6GCHF 2G8TA 2P95A 1NFWA 4MDSA 1DXWA 1WCZA 4THNH 9LPRA 3PM3A 2O8LA 4K69A 4DURA 1WBGB 2WYJA 1BTUA 5AF9H 1MTUA 1SPJA 4U30A 1XUFA 1YC0A 3FVFB 1KXFA 1IQIA 7GCHG 2AGGX 3GY6A 1WOFA 2FM2A 1O3AA 1O32A 1GMDG 1UCYK 1UHBA 2AERH 2XWAA 3UREA 1O5FH 5ESBA 4F49A 4A5TS 1Q31A 1QL7A 1BMMH 1KIGH 2TGDA 2THFB 3F9EA 5CHAC 1PYTC 1J15A 5TJXA 4DVAU 1X7AC 2GT8A 3PV4A 3V7TA 3RXHA 2WPIS 4IGDA 3PROA 3SNCA 1V2TT 1C2KA 2BY9X 5DP7A 2ANKH 1LPKB 3ZYDA 1AU8A 3TPIZ 2O8UA 2ZDNA 2ALPA 3QO6A 3F1SB 5JYIA 1D6WA 2XWBI 3SU2A 1NFUA 3RXSA 4A1VA 3SV6A 1WU1A 3ZZ9A 1C5UA 4B73A 2VWLA 1P2QA 3GY2A 4AFZA 1AE5A 3MYWA 2ZO3H 5C5OA 3SUDA 3SHCH 2FYQA 3CS7A 3ZVGA 1G32B 2OD3B 1UCYH 3NZIA 1BZXE 1K1NA 1MH0A 1FUJA 2H1UA 1QB1A 3ZZ7A 4JYUH 3MH6A 3KIDU 1GBDA 3A83A 1K2I1 2A7JA 2VIVA 3IG6B 1O2ZA 2FXRA 3STIA 1GJAB 1AKSA 1MKXK 1TBZH 1TAWA 4A92A 1INCA 5EG4A 3T26A 1BB0B 3H7OA 1AD8H 1S6HA 2YOLA 3P95A 3S9BA 1RTKA 1ZPBA 2VNTA 1KTSB 4HGCA 3RC6A 4NFFA 1GHBG 2OUAA 2ZKSA 3F68H 1F0UA 5DP4A 1AN1E 1C5YB 5BPEA 4AFQA 4ABFA 4YT7H 3A8DA 2B9LA 8LPRA 2AGEX 3T28A 3U8RH 1C4Y2 3OU0A 1SGFA 2WUBA 1GI7B 1Z1JA 4D9QA 1SGTA 3L3TA 4GAWA 3MI4A 3SZNA 5C5NA 5C1UA 2RA0A 3LH1A 3C1KA 3EA7A 4IN1A 5HYOA 3SUFA 3DUXH 1ANEA 3RC5A 1KTTB 1K28D 1MKXH 4MPXA 1UVPA 4AOQA 1MU6B 1N8OB 3FANA 4ZXXH 3BEUA 2SGFE 1SGDE 4FVBA 5EW1H 1H8IH 1ORFA 1RRKA 3D23A 3SUGA 3M5OA 3KHVA 2FOBA 1BRUP 4ISNA 1GJ9B 4LXBH 3GCTG 1MTNB 1LPGB 6GCHG 1VITG 2XC5A 1QBOA 4INKA 1XKAC 1HFDA 2HPPH 3HK3B 3FFGA 3SI4H 2EA3A 5T6FA 5IDKA 2HOBA 1SGFG 2DUCA 1TRMA 3SBKA 2BD4A 2ZEBA 4FUFA 3RXFA 2AH4X 1O35A 4RKOB 2WV4A 3ATIA 1GDUA 5F6MA 1O2LA 2V3HH 3KQEA 1Y5AT 5F8ZA 1U6QA 3RXGA 2PTCE 2ZHFH 4YT6H 1OYTH 3ZZ4A 2IJOB 4K8BA 1TGTA 1G3EA 1YBWA 1GCDA 3RU4T 4DCDA 1A0HB 3BG4C 1F0RA 1G37A 5EGMA 4Z6AH 4ZROA 5J4SA 3A8AA 3AASA 1D9IA 2FDAA 1IHSH 4IMZA 3KL6A 2JH6D 5HGGA 1W11U 2ZU1A 2FESH 3R3GB 1ZRKA 2Y5GA 4NG9H 3WY8A 3W94A 4I31A 1CHGA 1IQEA 1IQJA 1HAIH 1W0ZU 2V3OH 1E38B 2A7CA 3D65E 1Y3VA 1CA0B 3NK8A 1AVGH 1LVBA 1UVSH 4Y0ZE 3TITA 4JK6A 4U32A 4OS6A 2WYGA 1ELGA 1HAPH 1MTSA 2J38A 3GISB 1V2PT 5FPSA 4LOYH 5SGAE 1SGYE 5GCHF 1O3GA 2FLBH 1O30A 4TWYA 4VGCC 1CE5A 1TA6A 1NZQH 2TGPZ 2ODYB 5EPYA 3V12A 3K65B 2CHAC 1JIMA 2PKSB 1S0RA 1OP8A 2Y80A 1EAIA 1ZJDA 3ODFA 3MH7A 2ZI2H 1WYKA 1CBWC 1PPGE 2AYWA 2RA3A 3M3SA 2ZU5A 1BRCE 1HYLA 2VWMA 1QL9A 1UTLM 1EPTB 1QB6A 1MTWA 1PPFE 1UTKA 1O2VA 1C5WB 1TBQH 3Q3YA 3GY4A 4I32A 2VIDA 2P8OB 1Q2WA 1FY5A 1F92A 5LPFA 4YESB 1GI2A 1C5XB 1ZLRA 1CGIE 3LJJA 2ZNKH 1C2EA 3SU0A 2NU2E 2PSYA 3D49H 3PO1B 2VH6A 5DGJA 2FX6A 2HNTE 4XFQA 1GHAF 2ZC9H 3TNTA 2TIOA 3O8DA 5EQSA 1UK4A 2XC4A 1OSSA 3CENA 5C2ZA 4CREA 1MD7A 1TGNA 1T8MA 3P17H 3TH3H 2ZTYA 3BIUH 1GCTB 1W12U 4AB9A 3BSQA 4NIWA 4X2WA 1S83A 4K5ZA 4XBDA 4IW4E 5JBAS 1AE8H 2BB4A 1ZR0A 1K1IA 1AQ7A 1OXGA 1YPHE 3S9AA 2FMJA 1KLJH 1NRSH 1O5DH 1C2HA 4JZIA 2BTCE 3IWMA 1ELVA 1TGCA 1FPHH 3QZRA 1MBMA 3Q00A 1V2VT 1LTOA 3U9AH 1QJ7B 2J34A 2Z3CA 2ZFRH 3ZVAA 1KDQB 2HALA 1RD3B 1V2JT 4B2BA 1C1QA 3RC4A 2PV9B 2PUXB 2A4RA 1O2MA 6ESTA 2ANYA 5LH8A 2A5KA 1BIOA 5HMAA 1TPAE 4CRGA 1OS8A 2WPHS 1O2PA 1BRBE 5L6NH 2V35A 4UE7H 5HXFA 2ZHQH 1P10A 2FODA 1AMHA 1C5NH 3UNRA 1G36A 2G5VA 2UUFB 1B0EA 1RGQA 3GCHB 1O3CA 2GZ8A 3MH4A 1NO9H 1GBHA 3QGJA 1TWXB 3A7YA 2ZDLA 2FI4E 1XVOA 3RLWH 1EZQA 2QCYA 1C5ZB 4AN7A 3Q3KA 3EGKH 1O3MA 5L2ZH 2F9PA 2SGPE 2BX3A 2BLVA 1ZTKA 4DGJA 2A2XH 3SNBA 1V2WT 3UR6A 3M7TA 5C3NA 2PLXA 1GL1A 1O2RA 4TWWA 1FIZA 2BOHB 4ISOA 1OWIA 3TLOA 3M5MA 3PWCA 1ELEE 3SN8A 5GWZA 2PUQH 2ALVA 3P8NA 2BDCA 4WMDA 1O3NA 4WVPE 2AIQA 3HGPA 2BDHA 4Q7XA 2W3KA 1G30B 4KTUA 1HAHH 1QTFA 2EI7A 2FOEA 1CT0E 3LKWA 1EZUC 1ARCA 2ZFSA 3SQHE 2Y5HA 3ZZ5A 4Y79A 1O2HA 3GCNA 5AFYH 1C5QA 1TALA 1TMBH 3GDUA 2M5TA 1QCPA 4B2AA 5DP6A 2SGEE 1CO7E 1B7XB 5GIBA 1DE7H 1DPOA 3ESTA 1YPGH 1KXAA 1C2DA 2ZQ2A 4SGAE 1P03A 2BXUH 1PQ8A 2SNWA 1GPZA 2J9NA 3PMHB 3BTWE 3DA9B 4XOJA 3U8TH 5DG6A 1NU7B 5CE1A 4ZKOU 3OY5U 1QA7A 3OY6U 4FUBA 2WPLS 1GHAG 2ZCKP 1A0LA 4BXWA 1EP6A 3ZVCA 5DP8A 4AFSA 1C1UH 3RUOA 4CBOA 1GI8B 1CVWH 1C5MD 1F5KU 3TH4H 1AB9B 1E35B 4XSKU 3GY8A 1W0YH 2Z3DA 2QY0B 1GDQA 5EU8A 4B76A 3O8RA 3E0NB 3UIRA 5A09A 3A80A 2TRMA 3V13A 1NESE 5JB8S 1EX3A 4UEHH 3TVJB 2HNTC 1Z8GA 1DICA 2G4TA 1QQ4A 1RTLA 1KXCA 1SQAA 4MPUA 1HAYB 3A82A 4UDWH 3TJVA 1BTWA 2LPRA 4YLQH 1Y3UA 3MO3A 2XC0A 1C5RA 4O3TA 1YM0A 4KELA 2W7UA 4XE4A 1BMLA 1SGIB 1AUJA 1AZ8A 4IC6A 4HI3A 1J8AA 1BRAA 2H5DA 3A8CA 1ZOMA 4BTUB 2GTBA 1ELDE 5L2YH 3M5LA 1UTOA 1BMNH 3RMOH 1V2QT 2Y6TA 1FPCH 1THPB 4B1TA 1P2OA 1TB6H 2FOAA 2RG3A 2ZU3A 4AZ2B 2GCTB 2NU1E 1GBKA 1NC6A 2C90B 1GBAA 1GJ7B 5EXMA 3SU5A 4DJZB 1TNJA 1MZDA 1VJ9U 3I77A 2BZAA 5AHGH 2ULLA 1DLEA 2EI8A 1H1BA 2ZDVH 1BTHH 1L1GA 1QNJA 3QX5H 1TNIA 3SGQE 2LNCA 4GCHF 3SNDA 1C5TA 1TABE 1AFQB 2R3UA 2QXHA 2XNIA 3M3VA 1TIOA 4KTSA 4A6LA 3LGVA 1F0SA 4AGKA 1O34A 2FX4A 4ZHMU 1C1VH 1LVOA 2HGTH 3H7TA 2AEIH 1K1OA 1HIAA 1V2LT 1RFNA 3SV2H 2O9QA 1YP9A 1BA8B 2UUYA 1DWEH 2F3CE 1DSTA 4U2WA 1LHFH 4TPYA 2A0QB 1O33A 1SB1H 1S85A 2FP7B 1BTPA 2VINA 1HJ9A 4Q7YA 2HNTF 3K2UA 3F9HA 1ARBA 4MVNA 1UHBB 1IQMA 2AGIX 4Y71A 1K22H 4X8SH 1DDJA 1L4DA 1Y3XA 4BAQB 2Z94A 1SLXB 4D76A 1AWHB 1GBBA 1C5PA 3SJKA 1D6RA 2W26A 3TNSA 3SV9A 4MG3A 3RXUA 3QZQA 1TQ7B 2NWNA 1LDTT 4DG4A 3PMAB 3RMMH 1SOZA 1Y5BT 1Q3XA 2G52A 4X2VA 1DT2A 1D3PB 1O2IA 2VJ1A 2Z6BD 3A89A 2JH5D 1L2EA 3RMNH 1A3EH 2BX4A 1W14U 4YLUA 1N8OC 1O39A 4GUXA 4XBCA 3GY3A 3DHKH 1NS3A 2C93B 3P8GA 4GPGA 2BOKA 5K7RA 4X1PU 3LGTA 2VIWA 4I8HA 1D3DB 1MTNC 1BUIA 3MNBA 5FX5A 1YF4A 3UOUA 3A86A 2GT7A 1DWDH 5A8XA 2PTNA 4QT8C 1ACBE 1HAOH 1HXEH 3PLPA 3RXCA 1NTPA 3MU5A 4DT7B 2ZP0H 3QTVH 2GX4A 1K1MA 1AKSB 1SFQB 2FWWA 2XCNA 2Z9LA 1PQAA 1DUEA 3LT3A 3UY9A 2GZ9A 4ZAEA 5A0BA 1O37A 1GMHF 1GHYH 1YPJH 1F5RA 2Q1JA 4FUIA 1OYQA 4MNWA 1EB2A 4RKJB 4AG1A 2GZ7A 1Z8JB 3ZZ3A 2WINI 3UQVA 2FI5E 4MPVA 5A0CA 1W8BH 3SJOA 1BOQA 4GHTA 7ESTE 1O3OA 3GDSA 1QB9A 1OP0A 1QRZA 1FNIA 4NIXA 1C2FA 4HZHA 1E34B 4TY7A 2SGAA 5C1XA 2XTTB 4IS5A 1C5OH 1O31A 2G55A 4AX9H 2RDLA 1O2JA 1E37B 5EPNA 2P3TB 1Z6JH 2H9EH 2OTVA 3QUMP 1YGCH 1ZHPA 3CS0A 4BAOB 1SL3A 3MHWU 2Y7XA 2EC9H 3LGIA 3VB3A 1CA0C 3FP8E 5G4BA 3PTNA 4Q2KA 3LDXH 1Z71A 1KLTA 3NPSA 1TNHA 5FBEA 4ZKRU 2B8OH 5LPEA 2SGQE 4K1TA 1ABIH 1EJNA 3RXDA 3TIUA 1O0DH 1P12E 5F8XA 4FVDA 2BD7A 4E7RG 1IHTH 1NT1A 1P05A 1Y3YA 3UOPA 3A8BA 2BDIA 2VVUA 1KXEA 2XW9A 1PQ7A 3NUMA 3NXPA 2Y81A 1A5HA 1HV7A 2PKSC 1HJ8A 2Y7ZA 3MOCA 3LGYA 4CBNA 2GDDA 3FZZA 2G81E 1GBLA 3ZZ6A 3OX7U 1C5LH 1A5GH 1EPTC 5FX6A 1O5CB 4O03A 4BAKB 3S7HB 1NY22 3RLYH 1O3EA 2P8OC 1UTMA 2ZDAH 4H6TA 1CSOE 2Q6GA 3TK9A 2A4QA 2P59A 2VH0A 1J16A 1HUTH 1O3JA 2SNVA 2VVCA 4X1SU 4YOJA 5DKMA 3ATLA 4NGAH 5JBBS 1P04A 2J4IA 1YYY1 1A1RA 1VGCB 4FUGA 1V2UT 2G4UA 3BEFB 1GJCB 2ZGJA 4ASHA 3O8BA 5FPTA 2BM2A 1GG6B 2ZFTA 3EYDA 2YNBA 1KXDA 2ZPQA 1LVMA 7KMEH 1GCTC 1FY1A 1NRQH 1YCPM 1RXPA 8GCHF 2PKAA 1TX7A 1BTZA 1O2YA 2SFAA 1EZSC 1NN6A 1Y8TA 4WF8A 1GGDB 1GBMA 1CHOF 2F91A 1NROH 2BVRH 1DOJA 1XKBC 5JBTA 4J2YB 5HM2A 1GI4A 1EJMA 4AB8A 4R8TB 3GY5A 3PTBA 2UWLA 1TNLA 1AFEH 1BBRE 3JZ1B 1SLVB 4OGYA 1GHZA 1O2QA 4FU7A 1SHHB 2FOMB 1G3CA 2UUKB 3SUEA 3VPKA 1GI1A 1S0QA 2Z9JA 4NZLA 1GMHG 1RS0A 1G2LA 2R9PA 2FO9A 1GMCF 1UMAH 1FY8E 3A88A 4X2XA 1DS2E 5AFZH 3GCHC 1C2LA 1PYTD 3BEIB 2BD2A 1MMJN 1BBRK 1XXDA 5C20A 2ZGBH 1HJAB 1O3DA 2PHBA 5JB9S 2FOFA 3ZZ8A 1QBNA 2ANMH 4K1EA 8KME2 3M3TA 1C5SA 1GI6A 1ELCA 3RXJA 2BZ6H 3A7TA 3BN9A 3SNAA 1MKWK 1F0TA 2TBSA 2O8TA 2XRCA 1EASA 3RP2A 1GWAA 1O5AB 2ZTXA 3RM2H 1EP5A 1K9OE 3VGCB 1GJ5H 4ESTE 3MNSA 4KP0A 6CHAB 3N7OA 4UFGH 1GVKB 3A84A 3ZV8A 1HNEE 1K1JA 3RXIA 4A1TA 3EE0B 2A7HA 1MD8A 2GV6A 1C1WH 2QXIA 2B5TB 5FHTA 1O3FA 2ZDKA 2D1JA 4GLYA 1O36A 1T32A 4BAMB 1LHEH 1BBRH 1WV7H 2KAIA 2AMQA 4CR9A 2GP9B 3E16B 2UWPA 4Y7BA 3UR9A 1JOUB 2H5CA 2G5NA 5L30H 1N1LA 4OS2A 1M9UA 1DXPA 2FOHA 1LMWB 1TOMH 4GHQA 1MKWH 4CH8B 5T6GA 2H9TH 1NU9A 4CH2B 3TJOA 5E0JA 5A8YA 2Q6FA 2BY8X 4ZMAH 3KGPA 2ESTE 1C9TA 1TRYA 4BOHA 1FJSA 3GOVB 4DW2U 1C2MA 1JRTA 3ENSB 3O8CA 2AMDA 3RXBA 1ELAA 5EODA 4NCYA 1PPHE 4Y7AA 2BQWB 3SGBE 4WH8A 3OYPA 4CHAB 3TH2H 1AB9C 4ISHH 1XUKA 4I8KA 3FZDA 2Z9GA 2ZTZA 3DFLA 4ABBA 4NWKA 1UO6A 2CXVA 3AW1A 1LHCH 4ZHAA 1GJBB 1O2GH 1UJ1A 2VGCB 2VWOA 1CHOG 1O2UA 3M37A 1EKBB 5EOKA 4UONA 2HVXA 2GKVE 2OBQA 5K0HA 3QLPH 1HRTH 1S84A 4X8VH 1ETRH 4NSVA 1PPBH 5DPAA 4NIYA 2VWNA 5I46H 1AHTH 3UNSA 1O3BA 1QRXA 1SLWB 2BDBA 4YZUA 2VB0A 4IMQA 2ZWLH 1P57B 2BXTH 2A2QH 2FI3E 1SQOA 2QXJA 3MH5A 1ZPZA 1MCTA 1ZMLA 1NFXA 1VZQH 1EUFA 3QDZB 4X6PA 3RXRA 2A32A 3ZZCA 1KYNA 3S7KB 5FCKA 1JRSA 1ZMJA 1E36B 2CJIA 4ZKNU 1ELBA 3HK6B 3E1XB 4IC5A 2C8YB 2D26C 1ANBA 3L33A 3RMLH 3SOSA 3AAUA 1EJAA 2GCTC 1SC8U 3EA9A 1FONA 2GMTB 1ESAA 1T31A 2CGAA 1LPZB 1UTJA 4U01A 1BMAA 2C4FH 4K2YA 5GCHG 4Y10E 1CGHA 2IPHA 1H9HE 5EXLA 2BDAA 1W7GH 1AFQC 3ZYEA 2ZCLP 4A1XA 2C8WB 2FS8A 4UFFH 4D7GA 3E90B 1OPHB 1C1RA 1J9CH 4OS5A 2J2UA 3F9GA 1P3CA 1WQVH 3VB4A 1TFXA 3M7QA 3KQBA 2ZHDA 4OS1A 4Q80A 3E6PH 3TK6A 4AORA 5GXPA 1P0SH 4LZ1H 1SGRE 2DE9A 3ZZAA 1CT4E 1GBCA 3BTKE 1Z8RA 1ZSJA 1PPCE 1XVMA 1PFXC 1IQFA 4Q7ZA 2BDYA 4OS4A 1V3XA 1DUAA 3BV9B 2OQUA 3LJOA 3U8OH 1KXBA 1EOJA 1ELFA 1IOEA 1GL0E 3I29A 3BTHE 2JETB 1OOKB 3HGNA 1AGJA 4BNRA 1JMOH 3U1IB 1OKXA 4UD9H 5HM9A 1YPEH 2EI6A 4O9VA 2BQ6B 5B6OA 1EXFA 2Y82A 1QBVH 4NSYA 3PLKA 4WXIA 1DANH 1HAZB 1T4VH 2NU4E 2A31A 1PQ5A 3RXPA 5AVDA 1NPMA 2IOTA 1VCPA 1ZHMA 4BAHB 1C1PA 3AVZA 2GDEH 1GVLA 2H9HA 1K21H 1P02A 3TGJE 1HXFH 3VFEA 2F9UA 4YOGA 1LKBA 5LGOA 1FI8A 2BD3A 1VCQA 3HKIB 1LCYA 3T29A 7GCHF 1WSSH 1AVWA 2B0FA 1V6DA 1GMDF 3RXEA 2H6MA 1SR5C 2I6SA 4MNYA 3IITA 1C4V2 3M61U 4JZ1A 4NFEA 1DFPA 1VCWA 3GICB 1S6FA 3PMBB 4BXSA 4DY7B 1BT7A 4D9RA 4OGXA 4Y0YE 3SORA 2BMGB 2BLQA 1BTYA 1SLUB 4O97A 1GI9B 1THRH 1E0FD 1HIAB 1FAKH 2OC8A 5EQRA 4Y76A 2QXGA 3RXLA 1AVXA 4I8JA 2BDGA 3T27A 3W95A 3M5NA 2F9VA 1GI3A 2K1QA 1T8NA 2BY7X 2FLRH 4NIVA 1AY6H 1C1SA 1B0FA 1GI0A 1AI8H 1IQLA 2GV7A 4DIIH 1ZSKA 1MQ6A 4JYVH 4ZUHA 1F2SE 2OLGA 3MNCA 4X1NU 3KF2A 3RXOA 2A5AA 2FIRH 2ZIQH 2XBWA 2D2DA 3BTTE 1IQKA 5E2PA 4CRAA 3SJ8A 3E91A 1ZTLA 1Z1IA 1YLCA 3QK1A 5F03A 1LKAA 1BCUH 1C1OA 3BTEE 4HFPB 4FU8A 2ZG0H 1O5BB 1UK3A 1LO6A 1GI5A 4ISLA 1MCVA 1Z8IB 4KGAA 3R0FA 4K8YA 3B23B 2UWOA 5C67A 1DSUA 2F9BH 3LGWA 1KSNA 1WTHD 3KEEA 3T62A 1O3HA 4JZDH 1GHBF 1TNKA 1N6YA 4CRBA 3FP6E 2VIQA 2YNAA 2ZGCA 3E3TA 1P2IA 1S81A 3A7XA 1T8LA 1DITH 1F7ZA 1S82A 4X1RU 1QGFA 5A8ZA 1OWKA 1TNGA 1BHXB 3BG8A 4AYYB 1TPOA 1NFYA
chains in the Genus database with same CATH superfamily
1ZJKA 1EB1H 4Y6DA 2ODPA 4YM9A 2XBXA 4M9FA 3UUZA 1N6XA 3PLBA 3N99A 1A5IA 3ZVDA 1QZ8A 1WUNH 5T6DA 2O8MA 3BTGE 4X6MA 4H6SB 2OXSA 3MNXA 5EIYA 1TQ0B 3SJ9A 3MWIU 4NA7A 4B74A 4CRFA 4I7YH 3QGNB 4H42U 4E06H 2EEKA 4TT3D 3F2FA 2STAE 1PJPA 2V0BA 1ZYOA 3UPEA 1Z6EA 2ZDMA 5CMXH 4ABEA 1MBQA 4FUHA 5TCCA 2QF3A 1T7CA 4XDEA 2QGRA 1ETSH 5DJ7A 1VR1H 4NA8A 1DWBH 1VGCC 3GCTF 3ATMA 1XUJA 1VITF 4MLFB 3LIWA 1NM6A 1Y5UT 1OP2A 4NA9H 4ABIA 1GG6C 4Y11E 5FPYA 1XMNB 3LOXA 1SGPE 5I25A 3P70B 1SHYA 1HAVA 1O2WA 3STJA 1FDPA 3A7VA 2OC0A 5GPIB 1GGDC 1RTFB 1TRNA 1H4WA 4NWLA 2WUCA 1T8OA 3G01A 4K1SA 2IN2A 4WMFA 1D3TB 1P01A 2FOGA 3OTJE 4ZKSU 1GJDB 1GVZA 2A45B 4LZ4B 4JMYA 4CRDA 2BLOA 1MUEB 3A7WA 4H4FA 5B6LA 3VB7A 1BQYA 3SQEE 2FS9A 3ZVEA 4RT1A 1WAYB 4B75A 3SI3H 2WPJS 2Z9IA 4O3UA 3UB0A 2QA9E 4K3JA 3TJNA 3ELAH 1FAXA 5JDUB 1RIWB 2Z9KA 2ZGXH 3KNXA 4J1YA 2QV1A 2ZA5A 3EAJA 3GYLB 2QIQA 1CT2E 3RU4E 7LPRA 5DK1A 5DP5A 1CU1A 3ODDA 4GCHG 1KLIH 1TOCB 3FAOA 1SSXA 2PGQB 2BQ7B 1P9SA 1HJAC 3DT0H 5PTPA 2HWLB 3F3BA 3RXQA 4WJG2 5ETXA 4BTTB 3OAAD 1O38A 2OK5A 2ZZUH 3ATKA 2AFQB 1SOTA 2NU0E 3OSYA 1XUGA 1SMFE 2VVVA 1TX6A 4X8UH 3AK5A 1GBIA 1O5GH 1G9IE 3S0NA 5KGOA 1AIXH 3P6ZB 1MTVA 2B7DH 4B71A 2PKAB 1O3IA 2BVSH 3VGCC 5E8EH 5ESTE 1V2RT 1BJUA 4FUEA 4TSFD 6CHAC 1TMTH 3QTOH 1C2IA 4LK4A 2PW8H 2O8WA 2VIPA 3SNEA 4AG2A 1O2KA 5DSFA 1GBTA 2HLCA 3KYGA 1W10U 2ZECA 5LPRA 1CQQA 3ZVFA 4I8GA 2ZPSA 2R2MB 2VIOA 1O3PB 1GJ4H 1FZZA 2UUJB 1ZSLA 2WPKS 4I86A 4A7IB 1OWDA 2R3YA 1ZTJA 3SU3A 3PO1C 1BTXA 3M35A 3MU4A 2P93A 3MU0A 2ZPRA 1GJ6A 5EJ1A 1JXPA 2V6NA 2RFKC 1G3BA 4RN6A 1JWTA 3HPTB 1RJXB 2CF9H 1P2NA 3ZV9A 1C9PA 1FY3A 3SGAE 2J95A 2PSXA 3FOAA 4ISIH 3LH3A 3P8OA 2W5EA 2WHXA 1Z7KA 1Y59T 1XUHA 2YMSB 2JIZD 1W2KH 4BANB 1UVOA 1W7XH 1YPKH 1P2KA 1OWHA 4JZEH 1QIXB 2R0LA 4GSOA 4MNVA 5CHAB 3ZIAD 5FAHA 2W6ID 1JIRA 2F83A 1DX5M 1O3LA 4CHAC 1A46H 1YLDA 1TE0A 2NU3E 5FBIA 1GBFA 3RXAA 1MZAA 1O2SA 3ZZDA 3ATWA 1UTNA 1EAXA 4Y8XA 4WMEA 4AFUA 1B5GH 2VGCC 4Y8ZA 4AYVB 4B6EA 3PWBA 1HLTH 2L74A 3SHAH 5A2MH 2PR3A 4X6NA 1Y3WA 2PGBB 1TBRH 2P3FH 1O2TA 1YKTA 1KY9A 2ZCHP 4KKDA 4OS7A 1A2CH 4MPWA 1A0JA 3QWCH 1UK2A 2ZU2A 2BD5A 2ZGHA 5EXNA 4E05H 2KAIB 3KCGH 3BTFE 3HKJB 2BLWA 1ANCA 4X2YA 1TX8A 1MU8B 3AW0A 3PRDA 4DT4A 4PROA 1SQRA 3RXVA 3CP7A 2I6QA 2ZHEH 3SU4A 1DLKB 3TJUA 2AIPA 3URDA 5FCRA 3KQCA 1P11E 2HVYB 2DE8A 2VU8E 1ZHRA 2RDEA 1HDTH 4RT0A 1VJAU 3Q76A 2HRVA 4HTCH 3E0PB 4FXGH 1MQ5A 5FXLA 2GMTC 3P8FA 1YPMH 3LGUA 2STBE 3UAIC 4CR5A 1GHWH 2CN0H 3OEED 1AWFH 2R0KA 1QL8A 9ESTA 3GY7A 5F8TA 4ABAA 1ZZZA 4MQAA 3SW2B 1FXYA 4SGBE 2M2AA 1WXRA 1AZZA 4YOIA 3B9FH 5A0AE 3F2HA 4I8LA 1BJVA 2CV3A 1GBEA 3F6UH 4D8NA 4UFDH 3DD2H 2A4GA 4X1QU 1L1JA 3UWJH 2WZQA 3BIVH 4ABGA 1ABJH 1W3CA 2OQ5A 3S9CA 4DIHH 3DFJA 3MFJA 3QN7A 1EAWA 1O3KA 1COWD 3F9FA 4KTCA 2ZU4A 5BRRE 3KQDA 1P06A 3EE7A 2JJ1D 1IAUA 1CA8B 4UFEH 2V7QD 1EOLA 1FIWA 1WTGH 3LPRA 2F9NA 3D62A 3P92A 1GHVH 1YPLH 1AO5A 2GD4B 1GHXH 4JCNA 3URCA 2IPQX 2Z7FE 1A7SA 2AHME 1FY4A 2QC2A 3U98H 2JETC 1XXFA 2HPQH 2WPMS 1CGJE 1TYNA 1DWCH 2P94A 1V2OT 3UTUH 8GCHG 1HGTH 5EJLA 4X8TH 5E0GA 2KZ4A 1ZRBA 1HAGE 1A61H 3PYHA 4YTAA 2AMPA 1XX9A 4JYTA 1A4WH 1EPTA 3AAVA 3Q77A 2CF8H 1UVTH 3BTQE 1FN8A 2GVFA 2FPZA 2QF0A 4X0WU 1ANDA 1C1MA 1TA2A 3N7DA 1O2OA 2R2WU 3BG4B 1DY8A 1TONA 3LC5A 1FLEE 1MAYA 1LVYA 2SGDE 1C2GA 4ZXYH 2GCHF 1QURH 4F4OC 2TPIZ 3V3MA 3GCOA 1DM4B 1SVPA 1OWJA 1C1TA 1H9LB 3A87A 2G51A 3VG8A 1SQTA 2ANWA 1C4U2 2ZHWH 3I78A 1TGBA 2J98B 1SGNE 1QFKH 3PMJA 3GYMA 1P9UA 4K60A 2W3IA 1EQ9A 1J17T 1GMCG 4GVUA 4ABJA 3T5FH 1A3BH 1UVUH 3MMGA 3EQ0H 4R0IA 2BD8A 4M7GA 2G00A 5EJZA 2LP6A 4MTBA 4INLA 1V2ST 3SV7A 1G3DA 1LHDH 1HBTH 2QAAA 3E8LA 1L1NA 4INHA 3RXMA 4B2CA 4WH6A 3MTYA 4VGCB 1D3QB 1HPGA 1DY9A 1THSH 5E0HA 3F0OA 2WV5A 2Y5FA 1V2KT 1KDQA 1GBJA 2XCFA 2CHAB 1V2NT 4TYDA 1UTPA 5GJ4B 4ABHA 1CBWB 3MU8A 4JZFH 1ETTH 2A1DB 2ILNA 3LONA 1QJ1B 4TPIZ 1C1NA 3VXFH 1SGQE 3KN2A 2VBCA 3T2NA 4ABDA 2H2ZA 8ESTE 3TGKE 3T25A 5C1YA 1F5LA 3EA8A 1H9IE 4X6OA 3UWIA 5DP3A 1VITH 1SFIA 3GDVA 1PPZA 3M7UA 3BTME 3ZVBA 1T4UH 1QRWA 3SO3A 4FETA 1ESTA 1G2MA 2A5IA 5JBCS 1K1LA 2C3SA 4MNXA 1ELTA 1NRNH 1LHGH 2TGAA 5T3HA 5CDFE 5JPMH 2J92A 3LC3A 1IQGA 2A4OA 3RXKA 3VXEH 4CRCA 3NWUA 1H8DH 2C8XB 5ABWA 4FUCA 2PWXA 5J4QA 1TLDA 4YO9A 1VKYA 1H8ED 2FOCA 4FUDA 1GJ8B 1L4ZA 1C5VA 2GGVB 3L6PA 6LPRA 2ASUB 1ZMNA 2OP9A 2P3UB 2XBVA 3RU4D 1S5SA 1DVAH 3TK5A 1YCPK 1JBUH 1HAXB 1TPSA 2F9OA 3FP7E 2BVXH 2FTMA 4ZHLU 5GDSH 3A7ZA 2PFEA 2KCAA 2OC7A 3H5CB 3UNQA 2D8WA 5E2OA 2CMYA 4RSPA 1O5EH 5H4IB 3SV8A 3K6ZA 4E7NA 2ZFFH 1OX1A 1IQNA 4WXVA 4AGJA 1TMUH 3VB6A 1W13U 1BDAA 1OWEA 2TGTA 1BITA 4IN2A 1P2MA 1L0ZA 3A85A 3HATH 1V2MT 2P16A 3U69H 2GCHG 3MO6A 1EAUA 2QN5T 2FEQH 3MU1A 1O2NA 4IBLH 5FL7D 3RDZA 1C2JA 1SG8B 2Q6DA 1O2XA 3BF6H 2BY5X 2XBYA 1EZXC 1GDNA 1YPHC 3SU1A 1NRRH 1UW7A 3SU6A 1YCPH 1HCGA 2XXLA 3RM0H 1FN6A 4BTIB 3TU7H 1P2JA 1P09A 1QY6A 2FYRA 3UFAA 3K9XB 1ZGIA 2OBOA 4DOQA 4Z0KA 1ID5H 3OFND 5C94A 2BYAX 3B8JA 2OC1A 1SGCA 1PPEE 4WY3A 1EATA 3K6YA 2ZFPH 3MO9A 2QYIA 1UTQA 2BD9A 3TGIE 1BHXF 1RIWC 3A81A 2ZFQH 3U1JB 1P3EA 3V0XA 1XUIA 5EW2H 1LQDB 4D7FA 1MAXA 2JKHA 5DP9A 2AS9A 3UQOA 1QHRB 2FTLE 2J94A 3VB5A 1D4PB 3M36A 1TGSZ 2Z3EA 1QA0A 5EQQA 2BHGA 2OCVB 1J14A 4FUJA 4NZQA 2C8ZB 1ZGVA 3JZ2B 5IYTA 3RXTA 1FQ3A 2ODQA 3ZZBA 4XBBA 1QQUA 1HAVB 2W7SA 3ITIA 5TCAA 2FZZA 3PB1E 1HB0B 3NCLA 3BTDE 3VEQB 3SJIA 4Y8YA 2JH0D 1QR3E 2IJD1 1SI5H 1P8VC 1ZPCA 1IQHA 2JDID 3NKKA 4JK5A 1SGEE 1NRPH 1XM1A 2ZQ1A 4TY6A 5DO4H 4WWYA 3EDXB 2XYAA 4B6FA 3Q3XA 1QJ6B 1SBWA 2RCEA 1UCYE 1FMGA 1LQEA 2ZF0H 4I33A 1ESBA 1TPPA 1AUTC 4FU9A 1FV9A 2BY6X 1K1PA 3LU9B 1WQSA 3S69A 2OINA 4ZH8A 3C27B 6GCHF 2G8TA 2P95A 1NFWA 4MDSA 1DXWA 1WCZA 3N7EA 4THNH 9LPRA 3PM3A 2O8LA 4K69A 4DURA 1WBGB 4P00A 3PRBA 2WYJA 1BTUA 5AF9H 1MTUA 1SPJA 4U30A 1XUFA 1YC0A 3FVFB 1KXFA 1IQIA 7GCHG 2AGGX 2YMSC 3GY6A 1WOFA 2FM2A 1O3AA 1O32A 1GMDG 1UCYK 1UHBA 2AERH 2XWAA 3UREA 1O5FH 5ESBA 4F49A 4A5TS 1Q31A 1QL7A 1BMMH 1KIGH 2TGDA 2THFB 3F9EA 5CHAC 1PYTC 1J15A 5TJXA 4DVAU 1X7AC 2GT8A 3PV4A 3V7TA 3RXHA 2WPIS 4IGDA 3PROA 3SNCA 1V2TT 1C2KA 2BY9X 5DP7A 2ANKH 1LPKB 3ZYDA 1AU8A 3TPIZ 2O8UA 2ZDNA 2ALPA 3QO6A 3F1SB 5JYIA 1D6WA 5GNDA 2XWBI 3SU2A 1NFUA 3RXSA 4A1VA 3SV6A 1WU1A 3ZZ9A 1C5UA 4B73A 2VWLA 1P2QA 3GY2A 4AFZA 1AE5A 3MYWA 2ZO3H 5C5OA 3SUDA 3SHCH 2FYQA 3CS7A 3ZVGA 4Q63A 1G32B 2OD3B 1UCYH 3NZIA 1BZXE 1K1NA 1MH0A 1FUJA 2H1UA 1QB1A 3ZZ7A 4JYUH 3MH6A 3KIDU 1GBDA 3A83A 1K2I1 2A7JA 2VIVA 3IG6B 1O2ZA 2FXRA 3STIA 1GJAB 1AKSA 1MKXK 1TBZH 5T1VA 1TAWA 4A92A 3PV2A 1INCA 4OM9A 5EG4A 3T26A 1BB0B 3H7OA 1AD8H 1S6HA 2YOLA 3P95A 3S9BA 1RTKA 5HIZA 1ZPBA 2VNTA 1KTSB 3GS9A 4HGCA 3RC6A 4NFFA 1GHBG 2OUAA 2ZKSA 3F68H 1F0UA 4Q4LA 1AN1E 1C5YB 5DP4A 5BPEA 4AFQA 4ABFA 4YT7H 3A8DA 2B9LA 8LPRA 2AGEX 3T28A 3U8RH 2KX4A 1C4Y2 3OU0A 1SGFA 2WUBA 1GI7B 1Z1JA 4D9QA 1SGTA 3L3TA 4GAWA 3MI4A 3SZNA 5C5NA 5C1UA 2RA0A 3LH1A 3C1KA 3EA7A 4IN1A 5HYOA 1KMHB 3SUFA 3DUXH 1ANEA 3RC5A 2QF4A 1KTTB 1K28D 1MKXH 4MPXA 1UVPA 4AOQA 1MU6B 1N8OB 3FANA 4ZXXH 3BEUA 2SGFE 1SGDE 4FVBA 5EW1H 1H8IH 1ORFA 1RRKA 3D23A 3SUGA 3M5OA 3KHVA 2FOBA 1BRUP 4ISNA 1GJ9B 4LXBH 3GCTG 1MTNB 1LPGB 6GCHG 1VITG 2XC5A 1QBOA 4INKA 1XKAC 1HFDA 2HPPH 3HK3B 3FFGA 3SI4H 2EA3A 5T6FA 5IDKA 2HOBA 1SGFG 2DUCA 1TRMA 3SBKA 1E1RD 2BD4A 2ZEBA 4FUFA 3RXFA 2AH4X 1O35A 4RKOB 2WV4A 3ATIA 1GDUA 5F6MA 1O2LA 2V3HH 3KQEA 1Y5AT 5F8ZA 1U6QA 3RXGA 2PTCE 2ZHFH 4YT6H 1OYTH 3ZZ4A 2KM0A 2IJOB 4K8BA 1TGTA 1G3EA 1YBWA 1GCDA 3RU4T 4DCDA 1A0HB 3BG4C 1F0RA 1G37A 5EGMA 4Z6AH 4ZROA 5J4SA 3A8AA 3AASA 1D9IA 2FDAA 1IHSH 4IMZA 3KL6A 3SZEA 2JH6D 5HGGA 1W11U 2ZU1A 2FESH 3R3GB 1ZRKA 2W6JD 2Y5GA 4NG9H 3WY8A 3W94A 4I31A 1CHGA 1IQEA 1IQJA 1HAIH 1W0ZU 3SYJA 2V3OH 1E38B 2A7CA 3D65E 1Y3VA 4XD7D 1CA0B 3NK8A 1AVGH 1LVBA 1SKYE 1UVSH 4Y0ZE 3TITA 4JK6A 4U32A 4OS6A 2WYGA 1ELGA 5DN6D 1MTSA 2J38A 1HAPH 3GISB 1V2PT 5FPSA 3NRLA 4LOYH 5SGAE 1SGYE 5GCHF 1O3GA 2FLBH 1O30A 4TWYA 4VGCC 1CE5A 1TA6A 1NZQH 2TGPZ 2ODYB 5EPYA 3V12A 3K65B 2CHAC 1JIMA 3OEHD 3W1EA 2PKSB 1S0RA 1OP8A 2Y80A 1EAIA 1ZJDA 3ODFA 3MH7A 2ZI2H 1WYKA 1CBWC 1PPGE 2AYWA 2RA3A 3M3SA 2QE7D 2ZU5A 1BRCE 1HYLA 2VWMA 1QL9A 1UTLM 1EPTB 1QB6A 1MTWA 1PPFE 1UTKA 3U28C 1O2VA 1C5WB 1TBQH 3Q3YA 3GY4A 4I32A 2VIDA 2P8OB 1Q2WA 1FY5A 1F92A 5LPFA 4YESB 1GI2A 3OE7D 1C5XB 1ZLRA 1CGIE 3LJJA 2ZNKH 1C2EA 3SU0A 2NU2E 2PSYA 3D49H 3PO1B 2VH6A 5DGJA 2FX6A 1YLNA 2HNTE 1GHAF 2ZC9H 4XFQA 3TNTA 2TIOA 3O8DA 5EQSA 1UK4A 2XC4A 1OSSA 3CENA 5C2ZA 4CREA 1MD7A 1TGNA 1T8MA 3P17H 3TH3H 2ZTYA 3BIUH 1GCTB 1W12U 4AB9A 3BSQA 4NIWA 4X2WA 1S83A 4K5ZA 4XBDA 4IW4E 5JBAS 1AE8H 2BB4A 1ZR0A 1K1IA 1AQ7A 1OXGA 1YPHE 3S9AA 2FMJA 1KLJH 5CHBA 1NRSH 1O5DH 1C2HA 1YY3A 4JZIA 2BTCE 3IWMA 1ELVA 1TGCA 1FPHH 3QZRA 1MBMA 3Q00A 1V2VT 1LTOA 3U9AH 1QJ7B 2J34A 2Z3CA 2ZFRH 3ZVAA 1KDQB 2HALA 1RD3B 1V2JT 4B2BA 1C1QA 3RC4A 2PV9B 2PUXB 2A4RA 1O2MA 6ESTA 2ANYA 5LH8A 2A5KA 1BIOA 3WWFA 5HMAA 1TPAE 4CRGA 1OS8A 2WPHS 1O2PA 1BRBE 5L6NH 2V35A 4UE7H 5HXFA 2ZHQH 1P10A 2FODA 1AMHA 1C5NH 3UNRA 1G36A 2G5VA 2UUFB 1B0EA 1RGQA 3GCHB 1O3CA 2GZ8A 3MH4A 1NO9H 1GBHA 2PP6A 3QGJA 1TWXB 3A7YA 2ZDLA 2FI4E 1XVOA 3RLWH 1EZQA 2QCYA 1C5ZB 2WV9A 4AN7A 3Q3KA 3EGKH 3WW7A 1O3MA 5L2ZH 2F9PA 2SGPE 2BX3A 2BLVA 1ZTKA 4DGJA 2A2XH 2K0QA 3SNBA 2J97A 1V2WT 3UR6A 1E79D 1MABB 3M7TA 5C3NA 2PLXA 1GL1A 1O2RA 4TWWA 1FIZA 2BOHB 4ISOA 1OWIA 2KCPA 3TLOA 3M5MA 3PWCA 1ELEE 3SN8A 5GWZA 2PUQH 2ALVA 3P8NA 2BDCA 4WMDA 1O3NA 4WVPE 2AIQA 3HGPA 2BDHA 4ASUD 4Q7XA 2W3KA 1G30B 4KTUA 1HAHH 1QTFA 2EI7A 2FOEA 1E1QD 1CT0E 3LKWA 1EZUC 1ARCA 2EQNA 2ZFSA 3SQHE 2Y5HA 3ZZ5A 4Y79A 1O2HA 3GCNA 5AFYH 1C5QA 1TALA 1TMBH 3GDUA 2M5TA 1QCPA 4B2AA 3H09A 5DP6A 2SGEE 1CO7E 1B7XB 5GIBA 1DE7H 1DPOA 3ESTA 3DSOA 1YPGH 1KXAA 1C2DA 2ZQ2A 4SGAE 1P03A 2BXUH 1NBME 1PQ8A 2SNWA 1GPZA 2J9NA 3PMHB 3BTWE 3DA9B 2QF5A 4XOJA 3U8TH 5DG6A 1NU7B 5CE1A 4ZKOU 3OY5U 1QA7A 3OY6U 4FUBA 2WPLS 1GHAG 2ZCKP 1A0LA 4BXWA 1EP6A 3ZVCA 5DP8A 4AFSA 1C1UH 3RUOA 4CBOA 1GI8B 1CVWH 1C5MD 2K8IA 5KEDA 1F5KU 3TH4H 1AB9B 1E35B 4XSKU 3GY8A 1W0YH 2Z3DA 2QY0B 1GDQA 5EU8A 4B76A 3O8RA 3E0NB 3UIRA 5A09A 3A80A 2TRMA 3V13A 1NESE 5JB8S 1EX3A 4UEHH 3TVJB 2HNTC 1Z8GA 1DICA 2G4TA 1QQ4A 1RTLA 1KXCA 1SQAA 4MPUA 1HAYB 3A82A 4UDWH 3TJVA 1BTWA 2LPRA 4YLQH 1Y3UA 3MO3A 4ACBA 2XC0A 1C5RA 4O3TA 1YM0A 4KELA 2W7UA 4XE4A 1BMLA 1SGIB 1AUJA 1AZ8A 4IC6A 4HI3A 1J8AA 1BRAA 2H5DA 3A8CA 1ZOMA 4BTUB 2GTBA 1ELDE 5L2YH 4HG6A 3M5LA 1UTOA 1BMNH 3RMOH 1V2QT 2Y6TA 1FPCH 1THPB 4B1TA 1P2OA 1TB6H 2FOAA 2RG3A 2ZU3A 2WSSD 1BMFD 4AZ2B 2GCTB 2NU1E 1GBKA 1NC6A 2C90B 1GBAA 1GJ7B 5EXMA 3SU5A 4DJZB 3DSGA 4ACAA 1TNJA 1MZDA 1VJ9U 3I77A 2BZAA 5AHGH 2ULLA 1DLEA 2EI8A 1H1BA 2ZDVH 1BTHH 1L1GA 1QNJA 3QX5H 1TNIA 3SGQE 2LNCA 4GCHF 3SNDA 1C5TA 1TABE 1AFQB 2R3UA 2QXHA 2XNIA 3M3VA 1TIOA 1W0JD 4KTSA 4A6LA 2KFWA 3LGVA 1F0SA 4AGKA 1O34A 2FX4A 4ZHMU 1C1VH 1LVOA 2HGTH 3H7TA 2AEIH 1K1OA 1HIAA 1V2LT 1RFNA 3SV2H 2O9QA 1YP9A 2LELA 1BA8B 2UUYA 1DWEH 2F3CE 1DSTA 4U2WA 1LHFH 4TPYA 2A0QB 1O33A 1SB1H 1S85A 2FP7B 1BTPA 2VINA 1HJ9A 4Q7YA 2HNTF 3K2UA 3F9HA 3WWBA 3F2GA 1ARBA 4MVNA 1UHBB 1IQMA 2AGIX 4P02A 4Y71A 1K22H 4X8SH 1DDJA 1L4DA 1Y3XA 4BAQB 2Z94A 1SLXB 4D76A 1AWHB 1GBBA 1C5PA 3SJKA 1D6RA 2W26A 3TNSA 3SV9A 4MG3A 3RXUA 3QZQA 1TQ7B 2NWNA 1LDTT 4DG4A 3PMAB 2XOKD 3RMMH 1SOZA 1Y5BT 1Q3XA 2GJGA 2G52A 4X2VA 1DT2A 1D3PB 1O2IA 2VJ1A 2Z6BD 3A89A 2JH5D 5KECA 1L2EA 3RMNH 1A3EH 2BX4A 1W14U 4YLUA 1N8OC 1O39A 4GUXA 4XBCA 3GY3A 3DHKH 1NS3A 2C93B 3P8GA 4GPGA 2BOKA 5K7RA 4X1PU 3LGTA 2VIWA 4I8HA 1D3DB 1MTNC 1BUIA 3MNBA 5FX5A 1YF4A 3UOUA 3A86A 2GT7A 1DWDH 5A8XA 2PTNA 4QT8C 1ACBE 1HAOH 1HXEH 3PLPA 3RXCA 1NTPA 3MU5A 4DT7B 2ZP0H 3QTVH 2GX4A 3DSPA 1K1MA 1AKSB 1SFQB 2FWWA 2XCNA 2Z9LA 1PQAA 1DUEA 3LT3A 3UY9A 2GZ9A 4ZAEA 5A0BA 1O37A 1GMHF 1GHYH 1YPJH 1F5RA 2Q1JA 4FUIA 1OYQA 4MNWA 1EB2A 4RKJB 4AG1A 2GZ7A 1Z8JB 3ZZ3A 2WINI 3UQVA 2FI5E 4MPVA 1OHHD 5A0CA 1W8BH 3SJOA 1BOQA 4GHTA 7ESTE 1O3OA 3GDSA 1QB9A 1OP0A 1QRZA 1FNIA 4NIXA 1C2FA 4HZHA 1E34B 4TY7A 2SGAA 5C1XA 2XTTB 4IS5A 1C5OH 1O31A 2G55A 4AX9H 2RDLA 1O2JA 1E37B 5EPNA 2H9EH 1Z6JH 2OTVA 2P3TB 3QUMP 1YGCH 1ZHPA 3CS0A 4BAOB 1SL3A 2KCYA 3MHWU 2Y7XA 2EC9H 3LGIA 3VB3A 1CA0C 3FP8E 5G4BA 3PTNA 4Q2KA 3LDXH 1Z71A 1KLTA 3NPSA 1TNHA 5FBEA 4ZKRU 2B8OH 5LPEA 2SGQE 4K1TA 1ABIH 1EJNA 3RXDA 3TIUA 1O0DH 1P12E 5F8XA 1W0KD 4FVDA 2BD7A 4E7RG 1IHTH 1NT1A 1P05A 1Y3YA 3UOPA 3A8BA 2BDIA 2VVUA 1KXEA 2XW9A 1PQ7A 3NUMA 3NXPA 2Y81A 1A5HA 1HV7A 2PKSC 1HJ8A 4F48B 2Y7ZA 3MOCA 1S6LA 3LGYA 4CBNA 2GDDA 2KCOA 3FZZA 2G81E 2F43B 4FOUC 1GBLA 3ZZ6A 3OX7U 1C5LH 1A5GH 1EPTC 5FX6A 1O5CB 4O03A 4BAKB 3S7HB 1NY22 3RLYH 1O3EA 2P8OC 1UTMA 2ZDAH 4H6TA 1CSOE 2Q6GA 3TK9A 2A4QA 2P59A 5F53A 2VH0A 1J16A 1HUTH 4ZCNA 1O3JA 2SNVA 2VVCA 4X1SU 4YOJA 5DKMA 3ATLA 4NGAH 5JBBS 1P04A 2J4IA 1YYY1 1A1RA 1VGCB 2CK3D 4FUGA 1V2UT 2G4UA 3BEFB 1GJCB 2ZGJA 2WPDD 4ASHA 3O8BA 4RI0A 5FPTA 2BM2A 1GG6B 2ZFTA 3EYDA 2YNBA 1KXDA 4Z1MD 2ZPQA 4XRNA 1LVMA 7KMEH 1GCTC 1FY1A 1NRQH 3PV5A 1YCPM 1RXPA 8GCHF 2PKAA 1TX7A 1BTZA 1O2YA 2SFAA 1EZSC 1NN6A 1Y8TA 4WF8A 1GGDB 1GBMA 1CHOF 2F91A 1NROH 2BVRH 1DOJA 1XKBC 2HLDD 5JBTA 4J2YB 5HM2A 1GI4A 1EJMA 4AB8A 4R8TB 3GY5A 3PTBA 2UWLA 1TNLA 1AFEH 1BBRE 3JZ1B 1SLVB 4OGYA 1GHZA 1O2QA 4FU7A 1SHHB 2FOMB 1G3CA 2UUKB 3SUEA 3VPKA 2L6OA 1GI1A 1S0QA 2Z9JA 4NZLA 1GMHG 1RS0A 1NBMD 1G2LA 2R9PA 2FO9A 4AC9A 2YMSD 1GMCF 5C17A 1UMAH 3MQKC 1FY8E 3A88A 4X2XA 1DS2E 5AFZH 3GCHC 1C2LA 1PYTD 3BEIB 2BD2A 1MMJN 1BBRK 1XXDA 5C20A 2ZGBH 3F0PA 1HJAB 1O3DA 2PHBA 5JB9S 2FOFA 3ZZ8A 1QBNA 2ANMH 4K1EA 8KME2 3M3TA 1C5SA 1GI6A 1ELCA 3RXJA 2BZ6H 3A7TA 3BN9A 3SNAA 1MKWK 1F0TA 5HIYA 2TBSA 2O8TA 2XRCA 1EASA 3RP2A 1GWAA 1O5AB 2ZTXA 3RM2H 1EP5A 1K9OE 3VGCB 1GJ5H 4ESTE 3MNSA 4KP0A 6CHAB 3N7OA 4UFGH 1GVKB 3A84A 3ZV8A 1HNEE 1K1JA 3RXIA 4A1TA 3EE0B 2A7HA 1MD8A 2GV6A 1C1WH 2QXIA 2B5TB 2F4LA 5FHTA 1O3FA 2ZDKA 2D1JA 4GLYA 1O36A 1T32A 4BAMB 1LHEH 1BBRH 1WV7H 2KAIA 2AMQA 4CR9A 2GP9B 3E16B 2UWPA 4Y7BA 3UR9A 1JOUB 2H5CA 2G5NA 5L30H 1N1LA 4OS2A 1M9UA 1DXPA 2FOHA 1LMWB 1TOMH 4GHQA 1MKWH 4CH8B 5T6GA 2H9TH 1NU9A 1WDIA 3FO8D 4CH2B 3TJOA 5E0JA 5A8YA 2Q6FA 2BY8X 4ZMAH 3KGPA 2ESTE 1C9TA 1TRYA 4BOHA 1FJSA 3GOVB 4DW2U 1C2MA 1JRTA 3ENSB 3O8CA 2AMDA 3RXBA 1ELAA 5EODA 4NCYA 1PPHE 4Y7AA 2BQWB 3SGBE 4WH8A 3OYPA 4CHAB 3TH2H 1AB9C 2XNDD 4ISHH 5HKKD 3FKSD 1XUKA 4I8KA 3FZDA 2Z9GA 2ZTZA 3DFLA 3OTPA 4ABBA 4NWKA 1UO6A 2CXVA 3AW1A 1LHCH 4ZHAA 1GJBB 1O2GH 1UJ1A 2VGCB 2VWOA 1CHOG 1O2UA 3M37A 3KYFA 1EKBB 5EOKA 1YWUA 2JJ2D 4UONA 2HVXA 2GKVE 2OBQA 5K0HA 3QLPH 1HRTH 1S84A 4X8VH 2KR7A 1ETRH 4NSVA 1PPBH 5DPAA 4NIYA 2VWNA 5I46H 1AHTH 3UNSA 1O3BA 2V3MA 1QRXA 1SLWB 2BDBA 4YZUA 2VB0A 4IMQA 2ZWLH 1P57B 2BXTH 2A2QH 2FI3E 1SQOA 2QXJA 3MH5A 1ZPZA 1MCTA 1ZMLA 1NFXA 1VZQH 1EUFA 3QDZB 4X6PA 3RXRA 2A32A 3ZZCA 1KYNA 3S7KB 5FCKA 1JRSA 1ZMJA 1E36B 2CJIA 4ZKNU 1ELBA 3FN8A 3HK6B 3E1XB 4IC5A 2C8YB 2D26C 1ANBA 3L33A 3RMLH 3SOSA 3AAUA 1EJAA 2GCTC 1SC8U 3EA9A 1FONA 2GMTB 1ESAA 1T31A 2CGAA 1LPZB 1UTJA 4U01A 1BMAA 2C4FH 4K2YA 5GCHG 4Y10E 5C0UA 1CGHA 2IPHA 1H9HE 5EXLA 2BDAA 1W7GH 1AFQC 3ZYEA 2ZCLP 4A1XA 2C8WB 2FS8A 4UFFH 4D7GA 3E90B 1OPHB 2EY4C 2J5UA 1C1RA 1J9CH 4OS5A 2J2UA 3F9GA 1P3CA 1WQVH 3VB4A 2J98A 1TFXA 3M7QA 3KQBA 2ZHDA 4OS1A 4Q80A 3E6PH 3TK6A 4AORA 5GXPA 1P0SH 4LZ1H 1SGRE 2DE9A 3ZZAA 1CT4E 1GBCA 3BTKE 1Z8RA 1ZSJA 1PPCE 1XVMA 1PFXC 1IQFA 4Q7ZA 2BDYA 4OS4A 1V3XA 1DUAA 3BV9B 2OQUA 3LJOA 3U8OH 1KXBA 1EOJA 1ELFA 1IOEA 1GL0E 3I29A 3BTHE 2JETB 1OOKB 3HGNA 3DCLA 1AGJA 4BNRA 1JMOH 3U1IB 1OKXA 4UD9H 5HM9A 1YPEH 2EI6A 4O9VA 2BQ6B 5B6OA 1EXFA 2Y82A 1QBVH 4NSYA 3PLKA 4WXIA 1DANH 5IK2D 1HAZB 1T4VH 2NU4E 2A31A 1PQ5A 3RXPA 5AVDA 1NPMA 2IOTA 1VCPA 1ZHMA 4BAHB 1C1PA 3AVZA 2GDEH 1GVLA 2H9HA 1K21H 1P02A 3TGJE 1HXFH 3VFEA 2F9UA 4YOGA 1LKBA 5LGOA 1FI8A 2BD3A 1VCQA 3HKIB 1LCYA 3T29A 7GCHF 1WSSH 1AVWA 2B0FA 1V6DA 1GMDF 3RXEA 2H6MA 1SR5C 2I6SA 1H8HD 4MNYA 3IITA 1C4V2 3M61U 4JZ1A 4NFEA 1DFPA 1VCWA 3GICB 1S6FA 3PMBB 4BXSA 4DY7B 1BT7A 1K0HA 4D9RA 4OGXA 4Y0YE 3SORA 2BMGB 2BLQA 1BTYA 1SLUB 4O97A 1GI9B 1THRH 1E0FD 1HIAB 1FAKH 2OC8A 5EQRA 4Y76A 2QXGA 3RXLA 1AVXA 4I8JA 2BDGA 3T27A 3W95A 3M5NA 2F9VA 1GI3A 2K1QA 1T8NA 2BY7X 2FLRH 4NIVA 1AY6H 1C1SA 1B0FA 1GI0A 1AI8H 1IQLA 2GV7A 3CNRA 1ZSKA 4DIIH 1MQ6A 4JYVH 4ZUHA 1F2SE 2OLGA 3MNCA 4X1NU 3KF2A 3RXOA 2A5AA 2FIRH 2ZIQH 2XBWA 2D2DA 3BTTE 4YXWD 1IQKA 5E2PA 4CRAA 3SJ8A 3E91A 1ZTLA 1Z1IA 1YLCA 3QK1A 5F03A 1LKAA 1BCUH 1C1OA 3BTEE 4HFPB 4FU8A 4F55A 2ZG0H 1O5BB 1UK3A 1LO6A 1GI5A 4ISLA 1MCVA 1Z8IB 4KGAA 3R0FA 4K8YA 3B23B 2UWOA 5C67A 1DSUA 2F9BH 3LGWA 1KSNA 1WTHD 3KEEA 1FX0B 3T62A 1O3HA 3KQ5A 4JZDH 1GHBF 1TNKA 1N6YA 4CRBA 3FP6E 2VIQA 2YNAA 2ZGCA 3E3TA 1P2IA 1S81A 1EFRD 3A7XA 5C0TA 1T8LA 1DITH 1F7ZA 1S82A 4X1RU 1QGFA 5A8ZA 1OWKA 1TNGA 1BHXB 3BG8A 4AYYB 1TPOA 1NFYA
chains in the Genus database with same CATH topology
1ZJKA 1EB1H 4Y6DA 2ODPA 4YM9A 2XBXA 3UUZA 1N6XA 3PLBA 1A5IA 3ZVDA 1WUNH 5T6DA 2O8MA 3BTGE 4X6MA 4H6SB 2OXSA 3MNXA 1TQ0B 3SJ9A 3MWIU 4NA7A 4B74A 4CRFA 4I7YH 3QGNB 4H42U 4E06H 2EEKA 2STAE 1PJPA 2V0BA 1ZYOA 3UPEA 1Z6EA 2ZDMA 5CMXH 4ABEA 1MBQA 4FUHA 5TCCA 2QF3A 1T7CA 4XDEA 2QGRA 1ETSH 5DJ7A 1VR1H 4NA8A 1DWBH 1VGCC 3GCTF 3ATMA 1XUJA 1VITF 4MLFB 3LIWA 1NM6A 1Y5UT 1OP2A 4NA9H 4ABIA 1GG6C 4Y11E 5FPYA 1XMNB 3LOXA 1SGPE 5I25A 3P70B 1SHYA 1HAVA 1O2WA 3STJA 1FDPA 3A7VA 2OC0A 5GPIB 1GGDC 1RTFB 1TRNA 1H4WA 4NWLA 2WUCA 1T8OA 3G01A 4K1SA 2IN2A 4WMFA 1D3TB 1P01A 2FOGA 3OTJE 4ZKSU 1GJDB 1GVZA 2A45B 4LZ4B 4JMYA 4CRDA 2BLOA 1MUEB 3A7WA 4H4FA 3VB7A 1BQYA 3SQEE 2FS9A 3ZVEA 1WAYB 4B75A 3SI3H 2WPJS 2Z9IA 4O3UA 2QA9E 4K3JA 3TJNA 3ELAH 1FAXA 5JDUB 1RIWB 2Z9KA 2ZGXH 3KNXA 4J1YA 2QV1A 2ZA5A 3EAJA 3GYLB 2QIQA 1CT2E 3RU4E 7LPRA 5DK1A 5DP5A 1CU1A 3ODDA 4GCHG 1KLIH 1TOCB 3FAOA 1SSXA 2PGQB 2BQ7B 1P9SA 1HJAC 3DT0H 5PTPA 2HWLB 3RXQA 4WJG2 5ETXA 4BTTB 1O38A 2ZZUH 3ATKA 2AFQB 1SOTA 2NU0E 3OSYA 1XUGA 1SMFE 2VVVA 1TX6A 4X8UH 1GBIA 1O5GH 1G9IE 3S0NA 1AIXH 3P6ZB 1MTVA 2B7DH 4B71A 2PKAB 1O3IA 2BVSH 3VGCC 5E8EH 5ESTE 1V2RT 1BJUA 4FUEA 6CHAC 1TMTH 3QTOH 1C2IA 4LK4A 2PW8H 2O8WA 2VIPA 3SNEA 4AG2A 1O2KA 1GBTA 2HLCA 1W10U 2ZECA 5LPRA 1CQQA 3ZVFA 4I8GA 2ZPSA 2R2MB 2VIOA 1O3PB 1GJ4H 1FZZA 2UUJB 1ZSLA 2WPKS 4A7IB 1OWDA 2R3YA 1ZTJA 3SU3A 3PO1C 1BTXA 3M35A 3MU4A 2P93A 3MU0A 2ZPRA 1GJ6A 1JXPA 2V6NA 1G3BA 4RN6A 1JWTA 3HPTB 1RJXB 2CF9H 1P2NA 3ZV9A 1C9PA 1FY3A 3SGAE 2J95A 2PSXA 4ISIH 3LH3A 3P8OA 2W5EA 1Z7KA 1Y59T 1XUHA 1W2KH 4BANB 1UVOA 1W7XH 1YPKH 1P2KA 1OWHA 4JZEH 1QIXB 2R0LA 4GSOA 4MNVA 5CHAB 5FAHA 1JIRA 2F83A 1DX5M 1O3LA 4CHAC 1A46H 1YLDA 1TE0A 2NU3E 5FBIA 1GBFA 3RXAA 1MZAA 1O2SA 3ZZDA 3ATWA 1UTNA 1EAXA 4Y8XA 4WMEA 4AFUA 1B5GH 2VGCC 4Y8ZA 4AYVB 3PWBA 1HLTH 3SHAH 5A2MH 2PR3A 4X6NA 1Y3WA 2PGBB 1TBRH 2P3FH 1O2TA 1YKTA 1KY9A 2ZCHP 4KKDA 4OS7A 1A2CH 4MPWA 1A0JA 3QWCH 1UK2A 2ZU2A 2BD5A 2ZGHA 5EXNA 4E05H 2KAIB 3KCGH 3BTFE 3HKJB 2BLWA 1ANCA 4X2YA 1TX8A 1MU8B 3AW0A 4PROA 3RXVA 3CP7A 2I6QA 2ZHEH 3SU4A 1DLKB 3TJUA 2AIPA 3URDA 5FCRA 3KQCA 1P11E 2DE8A 2VU8E 1ZHRA 1HDTH 1VJAU 3Q76A 2HRVA 4HTCH 3E0PB 4FXGH 1MQ5A 5FXLA 2GMTC 3P8FA 1YPMH 3LGUA 2STBE 4CR5A 1GHWH 2CN0H 1AWFH 2R0KA 1QL8A 9ESTA 3GY7A 5F8TA 4ABAA 1ZZZA 4MQAA 3SW2B 1FXYA 4SGBE 1AZZA 4YOIA 3B9FH 5A0AE 4I8LA 1BJVA 2CV3A 1GBEA 3F6UH 4D8NA 4UFDH 3DD2H 2A4GA 4X1QU 1L1JA 3UWJH 3BIVH 4ABGA 1ABJH 1W3CA 2OQ5A 3S9CA 4DIHH 3DFJA 3MFJA 3QN7A 1EAWA 1O3KA 3F9FA 4KTCA 2ZU4A 5BRRE 3KQDA 1P06A 1IAUA 1CA8B 4UFEH 1EOLA 1FIWA 1WTGH 3LPRA 2F9NA 3D62A 3P92A 1GHVH 1YPLH 1AO5A 2GD4B 1GHXH 4JCNA 3URCA 2Z7FE 1A7SA 1FY4A 2QC2A 3U98H 2JETC 1XXFA 2HPQH 2WPMS 1CGJE 1TYNA 1DWCH 2P94A 1V2OT 3UTUH 8GCHG 1HGTH 4X8TH 5E0GA 1ZRBA 1HAGE 1A61H 3PYHA 4YTAA 2AMPA 1XX9A 4JYTA 1A4WH 1EPTA 3AAVA 3Q77A 2CF8H 1UVTH 3BTQE 1FN8A 2GVFA 2FPZA 2QF0A 4X0WU 1ANDA 1C1MA 1TA2A 1O2OA 2R2WU 3BG4B 1DY8A 1TONA 3LC5A 1FLEE 1MAYA 1LVYA 2SGDE 1C2GA 4ZXYH 2GCHF 1QURH 4F4OC 2TPIZ 3V3MA 3GCOA 1DM4B 1SVPA 1OWJA 1C1TA 1H9LB 3A87A 2G51A 1SQTA 2ANWA 1C4U2 2ZHWH 3I78A 1TGBA 1SGNE 1QFKH 3PMJA 3GYMA 1P9UA 4K60A 2W3IA 1EQ9A 1J17T 1GMCG 4GVUA 4ABJA 3T5FH 1A3BH 1UVUH 3MMGA 3EQ0H 4R0IA 2BD8A 4M7GA 2G00A 4MTBA 4INLA 1V2ST 3SV7A 1G3DA 1LHDH 1HBTH 2QAAA 3E8LA 1L1NA 4INHA 3RXMA 4B2CA 4WH6A 3MTYA 4VGCB 1D3QB 1HPGA 1DY9A 1THSH 5E0HA 2WV5A 2Y5FA 1V2KT 1KDQA 1GBJA 2XCFA 2CHAB 1V2NT 4TYDA 1UTPA 5GJ4B 4ABHA 1CBWB 3MU8A 4JZFH 1ETTH 2A1DB 2ILNA 3LONA 1QJ1B 4TPIZ 1C1NA 3VXFH 1SGQE 3KN2A 3T2NA 4ABDA 2H2ZA 8ESTE 3TGKE 3T25A 5C1YA 1F5LA 3EA8A 1H9IE 4X6OA 3UWIA 5DP3A 1VITH 1SFIA 3GDVA 1PPZA 3M7UA 3BTME 3ZVBA 1T4UH 1QRWA 3SO3A 1ESTA 1G2MA 2A5IA 5JBCS 1K1LA 2C3SA 4MNXA 1ELTA 1NRNH 1LHGH 2TGAA 5T3HA 5JPMH 2J92A 3LC3A 1IQGA 2A4OA 3RXKA 3VXEH 4CRCA 3NWUA 1H8DH 2C8XB 5ABWA 4FUCA 2PWXA 5J4QA 1TLDA 4YO9A 2FOCA 4FUDA 1GJ8B 1L4ZA 1C5VA 2GGVB 3L6PA 6LPRA 2ASUB 1ZMNA 2OP9A 2P3UB 2XBVA 3RU4D 1S5SA 1DVAH 3TK5A 1YCPK 1JBUH 1HAXB 1TPSA 2F9OA 3FP7E 2BVXH 2FTMA 4ZHLU 5GDSH 3A7ZA 2PFEA 2OC7A 3H5CB 3UNQA 2D8WA 5E2OA 2CMYA 4RSPA 1O5EH 5H4IB 3SV8A 3K6ZA 4E7NA 2ZFFH 1OX1A 1IQNA 4WXVA 4AGJA 1TMUH 3VB6A 1W13U 1BDAA 1OWEA 2TGTA 1BITA 4IN2A 1P2MA 1L0ZA 3A85A 3HATH 1V2MT 2P16A 3U69H 2GCHG 3MO6A 1EAUA 2QN5T 2FEQH 3MU1A 1O2NA 4IBLH 3RDZA 1C2JA 1SG8B 2Q6DA 1O2XA 3BF6H 2BY5X 2XBYA 1EZXC 1GDNA 1YPHC 3SU1A 1NRRH 3SU6A 1YCPH 1HCGA 2XXLA 3RM0H 1FN6A 4BTIB 3TU7H 1P2JA 1P09A 1QY6A 2FYRA 3UFAA 3K9XB 1ZGIA 2OBOA 4DOQA 4Z0KA 1ID5H 2BYAX 3B8JA 2OC1A 1SGCA 1PPEE 4WY3A 1EATA 3K6YA 2ZFPH 3MO9A 2QYIA 1UTQA 2BD9A 3TGIE 1BHXF 1RIWC 3A81A 2ZFQH 3U1JB 1P3EA 3V0XA 1XUIA 5EW2H 1LQDB 4D7FA 1MAXA 2JKHA 5DP9A 2AS9A 3UQOA 1QHRB 2FTLE 2J94A 3VB5A 1D4PB 3M36A 1TGSZ 2Z3EA 1QA0A 5EQQA 2BHGA 2OCVB 1J14A 4FUJA 4NZQA 2C8ZB 1ZGVA 3JZ2B 5IYTA 3RXTA 1FQ3A 2ODQA 3ZZBA 4XBBA 1QQUA 1HAVB 2W7SA 3ITIA 5TCAA 2FZZA 3PB1E 1HB0B 3NCLA 3BTDE 3VEQB 3SJIA 4Y8YA 2JH0D 1QR3E 1SI5H 1P8VC 1ZPCA 1IQHA 4JK5A 3NKKA 1SGEE 1NRPH 1XM1A 2ZQ1A 4TY6A 5DO4H 4WWYA 3EDXB 2XYAA 3Q3XA 1QJ6B 1SBWA 2RCEA 1UCYE 1FMGA 1LQEA 2ZF0H 4I33A 1ESBA 1TPPA 1AUTC 4FU9A 1FV9A 2BY6X 1K1PA 3LU9B 1WQSA 3S69A 2OINA 4ZH8A 3C27B 6GCHF 2G8TA 2P95A 1NFWA 4MDSA 1DXWA 1WCZA 4THNH 9LPRA 3PM3A 2O8LA 4K69A 4DURA 1WBGB 2WYJA 1BTUA 5AF9H 1MTUA 1SPJA 4U30A 1XUFA 1YC0A 3FVFB 1KXFA 1IQIA 7GCHG 2AGGX 3GY6A 1WOFA 2FM2A 1O3AA 1O32A 1GMDG 1UCYK 1UHBA 2AERH 2XWAA 3UREA 1O5FH 5ESBA 4F49A 4A5TS 1Q31A 1QL7A 1BMMH 1KIGH 2TGDA 2THFB 3F9EA 5CHAC 1PYTC 1J15A 5TJXA 4DVAU 1X7AC 2GT8A 3PV4A 3V7TA 3RXHA 2WPIS 4IGDA 3PROA 3SNCA 1V2TT 1C2KA 2BY9X 5DP7A 2ANKH 1LPKB 3ZYDA 1AU8A 3TPIZ 2O8UA 2ZDNA 2ALPA 3QO6A 3F1SB 5JYIA 1D6WA 2XWBI 3SU2A 1NFUA 3RXSA 4A1VA 3SV6A 1WU1A 3ZZ9A 1C5UA 4B73A 2VWLA 1P2QA 3GY2A 4AFZA 1AE5A 3MYWA 2ZO3H 5C5OA 3SUDA 3SHCH 2FYQA 3CS7A 3ZVGA 1G32B 2OD3B 1UCYH 3NZIA 1BZXE 1K1NA 1MH0A 1FUJA 2H1UA 1QB1A 3ZZ7A 4JYUH 3MH6A 3KIDU 1GBDA 3A83A 1K2I1 2A7JA 2VIVA 3IG6B 1O2ZA 2FXRA 3STIA 1GJAB 1AKSA 1MKXK 1TBZH 1TAWA 4A92A 1INCA 5EG4A 3T26A 1BB0B 3H7OA 1AD8H 1S6HA 2YOLA 3P95A 3S9BA 1RTKA 1ZPBA 2VNTA 1KTSB 4HGCA 3RC6A 4NFFA 1GHBG 2OUAA 2ZKSA 3F68H 1F0UA 5DP4A 1AN1E 1C5YB 5BPEA 4AFQA 4ABFA 4YT7H 3A8DA 2B9LA 8LPRA 2AGEX 3T28A 3U8RH 1C4Y2 3OU0A 1SGFA 2WUBA 1GI7B 1Z1JA 4D9QA 1SGTA 3L3TA 4GAWA 3MI4A 3SZNA 5C5NA 5C1UA 2RA0A 3LH1A 3C1KA 3EA7A 4IN1A 5HYOA 3SUFA 3DUXH 1ANEA 3RC5A 1KTTB 1K28D 1MKXH 4MPXA 1UVPA 4AOQA 1MU6B 1N8OB 3FANA 4ZXXH 3BEUA 2SGFE 1SGDE 4FVBA 5EW1H 1H8IH 1ORFA 1RRKA 3D23A 3SUGA 3M5OA 3KHVA 2FOBA 1BRUP 4ISNA 1GJ9B 4LXBH 3GCTG 1MTNB 1LPGB 6GCHG 1VITG 2XC5A 1QBOA 4INKA 1XKAC 1HFDA 2HPPH 3HK3B 3FFGA 3SI4H 2EA3A 5T6FA 5IDKA 2HOBA 1SGFG 2DUCA 1TRMA 3SBKA 2BD4A 2ZEBA 4FUFA 3RXFA 2AH4X 1O35A 4RKOB 2WV4A 3ATIA 1GDUA 5F6MA 1O2LA 2V3HH 3KQEA 1Y5AT 5F8ZA 1U6QA 3RXGA 2PTCE 2ZHFH 4YT6H 1OYTH 3ZZ4A 2IJOB 4K8BA 1TGTA 1G3EA 1YBWA 1GCDA 3RU4T 4DCDA 1A0HB 3BG4C 1F0RA 1G37A 5EGMA 4Z6AH 4ZROA 5J4SA 3A8AA 3AASA 1D9IA 2FDAA 1IHSH 4IMZA 3KL6A 2JH6D 5HGGA 1W11U 2ZU1A 2FESH 3R3GB 1ZRKA 2Y5GA 4NG9H 3WY8A 3W94A 4I31A 1CHGA 1IQEA 1IQJA 1HAIH 1W0ZU 2V3OH 1E38B 2A7CA 3D65E 1Y3VA 1CA0B 3NK8A 1AVGH 1LVBA 1UVSH 4Y0ZE 3TITA 4JK6A 4U32A 4OS6A 2WYGA 1ELGA 1HAPH 1MTSA 2J38A 3GISB 1V2PT 5FPSA 4LOYH 5SGAE 1SGYE 5GCHF 1O3GA 2FLBH 1O30A 4TWYA 4VGCC 1CE5A 1TA6A 1NZQH 2TGPZ 2ODYB 5EPYA 3V12A 3K65B 2CHAC 1JIMA 2PKSB 1S0RA 1OP8A 2Y80A 1EAIA 1ZJDA 3ODFA 3MH7A 2ZI2H 1WYKA 1CBWC 1PPGE 2AYWA 2RA3A 3M3SA 2ZU5A 1BRCE 1HYLA 2VWMA 1QL9A 1UTLM 1EPTB 1QB6A 1MTWA 1PPFE 1UTKA 1O2VA 1C5WB 1TBQH 3Q3YA 3GY4A 4I32A 2VIDA 2P8OB 1Q2WA 1FY5A 1F92A 5LPFA 4YESB 1GI2A 1C5XB 1ZLRA 1CGIE 3LJJA 2ZNKH 1C2EA 3SU0A 2NU2E 2PSYA 3D49H 3PO1B 2VH6A 5DGJA 2FX6A 2HNTE 4XFQA 1GHAF 2ZC9H 3TNTA 2TIOA 3O8DA 5EQSA 1UK4A 2XC4A 1OSSA 3CENA 5C2ZA 4CREA 1MD7A 1TGNA 1T8MA 3P17H 3TH3H 2ZTYA 3BIUH 1GCTB 1W12U 4AB9A 3BSQA 4NIWA 4X2WA 1S83A 4K5ZA 4XBDA 4IW4E 5JBAS 1AE8H 2BB4A 1ZR0A