4FUJA

Crystal structure of the urokinase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 63
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fujA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fujA01
2M5TA 4X6MA 1P11E 4O97A 1PJPA 3K2UA 4DIHH 2Q6DA 4CBNA 2ODYB 5C3NA 2NU1E 4CR9A 1ELBA 1ORFA 1UTPA 1ABJH 1KXDA 1L0ZA 1J14A 1EPTB 2NU4E 4H42U 1EATA 1MAYA 1RIWB 2RDLA 3BEFB 2V3HH 3UPEA 1BIOA 4FUGA 1BTWA 1FY1A 3P6ZB 2A4GA 1MU6B 2BY7X 3TIUA 2ZFQH 1TNJA 3FP8E 1TGCA 4NWLA 1ZHMA 2SNVA 1BJVA 1QFKH 1GJ5H 4XBBA 2FPZA 2FODA 3NUMA 2QAAA 3RXOA 1V2KT 1NROH 2JH5D 2R0KA 3QX5H 4Q7YA 1P2QA 1C2JA 1QIXB 4GCHG 1FAXA 1QJ1B 1BZXE 3R3GB 1DWEH 4X8VH 3RDZA 1TX6A 3RM0H 2PWXA 2OC1A 1VGCB 1CGHA 2F9VA 1KXAA 4X6NA 1BBRH 3SV7A 2QY0B 1HJAC 1MMJN 5LPRA 1DICA 2BY6X 1T8LA 2ZFSA 2TGTA 3AAVA 1BTHH 1CU1A 1ELGA 7ESTE 2ZF0H 1SQAA 1UVSH 3EA9A 3CS0A 2NU3E 1GGDC 3DA9B 1GPZA 5EW2H 1ELDE 2P8OB 1ELFA 1BHXB 3MU0A 5GJ4B 3P95A 1P05A 4Y8ZA 1LHDH 1XUIA 3ZVEA 1O5DH 1O2OA 2Y80A 3V12A 1NRNH 2GZ8A 7GCHF 2QN5T 5BRRE 4FU9A 2HVXA 2G4TA 2ZGXH 3KQDA 2ZFTA 1AE5A 1O3PB 2FM2A 3QTVH 1BITA 1C5SA 1ZJKA 1W0YH 1AKSB 5LGOA 5K0HA 1FMGA 1CO7E 2B8OH 2CJIA 1P04A 4WY3A 2ASUB 1WBGB 3OU0A 1TGSZ 1OWDA 3LKWA 4VGCC 1SGNE 1UJ1A 2OC0A 3H7OA 2ZA5A 2SGDE 1OP8A 3GY5A 3O8BA 1YGCH 3LONA 3ZZ6A 4MNVA 1YPEH 2GCHF 1YF4A 2BOHB 6LPRA 3Q3XA 4Q2KA 1KDQA 1TMTH 3RXEA 5E0HA 2F9OA 3U8OH 2A0QB 1THRH 1PYTC 1FV9A 2A4OA 2PFEA 3MI4A 3RUOA 1JRSA 2FOBA 3TJVA 5TJXA 1LKBA 1O2SA 2HNTE 2VIVA 4OS4A 1HRTH 7GCHG 2VIOA 3HGPA 5FXLA 1E36B 1QRWA 1S82A 3KGPA 1MKXK 5FPYA 7LPRA 1HAHH 4LK4A 5FBIA 1ZHPA 1A0LA 1P10A 4JYTA 2PV9B 1P9UA 2FO9A 4UDWH 1WYKA 1MH0A 1ACBE 4JCNA 2O8WA 2Y7ZA 1ZTKA 2BZAA 1YPJH 2DE8A 2GCTC 1QURH 1F5RA 3TGJE 1WQSA 2VWLA 4AFUA 1G30B 3F9HA 4INHA 1Z6EA 4GHTA 1V2UT 4K2YA 1ZGVA 3SNCA 3U1IB 2XBWA 2BD9A 4O3UA 2XTTB 3SJIA 1GJBB 3EDXB 2GCHG 1ZOMA 2A7JA 2AERH 3I77A 1NC6A 4UE7H 4I8HA 2LNCA 4X1PU 1TA2A 1ZMNA 3VB5A 1J15A 1CT2E 2FOHA 5GIBA 1PQ8A 3FZZA 1YCPK 1O3BA 5FPTA 1VJAU 1MTNC 3A7XA 4ZKRU 4RKJB 2J94A 3C27B 3BIUH 2BVRH 5FPSA 1TQ7B 1TNHA 4ZMAH 1N6XA 1UK4A 2R9PA 4GSOA 3MH4A 4IMZA 3RXTA 3ZZBA 4DT7B 1ARBA 1GL1A 1OWKA 3U9AH 1TA6A 2C90B 1AZ8A 3U1JB 1LTOA 5A0AE 1MD8A 5DP9A 4CRBA 4X2YA 1N8OC 1GBFA 4FUIA 3KHVA 3FANA 4H4FA 2B0FA 2BX3A 1T8MA 2B5TB 4X6OA 4O03A 2QC2A 1HIAA 3OX7U 1GWAA 1UTKA 2GZ7A 2Y82A 5E2PA 2HGTH 3RP2A 5EODA 2WPIS 3DD2H 3EQ0H 3P8GA 1H9HE 1QBOA 1O3JA 3RXLA 1D3QB 1W8BH 5DK1A 1KIGH 1LVYA 4TWWA 2AEIH 3G01A 1WTHD 2ANMH 1CVWH 1FY4A 4NIXA 2BD4A 1O3KA 1O3OA 4AFSA 1ESBA 1O5GH 1EP5A 1E35B 2G00A 1LMWB 2ZFPH 2XW9A 4JZDH 4ZXXH 3VGCC 4Y7BA 4ISIH 3U8RH 2VGCC 9LPRA 1XVOA 6ESTA 4XOJA 2ANYA 4I32A 1KDQB 3LGVA 2GV6A 4AX9H 3E90B 1C5MD 3ZV9A 4JZFH 1AN1E 1O3CA 2VNTA 5JBCS 1BA8B 1EAWA 2VIPA 1F0RA 2ALVA 2BVXH 1O3FA 2ZHQH 2Q6GA 1GHXH 1JIMA 3K6ZA 3BTWE 3T27A 1DLKB 1IQHA 4RSPA 1S84A 1ELAA 2GDDA 3LH3A 1VJ9U 1UTLM 3UUZA 4AG2A 1V2QT 2ZGBH 5LPFA 3TK9A 4NSYA 4GUXA 1TBRH 4YM9A 3U69H 1OWIA 3GY4A 3LIWA 1HCGA 1GBJA 1HJAB 2H9EH 2PUXB 2BY5X 3SZNA 4BTUB 3MNCA 1GDUA 1GMHF 1QRXA 2PGBB 5EW1H 1GHZA 1SFIA 1AVWA 3RXIA 1D6RA 1J8AA 3SO3A 3QLPH 2CF9H 1GGDB 2XXLA 2BYAX 1MAXA 2OQUA 3A7WA 1C2HA 1DSUA 3BTKE 3HATH 4Y71A 1O2HA 1RTKA 6GCHG 1D9IA 1W7XH 4DCDA 1ZPBA 1VITH 2K1QA 2WV4A 1J9CH 3ENSB 3HKJB 1QJ6B 2W26A 3CS7A 3SU2A 3B8JA 1ETSH 4B1TA 1WV7H 5FAHA 1TWXB 3LJOA 4AORA 1D3DB 1EUFA 4UD9H 2A5AA 1AHTH 2FI5E 1GJDB 2ZTZA 1C5NH 1OKXA 1C2KA 3TU7H 2ZIQH 3A87A 2QCYA 2GT8A 3A88A 4NA9H 2Y5FA 3RC6A 4MQAA 2AH4X 3K6YA 5TCCA 3V13A 4VGCB 2AYWA 1SGCA 3Q00A 3BIVH 3TJUA 1WSSH 5DG6A 3RXJA 1GBHA 1GMHG 1PPCE 1VCPA 3NKKA 3UWJH 2CN0H 3GY2A 1O31A 1HIAB 1N1LA 3VB7A 2J38A 2UWPA 2HALA 2OC8A 3IWMA 1EJNA 1FPCH 3NPSA 3ZVAA 1C1PA 3M5LA 2J9NA 3VB4A 2Z9LA 4IGDA 1C5XB 3WY8A 1V2NT 3L33A 1AZZA 3LJJA 2WPHS 1ETRH 5GWZA 4JYVH 1P8VC 2IOTA 3DHKH 2FOCA 5A0BA 1K1PA 5GDSH 1W13U 4INLA 1XXFA 1V2TT 2BLVA 1YPHE 2GCTB 1Q2WA 4TYDA 3MHWU 1O2YA 3BTTE 2SGQE 1V2RT 1Y5BT 4WXVA 1HAZB 4B76A 2FOGA 1MKWH 4KTUA 1P2OA 1MU8B 1TQ0B 4FUBA 4OS5A 3D62A 3K65B 1IQMA 3A89A 4XDEA 1AB9C 1FN8A 3RM2H 1SMFE 1T31A 2AGIX 1DWDH 1C2EA 1GCTC 1ZHRA 2TRMA 4O3TA 5C1XA 5J4QA 2G81E 4CHAC 1Z8RA 1FDPA 2J2UA 2BQ6B 1HLTH 2FYQA 3RXAA 5DPAA 1A46H 5C1UA 4DIIH 5JBBS 1O33A 3MOCA 3EAJA 2EI7A 1GBCA 1GBIA 5C5NA 4JK6A 3E8LA 1ZTJA 2XWAA 4Q7ZA 4Y79A 3M5MA 1QL9A 4B75A 4MNXA 1SGRE 1NO9H 2ZDAH 3IITA 2Z3DA 1N8OB 1Y5AT 3O8CA 2GDEH 4CRFA 5A8ZA 3QN7A 3ATKA 4CBOA 1W7GH 1T4VH 2WINI 1TNGA 4I8GA 4YZUA 3MNXA 1K2I1 2W3IA 1SL3A 1DANH 2IJOB 1BDAA 3QGJA 2ZI2H 1JRTA 1SQTA 3I78A 1SGTA 2BLWA 1E0FD 1G3EA 4WXIA 1BRUP 4MG3A 2FDAA 4WF8A 2A2QH 1QTFA 3KNXA 1BMAA 2R2MB 1UVUH 3F6UH 1AQ7A 1YBWA 2XNIA 1DVAH 1ZRBA 1C1MA 1NZQH 2OLGA 3RLYH 1Z8IB 3L6PA 4JZ1A 3PMBB 2Z9GA 1O3AA 1HPGA 3FP6E 1XM1A 1HXEH 2ODQA 2EI8A 3VGCB 2EEKA 2VGCB 1DUEA 5DKMA 5FHTA 1LO6A 1V3XA 4THNH 1BTXA 3S9BA 3ZYDA 1BQYA 5CHAC 1ARCA 2GT7A 1GI2A 1S0RA 4X8TH 1CGJE 2PSYA 1TRNA 1MTWA 1G37A 3ODFA 1F92A 1B0EA 3F9EA 1QA7A 3Q3KA 3OY5U 5A8YA 1GMCF 1Z1JA 4ISHH 3E3TA 1B0FA 3SJOA 2WPMS 4DW2U 1F7ZA 2CHAC 1S81A 2ZGHA 3TJNA 2JETC 2ZDNA 4ZROA 3RMLH 1ZTLA 4BOHA 2RA0A 4MLFB 1IQIA 1O5CB 5K7RA 1IAUA 4KGAA 2Y5GA 2ZQ2A 1FIWA 3DFLA 4UONA 1HBTH 1TGTA 2I6SA 2VJ1A 3SORA 1ZGIA 4D76A 5DJ7A 5IDKA 5T6DA 3QUMP 1OWJA 1A0JA 1C1OA 2A5IA 5CMXH 1TRYA 2ZU1A 1FN6A 1PPGE 1A2CH 1EQ9A 1GI8B 1TMBH 1D3PB 1Y3UA 3P17H 3LGYA 3ZZCA 3N7OA 4Q80A 4XSKU 1FIZA 1W12U 4ABFA 4NCYA 1EZSC 1Q3XA 1EP6A 3EYDA 2C8ZB 1LVMA 1PQ7A 1S6FA 1GBAA 1C1RA 1GMCG 3H7TA 1JOUB 1CA8B 1KY9A 2BD8A 3RXRA 1WCZA 3E16B 2G52A 2FLBH 5GPIB 1CHOG 2VB0A 1RS0A 3D49H 3HKIB 2Z9KA 2Y5HA 4DOQA 1RFNA 2UUFB 5F8XA 3PYHA 1YC0A 2R3UA 7KMEH 3BG8A 2F9BH 3P8OA 3A8AA 4KP0A 2IN2A 5HGGA 1GI5A 1O2QA 1W10U 1PPZA 1TIOA 3EA8A 1A1RA 1THSH 2OTVA 2QF0A 2LPRA 2F9UA 5EXNA 5C2ZA 1O2KA 2WUCA 2G8TA 1NFYA 3UY9A 1TBQH 3E1XB 2ZWLH 2HLCA 2KAIB 1IOEA 1G2LA 2ZTXA 1K1JA 1TMUH 4U32A 1PFXC 1GDQA 1ZYOA 1ID5H 4LXBH 2HOBA 3RXVA 2ZHEH 2ZU5A 1NFWA 3A86A 3E0PB 4OS2A 3LH1A 8GCHF 1TE0A 4X2WA 1UHBA 3SBKA 1A0HB 4R8TB 2QXIA 3QZQA 4FXGH 3STIA 2G4UA 4JYUH 3TNSA 1YPMH 1AB9B 4J1YA 1V2MT 1L1JA 1A3BH 3BTHE 2ZKSA 1MBQA 4UFGH 5E2OA 2ZU2A 1C5UA 2J92A 3GDUA 2O8MA 2XC4A 4OS6A 1GCTB 3KIDU 3T25A 5C20A 1MTVA 1NRQH 4CHAB 3MH7A 2BXUH 1QGFA 3LGUA 1MCTA 1O0DH 1HB0B 2A1DB 1C5RA 3FP7E 2TGAA 3TVJB 2ZP0H 5EXMA 5EXLA 2BLOA 1HV7A 1A7SA 2B9LA 1YLCA 4LZ4B 2D2DA 1P0SH 1K9OE 1GBBA 4HI3A 4D9RA 5CE1A 1SGDE 2FI4E 5EPYA 2BDCA 3TGIE 3BV9B 8GCHG 3I29A 3TITA 1Z1IA 1GBMA 1GBEA 3OY6U 1FZZA 1ABIH 3KCGH 1YPKH 3M5OA 3RXKA 5A09A 1TRMA 1O37A 1XUHA 1BTYA 2BDAA 1V2OT 4K69A 1BTZA 1EZXC 5A8XA 4A92A 1HGTH 1ANBA 1C5QA 1P2IA 4HZHA 1ELTA 1TGBA 3UQOA 2FYRA 2VVUA 4GAWA 3RMOH 4B2BA 3MH5A 1O2LA 4NA8A 3MTYA 1Z8GA 5JYIA 2UUYA 1GI9B 3SUDA 2Z9JA 2ANKH 3MO3A 5AHGH 2A32A 3A8CA 1BRCE 3KQCA 3M61U 5DP4A 1CSOE 1E34B 3SJKA 1SGEE 5T3HA 2AS9A 1C5YB 4IS5A 1OWHA 3NWUA 4JMYA 1V2LT 1JBUH 3BTFE 2QYIA 1EAIA 1SGIB 2V0BA 3SU4A 3M7TA 1L4ZA 5CHAB 3MH6A 2A4RA 2ZPQA 3URDA 4X1QU 5JDUB 5ESBA 1TB6H 5AFYH 1T7CA 4ZAEA 3V7TA 2HPPH 4A7IB 1O2WA 1O3NA 3KQBA 1C2MA 2V6NA 4Z6AH 3A81A 2O8LA 4RN6A 1VCWA 1CBWC 3AW1A 1S6HA 2CHAB 1C2IA 1AE8H 1PPEE 1AUTC 4Y8YA 1GHWH 1LDTT 2JETB 4SGAE 3SOSA 2YOLA 5I46H 3RLWH 1BTPA 3A82A 1B7XB 1W3CA 3GYLB 1IHSH 3ITIA 4RKOB 1C1UH 1BOQA 1ESAA 1AD8H 2BXTH 2ZHFH 2FI3E 1IQJA 1UHBB 1LPZB 2R3YA 1XUFA 4ZH8A 1O30A 2WPJS 4ABIA 4J2YB 1IHTH 1TOCB 3UNRA 4MVNA 1V2WT 2IPHA 1BJUA 1OX1A 1UVTH 4F49A 5DP6A 3PV4A 1HAOH 1EAUA 1BCUH 1Q31A 2OBQA 3TH4H 5ABWA 4ZUHA 2JH0D 3PO1C 1GL0E 1RRKA 3A8BA 1X7AC 2A31A 2TGPZ 3GY6A 6CHAC 1SVPA 3A7TA 3V0XA 2DE9A 1QB9A 1LKAA 1VZQH 3BN9A 5DP3A 3T2NA 2BB4A 5F8TA 2P16A 2H9TH 1NN6A 4ZHLU 4OGYA 2F83A 3MO6A 3BEUA 3A84A 3QGNB 5GCHF 2HPQH 3P70B 4Y6DA 2SGPE 3SHCH 5C67A 4A1VA 4TWYA 3M35A 3PMJA 3SNDA 1F0SA 2ZHDA 1O3EA 1DFPA 2ZO3H 2BD2A 2WYJA 2QXGA 2NWNA 3GCOA 1G36A 2XWBI 2FZZA 4DG4A 2OUAA 3ZZDA 2FX4A 1ANCA 3LGIA 1GG6C 1WQVH 4YLUA 3GY3A 4BXSA 4ABDA 1O3MA 1OP0A 4B71A 1GJ7B 1RD3B 5AF9H 1TFXA 1PPBH 1TLDA 1Y3VA 1BMNH 2VIQA 3M3SA 3MU5A 4FUEA 2QIQA 4Y10E 3RXUA 1H1BA 4F4OC 3PTBA 1SB1H 1C9TA 1GJ6A 1Y3XA 2ZDLA 3ATIA 4WMEA 1O2GH 4SGBE 1DXPA 3SI4H 3KQEA 1Z7KA 3SUEA 1NESE 3VB6A 4Y11E 3UREA 5GCHG 2ZGCA 1GMDF 4ABJA 1HYLA 1GVLA 2F9PA 4TPYA 4ZHMU 2AMPA 1VITF 4IC6A 4DJZB 2Z3EA 3BTEE 1ZLRA 4CRGA 2D1JA 1UTJA 1S0QA 4I33A 1DITH 1XUGA 5EG4A 5L30H 4OGXA 2CV3A 1SR5C 1HNEE 3FAOA 3S9CA 4NIYA 2GD4B 3W95A 4ASHA 5EOKA 3SGAE 2P94A 1P3CA 1L1GA 5EGMA 1TYNA 4DGJA 1TBZH 2WPLS 3M3VA 3T29A 4BAOB 1O34A 1FAKH 3BG4C 1DX5M 2GMTC 1AU8A 2H6MA 1NU7B 4YOGA 4AN7A 1RXPA 3BTQE 1SHYA 4BAKB 3TK6A 1SLVB 1TNIA 2G5VA 2VU8E 2CMYA 4U30A 2C93B 2JKHA 4GHQA 1MKXH 1O2MA 2ZNKH 1VITG 4Y7AA 4Y0YE 1K1IA 3RMNH 1T8NA 3QO6A 1A61H 2AIPA 3PLPA 1SLXB 2QV1A 3O8RA 4ZKOU 2BDIA 5SGAE 1TX7A 1UVPA 2WPKS 1GVKB 1AIXH 3UNQA 2ZG0H 2BD7A 1EZUC 4YLQH 4A1TA 1QL8A 5A2MH 3S9AA 4FUJA 3ODDA 4NFFA 2AMQA 4NZLA 1B5GH 2GTBA 2UWOA 1HAIH 1T4UH 1K1OA 3MU4A 5F03A 5FX6A 1SBWA 1LHEH 5C5OA 5HM9A 3SU1A 2FLRH 4Y76A 3HK3B 1LCYA 1F5KU 1YCPH 2VWOA 1MQ6A 4H6SB 3ZZ5A 2BTCE 1O3DA 1KLTA 1XX9A 1FPHH 2ODPA 1UCYK 2Q1JA 4IC5A 1BUIA 3Q77A 4YOIA 4BANB 1OOKB 2GX4A 4K1EA 1GBTA 3UFAA 1SGQE 4LZ1H 4K8YA 2Y7XA 1G32B 4NGAH 5ESTE 3GY7A 1BRBE 3SW2B 2XBVA 5DP5A 1C1QA 1MTNB 4BNRA 1O3HA 1LQDB 5I25A 5B6OA 4JK5A 3A7YA 2ZDMA 4X1RU 2BQ7B 1F0UA 4YT7H 1EOLA 1KLIH 1XXDA 2ZPRA 2ZCKP 4IW4E 1UMAH 4X6PA 1JXPA 3RU4E 1FNIA 2W5EA 3U8TH 3SQEE 1CBWB 1GHAF 1VCQA 4B74A 3LGTA 4NSVA 1QA0A 1O2IA 1ETTH 5IYTA 1GVZA 1S5SA 1GI4A 1NPMA 2D26C 1ANEA 1DPOA 3DT0H 3SU0A 1F2SE 2ZZUH 2VH0A 2V35A 4MNWA 1WTGH 2P3FH 4I8LA 8LPRA 5E8EH 1O39A 1AVXA 5HXFA 3SHAH 2TBSA 3KL6A 1A5IA 4WH6A 2ZCHP 2W3KA 4BAHB 4FUFA 1JMOH 3ESTA 1NRPH 1QJ7B 2CF8H 1P57B 3VXEH 5HYOA 1SGFA 3PO1B 3RC5A 3DUXH 3GCHC 1DWCH 2G55A 1GJ8B 4AB9A 2BQWB 6CHAB 3M3TA 1CQQA 1CT0E 1DY9A 1K21H 2BDBA 2ZQ1A 3A7ZA 4NFEA 2SGAA 2XBYA 1RTFB 1EZQA 1SPJA 1N6YA 1HAPH 1HAYB 1O35A 2QXJA 1QHRB 3SV9A 2Y81A 5PTPA 5JPMH 3SU5A 1V2PT 1H9LB 3T5FH 1GHAG 1GDNA 4IMQA 1AVGH 4YTAA 1E37B 3PWBA 2C3SA 1UTOA 1K1NA 4AYYB 4D7FA 3M36A 4TPIZ 1O2UA 1A3EH 5EQRA 3TLOA 1PPFE 2XCFA 4KTSA 9ESTA 1SGFG 5JB9S 1GG6B 3BTGE 2FOAA 4WVPE 3RXMA 4WJG2 1QL7A 1SHHB 1UCYE 2J95A 1F5LA 3ATLA 1C5VA 4FUDA 1HFDA 3UOPA 2AFQB 1BBRE 3S0NA 4X0WU 1UTNA 1SI5H 1ZSLA 3SGBE 3VEQB 3F68H 3LC3A 4GPGA 2AIQA 1C5WB 2Z7FE 5AVDA 3ZVGA 3RXSA 2HRVA 1TPSA 1G3CA 1GJCB 2FTLE 4K60A 3NCLA 3ELAH 4M7GA 1SC8U 2OC7A 1M9UA 1OWEA 1K1MA 1UO6A 2GVFA 5E0GA 3ZZ9A 4CR5A 1C4U2 2PUQH 1YYY1 2TIOA 3P92A 3RXHA 3MYWA 2THFB 2VIDA 4OS1A 4ZKNU 5TCAA 4E7RG 2OQ5A 4GLYA 3ZZ8A 3TH2H 1UTMA 2C8YB 2PR3A 1EX3A 1P2KA 2BDYA 4NWKA 5LPEA 1C1NA 4E06H 1LHGH 1TNKA 2BDHA 2ALPA 4CH2B 4PROA 1A5GH 1ZMJA 4I8KA 1K28D 4BAMB 4INKA 1WOFA 2BD3A 1BRAA 5LH8A 1PYTD 2C8XB 3SQHE 4LOYH 1H8IH 2CXVA 3BG4B 1IQFA 1GI7B 2GMTB 1FUJA 1EASA 1TPAE 4ISLA 3D23A 4ZXYH 3ZVCA 1O2ZA 2EA3A 3M7UA 1OSSA 3F9FA 1DLEA 3SV8A 1C1TA 2ANWA 3PROA 3TK5A 1NFUA 1ZPCA 1ZRKA 2GKVE 1LVBA 3F1SB 2ILNA 1KXCA 1RGQA 4BXWA 1PPHE 2A45B 1C5LH 5FBEA 3C1KA 1DUAA 4BTIB 3BSQA 1DY8A 4D7GA 3OSYA 3S7HB 1C2GA 4I31A 4NIWA 3JZ2B 1PQAA 3DFJA 2Q6FA 1AFQC 1C2FA 1KTTB 3NZIA 4U01A 1T8OA 2RG3A 3BF6H 4I8JA 1EB2A 1O2NA 5JBTA 1QBVH 3AW0A 3PM3A 1UCYH 3E0NB 1XUKA 3B23B 3LC5A 1NY22 4AYVB 3SUFA 1ZR0A 1FI8A 1W0ZU 2VVVA 4NZQA 1AO5A 1GBDA 1LPKB 5DO4H 5FCRA 2B7DH 1YPGH 3QTOH 4IN1A 4BAQB 1Z8JB 3LDXH 1YP9A 3SJ9A 3BTDE 1L4DA 4YO9A 3RXDA 1JWTA 4XFQA 1TX8A 4Z0KA 1BTUA 1LHFH 2PKSC 3SGQE 2W7SA 1C5ZB 1UVOA 1L2EA 1LPGB 5EPNA 4DVAU 2GGVB 4A1XA 1TONA 2UUKB 1BT7A 2FIRH 2XYAA 4MNYA 4Q7XA 3A8DA 1WUNH 1C5TA 3AVZA 4TY7A 3JZ1B 1O3LA 4UFFH 1XMNB 4ABEA 1V2ST 1FONA 5EU8A 2ZPSA 3SNBA 1CA0C 1GHYH 3UOUA 3A83A 2OINA 3KN2A 1SFQB 3ATMA 1A5HA 3RXBA 4YESB 5HMAA 1TPPA 1QNJA 1DSTA 1GI0A 4MPXA 4AOQA 2ZGJA 3GCTF 3K9XB 1EAXA 1O36A 3LGWA 1IQGA 1EXFA 1V6DA 2NU0E 4Y8XA 1O2PA 2P95A 1QQ4A 2XBXA 2FXRA 1P03A 3GCHB 3SNAA 2O8UA 3L3TA 2FP7B 4X2VA 5H4IB 3ZYEA 3UR9A 2ZTYA 1P06A 2HNTC 1Y3YA 4MPWA 1AMHA 1EB1H 2O9QA 3SU6A 1C4Y2 3EA7A 5J4SA 1HAVA 2SNWA 2Y6TA 4K1TA 1W14U 3TH3H 4FU7A 1O38A 3UNSA 3T62A 3GY8A 1FLEE 3NK8A 1A4WH 4KTCA 1DM4B 3GCNA 1P12E 1P3EA 3AASA 3SI3H 3HGNA 4CRDA 1EKBB 1O5AB 2P59A 3GISB 1C1VH 2BDGA 1SGPE 1WU1A 4ABAA 2PSXA 3UR6A 2F3CE 1OYQA 1PQ5A 3VPKA 4CRAA 3EE0B 1MBMA 1QQUA 1OS8A 3P8FA 5G4BA 3GCTG 3LPRA 1QB6A 4X2XA 1GI6A 1KXFA 2PLXA 5GXPA 5C1YA 1AY6H 3CP7A 5DP8A 2VWNA 2BZ6H 4WWYA 5F6MA 2FEQH 3URCA 3M37A 1MKWK 3V3MA 2Z3CA 4CRCA 2BOKA 1HAGE 1E38B 1OYTH 3UIRA 1GCDA 3T28A 1NRRH 1F0TA 5FX5A 2P93A 3P8NA 1G3BA 4HGCA 4AGJA 2A2XH 2ZHWH 4B2AA 1KTSB 1O3GA 2STAE 4AB8A 2UWLA 3GYMA 2AGEX 3QK1A 4FUCA 2BHGA 3TGKE 4D9QA 2ZCLP 1MD7A 1QY6A 2FMJA 1O5EH 1THPB 3SUGA 1MUEB 1SSXA 1MTSA 1ZSJA 4WH8A 1YKTA 3W94A 4X8UH 2HNTF 1GBKA 3ZVFA 3MO9A 1EJMA 1V2VT 4D8NA 1CE5A 2HWLB 1UTQA 1SOTA 1TAWA 3D65E 1DOJA 3TJOA 1UK2A 3LOXA 3MU1A 4R0IA 1TNLA 2ZU3A 4AFQA 1G2MA 2G51A 1EJAA 2BY8X 3A7VA 2SFAA 1HJ9A 1ZZZA 2R2WU 1Y8TA 1G3DA 3ZZAA 1AI8H 3MWIU 4HTCH 3R0FA 1KXBA 1C5PA 4XE4A 1ANDA 3M5NA 3ZZ7A 3UQVA 2A4QA 1QRZA 1V2JT 4XBCA 1DE7H 3PB1E 3SV2H 2A7HA 2PTNA 1O5BB 1Y5UT 2RA3A 6GCHF 2F91A 3MU8A 5EQQA 3PMAB 1VR1H 4X1NU 1K1LA 2JH6D 2Z9IA 1D4PB 4KKDA 4NIVA 3LU9B 1SOZA 2EC9H 1GJAB 4FUHA 3T26A 1OPHB 5E0JA 1AFQB 2BMGB 3S7KB 2PKAA 2Z94A 1H9IE 2OCVB 4MPVA 1YCPM 2TGDA 1GI1A 1HAVB 4U2WA 3RMMH 1MQ5A 2VIWA 1EOJA 3BEIB 3KEEA 2BD5A 4E05H 3PTNA 3ZV8A 5FCKA 1IQEA 1H4WA 4ISNA 1C2LA 2QGRA 1C4V2 3RU4D 4K1SA 1G9IE 3Q3YA 1KYNA 4IN2A 2BY9X 2F9NA 1D6WA 2PKSB 1C1SA 3GDVA 2ZFFH 5L6NH 1P02A 2P3UB 4CH8B 1GBLA 1YPLH 4ESTE 1QB1A 3VXFH 1NFXA 1Z71A 4BTTB 2VVCA 4YT6H 3SV6A 4DY7B 1FJSA 1Z6JH 3PMHB 4WMDA 4UEHH 3MMGA 4O9VA 2PTCE 1J16A 1P09A 1U6QA 4ZHAA 3FZDA 3VB3A 3TNTA 4AG1A 1O2VA 1CA0B 1EPTC 3SN8A 1GMDG 2VH6A 1C2DA 2H9HA 1RIWC 4NA7A 3QDZB 5HM2A 1NT1A 3ATWA 4AFZA 2SGFE 1FY8E 3OYPA 1SGYE 1KXEA 1O2JA 2XRCA 1SLUB 1SG8B 1O2RA 3LT3A 3IG6B 1C1WH 2ULLA 1O3IA 3PWCA 4B2CA 4B73A 4XBDA 1P2NA 2STBE 1DT2A 1XUJA 2P3TB 4A5TS 4TY6A 1TABE 1H8DH 4IBLH 1QR3E 1NM6A 2GP9B 1SLWB 3HK6B 2ZEBA 1LQEA 5T6FA 1ZJDA 2G5NA 1TOMH 1VGCC 1ELCA 3AAUA 4NG9H 1XVMA 1MTUA 1DWBH 5ETXA 1Y59T 1T32A 3Q76A 1LHCH 2OD3B 3QZRA 3UWIA 4AZ2B 1GHBF 2DUCA 3MNSA 4ZKSU 1O2XA 1TPOA 2NU2E 4Y0ZE 4H6TA 1YLDA 4JZEH 1WAYB 3O8DA 4K5ZA 3FFGA 1BB0B 2PW8H 3U98H 4DURA 4K3JA 1BBRK 2P8OC 1YPHC 4ISOA 1QBNA 2C4FH 1W11U 2BVSH 5BPEA 2H5CA 3SJ8A 8KME2 3TPIZ 3B9FH 3ZZ4A 4K8BA 2ZU4A 4HFPB 1HJ8A 4ABGA 4WMFA 2Z6BD 2PHBA 4MDSA 1RJXB 1IQKA 8ESTE 2GV7A 5T6GA 1C9PA 3BTME 1NU9A 2A5KA 2H2ZA 3GOVB 2PKAB 1INCA 2OXSA 3PLBA 4X1SU 2BX4A 4MTBA 1MCVA 2D8WA 2FTMA 2AGGX 5F8ZA 1KSNA 1TGNA 1DS2E 1W2KH 3NXPA 2O8TA 3STJA 4KELA 1EPTA 1GI3A 1AUJA 1IQLA 4CREA 2ZFRH 4YOJA 1GHBG 2R0LA 2XC5A 2H1UA 1NTPA 1P01A 3H5CB 2PGQB 1OP2A 1XKAC 1AWHB 1ZMLA 3E91A 2H5DA 2WV5A 3E6PH 5L2YH 2SGEE 2ZDVH 1HUTH 3VFEA 1GHVH 1O2TA 1O32A 1GJ9B 1SQOA 1Y3WA 3SU3A 2J34A 3ZZ3A 4I7YH 5DGJA 1ELVA 3RXCA 3KF2A 1P2MA 2FOMB 4FVBA 3RXQA 2EI6A 2UUJB 2KAIA 2AMDA 1K22H 1XKBC 1HDTH 4ABBA 4UFDH 1BHXF 2FS8A 1D3TB 1BMLA 2QA9E 2RCEA 3RXGA 2OP9A 4ABHA 2I6QA 1MZDA 1FY5A 1NS3A 1QCPA 1S83A 2C8WB 2QF3A 2FOEA 3PLKA 1C5OH 2FX6A 2BM2A 3GICB 3F9GA 5JBAS 2FOFA 1ZSKA 1DDJA 3A80A 2VINA 1ESTA 1J17T 2YNBA 1RTLA 1CHGA 5AFZH 1NRSH 2GZ9A 2FS9A 2FWWA 1ZPZA 3ZVDA 1AGJA 2XC0A 2BLQA 1P2JA 1P9SA 1IQNA 4FU8A 3A85A 3RXPA 2OBOA 4FVDA 3S69A 1O5FH 3M7QA 1HAXB 2ZECA 4QT8C 2V3OH 3RC4A 1AKSA 1FY3A 5DP7A 4GVUA 4UFEH 1AFEH 4X8SH 5EQSA 1HXFH 3OTJE 3UTUH 2W7UA 1BMMH 2J4IA 2XCNA 5JB8S 1FXYA 1L1NA 2A7CA 4OS7A 1CHOF 1ELEE 1MZAA 2FESH 3EGKH 3ZVBA 1CT4E 5A0CA 1GJ4H 4AGKA 1DXWA 1OXGA 1JIRA 2ESTE 4JZIA 2TPIZ 2WUBA 3RXFA 3SNEA 4MPUA 3RU4T 2ZC9H 5L2ZH 3CENA 3QWCH 3MNBA 1FQ3A 2YNAA 2CGAA 3HPTB 1LVOA 1UK3A 1TALA 3FVFB 3GDSA 2ZDKA 2VWMA 3MFJA 1CGIE 2WYGA 2QXHA 1AWFH 4E7NA 4GCHF 1YM0A 1S85A 1KLJH 4A6LA
chains in the Genus database with same CATH superfamily
2M5TA 4X6MA 1P11E 4O97A 1PJPA 3U28C 3K2UA 4DIHH 2Q6DA 4CBNA 2ODYB 5C3NA 2NU1E 4CR9A 1ELBA 1ORFA 1UTPA 1ABJH 1KXDA 1L0ZA 1J14A 1EPTB 2NU4E 4H42U 1EATA 1MAYA 1RIWB 2RDLA 3BEFB 2V3HH 3UPEA 2L74A 1BIOA 4FUGA 1BTWA 1FY1A 3P6ZB 2A4GA 1MU6B 2BY7X 3TIUA 2ZFQH 1TNJA 3FP8E 1TGCA 4NWLA 1ZHMA 2SNVA 1BJVA 1QFKH 5B6LA 1GJ5H 4XBBA 2FPZA 2FODA 3NUMA 2QAAA 3RXOA 1BMFD 1V2KT 1NROH 2JH5D 2R0KA 3QX5H 4Q7YA 1P2QA 1C2JA 1QIXB 4GCHG 1FAXA 1QJ1B 1BZXE 3R3GB 1DWEH 4X8VH 3RDZA 1TX6A 3RM0H 2PWXA 2OC1A 1VGCB 1CGHA 2F9VA 1KXAA 4X6NA 1BBRH 3SV7A 2QY0B 1HJAC 1MMJN 5LPRA 1DICA 2BY6X 1T8LA 2ZFSA 2TGTA 3AAVA 1BTHH 1CU1A 1ELGA 7ESTE 2ZF0H 1SQAA 2QE7D 1UVSH 3EA9A 3CS0A 2NU3E 1GGDC 3DA9B 1GPZA 5EW2H 1ELDE 2P8OB 1ELFA 1BHXB 3CNRA 3MU0A 5GJ4B 3P95A 1P05A 4Y8ZA 1LHDH 1XUIA 3ZVEA 5EJLA 1O5DH 1O2OA 5EJZA 2Y80A 3V12A 1NRNH 2GZ8A 7GCHF 2QN5T 5BRRE 4FU9A 2HVXA 2G4TA 2ZGXH 3KQDA 2ZFTA 1AE5A 5DSFA 1O3PB 2FM2A 3QTVH 1BITA 1C5SA 1ZJKA 1W0YH 1AKSB 5LGOA 5K0HA 1FMGA 1CO7E 2B8OH 2CJIA 1P04A 4WY3A 2ASUB 1WBGB 3OU0A 1TGSZ 1OWDA 3LKWA 4VGCC 1SGNE 1UJ1A 2OC0A 3H7OA 2OK5A 2ZA5A 2JJ2D 2SGDE 1OP8A 3GY5A 3O8BA 1OHHD 1YGCH 3LONA 3ZZ6A 4MNVA 1YPEH 2GCHF 1YF4A 2BOHB 6LPRA 3WW7A 2KCYA 3Q3XA 4Q2KA 1KDQA 1TMTH 3RXEA 5E0HA 2F9OA 2WSSD 3U8OH 2A0QB 1THRH 1PYTC 1FV9A 2A4OA 2PFEA 3PRBA 3MI4A 3RUOA 1JRSA 2FOBA 3TJVA 5TJXA 1LKBA 1O2SA 2HNTE 2VIVA 4OS4A 1HRTH 7GCHG 2VIOA 3HGPA 5FXLA 1E36B 1QRWA 1S82A 3KGPA 1MKXK 5FPYA 7LPRA 1HAHH 3KQ5A 4LK4A 5FBIA 1ZHPA 1A0LA 1P10A 4JYTA 2PV9B 1P9UA 2FO9A 4UDWH 1WYKA 1MH0A 1ACBE 4JCNA 2O8WA 2Y7ZA 1ZTKA 2BZAA 1YPJH 2DE8A 2GCTC 1QURH 1F5RA 2WZQA 3TGJE 1WQSA 2VWLA 4AFUA 1G30B 3F9HA 4INHA 1Z6EA 4GHTA 1V2UT 4K2YA 1ZGVA 3SNCA 3U1IB 2XBWA 2BD9A 4O3UA 2XTTB 3SJIA 1GJBB 3EDXB 2GCHG 1ZOMA 2A7JA 2AERH 3I77A 1NC6A 4UE7H 4I8HA 2LNCA 4X1PU 4P02A 1TA2A 1ZMNA 3VB5A 1J15A 1CT2E 2FOHA 5GIBA 1PQ8A 3FZZA 1YCPK 1O3BA 5FPTA 1VJAU 1MTNC 3A7XA 4ZKRU 4RKJB 2J94A 3C27B 3BIUH 2BVRH 5FPSA 1TQ7B 1TNHA 4ZMAH 1N6XA 3PV2A 1UK4A 2R9PA 4GSOA 3MH4A 4IMZA 3RXTA 3ZZBA 4DT7B 1ARBA 1GL1A 1OWKA 3U9AH 1TA6A 2C90B 1AZ8A 3U1JB 1LTOA 5A0AE 1MD8A 5DP9A 4CRBA 4X2YA 1N8OC 1GBFA 4FUIA 3KHVA 3FANA 4H4FA 2B0FA 2BX3A 1T8MA 2B5TB 4X6OA 4O03A 2QC2A 1HIAA 4P00A 3OX7U 1GWAA 1UTKA 2GZ7A 2Y82A 5E2PA 2HGTH 3RP2A 5EODA 2WPIS 3DD2H 3EQ0H 3P8GA 1H9HE 1QBOA 1O3JA 3RXLA 1D3QB 1W8BH 5DK1A 2KFWA 1KIGH 2K0QA 1LVYA 4TWWA 2AEIH 3G01A 1WTHD 2ANMH 1CVWH 1FY4A 4NIXA 2BD4A 1O3KA 1O3OA 4AFSA 3KYFA 1ESBA 1O5GH 1EP5A 1E35B 2G00A 1LMWB 2ZFPH 1W0JD 3DCLA 4F48B 2XW9A 4JZDH 4ZXXH 3VGCC 4Y7BA 4ISIH 3U8RH 2VGCC 9LPRA 1XVOA 6ESTA 4XOJA 2ANYA 4I32A 1KDQB 3LGVA 2GV6A 4AX9H 5C17A 2KR7A 1C5MD 3E90B 3ZV9A 4JZFH 1AN1E 1O3CA 2VNTA 5JBCS 1BA8B 1EAWA 2VIPA 1F0RA 2ALVA 2BVXH 1O3FA 2ZHQH 2Q6GA 1GHXH 1JIMA 3K6ZA 3BTWE 3T27A 1DLKB 1IQHA 4RSPA 1S84A 5GNDA 2GJGA 1ELAA 2GDDA 3LH3A 1VJ9U 1UTLM 3UUZA 4AG2A 1V2QT 2ZGBH 4YXWD 3TK9A 5LPFA 4NSYA 4GUXA 1TBRH 4YM9A 3U69H 1OWIA 3GY4A 3LIWA 5DN6D 1HCGA 1GBJA 1HJAB 2H9EH 2PUXB 2BY5X 3SZNA 4BTUB 3MNCA 3FKSD 1GDUA 1GMHF 1QRXA 2PGBB 5EW1H 2K8IA 1GHZA 1SFIA 1AVWA 3RXIA 1D6RA 1J8AA 3SO3A 3QLPH 2CF9H 1GGDB 2XXLA 2BYAX 1MAXA 2OQUA 3A7WA 1C2HA 1DSUA 3BTKE 3HATH 4Y71A 1O2HA 1RTKA 6GCHG 1D9IA 1W7XH 2HVYB 4DCDA 1ZPBA 1VITH 2K1QA 2WV4A 1J9CH 3ENSB 3HKJB 1QJ6B 2W26A 3CS7A 3SU2A 3B8JA 1ETSH 4B1TA 1WV7H 5FAHA 1TWXB 3LJOA 4AORA 1D3DB 1EUFA 4UD9H 2A5AA 1AHTH 2FI5E 1GJDB 2ZTZA 1C5NH 1OKXA 1C2KA 3TU7H 3DSGA 2J97A 2ZIQH 3A87A 2QCYA 2GT8A 3A88A 4NA9H 2Y5FA 3RC6A 4MQAA 2AH4X 3K6YA 5TCCA 3V13A 4VGCB 2AYWA 1SGCA 3Q00A 3BIVH 2V7QD 3TJUA 1WSSH 5DG6A 3RXJA 1GBHA 3MQKC 1GMHG 1PPCE 1VCPA 3NKKA 3UWJH 2CN0H 3GY2A 1O31A 1HIAB 1N1LA 3VB7A 2J38A 2UWPA 2HALA 2OC8A 3IWMA 1EJNA 1FPCH 3NPSA 3ZVAA 1C1PA 3M5LA 2J9NA 5C0TA 3VB4A 2Z9LA 4IGDA 1C5XB 3WY8A 3DSOA 1MABB 1V2NT 3L33A 1AZZA 3LJJA 2WPHS 1ETRH 5GWZA 4JYVH 1P8VC 2IOTA 3DHKH 2FOCA 5A0BA 1K1PA 5GDSH 1W13U 4INLA 1XXFA 1V2TT 2BLVA 1YPHE 2GCTB 1Q2WA 4TYDA 3MHWU 1O2YA 3BTTE 2SGQE 1V2RT 1Y5BT 4WXVA 1HAZB 4B76A 2FOGA 1MKWH 4KTUA 1P2OA 1MU8B 1TQ0B 4FUBA 4OS5A 3D62A 3K65B 1IQMA 3A89A 4XDEA 1AB9C 1FN8A 3RM2H 1SMFE 1T31A 2AGIX 1DWDH 1C2EA 1GCTC 1ZHRA 2TRMA 4O3TA 5C1XA 5J4QA 5C94A 1NBMD 2G81E 4CHAC 2J5UA 1Z8RA 1FDPA 2J2UA 2BQ6B 1HLTH 2FYQA 3RXAA 1K0HA 2W6JD 5DPAA 1A46H 5C1UA 4DIIH 5JBBS 2KCOA 1O33A 3MOCA 3EAJA 2EI7A 1GBCA 1GBIA 5C5NA 4RT1A 4JK6A 3E8LA 1ZTJA 2XWAA 4Q7ZA 4Y79A 3M5MA 1QL9A 4B75A 2QF5A 4MNXA 1SGRE 1NO9H 2ZDAH 3IITA 2Z3DA 1N8OB 1Y5AT 3O8CA 2GDEH 4CRFA 5A8ZA 3QN7A 1QZ8A 3ATKA 1W7GH 4CBOA 1T4VH 2WINI 1TNGA 4I8GA 4YZUA 3MNXA 1K2I1 2W3IA 1SL3A 1DANH 2IJOB 1BDAA 3QGJA 2M2AA 4OM9A 2ZI2H 1JRTA 1SQTA 3I78A 1SGTA 2BLWA 1E0FD 1G3EA 4WXIA 1BRUP 4MG3A 4Q63A 3ZIAD 2FDAA 4WF8A 2A2QH 1QTFA 3KNXA 2L6OA 1BMAA 2R2MB 1UVUH 3F0OA 3F6UH 1AQ7A 1YBWA 2XNIA 1DVAH 1ZRBA 1C1MA 1NZQH 2OLGA 3RLYH 1Z8IB 3L6PA 4JZ1A 3PMBB 2Z9GA 1O3AA 1HPGA 3FP6E 1XM1A 1HXEH 2ODQA 2EI8A 3VGCB 2EEKA 2VGCB 1DUEA 5DKMA 5FHTA 1LO6A 1V3XA 4THNH 1BTXA 3SYJA 3S9BA 3ZYDA 1BQYA 5CHAC 1ARCA 2GT7A 1GI2A 1S0RA 4X8TH 1CGJE 2PSYA 1TRNA 3N7DA 1MTWA 1G37A 3ODFA 1F92A 1B0EA 3F9EA 1QA7A 3Q3KA 3OY5U 5A8YA 1GMCF 1Z1JA 4ISHH 3E3TA 1B0FA 3SJOA 3DSPA 2WPMS 4DW2U 1F7ZA 2CHAC 1S81A 2ZGHA 3TJNA 4FOUC 2JETC 2ZDNA 4ZROA 3RMLH 1ZTLA 3PRDA 4BOHA 2RA0A 4MLFB 1IQIA 1E1QD 1O5CB 5K7RA 1IAUA 4KGAA 2Y5GA 2ZQ2A 1FIWA 3DFLA 4UONA 1HBTH 1TGTA 2I6SA 2VJ1A 3SORA 1ZGIA 4D76A 5DJ7A 5IDKA 5T6DA 3QUMP 1OWJA 1A0JA 1C1OA 2A5IA 5CMXH 1TRYA 2ZU1A 1FN6A 1PPGE 1A2CH 1EQ9A 1GI8B 1TMBH 1D3PB 1Y3UA 3P17H 3LGYA 3ZZCA 3N7OA 4Q80A 4XSKU 1FIZA 1W12U 4ABFA 4NCYA 1EZSC 1Q3XA 1EP6A 3EYDA 2C8ZB 1LVMA 1PQ7A 1S6FA 1GBAA 1C1RA 1GMCG 3H7TA 1JOUB 2F43B 1CA8B 1KY9A 2BD8A 3RXRA 1WCZA 3E16B 2G52A 2FLBH 5GPIB 1CHOG 2EY4C 2VB0A 1RS0A 3D49H 3HKIB 2Z9KA 2Y5HA 4DOQA 1RFNA 2UUFB 5F8XA 2XOKD 3PYHA 1YC0A 2R3UA 7KMEH 3OTPA 3BG8A 2F9BH 3P8OA 3A8AA 4KP0A 2IN2A 5HGGA 1GI5A 4FETA 1O2QA 1W10U 1WDIA 1PPZA 1TIOA 3EA8A 2YMSD 1A1RA 1THSH 2OTVA 2QF0A 2LPRA 2F9UA 5EXNA 5C2ZA 1O2KA 2WUCA 2G8TA 3F2HA 1NFYA 3UY9A 1TBQH 3E1XB 2ZWLH 3H09A 2HLCA 2KAIB 1IOEA 4B6EA 1G2LA 2ZTXA 1K1JA 4AC9A 1TMUH 4U32A 1PFXC 1GDQA 1ZYOA 1ID5H 4LXBH 1YLNA 2HOBA 3RXVA 2ZHEH 2ZU5A 1NFWA 3A86A 3E0PB 4OS2A 3LH1A 8GCHF 1TE0A 4X2WA 1UHBA 1YY3A 3SBKA 1A0HB 2W6ID 4R8TB 2QXIA 3QZQA 4FXGH 3STIA 2G4UA 4JYUH 3TNSA 1YPMH 1AB9B 4J1YA 1V2MT 1L1JA 1A3BH 3BTHE 2ZKSA 1MBQA 4UFGH 5E2OA 2ZU2A 1C5UA 2J92A 3GDUA 2O8MA 2XC4A 4OS6A 1GCTB 3KIDU 3T25A 5C20A 1MTVA 1NRQH 4CHAB 3MH7A 2BXUH 1QGFA 3LGUA 1MCTA 1O0DH 1HB0B 2A1DB 1C5RA 3FP7E 2TGAA 3TVJB 2ZP0H 5EXMA 5EXLA 2BLOA 1HV7A 1A7SA 2B9LA 1YLCA 4LZ4B 2D2DA 1P0SH 2WPDD 1K9OE 1GBBA 4HI3A 4D9RA 5CE1A 1SGDE 2FI4E 5EPYA 2BDCA 3TGIE 3BV9B 8GCHG 3FOAA 3I29A 3TITA 1Z1IA 1GBMA 1GBEA 3OY6U 1FZZA 1ABIH 3KCGH 1YPKH 3M5OA 3RXKA 5A09A 1TRMA 1O37A 1XUHA 1BTYA 2BDAA 1V2OT 4K69A 1BTZA 1EZXC 5A8XA 4A92A 1HGTH 1ANBA 1C5QA 1P2IA 4HZHA 1ELTA 1TGBA 3UQOA 2FYRA 2VVUA 4GAWA 3RMOH 4B2BA 3MH5A 1O2LA 4NA8A 3MTYA 1Z8GA 5HIZA 5JYIA 2UUYA 1GI9B 3SUDA 2Z9JA 2ANKH 3MO3A 5AHGH 1E79D 4HG6A 2A32A 3A8CA 1BRCE 3KQCA 3M61U 5DP4A 1CSOE 1E34B 3SJKA 1SGEE 5T3HA 3F2GA 1KMHB 2AS9A 1C5YB 4IS5A 1OWHA 3NWUA 3F3BA 4JMYA 1V2LT 1JBUH 3BTFE 3F2FA 4ASUD 2XNDD 2QYIA 1EAIA 1SGIB 2V0BA 3SU4A 3M7TA 1L4ZA 5CHAB 3MH6A 2A4RA 2ZPQA 3URDA 4X1QU 5JDUB 5ESBA 1TB6H 5AFYH 1T7CA 4ZAEA 3VG8A 3V7TA 2HPPH 4A7IB 1O2WA 1O3NA 3KQBA 1C2MA 2V6NA 4Z6AH 3A81A 2O8LA 4RN6A 1VCWA 1CBWC 3AW1A 1S6HA 2CHAB 1C2IA 1AE8H 1PPEE 1AUTC 4Y8YA 1GHWH 1LDTT 2JETB 4SGAE 3SOSA 2YOLA 3WWFA 5I46H 3RLWH 1BTPA 3A82A 1B7XB 1W3CA 3GYLB 1IHSH 3ITIA 4RKOB 1C1UH 1BOQA 1ESAA 1AD8H 2BXTH 2ZHFH 2FI3E 1IQJA 1UHBB 3FN8A 1LPZB 2R3YA 1XUFA 4ZH8A 1O30A 2WPJS 4ABIA 4J2YB 1IHTH 1TOCB 3UNRA 4MVNA 1V2WT 2IPHA 1BJUA 1OX1A 1UVTH 4F49A 4RT0A 5DP6A 3PV4A 1HAOH 1EAUA 1BCUH 1Q31A 2OBQA 3PV5A 3TH4H 5ABWA 2LELA 4ZUHA 2JH0D 3PO1C 1GL0E 1RRKA 3A8BA 1X7AC 2A31A 2TGPZ 3GY6A 6CHAC 1SVPA 3A7TA 3V0XA 2DE9A 1QB9A 1LKAA 1VZQH 3BN9A 4XRNA 5DP3A 2BB4A 3T2NA 5F8TA 2P16A 2H9TH 1NN6A 4Q4LA 4ZHLU 4OGYA 2F83A 3MO6A 3BEUA 3A84A 3QGNB 5GCHF 2HPQH 3P70B 4Y6DA 2SGPE 3SHCH 5C67A 4A1VA 4TWYA 3M35A 3PMJA 3SNDA 1F0SA 2ZHDA 1O3EA 1DFPA 2ZO3H 2BD2A 2WYJA 2QXGA 2NWNA 3GCOA 1G36A 2XWBI 2FZZA 4DG4A 2OUAA 3ZZDA 2FX4A 1ANCA 3LGIA 1GG6C 1WQVH 4YLUA 3GY3A 4BXSA 4ABDA 1O3MA 1OP0A 4B71A 1GJ7B 1RD3B 5AF9H 1TFXA 1PPBH 1TLDA 1Y3VA 1BMNH 2VIQA 3M3SA 3MU5A 4FUEA 2QIQA 4Y10E 3RXUA 1H1BA 4F4OC 3PTBA 5CDFE 1SB1H 1C9TA 1GJ6A 1Y3XA 2ZDLA 3ATIA 4WMEA 1O2GH 4SGBE 1DXPA 3SI4H 3KQEA 1Z7KA 3SUEA 1NESE 3VB6A 4Y11E 3UREA 5GCHG 2ZGCA 1GMDF 4ABJA 1HYLA 1GVLA 2F9PA 2LP6A 4TPYA 4ZHMU 2AMPA 1VITF 4IC6A 4DJZB 2Z3EA 3BTEE 1ZLRA 4CRGA 2D1JA 1UTJA 1S0QA 4I33A 1DITH 1XUGA 5EG4A 5L30H 4OGXA 2CV3A 3OEED 1SR5C 1HNEE 3FAOA 3S9CA 4NIYA 2GD4B 3W95A 4ASHA 5EOKA 3SGAE 2P94A 1P3CA 2CK3D 1L1GA 5EGMA 1TYNA 1H8HD 4DGJA 3OFND 1TBZH 2WPLS 3M3VA 3T29A 4BAOB 1O34A 1FAKH 3BG4C 1DX5M 2GMTC 1AU8A 2H6MA 1NU7B 4YOGA 4AN7A 1RXPA 3BTQE 1SHYA 4BAKB 3TK6A 1SLVB 1TNIA 2G5VA 2VU8E 2CMYA 4U30A 2C93B 2JKHA 4GHQA 1MKXH 1O2MA 2ZNKH 1VITG 4Y7AA 4Y0YE 1K1IA 3RMNH 1T8NA 3QO6A 1A61H 2AIPA 3PLPA 1SLXB 2QV1A 3O8RA 4ZKOU 2BDIA 5SGAE 1TX7A 1UVPA 2WPKS 1GVKB 1AIXH 3UNQA 3FO8D 2ZG0H 2BD7A 1EZUC 4YLQH 4A1TA 1QL8A 5A2MH 3S9AA 4FUJA 3ODDA 4NFFA 2AMQA 4NZLA 1B5GH 2GTBA 4DT4A 2UWOA 1HAIH 1T4UH 1K1OA 3MU4A 5F03A 5FX6A 3SZEA 1SBWA 1LHEH 5C5OA 5HM9A 3SU1A 2FLRH 4Y76A 3HK3B 1LCYA 1F5KU 1YCPH 2PP6A 2VWOA 1MQ6A 4H6SB 3ZZ5A 2BTCE 1O3DA 1KLTA 1XX9A 1FPHH 2ODPA 1UCYK 2Q1JA 4IC5A 1BUIA 3Q77A 4TSFD 4YOIA 4BANB 1OOKB 2GX4A 4K1EA 1GBTA 3UFAA 1SGQE 4LZ1H 4K8YA 2Y7XA 1G32B 4NGAH 5ESTE 3GY7A 1BRBE 3SW2B 2XBVA 5DP5A 1C1QA 1MTNB 4BNRA 1O3HA 1LQDB 5I25A 5B6OA 4JK5A 3A7YA 2ZDMA 4X1RU 2BQ7B 1F0UA 4YT7H 1EOLA 1KLIH 1XXDA 2ZPRA 2ZCKP 4IW4E 1UMAH 4X6PA 1JXPA 3RU4E 1FNIA 2W5EA 3U8TH 3SQEE 1CBWB 1GHAF 1VCQA 4B74A 3LGTA 4NSVA 1QA0A 1O2IA 1ETTH 5IYTA 1GVZA 1S5SA 1GI4A 1NPMA 2D26C 1ANEA 1DPOA 3DT0H 3SU0A 1F2SE 2ZZUH 2VH0A 2V35A 4MNWA 1WTGH 2P3FH 4I8LA 8LPRA 5E8EH 1O39A 1AVXA 2WV9A 5HXFA 3SHAH 2TBSA 3KL6A 1A5IA 4WH6A 2ZCHP 2W3KA 4BAHB 1YWUA 4FUFA 1JMOH 3ESTA 1NRPH 1QJ7B 2CF8H 1P57B 3VXEH 5HYOA 1SGFA 3PO1B 5F53A 3RC5A 3DUXH 3GCHC 1DWCH 2G55A 1GJ8B 4AB9A 2BQWB 6CHAB 3M3TA 1CQQA 1CT0E 1DY9A 1K21H 2BDBA 2ZQ1A 3A7ZA 4NFEA 2SGAA 2XBYA 1RTFB 1EZQA 1UW7A 1SPJA 1N6YA 1HAPH 1HAYB 1O35A 2QXJA 1QHRB 3SV9A 2Y81A 5PTPA 5JPMH 3SU5A 1V2PT 1H9LB 3T5FH 1GHAG 1GDNA 4IMQA 5KGOA 1AVGH 4YTAA 1E37B 3PWBA 2C3SA 1UTOA 1K1NA 4AYYB 4D7FA 3M36A 4TPIZ 1O2UA 1A3EH 5EQRA 3TLOA 1PPFE 2XCFA 4KTSA 9ESTA 5HKKD 1SGFG 5JB9S 1GG6B 3BTGE 2FOAA 4WVPE 3UAIC 3RXMA 4WJG2 1QL7A 1SHHB 1UCYE 2J95A 1F5LA 3ATLA 1C5VA 4FUDA 1HFDA 3UOPA 2AFQB 1BBRE 3S0NA 4X0WU 1UTNA 1SI5H 1ZSLA 3SGBE 3VEQB 2JIZD 3F68H 3LC3A 4GPGA 2AIQA 4Z1MD 1C5WB 2Z7FE 5AVDA 3ZVGA 3RXSA 2HRVA 1TPSA 1G3CA 1GJCB 2FTLE 4K60A 3NCLA 3ELAH 1COWD 4M7GA 1SC8U 2OC7A 1M9UA 1OWEA 1K1MA 1UO6A 2GVFA 5E0GA 3ZZ9A 4CR5A 1C4U2 4ACBA 2PUQH 1YYY1 2TIOA 3P92A 3RXHA 3MYWA 2THFB 2VIDA 4OS1A 4ZKNU 5TCAA 4E7RG 2OQ5A 4GLYA 3ZZ8A 3TH2H 1UTMA 2JJ1D 2C8YB 2PR3A 1EX3A 1P2KA 2BDYA 4NWKA 5LPEA 1C1NA 2KM0A 1LHGH 4E06H 1TNKA 2BDHA 2ALPA 4CH2B 4PROA 1A5GH 1ZMJA 5KEDA 4I8KA 1K28D 4BAMB 4INKA 1WOFA 2BD3A 1BRAA 5LH8A 1PYTD 2C8XB 3SQHE 4LOYH 1H8IH 2CXVA 3BG4B 1IQFA 1GI7B 2GMTB 1FUJA 1EASA 1TPAE 4ISLA 3D23A 4ZXYH 3ZVCA 1SKYE 1O2ZA 2EA3A 3M7UA 1OSSA 3F9FA 1DLEA 3SV8A 1C1TA 2ANWA 3PROA 3TK5A 1NFUA 1ZPCA 1ZRKA 2GKVE 1LVBA 3F1SB 2ILNA 1KXCA 1RGQA 4BXWA 1PPHE 2A45B 1C5LH 5FBEA 3C1KA 1DUAA 4BTIB 3BSQA 5KECA 1DY8A 4D7GA 3OSYA 3S7HB 1C2GA 4I31A 4NIWA 3JZ2B 1PQAA 3DFJA 2Q6FA 1AFQC 1C2FA 1EFRD 1KTTB 5T1VA 3NZIA 4U01A 1T8OA 2RG3A 3BF6H 4I8JA 1EB2A 1O2NA 1FX0B 1QBVH 3AW0A 5JBTA 3PM3A 1UCYH 3E0NB 1XUKA 3B23B 3LC5A 1NY22 4AYVB 3SUFA 1ZR0A 1FI8A 1W0ZU 3OAAD 2VVVA 4NZQA 1AO5A 1GBDA 1LPKB 5DO4H 5FCRA 2B7DH 1YPGH 3QTOH 4IN1A 4BAQB 1Z8JB 3LDXH 1YP9A 3SJ9A 3BTDE 1L4DA 4YO9A 3RXDA 1JWTA 4XFQA 3GS9A 1TX8A 2EQNA 1BTUA 1LHFH 2PKSC 4Z0KA 3SGQE 2W7SA 1C5ZB 1UVOA 3NRLA 1L2EA 1LPGB 5EPNA 4DVAU 2GGVB 4A1XA 1TONA 2UUKB 1BT7A 2FIRH 2XYAA 4MNYA 4Q7XA 1SQRA 3A8DA 1WUNH 1C5TA 3AVZA 4TY7A 3JZ1B 2IPQX 1O3LA 4UFFH 1XMNB 4ABEA 1V2ST 1FONA 2WHXA 5EU8A 2ZPSA 3SNBA 1CA0C 1GHYH 5EIYA 2KX4A 3UOUA 3A83A 2OINA 3KN2A 1SFQB 3ATMA 1A5HA 3RXBA 4YESB 5HMAA 1TPPA 1QNJA 1DSTA 1GI0A 4MPXA 3EE7A 4AOQA 2ZGJA 3GCTF 3K9XB 1EAXA 1O36A 3LGWA 1IQGA 1EXFA 1V6DA 2NU0E 4Y8XA 3OE7D 1O2PA 1QQ4A 2P95A 2XBXA 4I86A 2FXRA 1P03A 3GCHB 3SNAA 2O8UA 3L3TA 2FP7B 4X2VA 5H4IB 3ZYEA 3UR9A 2ZTYA 1P06A 2HNTC 1Y3YA 2JDID 1AMHA 4MPWA 1EB1H 2O9QA 3SU6A 1C4Y2 3EA7A 5J4SA 1HAVA 2SNWA 2Y6TA 4K1TA 1W14U 3TH3H 4FU7A 1O38A 3UNSA 3T62A 3N99A 3GY8A 2YMSC 1FLEE 3NK8A 1A4WH 4KTCA 1DM4B 3GCNA 1P12E 1P3EA 3AASA 3SI3H 3HGNA 4CRDA 1EKBB 1O5AB 2P59A 3GISB 1C1VH 2BDGA 1SGPE 1WU1A 4ABAA 2PSXA 3UR6A 2F3CE 1OYQA 1PQ5A 3VPKA 4CRAA 3EE0B 1MBMA 1VKYA 1QQUA 1OS8A 3P8FA 5G4BA 3GCTG 3LPRA 1QB6A 4X2XA 1GI6A 1KXFA 2PLXA 5GXPA 5C1YA 1AY6H 3CP7A 5DP8A 2VWNA 2BZ6H 4WWYA 5F6MA 2FEQH 4M9FA 3URCA 3M37A 1MKWK 3V3MA 2Z3CA 4CRCA 4ZCNA 2BOKA 1HAGE 1E38B 1OYTH 3UIRA 1GCDA 3T28A 1NRRH 1F0TA 5FX5A 2P93A 3P8NA 1G3BA 4HGCA 4AGJA 2A2XH 2ZHWH 4B2AA 1KTSB 1O3GA 2STAE 4AB8A 4B6FA 2UWLA 2AHME 3GYMA 2AGEX 3QK1A 4FUCA 2BHGA 3TGKE 4D9QA 2ZCLP 1MD7A 1QY6A 2FMJA 1O5EH 1THPB 3SUGA 1MUEB 1SSXA 1MTSA 1ZSJA 4WH8A 1YKTA 3W94A 4X8UH 2HNTF 1GBKA 3ZVFA 3MO9A 1EJMA 1V2VT 4D8NA 1CE5A 2HWLB 1UTQA 1SOTA 1TAWA 3D65E 1DOJA 3TJOA 1UK2A 3LOXA 3MU1A 4R0IA 1TNLA 2ZU3A 4AFQA 1G2MA 2G51A 1EJAA 2BY8X 3A7VA 2SFAA 1HJ9A 1ZZZA 2R2WU 2HLDD 1Y8TA 1G3DA 3ZZAA 1AI8H 3MWIU 4HTCH 3R0FA 1KXBA 1C5PA 4XE4A 1ANDA 3M5NA 3ZZ7A 3UQVA 2KCAA 2RFKC 2A4QA 1QRZA 3W1EA 5CHBA 2KCPA 1V2JT 4XBCA 1DE7H 3PB1E 3SV2H 2A7HA 2PTNA 1O5BB 1Y5UT 2RA3A 6GCHF 2F91A 3MU8A 5EQQA 3PMAB 1VR1H 4X1NU 1K1LA 2JH6D 2Z9IA 1D4PB 4KKDA 4NIVA 3LU9B 1SOZA 2EC9H 1GJAB 3F0PA 4FUHA 3T26A 1OPHB 5E0JA 1AFQB 2BMGB 4ACAA 3S7KB 2PKAA 2VBCA 1H9IE 2OCVB 2Z94A 4MPVA 3WWBA 1YCPM 2TGDA 1GI1A 1HAVB 4U2WA 3RMMH 1MQ5A 2VIWA 1EOJA 3BEIB 4RI0A 3KEEA 2BD5A 4E05H 3PTNA 3ZV8A 5FCKA 1IQEA 1H4WA 4ISNA 1C2LA 2QGRA 1C4V2 3RU4D 4K1SA 1G9IE 5HIYA 3Q3YA 1S6LA 1KYNA 4IN2A 2BY9X 2F9NA 1D6WA 2PKSB 1C1SA 3GDVA 2ZFFH 5L6NH 1P02A 2P3UB 4CH8B 1GBLA 1YPLH 4ESTE 1QB1A 3VXFH 2KZ4A 1NFXA 1Z71A 4BTTB 2VVCA 4YT6H 3SV6A 4DY7B 1FJSA 1Z6JH 3PMHB 4WMDA 4UEHH 3MMGA 4O9VA 2PTCE 1J16A 1P09A 1U6QA 4ZHAA 3FZDA 3VB3A 3TNTA 4AG1A 1O2VA 1CA0B 1EPTC 3SN8A 1GMDG 2VH6A 1C2DA 2H9HA 1RIWC 4NA7A 3QDZB 5HM2A 1NT1A 4XD7D 3ATWA 4AFZA 4F55A 2SGFE 1FY8E 3OYPA 1SGYE 2V3MA 1KXEA 1O2JA 2XRCA 1SLUB 1SG8B 1O2RA 3LT3A 3IG6B 1C1WH 2F4LA 1O3IA 2ULLA 3PWCA 4B2CA 1E1RD 4B73A 4XBDA 1P2NA 2STBE 1DT2A 1XUJA 2P3TB 4A5TS 4TY6A 1TABE 1H8DH 4IBLH 1QR3E 1NM6A 2GP9B 1SLWB 3HK6B 2ZEBA 1LQEA 5T6FA 1ZJDA 2G5NA 1TOMH 1VGCC 1W0KD 1ELCA 3AAUA 4NG9H 1XVMA 1MTUA 1DWBH 5ETXA 5C0UA 1Y59T 1T32A 3Q76A 1LHCH 2OD3B 3QZRA 3UWIA 4AZ2B 1GHBF 2J98A 2DUCA 3MNSA 4ZKSU 1O2XA 1TPOA 2NU2E 2YMSB 4Y0ZE 4H6TA 1YLDA 4JZEH 1WAYB 3O8DA 4K5ZA 3FFGA 1BB0B 2PW8H 3U98H 4DURA 4K3JA 1BBRK 2P8OC 1YPHC 4ISOA 1QBNA 2C4FH 1W11U 2BVSH 5BPEA 2H5CA 3SJ8A 8KME2 3TPIZ 3B9FH 3ZZ4A 4K8BA 2ZU4A 4HFPB 1HJ8A 4ABGA 4WMFA 5EJ1A 2Z6BD 2PHBA 4MDSA 1RJXB 1IQKA 8ESTE 2GV7A 5T6GA 1C9PA 3BTME 5FL7D 3AK5A 1NU9A 2A5KA 2H2ZA 3GOVB 2PKAB 1INCA 1WXRA 2OXSA 3PLBA 4X1SU 2BX4A 4MTBA 1MCVA 2D8WA 2FTMA 2AGGX 5F8ZA 1KSNA 1TGNA 1DS2E 1W2KH 3NXPA 2O8TA 3STJA 4KELA 1EPTA 1GI3A 1AUJA 1IQLA 4CREA 2ZFRH 4YOJA 1GHBG 2R0LA 2XC5A 2H1UA 1NTPA 1P01A 3H5CB 2PGQB 1OP2A 1XKAC 1AWHB 1ZMLA 3E91A 2H5DA 2WV5A 3E6PH 5L2YH 3KYGA 2SGEE 2ZDVH 1HUTH 3VFEA 1GHVH 1O2TA 1O32A 1GJ9B 1SQOA 1Y3WA 3SU3A 2J34A 3ZZ3A 4TT3D 4I7YH 5DGJA 1ELVA 3RXCA 3KF2A 3UB0A 1P2MA 2FOMB 4FVBA 3RXQA 2EI6A 2UUJB 2KAIA 2AMDA 1K22H 1XKBC 1HDTH 4ABBA 4UFDH 1BHXF 2FS8A 1D3TB 1BMLA 2QA9E 2RCEA 3RXGA 2OP9A 4ABHA 2I6QA 1MZDA 1FY5A 1NS3A 1QCPA 1S83A 2C8WB 2QF3A 2FOEA 3PLKA 1C5OH 2FX6A 2BM2A 3GICB 3F9GA 5JBAS 2FOFA 1ZSKA 1DDJA 2RDEA 3A80A 2VINA 2QF4A 1ESTA 1J17T 2YNBA 1RTLA 1CHGA 5AFZH 1NRSH 2GZ9A 2FS9A 2FWWA 1ZPZA 3ZVDA 1AGJA 2XC0A 2BLQA 1P2JA 2IJD1 1P9SA 1IQNA 4FU8A 3A85A 3RXPA 2OBOA 4FVDA 3S69A 1O5FH 3M7QA 3N7EA 1HAXB 2ZECA 4QT8C 2V3OH 3RC4A 1AKSA 1FY3A 5DP7A 4GVUA 4UFEH 1AFEH 4X8SH 5EQSA 1HXFH 3OTJE 1H8ED 3UTUH 2W7UA 1BMMH 2J4IA 2XCNA 5JB8S 1FXYA 1L1NA 2A7CA 3OEHD 4OS7A 1CHOF 1ELEE 2J98B 1MZAA 2FESH 3EGKH 3ZVBA 1CT4E 5A0CA 1GJ4H 4AGKA 1DXWA 1OXGA 1JIRA 2ESTE 4JZIA 2TPIZ 2WUBA 1NBME 3RXFA 3SNEA 4MPUA 3RU4T 5IK2D 2ZC9H 5L2ZH 3CENA 3QWCH 3MNBA 1FQ3A 2YNAA 2CGAA 3HPTB 1LVOA 1UK3A 1TALA 3FVFB 3GDSA 2ZDKA 2VWMA 3MFJA 1CGIE 2WYGA 2QXHA 1AWFH 4E7NA 4GCHF 1YM0A 1S85A 1KLJH 4A6LA
chains in the Genus database with same CATH topology
2M5TA 4X6MA 1P11E 4O97A 1PJPA 3K2UA 4DIHH 2Q6DA 4CBNA 2ODYB 5C3NA 2NU1E 4CR9A 1ELBA 1ORFA 1UTPA 1ABJH 1KXDA 1L0ZA 1J14A 1EPTB 2NU4E 4H42U 1EATA 1MAYA 1RIWB 2RDLA 3BEFB 2V3HH 3UPEA 1BIOA 4FUGA 1BTWA 1FY1A 3P6ZB 2A4GA 1MU6B 2BY7X 3TIUA 2ZFQH 1TNJA 3FP8E 1TGCA 4NWLA 1ZHMA 2SNVA 1BJVA 1QFKH 1GJ5H 4XBBA 2FPZA 2FODA 3NUMA 2QAAA 3RXOA 1V2KT 1NROH 2JH5D 2R0KA 3QX5H 4Q7YA 1P2QA 1C2JA 1QIXB 4GCHG 1FAXA 1QJ1B 1BZXE 3R3GB 1DWEH 4X8VH 3RDZA 1TX6A 3RM0H 2PWXA 2OC1A 1VGCB 1CGHA 2F9VA 1KXAA 4X6NA 1BBRH 3SV7A 2QY0B 1HJAC 1MMJN 5LPRA 1DICA 2BY6X 1T8LA 2ZFSA 2TGTA 3AAVA 1BTHH 1CU1A 1ELGA 7ESTE 2ZF0H 1SQAA 1UVSH 3EA9A 3CS0A 2NU3E 1GGDC 3DA9B 1GPZA 5EW2H 1ELDE 2P8OB 1ELFA 1BHXB 3MU0A 5GJ4B 3P95A 1P05A 4Y8ZA 1LHDH 1XUIA 3ZVEA 1O5DH 1O2OA 2Y80A 3V12A 1NRNH 2GZ8A 7GCHF 2QN5T 5BRRE 4FU9A 2HVXA 2G4TA 2ZGXH 3KQDA 2ZFTA 1AE5A 1O3PB 2FM2A 3QTVH 1BITA 1C5SA 1ZJKA 1W0YH 1AKSB 5LGOA 5K0HA 1FMGA 1CO7E 2B8OH 2CJIA 1P04A 4WY3A 2ASUB 1WBGB 3OU0A 1TGSZ 1OWDA 3LKWA 4VGCC 1SGNE 1UJ1A 2OC0A 3H7OA 2ZA5A 2SGDE 1OP8A 3GY5A 3O8BA 1YGCH 3LONA 3ZZ6A 4MNVA 1YPEH 2GCHF 1YF4A 2BOHB 6LPRA 3Q3XA 4Q2KA 1KDQA 1TMTH 3RXEA 5E0HA 2F9OA 3U8OH 2A0QB 1THRH 1PYTC 1FV9A 2A4OA 2PFEA 3MI4A 3RUOA 1JRSA 2FOBA 3TJVA 5TJXA 1LKBA 1O2SA 2HNTE 2VIVA 4OS4A 1HRTH 7GCHG 2VIOA 3HGPA 5FXLA 1E36B 1QRWA 1S82A 3KGPA 1MKXK 5FPYA 7LPRA 1HAHH 4LK4A 5FBIA 1ZHPA 1A0LA 1P10A 4JYTA 2PV9B 1P9UA 2FO9A 4UDWH 1WYKA 1MH0A 1ACBE 4JCNA 2O8WA 2Y7ZA 1ZTKA 2BZAA 1YPJH 2DE8A 2GCTC 1QURH 1F5RA 3TGJE 1WQSA 2VWLA 4AFUA 1G30B 3F9HA 4INHA 1Z6EA 4GHTA 1V2UT 4K2YA 1ZGVA 3SNCA 3U1IB 2XBWA 2BD9A 4O3UA 2XTTB 3SJIA 1GJBB 3EDXB 2GCHG 1ZOMA 2A7JA 2AERH 3I77A 1NC6A 4UE7H 4I8HA 2LNCA 4X1PU 1TA2A 1ZMNA 3VB5A 1J15A 1CT2E 2FOHA 5GIBA 1PQ8A 3FZZA 1YCPK 1O3BA 5FPTA 1VJAU 1MTNC 3A7XA 4ZKRU 4RKJB 2J94A 3C27B 3BIUH 2BVRH 5FPSA 1TQ7B 1TNHA 4ZMAH 1N6XA 1UK4A 2R9PA 4GSOA 3MH4A 4IMZA 3RXTA 3ZZBA 4DT7B 1ARBA 1GL1A 1OWKA 3U9AH 1TA6A 2C90B 1AZ8A 3U1JB 1LTOA 5A0AE 1MD8A 5DP9A 4CRBA 4X2YA 1N8OC 1GBFA 4FUIA 3KHVA 3FANA 4H4FA 2B0FA 2BX3A 1T8MA 2B5TB 4X6OA 4O03A 2QC2A 1HIAA 3OX7U 1GWAA 1UTKA 2GZ7A 2Y82A 5E2PA 2HGTH 3RP2A 5EODA 2WPIS 3DD2H 3EQ0H 3P8GA 1H9HE 1QBOA 1O3JA 3RXLA 1D3QB 1W8BH 5DK1A 1KIGH 1LVYA 4TWWA 2AEIH 3G01A 1WTHD 2ANMH 1CVWH 1FY4A 4NIXA 2BD4A 1O3KA 1O3OA 4AFSA 1ESBA 1O5GH 1EP5A 1E35B 2G00A 1LMWB 2ZFPH 2XW9A 4JZDH 4ZXXH 3VGCC 4Y7BA 4ISIH 3U8RH 2VGCC 9LPRA 1XVOA 6ESTA 4XOJA 2ANYA 4I32A 1KDQB 3LGVA 2GV6A 4AX9H 3E90B 1C5MD 3ZV9A 4JZFH 1AN1E 1O3CA 2VNTA 5JBCS 1BA8B 1EAWA 2VIPA 1F0RA 2ALVA 2BVXH 1O3FA 2ZHQH 2Q6GA 1GHXH 1JIMA 3K6ZA 3BTWE 3T27A 1DLKB 1IQHA 4RSPA 1S84A 1ELAA 2GDDA 3LH3A 1VJ9U 1UTLM 3UUZA 4AG2A 1V2QT 2ZGBH 5LPFA 3TK9A 4NSYA 4GUXA 1TBRH 4YM9A 3U69H 1OWIA 3GY4A 3LIWA 1HCGA 1GBJA 1HJAB 2H9EH 2PUXB 2BY5X 3SZNA 4BTUB 3MNCA 1GDUA 1GMHF 1QRXA 2PGBB 5EW1H 1GHZA 1SFIA 1AVWA 3RXIA 1D6RA 1J8AA 3SO3A 3QLPH 2CF9H 1GGDB 2XXLA 2BYAX 1MAXA 2OQUA 3A7WA 1C2HA 1DSUA 3BTKE 3HATH 4Y71A 1O2HA 1RTKA 6GCHG 1D9IA 1W7XH 4DCDA 1ZPBA 1VITH 2K1QA 2WV4A 1J9CH 3ENSB 3HKJB 1QJ6B 2W26A 3CS7A 3SU2A 3B8JA 1ETSH 4B1TA 1WV7H 5FAHA 1TWXB 3LJOA 4AORA 1D3DB 1EUFA 4UD9H 2A5AA 1AHTH 2FI5E 1GJDB 2ZTZA 1C5NH 1OKXA 1C2KA 3TU7H 2ZIQH 3A87A 2QCYA 2GT8A 3A88A 4NA9H 2Y5FA 3RC6A 4MQAA 2AH4X 3K6YA 5TCCA 3V13A 4VGCB 2AYWA 1SGCA 3Q00A 3BIVH 3TJUA 1WSSH 5DG6A 3RXJA 1GBHA 1GMHG 1PPCE 1VCPA 3NKKA 3UWJH 2CN0H 3GY2A 1O31A 1HIAB 1N1LA 3VB7A 2J38A 2UWPA 2HALA 2OC8A 3IWMA 1EJNA 1FPCH 3NPSA 3ZVAA 1C1PA 3M5LA 2J9NA 3VB4A 2Z9LA 4IGDA 1C5XB 3WY8A 1V2NT 3L33A 1AZZA 3LJJA 2WPHS 1ETRH 5GWZA 4JYVH 1P8VC 2IOTA 3DHKH 2FOCA 5A0BA 1K1PA 5GDSH 1W13U 4INLA 1XXFA 1V2TT 2BLVA 1YPHE 2GCTB 1Q2WA 4TYDA 3MHWU 1O2YA 3BTTE 2SGQE 1V2RT 1Y5BT 4WXVA 1HAZB 4B76A 2FOGA 1MKWH 4KTUA 1P2OA 1MU8B 1TQ0B 4FUBA 4OS5A 3D62A 3K65B 1IQMA 3A89A 4XDEA 1AB9C 1FN8A 3RM2H 1SMFE 1T31A 2AGIX 1DWDH 1C2EA 1GCTC 1ZHRA 2TRMA 4O3TA 5C1XA 5J4QA 2G81E 4CHAC 1Z8RA 1FDPA 2J2UA 2BQ6B 1HLTH 2FYQA 3RXAA 5DPAA 1A46H 5C1UA 4DIIH 5JBBS 1O33A 3MOCA 3EAJA 2EI7A 1GBCA 1GBIA 5C5NA 4JK6A 3E8LA 1ZTJA 2XWAA 4Q7ZA 4Y79A 3M5MA 1QL9A 4B75A 4MNXA 1SGRE 1NO9H 2ZDAH 3IITA 2Z3DA 1N8OB 1Y5AT 3O8CA 2GDEH 4CRFA 5A8ZA 3QN7A 3ATKA 4CBOA 1W7GH 1T4VH 2WINI 1TNGA 4I8GA 4YZUA 3MNXA 1K2I1 2W3IA 1SL3A 1DANH 2IJOB 1BDAA 3QGJA 2ZI2H 1JRTA 1SQTA 3I78A 1SGTA 2BLWA 1E0FD 1G3EA 4WXIA 1BRUP 4MG3A 2FDAA 4WF8A 2A2QH 1QTFA 3KNXA 1BMAA 2R2MB 1UVUH 3F6UH 1AQ7A 1YBWA 2XNIA 1DVAH 1ZRBA 1C1MA 1NZQH 2OLGA 3RLYH 1Z8IB 3L6PA 4JZ1A 3PMBB 2Z9GA 1O3AA 1HPGA 3FP6E 1XM1A 1HXEH 2ODQA 2EI8A 3VGCB 2EEKA 2VGCB 1DUEA 5DKMA 5FHTA 1LO6A 1V3XA 4THNH 1BTXA 3S9BA 3ZYDA 1BQYA 5CHAC 1ARCA 2GT7A 1GI2A 1S0RA 4X8TH 1CGJE 2PSYA 1TRNA 1MTWA 1G37A 3ODFA 1F92A 1B0EA 3F9EA 1QA7A 3Q3KA 3OY5U 5A8YA 1GMCF 1Z1JA 4ISHH 3E3TA 1B0FA 3SJOA 2WPMS 4DW2U 1F7ZA 2CHAC 1S81A 2ZGHA 3TJNA 2JETC 2ZDNA 4ZROA 3RMLH 1ZTLA 4BOHA 2RA0A 4MLFB 1IQIA 1O5CB 5K7RA 1IAUA 4KGAA 2Y5GA 2ZQ2A 1FIWA 3DFLA 4UONA 1HBTH 1TGTA 2I6SA 2VJ1A 3SORA 1ZGIA 4D76A 5DJ7A 5IDKA 5T6DA 3QUMP 1OWJA 1A0JA 1C1OA 2A5IA 5CMXH 1TRYA 2ZU1A 1FN6A 1PPGE 1A2CH 1EQ9A 1GI8B 1TMBH 1D3PB 1Y3UA 3P17H 3LGYA 3ZZCA 3N7OA 4Q80A 4XSKU 1FIZA 1W12U 4ABFA 4NCYA 1EZSC 1Q3XA 1EP6A 3EYDA 2C8ZB 1LVMA 1PQ7A 1S6FA 1GBAA 1C1RA 1GMCG 3H7TA 1JOUB 1CA8B 1KY9A 2BD8A 3RXRA 1WCZA 3E16B 2G52A 2FLBH 5GPIB 1CHOG 2VB0A 1RS0A 3D49H 3HKIB 2Z9KA 2Y5HA 4DOQA 1RFNA 2UUFB 5F8XA 3PYHA 1YC0A 2R3UA 7KMEH 3BG8A 2F9BH 3P8OA 3A8AA 4KP0A 2IN2A 5HGGA 1GI5A 1O2QA 1W10U 1PPZA 1TIOA 3EA8A 1A1RA 1THSH 2OTVA 2QF0A 2LPRA 2F9UA 5EXNA 5C2ZA 1O2KA 2WUCA 2G8TA 1NFYA 3UY9A 1TBQH 3E1XB 2ZWLH 2HLCA 2KAIB 1IOEA 1G2LA 2ZTXA 1K1JA 1TMUH 4U32A 1PFXC 1GDQA 1ZYOA 1ID5H 4LXBH 2HOBA 3RXVA 2ZHEH 2ZU5A 1NFWA 3A86A 3E0PB 4OS2A 3LH1A 8GCHF 1TE0A 4X2WA 1UHBA 3SBKA 1A0HB 4R8TB 2QXIA 3QZQA 4FXGH 3STIA 2G4UA 4JYUH 3TNSA 1YPMH 1AB9B 4J1YA 1V2MT 1L1JA 1A3BH 3BTHE 2ZKSA 1MBQA 4UFGH 5E2OA 2ZU2A 1C5UA 2J92A 3GDUA 2O8MA 2XC4A 4OS6A 1GCTB 3KIDU 3T25A 5C20A 1MTVA 1NRQH 4CHAB 3MH7A 2BXUH 1QGFA 3LGUA 1MCTA 1O0DH 1HB0B 2A1DB 1C5RA 3FP7E 2TGAA 3TVJB 2ZP0H 5EXMA 5EXLA 2BLOA 1HV7A 1A7SA 2B9LA 1YLCA 4LZ4B 2D2DA 1P0SH 1K9OE 1GBBA 4HI3A 4D9RA 5CE1A 1SGDE 2FI4E 5EPYA 2BDCA 3TGIE 3BV9B 8GCHG 3I29A 3TITA 1Z1IA 1GBMA 1GBEA 3OY6U 1FZZA 1ABIH 3KCGH 1YPKH 3M5OA 3RXKA 5A09A 1TRMA 1O37A 1XUHA 1BTYA 2BDAA 1V2OT 4K69A 1BTZA 1EZXC 5A8XA 4A92A 1HGTH 1ANBA 1C5QA 1P2IA 4HZHA 1ELTA 1TGBA 3UQOA 2FYRA 2VVUA 4GAWA 3RMOH 4B2BA 3MH5A 1O2LA 4NA8A 3MTYA 1Z8GA 5JYIA 2UUYA 1GI9B 3SUDA 2Z9JA 2ANKH 3MO3A 5AHGH 2A32A 3A8CA 1BRCE 3KQCA 3M61U 5DP4A 1CSOE 1E34B 3SJKA 1SGEE 5T3HA 2AS9A 1C5YB 4IS5A 1OWHA 3NWUA 4JMYA 1V2LT 1JBUH 3BTFE 2QYIA 1EAIA 1SGIB 2V0BA 3SU4A 3M7TA 1L4ZA 5CHAB 3MH6A 2A4RA 2ZPQA 3URDA 4X1QU 5JDUB 5ESBA 1TB6H 5AFYH 1T7CA 4ZAEA 3V7TA 2HPPH 4A7IB 1O2WA 1O3NA 3KQBA 1C2MA 2V6NA 4Z6AH 3A81A 2O8LA 4RN6A 1VCWA 1CBWC 3AW1A 1S6HA 2CHAB 1C2IA 1AE8H 1PPEE 1AUTC 4Y8YA 1GHWH 1LDTT 2JETB 4SGAE 3SOSA 2YOLA 5I46H 3RLWH 1BTPA 3A82A 1B7XB 1W3CA 3GYLB 1IHSH 3ITIA 4RKOB 1C1UH 1BOQA 1ESAA 1AD8H 2BXTH 2ZHFH 2FI3E 1IQJA 1UHBB 1LPZB 2R3YA 1XUFA 4ZH8A 1O30A 2WPJS 4ABIA 4J2YB 1IHTH 1TOCB 3UNRA 4MVNA 1V2WT 2IPHA 1BJUA 1OX1A 1UVTH 4F49A 5DP6A 3PV4A 1HAOH 1EAUA 1BCUH 1Q31A 2OBQA 3TH4H 5ABWA 4ZUHA 2JH0D 3PO1C 1GL0E 1RRKA 3A8BA 1X7AC 2A31A 2TGPZ 3GY6A 6CHAC 1SVPA 3A7TA 3V0XA 2DE9A 1QB9A 1LKAA 1VZQH 3BN9A 5DP3A 3T2NA 2BB4A 5F8TA 2P16A 2H9TH 1NN6A 4ZHLU 4OGYA 2F83A 3MO6A 3BEUA 3A84A 3QGNB 5GCHF 2HPQH 3P70B 4Y6DA 2SGPE 3SHCH 5C67A 4A1VA 4TWYA 3M35A 3PMJA 3SNDA 1F0SA 2ZHDA 1O3EA 1DFPA 2ZO3H 2BD2A 2WYJA 2QXGA 2NWNA 3GCOA 1G36A 2XWBI 2FZZA 4DG4A 2OUAA 3ZZDA 2FX4A 1ANCA 3LGIA 1GG6C 1WQVH 4YLUA 3GY3A 4BXSA 4ABDA 1O3MA 1OP0A 4B71A 1GJ7B 1RD3B 5AF9H 1TFXA 1PPBH 1TLDA 1Y3VA 1BMNH 2VIQA 3M3SA 3MU5A 4FUEA 2QIQA 4Y10E 3RXUA 1H1BA 4F4OC 3PTBA 1SB1H 1C9TA 1GJ6A 1Y3XA 2ZDLA 3ATIA 4WMEA 1O2GH 4SGBE 1DXPA 3SI4H 3KQEA 1Z7KA 3SUEA 1NESE 3VB6A 4Y11E 3UREA 5GCHG 2ZGCA