4FUJA

Crystal structure of the urokinase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
246
structure length
246
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 63
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fujA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fujA01
1BZXE 3ATKA 1LHDH 3ZZ5A 2ASUB 1D4PB 5DP3A 3IG6B 3LH1A 3SJ9A 1BDAA 1Z8IB 2ZG0H 1YLDA 3BG4B 5T6GA 3GY7A 1T8LA 1IQHA 1C9PA 1ZRBA 1NM6A 1GHVH 2CN0H 2H9EH 2WUCA 2H6MA 3SO3A 2RG3A 3V13A 4DY7B 1TGTA 1C9TA 3E0PB 1AFQC 2Z94A 2ANWA 1WAYB 3SGAE 3UTUH 4U30A 4AFSA 3TGJE 5GIBA 2GVFA 1G3EA 1P2JA 4FU9A 5F6MA 2KAIA 3F9EA 4CBNA 2EEKA 3ZV8A 4X6PA 2WPJS 5EQQA 1O2PA 1MZAA 4HGCA 1ETSH 2F9OA 1LPZB 1K9OE 1BTZA 1O38A 1QCPA 4MPUA 1L4DA 1VGCB 1GI3A 3RMMH 1S84A 1FV9A 3TH3H 1H9LB 2Z9GA 2VIQA 3PLKA 3LGUA 2ZCHP 1C4V2 4B2AA 2ANMH 2HVXA 5JYIA 1ZTLA 7LPRA 2W3IA 3LT3A 1LHGH 5I46H 1EX3A 1EJMA 4OGXA 4JZIA 4Y0ZE 1KXAA 2CHAC 1BJVA 2FO9A 5CE1A 1E38B 1O2WA 1S6HA 1TGNA 1TYNA 5DP4A 5EQRA 3SI3H 2BY9X 1AO5A 3GDSA 3SV8A 1XXFA 1FONA 2UWOA 5FCKA 4YM9A 1HJAC 2ZFPH 3NWUA 4K69A 1MD8A 5EGMA 2A0QB 5T6DA 3LGWA 1O3DA 2ZU3A 4A5TS 1K1OA 4I33A 1F5KU 1FI8A 4OGYA 2F9BH 3ATMA 1C5OH 4ISLA 5ESBA 4K5ZA 3O8CA 2W7UA 1YPHE 1FY4A 1RIWB 2FP7B 4JMYA 4DG4A 1ELVA 1TNLA 3FVFB 3LGTA 1F0RA 1AUTC 1FDPA 3RDZA 1HXFH 5AVDA 3UNQA 2Z9KA 1V2VT 1DE7H 3MH7A 1B5GH 2D8WA 3LU9B 5GXPA 4I8LA 1C2DA 2STAE 3ATIA 2VH6A 1Q2WA 3MNCA 3UQOA 3SGBE 1A61H 1O2JA 2PV9B 2O8WA 2SGAA 4XOJA 2QCYA 2Z6BD 1TRNA 2C3SA 1CT0E 1OWIA 1RS0A 2C8XB 1CGJE 1KY9A 4A1TA 1A2CH 1AWFH 4O97A 1Z8RA 4NA8A 1V2MT 5A0CA 1QL7A 3ESTA 2FOCA 4NG9H 1A5HA 1L1GA 2JH5D 1G32B 1T4UH 2VVUA 3OTJE 2TBSA 1LHCH 2HNTF 2ALPA 1ZPCA 3NZIA 1XKBC 2IN2A 2GD4B 3AASA 3E1XB 3NCLA 1FZZA 1VITH 5F03A 5E0GA 1G37A 1O3BA 1NY22 2NU3E 4BAKB 5DP9A 4H4FA 4D9QA 4DIHH 1QJ1B 1YLCA 4KTUA 1NU9A 4NFEA 1FAKH 1LMWB 2AMQA 3SU6A 1DOJA 5IYTA 2BD2A 2EC9H 1GBLA 1YF4A 2BZAA 2BDGA 1AZZA 2UUYA 2Y82A 3F9FA 1YM0A 4WMFA 3PV4A 1LVYA 1C5RA 4MQAA 2ZHFH 1P2OA 1ZTJA 3W95A 1JXPA 1N8OC 4KKDA 2ZHDA 1A1RA 4FUCA 3RXFA 1F5LA 4XE4A 3GCHB 4FVBA 1O2LA 1NRNH 1SOTA 1X7AC 3QK1A 3SHAH 3ZVEA 1MD7A 2QN5T 1V2RT 1ZGIA 2WYJA 1HDTH 4AYYB 3LH3A 1C2JA 2BLWA 1MKXH 5A8YA 1SGIB 1XXDA 1QTFA 1C1TA 4M7GA 3SUDA 3SV9A 2VVCA 1Z6JH 2H5CA 1G36A 3U8OH 1MQ5A 2OQ5A 3RXVA 2XBXA 5SGAE 4YOIA 1O0DH 1SLXB 4ABBA 3TNTA 1XUFA 1L4ZA 1BRAA 3HKJB 1AFQB 1BBRK 2QC2A 3MH4A 3NXPA 1D6WA 1MTSA 1BTXA 4Y6DA 3T2NA 1AY6H 2OD3B 4H42U 2AIQA 3V7TA 2FYQA 3F1SB 3ZV9A 3UR9A 3T29A 1P9UA 3URDA 1KSNA 4NIXA 1QBVH 4GLYA 1NFUA 3K6YA 3H7TA 1DUAA 1AZ8A 1LKAA 2OBOA 1C2LA 1TBRH 1GI6A 2SGFE 4HTCH 4QT8C 5FAHA 5LGOA 1PQ7A 5DPAA 1A4WH 1ORFA 2FX6A 2AYWA 5C2ZA 2SGDE 1TGSZ 3RXKA 1UTKA 2J94A 2ZFRH 2QYIA 3RXQA 1MTUA 3EE0B 1TAWA 1V2JT 3SJKA 4K60A 2TGAA 1QQUA 1YP9A 5A09A 3GY5A 3AAVA 4O9VA 1CVWH 1DT2A 3A83A 4O03A 2PFEA 1HJAB 2QAAA 1AVXA 2ZFQH 4NZQA 4RKOB 1EPTA 1AUJA 3PROA 1BQYA 5JPMH 4ZKNU 2AMPA 1SGCA 4LZ1H 2VGCC 3LOXA 1O3EA 3SN8A 4XBBA 1W14U 3S7KB 1AKSA 1NU7B 3F9HA 4I7YH 1SOZA 1GBJA 1YPLH 2SGQE 2AEIH 2Z3CA 2YOLA 1OPHB 1T4VH 1EZXC 4WXIA 1PPBH 1OP0A 2F83A 1ANCA 4DW2U 3PMBB 1MKWK 2FODA 2PUQH 1L0ZA 2WPKS 5GPIB 1V2NT 1NT1A 4FVDA 3MHWU 5A8ZA 5AHGH 1G3CA 1Y8TA 3DFLA 1V2UT 1O37A 5B6OA 1TGBA 3VB6A 3MNXA 2P3TB 2C4FH 3A82A 3ODFA 1ELBA 1OYTH 4E7NA 1FUJA 2I6QA 2DUCA 1P2IA 3E16B 1FY1A 1S6FA 4YT6H 3SI4H 1IOEA 1C5LH 4WH6A 3S69A 2OC7A 1NESE 1THPB 1HYLA 1BUIA 1F2SE 4Q7ZA 1UVTH 2J4IA 2FLRH 4D76A 1QL8A 1SGTA 4NA9H 4SGAE 3GYMA 4ZAEA 4BANB 1C5PA 1C2GA 3ZVBA 1ELTA 6GCHG 1RD3B 3SU3A 3GOVB 2BVXH 3D23A 4JZDH 3RXGA 1LVMA 1EASA 1T32A 3K9XB 1OWDA 3ZVCA 1HAYB 4LXBH 5EOKA 5H4IB 4UONA 3QDZB 2A7JA 2ZHQH 3ITIA 2H5DA 4YTAA 3ZZ9A 5HYOA 1GDQA 4ZMAH 3OSYA 2PTNA 2V3HH 4JYUH 3S7HB 1XVMA 2R3UA 3TNSA 1GCDA 2GGVB 2CGAA 2XC0A 4H6SB 2C93B 1RRKA 2F3CE 3QTOH 1AE5A 1P3CA 1GI7B 2BXTH 2P95A 3LJOA 1BMLA 2SNVA 4B71A 1P8VC 1SVPA 3A7YA 1N8OB 1P04A 2FPZA 4FXGH 3RUOA 1IQLA 1L2EA 1GBTA 2ZDVH 2GZ9A 1FMGA 1UK3A 2P3UB 3SUFA 1HLTH 3BTTE 3MU1A 3QWCH 1Y3YA 2VIVA 1CT2E 1GBAA 1UCYK 2GV7A 1QJ6B 1MQ6A 3FZZA 3FANA 1DSUA 1DVAH 2A4OA 2Z3EA 2Z9IA 2GX4A 1C4Y2 1LTOA 1TE0A 4OS1A 3TU7H 2ZGJA 3FP7E 1AMHA 1NRPH 2VNTA 4IMZA 2BDHA 5JBTA 2FESH 3P8OA 3RXEA 5TCCA 1SQTA 1YYY1 1NRRH 2A4RA 2NU0E 5T3HA 2RA0A 1GG6C 3K2UA 2AMDA 1HJ8A 3U8RH 3LGIA 2HRVA 4XDEA 3MTYA 2FLBH 3ZZ8A 1PJPA 4ZHLU 3SBKA 2OTVA 1QA0A 2VIDA 1LVOA 3QLPH 3MU8A 2BXUH 7GCHF 1DICA 2ZP0H 2ZHEH 4WMEA 3RXIA 1P01A 1JWTA 1GBCA 4ZROA 5J4QA 2IJOB 4X0WU 1DY9A 2A1DB 1V2WT 2ZF0H 1H9IE 1AN1E 2R3YA 3S9BA 1AU8A 1ZOMA 5TJXA 2LNCA 3PLBA 2FOMB 1C1PA 2ZGXH 3EYDA 4X8SH 4X6MA 3UY9A 1GMCG 1GBMA 2GDDA 1Y59T 4INHA 4I8HA 1PYTD 5JBAS 3PTBA 2PKAA 1XVOA 1BTUA 1HCGA 1TA2A 1J15A 1WOFA 3VGCC 3SUGA 2XTTB 2BD3A 1YPEH 2VGCB 1CA0C 1G3DA 1TMTH 4GUXA 5CHAC 2FDAA 1O3OA 3GCTG 2FYRA 1UVOA 4WVPE 1P02A 5EG4A 1CT4E 1EZQA 1M9UA 1XUJA 4R8TB 1FXYA 2XYAA 1K28D 3GCOA 1LO6A 1GI4A 1ZHPA 3ENSB 2GP9B 4X1SU 1BITA 1MU6B 2JETC 1ELEE 5GCHG 1G9IE 1P06A 2F91A 2FI3E 2SFAA 9LPRA 1EXFA 4K1SA 4BAMB 2ULLA 1OYQA 3MU5A 4NIVA 3SNEA 2BMGB 2R0LA 1TPSA 4CRFA 1GVZA 1MH0A 3L33A 3ZZCA 3OU0A 1O2TA 3KGPA 3Q00A 2PKSC 3I29A 2FS8A 1TRMA 3PTNA 2OUAA 1ANEA 4INKA 1IQGA 1GBKA 1HFDA 1L1NA 1MMJN 1W10U 1NZQH 1S5SA 3FFGA 2Q6GA 1PQAA 2FEQH 5EPNA 3MNSA 1EZUC 1KDQB 3FAOA 2ZECA 3BIVH 1EKBB 3GDUA 1SLWB 1QFKH 3W94A 1HAVB 2ZTZA 2YNAA 4ZXXH 5K7RA 2PUXB 2V3OH 3KIDU 4O3UA 3BTGE 4MPWA 2ZDKA 4PROA 1A3EH 1NFXA 2CV3A 2ZFTA 3HPTB 2F9PA 1EP6A 4OS6A 3M7TA 2J92A 3TJOA 1DUEA 5G4BA 4CR5A 3TK6A 2XC4A 4X1RU 2W5EA 2O8UA 2BDYA 1J16A 3RMNH 4WWYA 1ZHMA 4DOQA 3SQEE 1OXGA 2G8TA 4A7IB 2PLXA 2A45B 2PSXA 4KTSA 3SW2B 1PPCE 1ZZZA 2Y6TA 1BRCE 1HJ9A 1QB6A 3EQ0H 1IHTH 5HMAA 3M7QA 1N6YA 2WPIS 1O5CB 2EI7A 2WPHS 2ZCKP 1FPHH 4E05H 1BIOA 3LONA 3LDXH 5C1UA 1J8AA 2BD4A 5DJ7A 4IC5A 4ZH8A 1OSSA 3M5MA 3T28A 1MTWA 1AWHB 1GVKB 1GHYH 4CRAA 1ZTKA 5C5NA 2XNIA 2BX4A 3A8CA 3QGJA 3SJ8A 1XX9A 1TOMH 3KNXA 1UHBA 2D26C 3PMJA 5A0AE 1G2MA 2THFB 3UWJH 4AOQA 5JB8S 1O3JA 3TGKE 2UUFB 5AFZH 3CENA 1UMAH 2GMTC 4NGAH 5GDSH 1GJ6A 1HNEE 1MBMA 2BTCE 3E91A 1OX1A 2RA3A 3LIWA 1SHYA 4ZHAA 3PYHA 4ISOA 3FP6E 1O3MA 1O5EH 2P8OC 1RTKA 2ZI2H 1VZQH 2P16A 3BF6H 3SV2H 1E37B 3QUMP 1C5ZB 3UR6A 1FAXA 3A89A 4ISIH 1BHXB 1RFNA 2GCTC 3IITA 1K22H 1RTLA 1EOLA 1SLUB 2EA3A 1GBFA 1PFXC 4ESTE 3M37A 1TQ7B 4BXSA 1BRUP 1GCTC 1P2KA 3RXUA 1C5XB 1EAXA 3GY6A 5I25A 1PPEE 2PTCE 3MO9A 4B2CA 1EUFA 2O9QA 3D49H 4X8TH 1O3LA 3A81A 3RU4D 5EPYA 1ELGA 1K1IA 1TB6H 5EXMA 4XBCA 3A85A 4KP0A 1QQ4A 1BMMH 4XBDA 1OS8A 5HXFA 1S0RA 3H5CB 1DY8A 1F0UA 2NWNA 1C2HA 5AF9H 2ZGBH 1Z7KA 3S9AA 1NO9H 3QZQA 3RC4A 1ABIH 3VGCB 2FWWA 1O3AA 2PSYA 1GJAB 4IN2A 1DITH 1O5DH 1CA0B 2UUJB 2EI8A 2Y7XA 3BTFE 6CHAC 5CHAB 2P59A 1SGYE 2BVSH 1O2HA 2FS9A 2XCFA 3M61U 1EOJA 4IS5A 1P11E 3C1KA 2RDLA 4Y8YA 1O5GH 4ABDA 1FLEE 4ABGA 5EQSA 1TLDA 2JETB 4MNWA 3BIUH 1WYKA 4RKJB 4TPYA 3GY2A 2BY5X 1LDTT 1ZJDA 2YNBA 3KQEA 1P03A 3NPSA 5HM2A 4TPIZ 1K1PA 2GDEH 3HKIB 4I8JA 1TOCB 3Q77A 1NTPA 1CO7E 2ZEBA 1BHXF 1T8MA 2ZDNA 3MNBA 5C3NA 3L6PA 4FU8A 4LOYH 1TWXB 2Z9LA 4IW4E 1C2FA 2D2DA 5FPTA 2PKSB 1TPOA 2R0KA 5JB9S 4TY6A 2BDIA 2FX4A 1GJDB 1AE8H 3S9CA 3UFAA 1PQ5A 3ZYDA 1AVWA 2F9UA 1K1LA 5ESTE 4AYVB 4ABFA 1ARBA 3HK6B 4MTBA 1V2LT 3RMOH 2TIOA 4JK5A 1KXCA 5FBEA 4Q7XA 1FNIA 4KGAA 2CMYA 1BTPA 1TGCA 4J2YB 2G81E 5DG6A 2GCHG 3ZZ7A 4KELA 1IQIA 1O32A 3A8AA 1J17T 4NSYA 3BTWE 5JBCS 3VPKA 4UEHH 1P12E 1ZMJA 4U2WA 4FU7A 3VFEA 1EZSC 1ZPBA 5LPFA 1GBHA 1TPAE 3RU4E 1WTGH 1Y5BT 3O8BA 3M5LA 1W12U 2A5AA 4ZKRU 1C5NH 3SU0A 2Y7ZA 3LPRA 1LQDB 4JCNA 4RSPA 2KAIB 1GDUA 3A7ZA 3Q76A 3U1IB 1RXPA 4MNVA 2BQ6B 6GCHF 1P2QA 4INLA 3HGNA 4B2BA 1BTYA 4UFEH 1BJUA 4E7RG 3A88A 1EJAA 1NN6A 1NC6A 4D7FA 4HFPB 2G4UA 3NKKA 1AB9C 2OXSA 3SU1A 2G55A 1P2NA 2ZTYA 1GBEA 5A8XA 2OINA 3RLWH 1HAXB 3STJA 1UTNA 2G52A 1KTSB 1K1JA 2CHAB 3FP8E 2W3KA 2R2WU 1BTHH 2AERH 1C1SA 4Y7AA 2WYGA 4B73A 3M3SA 2G00A 3SZNA 1HBTH 2AIPA 1IQJA 3DUXH 1BBRE 1S83A 1ABJH 4XSKU 2BYAX 1OWEA 1YPMH 2ZQ2A 1C1UH 2XWAA 1EPTC 5GWZA 1O33A 2FI5E 1O34A 2BX3A 1SGFG 1GL1A 1UVSH 3A84A 1GJBB 1HIAA 1ETRH 1ELFA 4WY3A 1DXWA 2CJIA 4F4OC 2ODQA 1GDNA 2BDBA 4IGDA 1MTNC 3VB4A 2GMTB 1LHEH 1B0EA 2ZPQA 1TX8A 1DWCH 1EATA 3RXSA 1C5YB 1C2MA 5C20A 4HI3A 4WH8A 4FUBA 4FUIA 2JH6D 4KTCA 3T5FH 3U69H 2P8OB 1XUIA 1G2LA 2QGRA 1D6RA 2ZGCA 4X1PU 1TNKA 2PWXA 3A7VA 1O3KA 2GCTB 2IOTA 3P8GA 1WV7H 1O2ZA 1UO6A 3MH6A 5FBIA 2BDCA 5L30H 2PGQB 3QX5H 3AVZA 1B7XB 1A5IA 1GCTB 1V2TT 1BOQA 4Y7BA 1P09A 1UK4A 2SGEE 3GICB 3FZDA 5C5OA 2OC1A 3TPIZ 2FTMA 2WINI 3LJJA 3RC6A 1GI1A 2Y5FA 3BTKE 1D3QB 2PGBB 1CHOG 2G5NA 3A7XA 1EQ9A 4OS2A 2WUBA 5ABWA 2VWOA 5CMXH 1DLEA 1DFPA 1XUKA 4CRBA 1AI8H 1GJ4H 1ZPZA 2G51A 1O31A 1YCPM 2FIRH 3E6PH 2OCVB 3QTVH 1B0FA 2G4TA 1H8IH 3U1JB 1O3HA 1IQEA 6CHAB 1WQVH 4WJG2 1THRH 1F7ZA 4NWKA 1P9SA 5AFYH 1FQ3A 3HATH 4LK4A 1LCYA 1KIGH 1YPHC 2V0BA 4IMQA 1TNIA 1A5GH 2VB0A 4NIYA 1F5RA 3BG4C 5FX5A 4AGJA 2QF0A 3MWIU 1IHSH 1SB1H 2XWBI 4YZUA 1NRQH 1ZMLA 1FY3A 2B8OH 2ZDMA 5L2YH 1O2MA 3EA9A 1GMCF 1P3EA 2BDAA 4SGBE 3BTDE 3RXDA 3M7UA 1F92A 3UOPA 3WY8A 1WSSH 1ELAA 4NA7A 2SGPE 1W7XH 4CR9A 1GHBG 1LHFH 3A8DA 1A0JA 4NCYA 4FUJA 3GCTF 4WMDA 2GV6A 1HAIH 3DHKH 8ESTE 4OS7A 3GDVA 5A2MH 1KXFA 1BCUH 1KXBA 3UREA 1DS2E 1Z8GA 2VWMA 3CS0A 1IQNA 1GMDF 1HAPH 1QBOA 2A31A 2Z7FE 1Y5UT 2W7SA 2BLOA 5EODA 3KQCA 5GCHF 1VR1H 1THSH 1HAHH 3GISB 2BLQA 4BAQB 1TBZH 1FIWA 4GHTA 4Y0YE 4XFQA 4JYVH 1VCPA 1KLTA 4F49A 1SQOA 2ZHWH 1AVGH 3TJVA 1ZRKA 2FOEA 1A0HB 1T31A 4YLQH 1QY6A 4JZEH 4BXWA 2B0FA 3K6ZA 1Z1IA 1DXPA 3P92A 1OWKA 2CF8H 3RXLA 5DK1A 3P8FA 3F9GA 5E2OA 3A86A 1O3IA 1C5VA 1J14A 2OQUA 1SGDE 3E90B 3I78A 1LVBA 4BAHB 1QB9A 2QXHA 4IBLH 3H7OA 1YPGH 2FMJA 2ZA5A 3M3VA 2GT8A 1BBRH 1SBWA 4YOJA 4ZHMU 1SR5C 1GBBA 2HALA 1C2KA 3UUZA 1UCYE 4Y76A 3ZZ4A 1ZSLA 3ZZ6A 3MOCA 4ABIA 1CQQA 1KLIH 3TK9A 3UWIA 1GBIA 3V12A 1ELCA 2BY8X 3E3TA 1PQ8A 3VB7A 3ZZBA 1C2EA 5FX6A 3QO6A 1V2OT 1W7GH 4JYTA 2TRMA 2VWLA 1SGEE 1E36B 3EAJA 5J4SA 2UUKB 3V3MA 1SI5H 3O8RA 2VIWA 4AN7A 1SG8B 4D7GA 1T8OA 2XRCA 1HXEH 3MO6A 3UOUA 4CRCA 1O35A 1TMBH 3MFJA 2VWNA 1GJCB 2TPIZ 6LPRA 4IN1A 1EPTB 4MLFB 1EP5A 1QIXB 1KXDA 2ZU4A 3A7TA 2I6SA 4ISNA 1LPGB 1UJ1A 1AKSB 1UK2A 4WF8A 4B74A 1EB2A 1O3GA 5E2PA 2Q6FA 9ESTA 1GMDG 4Q2KA 2ZPRA 1YPKH 2ZU5A 3QGNB 3HK3B 2A32A 1ARCA 2ZGHA 2GZ8A 1SGPE 4HZHA 4NIWA 3TITA 4DCDA 4H6TA 3PMAB 3BSQA 2F9NA 3E8LA 1F0TA 2BHGA 3OY6U 1GI0A 2C8ZB 1RGQA 3IWMA 1CHGA 1MKWH 5JDUB 1DLKB 4YLUA 4ZUHA 1O2KA 1VITF 1C5QA 1IQMA 3DD2H 1E0FD 3VEQB 3SQHE 1W0YH 4D9RA 2J9NA 1MKXK 3ZVGA 1FY8E 4AORA 1CE5A 3GY4A 4OS5A 4U32A 1NS3A 1V2PT 4ABHA 2ZZUH 2FOGA 1T7CA 3F68H 3GYLB 5L6NH 2PW8H 1V3XA 1YCPK 3OX7U 2BQ7B 2V35A 3RMLH 4Z6AH 3SOSA 2ZFFH 1WCZA 4GSOA 1BT7A 1S0QA 2O8MA 3E0NB 5IDKA 2Q6DA 3RXBA 3PM3A 2ZU2A 5FCRA 2GKVE 2ILNA 3LGYA 3P8NA 4TWYA 2A2XH 1HRTH 1S82A 4UDWH 2OLGA 1OP8A 4X8VH 3AAUA 1C1NA 3EA7A 3SNAA 1UVUH 1O2SA 1O2QA 1XM1A 2HGTH 5DP6A 3BTME 2ESTE 1ESBA 4UFDH 3JZ1B 3RXOA 3GY3A 3TLOA 4I8GA 2HPPH 1NFYA 3BG8A 5TCAA 2H9TH 3LKWA 5GJ4B 1DWDH 2XW9A 1V6DA 1HB0B 3S0NA 2XCNA 1L1JA 3PB1E 2C90B 3SNDA 2AS9A 1D3DB 1MCVA 1WTHD 1BB0B 1GGDC 1OWHA 1EAIA 3ELAH 2H9HA 2OP9A 3KQDA 5DP7A 3KF2A 1QRXA 3MH5A 4BAOB 1WQSA 1DM4B 3BTHE 2BOKA 1TA6A 4LZ4B 1OKXA 2BD9A 2NU4E 2FOAA 2J95A 1VITG 1TONA 1O2YA 1P10A 4MDSA 2A5KA 4OS4A 2AGGX 1UCYH 3SV7A 1PPHE 1QA7A 3P17H 1C5MD 1GG6B 1QBNA 4K1EA 3L3TA 3MI4A 3KN2A 4NFFA 1P05A 5E0HA 1ZSJA 2AH4X 1GJ7B 3B23B 4BOHA 1MCTA 1UTQA 3BEFB 2Y80A 4GHQA 4K1TA 1BMAA 1UTOA 3EA8A 1P57B 3BTQE 4GCHG 1ZR0A 4YO9A 2J2UA 4D8NA 1ZHRA 4DT7B 1C5SA 1G30B 1YC0A 2GCHF 3B9FH 4THNH 3NUMA 2UWPA 2ZU1A 3SGQE 2ZIQH 1V2QT 1O2NA 1O5BB 5L2ZH 3N7OA 4X2WA 2ZNKH 1VJAU 2HPQH 3LC5A 4BTIB 4CBOA 1FY5A 2TGTA 2H1UA 3RM2H 1O3CA 2HNTE 1BRBE 1A0LA 1Y3VA 4IC6A 1K2I1 3BEUA 4CREA 1XUGA 1S85A 1C4U2 1YPJH 2O8LA 2BZ6H 2W26A 1C5TA 3MO3A 4X2YA 2PKAB 1OWJA 4UD9H 4GAWA 2Y5GA 3RP2A 1TBQH 2HWLB 1H8DH 3ZYEA 1SGRE 1TRYA 3OY5U 1DANH 2FOFA 2VIOA 3K65B 3I77A 1AD8H 1TPPA 1TALA 2ODYB 3SUEA 3D65E 5DP5A 1ESTA 1SQAA 1ZYOA 4NSVA 5DP8A 4AFUA 3ATWA 4I31A 1O5FH 1JOUB 1O2IA 1XUHA 2Z9JA 1D3TB 4CH2B 3ZZ3A 2AGIX 3AW1A 4JZ1A 1UTLM 4YT7H 1XKAC 4ZKSU 3RM0H 2AGEX 1KXEA 3ZZAA 3PO1C 1CA8B 4WXVA 3U98H 1GVLA 4AG1A 1C2IA 1KTTB 5BPEA 1O36A 5HM9A 3LC3A 1W3CA 3SJIA 1SGQE 3A80A 1GHXH 4Y79A 1G3BA 3TH4H 7KMEH 1QRWA 1D3PB 2WPMS 5BRRE 2A7CA 1NROH 1W8BH 1C1VH 2VVVA 4FUGA 4E06H 1ZJKA 3T27A 2QF3A 3VXEH 1QB1A 2RCEA 1TNGA 3BTEE 1ESAA 1JIRA 3RXJA 3SU5A 4J1YA 1GI8B 1MAXA 1PPZA 1W13U 2FXRA 3TK5A 8KME2 2FM2A 2QXGA 1ELDE 2SNWA 1BTWA 4YOGA 2DE9A 3QN7A 1UTPA 3SNCA 1GMHF 4MPXA 1SLVB 3QZRA 5E8EH 1QL9A 1TNJA 2TGDA 4Y71A 1O3PB 2EI6A 2BQWB 4FUEA 1YCPH 1Q31A 5ETXA 3DFJA 2FOBA 1Z71A 2VINA 2ODPA 5F8ZA 4R0IA 1CHOF 3AW0A 3C27B 3T25A 2XC5A 1XMNB 3PLPA 1O5AB 1HAZB 2BY6X 5T6FA 5C67A 2QXIA 1MBQA 2QXJA 3CP7A 3RU4T 5F8XA 2FZZA 1CSOE 8GCHF 3OYPA 4UFGH 1N1LA 3VB3A 1OOKB 1AQ7A 3RXMA 3EDXB 1MUEB 3BV9B 3UNSA 2PHBA 4JK6A 2OC8A 2ZO3H 3RXAA 5FHTA 4AFZA 1C5UA 1ID5H 1GGDB 3MU4A 5FXLA 1QNJA 1F0SA 2ANKH 2ZFSA 2WV4A 4A92A 1GI2A 2J34A 3SORA 3M5OA 3F6UH 1SFQB 4X6OA 4Q80A 2DE8A 1DPOA 1O39A 4TWWA 2ANYA 1SFIA 1FIZA 3SU4A 6ESTA 1C1OA 1QGFA 1GHAF 3CS7A 4K2YA 2V6NA 1Y3WA 8LPRA 2OBQA 3MYWA 4I8KA 1E35B 3P95A 4VGCC 1UHBB 1GHBF 4BTUB 2Q1JA 1S81A 3BEIB 3RC5A 2R9PA 1GPZA 1C1MA 2P93A 4UE7H 1P2MA 1K1MA 4DURA 1GJ9B 2AFQB 1SC8U 2BY7X 1C1WH 2GZ7A 3ZVDA 1EJNA 2P3FH 1UTMA 1AFEH 1EAWA 4NWLA 2CF9H 5LH8A 1PYTC 3D62A 1SMFE 2JKHA 4ISHH 1VCWA 1RJXB 2ALVA 2Z3DA 1TFXA 1U6QA 2ZC9H 1GI5A 2IPHA 4Y10E 4ABEA 1OP2A 3MU0A 4DJZB 2R2MB 3SU2A 1DSTA 1GMHG 3SV6A 3RLYH 2O8TA 3B8JA 3RXTA 1V2KT 4MVNA 1UVPA 1QHRB 2ZDAH 5E0JA 1C1QA 3T62A 2FOHA 2ZPSA 1CBWC 1UTJA 4FUHA 2A2QH 3ATLA 4X1NU 1O30A 3TH2H 2K1QA 1GJ5H 3KCGH 3P6ZB 3UPEA 2XXLA 1GI9B 4A1VA 1FN6A 1TNHA 1O2VA 2XBWA 2XBVA 3PMHB 4AFQA 4B75A 8GCHG 2VJ1A 4CHAC 4DVAU 1FJSA 2A7HA 2VH0A 1KDQA 3ZZDA 1E34B 1JMOH 3UIRA 2ZDLA 1HPGA 2M5TA 2PR3A 1WU1A 1JRSA 1HAVA 3LGVA 1LKBA 4DIIH 1WUNH 3A8BA 1T8NA 2OC0A 7ESTE 2CXVA 4Y8ZA 2ZTXA 5C1YA 3TGIE 3TJNA 4FUFA 5EW2H 1QRZA 1Y3UA 4CRDA 2BM2A 4Z0KA 2G5VA 1MTVA 3R0FA 1LPKB 1WBGB 1O2OA 1AHTH 1GHZA 2A4QA 4AG2A 1SHHB 1ACBE 1GHAG 3G01A 4AZ2B 2HLCA 2BVRH 3UNRA 2HOBA 1PPGE 5EU8A 1C5WB 1ZSKA 1ZLRA 2B7DH 1CGHA 3PO1B 1AGJA 1DDJA 2NU1E 3DT0H 1GL0E 4MG3A 4A6LA 1BMNH 4AB9A 4X2XA 1VGCC 4B1TA 1DWEH 1GHWH 3KHVA 3RXRA 1O3FA 5K0HA 1D9IA 4MNYA 1P0SH 4Q7YA 1N6XA 4ASHA 1V2ST 3Q3XA 1HUTH 2P94A 2QY0B 1EAUA 2STBE 1GBDA 2ZWLH 2JH0D 3SNBA 1QURH 2HNTC 2B9LA 1PPFE 1A46H 1O2UA 1Z6EA 3A87A 5LPRA 3URCA 4DGJA 1SSXA 1H9HE 1ZGVA 2BOHB 3RXCA 1GWAA 2F9VA 3VXFH 5DO4H 1JRTA 5FPYA 3U9AH 1W0ZU 3DA9B 3VB5A 1NRSH 4FUDA 3SJOA 3KEEA 3RXPA 1LQEA 1ANBA 4O3TA 2FI4E 1O2XA 1VJ9U 2Y81A 3PWBA 4U01A 1YBWA 4X8UH 1RIWC 3SHCH 1FN8A 1TQ0B 4A1XA 2XBYA 2Y5HA 4X2VA 4RN6A 3STIA 4ABJA 1HGTH 1IAUA 1HAGE 1O3NA 3ODDA 2QV1A 4Y11E 1AB9B 5EXNA 1QJ7B 2A4GA 1DWBH 3R3GB 2C8YB 4GPGA 3M5NA 4CH8B 3TVJB 1ANDA 3BN9A 1SGFA 3P70B 4BTTB 3GCNA 4BNRA 1HV7A 3A7WA 2WPLS 4UFFH 3GY8A 2A5IA 3EGKH 3KQBA 3M35A 3NK8A 3TIUA 2GTBA 1O2GH 4B76A 3PWCA 2NU2E 1VCQA 1ZMNA 1KLJH 1BA8B 3U8TH 1INCA 1EB1H 5FPSA 1Z1JA 3RXHA 3JZ2B 1W11U 1GJ8B 5DGJA 4YESB 4AX9H 1IQKA 1KYNA 3V0XA 1CU1A 1NFWA 5HGGA 1TABE 2ZCLP 2GT7A 1K21H 1TIOA 2J38A 4ABAA 1A7SA 3KL6A 4VGCB 3HGPA 1MTNB 1NPMA 4CRGA 4ZKOU 1W2KH 3M3TA 1HIAB 1C1RA 4MNXA 2VU8E 4AB8A 4I32A 2C8WB 5PTPA 1MZDA 1TMUH 2QA9E 1O2RA 1K1NA 1SL3A 2BD5A 4X1QU 2VIPA 2BD8A 4GVUA 2UWLA 1HAOH 3M36A 1QR3E 2WV5A 1J9CH 5EXLA 5C1XA 5EW1H 5DKMA 2BLVA 1DX5M 1H1BA 3Q3YA 1SGNE 4TY7A 2FTLE 2TGPZ 1Y3XA 3Q3KA 4MPVA 1MU8B 1MAYA 1YGCH 1CGIE 4K3JA 5LPEA 1A3BH 4K8YA 4Y8XA 1H4WA 2LPRA 4ZXYH 3T26A 1YKTA 2ZKSA 3GCHC 1TX6A 3MMGA 1CBWB 2BB4A 4JZFH 3ZVAA 4NZLA 2BD7A 2H2ZA 5A0BA 1TX7A 4AGKA 1Q3XA 5JBBS 2D1JA 4K8BA 2ZQ1A 1FPCH 4X6NA 1IQFA 1ETTH 1JBUH 1SPJA 4CHAB 1Z8JB 2QIQA 3ZVFA 1Y5AT 2B5TB 1RTFB 4GCHF 1JIMA 1AIXH 3O8DA 3TJUA 4TYDA 3UQVA 5F8TA 7GCHG
chains in the Genus database with same CATH superfamily
1BZXE 3ATKA 1LHDH 3ZZ5A 2ASUB 1D4PB 5DP3A 2V3MA 3IG6B 3LH1A 3SJ9A 1BDAA 1Z8IB 2ZG0H 1YLDA 3BG4B 5T6GA 3GY7A 1T8LA 1IQHA 1C9PA 1ZRBA 1NM6A 1GHVH 2CN0H 2H9EH 2WUCA 2H6MA 3SO3A 2RG3A 3V13A 4DY7B 1TGTA 1C9TA 3E0PB 1AFQC 2Z94A 2ANWA 3DSOA 1WAYB 3SGAE 3UTUH 4U30A 4AFSA 3TGJE 5GIBA 2GVFA 1OHHD 1G3EA 1P2JA 4FU9A 5F6MA 2KAIA 3F9EA 4CBNA 1WDIA 2EEKA 3ZV8A 2JDID 4X6PA 2WPJS 5EQQA 4F48B 5HIYA 2JIZD 1O2PA 1MZAA 4HGCA 1ETSH 2F9OA 1LPZB 1K9OE 3W1EA 1BTZA 1O38A 1QCPA 4MPUA 1L4DA 1VGCB 1GI3A 3RMMH 1S84A 1FV9A 3TH3H 1H9LB 2Z9GA 2HLDD 2VIQA 3PLKA 3LGUA 2ZCHP 1C4V2 4B2AA 2ANMH 2HVXA 3OEHD 5JYIA 1ZTLA 3KYGA 2W3IA 7LPRA 3LT3A 1LHGH 5I46H 1EX3A 1EJMA 4OGXA 4JZIA 3N7EA 4Y0ZE 3DSPA 1KXAA 2CHAC 1BJVA 2FO9A 5CE1A 3F0OA 1E38B 1O2WA 1S6HA 1TGNA 1TYNA 5DP4A 5EQRA 3SI3H 2BY9X 5C0UA 1AO5A 3GDSA 3SV8A 1XXFA 1FONA 2UWOA 5FCKA 4YM9A 1HJAC 2ZFPH 3NWUA 4K69A 1MD8A 5EGMA 2A0QB 5T6DA 3LGWA 1O3DA 2ZU3A 4A5TS 1K1OA 4I33A 1F5KU 1FI8A 4OGYA 2F9BH 3ATMA 1C5OH 3PV2A 4ISLA 5ESBA 4K5ZA 3O8CA 2W7UA 1YPHE 1FY4A 1RIWB 2FP7B 4JMYA 4DG4A 1ELVA 1TNLA 3FVFB 3LGTA 1F0RA 1AUTC 2IPQX 1FDPA 3RDZA 1HXFH 5AVDA 3UNQA 2Z9KA 1V2VT 1DE7H 3MH7A 1B5GH 2D8WA 3LU9B 5GXPA 4I8LA 1C2DA 2STAE 3ATIA 2VH6A 1Q2WA 3MNCA 3UQOA 3DCLA 3SGBE 1A61H 1O2JA 2PV9B 2O8WA 2SGAA 4XOJA 2QCYA 5EJLA 2Z6BD 1TRNA 2C3SA 1CT0E 1OWIA 1RS0A 2C8XB 1CGJE 1KY9A 4A1TA 1A2CH 1AWFH 4O97A 1Z8RA 4NA8A 1V2MT 5A0CA 1QL7A 3ESTA 1MABB 2FOCA 4NG9H 1A5HA 1L1GA 2JH5D 1G32B 1T4UH 2VVUA 3OTJE 2TBSA 1LHCH 2HNTF 2ALPA 1ZPCA 3NZIA 1XKBC 2IN2A 2GD4B 3AASA 3E1XB 3NCLA 1FZZA 1VITH 5F03A 5E0GA 1G37A 4HG6A 1O3BA 1NY22 2NU3E 4BAKB 5DP9A 4H4FA 4D9QA 4DIHH 1QJ1B 1YLCA 4KTUA 1NU9A 4NFEA 3OEED 1FAKH 1LMWB 2AMQA 3SU6A 1DOJA 5IYTA 2BD2A 2EC9H 1GBLA 1YF4A 2BZAA 4I86A 2BDGA 1AZZA 2UUYA 2Y82A 3F9FA 3FOAA 1YM0A 4WMFA 3PV4A 1LVYA 1C5RA 4MQAA 2J5UA 2ZHFH 1P2OA 1ZTJA 3W95A 1JXPA 1N8OC 4KKDA 2ZHDA 5KEDA 1A1RA 4FUCA 3RXFA 1F5LA 4XE4A 3GCHB 4FVBA 1O2LA 1NRNH 3F0PA 1SOTA 1X7AC 3QK1A 3SHAH 3ZVEA 1MD7A 2QN5T 1V2RT 1ZGIA 2WYJA 1HDTH 4AYYB 3LH3A 1C2JA 2BLWA 1MKXH 5A8YA 1SGIB 1XXDA 3OTPA 1QTFA 1C1TA 4M7GA 3SUDA 3SV9A 2VVCA 1Z6JH 2H5CA 1G36A 3U8OH 1MQ5A 2OQ5A 3RXVA 2XBXA 5SGAE 4YOIA 1O0DH 1SLXB 4ABBA 3TNTA 1XUFA 1L4ZA 1BRAA 3HKJB 1AFQB 1BBRK 2QC2A 3MH4A 3NXPA 4OM9A 1D6WA 1MTSA 1BTXA 4Y6DA 3T2NA 1AY6H 3F3BA 2OD3B 4H42U 2AIQA 3V7TA 2FYQA 3F1SB 3ZV9A 3UR9A 3T29A 1P9UA 3URDA 3OE7D 1KSNA 4NIXA 1QBVH 4GLYA 1NFUA 3K6YA 3H7TA 1DUAA 1AZ8A 1LKAA 2OBOA 1C2LA 1TBRH 1GI6A 2SGFE 4HTCH 4QT8C 5FAHA 5LGOA 1PQ7A 5DPAA 3AK5A 1A4WH 1ORFA 2FX6A 2AYWA 5C2ZA 2SGDE 1TGSZ 3RXKA 1UTKA 2J94A 2ZFRH 2QYIA 3RXQA 1MTUA 3EE0B 1TAWA 1V2JT 3SJKA 2J98A 4K60A 2TGAA 1QQUA 1YP9A 5A09A 3GY5A 3AAVA 5CDFE 4O9VA 1CVWH 4B6FA 1DT2A 3A83A 4O03A 2PFEA 1HJAB 2QAAA 1AVXA 2ZFQH 4NZQA 4RKOB 1EPTA 1AUJA 3PROA 1BQYA 5JPMH 4ZKNU 2AMPA 1SGCA 4LZ1H 2VGCC 2YMSC 3LOXA 1O3EA 3SN8A 4XBBA 1W14U 3S7KB 1AKSA 1NU7B 2AHME 3F9HA 1SOZA 4I7YH 1GBJA 1YPLH 2SGQE 2AEIH 2Z3CA 2YOLA 1OPHB 1T4VH 1EZXC 2XNDD 4WXIA 1PPBH 3PRBA 1OP0A 2F83A 1ANCA 1E1RD 4DW2U 3PMBB 1MKWK 2FODA 2PUQH 1L0ZA 2WPKS 5GPIB 1V2NT 1NT1A 4FVDA 3MHWU 5A8ZA 5AHGH 1G3CA 1Y8TA 3DFLA 1V2UT 1O37A 3N99A 4ASUD 1TGBA 2LELA 3VB6A 5B6OA 3MNXA 2P3TB 2C4FH 3A82A 3ODFA 1ELBA 1OYTH 4E7NA 1FUJA 2I6QA 2DUCA 1P2IA 2KCYA 3E16B 1FY1A 1S6FA 4YT6H 3SI4H 1IOEA 1C5LH 4WH6A 3S69A 2OC7A 1NESE 1THPB 1HYLA 1BUIA 1F2SE 4Q7ZA 2J4IA 1FX0B 1UVTH 2FLRH 4D76A 1QL8A 1SGTA 2GJGA 4NA9H 1YY3A 4SGAE 3GYMA 4ZAEA 4BANB 1C5PA 4AC9A 1C2GA 3ZVBA 1ELTA 2V7QD 1RD3B 6GCHG 3SU3A 3GOVB 2BVXH 3D23A 4JZDH 3RXGA 1LVMA 1EASA 1T32A 3K9XB 3FKSD 1OWDA 3ZVCA 1HAYB 4LXBH 5EOKA 5H4IB 4UONA 3QDZB 2A7JA 2ZHQH 3ITIA 2H5DA 4YTAA 3ZZ9A 5HYOA 1GDQA 4ZMAH 3OSYA 2PTNA 2V3HH 4JYUH 3S7HB 1XVMA 2R3UA 3TNSA 1GCDA 2GGVB 2CGAA 2XC0A 4H6SB 2C93B 1RRKA 2F3CE 3QTOH 1AE5A 1P3CA 1GI7B 2BXTH 2P95A 3LJOA 1BMLA 2SNVA 4B71A 1P8VC 1SVPA 3A7YA 1N8OB 1P04A 2FPZA 4FXGH 3RUOA 1IQLA 1L2EA 1GBTA 2ZDVH 2GZ9A 1FMGA 4RT1A 1UK3A 2P3UB 3SUFA 4ACBA 1HLTH 3BTTE 3MU1A 3QWCH 1Y3YA 2VIVA 1CT2E 1GBAA 1UCYK 2GV7A 2KM0A 1QJ6B 1MQ6A 3FZZA 3FANA 1DSUA 1DVAH 2A4OA 2Z3EA 2Z9IA 2GX4A 1C4Y2 1LTOA 1TE0A 4OS1A 3TU7H 2ZGJA 3FP7E 1AMHA 1NRPH 2VNTA 4IMZA 2BDHA 5JBTA 2FESH 3P8OA 3RXEA 5TCCA 1SQTA 1YYY1 1NRRH 2A4RA 1NBME 2NU0E 5T3HA 2RA0A 1GG6C 3K2UA 2AMDA 2QF5A 1HJ8A 3U8RH 3LGIA 2HRVA 4XDEA 3MTYA 2FLBH 1VKYA 3ZZ8A 1PJPA 4ZHLU 3SBKA 2OTVA 1QA0A 2VIDA 1LVOA 3QLPH 3MU8A 2BXUH 3VG8A 7GCHF 1DICA 2ZP0H 2ZHEH 4WMEA 3RXIA 1P01A 1JWTA 1GBCA 4ZROA 3UAIC 5J4QA 2IJOB 4X0WU 1DY9A 2A1DB 1V2WT 2ZF0H 1H9IE 1AN1E 2R3YA 5F53A 3S9BA 1KMHB 1AU8A 4DT4A 1ZOMA 5TJXA 3U28C 2LNCA 3PLBA 2FOMB 1C1PA 2ZGXH 3EYDA 4X8SH 4X6MA 3UY9A 1GMCG 1GBMA 2GDDA 1Y59T 4INHA 4I8HA 1PYTD 5JBAS 3PTBA 2PKAA 1XVOA 1BTUA 1HCGA 1TA2A 1J15A 1WOFA 3VGCC 3DSGA 3SUGA 2XTTB 2BD3A 1YPEH 2VGCB 1CA0C 1G3DA 2YMSB 1TMTH 4GUXA 5CHAC 2FDAA 1O3OA 3GCTG 2FYRA 1UVOA 4WVPE 1P02A 5EG4A 1CT4E 1EZQA 1M9UA 1XUJA 4R8TB 1FXYA 2XYAA 1K28D 3GCOA 1LO6A 1GI4A 1ZHPA 3ENSB 2GP9B 4X1SU 1BITA 1MU6B 3H09A 2JETC 1ELEE 5GCHG 1G9IE 1P06A 2F91A 2FI3E 2SFAA 2EY4C 9LPRA 1EXFA 1BMFD 4K1SA 4BAMB 2ULLA 1OYQA 3MU5A 4NIVA 3SNEA 2BMGB 2R0LA 1TPSA 4CRFA 1GVZA 1MH0A 5T1VA 3L33A 3ZZCA 3FN8A 3OU0A 1O2TA 3KGPA 3Q00A 2PKSC 3I29A 2FS8A 1TRMA 3PTNA 5KECA 2OUAA 1ANEA 4INKA 1IQGA 1GBKA 1HFDA 1L1NA 1MMJN 1W10U 1NZQH 1S5SA 3FFGA 2Q6GA 1PQAA 2FEQH 5EPNA 3MNSA 1EZUC 1KDQB 3FAOA 2KX4A 2ZECA 3BIVH 1EKBB 3WW7A 3MQKC 3GDUA 1SLWB 1QFKH 3W94A 1HAVB 2ZTZA 2YNAA 4ZXXH 5K7RA 2PUXB 2V3OH 3KIDU 4O3UA 3BTGE 4MPWA 2ZDKA 4PROA 1A3EH 1NFXA 2CV3A 2ZFTA 3HPTB 2F9PA 1EP6A 4OS6A 3M7TA 2J92A 3TJOA 1DUEA 5G4BA 4CR5A 3TK6A 2XC4A 2KCPA 4X1RU 2W5EA 2O8UA 2BDYA 1J16A 3RMNH 4WWYA 1ZHMA 4DOQA 3SQEE 1OXGA 2G8TA 4A7IB 2PLXA 2A45B 2PSXA 2KCOA 4KTSA 3SW2B 1PPCE 1ZZZA 2Y6TA 1BRCE 1HJ9A 1QB6A 2L74A 1IHTH 3EQ0H 5HMAA 3M7QA 2VBCA 1N6YA 2WPIS 1O5CB 2EI7A 2WPHS 2ZCKP 1FPHH 4E05H 1BIOA 3LONA 2JJ1D 3LDXH 5C1UA 1J8AA 2F4LA 2BD4A 5DJ7A 4IC5A 4ZH8A 1OSSA 3M5MA 3T28A 1MTWA 1AWHB 1GVKB 1GHYH 4CRAA 1ZTKA 5C5NA 2XNIA 2BX4A 3A8CA 3QGJA 3SJ8A 1XX9A 1TOMH 3KNXA 1UHBA 2D26C 3PMJA 5A0AE 1G2MA 2THFB 3UWJH 4AOQA 5JB8S 1O3JA 3TGKE 2WZQA 2UUFB 5AFZH 3CENA 1UMAH 2GMTC 4NGAH 5GDSH 1GJ6A 1HNEE 1MBMA 2BTCE 3E91A 1OX1A 2RA3A 3LIWA 1SHYA 4ZHAA 3PYHA 4ISOA 3FP6E 1O3MA 1O5EH 2P8OC 1RTKA 2ZI2H 1VZQH 5EJ1A 2P16A 3BF6H 1W0JD 3SV2H 1E37B 3QUMP 1C5ZB 3UR6A 1FAXA 3A89A 4ISIH 1BHXB 1RFNA 2GCTC 3IITA 1K22H 1RTLA 1EOLA 1SLUB 2EA3A 1GBFA 1PFXC 4ESTE 3M37A 4RI0A 1TQ7B 4BXSA 1BRUP 1GCTC 1P2KA 3OFND 3RXUA 5HKKD 1C5XB 1EAXA 3GY6A 5I25A 1PPEE 2PTCE 3MO9A 4B2CA 1EUFA 2O9QA 3D49H 4X8TH 1O3LA 3A81A 3RU4D 5EPYA 1ELGA 1K1IA 1TB6H 5EXMA 4XBCA 3A85A 4KP0A 1QQ4A 1BMMH 4XBDA 1OS8A 5HXFA 1S0RA 3H5CB 5EJZA 1DY8A 1F0UA 2NWNA 1C2HA 5AF9H 2ZGBH 1Z7KA 3PV5A 3S9AA 1NO9H 3QZQA 3RC4A 1ABIH 3VGCB 2FWWA 1O3AA 2PSYA 1GJAB 4IN2A 1DITH 1O5DH 1CA0B 2UUJB 2EI8A 2Y7XA 3BTFE 6CHAC 5CHAB 2P59A 1SGYE 2BVSH 1O2HA 2FS9A 2XCFA 3M61U 1EOJA 4IS5A 1P11E 3C1KA 2RDLA 4Y8YA 1O5GH 4ABDA 1FLEE 1EFRD 4ABGA 5EQSA 1TLDA 2JETB 3KYFA 4MNWA 3BIUH 1WYKA 4RKJB 4TPYA 3GY2A 2BY5X 1LDTT 1ZJDA 2YNBA 3KQEA 4F55A 2W6JD 1P03A 3NPSA 5HM2A 4TPIZ 1K1PA 2GDEH 3HKIB 4I8JA 1TOCB 3Q77A 1NTPA 1CO7E 2ZEBA 1BHXF 1T8MA 2QE7D 2ZDNA 3MNBA 5C3NA 3L6PA 4XRNA 4FU8A 4LOYH 1TWXB 2Z9LA 4IW4E 1C2FA 2D2DA 5FPTA 2PKSB 1TPOA 2R0KA 5JB9S 4TY6A 2BDIA 2FX4A 1GJDB 1AE8H 3S9CA 3UFAA 1PQ5A 3ZYDA 1AVWA 2F9UA 1K1LA 5ESTE 4AYVB 4ABFA 1ARBA 3HK6B 4MTBA 1V2LT 3RMOH 2TIOA 4JK5A 1KXCA 5FBEA 4Q7XA 1FNIA 4KGAA 2CMYA 1BTPA 1TGCA 4J2YB 2G81E 5DG6A 2GCHG 3ZZ7A 4KELA 1IQIA 1O32A 3A8AA 1J17T 4NSYA 3BTWE 5JBCS 3VPKA 4UEHH 1P12E 1ZMJA 4U2WA 4FU7A 3VFEA 1EZSC 1ZPBA 5LPFA 1GBHA 1TPAE 3RU4E 1WTGH 1Y5BT 3O8BA 3M5LA 1W12U 2A5AA 4ZKRU 1C5NH 3SU0A 2Y7ZA 3LPRA 1LQDB 4JCNA 4RSPA 2KAIB 1GDUA 3A7ZA 3Q76A 3U1IB 1RXPA 4MNVA 2BQ6B 6GCHF 1P2QA 4INLA 3HGNA 4B2BA 1BTYA 4UFEH 1BJUA 4E7RG 3A88A 1EJAA 1NN6A 1NC6A 4D7FA 4HFPB 2G4UA 3NKKA 1AB9C 2OXSA 3SU1A 2G55A 1P2NA 2ZTYA 1GBEA 5A8XA 2OINA 3RLWH 2XOKD 1HAXB 3STJA 1UTNA 2G52A 1KTSB 1K1JA 2CHAB 3FP8E 1K0HA 2F43B 2R2WU 1BTHH 2W3KA 2AERH 1C1SA 4Y7AA 2WYGA 4B73A 3M3SA 2G00A 3SZNA 1HBTH 2AIPA 1IQJA 3DUXH 1BBRE 1S83A 1ABJH 4XSKU 2BYAX 1OWEA 1YPMH 2ZQ2A 1C1UH 2XWAA 5C0TA 1EPTC 5GWZA 1O33A 2FI5E 1O34A 2BX3A 1SGFG 1GL1A 1UVSH 3A84A 1GJBB 1HIAA 1ETRH 1ELFA 4WY3A 1DXWA 2CJIA 4F4OC 2ODQA 1GDNA 2BDBA 4IGDA 1MTNC 4Q63A 3VB4A 2GMTB 1LHEH 1B0EA 2ZPQA 1TX8A 1DWCH 1EATA 3RXSA 1C5YB 1C2MA 5C20A 4HI3A 4WH8A 4FUBA 4FUIA 2JH6D 4KTCA 3T5FH 3ZIAD 3U69H 2P8OB 1XUIA 1G2LA 2QGRA 1D6RA 2ZGCA 4X1PU 1TNKA 2LP6A 2PWXA 2W6ID 3A7VA 1O3KA 2GCTB 2IOTA 3P8GA 1WV7H 1O2ZA 1UO6A 3MH6A 5FBIA 2BDCA 5L30H 2PGQB 3QX5H 3AVZA 3WWBA 1B7XB 1A5IA 1GCTB 1V2TT 1BOQA 4Y7BA 1P09A 1UK4A 2SGEE 3GICB 3FZDA 5C5OA 2OC1A 3TPIZ 2FTMA 2WINI 3LJJA 3RC6A 1GI1A 2Y5FA 3BTKE 1D3QB 2PGBB 1CHOG 2G5NA 3A7XA 1EQ9A 4OS2A 2WUBA 5ABWA 2VWOA 3F2FA 1SQRA 5CMXH 1DLEA 1DFPA 1XUKA 4CRBA 1AI8H 1GJ4H 1ZPZA 2G51A 1O31A 1YCPM 2FIRH 3E6PH 2OCVB 3QTVH 1B0FA 2G4TA 1H8IH 3U1JB 1O3HA 1IQEA 6CHAB 1WQVH 4WJG2 1THRH 1F7ZA 4NWKA 1P9SA 5AFYH 1FQ3A 3HATH 4LK4A 1LCYA 1KIGH 1YPHC 2V0BA 4IMQA 1TNIA 1A5GH 2VB0A 4NIYA 1F5RA 3BG4C 5FX5A 4AGJA 2QF0A 3MWIU 1IHSH 1SB1H 2XWBI 4YZUA 1NRQH 1ZMLA 1FY3A 2B8OH 2ZDMA 5L2YH 1O2MA 3EA9A 1GMCF 1P3EA 2BDAA 4SGBE 3BTDE 3RXDA 3M7UA 1F92A 3UOPA 3WY8A 1WSSH 1ELAA 4NA7A 2SGPE 2K8IA 1W7XH 2WV9A 4CR9A 1GHBG 1LHFH 4P02A 3A8DA 1A0JA 4NCYA 4FUJA 3GCTF 4WMDA 2GV6A 1HAIH 3DHKH 8ESTE 4OS7A 3GDVA 5A2MH 1KXFA 1BCUH 1KXBA 3UREA 1DS2E 1Z8GA 2VWMA 3CS0A 1IQNA 5GNDA 1GMDF 1HAPH 1QBOA 2A31A 2Z7FE 1Y5UT 2W7SA 2BLOA 5EODA 3KQCA 5GCHF 1VR1H 1THSH 1HAHH 3GISB 2BLQA 4BAQB 1TBZH 1FIWA 4GHTA 3FO8D 4Y0YE 4XFQA 4JYVH 1VCPA 1KLTA 4F49A 1SQOA 2ZHWH 1AVGH 3TJVA 1ZRKA 2FOEA 1A0HB 1T31A 4YLQH 1QY6A 4JZEH 4BXWA 2B0FA 3K6ZA 1Z1IA 1DXPA 3P92A 1OWKA 2CF8H 3RXLA 5DK1A 3P8FA 3F9GA 5E2OA 3A86A 1O3IA 1C5VA 1J14A 2OQUA 1SGDE 3E90B 3I78A 1LVBA 4BAHB 1YLNA 1QB9A 2QXHA 4IBLH 3H7OA 1YPGH 2FMJA 2ZA5A 3M3VA 2GT8A 1BBRH 1SBWA 4YOJA 4ZHMU 1SR5C 4YXWD 1GBBA 2HALA 2J97A 1C2KA 3UUZA 1UCYE 4Y76A 3ZZ4A 1ZSLA 3ZZ6A 3MOCA 4ABIA 1CQQA 1KLIH 3TK9A 3UWIA 1GBIA 1UW7A 3V12A 1ELCA 2BY8X 3E3TA 1PQ8A 3VB7A 3ZZBA 1C2EA 5FX6A 3QO6A 5C94A 2YMSD 1V2OT 1W7GH 4JYTA 2TRMA 2VWLA 2PP6A 1SGEE 1E36B 3EAJA 2KCAA 5J4SA 2UUKB 2J98B 3V3MA 1SI5H 3O8RA 3CNRA 2VIWA 4AN7A 1SG8B 4D7GA 1T8OA 2XRCA 1HXEH 3MO6A 3UOUA 4CRCA 1O35A 1TMBH 3MFJA 2VWNA 5IK2D 1GJCB 2TPIZ 6LPRA 4IN1A 1EPTB 2JJ2D 1S6LA 4MLFB 1EP5A 1QIXB 1KXDA 2ZU4A 3A7TA 2I6SA 4ISNA 1LPGB 1UJ1A 1AKSB 1UK2A 4WF8A 4B74A 1EB2A 1O3GA 5E2PA 2Q6FA 9ESTA 1GMDG 4Q2KA 2ZPRA 1YPKH 4ACAA 2ZU5A 3QGNB 3HK3B 2A32A 1ARCA 2ZGHA 2GZ8A 1SGPE 4HZHA 4NIWA 3TITA 4DCDA 4H6TA 3PMAB 3BSQA 2F9NA 3E8LA 1F0TA 2BHGA 3OY6U 1GI0A 2C8ZB 1RGQA 3IWMA 1CHGA 1MKWH 5JDUB 1DLKB 4YLUA 4ZUHA 1O2KA 1VITF 4P00A 1C5QA 1IQMA 3DD2H 1E0FD 3VEQB 3SQHE 1W0YH 4D9RA 2J9NA 1MKXK 3ZVGA 1FY8E 4AORA 1CE5A 3GY4A 4OS5A 4U32A 1NS3A 1V2PT 4ABHA 2ZZUH 2FOGA 1T7CA 3F68H 3GYLB 5L6NH 2PW8H 1V3XA 1YCPK 3OX7U 2BQ7B 2V35A 3RMLH 4Z6AH 3SOSA 2ZFFH 1WCZA 4GSOA 1BT7A 1S0QA 2O8MA 3E0NB 5IDKA 2Q6DA 3RXBA 3PM3A 2ZU2A 5FCRA 2GKVE 2ILNA 3LGYA 3P8NA 4TWYA 2A2XH 1HRTH 1S82A 4UDWH 2OLGA 1OP8A 4X8VH 3AAUA 1C1NA 3EA7A 3SNAA 1UVUH 1O2SA 1O2QA 1XM1A 2HGTH 5DP6A 3BTME 2ESTE 1ESBA 4UFDH 3JZ1B 3RXOA 3GY3A 3TLOA 4I8GA 2HPPH 1NFYA 3BG8A 5TCAA 2H9TH 3LKWA 5GJ4B 1DWDH 2XW9A 5CHBA 1V6DA 1HB0B 3S0NA 2XCNA 1L1JA 3PB1E 2C90B 2WPDD 3SNDA 2AS9A 1D3DB 1MCVA 1WTHD 1BB0B 1GGDC 1OWHA 1EAIA 3ELAH 2M2AA 2H9HA 2OP9A 3KQDA 5DP7A 3KF2A 1QRXA 3MH5A 4BAOB 1WQSA 1DM4B 3BTHE 2BOKA 1TA6A 4LZ4B 1OKXA 2BD9A 2NU4E 2FOAA 1H8HD 2J95A 1VITG 1TONA 1O2YA 1P10A 4MDSA 2A5KA 4OS4A 2AGGX 1UCYH 3SV7A 1PPHE 1QA7A 3P17H 4Z1MD 1C5MD 5KGOA 1GG6B 1QBNA 4K1EA 3L3TA 2KFWA 3MI4A 3KN2A 4NFFA 1P05A 5E0HA 1ZSJA 2AH4X 1GJ7B 3B23B 4BOHA 1MCTA 1UTQA 3BEFB 2Y80A 4GHQA 4K1TA 1BMAA 1UTOA 5EIYA 3EA8A 1P57B 2L6OA 3BTQE 1ZR0A 4GCHG 4YO9A 2J2UA 4D8NA 1ZHRA 4DT7B 1C5SA 1G30B 1YC0A 2GCHF 3B9FH 3NRLA 4THNH 3NUMA 2UWPA 2ZU1A 3SGQE 2ZIQH 1V2QT 1O2NA 1O5BB 2KZ4A 5L2ZH 3N7OA 4X2WA 2ZNKH 1VJAU 2HPQH 3LC5A 4BTIB 4CBOA 1FY5A 2TGTA 2H1UA 3RM2H 4FOUC 1O3CA 2HNTE 1BRBE 1A0LA 1Y3VA 4IC6A 1K2I1 3BEUA 4CREA 1XUGA 1S85A 1C4U2 1YPJH 2O8LA 2BZ6H 2W26A 1C5TA 3MO3A 3F2HA 4X2YA 2PKAB 1OWJA 4UD9H 4GAWA 2Y5GA 3RP2A 1TBQH 2HWLB 1H8DH 3ZYEA 1SGRE 1TRYA 3OY5U 1DANH 2FOFA 2VIOA 3K65B 3I77A 1AD8H 1TPPA 1TALA 2ODYB 3SUEA 3D65E 5DP5A 1ESTA 1SQAA 1ZYOA 4NSVA 4Q4LA 5DP8A 4AFUA 3ATWA 4I31A 1O5FH 1JOUB 1O2IA 1XUHA 2Z9JA 1D3TB 4CH2B 3ZZ3A 2AGIX 3AW1A 4JZ1A 1WXRA 1UTLM 4YT7H 1XKAC 4ZKSU 3RM0H 2AGEX 1KXEA 3ZZAA 3PO1C 1CA8B 4WXVA 3U98H 1GVLA 2HVYB 4AG1A 1C2IA 1KTTB 5BPEA 2EQNA 1O36A 5HM9A 3LC3A 1E79D 1W3CA 3SJIA 1SGQE 3A80A 1GHXH 4Y79A 4XD7D 1G3BA 3TH4H 7KMEH 1QRWA 1D3PB 2WPMS 5BRRE 2A7CA 1NROH 1W8BH 1C1VH 2VVVA 4TSFD 4FUGA 4E06H 1ZJKA 3T27A 3SYJA 2QF3A 3VXEH 1QB1A 2RCEA 1TNGA 3BTEE 4M9FA 1ESAA 1JIRA 3RXJA 3SU5A 4J1YA 1GI8B 1MAXA 1PPZA 1W13U 2FXRA 3TK5A 8KME2 2FM2A 2QXGA 2K0QA 1ELDE 2SNWA 1BTWA 4YOGA 2DE9A 3QN7A 1UTPA 3SNCA 1GMHF 4MPXA 1SLVB 3QZRA 5E8EH 1QL9A 1TNJA 2TGDA 4Y71A 1O3PB 2EI6A 2BQWB 4FUEA 1YCPH 1Q31A 5ETXA 3DFJA 2FOBA 1Z71A 2WHXA 2VINA 3N7DA 2ODPA 5F8ZA 4R0IA 1CHOF 3AW0A 3C27B 3T25A 2XC5A 1XMNB 3PLPA 1O5AB 1HAZB 2BY6X 5T6FA 5C67A 2QXIA 4FETA 1MBQA 2QXJA 3CP7A 3RU4T 5F8XA 2FZZA 1CSOE 8GCHF 3OYPA 4UFGH 1N1LA 3VB3A 1OOKB 5HIZA 1AQ7A 3RXMA 3EDXB 1MUEB 3BV9B 3UNSA 2PHBA 4JK6A 2OC8A 2ZO3H 5FL7D 5FHTA 3RXAA 4AFZA 1C5UA 1ID5H 1GGDB 3MU4A 5FXLA 1QNJA 1F0SA 2ANKH 2ZFSA 2WV4A 4A92A 1GI2A 2J34A 3SORA 3M5OA 3F6UH 1SFQB 4X6OA 4Q80A 2DE8A 1DPOA 1O39A 4TWWA 2ANYA 1SFIA 1FIZA 3SU4A 6ESTA 1C1OA 1QGFA 1GHAF 3CS7A 4K2YA 2V6NA 1Y3WA 8LPRA 2OBQA 3MYWA 4I8KA 1E35B 3P95A 4VGCC 1UHBB 1GHBF 4BTUB 2Q1JA 1S81A 3BEIB 3RC5A 2R9PA 1GPZA 1C1MA 2P93A 4UE7H 1P2MA 1K1MA 4DURA 1GJ9B 2AFQB 1SC8U 2BY7X 1C1WH 2GZ7A 3ZVDA 1EJNA 2P3FH 1UTMA 1AFEH 1EAWA 4NWLA 2CF9H 5LH8A 1PYTC 3D62A 1SMFE 2JKHA 2KR7A 4ISHH 1VCWA 1RJXB 2ALVA 2Z3DA 1TFXA 1U6QA 2ZC9H 1GI5A 2IPHA 3OAAD 4Y10E 4ABEA 1OP2A 3MU0A 4DJZB 2R2MB 3SU2A 1DSTA 1GMHG 3SV6A 3RLYH 2O8TA 3B8JA 3RXTA 1V2KT 4MVNA 1UVPA 1QHRB 2ZDAH 5E0JA 1C1QA 3T62A 2FOHA 2ZPSA 1CBWC 1UTJA 4FUHA 2A2QH 3ATLA 4X1NU 1O30A 3TH2H 2K1QA 1GJ5H 3KCGH 3P6ZB 3UPEA 2XXLA 1GI9B 4A1VA 1FN6A 1TNHA 1O2VA 2XBWA 2XBVA 3PMHB 4AFQA 1NBMD 4B75A 8GCHG 2VJ1A 4CHAC 4DVAU 1FJSA 2A7HA 2VH0A 2CK3D 1KDQA 3ZZDA 1E34B 1JMOH 3UIRA 2ZDLA 1HPGA 2M5TA 2PR3A 1WU1A 1JRSA 1HAVA 3LGVA 1LKBA 4DIIH 1WUNH 3A8BA 1T8NA 2OC0A 4ZCNA 2CXVA 4Y8ZA 7ESTE 2ZTXA 5C1YA 3TGIE 1YWUA 3TJNA 4FUFA 5DN6D 5EW2H 1QRZA 1Y3UA 4CRDA 2BM2A 4Z0KA 2G5VA 1MTVA 3R0FA 1LPKB 1WBGB 5DSFA 4B6EA 1O2OA 1AHTH 1GHZA 2A4QA 1W0KD 4AG2A 1SHHB 2RFKC 1ACBE 1GHAG 3G01A 4AZ2B 2HLCA 2BVRH 3UNRA 2HOBA 1PPGE 2OK5A 5EU8A 1C5WB 1ZSKA 1ZLRA 2B7DH 1CGHA 3PO1B 2RDEA 1AGJA 1DDJA 2NU1E 3DT0H 1GL0E 4MG3A 4A6LA 1BMNH 3UB0A 4AB9A 4X2XA 1VGCC 4B1TA 1DWEH 1GHWH 3KHVA 3RXRA 1O3FA 5K0HA 1D9IA 4MNYA 1P0SH 4Q7YA 1N6XA 4ASHA 1V2ST 3Q3XA 1HUTH 2P94A 2QY0B 1EAUA 2STBE 1GBDA 2ZWLH 2JH0D 3SNBA 1QURH 2HNTC 2B9LA 1PPFE 1A46H 1O2UA 1Z6EA 3A87A 5LPRA 3URCA 4DGJA 2WSSD 1SSXA 1COWD 1H9HE 1ZGVA 2BOHB 3RXCA 1GWAA 2F9VA 3F2GA 3VXFH 5DO4H 1JRTA 5FPYA 5B6LA 3U9AH 1W0ZU 3GS9A 3WWFA 3DA9B 3VB5A 1NRSH 4FUDA 3SJOA 3KEEA 3RXPA 1LQEA 1ANBA 4O3TA 2FI4E 1O2XA 1VJ9U 2Y81A 3PWBA 5C17A 4U01A 1YBWA 4X8UH 1RIWC 3SHCH 1FN8A 1TQ0B 2QF4A 4A1XA 2XBYA 2Y5HA 4X2VA 4RN6A 3STIA 4ABJA 1HGTH 1IAUA 1HAGE 1O3NA 3ODDA 2QV1A 4Y11E 1AB9B 1SKYE 5EXNA 1QJ7B 2A4GA 1DWBH 3R3GB 2C8YB 4GPGA 3M5NA 4CH8B 3TVJB 1ANDA 3BN9A 1SGFA 3P70B 4BTTB 3GCNA 4BNRA 1HV7A 3PRDA 3A7WA 2WPLS 4UFFH 3GY8A 2A5IA 3EGKH 3KQBA 3M35A 3NK8A 3TIUA 1H8ED 2GTBA 1O2GH 4B76A 3PWCA 2NU2E 1VCQA 1ZMNA 1KLJH 1BA8B 3U8TH 1INCA 1EB1H 5FPSA 1Z1JA 3KQ5A 3RXHA 1E1QD 3JZ2B 1W11U 1GJ8B 5DGJA 4YESB 4AX9H 1IQKA 1KYNA 3V0XA 1CU1A 1NFWA 5HGGA 1TABE 2ZCLP 2GT7A 1K21H 1TIOA 2J38A 4ABAA 1A7SA 3KL6A 4VGCB 3HGPA 1MTNB 1NPMA 4CRGA 4ZKOU 1W2KH 3M3TA 1HIAB 1C1RA 4MNXA 2VU8E 4AB8A 4I32A 2C8WB 5PTPA 1MZDA 1TMUH 2QA9E 1O2RA 1K1NA 1SL3A 2BD5A 4X1QU 2VIPA 2BD8A 4GVUA 2IJD1 3SZEA 2UWLA 1HAOH 3M36A 1QR3E 2WV5A 1J9CH 5EXLA 5C1XA 5EW1H 1QZ8A 5DKMA 2BLVA 1DX5M 1H1BA 3Q3YA 1SGNE 4TY7A 2FTLE 2TGPZ 1Y3XA 3Q3KA 4MPVA 1MU8B 1MAYA 1YGCH 1CGIE 4K3JA 5LPEA 1A3BH 4K8YA 4Y8XA 1H4WA 2LPRA 4ZXYH 3T26A 1YKTA 2ZKSA 3GCHC 3EE7A 1TX6A 3MMGA 1CBWB 2BB4A 4JZFH 3ZVAA 4NZLA 2BD7A 2H2ZA 5A0BA 1TX7A 4AGKA 1Q3XA 5JBBS 2D1JA 4K8BA 2ZQ1A 1FPCH 4X6NA 1IQFA 1ETTH 1JBUH 1SPJA 4TT3D 4CHAB 1Z8JB 2QIQA 3ZVFA 1Y5AT 2B5TB 4RT0A 1RTFB 4GCHF 1JIMA 1AIXH 3O8DA 3TJUA 4TYDA 3UQVA 5F8TA 7GCHG
chains in the Genus database with same CATH topology
1BZXE 3ATKA 1LHDH 3ZZ5A 2ASUB 1D4PB 5DP3A 3IG6B 3LH1A 3SJ9A 1BDAA 1Z8IB 2ZG0H 1YLDA 3BG4B 5T6GA 3GY7A 1T8LA 1IQHA 1C9PA 1ZRBA 1NM6A 1GHVH 2CN0H 2H9EH 2WUCA 2H6MA 3SO3A 2RG3A 3V13A 4DY7B 1TGTA 1C9TA 3E0PB 1AFQC 2Z94A 2ANWA 1WAYB 3SGAE 3UTUH 4U30A 4AFSA 3TGJE 5GIBA 2GVFA 1G3EA 1P2JA 4FU9A 5F6MA 2KAIA 3F9EA 4CBNA 2EEKA 3ZV8A 4X6PA 2WPJS 5EQQA 1O2PA 1MZAA 4HGCA 1ETSH 2F9OA 1LPZB 1K9OE 1BTZA 1O38A 1QCPA 4MPUA 1L4DA 1VGCB 1GI3A 3RMMH 1S84A 1FV9A 3TH3H 1H9LB 2Z9GA 2VIQA 3PLKA 3LGUA 2ZCHP 1C4V2 4B2AA 2ANMH 2HVXA 5JYIA 1ZTLA 7LPRA 2W3IA 3LT3A 1LHGH 5I46H 1EX3A 1EJMA 4OGXA 4JZIA 4Y0ZE 1KXAA 2CHAC 1BJVA 2FO9A 5CE1A 1E38B 1O2WA 1S6HA 1TGNA 1TYNA 5DP4A 5EQRA 3SI3H 2BY9X 1AO5A 3GDSA 3SV8A 1XXFA 1FONA 2UWOA 5FCKA 4YM9A 1HJAC 2ZFPH 3NWUA 4K69A 1MD8A 5EGMA 2A0QB 5T6DA 3LGWA 1O3DA 2ZU3A 4A5TS 1K1OA 4I33A 1F5KU 1FI8A 4OGYA 2F9BH 3ATMA 1C5OH 4ISLA 5ESBA 4K5ZA 3O8CA 2W7UA 1YPHE 1FY4A 1RIWB 2FP7B 4JMYA 4DG4A 1ELVA 1TNLA 3FVFB 3LGTA 1F0RA 1AUTC 1FDPA 3RDZA 1HXFH 5AVDA 3UNQA 2Z9KA 1V2VT 1DE7H 3MH7A 1B5GH 2D8WA 3LU9B 5GXPA 4I8LA 1C2DA 2STAE 3ATIA 2VH6A 1Q2WA 3MNCA 3UQOA 3SGBE 1A61H 1O2JA 2PV9B 2O8WA 2SGAA 4XOJA 2QCYA 2Z6BD 1TRNA 2C3SA 1CT0E 1OWIA 1RS0A 2C8XB 1CGJE 1KY9A 4A1TA 1A2CH 1AWFH 4O97A 1Z8RA 4NA8A 1V2MT 5A0CA 1QL7A 3ESTA 2FOCA 4NG9H 1A5HA 1L1GA 2JH5D 1G32B 1T4UH 2VVUA 3OTJE 2TBSA 1LHCH 2HNTF 2ALPA 1ZPCA 3NZIA 1XKBC 2IN2A 2GD4B 3AASA 3E1XB 3NCLA 1FZZA 1VITH 5F03A 5E0GA 1G37A 1O3BA 1NY22 2NU3E 4BAKB 5DP9A 4H4FA 4D9QA 4DIHH 1QJ1B 1YLCA 4KTUA 1NU9A 4NFEA 1FAKH 1LMWB 2AMQA 3SU6A 1DOJA 5IYTA 2BD2A 2EC9H 1GBLA 1YF4A 2BZAA 2BDGA 1AZZA 2UUYA 2Y82A 3F9FA 1YM0A 4WMFA 3PV4A 1LVYA 1C5RA 4MQAA 2ZHFH 1P2OA 1ZTJA 3W95A 1JXPA 1N8OC 4KKDA 2ZHDA 1A1RA 4FUCA 3RXFA 1F5LA 4XE4A 3GCHB 4FVBA 1O2LA 1NRNH 1SOTA 1X7AC 3QK1A 3SHAH 3ZVEA 1MD7A 2QN5T 1V2RT 1ZGIA 2WYJA 1HDTH 4AYYB 3LH3A 1C2JA 2BLWA 1MKXH 5A8YA 1SGIB 1XXDA 1QTFA 1C1TA 4M7GA 3SUDA 3SV9A 2VVCA 1Z6JH 2H5CA 1G36A 3U8OH 1MQ5A 2OQ5A 3RXVA 2XBXA 5SGAE 4YOIA 1O0DH 1SLXB 4ABBA 3TNTA 1XUFA 1L4ZA 1BRAA 3HKJB 1AFQB 1BBRK 2QC2A 3MH4A 3NXPA 1D6WA 1MTSA 1BTXA 4Y6DA 3T2NA 1AY6H 2OD3B 4H42U 2AIQA 3V7TA 2FYQA 3F1SB 3ZV9A 3UR9A 3T29A 1P9UA 3URDA 1KSNA 4NIXA 1QBVH 4GLYA 1NFUA 3K6YA 3H7TA 1DUAA 1AZ8A 1LKAA 2OBOA 1C2LA 1TBRH 1GI6A 2SGFE 4HTCH 4QT8C 5FAHA 5LGOA 1PQ7A 5DPAA 1A4WH 1ORFA 2FX6A 2AYWA 5C2ZA 2SGDE 1TGSZ 3RXKA 1UTKA 2J94A 2ZFRH 2QYIA 3RXQA 1MTUA 3EE0B 1TAWA 1V2JT 3SJKA 4K60A 2TGAA 1QQUA 1YP9A 5A09A 3GY5A 3AAVA 4O9VA 1CVWH 1DT2A 3A83A 4O03A 2PFEA 1HJAB 2QAAA 1AVXA 2ZFQH 4NZQA 4RKOB 1EPTA 1AUJA 3PROA 1BQYA 5JPMH 4ZKNU 2AMPA 1SGCA 4LZ1H 2VGCC 3LOXA 1O3EA 3SN8A 4XBBA 1W14U 3S7KB 1AKSA 1NU7B 3F9HA 4I7YH 1SOZA 1GBJA 1YPLH 2SGQE 2AEIH 2Z3CA 2YOLA 1OPHB 1T4VH 1EZXC 4WXIA 1PPBH 1OP0A 2F83A 1ANCA 4DW2U 3PMBB 1MKWK 2FODA 2PUQH 1L0ZA 2WPKS 5GPIB 1V2NT 1NT1A 4FVDA 3MHWU 5A8ZA 5AHGH 1G3CA 1Y8TA 3DFLA 1V2UT 1O37A 5B6OA 1TGBA 3VB6A 3MNXA 2P3TB 2C4FH 3A82A 3ODFA 1ELBA 1OYTH 4E7NA 1FUJA 2I6QA 2DUCA 1P2IA 3E16B 1FY1A 1S6FA 4YT6H 3SI4H 1IOEA 1C5LH 4WH6A 3S69A 2OC7A 1NESE 1THPB 1HYLA 1BUIA 1F2SE 4Q7ZA 1UVTH 2J4IA 2FLRH 4D76A 1QL8A 1SGTA 4NA9H 4SGAE 3GYMA 4ZAEA 4BANB 1C5PA 1C2GA 3ZVBA 1ELTA 6GCHG 1RD3B 3SU3A 3GOVB 2BVXH 3D23A 4JZDH 3RXGA 1LVMA 1EASA 1T32A 3K9XB 1OWDA 3ZVCA 1HAYB 4LXBH 5EOKA 5H4IB 4UONA 3QDZB 2A7JA 2ZHQH 3ITIA 2H5DA 4YTAA 3ZZ9A 5HYOA 1GDQA 4ZMAH 3OSYA 2PTNA 2V3HH 4JYUH 3S7HB 1XVMA 2R3UA 3TNSA 1GCDA 2GGVB 2CGAA 2XC0A 4H6SB 2C93B 1RRKA 2F3CE 3QTOH 1AE5A 1P3CA 1GI7B 2BXTH 2P95A 3LJOA 1BMLA 2SNVA 4B71A 1P8VC 1SVPA 3A7YA 1N8OB 1P04A 2FPZA 4FXGH 3RUOA 1IQLA 1L2EA 1GBTA 2ZDVH 2GZ9A 1FMGA 1UK3A 2P3UB 3SUFA 1HLTH 3BTTE 3MU1A 3QWCH 1Y3YA 2VIVA 1CT2E 1GBAA 1UCYK 2GV7A 1QJ6B 1MQ6A 3FZZA 3FANA 1DSUA 1DVAH 2A4OA 2Z3EA 2Z9IA 2GX4A 1C4Y2 1LTOA 1TE0A 4OS1A 3TU7H 2ZGJA 3FP7E 1AMHA 1NRPH 2VNTA 4IMZA 2BDHA 5JBTA 2FESH 3P8OA 3RXEA 5TCCA 1SQTA 1YYY1 1NRRH 2A4RA 2NU0E 5T3HA 2RA0A 1GG6C 3K2UA 2AMDA 1HJ8A 3U8RH 3LGIA 2HRVA 4XDEA 3MTYA 2FLBH 3ZZ8A 1PJPA 4ZHLU 3SBKA 2OTVA 1QA0A 2VIDA 1LVOA 3QLPH 3MU8A 2BXUH 7GCHF 1DICA 2ZP0H 2ZHEH 4WMEA 3RXIA 1P01A 1JWTA 1GBCA 4ZROA 5J4QA 2IJOB 4X0WU 1DY9A 2A1DB 1V2WT 2ZF0H 1H9IE 1AN1E 2R3YA 3S9BA 1AU8A 1ZOMA 5TJXA 2LNCA 3PLBA 2FOMB 1C1PA 2ZGXH 3EYDA 4X8SH 4X6MA 3UY9A 1GMCG 1GBMA 2GDDA 1Y59T 4INHA 4I8HA 1PYTD 5JBAS 3PTBA 2PKAA 1XVOA 1BTUA 1HCGA 1TA2A 1J15A 1WOFA 3VGCC 3SUGA 2XTTB 2BD3A 1YPEH 2VGCB 1CA0C 1G3DA 1TMTH 4GUXA 5CHAC 2FDAA 1O3OA 3GCTG 2FYRA 1UVOA 4WVPE 1P02A 5EG4A 1CT4E 1EZQA 1M9UA 1XUJA 4R8TB 1FXYA 2XYAA 1K28D 3GCOA 1LO6A 1GI4A 1ZHPA 3ENSB 2GP9B 4X1SU 1BITA 1MU6B 2JETC 1ELEE 5GCHG 1G9IE 1P06A 2F91A 2FI3E 2SFAA 9LPRA 1EXFA 4K1SA 4BAMB 2ULLA 1OYQA 3MU5A 4NIVA 3SNEA 2BMGB 2R0LA 1TPSA 4CRFA 1GVZA 1MH0A 3L33A 3ZZCA 3OU0A 1O2TA 3KGPA 3Q00A 2PKSC 3I29A 2FS8A 1TRMA 3PTNA 2OUAA 1ANEA 4INKA 1IQGA 1GBKA 1HFDA 1L1NA 1MMJN 1W10U 1NZQH 1S5SA 3FFGA 2Q6GA 1PQAA 2FEQH 5EPNA 3MNSA 1EZUC 1KDQB 3FAOA 2ZECA 3BIVH 1EKBB 3GDUA 1SLWB 1QFKH 3W94A 1HAVB 2ZTZA 2YNAA 4ZXXH 5K7RA 2PUXB 2V3OH 3KIDU 4O3UA 3BTGE 4MPWA 2ZDKA 4PROA 1A3EH 1NFXA 2CV3A 2ZFTA 3HPTB 2F9PA 1EP6A 4OS6A 3M7TA 2J92A 3TJOA 1DUEA 5G4BA 4CR5A 3TK6A 2XC4A 4X1RU 2W5EA 2O8UA 2BDYA 1J16A 3RMNH 4WWYA 1ZHMA 4DOQA 3SQEE 1OXGA 2G8TA 4A7IB 2PLXA 2A45B 2PSXA 4KTSA 3SW2B 1PPCE 1ZZZA 2Y6TA 1BRCE 1HJ9A 1QB6A 3EQ0H 1IHTH 5HMAA 3M7QA 1N6YA 2WPIS 1O5CB 2EI7A 2WPHS 2ZCKP 1FPHH 4E05H 1BIOA 3LONA 3LDXH 5C1UA 1J8AA 2BD4A 5DJ7A 4IC5A 4ZH8A 1OSSA 3M5MA 3T28A 1MTWA 1AWHB 1GVKB 1GHYH 4CRAA 1ZTKA 5C5NA 2XNIA 2BX4A 3A8CA 3QGJA 3SJ8A 1XX9A 1TOMH 3KNXA 1UHBA 2D26C 3PMJA 5A0AE 1G2MA 2THFB 3UWJH 4AOQA 5JB8S 1O3JA 3TGKE 2UUFB 5AFZH 3CENA 1UMAH 2GMTC 4NGAH 5GDSH 1GJ6A 1HNEE 1MBMA 2BTCE 3E91A 1OX1A 2RA3A 3LIWA 1SHYA 4ZHAA 3PYHA 4ISOA 3FP6E 1O3MA 1O5EH 2P8OC 1RTKA 2ZI2H 1VZQH 2P16A 3BF6H 3SV2H 1E37B 3QUMP 1C5ZB 3UR6A 1FAXA 3A89A 4ISIH 1BHXB 1RFNA 2GCTC 3IITA 1K22H 1RTLA 1EOLA 1SLUB 2EA3A 1GBFA 1PFXC 4ESTE 3M37A 1TQ7B 4BXSA 1BRUP 1GCTC 1P2KA 3RXUA 1C5XB 1EAXA 3GY6A 5I25A 1PPEE 2PTCE 3MO9A 4B2CA 1EUFA 2O9QA 3D49H 4X8TH 1O3LA 3A81A 3RU4D 5EPYA 1ELGA 1K1IA 1TB6H 5EXMA 4XBCA 3A85A 4KP0A 1QQ4A 1BMMH 4XBDA 1OS8A 5HXFA 1S0RA 3H5CB 1DY8A 1F0UA 2NWNA 1C2HA 5AF9H 2ZGBH 1Z7KA 3S9AA 1NO9H 3QZQA 3RC4A 1ABIH 3VGCB 2FWWA 1O3AA 2PSYA 1GJAB 4IN2A 1DITH 1O5DH 1CA0B 2UUJB 2EI8A 2Y7XA 3BTFE 6CHAC 5CHAB 2P59A 1SGYE 2BVSH 1O2HA 2FS9A 2XCFA 3M61U 1EOJA 4IS5A 1P11E 3C1KA 2RDLA 4Y8YA 1O5GH 4ABDA 1FLEE 4ABGA 5EQSA 1TLDA 2JETB 4MNWA 3BIUH 1WYKA 4RKJB 4TPYA 3GY2A 2BY5X 1LDTT 1ZJDA 2YNBA 3KQEA 1P03A 3NPSA 5HM2A 4TPIZ 1K1PA 2GDEH 3HKIB 4I8JA 1TOCB 3Q77A 1NTPA 1CO7E 2ZEBA 1BHXF 1T8MA 2ZDNA 3MNBA 5C3NA 3L6PA 4FU8A 4LOYH 1TWXB 2Z9LA 4IW4E 1C2FA 2D2DA 5FPTA 2PKSB 1TPOA 2R0KA 5JB9S 4TY6A 2BDIA 2FX4A 1GJDB 1AE8H 3S9CA 3UFAA 1PQ5A 3ZYDA 1AVWA 2F9UA 1K1LA 5ESTE 4AYVB 4ABFA 1ARBA 3HK6B 4MTBA 1V2LT 3RMOH 2TIOA 4JK5A 1KXCA 5FBEA 4Q7XA 1FNIA 4KGAA 2CMYA 1BTPA 1TGCA 4J2YB 2G81E 5DG6A 2GCHG 3ZZ7A 4KELA 1IQIA 1O32A 3A8AA 1J17T 4NSYA 3BTWE 5JBCS 3VPKA 4UEHH 1P12E 1ZMJA 4U2WA 4FU7A 3VFEA 1EZSC 1ZPBA 5LPFA 1GBHA 1TPAE 3RU4E 1WTGH 1Y5BT 3O8BA 3M5LA 1W12U 2A5AA 4ZKRU 1C5NH 3SU0A 2Y7ZA 3LPRA 1LQDB 4JCNA 4RSPA 2KAIB 1GDUA 3A7ZA 3Q76A 3U1IB 1RXPA 4MNVA 2BQ6B 6GCHF 1P2QA 4INLA 3HGNA 4B2BA 1BTYA 4UFEH 1BJUA 4E7RG 3A88A 1EJAA 1NN6A 1NC6A 4D7FA 4HFPB 2G4UA 3NKKA 1AB9C 2OXSA 3SU1A 2G55A 1P2NA 2ZTYA 1GBEA 5A8XA 2OINA 3RLWH 1HAXB 3STJA 1UTNA 2G52A 1KTSB 1K1JA 2CHAB 3FP8E 2W3KA 2R2WU 1BTHH 2AERH 1C1SA 4Y7AA 2WYGA 4B73A 3M3SA 2G00A 3SZNA 1HBTH 2AIPA 1IQJA 3DUXH 1BBRE 1S83A 1ABJH 4XSKU 2BYAX 1OWEA 1YPMH 2ZQ2A 1C1UH 2XWAA 1EPTC 5GWZA 1O33A 2FI5E 1O34A 2BX3A 1SGFG 1GL1A 1UVSH 3A84A 1GJBB 1HIAA 1ETRH 1ELFA 4WY3A 1DXWA 2CJIA 4F4OC 2ODQA 1GDNA 2BDBA 4IGDA 1MTNC 3VB4A 2GMTB 1LHEH 1B0EA 2ZPQA 1TX8A 1DWCH 1EATA 3RXSA 1C5YB 1C2MA 5C20A 4HI3A 4WH8A 4FUBA 4FUIA 2JH6D 4KTCA 3T5FH 3U69H 2P8OB 1XUIA 1G2LA 2QGRA 1D6RA <