4FUJA

Crystal structure of the urokinase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 63
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fujA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fujA01
1XMNB 2STBE 3T28A 1J16A 2J92A 1N8OC 3M7TA 3T26A 1TA2A 4DIHH 3U1JB 1AB9B 1MCTA 2F9UA 3SNDA 1D6RA 1HV7A 1P9SA 3D65E 1FY5A 1Z71A 5FX6A 4AFUA 1GDNA 3LC3A 1C5MD 3A8CA 1OWDA 1MTNB 1KDQB 4CREA 1V2QT 2IPHA 3S7KB 4FVBA 1RJXB 1QTFA 4WY3A 1HPGA 3W94A 1NT1A 4X1NU 1TIOA 3M3SA 1ZZZA 4OS5A 1UTMA 4TWWA 2FOMB 3M5LA 6LPRA 1QA7A 3MH4A 3SGBE 4GHTA 2J4IA 1EPTC 3MHWU 3ATMA 9ESTA 1W12U 1ZTKA 2VIWA 3TLOA 3VPKA 5JPMH 2Z3CA 2EI8A 3RXFA 2SGDE 1YF4A 1EKBB 4K2YA 1CGJE 2ZI2H 5LH8A 3VB6A 2HNTE 1ZSLA 1TNJA 1V2NT 2ZP0H 3RXHA 3A86A 5E8EH 2JH0D 1O3PB 3U8TH 3A7WA 1XUKA 1FZZA 3K6ZA 2ZTYA 1K9OE 3LIWA 4ZAEA 4DT7B 1BRAA 1O5FH 1DLKB 1HYLA 1BRCE 1AD8H 3SI3H 1SOTA 4HI3A 3A80A 3ZYEA 1NU7B 2FZZA 1QL8A 1QA0A 4FUHA 4IC5A 4WXIA 3TGIE 1WU1A 4ZMAH 2CF8H 1BA8B 3SZNA 2G4UA 3NPSA 4X1PU 1GGDB 2VGCB 1DUEA 5JBBS 4Y8ZA 2HWLB 4FUBA 3MU4A 1A1RA 1TMTH 1C2FA 3QGJA 1GJDB 2O8MA 2EEKA 2SGFE 2G4TA 3M35A 8ESTE 1B5GH 3PROA 3AVZA 2GX4A 1QB9A 1W7XH 3MWIU 3ZZCA 2UUJB 3ELAH 2O8LA 1YCPM 3UOPA 3LGYA 3F9EA 1LVYA 1TGTA 5ESBA 3SV9A 1GL0E 2QYIA 3ZZ5A 2F9NA 4U2WA 2UWOA 1O3GA 3UY9A 3LJOA 3LC5A 4ISLA 4TPIZ 1NM6A 1O0DH 2HALA 1ZHMA 5A2MH 2SNWA 3A83A 1CVWH 1O35A 3RXRA 1A61H 1K2I1 2B5TB 1DSUA 5FXLA 1BTYA 1UTPA 1O2TA 1A46H 1MKXK 1YBWA 1ZLRA 5GWZA 1BJUA 1HAIH 1WCZA 4AOQA 1GVKB 2CHAB 1A3BH 1MTWA 1A0LA 3ODDA 1O3CA 3AW1A 4E06H 5EXNA 2HNTC 1GBAA 1BZXE 2O9QA 1GMDF 1RGQA 2G8TA 3A88A 1O2LA 5C1YA 2RA3A 1ZMNA 2AMQA 3HGPA 3SU6A 3GDSA 4BXWA 1UTNA 3GDVA 4I7YH 3AAVA 1T4UH 1XUHA 3KEEA 3A82A 3K9XB 1VITF 2SGEE 1AFQB 1V2ST 1V3XA 1MUEB 3SNBA 2OINA 1LVMA 1C5LH 3L33A 4I33A 1H9LB 3STIA 5C1XA 1GHYH 2BY6X 2Z9IA 4NZQA 1WSSH 1C5WB 1YPHC 2D2DA 1P2IA 1OP8A 1UK4A 5DP3A 1G37A 4BOHA 2A7HA 3UTUH 4FUGA 2ZZUH 1GG6C 5HM9A 5K0HA 5EODA 1DWEH 3BG8A 3P95A 1HAVA 4JZFH 4Y10E 1O2XA 4DGJA 4Y11E 2P16A 1W10U 2GP9B 6CHAB 3ATKA 4KTSA 3TIUA 1P2MA 1T7CA 5DP5A 2UUYA 1DPOA 3UUZA 4DOQA 4CHAC 2PV9B 2BX3A 1NU9A 2CV3A 5GCHF 4A7IB 1DANH 3KN2A 2QF0A 5C20A 2A2QH 2WUBA 3F9FA 1PPBH 2WYGA 2G00A 1IQIA 2P3TB 3ATLA 1G36A 1BT7A 3SJ8A 1JMOH 4ISHH 2BQ7B 4OS2A 4UDWH 3ITIA 4K1SA 1WUNH 3TITA 3MI4A 2FS8A 2G51A 1TYNA 1TBQH 1YPHE 1FIZA 1Q3XA 4I31A 3SV6A 2VIQA 4CR5A 1A5GH 1CA0C 2R2MB 1E35B 2OLGA 4K69A 2ZECA 2G81E 1C4Y2 1S5SA 1EATA 3CS0A 1OP0A 1NRQH 1UVOA 4XBCA 1BMAA 1S83A 1VGCB 2WPJS 1YCPK 1P06A 2Y82A 1WBGB 3GCNA 3NKKA 2ZKSA 2PSXA 1UK3A 2Z9GA 4AZ2B 2C3SA 4BTUB 1TFXA 2FP7B 4BANB 1PQ7A 2H5DA 4R8TB 1MMJN 1TPAE 4ABGA 4O03A 1AWHB 1ELDE 1TLDA 4J2YB 4NIXA 1V2VT 1NY22 1NESE 1PJPA 1MBMA 1S81A 3OSYA 1KIGH 3S7HB 4ISNA 2XC4A 2GD4B 1O39A 4X8TH 2ZDLA 1BTZA 3ESTA 4Y79A 1HDTH 5I46H 2IN2A 1SR5C 5I25A 2BHGA 2TBSA 1P3EA 3GYLB 3A7ZA 2Z94A 1TX7A 1WTGH 1GMDG 5C1UA 2QXHA 2FI3E 1Z1IA 3ZZAA 1UMAH 2XYAA 3RC4A 3V12A 3DD2H 1AY6H 1C5OH 1FXYA 2Z3DA 3DT0H 1FN8A 2XC5A 4ESTE 1SI5H 1WV7H 1UTLM 1GI5A 2F83A 3BTME 4E7NA 4BNRA 2B0FA 2J2UA 2GZ8A 2DE8A 1GVZA 1Z1JA 2VIDA 4Y6DA 5EG4A 1F92A 1H4WA 1TNKA 3ZV8A 4K8YA 1UO6A 1CT2E 2QV1A 3ZVFA 4X2YA 3A85A 1AQ7A 1OWIA 1MD7A 1AE5A 1C1SA 2V0BA 3P70B 3M37A 3HKIB 2ZCHP 5DP6A 3Q3KA 2KAIA 1SHYA 1K22H 5C5NA 2GKVE 2HRVA 3F6UH 2BD8A 2RG3A 4JZ1A 1O3KA 2AIPA 3RP2A 3PO1C 1RD3B 2ZHQH 1O3IA 2PGQB 4BAMB 3VB4A 3FAOA 3SGAE 3VXFH 1F0TA 1O2NA 3O8RA 2R9PA 1GMCF 2XWBI 3PMJA 1W14U 4TY7A 2BOHB 3R0FA 4K5ZA 4NA8A 1TAWA 4MPXA 1GI9B 1NRRH 1SSXA 4ABIA 2W7UA 1YPGH 3SU3A 1ELVA 2RDLA 1T4VH 1FUJA 2F9BH 2Z6BD 1O31A 5E2PA 1V2MT 4H42U 1AN1E 3GY6A 3SQEE 1JOUB 5L6NH 1ZSKA 1JBUH 2Y5HA 4ISOA 1QGFA 2XTTB 1BBRH 3ZVBA 1WAYB 1Q31A 1VJ9U 2BTCE 4IMZA 4O97A 1V6DA 2G52A 5ETXA 1Z6JH 3NWUA 2XBVA 5C67A 1GJ7B 3BSQA 3RXMA 1O5CB 4GSOA 1TBRH 2Z7FE 1KLIH 7ESTE 2FLRH 1VGCC 3RXSA 3BTFE 4HTCH 1IQKA 1BRBE 2FTLE 1S0RA 1C1UH 2H9EH 2DE9A 2GZ9A 1UVUH 1UVPA 4ZKRU 1D3PB 1P12E 3KL6A 4PROA 2PR3A 4HGCA 2UUFB 3K2UA 1P2JA 4Y0YE 5HYOA 2C93B 2FIRH 1ANBA 3B8JA 3S9AA 1DITH 2OBOA 3RXGA 4WVPE 1PQ8A 2R0KA 3A8AA 2SGQE 1J9CH 3KNXA 3SU1A 1C9PA 3DUXH 1YPEH 4UFDH 4X2XA 6ESTA 3A84A 2ZHFH 4Q2KA 1PPFE 4JZDH 4YM9A 1S0QA 1AZZA 3SJIA 1TRYA 1EQ9A 1GHVH 5DJ7A 2BDYA 5EGMA 2ALVA 4NWKA 5FAHA 5E0JA 1SQOA 1GBBA 4NA7A 3A8DA 5T6FA 2OC0A 1EOJA 1O37A 3RXEA 2BD7A 1XXFA 3GCHC 1G3DA 3ZZ7A 1GI7B 2TGDA 1FV9A 4DURA 3SJ9A 1GCTC 4Y7AA 3TH2H 4AGJA 1ARCA 4ZUHA 1UCYE 3BN9A 1AB9C 1W2KH 1E36B 1QQ4A 2FODA 1BBRE 2PKSC 4CRFA 4I8KA 1C2MA 2Q6DA 4XE4A 1EX3A 1KY9A 1T32A 1EZQA 3KF2A 1AGJA 1Z7KA 1CA8B 4Y71A 4CR9A 4TY6A 1IQGA 5PTPA 1DS2E 2W26A 3HGNA 4RKOB 5L2ZH 1DVAH 1YGCH 5J4QA 2R2WU 4MNWA 2C4FH 1QL7A 1ZRKA 1GMHG 3VEQB 1DWCH 3PM3A 3RXLA 1PQAA 4OGYA 3BEFB 2GDEH 1Z8JB 1KTTB 2ANMH 1FI8A 1V2PT 1SB1H 5EOKA 1OSSA 3VXEH 3NXPA 1D3DB 2AFQB 1UTJA 2F9VA 4FUDA 2LPRA 4X6PA 1GCDA 4A1VA 5C3NA 1ZGIA 1AVWA 2AGGX 4MVNA 2ALPA 3U8RH 1JRTA 3MH6A 1DWDH 1Y3UA 2V3OH 1C1RA 2XBYA 2ODPA 2ULLA 4CBNA 1EP5A 1RTFB 1IOEA 1K1MA 2B7DH 2GV6A 2C8ZB 2TGTA 1SLVB 2FXRA 1ESBA 2C8XB 4Y8YA 5L30H 5DP9A 2OD3B 2BY5X 2BD9A 1OX1A 4MTBA 2I6QA 1CGHA 1QCPA 3F1SB 1GI6A 1L1GA 1TPOA 1YLDA 4WXVA 2NU4E 5EPNA 3FZDA 8LPRA 2TPIZ 3EA9A 3SNAA 3OYPA 1JXPA 2TRMA 2YOLA 1O2VA 2ZFFH 1MTVA 1TWXB 3FFGA 4H6SB 3ZVEA 1HCGA 1QY6A 4UE7H 5E0GA 1MKXH 1P8VC 3RXVA 4DCDA 1LO6A 5TCAA 1PPHE 5GCHG 3RUOA 4TWYA 1DWBH 4WMEA 1P9UA 2GMTC 3T25A 3GISB 3RDZA 1K1LA 2D26C 7GCHG 1RTKA 2ZHDA 1SL3A 3AAUA 1Y5UT 2WPIS 3Q00A 4ZXYH 1GBTA 3BEIB 4WF8A 1MAXA 3LU9B 1G30B 4B2AA 2XW9A 4NGAH 2ZTXA 3T2NA 3A8BA 3B9FH 1O5BB 2VVVA 4XBDA 1J17T 3E90B 5ESTE 1TNIA 4FUFA 2FESH 5AF9H 1G2LA 3S9CA 2OUAA 4KKDA 2FYRA 2BYAX 2A4QA 1LQDB 1HFDA 1P2OA 1KXBA 1BB0B 1OP2A 3MU8A 1C5UA 6GCHG 2A45B 1ETSH 2F9OA 5IDKA 1GJCB 5LPRA 3GY7A 1LPKB 1ETRH 1L0ZA 4X1RU 4A1XA 4NA9H 2QIQA 3A7VA 1OWKA 1SQAA 2AS9A 4XDEA 1C1VH 1EZUC 4K3JA 1YCPH 2BD4A 1BTPA 1Z8RA 1O2RA 1HIAB 4VGCB 1PPEE 2OBQA 4ZHLU 5SGAE 1ABIH 3MMGA 3SNCA 1ZMJA 1P2NA 2Z3EA 3QDZB 3RXKA 2VJ1A 2ASUB 1A5IA 1GBMA 2V35A 5DP4A 2ZU5A 2GGVB 2J9NA 1H8IH 4UFGH 1ZTJA 2WPHS 2VWOA 3IWMA 1VR1H 3P8NA 1TPPA 4CBOA 1T31A 3GICB 2GT8A 1AE8H 4ZKOU 4O9VA 5EW1H 2BD3A 3FZZA 2O8UA 5FCRA 2ESTE 2ZFSA 1MKWK 1J14A 1SGFG 2VNTA 4B1TA 1FQ3A 3RU4E 3A7XA 1OYQA 2WPKS 1A0HB 4F49A 3STJA 5EXMA 1VITH 1EJNA 1YPLH 1RRKA 1GJ4H 4I8HA 1MQ6A 4AFQA 3LONA 1W0YH 2AERH 2BDIA 2OC1A 1C1NA 1E37B 2A2XH 2PKSB 3SU0A 1TA6A 1MD8A 1RIWC 3LGIA 4CHAB 1EPTA 4DIIH 2WINI 1D6WA 2TIOA 4SGBE 1OS8A 1QBNA 1OYTH 1L4DA 1DY8A 5L2YH 1XUFA 2O8WA 1GGDC 3E91A 2PHBA 1LVBA 4YOIA 2P93A 1XX9A 1C1QA 1AFQC 5AVDA 4X1QU 2ZFTA 4AGKA 1NZQH 1N6XA 2PUXB 4ZHMU 3TK6A 5EQQA 2WV5A 5JDUB 1ZGVA 4ISIH 3ZZ3A 2UWPA 4THNH 2QC2A 1G3EA 4X0WU 4Z0KA 1N8OB 1GBHA 3NZIA 1EAWA 1RXPA 1XKBC 2P3FH 1HXFH 4U32A 1NROH 2SGPE 1PYTD 2BY7X 4ABAA 1TALA 1PPZA 2QXGA 1WTHD 4Y7BA 3URCA 1TE0A 2BZAA 1GI4A 3F9HA 2ZDKA 1QIXB 1ZR0A 3A7YA 3RM2H 5EW2H 2P8OC 3PLBA 3RLYH 1LHDH 3BTKE 5IYTA 1RFNA 1CT4E 1O2PA 3A89A 4H6TA 1GJ9B 2QY0B 2V3HH 3EGKH 2H1UA 2F91A 4JZIA 1TOMH 1QR3E 1KXFA 1MTUA 1GHBF 5FPYA 1A2CH 1WQVH 4FUEA 3FP6E 4JYVH 1NRNH 4WH8A 1QURH 1P02A 4DG4A 1TGSZ 2BXUH 1Y5BT 2BY8X 3SQHE 5GPIB 1LDTT 1LPZB 1SQTA 2VIOA 1UTQA 9LPRA 2ZGCA 1OWHA 4BAQB 1BHXB 1W7GH 4IGDA 1KXAA 3FP8E 1BJVA 2XNIA 4NCYA 1NN6A 4AB9A 1TQ0B 1O34A 4LK4A 1T8NA 4AYYB 3ATWA 2ZO3H 3RLWH 5EU8A 3ZYDA 4B2BA 2P59A 1O2OA 1IQLA 1NC6A 3CENA 3GY5A 4IW4E 1QL9A 3SNEA 1AUTC 1A4WH 2FLBH 3TNSA 1RIWB 5GXPA 2NU2E 1GHBG 1QRWA 1EUFA 1GBJA 1TX6A 1BITA 4OS6A 3GY2A 3Q77A 1E34B 1C4U2 5AHGH 3GYMA 4DJZB 4FUIA 4TPYA 1Y8TA 4Y0ZE 2GDDA 3P8FA 3PWBA 3E1XB 3RMNH 5A8XA 3JZ2B 1FY4A 2AGIX 2Z9LA 3HPTB 2D8WA 4IS5A 3GY4A 2H6MA 4GAWA 5F03A 3QTVH 1O2WA 1UVSH 3WY8A 4CRAA 2P3UB 2A4RA 2ZNKH 2ZFPH 2ZA5A 3LDXH 1IHTH 1KYNA 3V13A 3Q76A 4GVUA 1H9HE 2Y5FA 3UPEA 1SVPA 2GCHF 2H5CA 3KGPA 2OQUA 2ANKH 3PTBA 1T8MA 2OTVA 2BLWA 1CHGA 2VIPA 1BBRK 4YT7H 3SORA 3ZVAA 1A7SA 1L1JA 1EB2A 1XUIA 2KAIB 4X8VH 4M7GA 1Y59T 2A4GA 2CJIA 4UONA 1J15A 1F2SE 1D3QB 3UNSA 1GDUA 4JMYA 4NWLA 2BB4A 2FYQA 1SGRE 3SUFA 1DX5M 2GVFA 4WWYA 1V2WT 4I32A 3NK8A 2P94A 3R3GB 2AEIH 1HXEH 4AORA 5A0BA 2WPMS 1C1OA 1OOKB 3UWJH 6GCHF 2P95A 1DUAA 1M9UA 1Y5AT 2J34A 3OU0A 1KXCA 3VFEA 3A87A 1ACBE 2CMYA 3SOSA 1HAOH 2PKAB 2A7JA 1C2LA 1EASA 1TPSA 3P17H 4SGAE 1F5LA 1GHZA 2FO9A 1ZTLA 1K21H 5FBIA 1GI8B 1SPJA 7GCHF 4CRBA 2AIQA 1MAYA 4LZ1H 3RXCA 4OS4A 1KLJH 1O5DH 2ZHEH 3SU4A 3GCTF 2FX4A 1O5AB 5G4BA 5JBCS 4X8SH 2GCTB 1FPCH 1L2EA 3D49H 1S85A 1LPGB 1EAXA 2CXVA 2ZEBA 1BMMH 4BXSA 3MH7A 2VB0A 4ABEA 3SV8A 3RMMH 1QBOA 1EJAA 1TGBA 1XUJA 2OQ5A 3OX7U 1IQNA 1O3DA 1QQUA 5E0HA 3E3TA 3TU7H 1O2HA 4D76A 2ZWLH 1SLWB 2ZCLP 5TCCA 1TNHA 4ZXXH 2STAE 1O2UA 1ANCA 1G32B 1GHAG 7KMEH 3TGJE 2R3UA 4YO9A 1V2RT 3VGCB 2W5EA 2Z9KA 2LNCA 4Y8XA 2ANWA 4ZROA 1MTNC 3PTNA 5EQSA 3TGKE 4F4OC 4BAKB 3QTOH 1YPMH 1O3MA 3CP7A 1SFIA 5DK1A 1EZXC 1LVOA 1C2HA 3P92A 1W0ZU 3LKWA 2WV4A 3D62A 2O8TA 1LKAA 1VCPA 1THSH 4AG2A 2FEQH 4YOGA 3RU4D 4IBLH 3SUDA 3ZZBA 4RSPA 5AFYH 2HGTH 3P8OA 2TGAA 1LQEA 1O3LA 1GMHF 2OXSA 3BV9B 4YLQH 3ZZDA 1V2TT 2ZU1A 3RM0H 1NRPH 3EQ0H 2FOFA 1P05A 3TPIZ 3SUEA 1T8OA 1OWJA 3RXUA 2QN5T 3TJOA 3FP7E 1GHXH 3SBKA 4XBBA 2G5VA 2FDAA 5C5OA 1LHCH 2YNAA 3BTHE 3H5CB 3HKJB 1DLEA 2CN0H 3PV4A 3Q3YA 3BTGE 1C5TA 1D9IA 2XWAA 1YPKH 5F6MA 5CHAC 3QLPH 1C9TA 1SBWA 3JZ1B 1P10A 3BTDE 1DDJA 1P11E 4AG1A 3LPRA 2SFAA 3RXDA 3LT3A 3QZQA 1CBWB 5A0CA 4O3TA 2ZG0H 2ZPRA 2FOGA 2G55A 1ELEE 3VB3A 4B71A 4GLYA 2K1QA 2ZU3A 4AFZA 1IQMA 1EAUA 5LGOA 3S9BA 2A0QB 5EPYA 1DOJA 1F5KU 4YTAA 2RA0A 3BTWE 1GHWH 2FTMA 1C1TA 1GBEA 1LCYA 2BQ6B 4J1YA 1CT0E 3UIRA 1EOLA 1O2YA 4FUCA 4YLUA 1C4V2 1Z8IB 1P01A 3M36A 3PO1B 3QO6A 3U9AH 1P0SH 3K6YA 1NFUA 3KCGH 2ZDVH 3MTYA 2FOCA 2XBXA 4NZLA 1QRZA 2H2ZA 1C2KA 3MO3A 2ZDAH 3QN7A 5DPAA 4XSKU 2AMPA 3M61U 1C5NH 5GJ4B 1UCYH 2A32A 2QAAA 1EJMA 3TK9A 1AVGH 4HZHA 1TRMA 2BQWB 5JB8S 3RU4T 3H7OA 3C1KA 1EP6A 1UK2A 2A4OA 4XOJA 4WMFA 4MQAA 8KME2 3E6PH 4IC6A 3S69A 4UEHH 2QA9E 1GI1A 2QCYA 2GMTB 3AASA 1KXEA 3LGWA 1PQ5A 1GJAB 3E0NB 2PTNA 2ZGBH 1YM0A 4MG3A 2XC0A 4O3UA 3MNSA 1AMHA 3G01A 1C2JA 2PTCE 3T62A 5HM2A 1F0UA 3SU2A 1NTPA 1PPCE 2C8YB 4I8LA 2JH6D 5LPEA 1FY3A 1GJ8B 2GV7A 1SGNE 2BVXH 3KQBA 3FVFB 1GG6B 8GCHG 5J4SA 1ZPBA 4X6MA 4Q7XA 3RXQA 2FX6A 5T6GA 3V7TA 1BMLA 1W13U 1AZ8A 2B9LA 1HAHH 1C5VA 1QJ7B 2QXIA 3M5MA 2A31A 5JYIA 3ZVDA 3HK3B 3VB7A 4K1EA 1VITG 5ABWA 1TABE 1LTOA 5CHAB 3OTJE 1T8LA 1Y3VA 4DVAU 3DFLA 3V3MA 1DSTA 4AN7A 2NWNA 4OGXA 2UWLA 3EYDA 2BLOA 1ELTA 2BDBA 3EA8A 1AHTH 4NIYA 1GBCA 1P3CA 1SGQE 3EDXB 1CO7E 4JYUH 1L4ZA 3QWCH 4AYVB 1LHFH 4I8GA 1TX8A 1GCTB 1YP9A 3U1IB 1QRXA 3DHKH 2GT7A 1YKTA 3BTEE 4RKJB 5EQRA 1K1OA 2UUKB 2GCTC 3RXOA 4UD9H 3CS7A 2FI4E 3QGNB 4FXGH 3TNTA 1P09A 2XCNA 1O32A 3C27B 4NFEA 1VJAU 2SGAA 3MU5A 2ANYA 5GDSH 2P8OB 1Q2WA 2BMGB 3LGVA 1KTSB 3BF6H 2ZF0H 2GTBA 4X8UH 4A5TS 1THPB 4CRDA 3MFJA 2XRCA 2FOEA 3KHVA 1TBZH 3K65B 2A5IA 1KLTA 2JETB 3UR9A 3ZVGA 4ZKSU 2VH0A 4WH6A 4ABFA 1TOCB 3PWCA 2Y81A 2JKHA 1P2QA 3I29A 1DICA 1O30A 2GZ7A 1S6FA 1HIAA 2ZHWH 3ZZ8A 3UWIA 1ANEA 2A7CA 5A8YA 6CHAC 1FNIA 1AUJA 2PSYA 2XXLA 4B2CA 1QHRB 2PFEA 1D3TB 1O38A 2ZQ2A 4NSVA 3M5OA 2WPLS 1AVXA 4GHQA 4YESB 3RXJA 1HLTH 1C1MA 4BAOB 1C2EA 4ZHAA 1S6HA 1RS0A 1O5GH 3Q3XA 3GDUA 3IG6B 2HPQH 2ZC9H 3P8GA 1ZYOA 1OPHB 3QUMP 3LGUA 1NFXA 3BIUH 1HJ9A 1BQYA 1O3JA 2BDAA 1GBFA 4Q80A 1S82A 5F8XA 3GY3A 1VZQH 3D23A 3TK5A 4BTIB 3SU5A 4D7FA 5DP8A 2AMDA 1SGIB 2HVXA 3MYWA 3GCOA 2PW8H 1O3OA 3LOXA 3MH5A 3ZZ9A 3ZV9A 3M3VA 3H7TA 1GBDA 3SO3A 1MZDA 3O8CA 1CHOF 4OS1A 2OCVB 2BZ6H 3M7UA 1NFYA 2NU3E 1FAXA 3KQEA 4UFEH 4FUJA 1THRH 5CE1A 4DW2U 1C5YB 2DUCA 3PMBB 1K1PA 1QJ1B 1XVMA 1Y3YA 1ZSJA 2EA3A 1ZPCA 5FBEA 2QF3A 3MO9A 1BHXF 3W95A 1QBVH 4NIVA 1OKXA 1BIOA 1CHOG 1BMNH 1X7AC 3SGQE 1H1BA 4WMDA 1C5SA 5T3HA 1FONA 1Z8GA 1F7ZA 1GDQA 2WUCA 3ATIA 4YT6H 3RMLH 1FLEE 1Y3XA 3RXBA 3T29A 2BXTH 4Z6AH 1KSNA 2EI6A 2ZU2A 2FOBA 3URDA 2J94A 3B23B 5HXFA 1TMUH 4CH2B 5TJXA 7LPRA 5HMAA 3TJNA 4Q7YA 1O2QA 5JB9S 5DG6A 3EAJA 1MU6B 2OC8A 3ENSB 4Q7ZA 1MH0A 1INCA 3U69H 3HATH 1K1JA 2R0LA 1SC8U 1ELCA 2Y6TA 3HK6B 1QFKH 4MNXA 4NSYA 1MZAA 4Y76A 4RN6A 1UHBA 1WQSA 1FN6A 4MPVA 2Q6GA 1HNEE 1LHEH 1ELBA 3PYHA 1EXFA 1BUIA 1G3BA 2PUQH 1RTLA 5HGGA 1SGFA 4JCNA 1JIMA 1IQHA 1GI2A 4MNVA 3O8DA 4QT8C 1TNGA 5DGJA 4LOYH 3RMOH 1Z6EA 1E0FD 1IQFA 3BG4B 1N1LA 1KDQA 1O33A 2VIVA 1C1WH 2ZFRH 3RC5A 1H9IE 1ABJH 2FI5E 1GI3A 2AH4X 1J8AA 2AGEX 1W8BH 1W11U 2BDHA 2F9PA 3L3TA 4AB8A 1ELGA 2M5TA 1ELFA 1ZPZA 1DT2A 1ID5H 2WYJA 4WJG2 1BRUP 3BTQE 4K1TA 1VCWA 4XFQA 4U30A 3LH3A 3KIDU 3PMAB 4YZUA 2FPZA 1FY1A 2VINA 1BDAA 4FU8A 2QGRA 1C2DA 1GJ6A 2ZDMA 3I78A 4AX9H 4X6NA 2OC7A 5CMXH 1G9IE 1K1IA 3MU0A 2H9TH 2FMJA 4FU7A 4K8BA 1IQJA 1GI0A 2ZGJA 4ZH8A 4A1TA 1OXGA 4GUXA 4X2WA 3UNQA 2GCHG 4I8JA 1XXDA 1BTUA 3PLPA 4HFPB 5FHTA 1F0RA 1JWTA 1EAIA 1F0SA 1TGNA 3LGTA 4JK5A 1P04A 1F5RA 2Q6FA 2BM2A 3U8OH 5JBAS 1HAGE 1O2MA 5A8ZA 2VU8E 4A6LA 1AU8A 1GWAA 4X1SU 1HJ8A 2CGAA 2YNBA 1GBLA 4VGCC 1ETTH 1SLUB 1MQ5A 2XBWA 3ZVCA 1ZHRA 5DP7A 4LXBH 3A81A 2PLXA 1E38B 4BAHB 3RXAA 3ZZ6A 5FCKA 1MBQA 2FOHA 2ZGXH 2ZU4A 5F8TA 1H8DH 1QB1A 1EB1H 3DFJA 3UQOA 2G5NA 5BPEA 2Z9JA 1UVTH 1C5QA 2Y5GA 1HAZB 3QK1A 1O2ZA 1ZMLA 1FY8E 1ZJKA 3BG4C 1C2IA 1C5PA 3UFAA 1XUGA 2D1JA 1UHBB 1ZRBA 3T5FH 1ESTA 1PYTC 3E16B 4KELA 2HPPH 5H4IB 2VGCC 3AW0A 4UFFH 3F9GA 5T6DA 5LPFA 1SOZA 1XVOA 2JH5D 1K28D 2R3YA 1O5EH 1ESAA 1P57B 2ILNA 2HNTF 1YLCA 3PMHB 1LKBA 1HAPH 1CSOE 1O3EA 2SNVA 2NU0E 3SUGA 1WOFA 1IHSH 1UJ1A 3DA9B 4CRCA 5DO4H 3E8LA 1FPHH 1O2GH 2A5KA 4ABDA 4KTCA 3SHCH 4U01A 3SJKA 2AYWA 1Y3WA 2B8OH 2BDGA 1UCYK 2EI7A 4X6OA 4MNYA 4A92A 4D7GA 2V6NA 1O3AA 4E7RG 5FX5A 1HRTH 1NO9H 1AI8H 5A0AE 5E2OA 2F3CE 2HLCA 3NCLA 1C5XB 1ELAA 1B7XB 1CE5A 1AKSA 3MU1A 1P2KA 1PPGE 1DY9A 1SGTA 1O2IA 1V2JT 2BX4A 1TRNA 1SG8B 3EE0B 4NFFA 2J95A 1TGCA 2PWXA 3UREA 1DXWA 1IAUA 2OP9A 5FPTA 4NIWA 1SGEE 4INHA 2C8WB 3GCHB 2Y7XA 4MDSA 4MPWA 4ASHA 1HAYB 3TJVA 1NS3A 1EZSC 2ZPQA 1CA0B 4DY7B 3M3TA 4MLFB 2PKAA 1GJBB 1GVLA 3SN8A 1HGTH 1B0FA 2Y7ZA 4JZEH 3BEUA 4B75A 1TMBH 3OY6U 1P03A 1NPMA 3PLKA 4E05H 3SJOA 2Y80A 1AWFH 1BTXA 1KXDA 2FWWA 1JRSA 1BOQA 5A09A 5C2ZA 5B6OA 4D9QA 3BIVH 1HJAC 1UTOA 2THFB 5AFZH 3UNRA 1O2SA 1YC0A 2BLVA 1ORFA 4X2VA 2VWLA 4KGAA 3M7QA 4B74A 4JK6A 3E0PB 1HAXB 2TGPZ 2A1DB 2W3KA 2ZFQH 1GL1A 3TJUA 2W3IA 1FAKH 1CQQA 4CRGA 1GPZA 1TNLA 4IN2A 2EC9H 1B0EA 1ZJDA 1QB6A 1AO5A 2H9HA 3UOUA 2BDCA 1AKSB 3MNCA 1HBTH 1SLXB 4D8NA 1W3CA 4MPUA 4GCHG 3VGCC 3P6ZB 3MNBA 2NU1E 3VB5A 1SMFE 2ZTZA 3U98H 1D4PB 1SGCA 1DXPA 1A5HA 2A5AA 2JETC 3TH4H 1O2JA 4IN1A 3F68H 1EPTB 3FANA 1SGYE 4D9RA 3QZRA 1HJAB 4TYDA 4ABHA 1GMCG 4INLA 1QNJA 4K60A 1XKAC 1LMWB 1MCVA 2IJOB 1FMGA 1O3BA 3SV2H 3LH1A 2XCFA 1O3FA 3SV7A 3N7OA 4ABBA 2CF9H 1ZOMA 3MO6A 3SHAH 4KP0A 1GBIA 3ZZ4A 3SI4H 2Q1JA 3OY5U 1C2GA 1V2KT 4FVDA 3V0XA 1HB0B 3SW2B 1IQEA 1O36A 1O3HA 2VWNA 5JBTA 2ODQA 2VWMA 1CU1A 1SGPE 1S84A 5DKMA 4INKA 3M5NA 1VCQA 4AFSA 3KQDA 5FPSA 3EA7A 2QXJA 3L6PA 4LZ4B 4B73A 2ZQ1A 1FDPA 1BCUH 2ZIQH 1L1NA 1V2UT 2FM2A 1SFQB 3A7TA 1CBWC 2RCEA 1AIXH 4GCHF 5BRRE 1K1NA 1V2LT 1UTKA 2BD5A 5EXLA 3O8BA 4YOJA 3T27A 1A0JA 1V2OT 2ODYB 3BTTE 1ANDA 3MOCA 1JIRA 1LHGH 4GPGA 2FOAA 1SGDE 3RXTA 1O3NA 2BVRH 2ZCKP 1NFWA 1OWEA 1ZHPA 1XM1A 1FJSA 3MNXA 4ZKNU 5K7RA 2HOBA 2J38A 2BD2A 3GY8A 3PB1E 4KTUA 3I77A 1C5RA 1YPJH 2ZDNA 8GCHF 1MTSA 4ABJA 3UQVA 1U6QA 3RC6A 1TB6H 1HUTH 1G2MA 4CH8B 2I6SA 2VH6A 3GCTG 1HAVB 1TONA 2VVCA 3TVJB 2PGBB 1C1PA 4H4FA 1CGIE 1DE7H 1BTWA 3RXIA 2ZGHA 3GOVB 1QJ6B 4OS7A 5F8ZA 1N6YA 3UR6A 1GJ5H 1O2KA 2CHAC 1GHAF 4B76A 1PFXC 3NUMA 4BTTB 2W7SA 2BOKA 1G3CA 1TQ7B 2BY9X 4JYTA 1A3EH 1C5ZB 1MU8B 2IOTA 1GBKA 2FS9A 3S0NA 1ARBA 3KQCA 3LJJA 3ODFA 5GIBA 3TH3H 1SHHB 3QX5H 1AFEH 2ZPSA 1DFPA 1NRSH 1FIWA 1MKWH 4IMQA 2C90B 2BLQA 1YYY1 1DM4B 3IITA 1WYKA 4R0IA 2BVSH 4NG9H 3RXPA 4FU9A 1BTHH 2VVUA
chains in the Genus database with same CATH superfamily
1XMNB 2STBE 3T28A 1J16A 4F48B 2J92A 1N8OC 3M7TA 3T26A 1TA2A 4DIHH 3U1JB 1AB9B 1SKYE 1MCTA 2F9UA 3SNDA 1D6RA 1HV7A 1P9SA 3D65E 1FY5A 1Z71A 5FX6A 4AFUA 1GDNA 3LC3A 1C5MD 3A8CA 1OWDA 1MTNB 1KDQB 4CREA 1V2QT 2IPHA 3S7KB 4FVBA 1RJXB 1QTFA 4WY3A 1HPGA 3W94A 1NT1A 4X1NU 1TIOA 3M3SA 4P02A 1ZZZA 4OS5A 1UTMA 4TWWA 2FOMB 3FOAA 3M5LA 6LPRA 1QA7A 3MH4A 3SGBE 4GHTA 2J4IA 1EPTC 3MHWU 3ATMA 9ESTA 1W12U 1ZTKA 1K0HA 2VIWA 3TLOA 3VPKA 5JPMH 2Z3CA 2EI8A 3RXFA 2SGDE 1YF4A 1EKBB 4K2YA 1CGJE 2ZI2H 5LH8A 3VB6A 1SQRA 2HNTE 1ZSLA 1TNJA 1V2NT 2ZP0H 3RXHA 3A86A 5E8EH 2JH0D 1O3PB 3U8TH 3A7WA 1XUKA 5HIYA 1FZZA 4HG6A 3K6ZA 2ZTYA 1K9OE 3LIWA 4ZAEA 4DT7B 1BRAA 1O5FH 1DLKB 1HYLA 1BRCE 1AD8H 3SI3H 1SOTA 4HI3A 2YMSB 3A80A 3ZYEA 1NU7B 2FZZA 1QL8A 1QA0A 4FUHA 4IC5A 4WXIA 3TGIE 1WU1A 4ZMAH 2CF8H 1BA8B 3SZNA 2G4UA 3NPSA 4X1PU 1GGDB 2VGCB 1DUEA 5JBBS 4B6EA 4Y8ZA 2HWLB 4FUBA 3PV5A 4B6FA 3MU4A 3W1EA 1A1RA 1TMTH 3OEED 1C2FA 3QGJA 1GJDB 2J98A 2O8MA 2EEKA 2SGFE 2G4TA 3M35A 8ESTE 1B5GH 3PROA 3AVZA 2GX4A 1QB9A 1W7XH 3MWIU 3ZZCA 2UUJB 3ELAH 2O8LA 1YCPM 3UOPA 3LGYA 3F9EA 1LVYA 1WXRA 3N7DA 1TGTA 5ESBA 3SV9A 1GL0E 2QYIA 3ZZ5A 2F9NA 4U2WA 2UWOA 1O3GA 3UY9A 3LJOA 3LC5A 4ISLA 4TPIZ 1NM6A 1O0DH 2HALA 1ZHMA 5A2MH 2SNWA 3A83A 1CVWH 1O35A 3DSPA 3RXRA 1A61H 1K2I1 2B5TB 1DSUA 5FXLA 1BTYA 1UTPA 1O2TA 1A46H 1MKXK 1YBWA 1ZLRA 5GWZA 1BJUA 1HAIH 1WCZA 2F43B 4AOQA 1GVKB 2CHAB 1A3BH 1MTWA 1A0LA 3ODDA 1O3CA 3AW1A 4E06H 5EXNA 2HNTC 1GBAA 1BZXE 2O9QA 1GMDF 1RGQA 2G8TA 3A88A 1O2LA 5C1YA 2RA3A 1ZMNA 2AMQA 3HGPA 3SU6A 3GDSA 4BXWA 5EJ1A 1UTNA 3GDVA 3CNRA 4I7YH 3AAVA 1T4UH 1XUHA 3KEEA 3A82A 3K9XB 1VITF 2SGEE 1AFQB 1V2ST 1V3XA 1MUEB 3SNBA 2OINA 1LVMA 1C5LH 3L33A 4I33A 1H9LB 3STIA 5C1XA 1E79D 1GHYH 2BY6X 2Z9IA 4NZQA 1WSSH 1C5WB 1YPHC 2D2DA 1P2IA 1OP8A 1COWD 1UK4A 5DP3A 1G37A 4BOHA 2A7HA 3UTUH 4FUGA 2ZZUH 1GG6C 5HM9A 5K0HA 5EODA 1DWEH 3BG8A 3P95A 1HAVA 4JZFH 4Y10E 1O2XA 4DGJA 4Y11E 2YMSC 2P16A 1W10U 2GP9B 6CHAB 3ATKA 4KTSA 3TIUA 1P2MA 1T7CA 5DP5A 2UUYA 1DPOA 3UUZA 4DOQA 4CHAC 2PV9B 2BX3A 1NU9A 2CV3A 5GCHF 5HIZA 4A7IB 1DANH 3KN2A 2QF0A 5C20A 2A2QH 2WUBA 3F9FA 1PPBH 2G00A 2WYGA 1IQIA 2P3TB 3ATLA 1G36A 1BT7A 3SJ8A 1JMOH 4ISHH 2BQ7B 4OS2A 4UDWH 2JJ2D 3ITIA 4K1SA 1WUNH 3TITA 3MI4A 2FS8A 2G51A 1TYNA 1TBQH 1YPHE 1FIZA 1Q3XA 4I31A 3SV6A 2VIQA 4CR5A 1A5GH 1CA0C 2R2MB 1E35B 2OLGA 4K69A 2ZECA 2G81E 1C4Y2 1S5SA 1EATA 3CS0A 1OP0A 1NRQH 1UVOA 4XBCA 4TT3D 1BMAA 1S83A 1VGCB 1YWUA 2WPJS 1YCPK 1P06A 2Y82A 1WBGB 2WPDD 3GCNA 2ZKSA 3NKKA 2PSXA 1UK3A 2Z9GA 4AZ2B 2C3SA 4BTUB 1TFXA 2FP7B 4BANB 1PQ7A 2H5DA 4R8TB 3UB0A 1MMJN 1TPAE 5DN6D 4ABGA 4O03A 1AWHB 1ELDE 1TLDA 4J2YB 4NIXA 1V2VT 1NY22 1NESE 1PJPA 1MBMA 1S81A 3OSYA 1KIGH 5C0TA 3S7HB 4ISNA 2XC4A 2GD4B 1NBMD 1O39A 4X8TH 2ZDLA 1BTZA 1YY3A 3ESTA 1HDTH 4Y79A 5I46H 2IN2A 1SR5C 2IPQX 5I25A 2BHGA 2TBSA 1P3EA 3GYLB 3A7ZA 2Z94A 1TX7A 3F3BA 1WTGH 1GMDG 5C1UA 2QXHA 5HKKD 2FI3E 1Z1IA 3ZZAA 1UMAH 2XYAA 3RC4A 3V12A 3DD2H 1AY6H 1C5OH 3F2FA 1FXYA 2Z3DA 3DT0H 1FN8A 2XC5A 4ESTE 1SI5H 1WV7H 1UTLM 1GI5A 2F83A 3BTME 4E7NA 4BNRA 2B0FA 2J2UA 2GZ8A 2DE8A 2WV9A 1GVZA 1Z1JA 1WDIA 2VIDA 4Y6DA 4Q4LA 5EG4A 1F92A 1H4WA 1TNKA 3ZV8A 4K8YA 1UO6A 1CT2E 2QV1A 3ZVFA 4X2YA 3A85A 1AQ7A 1OWIA 1MD7A 1AE5A 1C1SA 2V0BA 3P70B 3M37A 3HKIB 2ZCHP 5DP6A 3Q3KA 2KAIA 1SHYA 1K22H 5C5NA 2GKVE 2HRVA 3F6UH 2BD8A 2RG3A 4JZ1A 1O3KA 2AIPA 3RP2A 3PO1C 1RD3B 2ZHQH 1O3IA 2PGQB 4BAMB 3VB4A 3FAOA 3SGAE 3VXFH 1F0TA 1O2NA 3O8RA 2R9PA 1GMCF 2XWBI 3PMJA 2J5UA 1W14U 4TY7A 2BOHB 3R0FA 4K5ZA 4NA8A 1TAWA 4MPXA 1GI9B 1NRRH 1SSXA 4ABIA 2W7UA 1YPGH 3SU3A 1ELVA 2RDLA 1T4VH 1FUJA 2F9BH 2Z6BD 1O31A 5E2PA 1V2MT 4H42U 1AN1E 3GY6A 3SQEE 1JOUB 5L6NH 1ZSKA 1JBUH 2Y5HA 5IK2D 4ISOA 1QGFA 2XTTB 1BBRH 3ZVBA 1WAYB 1Q31A 1VJ9U 2BTCE 4IMZA 4O97A 1V6DA 2G52A 5ETXA 1Z6JH 3OEHD 3NWUA 2XBVA 5C67A 1GJ7B 3BSQA 3RXMA 1O5CB 4GSOA 2JDID 1TBRH 2Z7FE 1KLIH 7ESTE 2FLRH 1VGCC 3RXSA 3BTFE 4HTCH 1IQKA 1BRBE 2FTLE 1S0RA 1BMFD 1C1UH 2H9EH 2DE9A 2GZ9A 1UVUH 1UVPA 4ZKRU 5FL7D 1D3PB 1P12E 3KL6A 4PROA 2PR3A 4HGCA 2UUFB 3K2UA 1P2JA 4Y0YE 5HYOA 2C93B 2FIRH 1ANBA 3B8JA 3S9AA 1DITH 2OBOA 3RXGA 4WVPE 1PQ8A 2R0KA 3A8AA 2SGQE 1J9CH 3KNXA 3SU1A 1C9PA 3DUXH 1YPEH 4UFDH 4X2XA 6ESTA 3A84A 2ZHFH 4Q2KA 1PPFE 4JZDH 4YM9A 1S0QA 1AZZA 4I86A 1TRYA 3SJIA 1EQ9A 1GHVH 5DJ7A 2XOKD 2BDYA 5EGMA 2ALVA 4NWKA 2KCPA 5FAHA 5E0JA 1SQOA 4M9FA 3MQKC 1GBBA 4NA7A 3A8DA 5T6FA 2HLDD 2OC0A 1EOJA 1O37A 3RXEA 2BD7A 2XNDD 1XXFA 3GCHC 1G3DA 3ZZ7A 1GI7B 2TGDA 1FV9A 4DURA 3SJ9A 1GCTC 4Y7AA 3TH2H 4AGJA 1ARCA 4ZUHA 1UCYE 3BN9A 1AB9C 1W2KH 1E36B 1QQ4A 2FODA 1BBRE 2PKSC 4CRFA 4I8KA 1C2MA 2Q6DA 4XE4A 1EX3A 1KY9A 2IJD1 1T32A 1EZQA 3KF2A 1AGJA 1Z7KA 1CA8B 4Y71A 5KGOA 4CR9A 4TY6A 1IQGA 5PTPA 1DS2E 2W26A 3HGNA 4RKOB 5L2ZH 1DVAH 1YGCH 5J4QA 2R2WU 4MNWA 2C4FH 1QL7A 1ZRKA 1GMHG 3VEQB 1DWCH 3PM3A 3RXLA 1PQAA 4OGYA 3BEFB 2GDEH 1Z8JB 4XD7D 1KTTB 2ANMH 1FI8A 1V2PT 3SYJA 4ACAA 1SB1H 5EOKA 2F4LA 2KFWA 1OSSA 3VXEH 3NXPA 1D3DB 2AFQB 1UTJA 2F9VA 4FUDA 2LPRA 4X6PA 1GCDA 4A1VA 5C3NA 1ZGIA 1AVWA 2AGGX 4MVNA 2ALPA 3U8RH 1JRTA 3MH6A 3WWFA 1DWDH 1Y3UA 2V3OH 4OM9A 1C1RA 2XBYA 2ODPA 2ULLA 4CBNA 1EP5A 1RTFB 1IOEA 1K1MA 2B7DH 2GV6A 2C8ZB 2TGTA 1SLVB 2FXRA 1ESBA 2C8XB 4Y8YA 5L30H 5DP9A 2OD3B 2BY5X 2BD9A 1OX1A 4MTBA 2I6QA 1CGHA 1QCPA 2KX4A 4DT4A 3F1SB 1GI6A 1L1GA 1TPOA 1YLDA 4WXVA 2NU4E 5EPNA 3FZDA 8LPRA 2TPIZ 3EA9A 3SNAA 3OYPA 1JXPA 2TRMA 2YOLA 1O2VA 2ZFFH 1MTVA 5T1VA 1TWXB 3FFGA 3PRDA 4H6SB 3ZVEA 1HCGA 1QY6A 4UE7H 5E0GA 1MKXH 1P8VC 3RXVA 4DCDA 1LO6A 5TCAA 1PPHE 5GCHG 3RUOA 4TWYA 1DWBH 4WMEA 1P9UA 2GMTC 3T25A 3GISB 3RDZA 1K1LA 2D26C 7GCHG 1RTKA 2ZHDA 1SL3A 3AAUA 1Y5UT 2WPIS 3Q00A 4ZXYH 1GBTA 3BEIB 4WF8A 1MAXA 3VG8A 4AC9A 3LU9B 4ASUD 1G30B 4B2AA 2XW9A 4NGAH 2ZTXA 3T2NA 3A8BA 3B9FH 1O5BB 2VVVA 4XBDA 1J17T 3E90B 5ESTE 1TNIA 4FUFA 1KMHB 2FESH 5AF9H 1G2LA 3S9CA 2OUAA 4KKDA 2FYRA 2BYAX 2A4QA 1LQDB 1HFDA 1P2OA 1KXBA 1BB0B 1OP2A 3MU8A 1C5UA 6GCHG 2A45B 1ETSH 2F9OA 5IDKA 1GJCB 5LPRA 3GY7A 1LPKB 1ETRH 1L0ZA 4X1RU 3WWBA 4A1XA 4NA9H 2QIQA 3A7VA 1OWKA 1SQAA 2AS9A 4XDEA 1C1VH 1EZUC 4K3JA 1YCPH 2BD4A 1BTPA 1Z8RA 1O2RA 1HIAB 4VGCB 1PPEE 2KR7A 1VKYA 2OBQA 4ZHLU 5SGAE 1ABIH 2GJGA 3MMGA 3SNCA 1ZMJA 1P2NA 2Z3EA 3QDZB 2V7QD 3RXKA 2VJ1A 2ASUB 1A5IA 1GBMA 2V35A 5DP4A 2ZU5A 2GGVB 2J9NA 1H8IH 4UFGH 5C17A 1ZTJA 2WPHS 2VWOA 3IWMA 1VR1H 3P8NA 1TPPA 4CBOA 1T31A 3GICB 2GT8A 1AE8H 4ZKOU 4O9VA 5EW1H 2BD3A 2KM0A 3FZZA 2O8UA 5FCRA 2ESTE 2ZFSA 1MKWK 1J14A 1SGFG 2VNTA 4B1TA 1FQ3A 3RU4E 3A7XA 1OYQA 2WPKS 1A0HB 4F49A 3STJA 5EXMA 1VITH 1EJNA 1YPLH 1RRKA 1GJ4H 4I8HA 1MQ6A 5C94A 4AFQA 3LONA 1W0YH 2AERH 2BDIA 2OC1A 1C1NA 1E37B 2A2XH 2PKSB 3SU0A 1TA6A 1MD8A 1RIWC 3LGIA 4CHAB 1EPTA 4DIIH 2KZ4A 2WINI 1D6WA 2TIOA 4SGBE 1OS8A 1QBNA 1OYTH 1L4DA 1DY8A 5L2YH 1XUFA 2O8WA 1GGDC 3E91A 2PHBA 1LVBA 4YOIA 2P93A 1XX9A 1C1QA 1AFQC 5AVDA 4X1QU 2ZFTA 4AGKA 1NZQH 1N6XA 2PUXB 4ZHMU 3TK6A 5EQQA 2WHXA 2WV5A 5JDUB 1ZGVA 4ISIH 3ZZ3A 2UWPA 4THNH 2QC2A 1G3EA 4X0WU 4Z0KA 1N8OB 2CK3D 1GBHA 3NZIA 1EAWA 1RXPA 1XKBC 2P3FH 1HXFH 4U32A 1NROH 2SGPE 1PYTD 2BY7X 4ABAA 1TALA 1PPZA 2QXGA 4FOUC 1WTHD 4Y7BA 3URCA 1TE0A 2BZAA 1GI4A 3F9HA 2ZDKA 1QIXB 1ZR0A 3A7YA 3RM2H 5EW2H 2P8OC 3PLBA 3RLYH 1LHDH 3BTKE 5IYTA 1RFNA 1CT4E 1O2PA 3A89A 4H6TA 1GJ9B 2QY0B 2V3HH 3EGKH 2H1UA 2F91A 4JZIA 1TOMH 1QR3E 1KXFA 1MTUA 1GHBF 5FPYA 1A2CH 1WQVH 4FUEA 3FP6E 4JYVH 2AHME 1NRNH 4WH8A 1QURH 1P02A 4DG4A 1TGSZ 2BXUH 3FO8D 2KCYA 1Y5BT 2BY8X 3SQHE 5GPIB 1LDTT 1LPZB 4Z1MD 1SQTA 2VIOA 1UTQA 9LPRA 2ZGCA 1OWHA 4BAQB 1BHXB 1W7GH 4IGDA 1KXAA 3FP8E 1BJVA 2XNIA 4NCYA 1NN6A 4AB9A 1TQ0B 1O34A 4LK4A 1T8NA 4AYYB 3ATWA 2ZO3H 3RLWH 5EU8A 3ZYDA 4B2BA 2P59A 1O2OA 1IQLA 1NC6A 3CENA 3GY5A 4IW4E 1QL9A 3SNEA 1AUTC 1A4WH 2FLBH 3TNSA 1RIWB 5GXPA 2NU2E 1GHBG 1QRWA 1EUFA 1GBJA 2QF4A 1TX6A 1BITA 4OS6A 3GY2A 3Q77A 1E34B 1C4U2 5AHGH 3GYMA 4DJZB 1OHHD 4FUIA 1Y8TA 4TPYA 4Y0ZE 2GDDA 3P8FA 2EY4C 3PWBA 3E1XB 3RMNH 5A8XA 3JZ2B 2J97A 1FY4A 2AGIX 2Z9LA 3HPTB 2D8WA 4IS5A 3GY4A 2H6MA 4GAWA 5F03A 3QTVH 1O2WA 1UVSH 3WY8A 4CRAA 2P3UB 2A4RA 2ZNKH 2ZFPH 2ZA5A 3LDXH 1IHTH 1KYNA 3V13A 3Q76A 4GVUA 1H9HE 2Y5FA 3UPEA 1SVPA 2GCHF 2H5CA 3KGPA 2OQUA 2ANKH 3PTBA 4RT0A 1T8MA 2OTVA 2BLWA 1CHGA 2VIPA 1BBRK 1W0KD 4YT7H 3SORA 3ZVAA 1A7SA 1L1JA 1EB2A 1XUIA 2KAIB 4X8VH 4M7GA 1Y59T 2A4GA 2CJIA 4UONA 1J15A 1F2SE 1D3QB 3UNSA 1GDUA 4JMYA 4NWLA 2BB4A 2FYQA 1SGRE 3SUFA 1DX5M 2GVFA 4WWYA 1V2WT 4I32A 3NK8A 2P94A 3FN8A 3R3GB 2AEIH 1HXEH 4AORA 5A0BA 2WPMS 1C1OA 1OOKB 3UWJH 6GCHF 2P95A 1DUAA 1M9UA 1Y5AT 2J34A 3OU0A 1KXCA 3VFEA 3A87A 1ACBE 2CMYA 3SOSA 1HAOH 2PKAB 2A7JA 1C2LA 1EASA 1TPSA 3P17H 4SGAE 1F5LA 1GHZA 2FO9A 1ZTLA 1K21H 5FBIA 1GI8B 1SPJA 7GCHF 4CRBA 2AIQA 1MAYA 4LZ1H 3RXCA 4OS4A 1KLJH 1O5DH 2ZHEH 3SU4A 3GCTF 2FX4A 3H09A 1O5AB 5G4BA 5JBCS 4X8SH 2GCTB 1FPCH 1L2EA 3D49H 1S85A 1LPGB 1EAXA 4YXWD 2CXVA 2ZEBA 1BMMH 4BXSA 3MH7A 2VB0A 4ABEA 3SV8A 3RMMH 1QBOA 1EJAA 1TGBA 1XUJA 2OQ5A 3OX7U 1IQNA 1O3DA 1QQUA 5E0HA 3E3TA 3TU7H 1O2HA 4D76A 2ZWLH 1SLWB 2ZCLP 5TCCA 1TNHA 4ZXXH 2STAE 1O2UA 1ANCA 3PV2A 1G32B 1GHAG 7KMEH 3TGJE 4F55A 2R3UA 4YO9A 1V2RT 3VGCB 2W5EA 2Z9KA 2LNCA 4Y8XA 2ANWA 4ZROA 1MTNC 3PTNA 5EQSA 3TGKE 3OE7D 4F4OC 4BAKB 3QTOH 1YPMH 1O3MA 3CP7A 3ZIAD 1SFIA 5DK1A 1EZXC 1LVOA 1C2HA 2K8IA 3P92A 1W0ZU 3LKWA 2WV4A 3D62A 2O8TA 1LKAA 1VCPA 1THSH 4AG2A 2FEQH 4YOGA 3RU4D 4IBLH 3SUDA 3ZZBA 4RSPA 5AFYH 2HGTH 2JIZD 3P8OA 2TGAA 1LQEA 1O3LA 2QE7D 3F2GA 1GMHF 2OXSA 3BV9B 4FETA 4YLQH 3ZZDA 1V2TT 2ZU1A 3RM0H 1NRPH 3EQ0H 2FOFA 1P05A 3TPIZ 3SUEA 1T8OA 1OWJA 3RXUA 2QN5T 3TJOA 3FP7E 1GHXH 1YLNA 3SBKA 4XBBA 2G5VA 2FDAA 5C5OA 1LHCH 2YNAA 3BTHE 3H5CB 3HKJB 1DLEA 2CN0H 3PV4A 5DSFA 3Q3YA 3BTGE 1C5TA 1D9IA 1QZ8A 1YPKH 2XWAA 2LELA 5F6MA 5CHAC 3QLPH 1C9TA 1SBWA 1E1RD 3JZ1B 1P10A 3BTDE 1DDJA 1P11E 4AG1A 3LPRA 2SFAA 3RXDA 3LT3A 3QZQA 1CBWB 5A0CA 4O3TA 2ZG0H 2ZPRA 5EJLA 2FOGA 2G55A 1ELEE 3VB3A 4B71A 4GLYA 2K1QA 2ZU3A 4AFZA 1IQMA 1EAUA 5LGOA 3S9BA 2A0QB 5EPYA 1DOJA 1F5KU 4YTAA 2RA0A 3BTWE 1GHWH 2FTMA 1C1TA 1GBEA 1LCYA 2BQ6B 4J1YA 1CT0E 3UIRA 1EOLA 1O2YA 4FUCA 4YLUA 1C4V2 1Z8IB 1P01A 2L6OA 3M36A 3PO1B 3QO6A 3U9AH 1P0SH 3K6YA 1NFUA 3KCGH 2ZDVH 3MTYA 2FOCA 2XBXA 2YMSD 4NZLA 5C0UA 1QRZA 2H2ZA 1C2KA 3MO3A 2ZDAH 3QN7A 5DPAA 4XSKU 2AMPA 3M61U 1C5NH 5GJ4B 1UCYH 2A32A 2QAAA 1EJMA 3TK9A 1AVGH 4HZHA 1TRMA 2BQWB 5JB8S 3RU4T 3H7OA 3C1KA 1EP6A 1UK2A 2A4OA 4XOJA 4WMFA 4MQAA 8KME2 3E6PH 4IC6A 3S69A 4UEHH 2QA9E 1GI1A 2QCYA 2GMTB 3AASA 1KXEA 3LGWA 1PQ5A 1GJAB 3E0NB 2PTNA 2ZGBH 1YM0A 4MG3A 2XC0A 4O3UA 3MNSA 1AMHA 3G01A 1C2JA 2PTCE 3T62A 5HM2A 1F0UA 3SU2A 1NTPA 1PPCE 2C8YB 4I8LA 2JH6D 5LPEA 1FY3A 1GJ8B 2EQNA 2GV7A 1SGNE 2BVXH 3KQBA 3FVFB 1GG6B 8GCHG 5J4SA 1ZPBA 4X6MA 4Q7XA 3RXQA 2FX6A 5T6GA 2QF5A 3V7TA 1BMLA 1W13U 1AZ8A 2B9LA 1HAHH 1C5VA 1QJ7B 2QXIA 3M5MA 2A31A 5JYIA 3ZVDA 3HK3B 3VB7A 4K1EA 1VITG 3F0OA 5ABWA 1TABE 3OTPA 1LTOA 5CHAB 5KECA 3OTJE 1T8LA 1Y3VA 4DVAU 3DFLA 3V3MA 1DSTA 1W0JD 2NWNA 4AN7A 4OGXA 2UWLA 3EYDA 2BLOA 1ELTA 2BDBA 3EA8A 1AHTH 4NIYA 1GBCA 1P3CA 1SGQE 3EDXB 1CO7E 2M2AA 2VBCA 3FKSD 4JYUH 1L4ZA 3QWCH 4AYVB 1LHFH 4I8GA 1TX8A 1GCTB 4ZCNA 1YP9A 3U1IB 3WW7A 1QRXA 3DHKH 2GT7A 1YKTA 3BTEE 3KQ5A 4RKJB 5EQRA 1K1OA 2UUKB 2GCTC 3RXOA 4UD9H 3CS7A 2FI4E 3QGNB 4FXGH 3TNTA 1P09A 2XCNA 1O32A 3C27B 4NFEA 1VJAU 2SGAA 3MU5A 2ANYA 5GDSH 2P8OB 1Q2WA 2BMGB 3LGVA 1KTSB 3BF6H 2ZF0H 2GTBA 4X8UH 4A5TS 1THPB 4CRDA 3MFJA 2XRCA 2FOEA 3KHVA 1TBZH 3K65B 2A5IA 1KLTA 2JETB 4TSFD 3UR9A 3DCLA 3ZVGA 4ZKSU 2VH0A 4WH6A 4ABFA 1TOCB 3PWCA 2Y81A 2JKHA 1P2QA 3I29A 1DICA 1O30A 2GZ7A 1S6FA 1HIAA 2ZHWH 3ZZ8A 3UWIA 5GNDA 1ANEA 2A7CA 5A8YA 6CHAC 2WSSD 1FNIA 1AUJA 2PSYA 2XXLA 4B2CA 1QHRB 2PFEA 1D3TB 1O38A 2ZQ2A 4NSVA 3M5OA 2WPLS 1AVXA 4GHQA 4YESB 3RXJA 3DSOA 1HLTH 1C1MA 4BAOB 1C2EA 4ZHAA 1S6HA 1RS0A 1O5GH 3Q3XA 5CDFE 3GDUA 3IG6B 2HPQH 2ZC9H 3P8GA 1ZYOA 1OPHB 3QUMP 3LGUA 1NFXA 3BIUH 1HJ9A 1BQYA 1O3JA 2BDAA 1GBFA 4Q80A 3UAIC 1S82A 5F8XA 3GY3A 1VZQH 3D23A 3TK5A 4BTIB 3SU5A 4D7FA 5DP8A 2AMDA 1SGIB 2HVXA 3MYWA 3GCOA 2PW8H 4RI0A 1O3OA 3LOXA 3MH5A 3ZZ9A 2V3MA 3F2HA 3ZV9A 3M3VA 3H7TA 1GBDA 3SO3A 1MZDA 3EE7A 3O8CA 3F0PA 1CHOF 4OS1A 2OCVB 2BZ6H 3OFND 3M7UA 1NFYA 2NU3E 1FAXA 3KQEA 4UFEH 4FUJA 1THRH 5CE1A 4DW2U 1C5YB 2DUCA 3PMBB 1K1PA 1QJ1B 1XVMA 1Y3YA 1ZSJA 2EA3A 1ZPCA 1S6LA 5FBEA 2QF3A 3MO9A 1BHXF 3W95A 1QBVH 4NIVA 1OKXA 5F53A 1BIOA 1CHOG 1BMNH 1X7AC 3SGQE 1H1BA 4WMDA 1C5SA 5T3HA 1FONA 1Z8GA 1F7ZA 1GDQA 2WUCA 3ATIA 4YT6H 2OK5A 1FLEE 1Y3XA 3RMLH 3RXBA 3T29A 2BXTH 5EJZA 4Z6AH 1KSNA 2EI6A 2ZU2A 2FOBA 3URDA 2J94A 3B23B 5HXFA 1TMUH 4CH2B 5TJXA 7LPRA 5HMAA 3TJNA 4Q7YA 1O2QA 5JB9S 5DG6A 3EAJA 1MU6B 1E1QD 2OC8A 3ENSB 4Q7ZA 1MH0A 1INCA 3U69H 3HATH 1K1JA 2R0LA 2W6ID 1SC8U 1ELCA 2Y6TA 3HK6B 1QFKH 4MNXA 4NSYA 1MZAA 4Y76A 4RN6A 1UHBA 1WQSA 1FN6A 4MPVA 2Q6GA 1HNEE 1LHEH 1ELBA 3PYHA 1EXFA 1BUIA 1G3BA 2PUQH 1RTLA 5HGGA 1SGFA 4JCNA 1JIMA 3U28C 1IQHA 1GI2A 1UW7A 4MNVA 3O8DA 4QT8C 1TNGA 5DGJA 4LOYH 3RMOH 1Z6EA 1E0FD 1IQFA 3BG4B 1N1LA 1KDQA 1O33A 2VIVA 1C1WH 2ZFRH 3RC5A 2JJ1D 1H9IE 1ABJH 2FI5E 1GI3A 2AH4X 1J8AA 2AGEX 1W8BH 2WZQA 1W11U 2BDHA 2F9PA 3AK5A 3L3TA 4AB8A 1ELGA 2HVYB 2M5TA 1ELFA 1ZPZA 2W6JD 1DT2A 1ID5H 2WYJA 4WJG2 1BRUP 3BTQE 4K1TA 1VCWA 4XFQA 4U30A 3LH3A 3KIDU 3PMAB 4YZUA 2FPZA 1FY1A 2VINA 1BDAA 4FU8A 2QGRA 1C2DA 1GJ6A 2ZDMA 3I78A 3N7EA 4AX9H 4X6NA 2OC7A 5CMXH 1G9IE 2KCAA 1K1IA 3MU0A 2H9TH 2FMJA 4FU7A 4K8BA 1IQJA 1GI0A 2ZGJA 4ZH8A 4A1TA 1OXGA 4GUXA 4X2WA 3UNQA 2GCHG 4I8JA 1XXDA 1BTUA 3PLPA 4HFPB 5FHTA 1F0RA 1JWTA 1EAIA 1F0SA 1TGNA 3LGTA 4JK5A 1P04A 1F5RA 2Q6FA 2BM2A 3U8OH 5JBAS 1HAGE 1O2MA 5A8ZA 2VU8E 4A6LA 1AU8A 1GWAA 3SZEA 4X1SU 1HJ8A 2CGAA 2YNBA 1GBLA 4VGCC 1ETTH 1SLUB 1MQ5A 2XBWA 3ZVCA 1ZHRA 5DP7A 4LXBH 3A81A 2PLXA 1E38B 4Q63A 4BAHB 3RXAA 3ZZ6A 5FCKA 1MBQA 2FOHA 2ZGXH 2ZU4A 5F8TA 1H8DH 1QB1A 1EB1H 3DFJA 3UQOA 2G5NA 5BPEA 2Z9JA 1UVTH 1C5QA 2Y5GA 1HAZB 3QK1A 1O2ZA 1ZMLA 1FY8E 1ZJKA 3BG4C 1C2IA 1C5PA 3UFAA 1XUGA 2D1JA 1UHBB 1ZRBA 4XRNA 3T5FH 1ESTA 1PYTC 3E16B 4KELA 2HPPH 5H4IB 2VGCC 3AW0A 4UFFH 3F9GA 5T6DA 5LPFA 1SOZA 1XVOA 2JH5D 1K28D 2R3YA 1O5EH 1ESAA 1P57B 2ILNA 2HNTF 1YLCA 3PMHB 1LKBA 1HAPH 1CSOE 1O3EA 2SNVA 2L74A 2NU0E 3OAAD 3SUGA 1WOFA 1IHSH 2PP6A 1UJ1A 3DA9B 3KYGA 4CRCA 5DO4H 3E8LA 1FPHH 1O2GH 2A5KA 4ABDA 4KTCA 3SHCH 4U01A 3SJKA 2AYWA 1Y3WA 2B8OH 2BDGA 1UCYK 2EI7A 4X6OA 4MNYA 4A92A 4D7GA 2V6NA 1O3AA 4E7RG 5FX5A 1HRTH 1NO9H 1AI8H 5A0AE 5E2OA 2F3CE 2HLCA 3NCLA 1C5XB 1ELAA 1B7XB 1CE5A 1AKSA 3MU1A 1P2KA 1PPGE 1DY9A 1SGTA 1O2IA 1V2JT 2BX4A 1TRNA 1SG8B 3EE0B 4NFFA 2J95A 1TGCA 2PWXA 3UREA 1DXWA 1IAUA 2OP9A 5FPTA 4NIWA 1SGEE 4INHA 2C8WB 3GCHB 2Y7XA 3NRLA 4MDSA 4MPWA 4ASHA 1HAYB 3TJVA 1NS3A 1EZSC 2ZPQA 1CA0B 4DY7B 3M3TA 4MLFB 2PKAA 1GJBB 1GVLA 3SN8A 1HGTH 1B0FA 2Y7ZA 4JZEH 3BEUA 4B75A 1TMBH 3OY6U 5CHBA 1P03A 1NPMA 3PLKA 4E05H 3SJOA 2Y80A 1AWFH 1BTXA 1KXDA 2FWWA 1JRSA 1BOQA 5A09A 5C2ZA 5B6OA 4D9QA 3BIVH 1HJAC 1UTOA 2THFB 5AFZH 3UNRA 1O2SA 1YC0A 2J98B 2BLVA 1ORFA 4X2VA 2VWLA 5KEDA 4KGAA 3M7QA 4B74A 4JK6A 3E0PB 1HAXB 2TGPZ 2A1DB 2W3KA 2ZFQH 1GL1A 3TJUA 2W3IA 1FAKH 1CQQA 4CRGA 1GPZA 1TNLA 4IN2A 2EC9H 1B0EA 1ZJDA 1QB6A 2KCOA 1AO5A 2H9HA 3UOUA 2BDCA 1AKSB 3MNCA 1HBTH 1SLXB 4D8NA 1W3CA 4MPUA 4GCHG 3VGCC 3P6ZB 3MNBA 2NU1E 3VB5A 1SMFE 2ZTZA 3U98H 1D4PB 1SGCA 1DXPA 1A5HA 2A5AA 2JETC 3N99A 3TH4H 1O2JA 4IN1A 3F68H 1EPTB 3FANA 1SGYE 4D9RA 3QZRA 1HJAB 4TYDA 4ABHA 4P00A 1GMCG 4INLA 1QNJA 1MABB 4K60A 1XKAC 1LMWB 1MCVA 2IJOB 1FMGA 1O3BA 3SV2H 3LH1A 2XCFA 1O3FA 3SV7A 3N7OA 4ABBA 2CF9H 1ZOMA 3PRBA 3MO6A 3SHAH 4KP0A 1GBIA 3ZZ4A 3SI4H 2Q1JA 4RT1A 3OY5U 1C2GA 1FX0B 1V2KT 4FVDA 3V0XA 1HB0B 3SW2B 1IQEA 1O36A 1O3HA 2VWNA 5JBTA 2ODQA 2VWMA 1CU1A 1SGPE 1S84A 5DKMA 4INKA 3M5NA 1VCQA 4AFSA 3KQDA 5FPSA 3EA7A 2QXJA 3L6PA 4LZ4B 4B73A 2ZQ1A 1FDPA 1BCUH 2ZIQH 1L1NA 4ACBA 1V2UT 3KYFA 2FM2A 1SFQB 3A7TA 1CBWC 2RCEA 1AIXH 4GCHF 5BRRE 2LP6A 1K1NA 1V2LT 1UTKA 2BD5A 5EXLA 3O8BA 4YOJA 3T27A 1A0JA 1V2OT 2ODYB 3BTTE 1ANDA 3MOCA 2RFKC 1JIRA 1LHGH 4GPGA 1NBME 2FOAA 1SGDE 3RXTA 1O3NA 2BVRH 2ZCKP 1NFWA 2RDEA 1OWEA 5B6LA 1ZHPA 1XM1A 2K0QA 1FJSA 3MNXA 4ZKNU 5K7RA 2HOBA 2J38A 2BD2A 3GY8A 3PB1E 4KTUA 3I77A 1C5RA 1YPJH 2ZDNA 8GCHF 1MTSA 4ABJA 3UQVA 1U6QA 3RC6A 1TB6H 1HUTH 1G2MA 4CH8B 1EFRD 2I6SA 2VH6A 3GCTG 1HAVB 1TONA 2VVCA 3TVJB 2PGBB 1C1PA 4H4FA 1CGIE 1DE7H 1BTWA 3RXIA 3GS9A 2ZGHA 3GOVB 1QJ6B 4OS7A 5F8ZA 1N6YA 3UR6A 1GJ5H 1O2KA 2CHAC 1GHAF 4B76A 1PFXC 3NUMA 4BTTB 2W7SA 1H8ED 1G3CA 2BOKA 3DSGA 1TQ7B 2BY9X 4JYTA 1A3EH 1C5ZB 1MU8B 2IOTA 1GBKA 1H8HD 2FS9A 3S0NA 1ARBA 3KQCA 3LJJA 3ODFA 5GIBA 3TH3H 1SHHB 3QX5H 1AFEH 2ZPSA 1DFPA 1NRSH 1FIWA 1MKWH 4IMQA 2C90B 2BLQA 1YYY1 5EIYA 1DM4B 3IITA 1WYKA 4R0IA 2BVSH 4NG9H 3RXPA 4FU9A 1BTHH 2VVUA
chains in the Genus database with same CATH topology
1XMNB 2STBE 3T28A 1J16A 2J92A 1N8OC 3M7TA 3T26A 1TA2A 4DIHH 3U1JB 1AB9B 1MCTA 2F9UA 3SNDA 1D6RA 1HV7A 1P9SA 3D65E 1FY5A 1Z71A 5FX6A 4AFUA 1GDNA 3LC3A 1C5MD 3A8CA 1OWDA 1MTNB 1KDQB 4CREA 1V2QT 2IPHA 3S7KB 4FVBA 1RJXB 1QTFA 4WY3A 1HPGA 3W94A 1NT1A 4X1NU 1TIOA 3M3SA 1ZZZA 4OS5A 1UTMA 4TWWA 2FOMB 3M5LA 6LPRA 1QA7A 3MH4A 3SGBE 4GHTA 2J4IA 1EPTC 3MHWU 3ATMA 9ESTA 1W12U 1ZTKA 2VIWA 3TLOA 3VPKA 5JPMH 2Z3CA 2EI8A 3RXFA 2SGDE 1YF4A 1EKBB 4K2YA 1CGJE 2ZI2H 5LH8A 3VB6A 2HNTE 1ZSLA 1TNJA 1V2NT 2ZP0H 3RXHA 3A86A 5E8EH 2JH0D 1O3PB 3U8TH 3A7WA 1XUKA 1FZZA 3K6ZA 2ZTYA 1K9OE 3LIWA 4ZAEA 4DT7B 1BRAA 1O5FH 1DLKB 1HYLA 1BRCE 1AD8H 3SI3H 1SOTA 4HI3A 3A80A 3ZYEA 1NU7B 2FZZA 1QL8A 1QA0A 4FUHA 4IC5A 4WXIA 3TGIE 1WU1A 4ZMAH 2CF8H 1BA8B 3SZNA 2G4UA 3NPSA 4X1PU 1GGDB 2VGCB 1DUEA 5JBBS 4Y8ZA 2HWLB 4FUBA 3MU4A 1A1RA 1TMTH 1C2FA 3QGJA 1GJDB 2O8MA 2EEKA 2SGFE 2G4TA 3M35A 8ESTE 1B5GH 3PROA 3AVZA 2GX4A 1QB9A 1W7XH 3MWIU 3ZZCA 2UUJB 3ELAH 2O8LA 1YCPM 3UOPA 3LGYA 3F9EA 1LVYA 1TGTA 5ESBA 3SV9A 1GL0E 2QYIA 3ZZ5A 2F9NA 4U2WA 2UWOA 1O3GA 3UY9A 3LJOA 3LC5A 4ISLA 4TPIZ 1NM6A 1O0DH 2HALA 1ZHMA 5A2MH 2SNWA 3A83A 1CVWH 1O35A 3RXRA 1A61H 1K2I1 2B5TB 1DSUA 5FXLA 1BTYA 1UTPA 1O2TA 1A46H 1MKXK 1YBWA 1ZLRA 5GWZA 1BJUA 1HAIH 1WCZA 4AOQA 1GVKB 2CHAB 1A3BH 1MTWA 1A0LA 3ODDA 1O3CA 3AW1A 4E06H 5EXNA 2HNTC 1GBAA 1BZXE 2O9QA 1GMDF 1RGQA 2G8TA 3A88A 1O2LA 5C1YA 2RA3A 1ZMNA 2AMQA 3HGPA 3SU6A 3GDSA 4BXWA 1UTNA 3GDVA 4I7YH 3AAVA 1T4UH 1XUHA 3KEEA 3A82A 3K9XB 1VITF 2SGEE 1AFQB 1V2ST 1V3XA 1MUEB 3SNBA 2OINA 1LVMA 1C5LH 3L33A 4I33A 1H9LB 3STIA 5C1XA 1GHYH 2BY6X 2Z9IA 4NZQA 1WSSH 1C5WB 1YPHC 2D2DA 1P2IA 1OP8A 1UK4A 5DP3A 1G37A 4BOHA 2A7HA 3UTUH 4FUGA 2ZZUH 1GG6C 5HM9A 5K0HA 5EODA 1DWEH 3BG8A 3P95A 1HAVA 4JZFH 4Y10E 1O2XA 4DGJA 4Y11E 2P16A 1W10U 2GP9B 6CHAB 3ATKA 4KTSA 3TIUA 1P2MA 1T7CA 5DP5A 2UUYA 1DPOA 3UUZA 4DOQA 4CHAC 2PV9B 2BX3A 1NU9A 2CV3A 5GCHF 4A7IB 1DANH 3KN2A 2QF0A 5C20A 2A2QH 2WUBA 3F9FA 1PPBH 2WYGA 2G00A 1IQIA 2P3TB 3ATLA 1G36A 1BT7A 3SJ8A 1JMOH 4ISHH 2BQ7B 4OS2A 4UDWH 3ITIA 4K1SA 1WUNH 3TITA 3MI4A 2FS8A 2G51A 1TYNA 1TBQH 1YPHE 1FIZA 1Q3XA 4I31A 3SV6A 2VIQA 4CR5A 1A5GH 1CA0C 2R2MB 1E35B 2OLGA 4K69A 2ZECA 2G81E 1C4Y2 1S5SA 1EATA 3CS0A 1OP0A 1NRQH 1UVOA 4XBCA 1BMAA 1S83A 1VGCB 2WPJS 1YCPK 1P06A 2Y82A 1WBGB 3GCNA 3NKKA 2ZKSA 2PSXA 1UK3A 2Z9GA 4AZ2B 2C3SA 4BTUB 1TFXA 2FP7B 4BANB 1PQ7A 2H5DA 4R8TB 1MMJN 1TPAE 4ABGA 4O03A 1AWHB 1ELDE 1TLDA 4J2YB 4NIXA 1V2VT 1NY22 1NESE 1PJPA 1MBMA 1S81A 3OSYA 1KIGH 3S7HB 4ISNA 2XC4A 2GD4B 1O39A 4X8TH 2ZDLA 1BTZA 3ESTA 4Y79A 1HDTH 5I46H 2IN2A 1SR5C 5I25A 2BHGA 2TBSA 1P3EA 3GYLB 3A7ZA 2Z94A 1TX7A 1WTGH 1GMDG 5C1UA 2QXHA 2FI3E 1Z1IA 3ZZAA 1UMAH 2XYAA 3RC4A 3V12A 3DD2H 1AY6H 1C5OH 1FXYA 2Z3DA 3DT0H 1FN8A 2XC5A 4ESTE 1SI5H 1WV7H 1UTLM 1GI5A 2F83A 3BTME 4E7NA 4BNRA 2B0FA 2J2UA 2GZ8A 2DE8A 1GVZA 1Z1JA 2VIDA 4Y6DA 5EG4A 1F92A 1H4WA 1TNKA 3ZV8A 4K8YA 1UO6A 1CT2E 2QV1A 3ZVFA 4X2YA 3A85A 1AQ7A 1OWIA 1MD7A 1AE5A 1C1SA 2V0BA 3P70B 3M37A 3HKIB 2ZCHP 5DP6A 3Q3KA 2KAIA 1SHYA 1K22H 5C5NA 2GKVE 2HRVA 3F6UH 2BD8A 2RG3A 4JZ1A 1O3KA 2AIPA 3RP2A 3PO1C 1RD3B 2ZHQH 1O3IA 2PGQB 4BAMB 3VB4A 3FAOA 3SGAE 3VXFH 1F0TA 1O2NA 3O8RA 2R9PA 1GMCF 2XWBI 3PMJA 1W14U 4TY7A 2BOHB 3R0FA 4K5ZA 4NA8A 1TAWA 4MPXA 1GI9B 1NRRH 1SSXA 4ABIA 2W7UA 1YPGH 3SU3A 1ELVA 2RDLA 1T4VH 1FUJA 2F9BH 2Z6BD 1O31A 5E2PA 1V2MT 4H42U 1AN1E 3GY6A 3SQEE 1JOUB 5L6NH 1ZSKA 1JBUH 2Y5HA 4ISOA 1QGFA 2XTTB 1BBRH 3ZVBA 1WAYB 1Q31A 1VJ9U 2BTCE 4IMZA 4O97A 1V6DA 2G52A 5ETXA 1Z6JH 3NWUA 2XBVA 5C67A 1GJ7B 3BSQA 3RXMA 1O5CB 4GSOA 1TBRH 2Z7FE 1KLIH 7ESTE 2FLRH 1VGCC 3RXSA 3BTFE 4HTCH 1IQKA 1BRBE 2FTLE 1S0RA 1C1UH 2H9EH 2DE9A 2GZ9A 1UVUH 1UVPA 4ZKRU 1D3PB 1P12E 3KL6A 4PROA 2PR3A 4HGCA 2UUFB 3K2UA 1P2JA 4Y0YE 5HYOA 2C93B 2FIRH 1ANBA 3B8JA 3S9AA 1DITH 2OBOA 3RXGA 4WVPE 1PQ8A 2R0KA 3A8AA 2SGQE 1J9CH 3KNXA 3SU1A 1C9PA 3DUXH 1YPEH 4UFDH 4X2XA 6ESTA 3A84A 2ZHFH 4Q2KA 1PPFE 4JZDH 4YM9A 1S0QA 1AZZA 3SJIA 1TRYA 1EQ9A 1GHVH 5DJ7A 2BDYA 5EGMA 2ALVA 4NWKA 5FAHA 5E0JA 1SQOA 1GBBA 4NA7A 3A8DA 5T6FA 2OC0A 1EOJA 1O37A 3RXEA 2BD7A 1XXFA 3GCHC 1G3DA 3ZZ7A 1GI7B 2TGDA 1FV9A 4DURA 3SJ9A 1GCTC 4Y7AA 3TH2H 4AGJA 1ARCA 4ZUHA 1UCYE 3BN9A 1AB9C 1W2KH 1E36B 1QQ4A 2FODA 1BBRE 2PKSC 4CRFA 4I8KA 1C2MA 2Q6DA 4XE4A 1EX3A 1KY9A 1T32A 1EZQA 3KF2A 1AGJA 1Z7KA 1CA8B 4Y71A 4CR9A 4TY6A 1IQGA 5PTPA 1DS2E 2W26A 3HGNA 4RKOB 5L2ZH 1DVAH 1YGCH 5J4QA 2R2WU 4MNWA 2C4FH 1QL7A 1ZRKA 1GMHG 3VEQB 1DWCH 3PM3A 3RXLA 1PQAA 4OGYA 3BEFB 2GDEH 1Z8JB 1KTTB 2ANMH 1FI8A 1V2PT 1SB1H 5EOKA 1OSSA 3VXEH 3NXPA 1D3DB 2AFQB 1UTJA 2F9VA 4FUDA 2LPRA 4X6PA 1GCDA 4A1VA 5C3NA 1ZGIA 1AVWA 2AGGX 4MVNA 2ALPA 3U8RH 1JRTA 3MH6A 1DWDH 1Y3UA 2V3OH 1C1RA 2XBYA 2ODPA 2ULLA 4CBNA 1EP5A 1RTFB 1IOEA 1K1MA 2B7DH 2GV6A 2C8ZB 2TGTA 1SLVB 2FXRA 1ESBA 2C8XB 4Y8YA 5L30H 5DP9A 2OD3B 2BY5X 2BD9A 1OX1A 4MTBA 2I6QA 1CGHA 1QCPA 3F1SB 1GI6A 1L1GA 1TPOA 1YLDA 4WXVA 2NU4E 5EPNA 3FZDA 8LPRA 2TPIZ 3EA9A 3SNAA 3OYPA 1JXPA 2TRMA 2YOLA 1O2VA 2ZFFH 1MTVA 1TWXB 3FFGA 4H6SB 3ZVEA 1HCGA 1QY6A 4UE7H 5E0GA 1MKXH 1P8VC 3RXVA 4DCDA 1LO6A 5TCAA 1PPHE 5GCHG 3RUOA 4TWYA 1DWBH 4WMEA 1P9UA 2GMTC 3T25A 3GISB 3RDZA 1K1LA 2D26C 7GCHG 1RTKA 2ZHDA 1SL3A 3AAUA 1Y5UT 2WPIS 3Q00A 4ZXYH 1GBTA 3BEIB 4WF8A 1MAXA 3LU9B 1G30B 4B2AA 2XW9A 4NGAH 2ZTXA 3T2NA 3A8BA 3B9FH 1O5BB 2VVVA 4XBDA 1J17T 3E90B 5ESTE 1TNIA 4FUFA 2FESH 5AF9H 1G2LA 3S9CA 2OUAA 4KKDA 2FYRA 2BYAX 2A4QA 1LQDB 1HFDA 1P2OA 1KXBA 1BB0B 1OP2A 3MU8A 1C5UA 6GCHG 2A45B 1ETSH 2F9OA 5IDKA 1GJCB 5LPRA 3GY7A 1LPKB 1ETRH 1L0ZA 4X1RU 4A1XA 4NA9H 2QIQA 3A7VA 1OWKA 1SQAA 2AS9A 4XDEA 1C1VH 1EZUC 4K3JA 1YCPH 2BD4A 1BTPA 1Z8RA 1O2RA 1HIAB 4VGCB 1PPEE 2OBQA 4ZHLU 5SGAE 1ABIH 3MMGA 3SNCA 1ZMJA 1P2NA 2Z3EA 3QDZB 3RXKA 2VJ1A 2ASUB 1A5IA 1GBMA 2V35A 5DP4A 2ZU5A 2GGVB 2J9NA 1H8IH 4UFGH 1ZTJA 2WPHS 2VWOA 3IWMA 1VR1H 3P8NA 1TPPA 4CBOA 1T31A 3GICB 2GT8A 1AE8H 4ZKOU 4O9VA 5EW1H 2BD3A 3FZZA 2O8UA 5FCRA 2ESTE 2ZFSA 1MKWK 1J14A 1SGFG 2VNTA 4B1TA 1FQ3A 3RU4E 3A7XA 1OYQA 2WPKS 1A0HB 4F49A 3STJA 5EXMA 1VITH 1EJNA 1YPLH 1RRKA 1GJ4H 4I8HA 1MQ6A 4AFQA 3LONA 1W0YH 2AERH 2BDIA 2OC1A 1C1NA 1E37B 2A2XH 2PKSB 3SU0A 1TA6A 1MD8A 1RIWC 3LGIA 4CHAB 1EPTA 4DIIH 2WINI 1D6WA 2TIOA 4SGBE 1OS8A 1QBNA 1OYTH 1L4DA 1DY8A 5L2YH 1XUFA 2O8WA 1GGDC 3E91A 2PHBA 1LVBA 4YOIA 2P93A 1XX9A 1C1QA 1AFQC 5AVDA 4X1QU 2ZFTA 4AGKA 1NZQH 1N6XA 2PUXB 4ZHMU 3TK6A 5EQQA 2WV5A 5JDUB 1ZGVA 4ISIH 3ZZ3A 2UWPA 4THNH 2QC2A 1G3EA 4X0WU 4Z0KA 1N8OB 1GBHA 3NZIA 1EAWA 1RXPA 1XKBC 2P3FH 1HXFH 4U32A 1NROH 2SGPE 1PYTD 2BY7X 4ABAA 1TALA 1PPZA 2QXGA 1WTHD 4Y7BA 3URCA 1TE0A 2BZAA 1GI4A 3F9HA 2ZDKA 1QIXB 1ZR0A 3A7YA 3RM2H 5EW2H 2P8OC 3PLBA 3RLYH 1LHDH 3BTKE 5IYTA 1RFNA 1CT4E 1O2PA 3A89A 4H6TA 1GJ9B 2QY0B 2V3HH 3EGKH 2H1UA 2F91A 4JZIA 1TOMH 1QR3E 1KXFA 1MTUA 1GHBF 5FPYA 1A2CH 1WQVH 4FUEA 3FP6E 4JYVH 1NRNH 4WH8A 1QURH 1P02A 4DG4A 1TGSZ 2BXUH 1Y5BT 2BY8X 3SQHE 5GPIB 1LDTT 1LPZB 1SQTA 2VIOA 1UTQA 9LPRA 2ZGCA 1OWHA 4BAQB 1BHXB 1W7GH 4IGDA 1KXAA 3FP8E 1BJVA 2XNIA 4NCYA 1NN6A 4AB9A 1TQ0B 1O34A 4LK4A 1T8NA 4AYYB 3ATWA 2ZO3H 3RLWH 5EU8A 3ZYDA 4B2BA 2P59A 1O2OA 1IQLA 1NC6A 3CENA 3GY5A 4IW4E 1QL9A 3SNEA 1AUTC 1A4WH 2FLBH 3TNSA 1RIWB 5GXPA 2NU2E 1GHBG 1QRWA 1EUFA 1GBJA 1TX6A 1BITA 4OS6A 3GY2A 3Q77A 1E34B 1C4U2 5AHGH 3GYMA 4DJZB 4FUIA 4TPYA 1Y8TA 4Y0ZE 2GDDA 3P8FA 3PWBA 3E1XB 3RMNH 5A8XA 3JZ2B 1FY4A 2AGIX 2Z9LA 3HPTB 2D8WA 4IS5A 3GY4A 2H6MA 4GAWA 5F03A 3QTVH 1O2WA 1UVSH 3WY8A 4CRAA 2P3UB 2A4RA 2ZNKH 2ZFPH 2ZA5A 3LDXH 1IHTH 1KYNA 3V13A 3Q76A 4GVUA 1H9HE 2Y5FA 3UPEA 1SVPA 2GCHF 2H5CA 3KGPA 2OQUA 2ANKH 3PTBA 1T8MA 2OTVA 2BLWA 1CHGA 2VIPA 1BBRK 4YT7H 3SORA 3ZVAA 1A7SA 1L1JA 1EB2A 1XUIA 2KAIB 4X8VH 4M7GA 1Y59T 2A4GA 2CJIA 4UONA 1J15A 1F2SE 1D3QB 3UNSA 1GDUA 4JMYA 4NWLA 2BB4A 2FYQA 1SGRE 3SUFA 1DX5M 2GVFA 4WWYA 1V2WT 4I32A 3NK8A 2P94A 3R3GB 2AEIH 1HXEH 4AORA 5A0BA 2WPMS 1C1OA 1OOKB 3UWJH 6GCHF 2P95A 1DUAA 1M9UA 1Y5AT 2J34A 3OU0A 1KXCA 3VFE<