1IAUA

Human granzyme b in complex with ac-iepd-cho
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
226
structure length
226
Chain Sequence
IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRANZYME B
publication title The three-dimensional structure of human granzyme B compared to caspase-3, key mediators of cell death with cleavage specificity for aspartic acid in P1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 226
sequence length 226
ec nomenclature ec 3.4.21.79: Granzyme B.
pdb deposition date 2001-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1iauA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1iauA02
1OP0A 4CRBA 2BDAA 2ZKSA 1NO9H 4X6OA 3UTUH 3S69A 1BRAA 3FP8E 1H1BA 2SNVA 4JMYA 3W94A 1BTWA 1QB6A 1MCTA 1MTVA 3RLWH 4A7IB 2A31A 3SU2A 4DCDA 5FBIA 1NU7B 3UY9A 4RKOB 1NROH 1TGBA 1BITA 4IN2A 3RU4T 4IS5A 1ABIH 1O2UA 3SV8A 1O3EA 4D9RA 1VITG 1BOQA 2P8OB 4MPVA 1TRMA 3UQVA 1LMWB 4FU8A 1ANDA 4NIVA 4WWYA 4Y8ZA 4K60A 3EAJA 4D7GA 3KIDU 4AGKA 2STAE 1V2NT 1KXBA 2R2MB 2FOBA 2ZA5A 1TFXA 2ZZUH 3UOPA 3TLOA 1GJAB 3HPTB 2BDGA 1DLKB 2PGBB 1UVPA 2SGAA 3LU9B 4DJZB 2VJ1A 1Y3WA 2FOEA 3PWBA 3C27B 1O2KA 3EA8A 3BIVH 1VITF 3T62A 4ABGA 1DS2E 4UFGH 1UCYH 1LKBA 4H42U 1ZSJA 3BEUA 4A92A 1EXFA 5CHAC 1V2ST 1H8IH 1K1LA 2XW9A 1W10U 1KXDA 4CREA 2P8OC 3A82A 3E8LA 3MU1A 1TOMH 1GBDA 2G5NA 3TJNA 4FVBA 4UFEH 1P04A 3U8RH 3U8TH 2BLVA 3SNAA 3PLKA 1AE8H 4MDSA 4YT7H 3PTBA 2O8TA 1LPKB 1O3MA 3AASA 4ISHH 3EA9A 5J4QA 3RXRA 3PMBB 5I25A 1AB9B 1ZPBA 5JBCS 1P3CA 4AFUA 2BD3A 2QXHA 3I29A 3KQBA 1V2MT 1C1WH 3QGNB 3SV6A 1OXGA 1EB2A 3A85A 4DGJA 5F8XA 2J94A 5A8YA 4D8NA 1C4Y2 1ZSLA 2ULLA 1FNIA 1P0SH 5C67A 2GMTC 2A5AA 2A2XH 4INHA 1QJ6B 1BTHH 2V0BA 1C1VH 4JZDH 2BVSH 2FZZA 2ZFPH 3TGIE 1D3DB 1P09A 1TPSA 1O5FH 3T25A 2EI6A 4B2BA 2BX3A 1THSH 1NS3A 2AMPA 3SNBA 4Y76A 2HRVA 1LO6A 4CRDA 1O35A 3RXQA 1ARCA 1BBRH 2BQ6B 2VGCC 2ZDKA 4FUEA 5GJ4B 1JRTA 1D3TB 2ASUB 1MU6B 2BD9A 5DK1A 1AB9C 4BAKB 1O37A 3U8OH 1NU9A 1KTSB 2PLXA 2ZTYA 2F83A 2QGRA 5SGAE 1AVXA 2HALA 1EAUA 1VJAU 3BSQA 1ABJH 1GG6B 1LHCH 2OUAA 2TGDA 4ZROA 1A61H 3ZVDA 1AWFH 2XBWA 4A6LA 2QV1A 5LGOA 1NRPH 1BHXF 1EZQA 4ZHMU 1W7GH 2ZC9H 4R0IA 3A87A 5HXFA 3WY8A 1KSNA 1VITH 2C3SA 3FANA 1LHGH 3SU4A 1ZHPA 2ZP0H 4MNXA 4OS4A 1N1LA 1W14U 3MYWA 2ZF0H 1F0UA 3M7TA 4FUCA 5T6GA 1ETSH 2BX4A 2I6QA 1LCYA 2AIQA 1C1OA 2WV5A 2HOBA 2OC7A 1O5AB 1SLXB 1SSXA 4DIIH 1EAXA 1AY6H 1TNJA 1C1NA 1YCPK 3EQ0H 1MAXA 4TPYA 1SGYE 4XOJA 1QR3E 1T4VH 3ZV8A 1C5PA 2C90B 2WUCA 1QBVH 1S5SA 3M37A 1CT4E 2ZWLH 2IPHA 3BN9A 1ARBA 2Y5HA 4JZEH 2ANKH 1O3HA 3UR6A 1GG6C 3EDXB 4K3JA 3E0NB 2QY0B 2ZDAH 4ZH8A 2RCEA 2LPRA 3QN7A 4CR9A 2ZHQH 3GY6A 1C5MD 1C2KA 2OC0A 3VB6A 1TPAE 3MH6A 2HPQH 3U69H 5A0BA 1FY1A 1NRSH 5L2ZH 6GCHG 3TVJB 1SQOA 4KP0A 1A3BH 3V0XA 1TGTA 3OY5U 4ABIA 4CRCA 1GPZA 3ITIA 2ZDVH 4JYUH 2ZHDA 1AD8H 1MQ6A 1MKXK 1XUKA 2XBYA 1UTKA 2G5VA 1SGDE 3P8FA 3LONA 1AN1E 1NRRH 1HAVA 3ZYDA 4D76A 2HNTC 3TK5A 1GJ8B 4GCHG 1Z8GA 3ZVEA 4UEHH 2VH6A 3D62A 2G00A 2XYAA 3RC6A 2PR3A 1IQFA 1JIMA 1HYLA 1OP2A 1SGCA 3GY3A 1WUNH 2CGAA 2ZIQH 2FOCA 4U2WA 5C20A 4B76A 3Q77A 2OINA 3PWCA 1C1TA 2G4UA 3P17H 3M3SA 1GVLA 2UUKB 4NSVA 1Z8JB 1QJ7B 4BXWA 2C8YB 1Z7KA 3TU7H 1Z71A 3SJOA 1TNLA 3RMLH 1AUTC 1NFXA 5CE1A 3SGQE 4GAWA 1ZTKA 2D2DA 1W7XH 1AZ8A 1RD3B 2BM2A 4NGAH 3FFGA 5GWZA 1KIGH 3KGPA 3A89A 1QL7A 1C5YB 1RTKA 3ZZDA 1TPPA 1G3CA 2A7CA 3ZYEA 1TNKA 3UWIA 2DUCA 1FY3A 1B0EA 4K5ZA 7ESTE 3RXUA 2VU8E 3RXDA 3PTNA 4DOQA 1XX9A 2SNWA 1FY8E 3ZVFA 4HFPB 2B5TB 2ZFFH 2GV7A 3MH7A 3S9BA 3KN2A 2THFB 1V2LT 1QL8A 3RC5A 5HYOA 1HAXB 3FP7E 4IBLH 1BIOA 1YYY1 1MD8A 1OYQA 3PLBA 4X8SH 2JKHA 1AIXH 4JZFH 2BQ7B 4RKJB 1NPMA 4THNH 1ELCA 1IQLA 1BDAA 1AGJA 3Q00A 3SU1A 2P95A 4I8JA 1PPHE 4KTCA 2YNAA 1TWXB 4INLA 2CF8H 2B9LA 5AFYH 1O3BA 3U1JB 1UCYK 2ZU3A 4FUIA 1C5SA 1ESAA 4LZ4B 1E34B 1L4DA 2P59A 5F8ZA 4UFDH 3GY8A 4WMEA 4K8BA 3ZZ9A 3M7UA 4K69A 2FLRH 5EXLA 1DPOA 1YPHE 2BY7X 2C4FH 3FVFB 3ZZ8A 1LDTT 5DPAA 1THRH 1L1GA 1ANBA 1DE7H 2NU4E 3FZDA 4WF8A 2UUFB 5DKMA 1LHDH 3BTGE 3NPSA 1G32B 2ZGBH 1QBNA 2OQ5A 3MH4A 3RXBA 2WPMS 1DWEH 4ISIH 1GHWH 2AMDA 1L1JA 1V2UT 4U01A 1O3KA 1QQUA 3RXMA 1W0YH 2D8WA 3SNDA 1PQ7A 1WCZA 1C5OH 3ZVBA 4U30A 2R2WU 1GI4A 4NCYA 4ZKOU 5LH8A 1SR5C 1ZJDA 4AG2A 3ATIA 2BLWA 3M5OA 4X2XA 1IQHA 1MTUA 2ALVA 4TPIZ 4XSKU 1UMAH 1GJ4H 4MNVA 1S6FA 2BQWB 1AVWA 1OS8A 3MNXA 2A1DB 3GOVB 3Q3XA 2XWAA 1ID5H 1LPZB 1O2XA 2ZEBA 4H6TA 4WJG2 1PYTD 3QO6A 4Q2KA 1IQIA 1ZHRA 4UE7H 1MH0A 2Z3DA 3NWUA 2ZDLA 1O5GH 4ZUHA 5EGMA 1UJ1A 1KY9A 2SGFE 3DT0H 4X6NA 5ESTE 1BBRK 4ZKNU 3DFLA 1BTYA 1H4WA 1GMCF 3OSYA 3SV2H 4H4FA 3SUEA 1IQEA 1IAUA 3OTJE 3GCHB 1CA0B 1YF4A 1P2NA 3OY6U 1ANEA 1KXCA 2G52A 3SJKA 1O2OA 1BRBE 2Z3EA 4DIHH 1HLTH 1W12U 3M3TA 4Y11E 5A09A 1UTJA 3E91A 1DX5M 1K28D 5PTPA 3SZNA 1DY9A 1A0JA 1MBMA 2ZCLP 3M35A 4NIYA 3QK1A 3TJOA 1Y5UT 4ZKSU 1O5EH 2Z9GA 4JYVH 2OTVA 3BIUH 1FV9A 1UK3A 4Y10E 2NWNA 3NUMA 2BVXH 1YKTA 2J95A 5FPSA 1P2OA 4X1PU 4CRGA 5DGJA 1CGIE 3D49H 1QCPA 1KXEA 1O3FA 4BTIB 3UREA 1NC6A 5K0HA 1DM4B 1XXFA 2WPJS 1J17T 2W5EA 3V12A 1Q2WA 3P70B 3RLYH 2DE9A 1RGQA 3ZZ6A 3P8GA 3U9AH 2A5KA 5JPMH 5C1UA 1EPTB 5T6FA 1L1NA 2FEQH 1O33A 1BA8B 3K9XB 3L3TA 3GCHC 1CA0C 1S81A 2A4QA 3UNQA 1SGIB 4M7GA 3RC4A 1C1MA 1GJBB 1S85A 3VFEA 3S7KB 1ELDE 2GT7A 5AFZH 1NFUA 3FZZA 3BTEE 3TNSA 2UWOA 2B7DH 1DWBH 3T27A 3KL6A 5A0AE 2AMQA 1QGFA 5FBEA 2ZPSA 1DOJA 1FXYA 4IGDA 4Y7BA 1P2KA 4CRFA 4E7RG 2TIOA 2Z9IA 3BTME 3MO3A 4UDWH 5EQSA 3TGJE 2AYWA 3V3MA 1O3JA 2ZU4A 7GCHF 1HFDA 1V2VT 1O3AA 2AIPA 1C5TA 3U1IB 3V7TA 3LJOA 3GCTG 2ZQ1A 3TH3H 8ESTE 3LGTA 1O2PA 3KQDA 3RU4E 3BEFB 1INCA 8LPRA 1Q31A 1HAYB 3SNCA 1Y3XA 3V13A 1EZSC 2VWNA 6ESTA 2PV9B 5JB9S 1C2JA 1LQDB 4LXBH 3RXFA 1Y3VA 4B73A 3SBKA 1LPGB 3M5MA 1ZMLA 1VR1H 1WQSA 1GL0E 2OBQA 3IWMA 4JZ1A 4BTUB 1IQKA 2VH0A 4D7FA 1TMBH 2VIQA 4UFFH 1JWTA 1TBZH 1TX7A 2TPIZ 3DA9B 4WMFA 4Y8YA 4ABAA 2D26C 1UVUH 1GBHA 1OPHB 2FO9A 4INKA 1F0RA 1FPHH 2ZI2H 2JH0D 3E16B 1J8AA 3M7QA 2Z9KA 2Z7FE 3GICB 1GI7B 4FU9A 2P3UB 1MQ5A 4MLFB 1V6DA 1O3PB 1GBFA 1G2MA 2I6SA 1GBCA 1YCPM 3ZVGA 2AGIX 1T32A 2OD3B 3PMHB 1P57B 4LZ1H 1GI1A 1CE5A 4GHQA 4YLQH 4B2CA 1YM0A 2ZFSA 4Z0KA 1C1SA 3FP6E 1OX1A 1MU8B 2Z9JA 2FS9A 3UWJH 3T29A 2Z9LA 5FAHA 1BTXA 1FN6A 1W2KH 1SFQB 3GDVA 4O03A 4BOHA 1FAKH 1Y5AT 5A2MH 5GIBA 1SVPA 3MMGA 3PLPA 2BOHB 4XDEA 1GCDA 1KYNA 4ABFA 2FWWA 1HJ9A 2FOFA 3K65B 1O2LA 1D3QB 1HUTH 3W95A 1UK4A 1XUGA 3LC5A 1G2LA 4O3TA 3BTFE 1D9IA 2J34A 2OBOA 3ATLA 1A4WH 5AHGH 1HIAA 1PJPA 2XBXA 2AS9A 1E37B 1GDUA 2AH4X 3K6ZA 3KNXA 1O3OA 4TWWA 2ILNA 1HCGA 3RXTA 2G4TA 2C8WB 3A8AA 1CBWB 2DE8A 2ODYB 1S0RA 2Y5FA 1PPZA 1TX8A 2BXUH 3MU5A 1GVZA 1IQGA 1ESBA 3RXSA 3M3VA 3TNTA 2SGQE 2F3CE 2VIOA 4O9VA 1D6WA 1TMUH 2WINI 1HRTH 1O2QA 1SFIA 3SU3A 2F9PA 3IITA 4I8GA 1BMLA 4ESTE 1MD7A 3QX5H 4OS1A 1P05A 3RU4D 3AVZA 1AFQB 3H5CB 2BHGA 1XUJA 3KQEA 1GHXH 4X1RU 4I32A 1RTLA 1K21H 1PPGE 2ZCKP 2P3FH 1Y59T 1SB1H 5J4SA 2FOMB 1C5UA 2ZGCA 2W26A 2ZG0H 2ZGXH 1C1UH 1DITH 1FJSA 2QXGA 1CSOE 1O3NA 4X2VA 3VXEH 1CBWC 4AZ2B 3O8CA 4X6PA 1DDJA 3ZZAA 3MTYA 3T2NA 2H6MA 1V2JT 2BD4A 2CJIA 1HAGE 2A45B 3T28A 2Y5GA 1CGHA 5EXNA 1HPGA 1EAIA 1W0ZU 2PTNA 3JZ2B 1UTLM 1Z1JA 1V2WT 1QA0A 1LQEA 3LH3A 1UO6A 4Y71A 4Y79A 5IDKA 1NM6A 3VGCB 3L6PA 2BLOA 2JETB 1EAWA 3TK9A 3URDA 2CN0H 1AFQC 4ABHA 1SG8B 5DP3A 4DY7B 4D9QA 7KMEH 1SLWB 4WXVA 4OS2A 1HJ8A 2Q6GA 3EE0B 4ABEA 1C1RA 5DJ7A 4Q7ZA 4MVNA 4SGBE 2VB0A 1UVTH 1V3XA 1P06A 2GKVE 3KEEA 2Z6BD 1H9HE 1MKWH 9ESTA 3GYMA 3H7OA 4CHAB 3VEQB 2EC9H 2GT8A 1G3EA 4NSYA 1N6YA 3OX7U 1HDTH 4ZHAA 3ZZ7A 3MO9A 3VXFH 1GDQA 1G9IE 1O5BB 3H7TA 4AFZA 2PSXA 4X8UH 5F6MA 5A8ZA 3VGCC 2JETC 1RXPA 1HAVB 2A5IA 1HXEH 3CP7A 4NFFA 1C2IA 1K1NA 1JRSA 3A88A 2F9BH 3K6YA 4ZAEA 1ZR0A 1BT7A 4A1TA 5HGGA 2GCHG 3KCGH 1MUEB 4I8HA 2Q6DA 1GBBA 1O2ZA 2CXVA 2VINA 3LGVA 1A5GH 1O2HA 1C2MA 1GI6A 2WV4A 1O3DA 1TGSZ 1BJUA 2O8WA 2HNTF 4O97A 3MOCA 2KAIB 4XBDA 2AERH 4OS6A 4CHAC 5EPNA 1FUJA 1F5LA 4AN7A 3SO3A 2RDLA 3TGKE 1YPLH 1EJNA 3MNCA 4YLUA 2J4IA 5ESBA 2PTCE 3QTOH 2FM2A 2FYRA 1RS0A 1P2IA 3QUMP 5C5OA 1GVKB 4HTCH 2ZGJA 5E8EH 1J15A 2NU1E 2W3IA 1G36A 1O2SA 2PFEA 2ZHEH 2LNCA 1UK2A 4IC6A 1C4V2 3LKWA 4UD9H 4NIXA 1AFEH 2WUBA 2W3KA 2XXLA 5GDSH 1YPJH 2PKSB 1SLUB 8GCHG 3SJ9A 1UTPA 3SHCH 1O30A 3RUOA 1EZXC 1TONA 1ZMNA 1TA6A 2Y7XA 1NTPA 2BZAA 3HGNA 1SGQE 1WAYB 2QXJA 3RXGA 1XXDA 4XBBA 5DP8A 3NK8A 3HK6B 1VGCB 1EOJA 3ESTA 2VIPA 2XC4A 6GCHF 4F49A 3M36A 1XKBC 2IJOB 1MTNB 4MTBA 4SGAE 1IHTH 4X8TH 3RXHA 5HMAA 4X0WU 1KLTA 1DVAH 1ZRBA 4MPWA 1F0TA 4HGCA 5GCHG 2FLBH 5BRRE 1T4UH 2AGEX 3GY4A 4WMDA 2BD8A 4IW4E 4X2YA 8GCHF 1PQ5A 2BD5A 4GCHF 2BY9X 4AORA 2CV3A 2BDIA 3I77A 4OGYA 3PROA 3RM2H 5DP5A 1PFXC 4YT6H 4MPUA 2FIRH 1THPB 1TRNA 1O5CB 1YPKH 3OU0A 4ZHLU 2PKSC 1OWKA 3E90B 4WH8A 3SW2B 1GBKA 1MTWA 2Q1JA 1M9UA 3ZZ5A 5T3HA 1MBQA 4MQAA 1T8OA 2FTMA 3NKKA 5EODA 5FX5A 2XTTB 2QYIA 1ESTA 1C5WB 1VGCC 1NRQH 3F9HA 2RA3A 3F9FA 2BYAX 5GCHF 1MTNC 2JH5D 1GJDB 4X8VH 5DP7A 2FODA 1T8MA 1TBRH 2OXSA 1GHZA 2PKAA 4I7YH 4GVUA 3MWIU 2PSYA 2WPHS 3STIA 1V2OT 1O2NA 2CHAB 1C4U2 3MFJA 1FZZA 4AFQA 1V2PT 1SGFA 1SOTA 3AAVA 3SOSA 1TNGA 2XCNA 1GI3A 3ZZBA 1GI5A 4ZKRU 1ELGA 2FP7B 1F5RA 2BMGB 2O9QA 1E35B 4MPXA 2K1QA 2TGPZ 1C2DA 2J2UA 3SJ8A 4NA8A 2SGEE 2GX4A 3P8OA 3CS7A 1SQTA 3SHAH 1YBWA 3QZQA 5GPIB 2G81E 3SV7A 1KLJH 2FESH 2ODPA 1MZAA 2QA9E 1C2FA 3TH4H 1KDQA 4NZLA 1UVOA 1VCPA 1MCVA 3LC3A 3B23B 1DXWA 2H9TH 3KHVA 2VIWA 5GXPA 3ZVCA 2Z3CA 5FCRA 4QT8C 3A83A 1RRKA 1ZPCA 2GZ7A 1BCUH 1UHBB 2W7SA 1HV7A 1ZGIA 1OWHA 4I8LA 3KQCA 4ABJA 4B74A 1QNJA 4XBCA 2AFQB 3SU5A 2JH6D 2V35A 2BZ6H 3RXJA 1AMHA 3VPKA 1A7SA 2ESTE 3F1SB 4B2AA 3VB5A 1LTOA 3F6UH 1SLVB 1GBJA 2FOHA 2V3HH 2EI7A 1C2EA 4IC5A 2O8LA 1PYTC 1ZLRA 2SGPE 3RDZA 1S82A 1O2YA 2BDBA 5DO4H 4R8TB 1LVOA 5EW1H 3CS0A 1ZRKA 1PPBH 1HJAB 1FY5A 1HGTH 3ELAH 2NU3E 4K1TA 1JIRA 4NFEA 3BEIB 1P11E 1L2EA 1CGJE 1UCYE 2OQUA 6CHAB 4GHTA 5IYTA 1QHRB 1DWDH 2ZNKH 1DICA 3VB7A 1KXAA 4J1YA 1RTFB 3D23A 3P8NA 5F8TA 3ATMA 1AE5A 2WYJA 1N6XA 4BANB 1MKWK 5B6OA 5FPTA 2GVFA 4Q7XA 1W8BH 1GL1A 2WPKS 2CF9H 1BTUA 3Q76A 1KLIH 3M61U 1ELBA 5HM2A 2CMYA 1OKXA 1LHFH 1SGNE 1O34A 1UTQA 3I78A 4NG9H 1MMJN 1VCWA 1LKAA 2ZHFH 4IN1A 4J2YB 4AYVB 2BDHA 3VB4A 3BTTE 4YTAA 2BB4A 2ZECA 3E0PB 5DP6A 2ZGHA 1HJAC 1YGCH 2W7UA 4CBOA 1OWDA 1PPFE 1IHSH 1SI5H 2QAAA 1LVBA 4BAOB 6CHAC 1ZJKA 1AU8A 3A84A 2SFAA 2QF3A 3BG8A 1GJCB 3BG4B 3NCLA 3RXAA 4Y8XA 2FI5E 3E3TA 3PO1B 1QBOA 1YPHC 3R0FA 1BUIA 1RFNA 2B0FA 4PROA 2WPIS 4Y0ZE 3ODDA 2FX4A 2BTCE 3URCA 1P2MA 3T5FH 1OOKB 5FX6A 1BBRE 5ETXA 3P95A 1GI0A 1HAOH 1PPEE 1AKSA 4NA7A 3S7HB 3QDZB 5HM9A 1BRUP 2Z94A 1V2RT 5JDUB 1TA2A 2J38A 2P3TB 3ENSB 2ALPA 1EPTC 2SGDE 1ORFA 3STJA 1Z1IA 3SI3H 1AZZA 1P3EA 2FXRA 1O31A 4YO9A 5FCKA 2GP9B 2HWLB 3BG4C 4WH6A 1K2I1 5E2OA 1NT1A 4FUGA 3TITA 3QLPH 3PO1C 5TCAA 4FXGH 2ZHWH 4TYDA 2QXIA 3B9FH 1OWJA 1MZDA 4CBNA 3MU4A 2HPPH 1K1MA 5TJXA 3HATH 1YP9A 3QZRA 1DY8A 5AVDA 2ZFQH 2BY6X 4NZQA 1E36B 3Q3KA 1T7CA 1Z8RA 5G4BA 2NU2E 1AUJA 4RN6A 3GCTF 5CMXH 3ZV9A 3NZIA 3O8DA 3GYLB 3LT3A 4WVPE 2FI4E 5A8XA 2A4GA 5E2PA 1A2CH 3A86A 1O39A 5A0CA 3ATWA 1WV7H 3GISB 5EOKA 3ZZ3A 1CU1A 1A46H 5C5NA 2A4RA 2FYQA 4YM9A 2YNBA 5E0HA 5H4IB 1BQYA 1QTFA 2H9EH 3RXEA 5LPRA 1H9IE 1JOUB 1QB9A 5LPEA 4CRAA 1Y5BT 3LJJA 5CHAB 5JBAS 2B8OH 3SN8A 3O8RA 3BTWE 1GJ7B 2OP9A 3A8CA 3BTKE 1WU1A 2HGTH 3QTVH 2BDYA 2Q6FA 3RXIA 2ANMH 1Y3YA 1XKAC 4NIWA 2XCFA 1K1IA 2C8XB 1XM1A 5AF9H 5C1XA 1SGEE 4HI3A 2GDDA 1EJAA 2ZU2A 3P6ZB 3RXVA 4BTTB 4CR5A 4FUJA 1ETTH 1QFKH 5BPEA 1K1PA 1ZSKA 7LPRA 5JBTA 1Z6EA 3MI4A 1G3DA 3MNSA 2FX6A 1B0FA 4OS5A 3UNRA 1SGTA 2QIQA 2GMTB 3TIUA 5LPFA 1J16A 4YOJA 2VIDA 3SJIA 4ABDA 1C5QA 1O2MA 2FMJA 1A0LA 2A2QH 2OCVB 2YOLA 5EW2H 4TY7A 1GJ9B 1WTHD 5L30H 3PMJA 3RMNH 4JZIA 2VWLA 1Y8TA 3SQHE 5JYIA 3HKJB 1SL3A 1DANH 1DT2A 1SHHB 2BY8X 4GPGA 1XUFA 1NZQH 4K1EA 4NA9H 1RIWB 4K2YA 2ZO3H 3Q3YA 2ZTZA 3RM0H 1ACBE 5C2ZA 1O0DH 1UTNA 2VGCB 2P93A 4TWYA 1A3EH 3A7XA 1AO5A 1ETRH 2STBE 1GI9B 1WOFA 3SUDA 1DFPA 3TPIZ 3PB1E 1LVYA 1YLDA 1O2JA 4AX9H 1BJVA 3BTQE 2ZU1A 5EU8A 1GMHG 3EGKH 1O5DH 1BMMH 1JXPA 1WTGH 2V6NA 2HNTE 3A81A 1GHAG 1ELFA 1GJ6A 3TJUA 3UPEA 2UWLA 3MO6A 2Y82A 3RXPA 1C5RA 1NRNH 3EA7A 4ASHA 1XMNB 1WBGB 1BTZA 1G30B 1RIWC 1TALA 4I8KA 5FPYA 2ZPRA 3KF2A 1C2LA 1QIXB 1IQJA 1EJMA 2F9VA 1YLCA 2RA0A 3E6PH 4X2WA 3SORA 1T31A 3R3GB 1T8LA 1XVMA 1GMHF 2ZDNA 2A32A 4ABBA 4YZUA 2BY5X 1BHXB 2R3YA 3RXCA 4ISNA 1TQ7B 4YOGA 4B71A 2OC1A 4ZMAH 1G37A 1GHAF 3GY2A 4XE4A 2A7JA 1CO7E 1HNEE 3UR9A 1GBAA 4AOQA 1AQ7A 1Z8IB 2NU0E 2GZ9A 4FVDA 1MAYA 1WYKA 1NFYA 2BXTH 1ZTLA 2Y81A 1C5LH 3LH1A 1YPGH 1CQQA 1AVGH 3L33A 4WXIA 3T26A 3LPRA 4LOYH 1SMFE 1C2HA 2GDEH 1DLEA 4UONA 1K1JA 3O8BA 1C5XB 2AGGX 1DUAA 4JK5A 1CHOG 4LK4A 1TB6H 2EI8A 1F7ZA 1YC0A 1CT0E 4YOIA 2BLQA 1P02A 1GHBG 4KTSA 1FI8A 5I46H 4DG4A 4BAMB 4F4OC 1F2SE 5E0GA 1S0QA 2RG3A 2GD4B 2V3OH 1C2GA 1V2QT 4BXSA 1FQ3A 1O32A 2BOKA 1SOZA 2FTLE 3SGBE 2PUQH 2F9NA 1P10A 1H8DH 4CH8B 3A80A 1C1PA 1HAHH 1TOCB 4JCNA 3RXKA 3UQOA 3LGIA 2GCHF 4FUDA 4AYYB 1EUFA 5C1YA 1QRWA 1TGCA 1QY6A 4BAHB 1CHOF 4I31A 3HKIB 2GZ8A 4X6MA 3SQEE 2VWMA 1GBLA 1GBMA 4ZXYH 1P2QA 2F9OA 2BVRH 1GHBF 1C5NH 1EP5A 4AB8A 4GSOA 3UFAA 1ELAA 1G3BA 1GI8B 1GBEA 1P01A 3QWCH 1O2IA 2VVUA 2A7HA 1FMGA 4K8YA 4KELA 2WPLS 1GDNA 2XBVA 1SGFG 1L4ZA 2VVCA 2GGVB 3F9EA 4MNWA 1P9SA 3AW0A 1O3LA 5DP4A 1DXPA 1ELTA 2C8ZB 3D65E 2IN2A 2O8MA 2G55A 2G51A 1HXFH 2PKAB 1U6QA 1OWIA 3GY7A 1GCTB 4AGJA 4Y6DA 2J92A 2VIVA 4X1QU 3A7ZA 2TGTA 5EQRA 1OYTH 1FDPA 3A8DA 1TX6A 1E0FD 1ZTJA 1BMAA 2O8UA 1D6RA 1ZZZA 4I33A 2KAIA 2H1UA 2VNTA 1P8VC 3BV9B 1EQ9A 2BD2A 5EXMA 1O3GA 1V2KT 3G01A 1C5ZB 3UOUA 3B8JA 1QB1A 1KDQB 2J9NA 3MHWU 2H9HA 2H5DA 4E05H 3CENA 4KKDA 3ZZCA 1IQNA 1TAWA 1BRCE 3MH5A 5TCCA 3PM3A 4TY6A 1HBTH 2A4OA 1P9UA 1WSSH 5L2YH 4ISOA 3S9AA 4HZHA 2G8TA 5DP9A 1DSTA 4A1XA 1T8NA 2XWBI 1TIOA 2C93B 5JB8S 1GCTC 1HB0B 1XUIA 1OWEA 3RP2A 1TPOA 2QF0A 3M5NA 2VWOA 2FS8A 4ZXXH 1AWHB 2WYGA 3K2UA 4E06H 3QGJA 4Q7YA 3VB3A 1TLDA 4FUFA 1B7XB 4JK6A 4MNYA 3BTDE 2EA3A 2XC5A 4OGXA 4IMZA 1SGRE 1FIWA 4X1SU 3A7VA 1TNIA 1A5IA 4Y0YE 3SU0A 1DSUA 4KGAA 1SHYA 2UWPA 1ELEE 3LIWA 1EATA 1GWAA 4GLYA 3C1KA 3FAOA 1UTMA 2PWXA 1HAPH 3PMAB 2VVVA 1KTTB 3BF6H 1ZHMA 2XNIA 3GY5A 1EP6A 3EYDA 2HLCA 1BB0B 4AG1A 1NY22 2PUXB 5L6NH 3S9CA 1TABE 1QURH 9LPRA 1O38A 2TRMA 1J14A 1QL9A 4Z6AH 1DUEA 1O2GH 3DHKH 5ABWA 1QRZA 1XVOA 1GBTA 1K9OE 2QN5T 1P03A 2UUJB 3AAUA 1NN6A 4CH2B 1WQVH 2GTBA 2HVXA 2ZPQA 1P12E 3U98H 2GCTB 3MU8A 2CHAC 4GUXA 2QC2A 1FPCH 1O3CA 1SC8U 2FDAA 1DWCH 1PQAA 1VCQA 1Z6JH 2XC0A 3SV9A 3F9GA 1NESE 1LVMA 1MTSA 2R9PA 3ODFA 5C3NA 3HK3B 5EQQA 1O2TA 4B75A 3E1XB 4Q80A 2UUYA 1CVWH 4H6SB 1J9CH 1AI8H 2XRCA 1JBUH 1GMCG 1PQ8A 4YESB 3JZ1B 4B1TA 3ATKA 1H9LB 1TE0A 1EKBB 1C9TA 4O3UA 4A1VA 2ZDMA 2M5TA 3LDXH 1O2WA 1EASA 1K1OA 1ZGVA 1GMDG 1YPMH 3LGWA 1FIZA 1S6HA 3MU0A 1EOLA 4NWKA 1Q3XA 3BTHE 1JMOH 1ELVA 2D1JA 5K7RA 5F03A 4DW2U 1TNHA 3DUXH 5FXLA 3F68H 8KME2 1F0SA 5EG4A 1RJXB 3A7WA 1HAZB 1SPJA 2IOTA 4BNRA 2R3UA 3DD2H 2P94A 1A0HB 3LOXA 3ZZ4A 2GCTC 3TJVA 2ZCHP 1A5HA 1HAIH 6LPRA 2ANYA 2TBSA 4XFQA 1O3IA 3LGYA 3N7OA 1FN8A 3NXPA 2H2ZA 2ZQ2A 1QQ4A 4VGCB 5FHTA 4IMQA 3RMMH 4OS7A 1OP8A 1BZXE 1TGNA 1VZQH 1CA8B 1GMDF 1L0ZA 1W11U 2GV6A 1AKSB 1O36A 1S83A 1W3CA 3GCNA 4KTUA 3RXOA 1QRXA 2R0LA 1UHBA 4JYTA 2OLGA 5DG6A 5E0JA 2ZFTA 1TMTH 1UVSH 1BTPA 1GI2A 1O2VA 4FU7A 1GGDB 1ZMJA 4E7NA 3SGAE 1ZYOA 2H5CA 1GBIA 2OC8A 1SQAA 2FI3E 1O2RA 1FONA 2ZFRH 1TRYA 3UNSA 3DFJA 2BDCA 2ANWA 2ODQA 3OYPA 2F9UA 1GJ5H 1IQMA 3TK6A 1NFWA 1K22H 1FLEE 2Y7ZA 3UUZA 4DT7B 5JBBS 3GDSA 1UTOA 5EPYA 1YCPH 2Y80A 3AW1A 1PPCE 1ANCA 2EEKA 1EB1H 3TH2H 2FOGA 4VGCC 4Y7AA 1LHEH 3PYHA 1B5GH 2AEIH 7GCHG 3UIRA 1C1QA 4DVAU 3RMOH 1KXFA 1N8OB 1OSSA 2TGAA 2R0KA 2Y6TA 5T6DA 2ZU5A 3GCOA 3RXLA 1EX3A 1VJ9U 1V2TT 1QA7A 4MG3A 1CHGA 2P16A 3A8BA 1GGDC 3HGPA 2A0QB 3SU6A 3S0NA 3ZVAA 1X7AC 4A5TS 1E38B 3PV4A 4FUBA 1C5VA 1BMNH 1YPEH 3GDUA 3P92A 2BD7A 4AB9A 1FY4A 1SGPE 4X1NU 4WY3A 1GHYH 3A7TA 4FUHA 1CT2E 3M5LA 1TBQH 1XUHA 4ISLA 4AFSA 1P2JA 2PW8H 4K1SA 3SNEA 3SUGA 2PHBA 1TQ0B 1ZOMA 1AHTH 1IOEA 1EZUC 1F5KU 2FOAA 4DURA 1MKXH 1D3PB 1ZPZA 1EPTA 4NWLA 1SBWA 3SUFA 1W13U 2PGQB 2F91A 3MNBA 1A1RA 2QCYA 3A7YA 1QJ1B 1GHVH 3LGUA 1N8OC 4U32A 1HIAB 1Y3UA 3SI4H 2FPZA 3IG6B 2ZTXA 4BAQB 1D4PB 1F92A 4RSPA 1S84A 1TYNA 1FAXA 1C9PA
chains in the Genus database with same CATH superfamily
1OP0A 3SZEA 4CRBA 2BDAA 2ZKSA 1NO9H 4X6OA 3UTUH 3S69A 1BRAA 3FP8E 1H1BA 1OHHD 2SNVA 4JMYA 3W94A 1BTWA 1QB6A 1MCTA 1MTVA 3RLWH 4A7IB 2A31A 3SU2A 4DCDA 4Q63A 1S6LA 5FBIA 1NU7B 3UY9A 4RKOB 1NROH 1TGBA 1BITA 4IN2A 3RU4T 4IS5A 1ABIH 1O2UA 3SV8A 1O3EA 4D9RA 1VITG 1BOQA 2P8OB 4MPVA 1TRMA 1COWD 3UQVA 1LMWB 4FU8A 1ANDA 4NIVA 4WWYA 4Y8ZA 4K60A 3EAJA 4D7GA 3KIDU 4DT4A 4AGKA 2STAE 1V2NT 1KXBA 2R2MB 2FOBA 2ZA5A 1TFXA 2ZZUH 3UOPA 4ACAA 3TLOA 1GJAB 3HPTB 1YWUA 2BDGA 2KX4A 1DLKB 2PGBB 1UVPA 2SGAA 3LU9B 4DJZB 2VJ1A 1Y3WA 2J97A 2FOEA 3PWBA 3C27B 1O2KA 3EA8A 3BIVH 1VITF 3T62A 4ABGA 1DS2E 4UFGH 1UCYH 1LKBA 4H42U 1ZSJA 3BEUA 4A92A 1EXFA 5CHAC 1V2ST 1H8IH 1K1LA 2XW9A 1W10U 1KXDA 4CREA 2P8OC 3A82A 3E8LA 2QF5A 3MU1A 1TOMH 1GBDA 2G5NA 3TJNA 4FVBA 4UFEH 1P04A 3U8RH 3U8TH 2BLVA 3SNAA 1WXRA 3PLKA 5B6LA 1AE8H 3F0OA 4MDSA 3PTBA 4YT7H 2O8TA 1LPKB 1O3MA 3AASA 4ISHH 3EA9A 5J4QA 3RXRA 3PMBB 5I25A 1AB9B 1ZPBA 5JBCS 1P3CA 4AFUA 2BD3A 2QXHA 3I29A 3KQBA 1V2MT 1C1WH 3QGNB 3SV6A 1OXGA 1EB2A 3A85A 4DGJA 5F8XA 2J94A 5A8YA 4D8NA 1C4Y2 1VKYA 1ZSLA 2JJ1D 2ULLA 3PRBA 1FNIA 1P0SH 3W1EA 5C67A 2GMTC 2A5AA 2A2XH 4INHA 1QJ6B 1BTHH 2V0BA 5EIYA 1C1VH 4JZDH 2BVSH 2FZZA 2ZFPH 3TGIE 1D3DB 1W0JD 1P09A 1TPSA 1O5FH 3T25A 2EI6A 4B2BA 2BX3A 1FX0B 3OEHD 1THSH 1NS3A 2AMPA 3SNBA 4Y76A 2HRVA 1LO6A 2WHXA 1O35A 4CRDA 3RXQA 1ARCA 1BBRH 2BQ6B 2VGCC 2ZDKA 4FUEA 5GJ4B 1JRTA 1D3TB 2ASUB 1MU6B 2BD9A 5DK1A 1AB9C 4BAKB 1O37A 3U8OH 1NU9A 1KTSB 2PLXA 2ZTYA 2F83A 2QGRA 5SGAE 1AVXA 2HALA 1EAUA 1VJAU 3BSQA 1ABJH 1GG6B 1LHCH 2OUAA 2TGDA 4ZROA 1A61H 3ZVDA 1AWFH 2XBWA 4A6LA 2QV1A 5LGOA 1NRPH 1BHXF 1EZQA 4ZHMU 1W7GH 2ZC9H 4R0IA 3A87A 5HXFA 3WY8A 1KSNA 1VITH 2C3SA 3FANA 1LHGH 3SU4A 1ZHPA 3VG8A 2ZP0H 4MNXA 4OS4A 1N1LA 1W14U 3MYWA 2ZF0H 1F0UA 3M7TA 4FUCA 5T6GA 1ETSH 2BX4A 2I6QA 3F3BA 1LCYA 2AIQA 1C1OA 2HLDD 2HOBA 2WV5A 2OC7A 1O5AB 1SLXB 3PRDA 1SSXA 4DIIH 1EAXA 1AY6H 1TNJA 1C1NA 1YCPK 3EQ0H 1MAXA 4TPYA 1SGYE 2KR7A 4XOJA 1QR3E 1T4VH 3ZV8A 1C5PA 4YXWD 2C90B 2WUCA 1QBVH 1S5SA 3M37A 1CT4E 2ZWLH 2IPHA 3BN9A 1ARBA 2Y5HA 4JZEH 2ANKH 1O3HA 3UR6A 1GG6C 3EDXB 4K3JA 3E0NB 2QY0B 2ZDAH 4ZH8A 2RCEA 2YMSD 2LPRA 3QN7A 4CR9A 2ZHQH 3GY6A 1C5MD 1C2KA 2OC0A 3VB6A 1TPAE 2XNDD 3MH6A 2HPQH 3U69H 5A0BA 1FY1A 1NRSH 5L2ZH 6GCHG 3TVJB 1SQOA 4KP0A 2WZQA 1A3BH 3V0XA 1TGTA 3OY5U 4ABIA 4CRCA 1GPZA 3ITIA 2ZDVH 4JYUH 2ZHDA 1AD8H 1MQ6A 1MKXK 1XUKA 2XBYA 1UTKA 2G5VA 1SGDE 3P8FA 3LONA 1AN1E 1NRRH 1HAVA 3ZYDA 4D76A 2HNTC 3TK5A 1GJ8B 4GCHG 1Z8GA 3ZVEA 4UEHH 2VH6A 3D62A 2G00A 2XYAA 3N99A 4XRNA 3RC6A 2PR3A 1IQFA 1JIMA 1HYLA 1OP2A 1SGCA 3CNRA 3GY3A 1WUNH 2CGAA 2ZIQH 2FOCA 4U2WA 5C20A 4B76A 3Q77A 2OINA 3PWCA 1C1TA 2G4UA 3P17H 3M3SA 1GVLA 2UUKB 4NSVA 1Z8JB 1QJ7B 4BXWA 2C8YB 1Z7KA 3TU7H 1Z71A 3SJOA 1TNLA 3RMLH 1AUTC 1NFXA 5CE1A 3SGQE 5FL7D 4GAWA 1ZTKA 2D2DA 1W7XH 1AZ8A 1RD3B 2BM2A 4NGAH 3FFGA 5GWZA 1KIGH 3KGPA 3A89A 1QL7A 1C5YB 1RTKA 3ZZDA 1TPPA 1G3CA 2A7CA 3KYGA 3ZYEA 1TNKA 3UWIA 2DUCA 1FY3A 1B0EA 4K5ZA 7ESTE 3RXUA 2VU8E 3RXDA 3PTNA 2LELA 4DOQA 1XX9A 2SNWA 1FY8E 3ZVFA 4HFPB 2B5TB 2ZFFH 2GV7A 3MH7A 3S9BA 3KN2A 2THFB 1V2LT 1QL8A 3RC5A 5HYOA 1HAXB 3FP7E 4IBLH 1BIOA 1YYY1 1MD8A 1OYQA 3PLBA 4X8SH 2EY4C 2JKHA 1AIXH 4JZFH 2BQ7B 4RKJB 1NPMA 4THNH 1ELCA 1IQLA 3DSPA 1BDAA 1AGJA 3DSGA 3Q00A 3SU1A 2P95A 4I8JA 1PPHE 4KTCA 2YNAA 1TWXB 4INLA 2CF8H 2B9LA 5AFYH 1O3BA 3U1JB 1UCYK 2W6JD 2ZU3A 4FUIA 1E1RD 1C5SA 1ESAA 4LZ4B 1E34B 1L4DA 2P59A 5F8ZA 4UFDH 3GY8A 4WMEA 4K8BA 3ZZ9A 3M7UA 4K69A 2FLRH 5EXLA 1DPOA 1YPHE 2BY7X 2C4FH 3FVFB 4XD7D 3ZZ8A 1LDTT 5DPAA 1THRH 1L1GA 1ANBA 1DE7H 2NU4E 3FZDA 4WF8A 2UUFB 5DKMA 1LHDH 3BTGE 3NPSA 1G32B 3PV2A 2ZGBH 1QBNA 2OQ5A 3MH4A 3RXBA 2WPMS 1DWEH 4ISIH 1GHWH 2AMDA 1L1JA 3OEED 1V2UT 4U01A 1O3KA 1QQUA 3RXMA 1W0YH 2D8WA 3SNDA 1PQ7A 1WCZA 1C5OH 3ZVBA 4U30A 2R2WU 1GI4A 4NCYA 2EQNA 4ZKOU 5LH8A 1SR5C 2K0QA 1ZJDA 4AG2A 5EJZA 3ATIA 2BLWA 3M5OA 4X2XA 1IQHA 1MTUA 2ALVA 4TPIZ 4XSKU 1UMAH 1GJ4H 4MNVA 1S6FA 2BQWB 1AVWA 1OS8A 3MNXA 2A1DB 3GOVB 3Q3XA 2XWAA 1ID5H 1LPZB 1O2XA 2ZEBA 4H6TA 4WJG2 1PYTD 3QO6A 4Q2KA 1IQIA 1MABB 1ZHRA 4UE7H 5T1VA 1MH0A 2Z3DA 3NWUA 2ZDLA 1O5GH 4ZUHA 5EGMA 1UJ1A 2KCAA 1KY9A 2SGFE 3DT0H 4X6NA 5ESTE 1BBRK 4P00A 4ZKNU 3DFLA 1BTYA 1H4WA 1GMCF 3OSYA 3SV2H 4H4FA 3SUEA 1IQEA 1IAUA 3OTJE 3GCHB 1CA0B 1YF4A 1P2NA 3OY6U 1ANEA 1KXCA 2G52A 3SJKA 1O2OA 1BRBE 5DSFA 2Z3EA 4DIHH 1HLTH 1W12U 3M3TA 4Y11E 5A09A 1UTJA 3E91A 1DX5M 1K28D 5PTPA 3SZNA 1DY9A 1A0JA 1MBMA 2ZCLP 3M35A 4NIYA 3QK1A 3TJOA 1Y5UT 4ZKSU 1O5EH 2Z9GA 4JYVH 2OTVA 3BIUH 1FV9A 1UK3A 4Y10E 5EJLA 2NWNA 3NUMA 2BVXH 1YKTA 2J95A 5FPSA 1P2OA 4X1PU 4CRGA 5DGJA 1CGIE 3D49H 1QCPA 1KXEA 1O3FA 4BTIB 3UREA 1NC6A 5K0HA 1DM4B 1XXFA 2WPJS 1J17T 2W5EA 3V12A 1Q2WA 3P70B 3RLYH 2DE9A 1RGQA 3ZZ6A 3P8GA 3U9AH 2A5KA 5JPMH 5C1UA 1EPTB 5T6FA 1L1NA 2FEQH 1O33A 1W0KD 1BA8B 3K9XB 3L3TA 3GCHC 4ASUD 1CA0C 1S81A 2A4QA 3UNQA 1SGIB 4M7GA 1SQRA 3RC4A 1C1MA 1GJBB 5HKKD 1S85A 3VFEA 3S7KB 1ELDE 2GT7A 5AFZH 1NFUA 3FZZA 3BTEE 3TNSA 2UWOA 3PV5A 2B7DH 1DWBH 3T27A 3KL6A 5A0AE 2AMQA 1QGFA 5FBEA 2ZPSA 1DOJA 1FXYA 4IGDA 4Y7BA 1P2KA 4CRFA 4E7RG 2TIOA 2Z9IA 3BTME 3MO3A 4UDWH 5EQSA 3TGJE 2AYWA 3V3MA 5C94A 1O3JA 2ZU4A 7GCHF 1HFDA 1V2VT 1O3AA 2AIPA 1C5TA 3U1IB 3V7TA 3LJOA 3GCTG 2ZQ1A 3TH3H 8ESTE 3LGTA 1O2PA 3KQDA 3RU4E 3BEFB 1INCA 8LPRA 1Q31A 1HAYB 3SNCA 1Y3XA 3V13A 1EZSC 2VWNA 6ESTA 2PV9B 5JB9S 1C2JA 1LQDB 4LXBH 3RXFA 1Y3VA 4B73A 3SBKA 1LPGB 3M5MA 1ZMLA 1VR1H 1WQSA 1GL0E 2OBQA 3IWMA 4JZ1A 4BTUB 1IQKA 2VH0A 4D7FA 1TMBH 2VIQA 3DSOA 4UFFH 1JWTA 1TBZH 1TX7A 2TPIZ 3DA9B 4WMFA 4Y8YA 4ABAA 4RT1A 2D26C 1UVUH 1GBHA 1OPHB 2FO9A 4INKA 1F0RA 1FPHH 2ZI2H 2JH0D 3E16B 5HIYA 1J8AA 3M7QA 4F55A 2Z9KA 2Z7FE 3GICB 1GI7B 4FU9A 2P3UB 1MQ5A 4MLFB 1V6DA 1O3PB 1GBFA 1G2MA 2I6SA 1GBCA 1YCPM 3ZVGA 2AGIX 1T32A 2OD3B 3PMHB 1P57B 4LZ1H 1GI1A 1CE5A 4GHQA 4YLQH 2WPDD 4B2CA 1YM0A 2ZFSA 3OE7D 4Z0KA 1C1SA 3FP6E 1OX1A 1MU8B 2Z9JA 2FS9A 3UWJH 3T29A 2Z9LA 5FAHA 1BTXA 1FN6A 1W2KH 1SFQB 3GDVA 4O03A 4BOHA 1FAKH 1Y5AT 5A2MH 5GIBA 1SVPA 3MMGA 3PLPA 2BOHB 4XDEA 1GCDA 1KYNA 4ABFA 2FWWA 1HJ9A 2FOFA 2XOKD 3K65B 1O2LA 1D3QB 1HUTH 3W95A 1UK4A 1XUGA 3LC5A 1G2LA 4O3TA 5KEDA 2RFKC 3BTFE 1D9IA 2J34A 2OBOA 3ATLA 1A4WH 5AHGH 1HIAA 1PJPA 2XBXA 2AS9A 1E37B 1GDUA 2AH4X 3K6ZA 3KNXA 1O3OA 3UAIC 4TWWA 2ILNA 1HCGA 3RXTA 2G4TA 2C8WB 1KMHB 3A8AA 1CBWB 2DE8A 5C0UA 2ODYB 1S0RA 2Y5FA 3WW7A 1PPZA 3FKSD 1TX8A 1QZ8A 2BXUH 3OAAD 3MU5A 1GVZA 1IQGA 2W6ID 1ESBA 3RXSA 3M3VA 2KCPA 3TNTA 2SGQE 2F3CE 2VIOA 4O9VA 1D6WA 1TMUH 2AHME 2WINI 1HRTH 1O2QA 1SFIA 3SU3A 2F9PA 3IITA 4I8GA 1BMLA 4ESTE 5CDFE 1MD7A 3QX5H 4OS1A 1P05A 4M9FA 3RU4D 3AVZA 1AFQB 3H5CB 2BHGA 1XUJA 3KQEA 1GHXH 4X1RU 4I32A 1RTLA 1K21H 1PPGE 2ZCKP 2P3FH 1Y59T 1SB1H 5J4SA 2FOMB 1C5UA 2ZGCA 2W26A 2ZG0H 2ZGXH 1C1UH 1DITH 1FJSA 2QXGA 1CSOE 1O3NA 4X2VA 3VXEH 1CBWC 4AZ2B 3O8CA 4X6PA 1DDJA 3ZZAA 3MTYA 3T2NA 2J5UA 2H6MA 1V2JT 2BD4A 2CJIA 1HAGE 2A45B 3T28A 2Y5GA 1CGHA 5EXNA 1HPGA 1EAIA 1W0ZU 2PTNA 3JZ2B 1UTLM 1Z1JA 1V2WT 1QA0A 1LQEA 3LH3A 1UO6A 4Y71A 4Y79A 5IDKA 1NM6A 3VGCB 3L6PA 2BLOA 2JETB 1EAWA 3TK9A 3URDA 2CN0H 1AFQC 4ABHA 1SG8B 5DP3A 4DY7B 4D9QA 7KMEH 1SLWB 4WXVA 4OS2A 1HJ8A 2Q6GA 3EE0B 4ABEA 1C1RA 5DJ7A 4Q7ZA 4MVNA 4SGBE 2VB0A 1UVTH 1V3XA 1P06A 2GKVE 3KEEA 2Z6BD 1H9HE 1MKWH 9ESTA 2YMSB 3GYMA 3H7OA 4CHAB 3VEQB 2EC9H 2GT8A 1G3EA 4NSYA 1N6YA 3OX7U 1HDTH 4ZHAA 3ZZ7A 3MO9A 3VXFH 1GDQA 1G9IE 3H09A 1O5BB 3H7TA 4AFZA 2PSXA 4X8UH 5F6MA 5A8ZA 3VGCC 2JDID 2JETC 1RXPA 1HAVB 2A5IA 1HXEH 3CP7A 4NFFA 1C2IA 1K1NA 1JRSA 3A88A 2F9BH 3K6YA 4ZAEA 1ZR0A 1BT7A 4A1TA 5HGGA 2GCHG 3KCGH 5HIZA 1MUEB 4I8HA 2Q6DA 1GBBA 1O2ZA 2CXVA 2VINA 3LGVA 1A5GH 1O2HA 1C2MA 1GI6A 2WV4A 1O3DA 1TGSZ 1BJUA 2O8WA 2HNTF 4O97A 3MOCA 2KAIB 2YMSC 4XBDA 2AERH 4OS6A 4CHAC 5EPNA 1FUJA 1F5LA 4AN7A 3SO3A 2RDLA 3TGKE 1YPLH 1EJNA 3MNCA 4YLUA 2J4IA 5ESBA 2PTCE 3QTOH 2FM2A 2FYRA 1RS0A 1P2IA 3QUMP 5C5OA 1GVKB 4HTCH 2ZGJA 5E8EH 1J15A 2NU1E 2W3IA 1G36A 1O2SA 2PFEA 2ZHEH 2LNCA 1UK2A 4IC6A 1C4V2 3LKWA 4UD9H 4NIXA 1AFEH 2WUBA 2W3KA 2XXLA 5GDSH 1YPJH 2PKSB 1SLUB 8GCHG 3SJ9A 1UTPA 3SHCH 1O30A 3RUOA 1EZXC 1TONA 1ZMNA 1TA6A 2Y7XA 1NTPA 2BZAA 3HGNA 1SGQE 1WAYB 2QXJA 3RXGA 1XXDA 2WV9A 2F43B 4XBBA 5DP8A 3NK8A 3HK6B 1VGCB 1EOJA 3ESTA 2VIPA 2XC4A 6GCHF 4F49A 3M36A 1XKBC 1SKYE 2IJOB 1MTNB 4MTBA 4SGAE 1IHTH 4X8TH 3RXHA 5HMAA 4TSFD 2IJD1 4X0WU 1KLTA 1DVAH 3U28C 1ZRBA 4MPWA 1F0TA 4HGCA 5GCHG 2FLBH 5BRRE 1T4UH 2AGEX 3GY4A 4WMDA 3KQ5A 2BD8A 2K8IA 4IW4E 4X2YA 8GCHF 1PQ5A 2BD5A 4GCHF 2BY9X 4AORA 2CV3A 2BDIA 3I77A 4OGYA 3PROA 3RM2H 5DP5A 1PFXC 4YT6H 4MPUA 2FIRH 1THPB 1TRNA 1O5CB 1YPKH 3OU0A 4Q4LA 4ZHLU 2PKSC 1OWKA 3E90B 4WH8A 3SW2B 1GBKA 1MTWA 2Q1JA 1M9UA 3ZZ5A 5T3HA 1MBQA 4MQAA 1T8OA 2FTMA 3NKKA 5EODA 5FX5A 2XTTB 2QYIA 1ESTA 5KGOA 1C5WB 1VGCC 1NRQH 3F9HA 2RA3A 3F9FA 2BYAX 5GCHF 1MTNC 2JH5D 1GJDB 4X8VH 5DP7A 2FODA 1T8MA 1TBRH 2OXSA 1GHZA 2PKAA 4I7YH 4GVUA 3MWIU 2PSYA 2WPHS 3STIA 1V2OT 1O2NA 2CHAB 1C4U2 3MFJA 1FZZA 4AFQA 1V2PT 1SGFA 1SOTA 3AAVA 3SOSA 1TNGA 1E1QD 1GI3A 2XCNA 3ZZBA 1GI5A 4ZKRU 1ELGA 2FP7B 1F5RA 2BMGB 2O9QA 1E35B 4MPXA 2K1QA 2TGPZ 1C2DA 2J2UA 3SJ8A 4NA8A 2SGEE 2GX4A 3P8OA 3CS7A 1SQTA 3SHAH 1YBWA 3QZQA 5GPIB 2G81E 3SV7A 1KLJH 2FESH 2ODPA 5GNDA 2KM0A 3WWFA 1MZAA 2QA9E 1C2FA 3TH4H 1KDQA 4NZLA 1UVOA 1VCPA 1MCVA 3LC3A 3B23B 1DXWA 2H9TH 3KHVA 2VIWA 5GXPA 3ZVCA 2V3MA 2Z3CA 2JJ2D 5FCRA 4QT8C 3A83A 1RRKA 1ZPCA 2GZ7A 1BCUH 1UHBB 2PP6A 2W7SA 1HV7A 1ZGIA 1OWHA 4I8LA 3KQCA 4ABJA 4B74A 1QNJA 4XBCA 2AFQB 3SU5A 2JH6D 2V35A 2BZ6H 3RXJA 1AMHA 3VPKA 1A7SA 2ESTE 3F1SB 4B2AA 3VB5A 1LTOA 3F6UH 1SLVB 1GBJA 2FOHA 2V3HH 2EI7A 1C2EA 4IC5A 2O8LA 1PYTC 1ZLRA 2SGPE 3RDZA 1S82A 1O2YA 2BDBA 5DO4H 4R8TB 1LVOA 5EW1H 3CS0A 1ZRKA 1PPBH 1HJAB 1FY5A 1HGTH 1K0HA 3ELAH 2NU3E 4K1TA 3F2GA 1JIRA 4NFEA 3BEIB 1P11E 1L2EA 1CGJE 1UCYE 2OQUA 6CHAB 4GHTA 5IYTA 1QHRB 5C17A 1DWDH 2ZNKH 3MQKC 1DICA 3VB7A 1KXAA 4J1YA 1RTFB 3D23A 3P8NA 5F8TA 3ATMA 1AE5A 2WYJA 1N6XA 4BANB 1MKWK 5B6OA 5FPTA 2GVFA 4Q7XA 1W8BH 1GL1A 2WPKS 2CF9H 1BTUA 3Q76A 1KLIH 3M61U 1ELBA 4TT3D 5HM2A 2CMYA 1OKXA 1LHFH 1SGNE 1O34A 1UTQA 3I78A 4NG9H 1MMJN 1VCWA 1LKAA 2ZHFH 4IN1A 4J2YB 4AYVB 2BDHA 3VB4A 3BTTE 4YTAA 2BB4A 2ZECA 3E0PB 5DP6A 2ZGHA 1HJAC 1YGCH 5IK2D 2W7UA 4CBOA 1OWDA 1PPFE 1IHSH 1SI5H 2QAAA 1LVBA 4BAOB 6CHAC 1ZJKA 1AU8A 3A84A 2SFAA 3KYFA 2QF3A 3BG8A 1GJCB 3BG4B 3NCLA 3RXAA 4Y8XA 2FI5E 3E3TA 3EE7A 3PO1B 1QBOA 1YPHC 3R0FA 4ZCNA 1BUIA 1RFNA 2B0FA 4PROA 2WPIS 4Y0ZE 3ODDA 2FX4A 2BTCE 3URCA 1P2MA 3T5FH 1OOKB 5FX6A 1BBRE 5ETXA 3P95A 1GI0A 1HAOH 1PPEE 1AKSA 4NA7A 3S7HB 3QDZB 5HM9A 1BRUP 2Z94A 1V2RT 5JDUB 1TA2A 2J38A 2P3TB 3ENSB 2ALPA 1E79D 1EPTC 2SGDE 1ORFA 3STJA 1Z1IA 3SI3H 1AZZA 1P3EA 2FXRA 2KCYA 1O31A 4YO9A 5FCKA 3FO8D 2GP9B 2HWLB 4B6FA 3BG4C 4WH6A 1K2I1 5E2OA 1NT1A 4FUGA 3TITA 3QLPH 3PO1C 5TCAA 4FXGH 2ZHWH 4TYDA 2QXIA 3B9FH 1OWJA 1MZDA 4CBNA 3MU4A 2HPPH 1K1MA 5TJXA 3HATH 1YP9A 3QZRA 1DY8A 5AVDA 2ZFQH 2BY6X 4FOUC 4NZQA 1E36B 3Q3KA 5F53A 1T7CA 1Z8RA 5G4BA 3FOAA 2NU2E 1AUJA 4RN6A 3GCTF 5CMXH 3ZV9A 3NZIA 3O8DA 3GYLB 3LT3A 4WVPE 2FI4E 5A8XA 2A4GA 5E2PA 1A2CH 3A86A 1O39A 4P02A 5A0CA 3ATWA 3AK5A 1WV7H 3GISB 5EOKA 3ZZ3A 1CU1A 1A46H 5C5NA 2A4RA 2FYQA 1EFRD 4YM9A 3UB0A 1NBME 2YNBA 5E0HA 5H4IB 3FN8A 1BQYA 1QTFA 2H9EH 3RXEA 5LPRA 1H9IE 1JOUB 1QB9A 3GS9A 5LPEA 4CRAA 1Y5BT 3LJJA 5CHAB 5JBAS 2B8OH 3SN8A 3O8RA 3BTWE 1GJ7B 2OP9A 3A8CA 3BTKE 5KECA 1WU1A 2HGTH 3QTVH 2BDYA 2Q6FA 3RXIA 2ANMH 1Y3YA 2J98A 1XKAC 4NIWA 2XCFA 1K1IA 2C8XB 1XM1A 5AF9H 5C1XA 1SGEE 4HI3A 2GDDA 1EJAA 2ZU2A 3P6ZB 3RXVA 4BTTB 4CR5A 4FUJA 1ETTH 1QFKH 5BPEA 2JIZD 1K1PA 1ZSKA 7LPRA 5JBTA 1Z6EA 3MI4A 1G3DA 3MNSA 2FX6A 1B0FA 4OS5A 3UNRA 1SGTA 2QIQA 2GMTB 3TIUA 5LPFA 1J16A 4YOJA 2VIDA 3SJIA 4ABDA 1C5QA 1O2MA 2FMJA 2V7QD 1A0LA 2A2QH 2OCVB 2YOLA 5EW2H 4TY7A 1GJ9B 1WTHD 5L30H 3PMJA 3N7EA 3RMNH 4JZIA 2VWLA 1Y8TA 3SQHE 5JYIA 3HKJB 1SL3A 1DANH 1DT2A 1SHHB 2BY8X 4GPGA 1XUFA 1NZQH 4K1EA 4NA9H 1RIWB 4K2YA 2ZO3H 3Q3YA 2ZTZA 3RM0H 1ACBE 5C2ZA 1O0DH 1UTNA 2VGCB 4RT0A 2P93A 4TWYA 1A3EH 3A7XA 1AO5A 1ETRH 2STBE 1GI9B 1WOFA 3SUDA 2KCOA 1DFPA 3TPIZ 3PB1E 1LVYA 1YLDA 1O2JA 4AX9H 1BJVA 3BTQE 2ZU1A 5EU8A 1GMHG 3EGKH 2L74A 1O5DH 1UW7A 2QF4A 1BMMH 1JXPA 1WTGH 2V6NA 4ACBA 2HNTE 3A81A 1GHAG 1ELFA 1GJ6A 3TJUA 3UPEA 2UWLA 3MO6A 2Y82A 3RXPA 1C5RA 1NRNH 3EA7A 4ASHA 1XMNB 1WBGB 1NBMD 1BTZA 1G30B 1RIWC 1TALA 4I8KA 5FPYA 2ZPRA 3KF2A 1C2LA 3NRLA 2F4LA 1QIXB 1IQJA 1EJMA 2F9VA 1YLCA 2RA0A 3E6PH 4X2WA 3SORA 1T31A 3R3GB 1T8LA 1XVMA 1GMHF 2ZDNA 2A32A 4ABBA 4YZUA 2BY5X 1BHXB 2R3YA 3RXCA 4ISNA 1TQ7B 4YOGA 4B71A 2OC1A 4ZMAH 1G37A 1GHAF 3GY2A 4XE4A 2A7JA 1CO7E 1HNEE 3UR9A 1GBAA 4AOQA 1AQ7A 1Z8IB 2NU0E 2GZ9A 4FVDA 1MAYA 1WYKA 1NFYA 2BXTH 1ZTLA 2RDEA 2Y81A 3N7DA 1C5LH 3LH1A 1YPGH 1CQQA 2OK5A 1AVGH 3L33A 4WXIA 3T26A 3LPRA 4LOYH 1SMFE 1C2HA 2GDEH 1DLEA 4UONA 1K1JA 3O8BA 1C5XB 2AGGX 1DUAA 4JK5A 1CHOG 4LK4A 1TB6H 5DN6D 2EI8A 2QE7D 1F7ZA 1YC0A 1CT0E 4YOIA 2BLQA 1P02A 1GHBG 4KTSA 1FI8A 5I46H 4DG4A 4BAMB 4F4OC 1F2SE 5E0GA 1S0QA 2RG3A 2GD4B 2KZ4A 2V3OH 1C2GA 1V2QT 4BXSA 1FQ3A 1O32A 1YLNA 1SOZA 2BOKA 1BMFD 1H8HD 2FTLE 3SGBE 2PUQH 2F9NA 1P10A 1H8DH 4CH8B 3A80A 1C1PA 1HAHH 1TOCB 4JCNA 3RXKA 3UQOA 3LGIA 2GCHF 3ZIAD 4FUDA 4AYYB 1EUFA 5C1YA 1QRWA 1TGCA 1QY6A 4BAHB 1CHOF 4I31A 3HKIB 2GZ8A 4X6MA 3SQEE 2VWMA 1GBLA 1GBMA 4ZXYH 1P2QA 2F9OA 2BVRH 1GHBF 1C5NH 1EP5A 4AB8A 4GSOA 3UFAA 1ELAA 1G3BA 1GI8B 1GBEA 1P01A 3QWCH 1O2IA 2VVUA 2A7HA 3OFND 1FMGA 4K8YA 4KELA 2WPLS 1GDNA 2XBVA 1SGFG 1L4ZA 2HVYB 2VVCA 2GGVB 3F9EA 4MNWA 1P9SA 3AW0A 4HG6A 1O3LA 5DP4A 1DXPA 1ELTA 2C8ZB 2GJGA 3D65E 2IN2A 2O8MA 2G55A 2G51A 1HXFH 2PKAB 1U6QA 1OWIA 3GY7A 1GCTB 4AGJA 4Y6DA 2J92A 2VIVA 4X1QU 3A7ZA 2TGTA 5EQRA 1OYTH 1FDPA 3A8DA 2M2AA 1TX6A 1E0FD 1ZTJA 1BMAA 2O8UA 1D6RA 1ZZZA 4I33A 2KAIA 3F2FA 2H1UA 2VNTA 1P8VC 3BV9B 1EQ9A 2BD2A 5EXMA 1O3GA 1V2KT 3G01A 1C5ZB 3UOUA 3B8JA 4RI0A 1QB1A 1KDQB 2J9NA 3MHWU 2H9HA 2H5DA 4E05H 2WSSD 3CENA 4KKDA 3ZZCA 1IQNA 1H8ED 1TAWA 1BRCE 3MH5A 4AC9A 5TCCA 3PM3A 4TY6A 1HBTH 2A4OA 2VBCA 1P9UA 1WSSH 5L2YH 4ISOA 3S9AA 4HZHA 2G8TA 5DP9A 1DSTA 4A1XA 1T8NA 2XWBI 1TIOA 2C93B 5JB8S 1GCTC 1HB0B 5EJ1A 1XUIA 1OWEA 3RP2A 1TPOA 2QF0A 3M5NA 2VWOA 2FS8A 4ZXXH 1AWHB 2WYGA 3K2UA 4E06H 3QGJA 4Q7YA 3VB3A 1TLDA 4FUFA 1B7XB 4JK6A 4MNYA 3BTDE 2EA3A 2XC5A 4OGXA 4IMZA 1SGRE 1FIWA 4X1SU 3A7VA 1TNIA 1WDIA 1A5IA 4Y0YE 3SU0A 1DSUA 4KGAA 1SHYA 2UWPA 1ELEE 3LIWA 1EATA 1GWAA 4GLYA 3C1KA 3FAOA 1UTMA 2PWXA 1HAPH 3F0PA 3PMAB 2VVVA 1KTTB 3BF6H 1ZHMA 2XNIA 3GY5A 1EP6A 3EYDA 2HLCA 1BB0B 4AG1A 1NY22 2PUXB 5L6NH 3S9CA 1TABE 3OTPA 1QURH 9LPRA 1O38A 2TRMA 1J14A 1QL9A 4Z6AH 1DUEA 1O2GH 3DHKH 5ABWA 1QRZA 1XVOA 1GBTA 1K9OE 4F48B 2QN5T 1P03A 2UUJB 3AAUA 1NN6A 4CH2B 1WQVH 2GTBA 2HVXA 2ZPQA 1P12E 3U98H 2GCTB 3MU8A 2CHAC 4GUXA 2QC2A 1FPCH 1O3CA 1SC8U 2FDAA 1DWCH 1PQAA 1VCQA 1Z6JH 2XC0A 3SV9A 3F9GA 1NESE 1LVMA 1MTSA 2R9PA 3ODFA 5C3NA 3HK3B 5EQQA 1O2TA 4B75A 3E1XB 4Q80A 2UUYA 1CVWH 4H6SB 1J9CH 1AI8H 2XRCA 1JBUH 1GMCG 1PQ8A 4YESB 3JZ1B 4B1TA 3ATKA 1H9LB 1TE0A 1EKBB 1C9TA 4O3UA 4A1VA 2ZDMA 2M5TA 3LDXH 1O2WA 2KFWA 5C0TA 4FETA 1EASA 1K1OA 1ZGVA 1GMDG 1YPMH 3LGWA 1FIZA 1S6HA 3MU0A 1EOLA 4NWKA 1Q3XA 3BTHE 1JMOH 1ELVA 2D1JA 5K7RA 1YY3A 5F03A 4DW2U 1TNHA 3DUXH 5FXLA 3F68H 8KME2 1F0SA 5EG4A 1RJXB 3A7WA 3SYJA 5CHBA 1HAZB 1SPJA 2IOTA 4BNRA 2R3UA 3DD2H 4I86A 2P94A 1A0HB 3LOXA 3ZZ4A 2GCTC 3TJVA 2ZCHP 1A5HA 1HAIH 6LPRA 2ANYA 2TBSA 4XFQA 1O3IA 3LGYA 3N7OA 1FN8A 3NXPA 2H2ZA 2ZQ2A 1QQ4A 4VGCB 5FHTA 4IMQA 3RMMH 4OS7A 1OP8A 1BZXE 1TGNA 1VZQH 1CA8B 1GMDF 2LP6A 3F2HA 1L0ZA 1W11U 2GV6A 1AKSB 1O36A 1S83A 1W3CA 3GCNA 4KTUA 3RXOA 1QRXA 2R0LA 1UHBA 4JYTA 2OLGA 5DG6A 5E0JA 2ZFTA 1TMTH 1UVSH 1BTPA 1GI2A 1O2VA 4FU7A 1GGDB 1ZMJA 4E7NA 3SGAE 1ZYOA 2H5CA 1GBIA 2OC8A 1SQAA 2FI3E 1O2RA 1FONA 2ZFRH 1TRYA 3UNSA 3DFJA 2BDCA 3DCLA 4B6EA 2ANWA 2ODQA 3OYPA 2F9UA 1GJ5H 1IQMA 3TK6A 1NFWA 1K22H 1FLEE 2Y7ZA 3UUZA 4DT7B 5JBBS 3GDSA 1UTOA 5EPYA 1YCPH 2Y80A 3AW1A 1PPCE 1ANCA 2EEKA 1EB1H 3TH2H 2FOGA 4VGCC 4Y7AA 1LHEH 3PYHA 1B5GH 2AEIH 7GCHG 3UIRA 1C1QA 2IPQX 4DVAU 3RMOH 1KXFA 1N8OB 1OSSA 2TGAA 2R0KA 2Y6TA 5T6DA 2ZU5A 3GCOA 3RXLA 1EX3A 1VJ9U 1V2TT 1QA7A 4MG3A 1CHGA 2P16A 3A8BA 1GGDC 3HGPA 2A0QB 3SU6A 3S0NA 3ZVAA 1X7AC 4A5TS 1E38B 3PV4A 4FUBA 1C5VA 1BMNH 1YPEH 3GDUA 3P92A 2BD7A 4AB9A 1FY4A 2L6OA 1SGPE 4X1NU 4WY3A 1GHYH 3A7TA 4FUHA 1CT2E 3M5LA 1TBQH 1XUHA 4ISLA 4AFSA 1P2JA 2PW8H 4K1SA 3SNEA 3SUGA 2PHBA 1TQ0B 1ZOMA 1AHTH 1IOEA 1EZUC 4Z1MD 1F5KU 2FOAA 4DURA 1MKXH 1D3PB 1ZPZA 1EPTA 4NWLA 1SBWA 3SUFA 1W13U 2PGQB 2F91A 3MNBA 2CK3D 1A1RA 2QCYA 3A7YA 1QJ1B 1GHVH 3LGUA 1N8OC 4U32A 1HIAB 1Y3UA 3SI4H 2FPZA 3WWBA 3IG6B 2ZTXA 4BAQB 1D4PB 1F92A 4RSPA 2J98B 1S84A 1TYNA 1FAXA 1C9PA 4OM9A
chains in the Genus database with same CATH topology
1OP0A 4CRBA 2BDAA 2ZKSA 1NO9H 4X6OA 3UTUH 3S69A 1BRAA 3FP8E 1H1BA 2SNVA 4JMYA 3W94A 1BTWA 1QB6A 1MCTA 1MTVA 3RLWH 4A7IB 2A31A 3SU2A 4DCDA 5FBIA 1NU7B 3UY9A 4RKOB 1NROH 1TGBA 1BITA 4IN2A 3RU4T 4IS5A 1ABIH 1O2UA 3SV8A 1O3EA 4D9RA 1VITG 1BOQA 2P8OB 4MPVA 1TRMA 3UQVA 1LMWB 4FU8A 1ANDA 4NIVA 4WWYA 4Y8ZA 4K60A 3EAJA 4D7GA 3KIDU 4AGKA 2STAE 1V2NT 1KXBA 2R2MB 2FOBA 2ZA5A 1TFXA 2ZZUH 3UOPA 3TLOA 1GJAB 3HPTB 2BDGA 1DLKB 2PGBB 1UVPA 2SGAA 3LU9B 4DJZB 2VJ1A 1Y3WA 2FOEA 3PWBA 3C27B 1O2KA 3EA8A 3BIVH 1VITF 3T62A 4ABGA 1DS2E 4UFGH 1UCYH 1LKBA 4H42U 1ZSJA 3BEUA 4A92A 1EXFA 5CHAC 1V2ST 1H8IH 1K1LA 2XW9A 1W10U 1KXDA 4CREA 2P8OC 3A82A 3E8LA 3MU1A 1TOMH 1GBDA 2G5NA 3TJNA 4FVBA 4UFEH 1P04A 3U8RH 3U8TH 2BLVA 3SNAA 3PLKA 1AE8H 4MDSA 4YT7H 3PTBA 2O8TA 1LPKB 1O3MA 3AASA 4ISHH 3EA9A 5J4QA 3RXRA 3PMBB 5I25A 1AB9B 1ZPBA 5JBCS 1P3CA 4AFUA 2BD3A 2QXHA 3I29A 3KQBA 1V2MT 1C1WH 3QGNB 3SV6A 1OXGA 1EB2A 3A85A 4DGJA 5F8XA 2J94A 5A8YA 4D8NA 1C4Y2 1ZSLA 2ULLA 1FNIA 1P0SH 5C67A 2GMTC 2A5AA 2A2XH 4INHA 1QJ6B 1BTHH 2V0BA 1C1VH 4JZDH 2BVSH 2FZZA 2ZFPH 3TGIE 1D3DB 1P09A 1TPSA 1O5FH 3T25A 2EI6A 4B2BA 2BX3A 1THSH 1NS3A 2AMPA 3SNBA 4Y76A 2HRVA 1LO6A 4CRDA 1O35A 3RXQA 1ARCA 1BBRH 2BQ6B 2VGCC 2ZDKA 4FUEA 5GJ4B 1JRTA 1D3TB 2ASUB 1MU6B 2BD9A 5DK1A 1AB9C 4BAKB 1O37A 3U8OH 1NU9A 1KTSB 2PLXA 2ZTYA 2F83A 2QGRA 5SGAE 1AVXA 2HALA 1EAUA 1VJAU 3BSQA 1ABJH 1GG6B 1LHCH 2OUAA 2TGDA 4ZROA 1A61H 3ZVDA 1AWFH 2XBWA 4A6LA 2QV1A 5LGOA 1NRPH 1BHXF 1EZQA 4ZHMU 1W7GH 2ZC9H 4R0IA 3A87A 5HXFA 3WY8A 1KSNA 1VITH 2C3SA 3FANA 1LHGH 3SU4A 1ZHPA 2ZP0H 4MNXA 4OS4A 1N1LA 1W14U 3MYWA 2ZF0H 1F0UA 3M7TA 4FUCA 5T6GA 1ETSH 2BX4A 2I6QA 1LCYA 2AIQA 1C1OA 2WV5A 2HOBA 2OC7A 1O5AB 1SLXB 1SSXA 4DIIH 1EAXA 1AY6H 1TNJA 1C1NA 1YCPK 3EQ0H 1MAXA 4TPYA 1SGYE 4XOJA 1QR3E 1T4VH 3ZV8A 1C5PA 2C90B 2WUCA 1QBVH 1S5SA 3M37A 1CT4E 2ZWLH 2IPHA 3BN9A 1ARBA 2Y5HA 4JZEH 2ANKH 1O3HA 3UR6A 1GG6C 3EDXB 4K3JA 3E0NB 2QY0B 2ZDAH 4ZH8A 2RCEA 2LPRA 3QN7A 4CR9A 2ZHQH 3GY6A 1C5MD 1C2KA 2OC0A 3VB6A 1TPAE 3MH6A 2HPQH 3U69H 5A0BA 1FY1A 1NRSH 5L2ZH 6GCHG 3TVJB 1SQOA 4KP0A 1A3BH 3V0XA 1TGTA 3OY5U 4ABIA 4CRCA 1GPZA 3ITIA 2ZDVH 4JYUH 2ZHDA 1AD8H 1MQ6A 1MKXK 1XUKA 2XBYA 1UTKA 2G5VA 1SGDE 3P8FA 3LONA 1AN1E 1NRRH 1HAVA 3ZYDA 4D76A 2HNTC 3TK5A 1GJ8B 4GCHG 1Z8GA 3ZVEA 4UEHH 2VH6A 3D62A 2G00A 2XYAA 3RC6A 2PR3A 1IQFA 1JIMA 1HYLA 1OP2A 1SGCA 3GY3A 1WUNH 2CGAA 2ZIQH 2FOCA 4U2WA 5C20A 4B76A 3Q77A 2OINA 3PWCA 1C1TA 2G4UA 3P17H 3M3SA 1GVLA 2UUKB 4NSVA 1Z8JB 1QJ7B 4BXWA 2C8YB 1Z7KA 3TU7H 1Z71A 3SJOA 1TNLA 3RMLH 1AUTC 1NFXA 5CE1A 3SGQE 4GAWA 1ZTKA 2D2DA 1W7XH 1AZ8A 1RD3B 2BM2A 4NGAH 3FFGA 5GWZA 1KIGH 3KGPA 3A89A 1QL7A 1C5YB 1RTKA 3ZZDA 1TPPA 1G3CA 2A7CA 3ZYEA 1TNKA 3UWIA 2DUCA 1FY3A 1B0EA 4K5ZA 7ESTE 3RXUA 2VU8E 3RXDA 3PTNA 4DOQA 1XX9A 2SNWA 1FY8E 3ZVFA 4HFPB 2B5TB 2ZFFH 2GV7A 3MH7A 3S9BA 3KN2A 2THFB 1V2LT 1QL8A 3RC5A 5HYOA 1HAXB 3FP7E 4IBLH 1BIOA 1YYY1 1MD8A 1OYQA 3PLBA 4X8SH 2JKHA 1AIXH 4JZFH 2BQ7B 4RKJB 1NPMA 4THNH 1ELCA 1IQLA 1BDAA 1AGJA 3Q00A 3SU1A 2P95A 4I8JA 1PPHE 4KTCA 2YNAA 1TWXB 4INLA 2CF8H 2B9LA 5AFYH 1O3BA 3U1JB 1UCYK 2ZU3A 4FUIA 1C5SA 1ESAA 4LZ4B 1E34B 1L4DA 2P59A 5F8ZA 4UFDH 3GY8A 4WMEA 4K8BA 3ZZ9A 3M7UA 4K69A 2FLRH 5EXLA 1DPOA 1YPHE 2BY7X 2C4FH 3FVFB 3ZZ8A 1LDTT 5DPAA 1THRH 1L1GA 1ANBA 1DE7H 2NU4E 3FZDA 4WF8A 2UUFB 5DKMA 1LHDH 3BTGE 3NPSA 1G32B 2ZGBH 1QBNA 2OQ5A 3MH4A 3RXBA 2WPMS 1DWEH 4ISIH 1GHWH 2AMDA 1L1JA 1V2UT 4U01A 1O3KA 1QQUA 3RXMA 1W0YH 2D8WA 3SNDA 1PQ7A 1WCZA 1C5OH 3ZVBA 4U30A 2R2WU 1GI4A 4NCYA 4ZKOU 5LH8A 1SR5C 1ZJDA 4AG2A 3ATIA 2BLWA 3M5OA 4X2XA 1IQHA 1MTUA 2ALVA 4TPIZ 4XSKU 1UMAH 1GJ4H 4MNVA 1S6FA 2BQWB 1AVWA 1OS8A 3MNXA 2A1DB 3GOVB 3Q3XA 2XWAA 1ID5H 1LPZB 1O2XA 2ZEBA 4H6TA 4WJG2 1PYTD 3QO6A 4Q2KA 1IQIA 1ZHRA 4UE7H 1MH0A 2Z3DA 3NWUA 2ZDLA 1O5GH 4ZUHA 5EGMA 1UJ1A 1KY9A 2SGFE 3DT0H 4X6NA 5ESTE 1BBRK 4ZKNU 3DFLA 1BTYA 1H4WA 1GMCF 3OSYA 3SV2H 4H4FA 3SUEA 1IQEA 1IAUA 3OTJE 3GCHB 1CA0B 1YF4A 1P2NA 3OY6U 1ANEA 1KXCA 2G52A 3SJKA 1O2OA 1BRBE 2Z3EA 4DIHH 1HLTH 1W12U 3M3TA 4Y11E 5A09A 1UTJA 3E91A 1DX5M 1K28D 5PTPA 3SZNA 1DY9A 1A0JA 1MBMA 2ZCLP 3M35A 4NIYA 3QK1A 3TJOA 1Y5UT 4ZKSU 1O5EH 2Z9GA 4JYVH 2OTVA 3BIUH 1FV9A 1UK3A 4Y10E 2NWNA 3NUMA 2BVXH 1YKTA 2J95A 5FPSA 1P2OA 4X1PU 4CRGA 5DGJA 1CGIE 3D49H 1QCPA 1KXEA 1O3FA 4BTIB 3UREA 1NC6A 5K0HA 1DM4B 1XXFA 2WPJS 1J17T 2W5EA 3V12A 1Q2WA 3P70B 3RLYH 2DE9A 1RGQA 3ZZ6A 3P8GA 3U9AH 2A5KA 5JPMH 5C1UA 1EPTB 5T6FA 1L1NA 2FEQH 1O33A 1BA8B 3K9XB 3L3TA 3GCHC 1CA0C 1S81A 2A4QA 3UNQA 1SGIB 4M7GA 3RC4A 1C1MA 1GJBB 1S85A 3VFEA 3S7KB 1ELDE 2GT7A 5AFZH 1NFUA 3FZZA 3BTEE 3TNSA 2UWOA 2B7DH 1DWBH 3T27A 3KL6A 5A0AE 2AMQA 1QGFA 5FBEA 2ZPSA 1DOJA 1FXYA 4IGDA 4Y7BA 1P2KA 4CRFA 4E7RG 2TIOA 2Z9IA 3BTME 3MO3A 4UDWH 5EQSA 3TGJE 2AYWA 3V3MA 1O3JA 2ZU4A 7GCHF 1HFDA 1V2VT 1O3AA 2AIPA 1C5TA 3U1IB 3V7TA 3LJOA 3GCTG 2ZQ1A 3TH3H 8ESTE 3LGTA 1O2PA 3KQDA 3RU4E 3BEFB 1INCA 8LPRA 1Q31A 1HAYB 3SNCA 1Y3XA 3V13A 1EZSC 2VWNA 6ESTA 2PV9B 5JB9S 1C2JA 1LQDB 4LXBH 3RXFA 1Y3VA 4B73A 3SBKA 1LPGB 3M5MA 1ZMLA 1VR1H 1WQSA 1GL0E 2OBQA 3IWMA 4JZ1A 4BTUB 1IQKA 2VH0A 4D7FA 1TMBH 2VIQA 4UFFH 1JWTA 1TBZH 1TX7A 2TPIZ 3DA9B 4WMFA 4Y8YA 4ABAA 2D26C 1UVUH 1GBHA 1OPHB 2FO9A 4INKA 1F0RA 1FPHH 2ZI2H 2JH0D 3E16B 1J8AA 3M7QA 2Z9KA 2Z7FE 3GICB 1GI7B 4FU9A 2P3UB 1MQ5A 4MLFB 1V6DA 1O3PB 1GBFA 1G2MA 2I6SA 1GBCA 1YCPM 3ZVGA 2AGIX 1T32A 2OD3B 3PMHB 1P57B 4LZ1H 1GI1A 1CE5A 4GHQA 4YLQH 4B2CA 1YM0A 2ZFSA 4Z0KA 1C1SA 3FP6E 1OX1A 1MU8B 2Z9JA 2FS9A 3UWJH 3T29A 2Z9LA 5FAHA 1BTXA 1FN6A 1W2KH 1SFQB 3GDVA 4O03A 4BOHA 1FAKH 1Y5AT 5A2MH 5GIBA 1SVPA 3MMGA 3PLPA 2BOHB 4XDEA 1GCDA 1KYNA 4ABFA 2FWWA 1HJ9A 2FOFA 3K65B 1O2LA 1D3QB 1HUTH 3W95A 1UK4A 1XUGA 3LC5A 1G2LA 4O3TA 3BTFE 1D9IA 2J34A 2OBOA 3ATLA 1A4WH 5AHGH 1HIAA 1PJPA 2XBXA 2AS9A 1E37B 1GDUA 2AH4X 3K6ZA 3KNXA 1O3OA 4TWWA 2ILNA 1HCGA 3RXTA 2G4TA 2C8WB 3A8AA 1CBWB 2DE8A 2ODYB 1S0RA 2Y5FA 1PPZA 1TX8A 2BXUH 3MU5A 1GVZA 1IQGA 1ESBA 3RXSA 3M3VA 3TNTA 2SGQE 2F3CE 2VIOA 4O9VA 1D6WA 1TMUH 2WINI 1HRTH 1O2QA 1SFIA 3SU3A 2F9PA 3IITA 4I8GA 1BMLA 4ESTE 1MD7A 3QX5H 4OS1A 1P05A 3RU4D 3AVZA 1AFQB 3H5CB 2BHGA 1XUJA 3KQEA 1GHXH 4X1RU 4I32A 1RTLA 1K21H 1PPGE 2ZCKP 2P3FH 1Y59T 1SB1H 5J4SA 2FOMB 1C5UA 2ZGCA 2W26A 2ZG0H 2ZGXH 1C1UH 1DITH 1FJSA 2QXGA 1CSOE 1O3NA 4X2VA 3VXEH 1CBWC 4AZ2B 3O8CA 4X6PA 1DDJA 3ZZAA 3MTYA 3T2NA 2H6MA 1V2JT 2BD4A 2CJIA 1HAGE 2A45B 3T28A 2Y5GA 1CGHA 5EXNA 1HPGA 1EAIA 1W0ZU 2PTNA 3JZ2B 1UTLM 1Z1JA 1V2WT 1QA0A 1LQEA 3LH3A 1UO6A 4Y71A 4Y79A 5IDKA 1NM6A 3VGCB 3L6PA 2BLOA 2JETB 1EAWA 3TK9A 3URDA 2CN0H 1AFQC 4ABHA 1SG8B 5DP3A 4DY7B 4D9QA 7KMEH 1SLWB 4WXVA 4OS2A 1HJ8A 2Q6GA 3EE0B 4ABEA 1C1RA 5DJ7A 4Q7ZA 4MVNA 4SGBE 2VB0A 1UVTH 1V3XA 1P06A 2GKVE 3KEEA 2Z6BD 1H9HE 1MKWH 9ESTA 3GYMA 3H7OA 4CHAB 3VEQB 2EC9H 2GT8A 1G3EA 4NSYA 1N6YA 3OX7U 1HDTH 4ZHAA 3ZZ7A 3MO9A 3VXFH 1GDQA 1G9IE 1O5BB 3H7TA 4AFZA 2PSXA 4X8UH 5F6MA 5A8ZA 3VGCC 2JETC 1RXPA 1HAVB 2A5IA 1HXEH 3CP7A 4NFFA 1C2IA 1K1NA 1JRSA 3A88A 2F9BH 3K6YA 4ZAEA 1ZR0A 1BT7A 4A1TA 5HGGA 2GCHG 3KCGH 1MUEB 4I8HA 2Q6DA 1GBBA 1O2ZA 2CXVA 2VINA 3LGVA 1A5GH 1O2HA 1C2MA 1GI6A 2WV4A 1O3DA 1TGSZ 1BJUA 2O8WA 2HNTF 4O97A 3MOCA 2KAIB 4XBDA 2AERH 4OS6A 4CHAC 5EPNA 1FUJA 1F5LA 4AN7A 3SO3A 2RDLA 3TGKE 1YPLH 1EJNA 3MNCA 4YLUA 2J4IA 5ESBA 2PTCE 3QTOH 2FM2A 2FYRA 1RS0A 1P2IA 3QUMP 5C5OA 1GVKB 4HTCH 2ZGJA 5E8EH 1J15A 2NU1E 2W3IA 1G36A 1O2SA 2PFEA 2ZHEH 2LNCA 1UK2A 4IC6A 1C4V2 3LKWA 4UD9H 4NIXA 1AFEH 2WUBA 2W3KA 2XXLA 5GDSH 1YPJH 2PKSB 1SLUB 8GCHG 3SJ9A 1UTPA 3SHCH 1O30A 3RUOA 1EZXC 1TONA 1ZMNA 1TA6A 2Y7XA 1NTPA 2BZAA 3HGNA 1SGQE 1WAYB 2QXJA 3RXGA 1XXDA 4XBBA 5DP8A 3NK8A 3HK6B 1VGCB 1EOJA 3ESTA 2VIPA 2XC4A 6GCHF 4F49A 3M36A 1XKBC 2IJOB 1MTNB 4MTBA 4SGAE 1IHTH 4X8TH 3RXHA 5HMAA 4X0WU 1KLTA 1DVAH 1ZRBA 4MPWA 1F0TA 4HGCA 5GCHG 2FLBH 5BRRE 1T4UH 2AGEX 3GY4A 4WMDA 2BD8A 4IW4E 4X2YA 8GCHF 1PQ5A 2BD5A 4GCHF 2BY9X 4AORA 2CV3A 2BDIA 3I77A 4OGYA 3PROA