1IAUA

Human granzyme b in complex with ac-iepd-cho
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
226
structure length
226
Chain Sequence
b'IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRANZYME B
publication title The three-dimensional structure of human granzyme B compared to caspase-3, key mediators of cell death with cleavage specificity for aspartic acid in P1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 226
sequence length 226
ec nomenclature ec 3.4.21.79: Granzyme B.
pdb deposition date 2001-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1iauA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1iauA02
2Y7XA 2DE9A 4X8TH 3ZZ9A 1TGSZ 1WSSH 1C5NH 1K1MA 4I8GA 1D3QB 3SJKA 5AFYH 1DDJA 2TRMA 2PKAB 3RC5A 2PGQB 4ZHMU 1VJ9U 4FUCA 1AQ7A 3BTGE 1C5LH 3KEEA 1C5ZB 2WPJS 2AIQA 3AAUA 2FYRA 1N1LA 1F5LA 3HK3B 4TPYA 1PPHE 3MO9A 5A0BA 3ZZDA 4NG9H 1CGHA 1LO6A 3T27A 1YGCH 1Z1IA 1O3MA 1QRXA 5K7RA 2ZG0H 1ZSKA 4CR5A 1F7ZA 1ZHMA 4CHAC 1ORFA 1FN6A 2BTCE 2ODPA 1TYNA 1VITH 1Y8TA 3Q76A 5FPTA 2GV7A 3TGKE 1PPFE 3P8GA 3RXDA 2G51A 2EEKA 1OWKA 3U8RH 3KF2A 2ZCKP 3V0XA 1LPGB 1GGDC 1SGFG 3GCTG 5LPRA 3FP6E 1NTPA 4X1QU 1KLIH 3EA8A 3SHCH 5FBEA 3ZYDA 1QL8A 1C2IA 1C5MD 3MWIU 5L30H 1QJ1B 1EOLA 5FCRA 3GCNA 1E34B 4KTSA 3EQ0H 2C8ZB 2J95A 1FAKH 1FPHH 1DFPA 4KGAA 1AMHA 1UHBB 2CN0H 4Y79A 2OP9A 3MOCA 3SI3H 5LPEA 3UREA 4WH6A 3SGBE 1GJAB 2A7JA 5EXLA 1ZPCA 1LVYA 1RGQA 3SJIA 3IWMA 3PWCA 1UO6A 3NWUA 1TNHA 1KXAA 3SUFA 2Q6GA 1EB1H 1GBBA 1Z1JA 4OS7A 3M3TA 1NPMA 3GY4A 2ZFRH 2H1UA 1C1UH 1QNJA 1UTPA 3VFEA 3F9FA 1HNEE 5C1UA 5FBIA 3SGAE 1EPTA 3SNAA 1EZSC 2JETB 1QJ6B 3GDVA 1FY1A 1O2UA 2BDYA 1LPKB 4MPWA 2ZTZA 2QA9E 1C2GA 6ESTA 2QXIA 2GKVE 2Z9JA 3VB3A 1P03A 1P01A 1AO5A 2VWMA 2FXRA 1EXFA 2WV5A 2XXLA 4ZKRU 2Q6DA 1XUJA 1NU9A 1XMNB 1HJAB 1KTSB 3FFGA 3VGCC 3SJ9A 1KXEA 1SVPA 3MYWA 1GMDF 1FPCH 3E3TA 3H7OA 3LH3A 4Y8YA 1LVBA 2VIWA 1K1OA 4YM9A 1HUTH 1DT2A 1GPZA 3SQHE 3ZVCA 1Y3VA 4K1TA 5G4BA 3MFJA 4K3JA 1TNKA 1BBRE 1E37B 5A09A 1JRSA 3BTDE 1ELGA 4WY3A 1AFQC 1FV9A 1V2LT 3SNEA 3E8LA 1JRTA 4Q7XA 1O3NA 2FMJA 1V2NT 1YLDA 3DD2H 4FUEA 1ETSH 2GZ9A 2C8WB 1PYTC 4X8UH 1PJPA 5F6MA 1V2VT 3T26A 3SU6A 4A1TA 1ZLRA 1GCTC 1OPHB 1KYNA 1BRCE 2TBSA 1C4U2 2V3HH 2ZKSA 3UNRA 2SGEE 4NZQA 1GVZA 2ZEBA 4UDWH 1TGBA 2BXTH 1B5GH 3RXBA 5C2ZA 1V2RT 1H9LB 3TLOA 2QXJA 2A2QH 4UONA 1F0UA 2BLOA 3GCHB 1QB9A 4FU8A 3C1KA 3Q00A 3AVZA 2H5CA 1CA8B 2ODYB 4DT7B 4D7FA 3Q77A 2VU8E 4GAWA 2OXSA 2NU1E 8GCHF 3UR9A 4MTBA 4NIXA 1G3BA 1GMHG 2PSXA 1EZQA 2FS8A 2ZCLP 1LMWB 3K6YA 4DGJA 2ZNKH 2BHGA 3BTME 2OBQA 1IQNA 1L0ZA 4WJG2 5B6OA 3KIDU 3MH4A 1C2LA 1SQTA 3HATH 1C2HA 2C4FH 4MPVA 1K1JA 3RM2H 1FZZA 1NRSH 3A88A 1Z8RA 1SQAA 3GY5A 4UE7H 1C9PA 1O3BA 1DWEH 1GG6B 3GYMA 1TNJA 5DGJA 1SGRE 1ELDE 1VJAU 1O2ZA 1ZGIA 1S6HA 3O8CA 4UD9H 4YOIA 2PWXA 1ANBA 1RXPA 1GI1A 3SHAH 1O2XA 1AE5A 3STIA 1C5YB 4YTAA 1UVPA 2A4QA 1TQ0B 2AEIH 1DUEA 1O2IA 4TY6A 4Q7ZA 2BX3A 1WU1A 4ZKSU 2Z9IA 3P8OA 1SGFA 1ZTKA 5T6FA 1CE5A 3M5NA 1T32A 3L33A 2F9OA 3T2NA 7KMEH 1HAGE 1W12U 4Y8XA 1W0ZU 3SW2B 1O3LA 1Y5UT 4ZKOU 1IQLA 2ZHFH 1CBWB 1GHBF 2XBWA 5DP4A 4B2BA 1SGNE 1G3DA 1IQFA 1BRAA 1TABE 3A85A 5C3NA 1K1LA 1SOZA 1GI3A 3LU9B 1V2WT 1LDTT 1ESBA 1GHWH 1HCGA 1V2JT 1DY8A 1FY3A 2D8WA 3KN2A 1D4PB 1GBAA 1S0QA 3DT0H 3CS7A 1O3DA 3G01A 1MTNC 3NKKA 4X2XA 1AU8A 1DITH 3BTFE 1UCYK 1SI5H 4NA7A 1U6QA 1C2KA 4RKJB 2C93B 1HDTH 2GGVB 4RN6A 1F0SA 2GCHF 4IN1A 3LDXH 4B2CA 1O3EA 1V2TT 3O8BA 2XW9A 1SC8U 3RXKA 5DP6A 2VWNA 4DW2U 2P8OB 1P09A 1EAWA 1X7AC 3SU1A 3PO1C 2GVFA 1C5QA 2FESH 3EE0B 1A3EH 1MAYA 4KKDA 2GMTB 1BTHH 1AFEH 1Z6JH 2AMQA 2VVVA 1W7GH 3VEQB 2FX6A 4GCHF 3HK6B 1JXPA 3W94A 1A5HA 2D1JA 4JZ1A 1JBUH 2A45B 3RXUA 3RDZA 3BG8A 3LGVA 1Y5BT 3BEIB 1H9HE 3T28A 1TBQH 3HGPA 1DX5M 3RXEA 1E35B 5GJ4B 4ISIH 3E0PB 1MH0A 3FAOA 3HGNA 3ZVDA 4FU7A 2K1QA 1MU6B 1PPZA 3RM0H 4ISLA 3GY6A 4KTCA 3ZZ4A 1FAXA 3F9HA 2F83A 2RA3A 3KGPA 1ZJDA 1OWJA 2F9VA 1K28D 4ZXXH 4MNVA 1GJ9B 3M35A 1AKSB 1WQSA 2QF3A 4HTCH 3MU4A 2XC4A 3S9BA 1HJ8A 4CRGA 1DE7H 1NFYA 2Y81A 4XBBA 1P04A 1MBMA 2LPRA 1RFNA 3MO6A 1EUFA 1YCPK 1MKWK 4YT7H 3A8DA 1P11E 2W26A 5HXFA 1TRMA 1O5EH 1W10U 3RXOA 3MU1A 2ANKH 1INCA 2CXVA 3I77A 1JOUB 2OC0A 1SLUB 2F91A 1L4ZA 4CRBA 2ZA5A 1VITF 3BTEE 1ELVA 5K0HA 4H4FA 3NUMA 1UCYH 1QHRB 2XBYA 2FOAA 4X6OA 3TJUA 2BDGA 2R0KA 1GBJA 3UNSA 2FEQH 1MZAA 4ZUHA 1DWDH 4DCDA 2ZP0H 1ESAA 5DPAA 1OWIA 1S85A 4K8YA 1TQ7B 3S69A 1HJ9A 1OS8A 5HM9A 1WCZA 1OKXA 3UIRA 2FTMA 2VGCB 1XUIA 1HGTH 2TGTA 1ZHPA 5CHAB 1C9TA 3LOXA 4AN7A 1L4DA 3KHVA 1IQEA 4LZ4B 1EX3A 1LHFH 2FS9A 2ZGXH 1MCVA 3LGWA 1HAVB 1Z7KA 2W7UA 2AYWA 2PTCE 1C1RA 1TMTH 1LQDB 4IMZA 4NZLA 1HB0B 4ABEA 2G52A 1LVMA 2VVCA 1O2PA 1C5PA 1WBGB 3ATKA 2XCNA 4JZDH 1UTLM 3ZV8A 4E05H 4I8JA 1EATA 1NRQH 2SFAA 4X8SH 1G32B 2ZGBH 3GY8A 2UWPA 1SL3A 4Y6DA 5EXNA 1GBLA 4CBNA 2WUBA 2WPKS 1A0JA 1YF4A 2ZWLH 3RUOA 4I8KA 4UFFH 1TRYA 1GMDG 1OXGA 2OQUA 2PKAA 1XXFA 2NU4E 3P6ZB 1AIXH 2ZDMA 3BSQA 1GWAA 2VNTA 1MZDA 2FOEA 1O36A 1BTUA 3A84A 1GHZA 2ZDKA 1OYTH 1ELFA 1YCPH 1MKWH 2BDBA 2XTTB 3TJNA 3UFAA 4X1SU 4NCYA 1KDQB 4I7YH 5HMAA 2W7SA 2VIPA 2AGIX 5A8YA 1CGJE 1EZUC 2ESTE 3QN7A 3RXJA 4MVNA 3RP2A 1F0RA 3SN8A 4O3TA 1K22H 1A7SA 4TWWA 3MMGA 2TGPZ 1EKBB 2ALPA 3UUZA 1XVMA 1AVWA 4ISHH 1GHAF 1CT0E 3K2UA 4WMDA 3ENSB 3W95A 3A7WA 6GCHF 1TALA 3BTHE 2XNIA 4LXBH 3QZQA 2F9BH 2Y80A 2HALA 1AUJA 4AOQA 4Q80A 2P95A 2AERH 3A8BA 3MH7A 1TOCB 1K9OE 1WYKA 2VH0A 4CHAB 4JMYA 4CBOA 1MCTA 3EA9A 2BY5X 3ZVGA 3TGIE 3P92A 2QC2A 1TGCA 1AD8H 2ZGCA 1PQ5A 8GCHG 1MD7A 1ABIH 1UHBA 1GGDB 3DA9B 1C1PA 1VCWA 2M5TA 4ISNA 3URDA 3RXIA 4HGCA 4DG4A 1QCPA 1O2YA 3ATLA 2Y82A 1YPGH 2SGFE 1LHCH 1XKBC 4Q7YA 3UR6A 1IOEA 5ETXA 1BMNH 1TBZH 1S84A 1DS2E 2QY0B 1GJ4H 2WYGA 1GCDA 4NIVA 1ZZZA 1QFKH 1Y5AT 3AW1A 5J4QA 1GI9B 1Z8JB 3K9XB 1BMLA 2CF8H 4AB8A 1LHEH 2CHAC 4BANB 5A2MH 5HGGA 1Y3UA 1YM0A 1MD8A 4NFFA 5ABWA 4FXGH 3F9EA 1H9IE 1UMAH 1VR1H 6CHAC 2B9LA 4X8VH 3ODFA 1C2MA 2BD8A 4YESB 1C1VH 1V2ST 4K5ZA 1K2I1 3QGNB 3BF6H 2UUYA 4TY7A 1P9SA 1NFUA 2R3YA 5E0HA 1NRRH 2A1DB 4F49A 1CGIE 4D7GA 3JZ1B 4CRAA 3KQDA 1WTGH 3RXTA 2W3KA 3PTNA 2BD2A 2HNTF 1AGJA 1GHBG 4CREA 5GPIB 2O9QA 3VGCB 3PROA 1QGFA 2JH0D 1EAUA 1NT1A 2O8WA 3BTWE 4YZUA 2ZCHP 2ZTXA 2VH6A 1QB1A 4UFEH 1JMOH 3SV7A 2FI3E 5CMXH 1SQOA 2F9UA 2A4GA 1AFQB 5FX5A 2P93A 1MMJN 4X6PA 1J17T 1DM4B 5FPSA 3E0NB 3BEFB 4O3UA 3ZVAA 1Y59T 4I8HA 2GCHG 5GCHF 1L1GA 1XUHA 2R0LA 2XCFA 2PKSC 3S0NA 2ZQ2A 3PWBA 1GDUA 1P2IA 1PPBH 2ANMH 2ALVA 1HAIH 1AE8H 2Z9KA 4NWLA 1W2KH 2O8MA 2FO9A 1O3AA 2ZPSA 5E0JA 2BVSH 1ZPZA 3ZZ7A 2STBE 2J4IA 1G2LA 3SV9A 1O5AB 1BTWA 1J9CH 1XXDA 3MNCA 4X2VA 1P12E 3MNSA 4GCHG 1RS0A 1ZPBA 2OC1A 4VGCC 4I8LA 4X1NU 4RKOB 3T62A 2B8OH 1OP0A 1O38A 3NK8A 5EXMA 2A4OA 3CENA 3M37A 2FZZA 1O3PB 1KIGH 2Q1JA 3K6ZA 3MH6A 1O2LA 3LGIA 2HLCA 2FI4E 3S7KB 2OC7A 2PUXB 2BVXH 2ZDNA 4K69A 2J38A 2P59A 3B23B 2VWOA 2RA0A 2QXHA 4IN2A 4B75A 2OC8A 3P95A 3RMOH 4BTTB 5IDKA 1GBMA 1ETTH 3TK9A 3EAJA 1O2NA 3PMBB 1GBFA 4AG1A 3QUMP 3TH3H 1GJBB 3GOVB 2FODA 1NZQH 3OY5U 1SB1H 1GMCF 1SG8B 4OGXA 2PUQH 1O2KA 4GVUA 4Y11E 1ID5H 3HKJB 5L6NH 1SPJA 5FPYA 1A0HB 3TNTA 4K1SA 1T8MA 4X1PU 1HBTH 1E38B 5E0GA 1WAYB 1HXFH 2J34A 3SNCA 3LGYA 3H5CB 2QN5T 2HPPH 1EQ9A 2B7DH 2J9NA 1NN6A 2OUAA 3LGTA 2WPHS 2FLBH 3GDSA 4AG2A 3TGJE 1O5BB 2ZGJA 1TGTA 1SHHB 1FUJA 3LC3A 4Y71A 5HM2A 4MDSA 3SGQE 4ZKNU 2BD4A 3RU4T 1MTSA 2PFEA 4Q2KA 1QBNA 5JB8S 1NO9H 5EOKA 1ZGVA 2A0QB 1C1SA 5A0AE 3SU3A 1G3CA 5L2ZH 4ABAA 4BAQB 1YPMH 2AMDA 5E2OA 5DP3A 1GJ7B 1G3EA 1ARBA 5AFZH 3TJOA 1KXCA 1RTFB 3BIUH 2YNBA 1V2MT 1KXFA 2STAE 4FUFA 3SNDA 5HYOA 3HPTB 2HNTC 2HNTE 1MTNB 3U1IB 1WV7H 2XWBI 5A8ZA 1C2DA 5TCCA 2WPLS 1DICA 4NGAH 1AZZA 3MO3A 1NU7B 3S9CA 2ZFQH 1JIMA 1N8OC 5EQRA 1E36B 1SGQE 2BZ6H 1GI4A 1O2SA 2XYAA 2FI5E 4IC5A 5E2PA 1QIXB 3DFLA 1GJ8B 1EJNA 2G55A 2SGQE 2JH6D 3ZZ8A 2BOKA 2BXUH 2UUFB 2VVUA 3SU5A 1ZSLA 1EOJA 1V3XA 1HJAC 3PO1B 1ELAA 4WF8A 1BA8B 3SO3A 4ABIA 1VCPA 1TA2A 2NWNA 2P3UB 4D9RA 2C8YB 1SLVB 1TMUH 4J1YA 1Q2WA 4K2YA 1ZHRA 1A3BH 3K65B 4A7IB 3M7TA 1TX6A 4JCNA 1S5SA 1IQJA 4AORA 2QXGA 1AKSA 1F2SE 4DJZB 2NU0E 2P3FH 4TYDA 1NFWA 1E0FD 1GL1A 4FUIA 2FDAA 1GI6A 2GCTB 2A7CA 2BY7X 2QYIA 2HOBA 4LZ1H 2H5DA 1C5RA 3ESTA 3ELAH 5E8EH 7ESTE 1QBOA 1J8AA 3PLKA 1W7XH 4B71A 1A2CH 2AS9A 1ZJKA 3RXAA 4IGDA 4MPUA 2GV6A 1TFXA 1D3PB 4U01A 1SR5C 4DY7B 2SNWA 1O3KA 5FXLA 1AWHB 1O37A 1GHAG 5C5NA 1ANDA 4IC6A 3VB4A 4B74A 1AZ8A 2DE8A 6GCHG 4WWYA 1FN8A 1ABJH 1O3GA 1ACBE 4GHTA 3BTQE 1O31A 4OS4A 4XDEA 3RXMA 1H8IH 3MH5A 5AF9H 3AASA 4UFGH 1GBCA 1AVGH 3RMLH 3RXSA 1IQHA 2BLVA 3QGJA 1TX8A 3VB5A 2BY9X 1L1JA 1QQUA 2FM2A 3D49H 2GP9B 3TVJB 2OLGA 3BIVH 2WUCA 3PYHA 3QX5H 1YPLH 3U69H 5F8XA 1Z6EA 1BDAA 1BTXA 2G5VA 1HIAB 3M5MA 1MQ5A 1W13U 2GT7A 2ZHEH 1EP5A 4I32A 3SUEA 4Y7BA 1HAVA 1EP6A 1EPTC 1UVTH 2W3IA 4FUHA 5ESBA 1G37A 4D9QA 2OINA 3NCLA 4AZ2B 2AFQB 5ESTE 1YC0A 2PW8H 4JK5A 2I6SA 1RIWC 1VGCC 2FWWA 1SLXB 1XUKA 1PPEE 4PROA 2V3OH 3I29A 4GHQA 1GL0E 2G4TA 1UVOA 1JIRA 2SNVA 3B8JA 2GX4A 4WMEA 4Z0KA 3V7TA 5JPMH 4X6NA 3A87A 3LIWA 1MQ6A 1P0SH 2TPIZ 1W8BH 4BXSA 1O5CB 3MNXA 4D8NA 1RRKA 5L2YH 4MNYA 2SGAA 3GY2A 1S81A 1FMGA 1DSTA 1Q31A 1LTOA 5FCKA 1BMMH 1IQMA 3BN9A 5DP7A 5DP8A 2RCEA 2BLWA 3QTOH 1ZMNA 2EI8A 1P10A 2NU2E 4NIWA 7GCHF 4IS5A 3TU7H 3T29A 3TJVA 1GHXH 1GHVH 1O3IA 2AGGX 5EU8A 1P8VC 1N6XA 5F8TA 8ESTE 4LOYH 4Y0ZE 2P3TB 4D76A 2Z94A 1JWTA 1F5RA 1KDQA 1O33A 1XM1A 3RXLA 1C1QA 3TH2H 3SOSA 1A5GH 1OP2A 1GI5A 3RXQA 1T8LA 1A1RA 3ATWA 4AGKA 4ABDA 1H1BA 3M7QA 4ASHA 3KQEA 1O32A 2QIQA 1SGEE 1ANEA 2THFB 1C4V2 3FVFB 2A2XH 1UTOA 1GBKA 3SU0A 5A0CA 2HGTH 2Y5FA 4HFPB 4BTIB 1HAZB 3U98H 1Y3WA 3PLPA 4MNWA 4Z6AH 4JZIA 1TA6A 3FZDA 1BIOA 1BTZA 1SMFE 3M3VA 1DWCH 2BD5A 4H6SB 5EPYA 7LPRA 4JK6A 2P8OC 5C1XA 2OQ5A 9LPRA 4XBDA 4E06H 4YLQH 4IMQA 1YPKH 1O3JA 2WYJA 1UVUH 1C1MA 1FLEE 1N6YA 1HRTH 1DXPA 3LJOA 5JDUB 2I6QA 2F9NA 1DXWA 1TAWA 1RJXB 2GZ8A 1O34A 2YNAA 5C1YA 1ELTA 3RC6A 1ZR0A 2PTNA 2ZFPH 3SUGA 4JZFH 1BQYA 2JH5D 3KQCA 2JKHA 2GZ7A 3L6PA 3E1XB 2D2DA 1KSNA 4AYYB 1EJAA 2ZDAH 4AB9A 1EAIA 1V2UT 4ISOA 3URCA 3SQEE 1AI8H 1SGCA 3MI4A 4CRFA 1P2KA 1GJDB 2PR3A 3A7YA 1O3FA 3D23A 3GCOA 4FU9A 1C5UA 3QDZB 3L3TA 3RXVA 2Z3EA 1L1NA 2FLRH 1C2JA 1C5WB 4ZAEA 5EODA 4A5TS 1P05A 1SGPE 1KY9A 3ZZBA 2C90B 2Y7ZA 1DLKB 1ZRKA 2AH4X 1ANCA 1QA0A 4AX9H 1O0DH 1CU1A 5EW1H 1A46H 1OP8A 2Z3DA 1TOMH 1QBVH 1GMCG 1V2PT 2Z9GA 2CHAB 5GIBA 1AN1E 1TPPA 1BUIA 1O35A 1AY6H 4UFDH 4X2WA 4INHA 2VIDA 1P3EA 3SV8A 4MPXA 3U9AH 1D9IA 2BM2A 4MLFB 3SU4A 3E16B 1QRWA 6CHAB 1CHOF 2WV4A 4LK4A 2FOMB 2G8TA 1D6RA 1TE0A 3PB1E 5FHTA 3QZRA 3R0FA 1UTJA 3T5FH 2C8XB 1LVOA 3GY3A 3EGKH 1HAYB 2EA3A 4AFQA 4KTUA 4Y0YE 4J2YB 1FIWA 4FVBA 3MHWU 5DO4H 1P2QA 1RTKA 2FP7B 1YPHC 3LPRA 5JBCS 2A32A 3U8TH 2GT8A 5EG4A 2BD7A 4BNRA 4NA8A 3U8OH 2ZO3H 1W11U 3FANA 3UNQA 5CHAC 4Y7AA 2XC5A 1HAHH 1K21H 2VINA 2ZFFH 5TJXA 4CH8B 4BAOB 1FJSA 1AB9C 1BJUA 1ZOMA 1GI8B 1KXBA 1TMBH 2V35A 2ZHWH 4K8BA 4WXIA 5C5OA 3E90B 3P70B 3F9GA 3V12A 4ZXYH 1HAXB 4U32A 4U30A 1V2QT 4GUXA 1YYY1 1MAXA 4R0IA 1MBQA 2BD9A 2Y5HA 2XWAA 3RU4D 3T25A 2FOFA 2VJ1A 1CHGA 1S82A 1OYQA 4YLUA 1O2QA 5CE1A 1O5GH 3F6UH 4CRCA 4H42U 2GTBA 2OTVA 1UVSH 3RXFA 4JYVH 4A92A 2Y6TA 4WMFA 5J4SA 1FQ3A 3NXPA 4HZHA 1S0RA 3LONA 1A4WH 5LH8A 2H6MA 1K1IA 1GBIA 1O3HA 8KME2 3QWCH 4DVAU 1GI0A 1DVAH 1ZTLA 4OS5A 3BTTE 2A7HA 4KP0A 2BDIA 4BAMB 1CVWH 1UK2A 2O8LA 1J15A 2W5EA 1TBRH 3A86A 1XVOA 1V2OT 5T6DA 2HRVA 1J16A 1M9UA 4THNH 1A61H 3RMMH 4RSPA 3DFJA 1KLTA 3PMAB 3PLBA 1D3DB 2BLQA 2ZU4A 1C1TA 5JBTA 3N7OA 2ZIQH 5H4IB 2KAIA 2R3UA 5EGMA 1Z71A 5A8XA 3GDUA 4I33A 2V6NA 2OBOA 4FVDA 4JYUH 1OWDA 4H6TA 2Z7FE 1XX9A 2FOHA 3A7ZA 2H9HA 1DPOA 1SGIB 4DURA 3A7VA 1SGYE 1CA0C 1FIZA 2BVRH 4YOJA 5PTPA 2BDHA 1C1OA 3TITA 1DY9A 3M3SA 1YKTA 1QL7A 2IOTA 1SOTA 2F3CE 2ANYA 1BOQA 1ZTJA 2SGDE 8LPRA 3BEUA 2BQ6B 3MU0A 1UTNA 3P8FA 1Y3YA 3SV2H 3UTUH 1EASA 3V3MA 1IHSH 2P94A 3SV6A 3ZVBA 1WTHD 3TH4H 3QLPH 1TRNA 2B0FA 3B9FH 3S9AA 1GCTB 1ZMLA 2ZQ1A 2CJIA 1HPGA 2QGRA 2WPMS 3BG4C 1LKAA 3SNBA 1G9IE 2PHBA 2EI6A 1ZYOA 4NA9H 2R9PA 4NWKA 5GWZA 3TK5A 4O97A 3IITA 1GDNA 2GD4B 2TGAA 1NC6A 1GJCB 1O30A 3ITIA 1A5IA 1TB6H 1J14A 2ZECA 4MNXA 1AUTC 2OCVB 4Y8ZA 1H4WA 2ZU5A 4E7RG 3KCGH 3OY6U 4X1RU 4SGBE 2YOLA 1FI8A 2AMPA 5AHGH 1BBRK 4BTUB 4TPIZ 3MTYA 1AVXA 1GVKB 5DJ7A 3RMNH 2V0BA 2ZU1A 2D26C 3H7TA 4ESTE 2FPZA 4XFQA 3NZIA 1GI2A 1N8OB 1PQ7A 3RXGA 3E91A 1HXEH 2PGBB 5TCAA 4OS6A 6LPRA 3UQVA 3ZYEA 1THPB 1OX1A 7GCHG 1TGNA 1KTTB 3A83A 3MU8A 3D65E 2KAIB 1C1WH 2ZDLA 3VXEH 3SU2A 3VPKA 1LQEA 1MUEB 1P06A 3P17H 3GYLB 4FUBA 4QT8C 3S7HB 3STJA 1LKBA 1C5XB 4IW4E 3VB6A 1XUFA 3UOPA 2B5TB 1XKAC 2EI7A 1C5TA 1UTMA 1K1PA 2G00A 4B2AA 5T6GA 1VITG 3UPEA 4CRDA 4JYTA 1TONA 2ZPRA 3I78A 4XSKU 3P8NA 1HLTH 1YCPM 1IHTH 2XBVA 1O2WA 2G5NA 2PV9B 3M5OA 3RXCA 3CS0A 4BOHA 1S83A 3C27B 5BRRE 2IPHA 1P02A 1T31A 1NY22 3UOUA 1HAOH 3O8RA 2BY6X 2Z3CA 4DIIH 2WPIS 3ZZ5A 1MU8B 1OSSA 5I25A 1HFDA 3KL6A 1MKXK 3LC5A 1C1NA 2Z9LA 2ZFSA 2WINI 2VIQA 4IBLH 3RLWH 2BB4A 1VCQA 5EQQA 2FX4A 1SFIA 1HIAA 1QL9A 4NSVA 1PYTD 5EW2H 2F9PA 4MQAA 3SUDA 2FTLE 1C5VA 1FDPA 2JETC 1TLDA 1DLEA 4X6MA 3FZZA 1P9UA 1EZXC 1W14U 3SJ8A 1BBRH 3DHKH 3UY9A 1HV7A 2FIRH 1QRZA 2CMYA 1YBWA 4ZHLU 1OWEA 2ZHQH 4ZROA 3TK6A 1BHXF 3OTJE 4HI3A 1THSH 5DP5A 1CQQA 1EPTB 2P16A 4INLA 3A80A 1T4UH 3LKWA 2ASUB 3PMJA 5DG6A 1HYLA 2BZAA 4ABHA 5C67A 5I46H 1RIWB 1VGCB 1LHDH 2A5KA 3EDXB 1NESE 9ESTA 1O2VA 3LJJA 1THRH 2Q6FA 2H9EH 4ABJA 1CO7E 4ZMAH 2QAAA 3M5LA 1B0FA 1L2EA 1NROH 1OWHA 1SLWB 2PLXA 2DUCA 1T8NA 4B76A 4WH8A 3WY8A 1ZMJA 1O2TA 1FNIA 1NS3A 1AHTH 5GXPA 1P2NA 2H2ZA 5SGAE 1O5DH 2FYQA 3HKIB 4JZEH 2FOCA 1SHYA 1CHOG 4SGAE 1P3CA 2BY8X 3M61U 1AWFH 2AGEX 2CV3A 1F5KU 2HVXA 1GBEA 3GCHC 1O2JA 3VXFH 1GDQA 5JB9S 3RC4A 1BRBE 2BQWB 4B1TA 3D62A 1GJ6A 5BPEA 1MKXH 2AIPA 3UQOA 3GY7A 4A1VA 1C4Y2 3TPIZ 1T8OA 2A5AA 3F1SB 1GBHA 3KQBA 4UEHH 3GCTF 4ABBA 1BT7A 3ATMA 3E6PH 4AFSA 1BHXB 1FY8E 4ABFA 1C5SA 1FY5A 2J94A 2BX4A 2PSYA 3CP7A 3KNXA 4OS1A 1BCUH 3SBKA 5JYIA 3AW0A 1Q3XA 5FX6A 3M7UA 1ZSJA 2EC9H 1QQ4A 1HAPH 3O8DA 1O3CA 1Z8IB 4INKA 4FUGA 3EA7A 1CSOE 2ZGHA 1GG6C 4YOGA 2ODQA 2ZF0H 2ZI2H 4NSYA 1TNLA 4AFZA 1BMAA 2Z6BD 1UCYE 1EAXA 3NPSA 1PQAA 1H8DH 2ZTYA 3ZVEA 4WVPE 4O9VA 1LPZB 1V6DA 5EQSA 3A81A 4YT6H 3SI4H 1K1NA 1QR3E 5F8ZA 1D3TB 3SJOA 4BAKB 1C2FA 1DOJA 3GICB 2BD3A 1P57B 1SSXA 4XE4A 2Y5GA 3FP7E 4U2WA 5JBAS 1TIOA 2CF9H 4M7GA 2O8TA 2GCTC 3OX7U 1WUNH 1SGDE 2ULLA 1CBWC 1T7CA 1Y3XA 1BJVA 4KELA 3ZV9A 1D6WA 2J2UA 1W0YH 2R2MB 1IAUA 2XRCA 1P2JA 3TIUA 4FUDA 4OGYA 4E7NA 1O39A 2VIOA 1MTWA 1ELCA 1SBWA 2BQ7B 1LHGH 2HWLB 1GBTA 1FY4A 2HPQH 5GDSH 5AVDA 4ZHAA 1IQKA 1ETRH 1SFQB 1WQVH 3PV4A 4MG3A 5DK1A 1YP9A 2SGPE 1IQIA 1F0TA 4FUJA 4BAHB 4X0WU 1TWXB 2BDAA 4A6LA 3IG6B 2UWOA 2H9TH 2GDDA 2OD3B 1B0EA 2FOGA 2ANWA 5GCHG 2BMGB 1DUAA 2QV1A 3A8CA 2VB0A 1G2MA 1CT2E 3MNBA 4GSOA 1TX7A 1O2GH 4GLYA 3TNSA 2ZU2A 3R3GB 5FAHA 4R8TB 2UUKB 4AGJA 1EJMA 4ABGA 3ZZCA 2ZC9H 2GMTC 3FP8E 1BB0B 1G30B 3A7TA 1UK3A 2ZPQA 2ZDVH 4I31A 5C20A 4B73A 1CT4E 3ODDA 1MTVA 2LNCA 4BXWA 4Y10E 1TPSA 1GMHF 3U1JB 2BOHB 1YPJH 3ATIA 1NRNH 1FONA 2O8UA 4XBCA 1QY6A 3V13A 5LPFA 2UWLA 1AB9B 4K60A 1C2EA 1ELEE 2R2WU 1V2KT 3A82A 1O3OA 2VIVA 2J92A 1BZXE 2ILNA 3M36A 3PM3A 1BRUP 2NU3E 1LCYA 1RTLA 3SORA 2QCYA 2VWLA 3SZNA 1PFXC 1ESTA 1DANH 3OSYA 3ZZ6A 5DP9A 5IYTA 1GJ5H 1XUGA 1MTUA 2BYAX 3DUXH 3RXHA 1O5FH 3ZZ3A 1GHYH 1A0LA 3RLYH 1QURH 3MU5A 4Y76A 4YO9A 1G36A 5DKMA 1GVLA 4CR9A 4AFUA 1PPGE 2A4RA 4OS2A 1P2OA 1UTKA 1UTQA 1KLJH 1B7XB 3A89A 2TIOA 1P2MA 2A5IA 1O2RA 1NM6A 1TNGA 1GI7B 1BITA 4K1EA 3AAVA 3JZ2B 2RG3A 1KXDA 1O2HA 2A31A 1PPCE 4O03A 4DIHH 2XBXA 3QK1A 1S6FA 1FXYA 1TPOA 5T3HA 1QJ7B 2UUJB 1O2MA 1QB6A 3RXPA 3EYDA 1YPHE 4NIYA 3UWJH 5JBBS 3VB7A 1T4VH 2VGCC 4A1XA 3QTVH 1VZQH 3PTBA 3RU4E 1TPAE 4F4OC 1NFXA 2ZU3A 1OOKB 1CA0B 1BTPA 2RDLA 3F68H 4TWYA 5EPNA 3LGUA 1F92A 4DOQA 1ARCA 3Q3XA 4XOJA 1DSUA 3ZVFA 2IN2A 1IQGA 3PMHB 4AYVB 2ZFTA 3GISB 1O2OA 2G81E 4CH2B 3UWIA 1QA7A 1W3CA 2GDEH 5F03A 4WXVA 1QTFA 3RXRA 2PKSB 2CGAA 3LH1A 3Q3YA 2FOBA 5LGOA 2QF0A 1RD3B 1UK4A 3ZZAA 1NRPH 4ZH8A 1ZRBA 3BG4B 4X2YA 3A7XA 2TGDA 1GBDA 1WOFA 2G4UA 1UJ1A 3QO6A 3BV9B 3OYPA 3OU0A 1TNIA 1ELBA 1SGTA 1C5OH 2IJOB 4NFEA 2XC0A 3A8AA 2ZHDA 3Q3KA 1Z8GA 3LT3A 4VGCB 2ZZUH 1YLCA 1DWBH 2C3SA 2BDCA 4GPGA 1PQ8A 3BTKE 1BTYA 1YPEH 1EB2A
chains in the Genus database with same CATH superfamily
2Y7XA 2DE9A 4X8TH 3ZZ9A 1TGSZ 1WSSH 4FETA 1C5NH 1K1MA 4I8GA 1D3QB 3SJKA 5AFYH 1DDJA 2TRMA 2PKAB 2QF4A 3RC5A 2PGQB 4ZHMU 1VJ9U 4FUCA 5CDFE 1AQ7A 3BTGE 1C5LH 3KEEA 1C5ZB 3F2FA 2WPJS 2AIQA 3AAUA 2FYRA 1N1LA 1F5LA 3HK3B 4TPYA 1PPHE 3MO9A 1WDIA 2YMSC 3ZZDA 5A0BA 3CNRA 4NG9H 1CGHA 2JDID 1LO6A 3T27A 1YGCH 2M2AA 1Z1IA 1O3MA 1QRXA 5K7RA 2ZG0H 1ZSKA 4CR5A 1F7ZA 1ZHMA 4CHAC 3F0OA 1ORFA 1FN6A 2BTCE 2ODPA 2V7QD 1TYNA 1VITH 1Y8TA 3Q76A 1QZ8A 2GJGA 2GV7A 5FPTA 3TGKE 1PPFE 3P8GA 3RXDA 2G51A 2EEKA 1OWKA 3U8RH 3KF2A 2ZCKP 3V0XA 1LPGB 2YMSD 1GGDC 1SGFG 3GCTG 5LPRA 3FP6E 1NTPA 4X1QU 1KLIH 3EA8A 3SHCH 5FBEA 3ZYDA 1QL8A 1C2IA 1C5MD 3MWIU 5L30H 1QJ1B 1EOLA 5FCRA 3GCNA 2W6ID 1E34B 4KTSA 3EQ0H 2C8ZB 2J95A 1FAKH 1FPHH 1DFPA 1NBME 4KGAA 1AMHA 1UHBB 2CN0H 2J97A 4Y79A 2OP9A 3MOCA 3SI3H 5LPEA 3UREA 4WH6A 3SGBE 1GJAB 2A7JA 5EXLA 1ZPCA 1LVYA 1RGQA 3SJIA 3IWMA 3PWCA 1UO6A 3NWUA 1TNHA 1KXAA 3SUFA 2Q6GA 1EB1H 1GBBA 1Z1JA 4OS7A 3M3TA 1NPMA 3GY4A 2ZFRH 2H1UA 1C1UH 1QNJA 1UTPA 3VFEA 2J98B 3F9FA 1HNEE 5C1UA 5FBIA 3SGAE 1EPTA 3SNAA 1EZSC 2JETB 1QJ6B 3GDVA 1FY1A 1O2UA 2BDYA 1LPKB 4MPWA 2LELA 2ZTZA 2QA9E 1C2GA 6ESTA 2QXIA 2GKVE 2Z9JA 3VB3A 1P03A 1P01A 1AO5A 2VWMA 2FXRA 1EXFA 2WV5A 2XXLA 4ZKRU 2Q6DA 1XUJA 1NU9A 1XMNB 1HJAB 1KTSB 3FFGA 3VGCC 3SJ9A 1KXEA 1SVPA 3MYWA 1GMDF 1FPCH 3E3TA 3H7OA 1BMFD 3LH3A 4Y8YA 1LVBA 2VIWA 1K1OA 4YM9A 1HUTH 1DT2A 1GPZA 3SQHE 3ZVCA 1Y3VA 4K1TA 5G4BA 3MFJA 4K3JA 1TNKA 1BBRE 1E37B 5A09A 1JRSA 1E79D 3BTDE 1ELGA 4WY3A 1AFQC 1FV9A 1V2LT 3SNEA 4DT4A 3VG8A 3E8LA 1JRTA 4Q7XA 1O3NA 2FMJA 1V2NT 1YLDA 3DD2H 4FUEA 1ETSH 3OE7D 2GZ9A 3WWBA 2C8WB 1PYTC 4X8UH 1PJPA 5F6MA 1V2VT 3T26A 3SU6A 4A1TA 1ZLRA 1GCTC 1OPHB 1KYNA 1BRCE 2TBSA 4TT3D 1C4U2 2V3HH 5C17A 2ZKSA 3UNRA 2SGEE 4NZQA 1GVZA 2ZEBA 4UDWH 3N7EA 1TGBA 2BXTH 1B5GH 3RXBA 5C2ZA 1V2RT 1H9LB 3TLOA 2QXJA 2A2QH 4UONA 1F0UA 2BLOA 3GCHB 1QB9A 4FU8A 3C1KA 3Q00A 3AVZA 2H5CA 1CA8B 2ODYB 4DT7B 4D7FA 3Q77A 5F53A 2VU8E 4GAWA 2OXSA 2NU1E 8GCHF 3UR9A 4MTBA 4NIXA 1G3BA 1GMHG 2PSXA 1EZQA 2FS8A 2ZCLP 1LMWB 1H8ED 3K6YA 4DGJA 2ZNKH 2BHGA 3BTME 2OBQA 1IQNA 2JIZD 1L0ZA 4WJG2 5B6OA 3KIDU 3MH4A 2KCAA 1C2LA 1SQTA 3HATH 1C2HA 2C4FH 4MPVA 1K1JA 3RM2H 1FZZA 1NRSH 3A88A 1Z8RA 1SQAA 3GY5A 4UE7H 1C9PA 1O3BA 1DWEH 1GG6B 3GYMA 1TNJA 5DGJA 1SGRE 2JJ2D 5CHBA 1ELDE 1VJAU 1O2ZA 1ZGIA 1S6HA 2KCPA 3O8CA 4UD9H 4YOIA 2PWXA 1ANBA 1RXPA 1GI1A 3SHAH 3FN8A 1O2XA 1AE5A 5DSFA 1C5YB 3STIA 4YTAA 1UVPA 2A4QA 1TQ0B 2AEIH 1DUEA 1O2IA 4TY6A 4Q7ZA 2BX3A 1WU1A 4ZKSU 2Z9IA 3P8OA 1SGFA 4HG6A 1ZTKA 5T6FA 1CE5A 3M5NA 5DN6D 1T32A 3L33A 2F9OA 3T2NA 7KMEH 1HAGE 1W12U 4Y8XA 1W0ZU 3SW2B 1O3LA 1Y5UT 4ZKOU 1IQLA 2ZHFH 1CBWB 1GHBF 2XBWA 5DP4A 4B2BA 1SGNE 1G3DA 1IQFA 1BRAA 1TABE 3A85A 5C3NA 1K1LA 1SOZA 1GI3A 3LU9B 1V2WT 1LDTT 1ESBA 1GHWH 1HCGA 1V2JT 1DY8A 1FY3A 2D8WA 3KN2A 4RT0A 1D4PB 1GBAA 1S0QA 3DT0H 3CS7A 1O3DA 3G01A 1MTNC 3NKKA 4X2XA 1AU8A 1DITH 3BTFE 1UCYK 1SI5H 4NA7A 1U6QA 1C2KA 4RKJB 2C93B 1HDTH 2GGVB 4RN6A 4XD7D 1F0SA 2GCHF 4IN1A 3LDXH 4B2CA 1O3EA 1V2TT 3O8BA 4P00A 2XW9A 1SC8U 3RXKA 5DP6A 2VWNA 4DW2U 2P8OB 1P09A 1EAWA 1X7AC 3SU1A 3PO1C 2GVFA 1C5QA 2FESH 3EE0B 1A3EH 1MAYA 4KKDA 2GMTB 1BTHH 1AFEH 1Z6JH 2AMQA 2CK3D 2VVVA 1W7GH 3VEQB 2FX6A 4GCHF 3HK6B 1JXPA 4XRNA 3W94A 1A5HA 2D1JA 4JZ1A 1JBUH 2A45B 3RXUA 3RDZA 3BG8A 3LGVA 1Y5BT 3BEIB 1H9HE 3T28A 1TBQH 3HGPA 1DX5M 3RXEA 1E35B 5GJ4B 4ISIH 3E0PB 1MH0A 3FAOA 3HGNA 3ZVDA 4FU7A 5IK2D 2K1QA 1MU6B 1PPZA 3RM0H 4ISLA 3GY6A 4KTCA 3ZZ4A 1FAXA 2RDEA 3F9HA 2F83A 2RA3A 3KGPA 1ZJDA 1OWJA 2F9VA 1K28D 4ZXXH 4MNVA 1GJ9B 3M35A 1AKSB 1WQSA 2QF3A 4HTCH 3MU4A 2XC4A 3S9BA 1HJ8A 4CRGA 1DE7H 1NFYA 2Y81A 4XBBA 1P04A 1MBMA 2LPRA 1RFNA 3MO6A 1EUFA 1YCPK 1MKWK 4YT7H 3A8DA 1P11E 2W26A 5HXFA 1TRMA 1O5EH 1W10U 3RXOA 3MU1A 2ANKH 2QE7D 1INCA 2CXVA 3I77A 1JOUB 2OC0A 1SLUB 3KQ5A 2F91A 1L4ZA 4CRBA 2ZA5A 1VITF 3BTEE 1ELVA 5K0HA 4H4FA 3NUMA 1UCYH 1QHRB 2XBYA 2FOAA 4X6OA 3TJUA 2BDGA 2R0KA 1GBJA 3UNSA 2FEQH 1MZAA 4ZUHA 1DWDH 4DCDA 2ZP0H 1ESAA 5DPAA 1OWIA 2W6JD 1S85A 4K8YA 1TQ7B 4I86A 3S69A 1HJ9A 1OS8A 5HM9A 1WCZA 1OKXA 3UIRA 2FTMA 2VGCB 1XUIA 1HGTH 2TGTA 1ZHPA 5CHAB 1C9TA 3LOXA 4AN7A 1L4DA 3KHVA 1IQEA 4LZ4B 1EX3A 1LHFH 2FS9A 2ZGXH 1MCVA 3LGWA 1HAVB 1Z7KA 2W7UA 2AYWA 2PTCE 1C1RA 1TMTH 1LQDB 4IMZA 4NZLA 1HB0B 4ABEA 2G52A 1LVMA 2VVCA 1O2PA 1C5PA 1WBGB 3ATKA 2XCNA 4JZDH 1UTLM 3ZV8A 4E05H 4I8JA 1EATA 1NRQH 2SFAA 4X8SH 1G32B 2ZGBH 3GY8A 2UWPA 1SL3A 4Y6DA 5EXNA 2L6OA 1GBLA 4CBNA 2WUBA 2WPKS 1A0JA 1YF4A 2ZWLH 3RUOA 4I8KA 4UFFH 1TRYA 1GMDG 1OXGA 2OQUA 2PKAA 2RFKC 1XXFA 3FO8D 2NU4E 3P6ZB 2EY4C 1AIXH 2ZDMA 3BSQA 1GWAA 2VNTA 1MZDA 2FOEA 1O36A 1BTUA 3A84A 1GHZA 2ZDKA 1OYTH 1ELFA 1YCPH 1MKWH 2BDBA 2XTTB 3TJNA 3UFAA 4X1SU 2HLDD 4NCYA 1KDQB 4I7YH 5HMAA 2W7SA 1E1QD 2VIPA 2AGIX 5A8YA 1CGJE 1EZUC 2ESTE 3QN7A 3RXJA 4MVNA 3RP2A 1F0RA 3SN8A 4O3TA 1K22H 1A7SA 4TWWA 3MMGA 2TGPZ 1EKBB 2ALPA 3UUZA 1XVMA 1AVWA 4ISHH 1GHAF 1CT0E 3K2UA 4WMDA 3ENSB 3W95A 3A7WA 2IJD1 6GCHF 1TALA 3BTHE 3ZIAD 2XNIA 4LXBH 3QZQA 2F9BH 2J5UA 2Y80A 2HALA 1AUJA 4AOQA 4Q80A 2P95A 2AERH 3A8BA 3MH7A 1TOCB 1K9OE 1WYKA 2VH0A 5GNDA 4CHAB 4JMYA 4CBOA 1MCTA 3EA9A 2BY5X 3ZVGA 3TGIE 3P92A 2QC2A 1TGCA 1AD8H 2ZGCA 1PQ5A 8GCHG 1MD7A 1ABIH 1FX0B 1UHBA 1GGDB 3DA9B 1C1PA 1VCWA 2M5TA 4ISNA 3URDA 3RXIA 4HGCA 4DG4A 1QCPA 1O2YA 3ATLA 2Y82A 1YPGH 2SGFE 1LHCH 1XKBC 4Q7YA 3UR6A 1IOEA 5ETXA 1BMNH 1TBZH 1S84A 1DS2E 5EIYA 2QY0B 1GJ4H 2WYGA 1GCDA 4NIVA 1ZZZA 2J98A 1QFKH 1Y5AT 3AW1A 5J4QA 1GI9B 1Z8JB 3K9XB 1BMLA 2CF8H 4AB8A 1LHEH 2CHAC 4BANB 5A2MH 5HGGA 1Y3UA 1YM0A 1MD8A 4NFFA 5HIZA 5ABWA 4FXGH 1SKYE 3F9EA 1H9IE 1UMAH 1VR1H 6CHAC 2B9LA 4X8VH 3ODFA 1C2MA 2BD8A 4YESB 1C1VH 2HVYB 1V2ST 4K5ZA 1K2I1 3QGNB 3BF6H 2UUYA 4TY7A 1P9SA 1NFUA 2R3YA 5E0HA 1NRRH 2A1DB 4F49A 1CGIE 4D7GA 3JZ1B 4CRAA 3KQDA 1WTGH 3OEED 3DCLA 3RXTA 2W3KA 3PTNA 2BD2A 2HNTF 1AGJA 1GHBG 4CREA 2KX4A 5GPIB 2O9QA 3VGCB 3PROA 1QGFA 2JH0D 1EAUA 1NT1A 2O8WA 3BTWE 4YZUA 2ZCHP 2ZTXA 2VH6A 1QB1A 4UFEH 3N99A 1JMOH 3SV7A 2FI3E 5CMXH 1SQOA 2F9UA 2A4GA 1AFQB 5FX5A 2P93A 1MMJN 4X6PA 1J17T 1DM4B 5FPSA 3E0NB 3BEFB 4O3UA 3ZVAA 1Y59T 4I8HA 2GCHG 5GCHF 1L1GA 1XUHA 2R0LA 5B6LA 2XCFA 2PKSC 3S0NA 2ZQ2A 3PWBA 1GDUA 1P2IA 1PPBH 2ANMH 2ALVA 1HAIH 5HKKD 1AE8H 2Z9KA 4NWLA 1W2KH 2O8MA 2FO9A 1O3AA 2ZPSA 5E0JA 2BVSH 1ZPZA 3ZZ7A 2STBE 3PV5A 2J4IA 1G2LA 3SV9A 1O5AB 3U28C 1BTWA 1J9CH 2F4LA 1XXDA 3MNCA 4X2VA 1P12E 3MNSA 4GCHG 1RS0A 1YWUA 1ZPBA 2OC1A 1W0KD 4VGCC 4I8LA 4X1NU 4RKOB 3T62A 2B8OH 1OP0A 1O38A 3NK8A 5EXMA 2A4OA 3CENA 3M37A 2FZZA 2XNDD 1O3PB 1KIGH 5FL7D 2Q1JA 3K6ZA 3MH6A 1O2LA 3DSPA 3LGIA 2HLCA 2FI4E 3PV2A 3S7KB 2OC7A 2PUXB 2BVXH 2ZDNA 4K69A 2J38A 2P59A 3B23B 2VWOA 2RA0A 2QXHA 4IN2A 5EJZA 4B75A 2OC8A 3P95A 3RMOH 4BTTB 5IDKA 1GBMA 1ETTH 3TK9A 3EAJA 1O2NA 3PMBB 1GBFA 4AG1A 3QUMP 3TH3H 1GJBB 3GOVB 5EJLA 2FODA 1NZQH 3OY5U 5C0TA 1SB1H 1GMCF 1SG8B 4OGXA 2PUQH 1O2KA 4GVUA 3MQKC 4Y11E 1ID5H 3HKJB 5L6NH 1SPJA 3EE7A 5FPYA 1A0HB 3TNTA 4K1SA 1T8MA 4X1PU 1HBTH 1E38B 5E0GA 1WAYB 1HXFH 2J34A 3SNCA 3LGYA 3H5CB 2QN5T 2HPPH 1EQ9A 2B7DH 2J9NA 1NN6A 2OUAA 3LGTA 2WPHS 2FLBH 3GDSA 4AG2A 3TGJE 1O5BB 2ZGJA 1TGTA 1SHHB 1FUJA 3LC3A 4Y71A 5HM2A 4MDSA 3SGQE 4ZKNU 2BD4A 3RU4T 1MTSA 2PFEA 4Q2KA 1QBNA 5JB8S 1NO9H 5EOKA 1ZGVA 2A0QB 1C1SA 5A0AE 3SU3A 1KMHB 1G3CA 5L2ZH 4ABAA 4BAQB 1YPMH 2AMDA 5E2OA 5DP3A 1GJ7B 1G3EA 1ARBA 5AFZH 3TJOA 1KXCA 1RTFB 3BIUH 2YNBA 1V2MT 1KXFA 2STAE 4FUFA 3SNDA 5HYOA 3HPTB 2HNTC 2HNTE 1MTNB 3U1IB 1WV7H 2XWBI 5A8ZA 1C2DA 5TCCA 2WPLS 1DICA 4NGAH 1AZZA 3MO3A 1NU7B 3S9CA 2ZFQH 1JIMA 1N8OC 5EQRA 1E36B 1SGQE 2BZ6H 1GI4A 1O2SA 2XYAA 2FI5E 4IC5A 5E2PA 1QIXB 3DFLA 1GJ8B 1EJNA 2G55A 2SGQE 2JH6D 3ZZ8A 2BOKA 2BXUH 2UUFB 2VVUA 3SU5A 1ZSLA 3H09A 1EOJA 1V3XA 4F55A 1HJAC 3PO1B 1ELAA 4WF8A 1BA8B 3SO3A 2WPDD 4ABIA 1VCPA 1TA2A 2NWNA 2P3UB 4D9RA 2C8YB 1SLVB 1TMUH 4J1YA 1Q2WA 3OFND 4K2YA 1ZHRA 1A3BH 3K65B 4A7IB 3M7TA 1TX6A 4JCNA 1S5SA 1IQJA 4AORA 2QXGA 1AKSA 1F2SE 4DJZB 2NU0E 2P3FH 4TYDA 1NFWA 1E0FD 1GL1A 4FUIA 2FDAA 1GI6A 2GCTB 2A7CA 2BY7X 2VBCA 2QYIA 2HOBA 4LZ1H 2H5DA 1C5RA 3ESTA 3ELAH 5E8EH 7ESTE 1QBOA 1J8AA 3PLKA 1W7XH 4B71A 1A2CH 2AS9A 1ZJKA 3RXAA 4IGDA 4MPUA 2GV6A 1TFXA 1D3PB 4U01A 1SR5C 4DY7B 2SNWA 1O3KA 5FXLA 1AWHB 1O37A 1GHAG 5C5NA 1ANDA 4IC6A 3VB4A 4B74A 1AZ8A 2DE8A 6GCHG 4WWYA 1FN8A 3KYFA 1ABJH 1O3GA 1ACBE 4GHTA 3BTQE 4FOUC 1S6LA 1O31A 4OS4A 3OEHD 4XDEA 3RXMA 2WSSD 1H8IH 3MH5A 1VKYA 5AF9H 3AASA 4UFGH 1GBCA 1AVGH 3RMLH 2JJ1D 3RXSA 1IQHA 2BLVA 3QGJA 1TX8A 3VB5A 2BY9X 1L1JA 1QQUA 2FM2A 3D49H 2GP9B 3TVJB 2OLGA 3BIVH 2WUCA 3PYHA 3QX5H 1YPLH 3U69H 5F8XA 1Z6EA 1BDAA 1BTXA 2G5VA 1HIAB 3M5MA 1MQ5A 1W13U 2GT7A 4M9FA 2ZHEH 1EP5A 4I32A 3SUEA 4Y7BA 1HAVA 3GS9A 1EP6A 1EPTC 1UVTH 2W3IA 4FUHA 5ESBA 1G37A 4D9QA 2OINA 3NCLA 4AZ2B 4RT1A 4B6FA 2AFQB 3OAAD 5ESTE 1YC0A 2PW8H 4JK5A 2I6SA 1RIWC 1VGCC 2KM0A 2FWWA 1SLXB 1XUKA 1PPEE 4PROA 2V3OH 3I29A 4GHQA 1GL0E 2G4TA 1UVOA 1JIRA 2SNVA 3B8JA 3NRLA 2GX4A 4WMEA 4Z0KA 3V7TA 5JPMH 4X6NA 3A87A 3LIWA 1MQ6A 1P0SH 2TPIZ 1W8BH 4BXSA 1O5CB 3MNXA 4D8NA 1RRKA 5L2YH 4MNYA 2SGAA 3GY2A 1S81A 1FMGA 3F2GA 1DSTA 1Q31A 1LTOA 5FCKA 1BMMH 1IQMA 3BN9A 5DP7A 5DP8A 2RCEA 2BLWA 3QTOH 3KYGA 1ZMNA 2EI8A 1P10A 2NU2E 4NIWA 7GCHF 4IS5A 3TU7H 3T29A 3TJVA 1GHXH 1GHVH 1O3IA 2AGGX 2WHXA 5EU8A 1P8VC 1N6XA 5F8TA 8ESTE 4LOYH 4Y0ZE 2P3TB 4D76A 2Z94A 1JWTA 1F5RA 1KDQA 1O33A 1XM1A 3RXLA 1C1QA 3TH2H 3SOSA 1A5GH 1OP2A 1GI5A 3RXQA 1T8LA 1A1RA 3ATWA 4AGKA 4ABDA 1H1BA 3M7QA 1EFRD 4ASHA 3KQEA 1O32A 2QIQA 1SGEE 1ANEA 2THFB 1C4V2 2LP6A 3FVFB 2A2XH 1UTOA 1GBKA 3SU0A 5A0CA 2HGTH 2Y5FA 4HFPB 4BTIB 1HAZB 3U98H 1Y3WA 3PLPA 4MNWA 2V3MA 4Z6AH 4JZIA 1TA6A 3FZDA 1BIOA 1BTZA 1SMFE 3M3VA 1DWCH 2BD5A 4H6SB 5EPYA 7LPRA 4JK6A 2P8OC 5C1XA 2OQ5A 9LPRA 4XBDA 4E06H 4YLQH 4IMQA 1YPKH 1O3JA 2WYJA 1UVUH 1C1MA 1FLEE 1N6YA 1HRTH 1DXPA 3LJOA 5JDUB 2I6QA 2F9NA 1DXWA 1TAWA 1RJXB 2GZ8A 1O34A 2YNAA 5C1YA 1ELTA 3RC6A 1ZR0A 2PTNA 2ZFPH 3SUGA 4TSFD 4JZFH 1BQYA 2JH5D 5KGOA 3KQCA 2JKHA 2GZ7A 3L6PA 3E1XB 2D2DA 1KSNA 5C0UA 4AYYB 1EJAA 2ZDAH 4AB9A 1EAIA 1V2UT 4ISOA 3URCA 3SQEE 1AI8H 1SGCA 3MI4A 4CRFA 1P2KA 1GJDB 2PR3A 3A7YA 1O3FA 3D23A 3GCOA 4FU9A 1C5UA 3QDZB 3L3TA 3RXVA 2Z3EA 1L1NA 2FLRH 1C2JA 1C5WB 4F48B 4ZAEA 5EODA 4A5TS 1P05A 1SGPE 1KY9A 3ZZBA 2C90B 2Y7ZA 1DLKB 1ZRKA 2AH4X 1ANCA 1QA0A 4AX9H 1O0DH 1CU1A 5EW1H 1A46H 1OP8A 2Z3DA 1TOMH 1QBVH 1GMCG 1V2PT 2Z9GA 2CHAB 5GIBA 1AN1E 1TPPA 1BUIA 1O35A 1AY6H 4UFDH 4X2WA 4INHA 2VIDA 1P3EA 3SV8A 4MPXA 3U9AH 1D9IA 2BM2A 4MLFB 3SU4A 3E16B 1QRWA 6CHAB 1CHOF 2WV4A 4LK4A 2FOMB 3WW7A 2G8TA 1D6RA 1TE0A 3PB1E 5FHTA 3QZRA 3R0FA 1UTJA 3T5FH 2C8XB 1LVOA 4RI0A 3GY3A 3EGKH 1HAYB 2EA3A 4AFQA 2YMSB 4KTUA 4Y0YE 4J2YB 1FIWA 4FVBA 3MHWU 5DO4H 1P2QA 1RTKA 2FP7B 1YPHC 3LPRA 5JBCS 2A32A 3U8TH 2GT8A 5EG4A 2BD7A 4BNRA 1COWD 4NA8A 3U8OH 2ZO3H 1W11U 3FANA 3UNQA 5CHAC 4Y7AA 2XC5A 1HAHH 1K21H 2VINA 2ZFFH 5TJXA 4CH8B 4BAOB 1FJSA 3F2HA 1AB9C 1BJUA 1ZOMA 1GI8B 1KXBA 1TMBH 2V35A 2ZHWH 4K8BA 4WXIA 5C5OA 3E90B 3P70B 3F9GA 3AK5A 5KEDA 3V12A 4ZXYH 1HAXB 4U32A 4U30A 1V2QT 4GUXA 1YYY1 1MAXA 4R0IA 1MBQA 2BD9A 2Y5HA 2K8IA 2XWAA 3RU4D 3T25A 2FOFA 2VJ1A 1CHGA 1S82A 1OYQA 4YLUA 1O2QA 5CE1A 1O5GH 3F6UH 4CRCA 2KFWA 2GTBA 4H42U 2OTVA 1UVSH 3RXFA 4JYVH 4A92A 2Y6TA 4WMFA 5J4SA 1FQ3A 3NXPA 1W0JD 4HZHA 1S0RA 3LONA 1A4WH 5LH8A 2H6MA 1K1IA 1GBIA 1O3HA 8KME2 3QWCH 4DVAU 1GI0A 1DVAH 1ZTLA 4OS5A 3BTTE 2A7HA 4KP0A 2BDIA 4BAMB 1CVWH 1UK2A 4ZCNA 2O8LA 1J15A 2W5EA 1TBRH 3A86A 1XVOA 1V2OT 5T6DA 2HRVA 1J16A 1M9UA 4THNH 1A61H 3RMMH 4RSPA 3DFJA 1KLTA 3PMAB 3PLBA 1D3DB 2BLQA 2ZU4A 1C1TA 5JBTA 3N7OA 2ZIQH 5H4IB 2KAIA 2R3UA 5EGMA 1Z71A 5A8XA 3GDUA 2L74A 4I33A 2V6NA 2OBOA 4FVDA 4JYUH 1OWDA 4H6TA 2Z7FE 1XX9A 2FOHA 3A7ZA 2H9HA 1DPOA 1SGIB 4DURA 3A7VA 1SGYE 1CA0C 1FIZA 2BVRH 4YOJA 5PTPA 2BDHA 1C1OA 3TITA 1DY9A 3M3SA 1YKTA 1QL7A 2IOTA 1SOTA 2F3CE 2ANYA 1BOQA 1ZTJA 2SGDE 8LPRA 3BEUA 2BQ6B 3MU0A 1UTNA 3P8FA 1Y3YA 3SV2H 3UTUH 1EASA 3V3MA 1IHSH 2P94A 3SV6A 3ZVBA 1WTHD 3TH4H 1YY3A 1TRNA 2B0FA 3B9FH 3QLPH 3S9AA 1GCTB 1ZMLA 2ZQ1A 2CJIA 1HPGA 2QGRA 2WPMS 3BG4C 2IPQX 1LKAA 3SNBA 3PRDA 1G9IE 1YLNA 2EI6A 1ZYOA 2PHBA 4NA9H 2R9PA 4NWKA 5GWZA 3TK5A 4O97A 3IITA 1GDNA 2GD4B 2TGAA 1NC6A 1GJCB 1O30A 3ITIA 1A5IA 1TB6H 1J14A 5C94A 2ZECA 4MNXA 1AUTC 2OCVB 4Y8ZA 1H4WA 2ZU5A 4E7RG 3KCGH 3OY6U 4X1RU 4SGBE 2YOLA 1FI8A 2AMPA 5AHGH 1BBRK 4BTUB 4TPIZ 3MTYA 1AVXA 1GVKB 5DJ7A 3RMNH 2V0BA 2ZU1A 2D26C 2XOKD 3H7TA 5EJ1A 1NBMD 4ESTE 2FPZA 4XFQA 3NZIA 1GI2A 1N8OB 1PQ7A 3RXGA 3E91A 1HXEH 2PGBB 5TCAA 4OS6A 6LPRA 3UQVA 3ZYEA 4ASUD 1THPB 1OX1A 7GCHG 1TGNA 1KTTB 3A83A 3MU8A 3D65E 2KAIB 1C1WH 2ZDLA 3VXEH 3SU2A 3VPKA 1LQEA 1MUEB 1P06A 3P17H 3GYLB 4FUBA 4QT8C 3S7HB 3STJA 1LKBA 1C5XB 4IW4E 3VB6A 1XUFA 3UOPA 2B5TB 1XKAC 2EI7A 1C5TA 1UTMA 1K1PA 2G00A 4B2AA 5T6GA 1VITG 3UPEA 4CRDA 4JYTA 1TONA 2ZPRA 3I78A 4XSKU 3P8NA 1HLTH 1YCPM 1IHTH 2XBVA 1O2WA 2G5NA 2PV9B 3M5OA 3RXCA 3CS0A 4BOHA 1S83A 3C27B 5BRRE 2IPHA 1P02A 1T31A 1NY22 3UOUA 1HAOH 3O8RA 2BY6X 2Z3CA 4DIIH 2WPIS 3ZZ5A 4OM9A 1MU8B 1OSSA 5I25A 1HFDA 3KL6A 1MKXK 3LC5A 3SZEA 1C1NA 2Z9LA 2ZFSA 2WINI 2VIQA 4IBLH 3RLWH 2BB4A 1VCQA 5EQQA 2FX4A 1SFIA 1HIAA 3W1EA 1QL9A 4NSVA 3UAIC 1PYTD 5EW2H 2F9PA 4MQAA 3SUDA 2FTLE 1C5VA 1FDPA 2JETC 1TLDA 1DLEA 4X6MA 3FZZA 1P9UA 1EZXC 1W14U 2KCYA 3SJ8A 1BBRH 3DHKH 3UY9A 1HV7A 2FIRH 1QRZA 2CMYA 1YBWA 4ZHLU 1OWEA 2ZHQH 4ZROA 3TK6A 1BHXF 3OTJE 4HI3A 1THSH 5DP5A 1CQQA 1EPTB 2P16A 4INLA 3A80A 1T4UH 2K0QA 3LKWA 2ASUB 3PMJA 5DG6A 1HYLA 2BZAA 4ABHA 5C67A 5I46H 1RIWB 1VGCB 1LHDH 4AC9A 2A5KA 3EDXB 1NESE 9ESTA 1O2VA 3LJJA 1THRH 2Q6FA 2H9EH 4ABJA 1CO7E 4ZMAH 2QAAA 3M5LA 1B0FA 1L2EA 1NROH 1OWHA 1SLWB 2PLXA 2DUCA 1T8NA 4B76A 4WH8A 3WY8A 1ZMJA 1O2TA 1FNIA 1NS3A 1AHTH 5GXPA 2AHME 1P2NA 2H2ZA 5SGAE 3FOAA 1O5DH 1SQRA 2FYQA 3HKIB 4JZEH 2FOCA 1SHYA 1CHOG 4SGAE 1P3CA 2BY8X 3M61U 1AWFH 2AGEX 2CV3A 1F5KU 2HVXA 1GBEA 3GCHC 1O2JA 3VXFH 1GDQA 5JB9S 3PRBA 3RC4A 1BRBE 2BQWB 4B1TA 3D62A 1GJ6A 5BPEA 1MKXH 2AIPA 3UQOA 3GY7A 4A1VA 1C4Y2 3TPIZ 1T8OA 2A5AA 3F1SB 1GBHA 4Q63A 3KQBA 4UEHH 1E1RD 3GCTF 4ABBA 1BT7A 3ATMA 3E6PH 4AFSA 1UW7A 1BHXB 1FY8E 4ABFA 1C5SA 2QF5A 1FY5A 2J94A 2BX4A 2PSYA 3CP7A 3KNXA 4OS1A 1BCUH 3SBKA 5JYIA 3AW0A 1Q3XA 5FX6A 3M7UA 1ZSJA 2EC9H 1QQ4A 5HIYA 1HAPH 3O8DA 1O3CA 1Z8IB 4INKA 4FUGA 3EA7A 1CSOE 2ZGHA 1GG6C 4YOGA 2ODQA 2ZF0H 2ZI2H 4NSYA 1TNLA 4AFZA 1BMAA 2Z6BD 1UCYE 1EAXA 3NPSA 1PQAA 1H8DH 2ZTYA 3DSOA 5KECA 3ZVEA 4WVPE 4O9VA 1LPZB 1V6DA 5EQSA 3A81A 4YT6H 1K0HA 3SI4H 1K1NA 1QR3E 5F8ZA 1D3TB 3SJOA 4BAKB 1C2FA 1DOJA 3GICB 2BD3A 1P57B 1SSXA 4XE4A 2Y5GA 3FP7E 4U2WA 5JBAS 1TIOA 2CF9H 4M7GA 2O8TA 2GCTC 3OX7U 1WUNH 1SGDE 2ULLA 1CBWC 1T7CA 1Y3XA 1BJVA 4KELA 3ZV9A 1D6WA 2J2UA 1W0YH 2R2MB 2EQNA 1IAUA 2XRCA 1P2JA 3TIUA 4FUDA 4OGYA 4E7NA 1O39A 2VIOA 1MTWA 4YXWD 1ELCA 1SBWA 2BQ7B 1LHGH 2HWLB 1GBTA 1FY4A 2HPQH 5GDSH 5AVDA 4ZHAA 1IQKA 1ETRH 1SFQB 2PP6A 1WQVH 3PV4A 4MG3A 5DK1A 1YP9A 2SGPE 1IQIA 1F0TA 4FUJA 4BAHB 4X0WU 1TWXB 2BDAA 4A6LA 3IG6B 2UWOA 2H9TH 2GDDA 2OD3B 1B0EA 2FOGA 2ANWA 5GCHG 2BMGB 1DUAA 2QV1A 3A8CA 2VB0A 1G2MA 1CT2E 3MNBA 4GSOA 1TX7A 1O2GH 4GLYA 3TNSA 2ZU2A 4B6EA 3R3GB 5FAHA 4R8TB 2UUKB 4AGJA 1EJMA 4ABGA 3ZZCA 2ZC9H 2GMTC 3FP8E 1BB0B 1G30B 3A7TA 1UK3A 2ZPQA 2ZDVH 4I31A 5C20A 2KR7A 4B73A 1CT4E 3ODDA 1MTVA 2LNCA 4BXWA 4Y10E 1TPSA 2WV9A 4ACAA 1GMHF 3UB0A 3U1JB 2BOHB 1YPJH 3ATIA 1NRNH 1FONA 2O8UA 4XBCA 1QY6A 3V13A 5LPFA 2UWLA 3SYJA 1AB9B 4K60A 4ACBA 1C2EA 1ELEE 2R2WU 1V2KT 3A82A 1O3OA 2VIVA 2J92A 1OHHD 1BZXE 2ILNA 3M36A 3PM3A 1BRUP 2NU3E 1LCYA 1RTLA 3SORA 2QCYA 2VWLA 3SZNA 1PFXC 1ESTA 1DANH 3OSYA 3ZZ6A 5DP9A 5IYTA 1GJ5H 1XUGA 1MTUA 2BYAX 3DUXH 3RXHA 1O5FH 3ZZ3A 1GHYH 1A0LA 3RLYH 1QURH 3MU5A 4Y76A 4YO9A 1G36A 5DKMA 1GVLA 4CR9A 4Q4LA 4Z1MD 4AFUA 1PPGE 2A4RA 4OS2A 1P2OA 1UTKA 1UTQA 1KLJH 1B7XB 3A89A 2TIOA 1P2MA 2A5IA 1O2RA 1NM6A 1TNGA 1GI7B 1BITA 4K1EA 3AAVA 3JZ2B 2RG3A 2WZQA 1MABB 3F0PA 5T1VA 3WWFA 3DSGA 1KXDA 1O2HA 2A31A 1PPCE 4O03A 4DIHH 2XBXA 2F43B 3QK1A 1S6FA 1FXYA 1TPOA 5T3HA 1QJ7B 2UUJB 1O2MA 1QB6A 3RXPA 3EYDA 1YPHE 4NIYA 3UWJH 5JBBS 3F3BA 3VB7A 1T4VH 2VGCC 4A1XA 3QTVH 1VZQH 3PTBA 2OK5A 3RU4E 1TPAE 4F4OC 1NFXA 2ZU3A 1OOKB 3OTPA 1CA0B 1BTPA 2RDLA 3F68H 4TWYA 5EPNA 3LGUA 1F92A 4DOQA 1ARCA 3N7DA 3Q3XA 4XOJA 1DSUA 3ZVFA 2IN2A 1IQGA 3PMHB 2KCOA 2ZFTA 4AYVB 3GISB 1O2OA 2G81E 4CH2B 3UWIA 1QA7A 1W3CA 2GDEH 5F03A 4WXVA 1QTFA 3RXRA 2PKSB 2CGAA 3LH1A 3Q3YA 2FOBA 1H8HD 5LGOA 2QF0A 1RD3B 1UK4A 3ZZAA 1NRPH 4ZH8A 1ZRBA 3BG4B 4X2YA 3FKSD 3A7XA 2TGDA 4P02A 1GBDA 1WOFA 2G4UA 1UJ1A 3QO6A 1WXRA 3BV9B 3OYPA 3OU0A 1TNIA 1ELBA 1SGTA 1C5OH 2IJOB 4NFEA 2XC0A 3A8AA 2ZHDA 3Q3KA 1Z8GA 3LT3A 4VGCB 2ZZUH 1YLCA 1DWBH 2C3SA 2BDCA 4GPGA 1PQ8A 3BTKE 2KZ4A 1BTYA 1YPEH 1EB2A
chains in the Genus database with same CATH topology
2Y7XA 2DE9A 4X8TH 3ZZ9A 1TGSZ 1WSSH 1C5NH 1K1MA 4I8GA 1D3QB 3SJKA 5AFYH 1DDJA 2TRMA 2PKAB 3RC5A 2PGQB 4ZHMU 1VJ9U 4FUCA 1AQ7A 3BTGE 1C5LH 3KEEA 1C5ZB 2WPJS 2AIQA 3AAUA 2FYRA 1N1LA 1F5LA 3HK3B 4TPYA 1PPHE 3MO9A 5A0BA 3ZZDA 4NG9H 1CGHA 1LO6A 3T27A 1YGCH 1Z1IA 1O3MA 1QRXA 5K7RA 2ZG0H 1ZSKA 4CR5A 1F7ZA 1ZHMA 4CHAC 1ORFA 1FN6A 2BTCE 2ODPA 1TYNA 1VITH 1Y8TA 3Q76A 5FPTA 2GV7A 3TGKE 1PPFE 3P8GA 3RXDA 2G51A 2EEKA 1OWKA 3U8RH 3KF2A 2ZCKP 3V0XA 1LPGB 1GGDC 1SGFG 3GCTG 5LPRA 3FP6E 1NTPA 4X1QU 1KLIH 3EA8A 3SHCH 5FBEA 3ZYDA 1QL8A 1C2IA 1C5MD 3MWIU 5L30H 1QJ1B 1EOLA 5FCRA 3GCNA 1E34B 4KTSA 3EQ0H 2C8ZB 2J95A 1FAKH 1FPHH 1DFPA 4KGAA 1AMHA 1UHBB 2CN0H 4Y79A 2OP9A 3MOCA 3SI3H 5LPEA 3UREA 4WH6A 3SGBE 1GJAB 2A7JA 5EXLA 1ZPCA 1LVYA 1RGQA 3SJIA 3IWMA 3PWCA 1UO6A 3NWUA 1TNHA 1KXAA 3SUFA 2Q6GA 1EB1H 1GBBA 1Z1JA 4OS7A 3M3TA 1NPMA 3GY4A 2ZFRH 2H1UA 1C1UH 1QNJA 1UTPA 3VFEA 3F9FA 1HNEE 5C1UA 5FBIA 3SGAE 1EPTA 3SNAA 1EZSC 2JETB 1QJ6B 3GDVA 1FY1A 1O2UA 2BDYA 1LPKB 4MPWA 2ZTZA 2QA9E 1C2GA 6ESTA 2QXIA 2GKVE 2Z9JA 3VB3A 1P03A 1P01A 1AO5A 2VWMA 2FXRA 1EXFA 2WV5A 2XXLA 4ZKRU 2Q6DA 1XUJA 1NU9A 1XMNB 1HJAB 1KTSB 3FFGA 3VGCC 3SJ9A 1KXEA 1SVPA 3MYWA 1GMDF 1FPCH 3E3TA 3H7OA 3LH3A 4Y8YA 1LVBA 2VIWA 1K1OA 4YM9A 1HUTH 1DT2A 1GPZA 3SQHE 3ZVCA 1Y3VA 4K1TA 5G4BA 3MFJA 4K3JA 1TNKA 1BBRE 1E37B 5A09A 1JRSA 3BTDE 1ELGA 4WY3A 1AFQC 1FV9A 1V2LT 3SNEA 3E8LA 1JRTA 4Q7XA 1O3NA 2FMJA 1V2NT 1YLDA 3DD2H 4FUEA 1ETSH 2GZ9A 2C8WB 1PYTC 4X8UH 1PJPA 5F6MA 1V2VT 3T26A 3SU6A 4A1TA 1ZLRA 1GCTC 1OPHB 1KYNA 1BRCE 2TBSA 1C4U2 2V3HH 2ZKSA 3UNRA 2SGEE 4NZQA 1GVZA 2ZEBA 4UDWH 1TGBA 2BXTH 1B5GH 3RXBA 5C2ZA 1V2RT 1H9LB 3TLOA 2QXJA 2A2QH 4UONA 1F0UA 2BLOA 3GCHB 1QB9A 4FU8A 3C1KA 3Q00A 3AVZA 2H5CA 1CA8B 2ODYB 4DT7B 4D7FA 3Q77A 2VU8E 4GAWA 2OXSA 2NU1E 8GCHF 3UR9A 4MTBA 4NIXA 1G3BA 1GMHG 2PSXA 1EZQA 2FS8A 2ZCLP 1LMWB 3K6YA 4DGJA 2ZNKH 2BHGA 3BTME 2OBQA 1IQNA 1L0ZA 4WJG2 5B6OA 3KIDU 3MH4A 1C2LA 1SQTA 3HATH 1C2HA 2C4FH 4MPVA 1K1JA 3RM2H 1FZZA 1NRSH 3A88A 1Z8RA 1SQAA 3GY5A 4UE7H 1C9PA 1O3BA 1DWEH 1GG6B 3GYMA 1TNJA 5DGJA 1SGRE 1ELDE 1VJAU 1O2ZA 1ZGIA 1S6HA 3O8CA 4UD9H 4YOIA 2PWXA 1ANBA 1RXPA 1GI1A 3SHAH 1O2XA 1AE5A 3STIA 1C5YB 4YTAA 1UVPA 2A4QA 1TQ0B 2AEIH 1DUEA 1O2IA 4TY6A 4Q7ZA 2BX3A 1WU1A 4ZKSU 2Z9IA 3P8OA 1SGFA 1ZTKA 5T6FA 1CE5A 3M5NA 1T32A 3L33A 2F9OA 3T2NA 7KMEH 1HAGE 1W12U 4Y8XA 1W0ZU 3SW2B 1O3LA 1Y5UT 4ZKOU 1IQLA 2ZHFH 1CBWB 1GHBF 2XBWA 5DP4A 4B2BA 1SGNE 1G3DA 1IQFA 1BRAA 1TABE 3A85A 5C3NA 1K1LA 1SOZA 1GI3A 3LU9B 1V2WT 1LDTT 1ESBA 1GHWH 1HCGA 1V2JT 1DY8A 1FY3A 2D8WA 3KN2A 1D4PB 1GBAA 1S0QA 3DT0H 3CS7A 1O3DA 3G01A 1MTNC 3NKKA 4X2XA 1AU8A 1DITH 3BTFE 1UCYK 1SI5H 4NA7A 1U6QA 1C2KA 4RKJB 2C93B 1HDTH 2GGVB 4RN6A 1F0SA 2GCHF 4IN1A 3LDXH 4B2CA 1O3EA 1V2TT 3O8BA 2XW9A 1SC8U 3RXKA 5DP6A 2VWNA 4DW2U 2P8OB 1P09A 1EAWA 1X7AC 3SU1A 3PO1C 2GVFA 1C5QA 2FESH 3EE0B 1A3EH 1MAYA 4KKDA 2GMTB 1BTHH 1AFEH 1Z6JH 2AMQA 2VVVA 1W7GH 3VEQB 2FX6A 4GCHF 3HK6B 1JXPA 3W94A 1A5HA 2D1JA 4JZ1A 1JBUH 2A45B 3RXUA 3RDZA 3BG8A 3LGVA 1Y5BT 3BEIB 1H9HE 3T28A 1TBQH 3HGPA 1DX5M 3RXEA 1E35B 5GJ4B 4ISIH 3E0PB 1MH0A 3FAOA 3HGNA 3ZVDA 4FU7A 2K1QA 1MU6B 1PPZA 3RM0H 4ISLA 3GY6A 4KTCA 3ZZ4A 1FAXA 3F9HA 2F83A 2RA3A 3KGPA 1ZJDA 1OWJA 2F9VA 1K28D 4ZXXH 4MNVA 1GJ9B 3M35A 1AKSB 1WQSA 2QF3A 4HTCH 3MU4A 2XC4A 3S9BA 1HJ8A 4CRGA 1DE7H 1NFYA 2Y81A 4XBBA 1P04A 1MBMA 2LPRA 1RFNA 3MO6A 1EUFA 1YCPK 1MKWK 4YT7H 3A8DA 1P11E 2W26A 5HXFA 1TRMA 1O5EH 1W10U 3RXOA 3MU1A 2ANKH 1INCA 2CXVA 3I77A 1JOUB 2OC0A 1SLUB 2F91A 1L4ZA 4CRBA 2ZA5A 1VITF 3BTEE 1ELVA 5K0HA 4H4FA 3NUMA 1UCYH 1QHRB 2XBYA 2FOAA 4X6OA 3TJUA 2BDGA 2R0KA 1GBJA 3UNSA 2FEQH 1MZAA 4ZUHA 1DWDH 4DCDA 2ZP0H 1ESAA 5DPAA 1OWIA 1S85A 4K8YA 1TQ7B 3S69A 1HJ9A 1OS8A 5HM9A 1WCZA 1OKXA 3UIRA 2FTMA 2VGCB 1XUIA 1HGTH 2TGTA 1ZHPA 5CHAB 1C9TA 3LOXA 4AN7A 1L4DA 3KHVA 1IQEA 4LZ4B 1EX3A 1LHFH 2FS9A 2ZGXH 1MCVA 3LGWA 1HAVB 1Z7KA 2W7UA 2AYWA 2PTCE 1C1RA 1TMTH 1LQDB 4IMZA 4NZLA 1HB0B 4ABEA 2G52A 1LVMA 2VVCA 1O2PA 1C5PA 1WBGB 3ATKA 2XCNA 4JZDH 1UTLM 3ZV8A 4E05H 4I8JA 1EATA 1NRQH 2SFAA 4X8SH 1G32B 2ZGBH 3GY8A 2UWPA 1SL3A 4Y6DA 5EXNA 1GBLA 4CBNA 2WUBA 2WPKS 1A0JA 1YF4A 2ZWLH 3RUOA 4I8KA 4UFFH 1TRYA 1GMDG 1OXGA 2OQUA 2PKAA 1XXFA 2NU4E 3P6ZB 1AIXH 2ZDMA 3BSQA 1GWAA 2VNTA 1MZDA 2FOEA 1O36A 1BTUA 3A84A 1GHZA 2ZDKA 1OYTH 1ELFA 1YCPH 1MKWH 2BDBA 2XTTB 3TJNA 3UFAA 4X1SU 4NCYA 1KDQB 4I7YH 5HMAA 2W7SA 2VIPA 2AGIX 5A8YA 1CGJE 1EZUC 2ESTE 3QN7A 3RXJA 4MVNA 3RP2A 1F0RA 3SN8A 4O3TA 1K22H 1A7SA 4TWWA 3MMGA 2TGPZ 1EKBB 2ALPA 3UUZA 1XVMA 1AVWA 4ISHH 1GHAF 1CT0E 3K2UA 4WMDA 3ENSB 3W95A 3A7WA 6GCHF 1TALA 3BTHE 2XNIA 4LXBH 3QZQA 2F9BH 2Y80A 2HALA 1AUJA 4AOQA 4Q80A 2P95A 2AERH 3A8BA 3MH7A 1TOCB 1K9OE 1WYKA 2VH0A 4CHAB 4JMYA 4CBOA 1MCTA 3EA9A 2BY5X 3ZVGA 3TGIE 3P92A 2QC2A 1TGCA 1AD8H 2ZGCA 1PQ5A 8GCHG 1MD7A 1ABIH 1UHBA 1GGDB 3DA9B 1C1PA 1VCWA 2M5TA 4ISNA 3URDA 3RXIA 4HGCA 4DG4A 1QCPA 1O2YA 3ATLA 2Y82A 1YPGH 2SGFE 1LHCH 1XKBC 4Q7YA 3UR6A 1IOEA 5ETXA 1BMNH 1TBZH 1S84A 1DS2E 2QY0B 1GJ4H 2WYGA 1GCDA 4NIVA 1ZZZA 1QFKH 1Y5AT 3AW1A 5J4QA 1GI9B 1Z8JB 3K9XB 1BMLA 2CF8H 4AB8A 1LHEH 2CHAC 4BANB 5A2MH 5HGGA 1Y3UA 1YM0A 1MD8A 4NFFA 5ABWA 4FXGH 3F9EA 1H9IE 1UMAH 1VR1H 6CHAC 2B9LA 4X8VH 3ODFA 1C2MA 2BD8A 4YESB 1C1VH 1V2ST 4K5ZA 1K2I1 3QGNB 3BF6H 2UUYA 4TY7A 1P9SA 1NFUA 2R3YA 5E0HA 1NRRH 2A1DB 4F49A 1CGIE 4D7GA 3JZ1B 4CRAA 3KQDA 1WTGH 3RXTA 2W3KA 3PTNA 2BD2A 2HNTF 1AGJA 1GHBG 4CREA 5GPIB 2O9QA 3VGCB 3PROA 1QGFA 2JH0D 1EAUA 1NT1A 2O8WA 3BTWE 4YZUA 2ZCHP 2ZTXA 2VH6A 1QB1A 4UFEH 1JMOH 3SV7A 2FI3E 5CMXH 1SQOA 2F9UA 2A4GA 1AFQB 5FX5A 2P93A 1MMJN 4X6PA 1J17T 1DM4B 5FPSA 3E0NB 3BEFB 4O3UA 3ZVAA 1Y59T 4I8HA 2GCHG 5GCHF 1L1GA 1XUHA 2R0LA 2XCFA 2PKSC 3S0NA 2ZQ2A 3PWBA 1GDUA 1P2IA 1PPBH 2ANMH 2ALVA 1HAIH 1AE8H 2Z9KA 4NWLA 1W2KH 2O8MA 2FO9A 1O3AA 2ZPSA 5E0JA 2BVSH 1ZPZA 3ZZ7A 2STBE 2J4IA 1G2LA 3SV9A 1O5AB 1BTWA 1J9CH 1XXDA 3MNCA 4X2VA 1P12E 3MNSA 4GCHG 1RS0A 1ZPBA 2OC1A 4VGCC 4I8LA 4X1NU 4RKOB 3T62A 2B8OH 1OP0A 1O38A 3NK8A 5EXMA 2A4OA 3CENA 3M37A 2FZZA 1O3PB 1KIGH 2Q1JA 3K6ZA 3MH6A 1O2LA 3LGIA 2HLCA 2FI4E 3S7KB 2OC7A 2PUXB 2BVXH 2ZDNA 4K69A 2J38A 2P59A 3B23B 2VWOA 2RA0A 2QXHA 4IN2A 4B75A 2OC8A 3P95A 3RMOH 4BTTB 5IDKA 1GBMA 1ETTH 3TK9A 3EAJA 1O2NA 3PMBB 1GBFA 4AG1A 3QUMP 3TH3H 1GJBB 3GOVB 2FODA 1NZQH 3OY5U 1SB1H 1GMCF 1SG8B 4OGXA 2PUQH 1O2KA 4GVUA 4Y11E 1ID5H 3HKJB 5L6NH 1SPJA 5FPYA 1A0HB 3TNTA 4K1SA 1T8MA 4X1PU 1HBTH 1E38B 5E0GA 1WAYB 1HXFH 2J34A 3SNCA 3LGYA 3H5CB 2QN5T 2HPPH 1EQ9A 2B7DH 2J9NA 1NN6A 2OUAA 3LGTA 2WPHS 2FLBH 3GDSA 4AG2A 3TGJE 1O5BB 2ZGJA 1TGTA 1SHHB 1FUJA 3LC3A 4Y71A 5HM2A 4MDSA 3SGQE 4ZKNU 2BD4A 3RU4T 1MTSA 2PFEA 4Q2KA 1QBNA 5JB8S 1NO9H 5EOKA 1ZGVA 2A0QB 1C1SA 5A0AE 3SU3A 1G3CA 5L2ZH 4ABAA 4BAQB 1YPMH 2AMDA 5E2OA 5DP3A 1GJ7B 1G3EA 1ARBA 5AFZH 3TJOA 1KXCA 1RTFB 3BIUH 2YNBA 1V2MT 1KXFA 2STAE 4FUFA 3SNDA 5HYOA 3HPTB 2HNTC 2HNTE 1MTNB 3U1IB 1WV7H 2XWBI 5A8ZA 1C2DA 5TCCA 2WPLS 1DICA 4NGAH 1AZZA 3MO3A 1NU7B 3S9CA 2ZFQH 1JIMA 1N8OC 5EQRA 1E36B 1SGQE 2BZ6H 1GI4A 1O2SA 2XYAA 2FI5E 4IC5A 5E2PA 1QIXB 3DFLA 1GJ8B 1EJNA 2G55A 2SGQE 2JH6D 3ZZ8A 2BOKA 2BXUH 2UUFB 2VVUA 3SU5A 1ZSLA 1EOJA 1V3XA 1HJAC 3PO1B 1ELAA 4WF8A 1BA8B 3SO3A 4ABIA 1VCPA 1TA2A 2NWNA 2P3UB 4D9RA 2C8YB 1SLVB 1TMUH 4J1YA 1Q2WA 4K2YA 1ZHRA 1A3BH 3K65B 4A7IB 3M7TA 1TX6A 4JCNA 1S5SA 1IQJA 4AORA 2QXGA 1AKSA 1F2SE 4DJZB 2NU0E 2P3FH 4TYDA 1NFWA 1E0FD 1GL1A 4FUIA 2FDAA 1GI6A 2GCTB 2A7CA 2BY7X 2QYIA 2HOBA 4LZ1H 2H5DA 1C5RA 3ESTA 3ELAH 5E8EH 7ESTE 1QBOA 1J8AA 3PLKA 1W7XH 4B71A 1A2CH 2AS9A 1ZJKA 3RXAA 4IGDA 4MPUA 2GV6A 1TFXA 1D3PB 4U01A 1SR5C 4DY7B 2SNWA 1O3KA 5FXLA 1AWHB 1O37A 1GHAG 5C5NA 1ANDA 4IC6A 3VB4A 4B74A 1AZ8A 2DE8A 6GCHG 4WWYA 1FN8A 1ABJH 1O3GA 1ACBE 4GHTA 3BTQE 1O31A 4OS4A 4XDEA 3RXMA 1H8IH 3MH5A 5AF9H 3AASA 4UFGH 1GBCA 1AVGH 3RMLH 3RXSA 1IQHA 2BLVA 3QGJA 1TX8A 3VB5A 2BY9X 1L1JA 1QQUA 2FM2A 3D49H 2GP9B 3TVJB 2OLGA 3BIVH 2WUCA 3PYHA