2A7JA

On the routine use of soft x-rays in macromolecular crystallography, part iii- the optimal data collection wavelength
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Elastase 1
publication title On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength.
pubmed doi rcsb
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a7jA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a7jA01
2R0LA 2FTLE 2EI6A 1KXFA 3RU4D 3R3GB 3SQEE 3KQEA 3UY9A 1GJAB 1HDTH 3BIVH 3P6ZB 4B74A 1O2MA 1RIWB 4Q80A 4BAOB 4Q7ZA 1TMTH 1ZJKA 4TWYA 1EZXC 1A5GH 1V2WT 3L3TA 1FXYA 1K1NA 1DY8A 2JH0D 3U8OH 1G3BA 4RKOB 1SPJA 1AMHA 1MZAA 1RD3B 1MTVA 1NU7B 4AB8A 4CRDA 3TGJE 1SGTA 2G55A 1YPMH 2ZU1A 2F9OA 1A7SA 2F3CE 1YLDA 4VGCB 3OTJE 2OP9A 3RXOA 4A1TA 2SGDE 1MCTA 2C8XB 1MKXK 1QL9A 4MG3A 1EPTA 1K22H 1KXEA 5FX6A 4M7GA 4ZXXH 1V2JT 3NUMA 3SJ8A 1D9IA 1D3TB 1A0JA 2BZAA 1MKWH 3UOUA 3V3MA 2ESTE 6ESTA 1QRZA 2OC8A 1P2OA 2F9PA 3I29A 1AU8A 1GL1A 3AASA 3SI3H 3SU5A 2Z94A 1QB6A 2B7DH 4AGJA 4X0WU 2CV3A 3BG4C 3RMOH 1BBRK 2SNVA 2WPKS 4DY7B 5G4BA 2EC9H 3ZVGA 2ZP0H 4Q2KA 3GY6A 4I33A 4CHAB 2D1JA 1E38B 1ZYOA 1BMAA 2GTBA 2H5CA 4X1NU 1GBIA 4O3TA 1Y3UA 2XTTB 2J95A 1ZMLA 1GI1A 3UUZA 3SGAE 3UR6A 2AMDA 4FXGH 3M3VA 3A83A 2ZDVH 2NU2E 3NCLA 1TNGA 1GBDA 1DANH 2PGBB 1CGHA 1XUIA 1O2UA 4ZMAH 3ZZ6A 1C5PA 1KSNA 2CGAA 1LVBA 4ZHAA 1G2MA 4YOJA 2BQ6B 1WUNH 2GCHG 4DG4A 1HJ8A 1OP8A 1TGSZ 3NK8A 1LPGB 1UVPA 2FEQH 1A61H 4CRCA 3SU3A 1TOCB 2BVRH 3D23A 3LGWA 3UWJH 1DPOA 3PROA 1C1OA 1LHGH 2ZFFH 2AEIH 5I25A 1YBWA 7GCHF 3GY7A 1QB9A 2B8OH 2THFB 4CRFA 1P11E 4NIVA 4Y76A 2ZHEH 2PUXB 5DP7A 2Y6TA 1B5GH 2VWNA 3D49H 2WV4A 5EODA 1O37A 3VFEA 3BIUH 1ZHRA 4CREA 1AVXA 1W13U 1XM1A 4BAHB 1J16A 1NM6A 1O5CB 1AWFH 5EW2H 1RS0A 1C2FA 4CBOA 3LOXA 4GLYA 1IHSH 1Y5BT 4CR9A 3SZNA 3SQHE 1C4V2 1H1BA 2WPHS 5FAHA 3DA9B 1Y59T 1KDQA 2XW9A 3RXLA 2A5AA 2BLVA 1KTSB 1Z6EA 3ZZ3A 2V6NA 4DVAU 2G52A 1X7AC 4AYVB 2EEKA 2FMJA 4D9RA 2BMGB 3M61U 2KAIA 1L1NA 2VH6A 2F9VA 1V2TT 1PPEE 1JIRA 3BTDE 1DX5M 4YOIA 1C4U2 4VGCC 1YC0A 2QGRA 1C9PA 1ETRH 4RN6A 1TQ0B 5AFYH 2UUYA 3HPTB 2GZ7A 3RXFA 4OS2A 1UTKA 2YNBA 5CE1A 1DWEH 5TCCA 3TJNA 5GXPA 2M5TA 2YOLA 4PROA 4X6OA 2QAAA 1IQIA 1F5RA 1ELDE 1C1PA 2HGTH 4H42U 5EPNA 1P02A 2B0FA 5EOKA 4FUEA 2ZNKH 1OWJA 3SUFA 2ZU3A 1DLKB 3T26A 3A7TA 2RA0A 3P8OA 1MMJN 1TA2A 2ZECA 1F5LA 2F91A 2PSYA 4Y0ZE 1EZUC 1GG6B 1MUEB 1HCGA 4ABAA 2GZ8A 3VB6A 2ZU4A 1GBTA 5GCHG 5E0HA 4TWWA 1GJ6A 2OC7A 4K69A 1EATA 4AN7A 1NESE 1GHAG 2NU4E 5C1UA 3M7QA 1G3CA 2JETC 1FV9A 1S6HA 2ZFPH 4AFQA 1UVOA 3S69A 3KL6A 3GY2A 2UUKB 1AB9C 3MU1A 4R8TB 1DSUA 3Q3XA 1K28D 2AYWA 1XVOA 9LPRA 3VB5A 2OXSA 5ESBA 6LPRA 3FP8E 4AB9A 4BTUB 1P8VC 3BTHE 4JYUH 4HZHA 2BLOA 1K1MA 1EAXA 3A80A 1FI8A 3TK5A 2QA9E 2TGAA 1HAPH 1KLIH 1ZRKA 1PQAA 4A1VA 4ZROA 2ZQ2A 2FODA 2AH4X 2A7HA 1ARBA 2Z3CA 2SNWA 1N6XA 1GJ8B 2J94A 1BTZA 5CMXH 7ESTE 1ORFA 1O2KA 1CT2E 1VCQA 2JH6D 3LONA 2HNTF 3RXCA 3BTGE 1XUFA 1G2LA 1ZPBA 2C93B 3ZVEA 1CT4E 1OWKA 2VVUA 2ZPQA 2ZEBA 1BRCE 1OYTH 3P95A 3RMNH 4X8VH 1C1TA 2LNCA 1HNEE 2BB4A 1K1PA 1UK2A 4XBDA 1CA8B 1RGQA 3D65E 3Q00A 4X1RU 4LZ1H 1A46H 1Z8GA 3T28A 3KHVA 4ISOA 1GVLA 2FDAA 1C5TA 1GGDC 4CRGA 1C1QA 2ZFTA 4AGKA 4CH8B 1XX9A 2PW8H 5E0GA 1GMCG 3EQ0H 1GJBB 2FYQA 1AD8H 1SGQE 3QO6A 3F68H 3P8NA 1S0RA 2Y7ZA 1XMNB 1C1UH 3GCTG 1LDTT 1SQOA 2G8TA 1SGNE 4XBBA 1OOKB 1C5SA 4WMEA 1MH0A 4TYDA 1SQTA 1XUKA 3I77A 1TPAE 1E35B 1OWEA 2G51A 1AFEH 1FY8E 2CF8H 4FVDA 3T5FH 2XCFA 1ANDA 4B1TA 2HPQH 2ASUB 5LGOA 2SGEE 3P8FA 1ABIH 1K1JA 3EDXB 3RU4T 2C4FH 4K1TA 1FY1A 2FO9A 2ZC9H 1L1GA 2BD4A 1ZMJA 1RTFB 5FPTA 5ABWA 1LQEA 1O2YA 1A0LA 3U69H 1HAZB 5DGJA 1GVKB 3BF6H 5HGGA 4Y7BA 3E3TA 1FPHH 3M5OA 3M7UA 3RXKA 3RLYH 1GI5A 3ZVFA 2G4UA 5FPYA 2C8ZB 2ZWLH 3HK6B 2BY9X 5TCAA 1TWXB 1B0FA 3NXPA 3NZIA 1CO7E 1UVUH 1GHZA 4E7NA 2BDHA 4SGBE 2W3KA 1GCTB 1AIXH 3S0NA 3VGCB 3AAVA 4MNWA 3OU0A 5JDUB 4CBNA 3PB1E 2ANWA 1AFQB 3E91A 3A82A 1NFYA 2ZGBH 2NU0E 4I32A 1HAOH 1T32A 4B71A 3ZZ9A 5JB8S 1SFQB 2RG3A 2WPMS 4ISIH 1BJVA 4Y0YE 1GHYH 1IQFA 1V2QT 3PMHB 1GBFA 4X6PA 3PLBA 1FAKH 3S9BA 1VITH 4I8JA 2P3TB 5DP5A 1BRUP 5A0AE 3QGNB 3D62A 1TOMH 3RC6A 4IBLH 4KP0A 2O8LA 3P70B 1L1JA 1W10U 2FOMB 1BZXE 4GVUA 1UTMA 3GOVB 2TGPZ 4NA8A 3ENSB 1N8OC 4WXVA 3SNEA 1Z1JA 2XRCA 1UHBA 5BRRE 3SU2A 1ZMNA 2HVXA 3A7WA 1FQ3A 2OBQA 4JZEH 1HV7A 3QUMP 1CA0B 1LTOA 1FMGA 4FUJA 4KTUA 3EAJA 1LPKB 4JZ1A 3EE0B 3SW2B 1MTNB 3MNBA 3MO9A 3P17H 3ATKA 1ESTA 1EPTC 1XKBC 2FP7B 2R2MB 2R2WU 3MH4A 2GZ9A 3ITIA 9ESTA 1DSTA 2BZ6H 5CHAC 1EB1H 3GYMA 3U9AH 3MNCA 3QGJA 4HFPB 1UCYE 1KXDA 3RXEA 1MTSA 4K2YA 4THNH 3T2NA 1QGFA 1J8AA 3AW0A 1C1NA 5FCKA 4NFFA 4IW4E 1GHVH 1GDQA 1XXDA 2PHBA 1PQ5A 4WH8A 2WYJA 4I8KA 1KIGH 4MQAA 1P03A 1H8DH 3V13A 4XBCA 4DGJA 5EXLA 4INKA 3PMBB 3ZZCA 3VB7A 4I31A 1S83A 4H6TA 4DT7B 3KN2A 1RJXB 3MO3A 3KEEA 4RKJB 3A8DA 1W3CA 1Y3WA 4XDEA 2VU8E 5A8ZA 3TNSA 1O2OA 2D8WA 2P8OB 3EA9A 2J2UA 4I8LA 1SLXB 3K9XB 4AFUA 3VXFH 3NKKA 4J1YA 3ZZDA 3ZV9A 1N6YA 2ZTYA 2J38A 4YLQH 3UWIA 1O36A 1ELAA 1Z7KA 2FI4E 4UFFH 3RXIA 1TGCA 2BDBA 3S7KB 1O2QA 2R9PA 2AIPA 1A1RA 1C2IA 1DWDH 4JK6A 1L0ZA 3F1SB 4Z0KA 3V12A 3ZZAA 1ELBA 1GCTC 4UDWH 3VGCC 3PLKA 4A7IB 5TJXA 5EQRA 3PWBA 3M3TA 2CN0H 1HIAB 4JYTA 4U30A 2FM2A 2EA3A 3UNQA 4CH2B 3GY8A 2AFQB 1NRRH 3E90B 4NIWA 1E34B 2QXJA 4MPXA 1C5OH 3SNAA 3FAOA 1MAYA 3MMGA 5HMAA 1S0QA 3FZDA 1TB6H 1C5NH 2VVCA 1PYTD 3HKIB 1HJAC 3SNBA 2A7JA 6CHAB 5DP3A 2PLXA 2AS9A 1QTFA 4BTIB 1WTHD 2ODQA 1ZPCA 2PTCE 3MU5A 2ZQ1A 4X1PU 4ABEA 2XWBI 4AZ2B 2PKAA 1TNLA 4B2BA 1TPOA 3SGBE 3GY4A 5C20A 3RXRA 1IQLA 2BQ7B 1UK4A 3O8BA 1CA0C 1AE5A 4WVPE 1O3NA 2GCTB 3BN9A 1GHWH 1MCVA 4ASHA 3Q76A 2GV7A 3SU0A 4D8NA 3GDUA 2QY0B 1NROH 5A0CA 4ISNA 4WY3A 5F8TA 3PWCA 4IMZA 5DP8A 2F9UA 3CS7A 1AHTH 4DJZB 1GMHG 1WV7H 2ZCKP 3TJOA 1K2I1 5E2OA 4GHQA 4NCYA 4AFZA 3OYPA 3F6UH 2PTNA 1ELEE 1O3DA 2BD7A 2P59A 4NA7A 2PSXA 2H2ZA 4IN1A 4YT7H 2H5DA 1W11U 2C8YB 2G4TA 3BEFB 3LH3A 1OWHA 1AI8H 1YP9A 2WYGA 5PTPA 1EJNA 1W12U 1C2JA 4DURA 1S82A 2HNTC 3LJJA 1P2NA 1BRAA 1QL7A 1LVOA 3UQVA 3AAUA 4X6NA 2WPLS 1H9HE 2P93A 1NZQH 1Y5UT 5FPSA 1C2KA 2IN2A 3N7OA 3M36A 4MTBA 1CT0E 1SGEE 2A5IA 4ABDA 2J9NA 1WOFA 1JBUH 1YPJH 1BUIA 4H6SB 1O3JA 4OS1A 3M3SA 4OS5A 1TQ7B 1EKBB 1O3GA 1GJ9B 1Z6JH 1C2GA 2R0KA 1F0UA 2VIOA 2GDDA 1ELFA 2FS9A 3LDXH 2FS8A 4B2CA 1O3BA 2RCEA 3NWUA 1TIOA 1KY9A 1BMNH 2GMTC 3TK9A 1ID5H 1EJMA 1TNHA 2Y5FA 1HAYB 2PV9B 4AX9H 2NU3E 2BXUH 2H9EH 1HGTH 1EP6A 3O8CA 3RM0H 1Z1IA 2OINA 2VIWA 3VPKA 2GVFA 1EAUA 1ZHMA 5A8XA 5B6OA 1T4UH 1F2SE 1O39A 4B75A 1P3CA 1BTYA 3P92A 3A7XA 1TX7A 4FUIA 2ZHWH 4WMFA 2O9QA 1TA6A 2ZFRH 2CJIA 2BD8A 1RTLA 4DIHH 1ZSJA 1BMLA 4UEHH 2WPIS 1ESBA 2W7UA 3DHKH 3TNTA 1W0YH 3ZVCA 5JB9S 1UTNA 1EB2A 4NWKA 2SFAA 2BLQA 4WH6A 1O2JA 4OS4A 3HK3B 1DS2E 4NIYA 1AZZA 2ZGHA 1GBJA 1Q2WA 1RIWC 2GCTC 5L30H 8GCHG 1KXAA 3U8TH 2FLBH 2HNTE 4WXIA 3U98H 1A3BH 1T8LA 2P3FH 3UQOA 2GT8A 1K1LA 1TGBA 1Z8JB 4BAQB 2QXHA 1O3IA 1J15A 3PMJA 1QR3E 4GAWA 3M5NA 1QB1A 1A5HA 4FUHA 1BQYA 2A0QB 2A32A 4F4OC 3RU4E 3SJOA 4B2AA 1P01A 1OPHB 1BTPA 1QJ7B 1O30A 1TALA 3GCHB 3MO6A 4ZKNU 1O5EH 4KTSA 2W26A 1O3CA 4B76A 4BXSA 1NRSH 4X8SH 2OTVA 4YZUA 2XBVA 3VEQB 2Y7XA 1SHYA 3W94A 2ZKSA 1GBBA 3GYLB 2ZFQH 4NZQA 3RXDA 1P9SA 2QV1A 1DWCH 1YYY1 3E0PB 4YLUA 1A2CH 3H5CB 1C5RA 4UE7H 4A5TS 1XXFA 1TE0A 3SO3A 3O8RA 1GI7B 2Q6DA 3K6YA 1V2ST 4INLA 2ZCLP 2GCHF 4CHAC 4ZUHA 2A31A 2BXTH 5T3HA 4UFEH 5E8EH 1NT1A 4ISHH 1YKTA 4JCNA 3E16B 3RP2A 2BM2A 1P12E 5EQSA 2VWMA 1B7XB 1HAIH 1V2LT 3A88A 1E37B 3UNRA 1U6QA 3Q77A 1SGPE 2BVXH 1SVPA 3Q3KA 1NFXA 1B0EA 4D9QA 1XUGA 2OQ5A 2FESH 4FVBA 2D26C 1RTKA 5AFZH 2B5TB 2CHAB 5ESTE 1TPSA 3A89A 3A85A 4MPUA 5T6FA 1PQ8A 1BTUA 1GJCB 2QN5T 3SV9A 3B23B 1YM0A 2QF0A 1TRNA 2Q6FA 2J4IA 4Y7AA 4Y11E 5JBBS 5H4IB 3K65B 2FZZA 1FN8A 5EXMA 3TLOA 1D3PB 1AE8H 1C1VH 4I8GA 1C1RA 1D4PB 1FY5A 1MKWK 1ZLRA 1GJ5H 3TU7H 3FANA 1GHXH 5HM2A 1NRPH 2AMPA 3CENA 4TY7A 1JXPA 2ANMH 4ABFA 3SUDA 2BDYA 2C8WB 3T29A 2LPRA 5GDSH 3BTWE 2EI8A 2VNTA 3M5MA 1PPCE 2CMYA 4I7YH 1DWBH 3KCGH 7KMEH 3T27A 4KKDA 1MQ5A 1NU9A 1NN6A 1FZZA 1NY22 3PV4A 1GBAA 4NIXA 2ZGXH 4XFQA 5EG4A 3TH2H 1H9LB 1WQVH 2G5VA 1N1LA 3GCOA 4JZFH 4BOHA 4U01A 3L6PA 1TONA 5GJ4B 1ELCA 1OWIA 1BRBE 4ABJA 2ZDNA 4HI3A 4UFDH 4X2YA 1T4VH 3PTNA 2QXGA 4K1EA 1UTLM 1CBWB 2VIPA 3DUXH 2F9NA 1UMAH 1A5IA 1QBOA 1DFPA 1MTWA 5GCHF 1MD7A 1P10A 2BDGA 1D6RA 1HAVB 2BHGA 5C1YA 3SN8A 1C4Y2 1CHOG 1INCA 1HUTH 1GHAF 5C2ZA 1ARCA 3SJKA 2ANKH 3ODDA 3SNDA 4MPWA 2BY5X 3MU4A 5GIBA 1DITH 4Y8ZA 5SGAE 1TGTA 1CHGA 1TPPA 2Y82A 1VGCB 5DJ7A 1EP5A 1T8OA 1W7XH 1WSSH 1GG6C 3RC4A 2ZI2H 1DY9A 1BBRE 1SGFG 1J17T 1AVGH 3RXTA 2TRMA 2ZDKA 5LPRA 1UTQA 2XYAA 1AGJA 3RXBA 2XC5A 1P2MA 2UWPA 4AOQA 3A8CA 2VGCB 5K7RA 1NFUA 3SV7A 3S7HB 1LMWB 3GCNA 1CQQA 3RXVA 3GY5A 1EX3A 1THSH 2WINI 4MLFB 4K5ZA 1C5UA 4NSYA 2SGQE 2QYIA 4AFSA 3ODFA 3SGQE 3ZYEA 3TK6A 2OBOA 1O3LA 1DLEA 6GCHG 1EAWA 1O2GH 3OY6U 1IOEA 2Y80A 4Q7XA 2STBE 1ETTH 3MYWA 1ZSLA 1XUHA 3DFLA 5AHGH 3RXJA 4K3JA 2ZFSA 4WF8A 2FOEA 1IQGA 1WCZA 5FBEA 1TMUH 1EAIA 1P04A 5J4QA 2A4QA 1LO6A 1HBTH 1TBRH 4E06H 3MNXA 2FYRA 4LK4A 2XCNA 1KXCA 1IQEA 3UREA 5C67A 1GPZA 2ILNA 3RC5A 1NO9H 3DD2H 4DW2U 3UFAA 1OKXA 3E8LA 4WMDA 2XXLA 1GMCF 2ZIQH 2BQWB 1V2RT 1TX8A 1G9IE 1W2KH 2Q1JA 3M5LA 2BD3A 3UPEA 5FXLA 3BEUA 1YPGH 3GCTF 1GJ4H 3U8RH 3LKWA 1E0FD 4LZ4B 5LH8A 1O2IA 1IQJA 1BA8B 1ACBE 1YPLH 1JWTA 1O2LA 3RMMH 1O3AA 4IC5A 1F0SA 1TLDA 1BB0B 2ZU2A 1O2VA 3LU9B 1QJ1B 3LC5A 1VCWA 2QXIA 4KTCA 1W0ZU 3S9AA 5ETXA 1YPHC 2ZDLA 4OS6A 2BOHB 3ATMA 2A7CA 1QIXB 1FAXA 3URDA 2OUAA 1GMDG 1CBWC 3BTKE 1L2EA 3MH7A 4E05H 3LGVA 1KDQB 1GI6A 3F9FA 4LOYH 4ZKOU 3RDZA 1J9CH 4GCHG 1ANCA 1JIMA 2KAIB 4Y79A 3E0NB 3MWIU 1O3HA 1K21H 1GDNA 2BD5A 2D2DA 4WWYA 2BTCE 1PPZA 2AGEX 3RLWH 2BD9A 1THRH 2VJ1A 1V2KT 1MBMA 3TGIE 1TBZH 4F49A 1HB0B 1D6WA 1DXPA 2FWWA 1AZ8A 3AVZA 1C2MA 1O31A 2PUQH 4UD9H 1S5SA 3GISB 1S81A 3SU4A 1GI9B 3EA7A 1G37A 3SUGA 1LHDH 1O3EA 3FFGA 1VGCC 3H7OA 1NFWA 1BT7A 2PFEA 1P2IA 4K8YA 5C3NA 1M9UA 3BV9B 2J34A 1EOLA 2GP9B 1ANBA 1O34A 1ZOMA 2GV6A 4DCDA 2P94A 2FX6A 4K60A 4ZKSU 4D7FA 1WU1A 2VIQA 1O0DH 2UUJB 5GPIB 2WV5A 1QRXA 2Z3EA 2Z9IA 1VCPA 1EZQA 1ZJDA 1QBNA 1GJDB 4O03A 3BG4B 1O2HA 1LQDB 3SJIA 4MNYA 1QCPA 3BTME 1BITA 1P06A 4H4FA 1HFDA 1BMMH 1A0HB 2FLRH 1BDAA 1ZSKA 1LVYA 5IDKA 1C5YB 1OS8A 1TNKA 5FX5A 3QTOH 1AQ7A 3RXUA 2VIDA 5JPMH 3U1JB 2OD3B 2BDIA 3LGIA 3B8JA 2AGIX 2V0BA 4IGDA 2V3HH 2VVVA 2R3YA 1AFQC 1SOZA 2Z9LA 1QRWA 5A2MH 2F9BH 5DG6A 5EGMA 2H9TH 2ZCHP 2GDEH 3A8AA 1XVMA 2FI3E 4U32A 3TH4H 3QDZB 1SGYE 2PGQB 3F9GA 1JRSA 1YCPM 4HTCH 2Z9JA 4FUGA 1UCYH 3VXEH 1YPHE 3QN7A 1RFNA 1UVTH 1MD8A 2XC4A 4A92A 4JYVH 4QT8C 2ZZUH 1ZZZA 3A84A 4ZH8A 1O3PB 4YESB 2R3UA 3V7TA 2FOGA 3HKJB 3TITA 4FU7A 2UWLA 3LC3A 1DICA 1CU1A 1F92A 2ANYA 1BCUH 2Z7FE 4CRAA 1TMBH 3LGYA 4A6LA 3IITA 1DT2A 1NC6A 4ZHLU 1Y5AT 5IYTA 1F7ZA 1HJ9A 4FU8A 1YLCA 5JBAS 5AF9H 1GBEA 1Z8IB 1MTNC 3MOCA 3P8GA 3RXPA 1DUEA 1O3OA 1Y3YA 1AKSB 1GI3A 1SB1H 3BEIB 2FXRA 1V6DA 1L4ZA 1Y3VA 4FU9A 2G81E 1O2SA 2DE9A 3PLPA 3TH3H 2BDCA 1EOJA 2AERH 2XWAA 2XBXA 2HWLB 3DFJA 7GCHG 3TGKE 1UTPA 3PM3A 4WJG2 4NG9H 1DM4B 2GD4B 4D7GA 1O5AB 4GPGA 3K6ZA 4GHTA 1ZGVA 2Y5GA 1ZR0A 5L2ZH 1VZQH 1GWAA 1PYTC 1ELVA 1HAVA 1OX1A 1C1MA 3BTTE 3ZZ7A 2BD2A 2K1QA 3UNSA 1QFKH 1CSOE 2ODYB 2BY6X 1T8MA 1P05A 1P2KA 1ESAA 1FIZA 1P0SH 1P2QA 1TBQH 2J92A 2UWOA 3A86A 5L6NH 2BVSH 4NWLA 4AYYB 1QA0A 3IG6B 2P8OC 1P2JA 1THPB 3PYHA 3RM2H 2XBYA 1YCPH 4YO9A 2OCVB 1IHTH 1LVMA 4YOGA 3GY3A 3SU1A 4K1SA 7LPRA 1GCDA 2SGFE 2TGTA 1SGRE 1C9TA 1C5MD 1C5QA 3EGKH 3LGUA 5HM9A 4MVNA 1O2TA 2ZPRA 4IN2A 3CS0A 5A09A 4GUXA 3STJA 4JK5A 2JETB 2FOCA 1DE7H 3OY5U 1EQ9A 1MBQA 5EU8A 1AB9B 1A4WH 2HRVA 2A5KA 2TIOA 3ATLA 2UUFB 3ATIA 1YF4A 1SG8B 1EJAA 1QL8A 2A2QH 1DVAH 2AGGX 1C2EA 1O5DH 1O2NA 3MI4A 6CHAC 2STAE 1UO6A 3KNXA 2HLCA 1VR1H 2OLGA 2B9LA 1IQMA 1O33A 3S9CA 2QCYA 1CGJE 1GMHF 1KLJH 2OQUA 1G3EA 5EXNA 3C27B 1JMOH 1QA7A 2ZU5A 4NA9H 3RXSA 4AORA 4SGAE 2QF3A 3DT0H 2Z9KA 1UHBB 3K2UA 1Q31A 4BNRA 1HAGE 4UONA 1EASA 3WY8A 5JBTA 1GBMA 1JRTA 4JMYA 1P57B 3GICB 1PJPA 5C5OA 1S85A 1NTPA 3ATWA 3UOPA 3W95A 4ABIA 1QBVH 1OXGA 4BANB 1HAHH 3PO1B 2VINA 2C3SA 4Y10E 1BHXF 1QJ6B 1EZSC 2VWOA 2O8TA 3QWCH 3QZRA 2FOBA 4D76A 1FDPA 3ESTA 1WBGB 2RA3A 1GGDB 3L33A 4ZAEA 1D3QB 4AG2A 2W5EA 3SJ9A 1Z71A 4Y8YA 2RDLA 2TGDA 2A1DB 2FOHA 5DKMA 1SR5C 1O35A 1UCYK 4X8UH 1TNJA 4I8HA 2IPHA 4MNXA 1SSXA 2BX3A 3BSQA 2ZHDA 1ANEA 1V2OT 3LT3A 2BY7X 1FY3A 2G5NA 5T6GA 1TABE 1O2XA 4X1QU 5F03A 2IJOB 3A87A 1C5WB 1AO5A 3LGTA 1C5VA 1SLUB 1CGIE 2ULLA 1WQSA 3MU0A 3FZZA 1SOTA 1TFXA 5F6MA 3MHWU 1UVSH 2BX4A 1V2VT 2PKSB 2Y81A 3BTFE 3TJUA 1HYLA 2BY8X 3E6PH 2HALA 1KYNA 4J2YB 2Z9GA 4X2XA 2FOAA 3VB4A 1DXWA 1SQAA 2WPJS 3RXQA 1MTUA 1C2DA 3MFJA 4BXWA 4ABBA 3U1IB 2W3IA 4NFEA 2ZPSA 1Z8RA 4ABHA 1TNIA 1TRYA 2GT7A 1FUJA 1F0TA 2ZHQH 3C1KA 5EW1H 3SOSA 3BTEE 2O8UA 2FTMA 1HXFH 1LKAA 3LPRA 1OP2A 2A4RA 1H8IH 1V2PT 3T25A 8GCHF 2ZGCA 3PTBA 2ALPA 1JOUB 1P3EA 4RSPA 4ISLA 1FJSA 1AN1E 1HIAA 4MNVA 1G32B 3QTVH 5J4SA 2Z3DA 2FOFA 2P95A 2F83A 5LPEA 1O2ZA 4TPIZ 1UTOA 1NRQH 4IC6A 1QY6A 5E2PA 3URCA 5A0BA 2Q6GA 5HYOA 3FP6E 4Y8XA 1HPGA 1YPEH 2PWXA 1HXEH 1O3MA 4X6MA 3KQCA 1LKBA 3H7TA 2TPIZ 1ETSH 4Y71A 2VH0A 4TPYA 2Z6BD 3QX5H 1V2MT 2O8MA 1S84A 3M37A 1HLTH 3A7ZA 2PKAB 2EI7A 4ZKRU 3NPSA 4KGAA 1YCPK 1TRMA 1ELTA 1ZPZA 3IWMA 1G30B 8KME2 5DP4A 2ZTXA 3PO1C 4Y6DA 2QC2A 2ODPA 4A1XA 1N8OB 1OSSA 1P9UA 2CXVA 3A81A 4DOQA 3GCHC 1BTHH 1K9OE 1QNJA 1IQNA 3QZQA 1AKSA 1C5ZB 1UTJA 2W7SA 1T8NA 3KIDU 1FLEE 1WAYB 2TBSA 3OX7U 3TJVA 3MTYA 1C2HA 5F8XA 1SGCA 1HRTH 2HOBA 1EPTB 1J14A 4BTTB 4ZHMU 1SHHB 1GDUA 2H9HA 1SMFE 1C1WH 1FPCH 3CP7A 3PMAB 2FIRH 1ELGA 1SI5H 5CHAB 4YM9A 1LHEH 1O5GH 3KQBA 2A4GA 3SI4H 2A4OA 2ZDAH 4BAKB 5EQQA 1EXFA 4NGAH 5AVDA 1QQUA 1TYNA 1MU6B 3EA8A 2FX4A 2P3UB 2AIQA 1MU8B 1ABJH 1GVZA 2PR3A 3E1XB 1H9IE 3ZV8A 1VITG 2P16A 3SHAH 2PKSC 4FUCA 2ZG0H 3OSYA 3SHCH 5JYIA 1AWHB 1PPBH 4K8BA 4NSVA 1BIOA 1BHXB 1O2RA 4JZDH 5A8YA 8LPRA 1ZHPA 4TY6A 4UFGH 1EUFA 4MPVA 3FP7E 2XC0A 1GI0A 2CHAC 3FVFB 3ZVAA 4OGXA 3M7TA 3LIWA 5K0HA 1WYKA 4XSKU 1QQ4A 3A8BA 4CRBA 1C5XB 2BOKA 8ESTE 1PQ7A 1SGFA 1G3DA 5FHTA 2IOTA 3SNCA 2ZA5A 4ZXYH 5E0JA 1FNIA 1O5BB 1FIWA 1KLTA 2H1UA 1OWDA 1C5LH 3F9HA 3ZVDA 2XBWA 1AVWA 1G36A 1LPZB 1MQ6A 4YTAA 3AW1A 3SORA 5HXFA 2XNIA 1OP0A 3QLPH 3JZ1B 1MKXH 2C90B 2I6QA 1AY6H 3HATH 1S6FA 4NZLA 2ZO3H 4ESTE 1SLWB 2H6MA 3SV6A 3ELAH 5BPEA 2GX4A 3I78A 4FUBA 1ZTKA 2VB0A 1LCYA 1MAXA 1UJ1A 2AMQA 2WUCA 4O3UA 1V2NT 3B9FH 1DOJA 1MZDA 1BJUA 2A2XH 2QIQA 3ZZBA 3RXMA 5T6DA 4O97A 1BBRH 1H4WA 1CHOF 5JBCS 1XUJA 1FN6A 2Y5HA 1HJAB 1SGDE 3ZZ8A 1IQHA 4U2WA 1L4DA 1PPFE 2A45B 1KTTB 1TGNA 3MH5A 1V3XA 3KGPA 4CR5A 1NRNH 1TAWA 3GDVA 1GBHA 4B73A 3KF2A 1ZTJA 4MDSA 3ZYDA 1T7CA 2VIVA 3ZZ4A 1AUTC 2FPZA 3BG8A 3QK1A 1QURH 1C2LA 1KXBA 4E7RG 1RRKA 1VJAU 1VITF 1W7GH 3RUOA 2V3OH 1FY4A 1P09A 1D3DB 1DUAA 1Y8TA 4KELA 1SFIA 3GDSA 2GKVE 2ZHFH 5DP9A 3M35A 1GHBG 2JH5D 5F8ZA 2BDAA 1F0RA 4OS7A 1FONA 1PFXC 1GI4A 3LH1A 4X1SU 2ZTZA 3V0XA 6GCHF 2ALVA 5FBIA 5C5NA 5GWZA 1GI8B 1O3FA 1BTXA 1GBLA 5EPYA 1ZTLA 3TVJB 2DUCA 2CF9H 4O9VA 3G01A 1SGIB 4R0IA 5DP6A 2NWNA 1LHFH 1W14U 5DO4H 2ZGJA 3SV2H 1F5KU 2VGCC 3TIUA 2WUBA 3SV8A 3RXHA 2FI5E 2HPPH 4HGCA 4FUDA 3SU6A 4IMQA 3A7VA 4JZIA 1QHRB 3RMLH 1UK3A 4X2WA 5DK1A 2BYAX 2O8WA 3T62A 3A7YA 3HGPA 1YPKH 2SGPE 4GSOA 3STIA 1NS3A 3JZ2B 3HGNA 1BOQA 1WTGH 3O8DA 1OYQA 1GBKA 4Z6AH 5I46H 1IAUA 4XE4A 1RXPA 1SLVB 2GGVB 4ABGA 2G00A 1VJ9U 3LJOA 3SUEA 3Q3YA 3UIRA 3MU8A 1SBWA 1O32A 2NU1E 3BTQE 5FCRA 1HAXB 1CVWH 1O2PA 1W8BH 2SGAA 4DIIH 1PPHE 1K1OA 4LXBH 1SC8U 2I6SA 3MNSA 1E36B 4XOJA 1CE5A 2OC1A 5DPAA 1V2UT 1Y3XA 3KQDA 4FUFA 1LHCH 1SL3A 2DE8A 3ZVBA 2OC0A 2YNAA 4INHA 1T31A 1IQKA 1XKAC 1O3KA 4Q7YA 2GMTB 1O2WA 4AG1A 1A3EH 3F9EA 4YT6H 1GMDF 3SBKA 1O5FH 4BAMB 3ZZ5A 3EYDA 1GBCA 3MH6A 3UTUH 2VWLA 1YGCH 1NPMA 4GCHF 1Q3XA 3VB3A 2ZF0H 1C1SA 3RXGA 1GL0E 3RXAA 4IS5A 1BTWA 4X8TH 1ZRBA 3R0FA 3UR9A 2BLWA 1DDJA 1O38A 1PPGE 1ZGIA 5C1XA 2V35A 1AUJA 5LPFA 1GI2A 1GHBF 1TX6A 1GJ7B 3TPIZ 5L2YH 4X2VA 2ZDMA 1K1IA 2JKHA 4OGYA
chains in the Genus database with same CATH superfamily
2R0LA 2FTLE 2EI6A 2EQNA 1KXFA 3RU4D 3R3GB 3SQEE 3KQEA 3UY9A 1GJAB 1HDTH 3BIVH 3P6ZB 4B74A 1O2MA 1RIWB 4Q80A 4BAOB 4Q7ZA 1TMTH 1ZJKA 4TWYA 1EZXC 1A5GH 1V2WT 3L3TA 1FXYA 1K1NA 1DY8A 2JH0D 3U8OH 1G3BA 4RKOB 1SPJA 1AMHA 1MZAA 1RD3B 1MTVA 1NU7B 4AB8A 3OEHD 2WV9A 4CRDA 3TGJE 1SGTA 2G55A 1YPMH 2ZU1A 3OFND 2F9OA 1A7SA 2F3CE 1YLDA 4VGCB 3OTJE 2OP9A 3RXOA 4A1TA 2SGDE 1MCTA 2C8XB 1MKXK 1QL9A 4MG3A 1EPTA 1K22H 1KXEA 5FX6A 4M7GA 4ZXXH 1V2JT 3H09A 3NUMA 3SJ8A 1D9IA 1D3TB 1A0JA 2BZAA 1MKWH 4OM9A 3UOUA 3V3MA 2ESTE 6ESTA 1QRZA 2OC8A 1P2OA 2F9PA 3I29A 1AU8A 1GL1A 3AASA 3SI3H 3SU5A 2Z94A 1QB6A 2B7DH 4AGJA 4X0WU 2CV3A 3BG4C 3RMOH 1BBRK 2SNVA 2WPKS 4Q63A 4DY7B 5G4BA 2EC9H 3ZVGA 3OE7D 2ZP0H 4Q2KA 3GY6A 4I33A 4ASUD 4CHAB 2D1JA 4M9FA 1E38B 1ZYOA 1BMAA 2IJD1 2GTBA 2H5CA 4X1NU 1GBIA 4O3TA 1Y3UA 2XTTB 4F55A 2J95A 1ZMLA 1GI1A 3UUZA 3SGAE 3UR6A 2AMDA 4FXGH 3M3VA 3A83A 2ZDVH 2NU2E 3NCLA 1TNGA 1GBDA 1DANH 2PGBB 1YY3A 1CGHA 1XUIA 1O2UA 4ZMAH 3ZZ6A 1C5PA 1KSNA 2CGAA 1LVBA 4ZHAA 2QF4A 1G2MA 4YOJA 2BQ6B 1WUNH 2GCHG 4DG4A 1HJ8A 1OP8A 1TGSZ 3NK8A 1LPGB 1UVPA 2FEQH 1A61H 4CRCA 1WDIA 3SU3A 1TOCB 2BVRH 3D23A 3LGWA 3UWJH 1DPOA 3PROA 1C1OA 3FO8D 1LHGH 2ZFFH 2AEIH 5I25A 1YBWA 7GCHF 3GY7A 1QB9A 2B8OH 2THFB 4CRFA 1P11E 4NIVA 4Y76A 2ZHEH 2PUXB 5DP7A 2Y6TA 1B5GH 2VWNA 3D49H 2WV4A 5EODA 1O37A 3VFEA 3BIUH 1ZHRA 2KFWA 4CREA 1AVXA 1W13U 1XM1A 4BAHB 1J16A 1NM6A 1O5CB 1AWFH 5EW2H 1RS0A 1C2FA 4CBOA 3LOXA 4GLYA 1IHSH 1Y5BT 4CR9A 4RT1A 3SZNA 3SQHE 1C4V2 1H1BA 2WPHS 5FAHA 3DA9B 1Y59T 2JDID 1KDQA 2XW9A 3RXLA 2A5AA 2BLVA 1KTSB 1Z6EA 3ZZ3A 2V6NA 4DVAU 2G52A 1X7AC 4AYVB 2EEKA 2FMJA 4D9RA 2BMGB 3M61U 2KAIA 1QZ8A 1L1NA 2VH6A 2F9VA 1V2TT 3DSGA 1PPEE 1JIRA 3BTDE 3VG8A 1DX5M 2RDEA 4YOIA 1C4U2 4VGCC 1YC0A 2QGRA 1C9PA 2J98B 1ETRH 4RN6A 1TQ0B 5AFYH 2UUYA 3HPTB 2GZ7A 3RXFA 4OS2A 1UTKA 2YNBA 5CE1A 1DWEH 2V3MA 5TCCA 3TJNA 5GXPA 2M5TA 2YOLA 4PROA 4X6OA 2QAAA 1IQIA 1F5RA 1ELDE 1C1PA 2HGTH 4H42U 5EPNA 1P02A 2B0FA 5EOKA 4FUEA 2ZNKH 1OWJA 3SUFA 2ZU3A 1DLKB 3T26A 3A7TA 2RA0A 3P8OA 1MMJN 1TA2A 2ZECA 1F5LA 2F91A 2PSYA 4Y0ZE 1EZUC 1GG6B 1MUEB 1HCGA 4ABAA 2GZ8A 3VB6A 2ZU4A 1GBTA 5GCHG 5E0HA 1BMFD 4TWWA 1GJ6A 2OC7A 4K69A 1EATA 4AN7A 1NESE 1GHAG 2NU4E 5C1UA 3M7QA 1G3CA 2JETC 1FV9A 1S6HA 2ZFPH 4AFQA 1UVOA 3S69A 3KL6A 3GY2A 2UUKB 1AB9C 3MU1A 4R8TB 1DSUA 3Q3XA 2RFKC 1K28D 2AYWA 1XVOA 9LPRA 3VB5A 2OXSA 5ESBA 6LPRA 3FP8E 4AB9A 4BTUB 1P8VC 3BTHE 4JYUH 4HZHA 2BLOA 1K1MA 1EAXA 3A80A 1FI8A 3TK5A 2QA9E 2TGAA 1HAPH 1KLIH 1ZRKA 1PQAA 4A1VA 4ZROA 2ZQ2A 2FODA 2AH4X 2A7HA 1ARBA 2Z3CA 2SNWA 1N6XA 3KYGA 1GJ8B 2J94A 1BTZA 1YWUA 5CMXH 3OTPA 7ESTE 1ORFA 1O2KA 1CT2E 1VCQA 2JH6D 3LONA 2HNTF 3RXCA 3BTGE 1XUFA 1G2LA 1ZPBA 2C93B 3ZVEA 1CT4E 1OWKA 2VVUA 2ZPQA 2ZEBA 1BRCE 1OYTH 3P95A 3RMNH 4X8VH 1C1TA 2LNCA 1HNEE 2BB4A 1K1PA 1UK2A 2L74A 1CA8B 1RGQA 3D65E 3Q00A 4X1RU 4XBDA 4LZ1H 1A46H 1Z8GA 3T28A 3KHVA 4ISOA 1GVLA 2FDAA 1C5TA 1GGDC 4CRGA 1C1QA 2ZFTA 4AGKA 4CH8B 1XX9A 2PW8H 5E0GA 1GMCG 3EQ0H 1GJBB 2FYQA 1AD8H 1SGQE 3QO6A 4XRNA 3F68H 3P8NA 1S0RA 2Y7ZA 1XMNB 1C1UH 3GCTG 1LDTT 1SQOA 2G8TA 1SGNE 4XBBA 1OOKB 1C5SA 4WMEA 1MH0A 4TYDA 1SQTA 1XUKA 3I77A 1TPAE 1E35B 1OWEA 5FL7D 1WXRA 2G51A 1AFEH 1FY8E 2CF8H 4FVDA 3T5FH 2XCFA 1ANDA 4B1TA 2HPQH 2ASUB 5LGOA 2SGEE 3P8FA 1ABIH 2QF5A 1K1JA 1KMHB 3EDXB 2C4FH 4K1TA 3RU4T 1FY1A 2FO9A 2ZC9H 1L1GA 2BD4A 1ZMJA 1RTFB 5FPTA 5ABWA 1LQEA 1O2YA 1A0LA 3U69H 1HAZB 2VBCA 5DGJA 1GVKB 3BF6H 5HGGA 3DCLA 4Y7BA 3E3TA 1FPHH 3M5OA 3M7UA 3RXKA 3RLYH 1GI5A 3ZVFA 2G4UA 5FPYA 2C8ZB 2ZWLH 3DSPA 3HK6B 2BY9X 5TCAA 1TWXB 1B0FA 3NXPA 3NZIA 1CO7E 1UVUH 1GHZA 4E7NA 2BDHA 4SGBE 2W3KA 1GCTB 1AIXH 3S0NA 3VGCB 3AAVA 4MNWA 3OU0A 5JDUB 4CBNA 3PB1E 2ANWA 1AFQB 3E91A 3A82A 1NFYA 2ZGBH 2NU0E 4I32A 1HAOH 1T32A 4B71A 3ZZ9A 5JB8S 1SFQB 2RG3A 2WPMS 4ISIH 1BJVA 4Y0YE 1GHYH 1IQFA 1V2QT 3PMHB 1GBFA 4X6PA 3PLBA 1FAKH 3S9BA 1VITH 4I8JA 2P3TB 5DP5A 1BRUP 5A0AE 3QGNB 3D62A 5HKKD 1TOMH 2J5UA 3RC6A 4IBLH 4KP0A 2O8LA 3PV5A 3P70B 1L1JA 1W10U 2FOMB 1BZXE 4GVUA 1UTMA 3GOVB 2TGPZ 4NA8A 3ENSB 1N8OC 4WXVA 3SNEA 1Z1JA 2XRCA 1UHBA 5BRRE 3SU2A 1ZMNA 2HVXA 3A7WA 1FQ3A 2OBQA 4JZEH 1VKYA 1HV7A 3QUMP 1CA0B 1LTOA 1FMGA 4FUJA 1EFRD 4KTUA 3EAJA 1LPKB 4JZ1A 3EE0B 3SW2B 1MTNB 3MNBA 2KX4A 3MO9A 3P17H 3ATKA 1ESTA 1EPTC 1XKBC 2FP7B 2R2MB 2R2WU 3MH4A 2GZ9A 3ITIA 9ESTA 1DSTA 2BZ6H 5CHAC 1EB1H 3GYMA 3U9AH 3MNCA 3QGJA 4HFPB 1UCYE 1KXDA 3RXEA 1MTSA 4K2YA 4THNH 3T2NA 1QGFA 1J8AA 3AW0A 1C1NA 5FCKA 4NFFA 4IW4E 1GHVH 1GDQA 1XXDA 2PHBA 1PQ5A 4WH8A 2WYJA 4I8KA 1KIGH 4MQAA 1P03A 1H8DH 3V13A 4XBCA 4DGJA 5EXLA 4INKA 3PMBB 3ZZCA 3VB7A 4I31A 1S83A 4H6TA 4DT7B 3KN2A 1RJXB 3MO3A 3KEEA 4RKJB 3A8DA 1W3CA 1Y3WA 4XDEA 2VU8E 5A8ZA 3TNSA 1O2OA 2D8WA 2P8OB 3EA9A 2J2UA 4I8LA 1SLXB 3K9XB 4AFUA 3VXFH 3NKKA 4J1YA 3ZZDA 3ZV9A 1N6YA 2ZTYA 2M2AA 2J38A 4YLQH 3UWIA 1O36A 1ELAA 1Z7KA 2FI4E 4UFFH 3RXIA 1TGCA 2BDBA 2WZQA 3FKSD 3S7KB 1O2QA 2R9PA 2AIPA 1A1RA 1C2IA 1DWDH 4JK6A 1L0ZA 3F2FA 3F1SB 4Z0KA 3V12A 3ZZAA 4TT3D 1ELBA 1GCTC 4UDWH 3VGCC 2KCOA 3PLKA 4A7IB 3UAIC 5TJXA 5EQRA 3PWBA 3M3TA 3PV2A 2CN0H 1HIAB 4JYTA 4U30A 2FM2A 2EA3A 3UNQA 4CH2B 3GY8A 2AFQB 1NRRH 3E90B 4NIWA 1E34B 2QXJA 3FOAA 1C5OH 4MPXA 3FAOA 3SNAA 1MAYA 3MMGA 5HMAA 1S0QA 3FZDA 3F2GA 1TB6H 1C5NH 2VVCA 1PYTD 3HKIB 3N7EA 1HJAC 3SNBA 2A7JA 6CHAB 5DP3A 2K0QA 2PLXA 2AS9A 1QTFA 4BTIB 1WTHD 2ODQA 1ZPCA 2PTCE 3MU5A 3PRBA 2ZQ1A 4X1PU 4ABEA 2XWBI 4AZ2B 2PKAA 1TNLA 4B2BA 1TPOA 3SGBE 3GY4A 5C20A 3RXRA 1IQLA 2BQ7B 1UK4A 3O8BA 1CA0C 1AE5A 4WVPE 1O3NA 2GCTB 1UW7A 3BN9A 1GHWH 1MCVA 4ASHA 3Q76A 2GV7A 3SU0A 4D8NA 3GDUA 2QY0B 3FN8A 1NROH 5A0CA 4FETA 4ISNA 4WY3A 5F8TA 3PWCA 4IMZA 5DP8A 2F9UA 3CS7A 1AHTH 5KEDA 4DJZB 1GMHG 1WV7H 2ZCKP 4RT0A 3TJOA 1K2I1 2XNDD 5E2OA 4GHQA 4NCYA 4AFZA 3OYPA 3F6UH 2PTNA 1ELEE 1O3DA 2BD7A 2P59A 4NA7A 2PSXA 2H2ZA 4IN1A 4YT7H 2H5DA 2KM0A 2KR7A 1W11U 2C8YB 2G4TA 3BEFB 3LH3A 1OWHA 1AI8H 1YP9A 2WYGA 5PTPA 1EJNA 1W12U 1C2JA 4DURA 1S82A 2HNTC 3LJJA 1P2NA 1BRAA 1QL7A 1LVOA 4P02A 3UQVA 3AAUA 4X6NA 2WPLS 5EJ1A 1H9HE 2P93A 1NZQH 4F48B 1Y5UT 5FPSA 1C2KA 2IN2A 3N7OA 3M36A 4MTBA 1CT0E 1SGEE 2A5IA 4ABDA 5C17A 2J9NA 1WOFA 1JBUH 1YPJH 1BUIA 4H6SB 1O3JA 4OS1A 3M3SA 4OS5A 1TQ7B 1EKBB 1O3GA 3SYJA 1GJ9B 1Z6JH 1C2GA 2R0KA 1F0UA 2VIOA 2GDDA 1ELFA 2FS9A 3LDXH 2FS8A 4B2CA 1O3BA 2RCEA 5DSFA 3NWUA 1TIOA 1KY9A 1BMNH 2GMTC 3TK9A 1ID5H 5DN6D 1EJMA 1TNHA 2Y5FA 1HAYB 2PV9B 4AX9H 2NU3E 2BXUH 2H9EH 1HGTH 1EP6A 3O8CA 3RM0H 1Z1IA 2OINA 2VIWA 3VPKA 2GVFA 1EAUA 1ZHMA 5A8XA 5B6OA 1T4UH 1F2SE 1O39A 4B75A 1P3CA 1BTYA 1E1QD 2AHME 3P92A 3A7XA 1TX7A 3AK5A 4FUIA 2ZHWH 4WMFA 2O9QA 1TA6A 2ZFRH 2CJIA 2BD8A 1RTLA 4DIHH 1ZSJA 1BMLA 4UEHH 2WPIS 1ESBA 2W7UA 3DHKH 3TNTA 1W0YH 3ZVCA 5JB9S 1UTNA 1EB2A 4NWKA 2SFAA 2BLQA 4WH6A 1O2JA 4OS4A 3HK3B 1DS2E 4NIYA 2WHXA 1AZZA 2ZGHA 1GBJA 3GS9A 1Q2WA 1RIWC 2GCTC 5L30H 8GCHG 1KXAA 3U8TH 2FLBH 2HNTE 4WXIA 3U98H 1A3BH 1T8LA 2P3FH 3UQOA 2GT8A 1K1LA 1TGBA 1Z8JB 4BAQB 2QXHA 1O3IA 1J15A 3PMJA 1QR3E 4GAWA 3M5NA 1QB1A 1A5HA 2JIZD 4FUHA 1BQYA 2A0QB 2A32A 3SZEA 4F4OC 3RU4E 3SJOA 4B2AA 1P01A 1OPHB 1BTPA 1QJ7B 1O30A 1TALA 3GCHB 3MO6A 4ZKNU 1O5EH 4KTSA 2W26A 1O3CA 4B76A 4BXSA 2CK3D 1NRSH 4X8SH 2OTVA 4YZUA 2XBVA 3VEQB 2Y7XA 1SHYA 3W94A 2ZKSA 1GBBA 3GYLB 2ZFQH 4NZQA 3RXDA 1P9SA 2QV1A 1DWCH 1YYY1 3E0PB 4YLUA 1A2CH 3H5CB 1C5RA 4UE7H 4A5TS 1XXFA 1TE0A 3SO3A 3O8RA 1GI7B 2Q6DA 3K6YA 1V2ST 4INLA 2ZCLP 2GCHF 4CHAC 4ZUHA 2A31A 2BXTH 5T3HA 4UFEH 5E8EH 1NT1A 4ISHH 1YKTA 4JCNA 3E16B 3RP2A 2BM2A 1P12E 5EQSA 2VWMA 1B7XB 1HAIH 1V2LT 3A88A 1E37B 3NRLA 3UNRA 1U6QA 3Q77A 1SGPE 2BVXH 1SVPA 3Q3KA 1NFXA 1B0EA 4D9QA 1XUGA 2OQ5A 2FESH 4FVBA 2D26C 1RTKA 5AFZH 2B5TB 2CHAB 5ESTE 1TPSA 3A89A 2LELA 3A85A 4MPUA 5T6FA 1PQ8A 1BTUA 1GJCB 2QN5T 3SV9A 3B23B 1YM0A 2QF0A 1TRNA 2Q6FA 2YMSB 2J4IA 4Y7AA 4Y11E 5JBBS 5H4IB 3K65B 2FZZA 1FN8A 5EXMA 3TLOA 1D3PB 1AE8H 1C1VH 3EE7A 4I8GA 1C1RA 1D4PB 1FY5A 1MKWK 1ZLRA 1GJ5H 3TU7H 3FANA 1GHXH 5HM2A 1NRPH 2KCAA 2AMPA 3CENA 4TY7A 1JXPA 2ANMH 4ABFA 3SUDA 2BDYA 2C8WB 3T29A 2LPRA 5GDSH 3BTWE 2EI8A 2VNTA 3M5MA 1PPCE 2CMYA 4I7YH 1DWBH 3KCGH 7KMEH 3T27A 4KKDA 1MQ5A 1NU9A 1NN6A 1FZZA 1NY22 3PV4A 1GBAA 4NIXA 2ZGXH 4XFQA 5EG4A 4ZCNA 2KZ4A 3TH2H 1H9LB 1WQVH 2G5VA 1N1LA 3GCOA 4JZFH 4BOHA 4U01A 3L6PA 4HG6A 1TONA 3ZIAD 5GJ4B 1ELCA 1NBMD 1OWIA 1BRBE 4ABJA 2ZDNA 4HI3A 4UFDH 4X2YA 1T4VH 3PTNA 2QXGA 4K1EA 1UTLM 1CBWB 2VIPA 3DUXH 2HVYB 2F9NA 1UMAH 1E1RD 1A5IA 1QBOA 1DFPA 1MTWA 5GCHF 4YXWD 1MD7A 1P10A 2BDGA 1D6RA 1HAVB 2BHGA 2YMSD 1H8HD 5C1YA 3SN8A 1C4Y2 1CHOG 1INCA 1HUTH 1GHAF 5C2ZA 1ARCA 3SJKA 2ANKH 3ODDA 3SNDA 4MPWA 2BY5X 3MU4A 5GIBA 1DITH 4Y8ZA 5SGAE 1TGTA 4Q4LA 1CHGA 1TPPA 2Y82A 1VGCB 5DJ7A 1EP5A 1T8OA 1W7XH 1WSSH 1GG6C 3RC4A 2ZI2H 1DY9A 1BBRE 1SGFG 1J17T 1AVGH 3RXTA 2TRMA 2ZDKA 5LPRA 1UTQA 2XYAA 1AGJA 3RXBA 5HIZA 2XC5A 1P2MA 2UWPA 4AOQA 3A8CA 2VGCB 5K7RA 1NFUA 3SV7A 3S7HB 1LMWB 3GCNA 1CQQA 3RXVA 3GY5A 1EX3A 1THSH 2WINI 4MLFB 4K5ZA 1C5UA 5CHBA 4NSYA 2SGQE 2QYIA 4AFSA 3ODFA 3SGQE 3ZYEA 3TK6A 2OBOA 1O3LA 1DLEA 6GCHG 1EAWA 1O2GH 3OY6U 1IOEA 2Y80A 4Q7XA 2STBE 1ETTH 3MYWA 1ZSLA 1XUHA 3DFLA 5AHGH 3RXJA 4K3JA 2ZFSA 4WF8A 2FOEA 1IQGA 1WCZA 5FBEA 1TMUH 1EAIA 1P04A 5J4QA 2A4QA 1LO6A 1HBTH 1TBRH 4E06H 3MNXA 2FYRA 4LK4A 2XCNA 1KXCA 1IQEA 3UREA 5C67A 1GPZA 2ILNA 3RC5A 1NO9H 3DD2H 2K8IA 4DW2U 3UFAA 1OKXA 3E8LA 4WMDA 2XXLA 2F43B 1GMCF 2ZIQH 2BQWB 1V2RT 1TX8A 1G9IE 1W2KH 2Q1JA 3M5LA 2BD3A 3UPEA 5FXLA 3BEUA 5C0TA 1YPGH 3GCTF 1GJ4H 3U8RH 3LKWA 1E0FD 4LZ4B 5LH8A 1O2IA 1IQJA 1BA8B 1ACBE 1YPLH 3N7DA 1JWTA 1O2LA 3RMMH 1O3AA 4IC5A 1F0SA 1TLDA 2WSSD 1BB0B 2ZU2A 1O2VA 3LU9B 1QJ1B 3LC5A 1VCWA 2QXIA 4KTCA 1W0ZU 3S9AA 5ETXA 1YPHC 2ZDLA 4OS6A 2BOHB 3ATMA 2IPQX 2A7CA 1QIXB 1FAXA 3URDA 2OUAA 1GMDG 1CBWC 3BTKE 1L2EA 3MH7A 1E79D 3LGVA 4E05H 1KDQB 1GI6A 3F9FA 4LOYH 4ZKOU 3RDZA 1J9CH 4GCHG 1ANCA 1JIMA 2KAIB 4Y79A 3E0NB 3MWIU 1O3HA 1K21H 1GDNA 2BD5A 2D2DA 4WWYA 2BTCE 1PPZA 2QE7D 2AGEX 3RLWH 2BD9A 2J98A 1THRH 2VJ1A 1V2KT 1MBMA 3TGIE 1TBZH 4F49A 1HB0B 1D6WA 1DXPA 2FWWA 1AZ8A 3AVZA 1W0KD 1C2MA 1O31A 2PUQH 4UD9H 1S5SA 3GISB 1S81A 3SU4A 1GI9B 3EA7A 1G37A 3SUGA 1LHDH 1O3EA 3FFGA 1VGCC 3H7OA 1NFWA 1SQRA 1BT7A 2PFEA 1P2IA 4K8YA 5C3NA 1M9UA 3BV9B 2J34A 1EOLA 2GP9B 1ANBA 1O34A 1ZOMA 2GV6A 4DCDA 3N99A 2P94A 2FX6A 4K60A 4ZKSU 4D7FA 1WU1A 1YLNA 2VIQA 2LP6A 1O0DH 2UUJB 5GPIB 2WV5A 1QRXA 2Z3EA 2Z9IA 1VCPA 1EZQA 1ZJDA 1QBNA 1GJDB 4O03A 3BG4B 1O2HA 1LQDB 3SJIA 4MNYA 1QCPA 3BTME 1BITA 1P06A 4H4FA 1HFDA 1BMMH 1A0HB 2FLRH 1BDAA 1ZSKA 1LVYA 5IDKA 1C5YB 1OS8A 1TNKA 5FX5A 3QTOH 1AQ7A 3RXUA 2VIDA 5JPMH 3U1JB 2OD3B 2BDIA 3LGIA 3B8JA 2AGIX 2V0BA 4IGDA 2V3HH 2VVVA 2R3YA 2KCYA 1AFQC 1SOZA 2Z9LA 1QRWA 5A2MH 2F9BH 5DG6A 5EGMA 2H9TH 5F53A 2ZCHP 2GDEH 3A8AA 1XVMA 2FI3E 4U32A 3OEED 3QDZB 3TH4H 3WWFA 1SGYE 2PGQB 3F9GA 1JRSA 1YCPM 4HTCH 2Z9JA 4FUGA 1UCYH 3VXEH 1YPHE 3QN7A 1RFNA 1UVTH 1MD8A 2XC4A 4A92A 4TSFD 4JYVH 4QT8C 2ZZUH 1ZZZA 4Z1MD 3A84A 4ZH8A 1O3PB 4YESB 2R3UA 3V7TA 5GNDA 2FOGA 3HKJB 2HLDD 4FU7A 3TITA 2UWLA 3LC3A 5HIYA 1DICA 1CU1A 1F92A 2ANYA 1BCUH 2Z7FE 4CRAA 1TMBH 3LGYA 4A6LA 3UB0A 3IITA 5T1VA 3OAAD 1DT2A 1NC6A 4ZHLU 1Y5AT 5IYTA 1F7ZA 1HJ9A 4FU8A 1YLCA 5JBAS 5AF9H 1GBEA 1Z8IB 1MTNC 3MOCA 3P8GA 3RXPA 1DUEA 1O3OA 1Y3YA 1AKSB 1GI3A 1SB1H 3BEIB 2FXRA 1V6DA 1MABB 1L4ZA 1Y3VA 4FU9A 5KECA 2G81E 1O2SA 2DE9A 3PLPA 3TH3H 2BDCA 1EOJA 2AERH 3WWBA 2XWAA 2XBXA 2HWLB 3DFJA 7GCHG 3TGKE 1UTPA 3PM3A 4WJG2 4NG9H 1DM4B 2GD4B 4D7GA 1O5AB 4GPGA 3K6ZA 4GHTA 1ZGVA 2Y5GA 1ZR0A 5L2ZH 1VZQH 1GWAA 1PYTC 3KQ5A 1ELVA 1HAVA 1OX1A 1C1MA 3BTTE 3ZZ7A 2BD2A 2K1QA 3UNSA 1QFKH 1CSOE 2ODYB 2BY6X 1T8MA 1P05A 1P2KA 1ESAA 1FIZA 1P0SH 1P2QA 1TBQH 2J92A 2UWOA 3A86A 5L6NH 2BVSH 2XOKD 4NWLA 4AYYB 1QA0A 3IG6B 2P8OC 1P2JA 1THPB 3PYHA 3RM2H 2XBYA 1YCPH 4YO9A 2OCVB 1IHTH 1LVMA 4YOGA 3GY3A 3SU1A 5EJZA 4K1SA 7LPRA 1GCDA 2SGFE 4FOUC 2TGTA 1SGRE 1C9TA 1C5MD 1C5QA 3EGKH 3LGUA 5HM9A 4MVNA 1O2TA 2ZPRA 2PP6A 4IN2A 1SKYE 3CS0A 5A09A 4GUXA 3STJA 4JK5A 2JETB 2FOCA 1DE7H 3OY5U 1EQ9A 1MBQA 5EU8A 1AB9B 1A4WH 2HRVA 2A5KA 2TIOA 3ATLA 2UUFB 3ATIA 1YF4A 1SG8B 1EJAA 1QL8A 2A2QH 1DVAH 2AGGX 1C2EA 1O5DH 1O2NA 3MI4A 6CHAC 2STAE 1UO6A 3KNXA 2HLCA 1VR1H 2B9LA 1IQMA 2OLGA 1O33A 3S9CA 2QCYA 1CGJE 1GMHF 1KLJH 2OQUA 1G3EA 5EXNA 3C27B 1JMOH 1QA7A 2ZU5A 4NA9H 3RXSA 4AORA 4SGAE 2QF3A 3DT0H 2Z9KA 1UHBB 3K2UA 1Q31A 4BNRA 3MQKC 1HAGE 4UONA 1EASA 3WY8A 5JBTA 1GBMA 1JRTA 4JMYA 1P57B 3GICB 1PJPA 5C5OA 1S85A 1NTPA 3ATWA 3UOPA 3W95A 4ABIA 1QBVH 1OXGA 4BANB 1HAHH 3PO1B 4B6FA 2VINA 2C3SA 4Y10E 1BHXF 1QJ6B 1EZSC 2VWOA 2O8TA 3QWCH 3QZRA 2FOBA 4D76A 1FDPA 3ESTA 1WBGB 2RA3A 1GGDB 3L33A 4ZAEA 1D3QB 4AG2A 2W5EA 4DT4A 3SJ9A 1Z71A 4Y8YA 2RDLA 2TGDA 2A1DB 2FOHA 5DKMA 1SR5C 1O35A 1UCYK 4X8UH 1TNJA 4I8HA 2IPHA 4MNXA 1SSXA 2BX3A 3BSQA 2ZHDA 1ANEA 1V2OT 3LT3A 2BY7X 1FY3A 4P00A 2G5NA 5T6GA 5B6LA 1TABE 1O2XA 4X1QU 5F03A 2IJOB 3A87A 1C5WB 1AO5A 3LGTA 1C5VA 1SLUB 1CGIE 2ULLA 1WQSA 3KYFA 3MU0A 3FZZA 1SOTA 1TFXA 5F6MA 3MHWU 1UVSH 2BX4A 1V2VT 2PKSB 2Y81A 3BTFE 3TJUA 1HYLA 2BY8X 5EIYA 3E6PH 2HALA 1KYNA 4J2YB 2Z9GA 4X2XA 2FOAA 3VB4A 1DXWA 3F3BA 1SQAA 2WPJS 3RXQA 1MTUA 1C2DA 3MFJA 4BXWA 4ABBA 3U1IB 2W3IA 4NFEA 2ZPSA 1Z8RA 4ABHA 1TNIA 1TRYA 4RI0A 2GT7A 1FUJA 1F0TA 2ZHQH 3C1KA 5EW1H 3SOSA 3BTEE 2O8UA 2FTMA 2JJ2D 1HXFH 1LKAA 3LPRA 1OP2A 2A4RA 1H8IH 1V2PT 3T25A 8GCHF 2ZGCA 3PTBA 2ALPA 1JOUB 1P3EA 4RSPA 4ISLA 1FJSA 1AN1E 1HIAA 4MNVA 1G32B 3QTVH 5J4SA 2Z3DA 2FOFA 2P95A 2F83A 2L6OA 5LPEA 1O2ZA 4TPIZ 1UTOA 1NRQH 4IC6A 1QY6A 5E2PA 3URCA 5A0BA 2Q6GA 5HYOA 3FP6E 4Y8XA 1HPGA 3PRDA 1YPEH 2PWXA 1HXEH 4I86A 1O3MA 4X6MA 5IK2D 3KQCA 4B6EA 1LKBA 3H7TA 2TPIZ 1ETSH 4Y71A 2VH0A 4TPYA 5KGOA 2Z6BD 3QX5H 1V2MT 2O8MA 1S84A 3M37A 1HLTH 3A7ZA 2PKAB 2EI7A 4ZKRU 3NPSA 4KGAA 1YCPK 1TRMA 1ELTA 1ZPZA 3IWMA 1G30B 8KME2 5DP4A 2ZTXA 3PO1C 4Y6DA 2QC2A 2ODPA 1W0JD 4A1XA 1N8OB 5CDFE 1OSSA 1P9UA 2CXVA 3A81A 2WPDD 4DOQA 3GCHC 1BTHH 1K9OE 1QNJA 1IQNA 2JJ1D 3QZQA 1AKSA 1C5ZB 1UTJA 2W7SA 1T8NA 3KIDU 1FLEE 1WAYB 2TBSA 3OX7U 3TJVA 3MTYA 1C2HA 5F8XA 1SGCA 1HRTH 2HOBA 1EPTB 1J14A 4BTTB 4ZHMU 1SHHB 1GDUA 1H8ED 1SMFE 2H9HA 1C1WH 1FPCH 3CP7A 1OHHD 3PMAB 2FIRH 1ELGA 1SI5H 5CHAB 4YM9A 1LHEH 1O5GH 3KQBA 2A4GA 3SI4H 2A4OA 3DSOA 2ZDAH 4BAKB 5EQQA 1EXFA 4NGAH 5AVDA 1QQUA 1TYNA 1MU6B 3EA8A 2FX4A 2P3UB 2AIQA 3W1EA 1MU8B 1ABJH 1GVZA 2PR3A 3E1XB 1H9IE 3U28C 3ZV8A 1VITG 2P16A 3SHAH 2PKSC 4FUCA 2ZG0H 3OSYA 3SHCH 5JYIA 1AWHB 1PPBH 4K8BA 4NSVA 1BIOA 1BHXB 1O2RA 4JZDH 5A8YA 8LPRA 1ZHPA 4TY6A 4UFGH 1EUFA 4MPVA 3FP7E 2XC0A 1GI0A 2CHAC 3FVFB 3ZVAA 4OGXA 3M7TA 3LIWA 5K0HA 1WYKA 4XSKU 1QQ4A 3A8BA 4CRBA 1C5XB 2BOKA 8ESTE 1PQ7A 1SGFA 1G3DA 5FHTA 1COWD 2IOTA 2YMSC 3SNCA 2ZA5A 4ZXYH 5E0JA 1FNIA 1O5BB 1FIWA 1KLTA 2H1UA 1OWDA 1C5LH 3F9HA 3ZVDA 2XBWA 1AVWA 1FX0B 1G36A 1LPZB 1MQ6A 4YTAA 3AW1A 2F4LA 3SORA 5HXFA 2XNIA 1OP0A 3QLPH 3JZ1B 1MKXH 2C90B 2I6QA 1AY6H 3HATH 1S6FA 4NZLA 2ZO3H 3F0PA 4ESTE 1SLWB 2H6MA 3SV6A 3ELAH 5BPEA 2GX4A 3I78A 4FUBA 1ZTKA 2VB0A 1LCYA 1MAXA 1UJ1A 2W6JD 2AMQA 2WUCA 4O3UA 1V2NT 3B9FH 1DOJA 1MZDA 1BJUA 2A2XH 2QIQA 3ZZBA 3RXMA 5T6DA 4O97A 1BBRH 1H4WA 1CHOF 5JBCS 1XUJA 1FN6A 2Y5HA 1HJAB 1SGDE 3ZZ8A 1IQHA 4U2WA 2OK5A 1L4DA 1PPFE 2A45B 1KTTB 1TGNA 3MH5A 1V3XA 2EY4C 3KGPA 4CR5A 1NRNH 1TAWA 5C0UA 3GDVA 1GBHA 4B73A 3KF2A 1ZTJA 4MDSA 3ZYDA 1T7CA 2VIVA 3ZZ4A 1AUTC 3F0OA 2FPZA 3BG8A 3QK1A 1QURH 1C2LA 1KXBA 4E7RG 1RRKA 1VJAU 1VITF 1W7GH 3RUOA 2V3OH 1FY4A 1P09A 1D3DB 1DUAA 1Y8TA 4KELA 1SFIA 1NBME 3GDSA 2GKVE 2ZHFH 5DP9A 3M35A 4AC9A 1GHBG 2JH5D 5F8ZA 2BDAA 1F0RA 4OS7A 1FONA 1PFXC 1GI4A 3LH1A 3F2HA 4X1SU 4ACAA 2ZTZA 3V0XA 6GCHF 2ALVA 5FBIA 5C5NA 5GWZA 1GI8B 1O3FA 1BTXA 3WW7A 1GBLA 5EPYA 1ZTLA 3TVJB 2DUCA 2CF9H 4O9VA 3G01A 1SGIB 4R0IA 5DP6A 2NWNA 2W6ID 1LHFH 1W14U 5DO4H 2ZGJA 5EJLA 3SV2H 1F5KU 2J97A 2VGCC 3TIUA 2WUBA 3SV8A 3RXHA 2FI5E 3CNRA 2HPPH 4HGCA 4FUDA 3SU6A 4IMQA 3A7VA 4JZIA 1QHRB 3RMLH 1UK3A 4X2WA 5DK1A 2BYAX 2O8WA 3T62A 3A7YA 3HGPA 1YPKH 2SGPE 4GSOA 4XD7D 1NS3A 3STIA 3JZ2B 3HGNA 1BOQA 1WTGH 3O8DA 1OYQA 1GBKA 4Z6AH 5I46H 1IAUA 4XE4A 1RXPA 1SLVB 2GGVB 4ABGA 2G00A 1VJ9U 3LJOA 3SUEA 3Q3YA 3UIRA 3MU8A 1SBWA 2GJGA 1O32A 2NU1E 3BTQE 5FCRA 1HAXB 1CVWH 1O2PA 1W8BH 2SGAA 4DIIH 1PPHE 1K1OA 4LXBH 1SC8U 2I6SA 3MNSA 1E36B 4XOJA 1CE5A 2OC1A 5DPAA 5C94A 1V2UT 1Y3XA 3KQDA 4FUFA 1LHCH 1SL3A 2DE8A 3ZVBA 2OC0A 2YNAA 4INHA 1T31A 1IQKA 1XKAC 1O3KA 4Q7YA 2GMTB 1O2WA 4AG1A 1A3EH 3F9EA 4YT6H 1S6LA 1GMDF 3SBKA 1O5FH 4BAMB 3ZZ5A 3EYDA 1GBCA 3MH6A 3UTUH 2VWLA 1YGCH 1NPMA 4GCHF 1Q3XA 3VB3A 2ZF0H 1C1SA 3RXGA 1GL0E 1K0HA 3RXAA 4IS5A 1BTWA 4X8TH 1ZRBA 3R0FA 3UR9A 2BLWA 1DDJA 1O38A 1PPGE 1ZGIA 5C1XA 2V35A 1AUJA 5LPFA 1GI2A 1GHBF 4ACBA 1TX6A 1GJ7B 2KCPA 3TPIZ 5L2YH 2V7QD 4X2VA 2ZDMA 1K1IA 2JKHA 4OGYA
chains in the Genus database with same CATH topology
2R0LA 2FTLE 2EI6A 1KXFA 3RU4D 3R3GB 3SQEE 3KQEA 3UY9A 1GJAB 1HDTH 3BIVH 3P6ZB 4B74A 1O2MA 1RIWB 4Q80A 4BAOB 4Q7ZA 1TMTH 1ZJKA 4TWYA 1EZXC 1A5GH 1V2WT 3L3TA 1FXYA 1K1NA 1DY8A 2JH0D 3U8OH 1G3BA 4RKOB 1SPJA 1AMHA 1MZAA 1RD3B 1MTVA 1NU7B 4AB8A 4CRDA 3TGJE 1SGTA 2G55A 1YPMH 2ZU1A 2F9OA 1A7SA 2F3CE 1YLDA 4VGCB 3OTJE 2OP9A 3RXOA 4A1TA 2SGDE 1MCTA 2C8XB 1MKXK 1QL9A 4MG3A 1EPTA 1K22H 1KXEA 5FX6A 4M7GA 4ZXXH 1V2JT 3NUMA 3SJ8A 1D9IA 1D3TB 1A0JA 2BZAA 1MKWH 3UOUA 3V3MA 2ESTE 6ESTA 1QRZA 2OC8A 1P2OA 2F9PA 3I29A 1AU8A 1GL1A 3AASA 3SI3H 3SU5A 2Z94A 1QB6A 2B7DH 4AGJA 4X0WU 2CV3A 3BG4C 3RMOH 1BBRK 2SNVA 2WPKS 4DY7B 5G4BA 2EC9H 3ZVGA 2ZP0H 4Q2KA 3GY6A 4I33A 4CHAB 2D1JA 1E38B 1ZYOA 1BMAA 2GTBA 2H5CA 4X1NU 1GBIA 4O3TA 1Y3UA 2XTTB 2J95A 1ZMLA 1GI1A 3UUZA 3SGAE 3UR6A 2AMDA 4FXGH 3M3VA 3A83A 2ZDVH 2NU2E 3NCLA 1TNGA 1GBDA 1DANH 2PGBB 1CGHA 1XUIA 1O2UA 4ZMAH 3ZZ6A 1C5PA 1KSNA 2CGAA 1LVBA 4ZHAA 1G2MA 4YOJA 2BQ6B 1WUNH 2GCHG 4DG4A 1HJ8A 1OP8A 1TGSZ 3NK8A 1LPGB 1UVPA 2FEQH 1A61H 4CRCA 3SU3A 1TOCB 2BVRH 3D23A 3LGWA 3UWJH 1DPOA 3PROA 1C1OA 1LHGH 2ZFFH 2AEIH 5I25A 1YBWA 7GCHF 3GY7A 1QB9A 2B8OH 2THFB 4CRFA 1P11E 4NIVA 4Y76A 2ZHEH 2PUXB 5DP7A 2Y6TA 1B5GH 2VWNA 3D49H 2WV4A 5EODA 1O37A 3VFEA 3BIUH 1ZHRA 4CREA 1AVXA 1W13U 1XM1A 4BAHB 1J16A 1NM6A 1O5CB 1AWFH 5EW2H 1RS0A 1C2FA 4CBOA 3LOXA 4GLYA 1IHSH 1Y5BT 4CR9A 3SZNA 3SQHE 1C4V2 1H1BA 2WPHS 5FAHA 3DA9B 1Y59T 1KDQA 2XW9A 3RXLA 2A5AA 2BLVA 1KTSB 1Z6EA 3ZZ3A 2V6NA 4DVAU 2G52A 1X7AC 4AYVB 2EEKA 2FMJA 4D9RA 2BMGB 3M61U 2KAIA 1L1NA 2VH6A 2F9VA 1V2TT 1PPEE 1JIRA 3BTDE 1DX5M 4YOIA 1C4U2 4VGCC 1YC0A 2QGRA 1C9PA 1ETRH 4RN6A 1TQ0B 5AFYH 2UUYA 3HPTB 2GZ7A 3RXFA 4OS2A 1UTKA 2YNBA 5CE1A 1DWEH 5TCCA 3TJNA 5GXPA 2M5TA 2YOLA 4PROA 4X6OA 2QAAA 1IQIA 1F5RA 1ELDE 1C1PA 2HGTH 4H42U 5EPNA 1P02A 2B0FA 5EOKA 4FUEA 2ZNKH 1OWJA 3SUFA 2ZU3A 1DLKB 3T26A 3A7TA 2RA0A 3P8OA 1MMJN 1TA2A 2ZECA 1F5LA 2F91A 2PSYA 4Y0ZE 1EZUC 1GG6B 1MUEB 1HCGA 4ABAA 2GZ8A 3VB6A 2ZU4A 1GBTA 5GCHG 5E0HA 4TWWA 1GJ6A 2OC7A 4K69A 1EATA 4AN7A 1NESE 1GHAG 2NU4E 5C1UA 3M7QA 1G3CA 2JETC 1FV9A 1S6HA 2ZFPH 4AFQA 1UVOA 3S69A 3KL6A 3GY2A 2UUKB 1AB9C 3MU1A 4R8TB 1DSUA 3Q3XA 1K28D 2AYWA 1XVOA 9LPRA 3VB5A 2OXSA 5ESBA 6LPRA 3FP8E 4AB9A 4BTUB 1P8VC 3BTHE 4JYUH 4HZHA 2BLOA 1K1MA 1EAXA 3A80A 1FI8A 3TK5A 2QA9E 2TGAA 1HAPH 1KLIH 1ZRKA 1PQAA 4A1VA 4ZROA 2ZQ2A 2FODA 2AH4X 2A7HA 1ARBA 2Z3CA 2SNWA 1N6XA 1GJ8B 2J94A 1BTZA 5CMXH 7ESTE 1ORFA 1O2KA 1CT2E 1VCQA 2JH6D 3LONA 2HNTF 3RXCA 3BTGE 1XUFA 1G2LA 1ZPBA 2C93B 3ZVEA 1CT4E 1OWKA 2VVUA 2ZPQA 2ZEBA 1BRCE 1OYTH 3P95A 3RMNH 4X8VH 1C1TA 2LNCA 1HNEE 2BB4A 1K1PA 1UK2A 4XBDA 1CA8B 1RGQA 3D65E 3Q00A 4X1RU 4LZ1H 1A46H 1Z8GA 3T28A 3KHVA 4ISOA 1GVLA 2FDAA 1C5TA 1GGDC 4CRGA 1C1QA 2ZFTA 4AGKA 4CH8B 1XX9A 2PW8H 5E0GA 1GMCG 3EQ0H 1GJBB 2FYQA 1AD8H 1SGQE 3QO6A 3F68H 3P8NA 1S0RA 2Y7ZA 1XMNB 1C1UH 3GCTG 1LDTT 1SQOA 2G8TA 1SGNE 4XBBA 1OOKB 1C5SA 4WMEA 1MH0A 4TYDA 1SQTA 1XUKA 3I77A 1TPAE 1E35B 1OWEA 2G51A 1AFEH 1FY8E 2CF8H 4FVDA 3T5FH 2XCFA 1ANDA 4B1TA 2HPQH 2ASUB 5LGOA 2SGEE 3P8FA 1ABIH 1K1JA 3EDXB 3RU4T 2C4FH 4K1TA 1FY1A 2FO9A 2ZC9H 1L1GA 2BD4A 1ZMJA 1RTFB 5FPTA 5ABWA 1LQEA 1O2YA 1A0LA 3U69H 1HAZB 5DGJA 1GVKB 3BF6H 5HGGA 4Y7BA 3E3TA 1FPHH 3M5OA 3M7UA 3RXKA 3RLYH 1GI5A 3ZVFA 2G4UA 5FPYA 2C8ZB 2ZWLH 3HK6B 2BY9X 5TCAA 1TWXB 1B0FA 3NXPA 3NZIA 1CO7E 1UVUH 1GHZA 4E7NA 2BDHA 4SGBE 2W3KA 1GCTB 1AIXH 3S0NA 3VGCB 3AAVA 4MNWA 3OU0A 5JDUB 4CBNA 3PB1E 2ANWA 1AFQB 3E91A 3A82A 1NFYA 2ZGBH 2NU0E 4I32A 1HAOH 1T32A 4B71A 3ZZ9A 5JB8S 1SFQB 2RG3A 2WPMS 4ISIH 1BJVA 4Y0YE 1GHYH 1IQFA 1V2QT 3PMHB 1GBFA 4X6PA 3PLBA 1FAKH 3S9BA 1VITH 4I8JA 2P3TB 5DP5A 1BRUP 5A0AE 3QGNB 3D62A 1TOMH 3RC6A 4IBLH 4KP0A 2O8LA 3P70B 1L1JA 1W10U 2FOMB 1BZXE 4GVUA 1UTMA 3GOVB 2TGPZ 4NA8A 3ENSB 1N8OC 4WXVA 3SNEA 1Z1JA 2XRCA 1UHBA 5BRRE 3SU2A 1ZMNA 2HVXA 3A7WA 1FQ3A 2OBQA 4JZEH 1HV7A 3QUMP 1CA0B 1LTOA 1FMGA 4FUJA 4KTUA 3EAJA 1LPKB 4JZ1A 3EE0B 3SW2B 1MTNB 3MNBA 3MO9A 3P17H 3ATKA 1ESTA 1EPTC 1XKBC 2FP7B 2R2MB 2R2WU 3MH4A 2GZ9A 3ITIA 9ESTA 1DSTA 2BZ6H 5CHAC 1EB1H 3GYMA 3U9AH 3MNCA 3QGJA 4HFPB 1UCYE 1KXDA 3RXEA 1MTSA 4K2YA 4THNH 3T2NA 1QGFA 1J8AA 3AW0A 1C1NA 5FCKA 4NFFA 4IW4E 1GHVH 1GDQA 1XXDA 2PHBA 1PQ5A 4WH8A 2WYJA 4I8KA 1KIGH 4MQAA 1P03A 1H8DH 3V13A 4XBCA 4DGJA 5EXLA 4INKA 3PMBB 3ZZCA 3VB7A 4I31A 1S83A 4H6TA 4DT7B 3KN2A 1RJXB 3MO3A 3KEEA 4RKJB 3A8DA 1W3CA 1Y3WA 4XDEA 2VU8E 5A8ZA 3TNSA 1O2OA 2D8WA 2P8OB 3EA9A 2J2UA 4I8LA 1SLXB 3K9XB 4AFUA 3VXFH 3NKKA 4J1YA 3ZZDA 3ZV9A 1N6YA 2ZTYA 2J38A 4YLQH 3UWIA 1O36A 1ELAA 1Z7KA 2FI4E 4UFFH 3RXIA 1TGCA 2BDBA 3S7KB 1O2QA 2R9PA 2AIPA 1A1RA 1C2IA 1DWDH 4JK6A 1L0ZA 3F1SB 4Z0KA 3V12A 3ZZAA 1ELBA 1GCTC 4UDWH 3VGCC 3PLKA 4A7IB 5TJXA 5EQRA 3PWBA 3M3TA 2CN0H 1HIAB 4JYTA 4U30A 2FM2A 2EA3A 3UNQA 4CH2B 3GY8A 2AFQB 1NRRH 3E90B 4NIWA 1E34B 2QXJA 4MPXA 1C5OH 3SNAA 3FAOA 1MAYA 3MMGA 5HMAA 1S0QA 3FZDA 1TB6H 1C5NH 2VVCA 1PYTD 3HKIB 1HJAC 3SNBA 2A7JA 6CHAB 5DP3A 2PLXA 2AS9A 1QTFA 4BTIB 1WTHD 2ODQA 1ZPCA 2PTCE 3MU5A 2ZQ1A 4X1PU 4ABEA 2XWBI 4AZ2B 2PKAA 1TNLA 4B2BA 1TPOA 3SGBE 3GY4A 5C20A 3RXRA 1IQLA 2BQ7B 1UK4A 3O8BA 1CA0C 1AE5A 4WVPE 1O3NA 2GCTB 3BN9A 1GHWH 1MCVA 4ASHA 3Q76A 2GV7A 3SU0A 4D8NA 3GDUA 2QY0B 1NROH 5A0CA 4ISNA 4WY3A 5F8TA 3PWCA 4IMZA 5DP8A 2F9UA 3CS7A 1AHTH 4DJZB 1GMHG 1WV7H 2ZCKP 3TJOA 1K2I1 5E2OA 4GHQA 4NCYA 4AFZA 3OYPA 3F6UH 2PTNA 1ELEE 1O3DA 2BD7A 2P59A 4NA7A 2PSXA 2H2ZA 4IN1A 4YT7H 2H5DA 1W11U 2C8YB 2G4TA 3BEFB 3LH3A 1OWHA 1AI8H 1YP9A 2WYGA 5PTPA 1EJNA 1W12U 1C2JA 4DURA 1S82A 2HNTC 3LJJA 1P2NA 1BRAA 1QL7A 1LVOA 3UQVA 3AAUA 4X6NA 2WPLS 1H9HE 2P93A 1NZQH 1Y5UT 5FPSA 1C2KA 2IN2A 3N7OA 3M36A 4MTBA 1CT0E 1SGEE 2A5IA 4ABDA 2J9NA 1WOFA 1JBUH 1YPJH 1BUIA 4H6SB 1O3JA 4OS1A 3M3SA 4OS5A 1TQ7B 1EKBB 1O3GA 1GJ9B 1Z6JH 1C2GA 2R0KA 1F0UA 2VIOA 2GDDA 1ELFA 2FS9A 3LDXH 2FS8A 4B2CA 1O3BA 2RCEA 3NWUA 1TIOA 1KY9A 1BMNH 2GMTC 3TK9A 1ID5H 1EJMA 1TNHA 2Y5FA 1HAYB 2PV9B 4AX9H 2NU3E 2BXUH 2H9EH 1HGTH 1EP6A 3O8CA 3RM0H 1Z1IA 2OINA 2VIWA 3VPKA 2GVFA 1EAUA 1ZHMA 5A8XA 5B6OA 1T4UH 1F2SE 1O39A 4B75A 1P3CA 1BTYA 3P92A 3A7XA 1TX7A 4FUIA 2ZHWH 4WMFA 2O9QA 1TA6A 2ZFRH 2CJIA 2BD8A 1RTLA 4DIHH 1ZSJA 1BMLA 4UEHH 2WPIS 1ESBA 2W7UA 3DHKH 3TNTA 1W0YH 3ZVCA 5JB9S 1UTNA 1EB2A 4NWKA 2SFAA 2BLQA 4WH6A 1O2JA 4OS4A 3HK3B 1DS2E 4NIYA 1AZZA 2ZGHA 1GBJA 1Q2WA 1RIWC 2GCTC 5L30H 8GCHG 1KXAA 3U8TH 2FLBH 2HNTE 4WXIA 3U98H 1A3BH 1T8LA 2P3FH 3UQOA 2GT8A 1K1LA 1TGBA 1Z8JB 4BAQB 2QXHA 1O3IA 1J15A 3PMJA 1QR3E 4GAWA 3M5NA 1QB1A 1A5HA 4FUHA 1BQYA 2A0QB 2A32A 4F4OC 3RU4E 3SJOA 4B2AA 1P01A 1OPHB 1BTPA 1QJ7B 1O30A 1TALA 3GCHB 3MO6A 4ZKNU 1O5EH 4KTSA 2W26A 1O3CA 4B76A 4BXSA 1NRSH 4X8SH 2OTVA 4YZUA 2XBVA 3VEQB 2Y7XA 1SHYA 3W94A 2ZKSA 1GBBA 3GYLB 2ZFQH 4NZQA 3RXDA 1P9SA 2QV1A 1DWCH 1YYY1 3E0PB 4YLUA 1A2CH 3H5CB 1C5RA 4UE7H 4A5TS 1XXFA 1TE0A 3SO3A 3O8RA 1GI7B 2Q6DA 3K6YA 1V2ST 4INLA 2ZCLP 2GCHF 4CHAC 4ZUHA 2A31A 2BXTH 5T3HA 4UFEH 5E8EH 1NT1A 4ISHH 1YKTA 4JCNA 3E16B 3RP2A 2BM2A 1P12E 5EQSA 2VWMA 1B7XB 1HAIH 1V2LT 3A88A 1E37B 3UNRA 1U6QA 3Q77A 1SGPE 2BVXH 1SVPA 3Q3KA 1NFXA 1B0EA 4D9QA 1XUGA 2OQ5A 2FESH 4FVBA 2D26C 1RTKA 5AFZH 2B5TB 2CHAB 5ESTE 1TPSA 3A89A 3A85A 4MPUA 5T6FA 1PQ8A 1BTUA 1GJCB 2QN5T 3SV9A 3B23B 1YM0A 2QF0A 1TRNA 2Q6FA 2J4IA 4Y7AA 4Y11E 5JBBS 5H4IB 3K65B 2FZZA 1FN8A 5EXMA 3TLOA 1D3PB 1AE8H 1C1VH 4I8GA 1C1RA 1D4PB 1FY5A 1MKWK 1ZLRA 1GJ5H 3TU7H 3FANA 1GHXH 5HM2A 1NRPH 2AMPA 3CENA 4TY7A 1JXPA 2ANMH 4ABFA 3SUDA 2BDYA 2C8WB 3T29A 2LPRA 5GDSH 3BTWE 2EI8A 2VNTA 3M5MA 1PPCE 2CMYA 4I7YH 1DWBH 3KCGH 7KMEH 3T27A 4KKDA 1MQ5A 1NU9A 1NN6A 1FZZA 1NY22 3PV4A 1GBAA 4NIXA 2ZGXH 4XFQA 5EG4A 3TH2H 1H9LB 1WQVH 2G5VA 1N1LA 3GCOA 4JZFH 4BOHA 4U01A 3L6PA 1TONA 5GJ4B 1ELCA 1OWIA 1BRBE 4ABJA 2ZDNA 4HI3A 4UFDH 4X2YA 1T4VH 3PTNA 2QXGA 4K1EA 1UTLM 1CBWB 2VIPA 3DUXH 2F9NA 1UMAH 1A5IA 1QBOA 1DFPA 1MTWA 5GCHF 1MD7A 1P10A 2BDGA 1D6RA 1HAVB 2BHGA 5C1YA 3SN8A 1C4Y2 1CHOG 1INCA 1HUTH 1GHAF 5C2ZA 1ARCA