3KN2A

Hcv ns3 protease domain with ketoamide inhibitor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
181
structure length
181
Chain Sequence
b'APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCV NS3 Protease Domain
publication title P4 capped amides and lactams as HCV NS3 protease inhibitors with improved potency and DMPK profile.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1a
molecule tags Hydrolase
total genus 42
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3kn2A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3kn2A01
1HYLA 4FU8A 4Y76A 2A7JA 3A7WA 1FONA 2QAAA 2EI7A 4ABAA 4K1SA 1AFQC 1O2RA 1FAKH 1ZTKA 4FVDA 5F03A 2AH4X 5K0HA 2BVSH 1AFQB 1QURH 1DXWA 1SQOA 1SHHB 4MDSA 2Y7XA 2NU0E 4ZAEA 1SFQB 3QWCH 3MWIU 3K2UA 1Y3WA 2AGGX 2PFEA 1XKBC 1C1RA 3P70B 1QQUA 5T6DA 2SGDE 1JOUB 1OP0A 2SNWA 2Y82A 1OWHA 1HNEE 3TK5A 3SORA 1OPHB 4JZDH 1C1MA 1DPOA 2FOEA 1ANDA 1YPMH 1XKAC 2ZG0H 1NFXA 4NCYA 2V0BA 2AEIH 1BTPA 3DHKH 2FYQA 2ZHEH 1B0FA 4F4OC 2FESH 3K6YA 4Q7ZA 4AN7A 1GJ7B 2C8WB 2PSYA 2GGVB 4F49A 3ZZ8A 3ESTA 5CHAC 1O33A 2R2MB 3C27B 2HALA 2AMPA 3SO3A 1P9UA 1UTJA 5CMXH 2FEQH 2BXTH 2W5EA 2GZ9A 2ZU3A 3ZZCA 1TA6A 1O5FH 1O3KA 1RTFB 1T32A 4DOQA 3LONA 1FPCH 3BN9A 2VWNA 4MNWA 3UREA 1UK4A 3RU4D 1CSOE 3SBKA 2FS9A 3DFJA 1GDQA 3SU2A 3SYJA 4B1TA 1A46H 3SUEA 2BY5X 4YLQH 3TPIZ 1BIOA 1W3CA 5F8TA 1GPZA 3O8BA 1GGDB 1TRYA 3MH7A 1DVAH 5DP9A 2G4UA 2PUQH 1W2KH 1A7SA 1C9TA 1SQAA 4BXSA 1W0ZU 1AB9C 2BLWA 3ODFA 5A8YA 1Y3YA 5LPEA 1KLJH 4XBCA 3Q00A 1FI8A 1L4ZA 4KP0A 1HJ9A 3GYLB 3SU0A 5C3NA 2G00A 3D49H 3HK6B 4YOJA 3KN2A 1UK3A 2BDAA 3ZZ6A 2OC7A 3IWMA 1NRSH 4H6SB 3T29A 5BPEA 2BTCE 2Z3DA 3ZZDA 3MO9A 1DWCH 1QBOA 1GJCB 1MU6B 1VR1H 4WWYA 1ZRKA 1HAVA 1LQDB 1VITG 1LTOA 1YGCH 2ASUB 1HJAC 1O2WA 1AZ8A 2A5KA 2KAIB 5EG4A 1DWBH 1XX9A 2FPZA 1BTUA 3W95A 2HGTH 1SL3A 1FN8A 3BEUA 2VH0A 4UFDH 1Z1IA 2ZQ2A 2OC8A 3SNBA 1Y3UA 1O2JA 1C1QA 2QN5T 2ZF0H 2BY9X 4A1VA 1K1LA 2H6MA 2XBYA 1O39A 2FS8A 2B9LA 1C1SA 1ZRBA 2OUAA 1GVLA 1S81A 1VITF 1QTFA 1NRQH 1D3DB 2ZU5A 3QX5H 1EKBB 2HVXA 1V2NT 1UTLM 4IW4E 2BYAX 4WXIA 2P8OC 1PQ7A 1QL8A 1V2KT 3LGYA 1QQ4A 1BBRE 2P8OB 3ZZ5A 1SGFA 1TX8A 2R2WU 2JH0D 4Y8ZA 5JB9S 3RUOA 4BTIB 2ESTE 4U2WA 3SJOA 3T62A 1VJAU 1Q3XA 3E0PB 1WTHD 1G30B 3IG6B 3BTKE 4GUXA 2FO9A 5ESTE 2H2ZA 2ZDVH 3SUDA 1L0ZA 1NTPA 1QL9A 2CV3A 3A7TA 1ARCA 1QHRB 1ZSLA 4AYYB 3V12A 2ANKH 1F0UA 3EA8A 2HNTC 4X1NU 1S6FA 1QFKH 4ZHMU 1O3IA 1P04A 3Q76A 1SGQE 3BV9B 1JRTA 3GOVB 2BM2A 1GJ9B 3TNTA 1PQ5A 1DLEA 3Q3YA 1NFYA 2R3YA 2HWLB 3K65B 3MH6A 4IMQA 2PKSC 1UCYK 3SZEA 1OWJA 2VINA 2F83A 2PKSB 1KIGH 1HIAB 1BMMH 1FAXA 1H8IH 2OCVB 2QIQA 2Y5FA 1P09A 1TQ0B 2F9OA 1TX6A 1LO6A 1O2NA 2B0FA 4DURA 5JPMH 1D9IA 2GTBA 3VXFH 1BUIA 1GL0E 3HKJB 1O3DA 1WYKA 4TY7A 1O2PA 1UVOA 2ZDKA 3O8RA 3F6UH 1ELBA 1NM6A 3GY2A 3M3SA 1JRSA 1UTQA 1YKTA 4UDWH 2IJD1 4THNH 1W8BH 1EB1H 1N6XA 1O32A 2FOFA 1AKSB 2GDDA 3PV4A 2FMJA 3O8CA 1AN1E 1ZHMA 4OGYA 3SV7A 4AYVB 1P12E 1NROH 1O35A 2OD3B 1O0DH 1AO5A 1SHYA 4JZIA 1OOKB 4I8HA 1XXFA 1LKAA 4IC5A 5IYTA 2P3TB 5DO4H 3OX7U 1TAWA 4CH8B 1RRKA 1C5WB 3KCGH 1HRTH 2XBXA 2BDCA 3PROA 1GMHG 3LGUA 1CT0E 1O5BB 1C2IA 2R3UA 2VH6A 2PGBB 3V0XA 1IAUA 3M5MA 4SGAE 4X1SU 1CO7E 1DDJA 5HM2A 3HGNA 3BTTE 1T4UH 3RXGA 4AFQA 2BDHA 1LPZB 1SI5H 1G32B 4GLYA 1V2WT 1YCPM 1U6QA 5FX5A 1BTYA 1ELFA 2AMQA 2Y80A 1QNJA 1G36A 3M36A 1SLWB 1C1TA 3LJJA 1ACBE 1GDUA 2FX4A 1GMHF 1CBWC 3V3MA 4CRBA 2ZEBA 4DCDA 2BD3A 1GHWH 3ZZBA 4Y7BA 1P3EA 5HM9A 1BDAA 1DSTA 1XUGA 2QF0A 1XUFA 3EE0B 3ZVBA 5EODA 3SV9A 1BMAA 2DE8A 4ASHA 4QT8C 3S9CA 1PPEE 3VB5A 3ZVAA 1G3BA 1O2SA 1J15A 1GBTA 5EOKA 3RC6A 1RTLA 1FY8E 1PPHE 2H9HA 2DUCA 1OWEA 4IGDA 2A4RA 3LGIA 1PPGE 5JB8S 1VCWA 1FV9A 3BF6H 3LKWA 1ELAA 3P8GA 1OKXA 3KHVA 1TBRH 2F9BH 2TGDA 2XCFA 1AI8H 2OINA 3ZVDA 5DP3A 4E7RG 2QV1A 3HATH 2ZKSA 2D8WA 3BTME 4OS2A 1N8OC 1DS2E 2WPLS 3FZZA 2R9PA 1N1LA 1PYTC 1M9UA 1TBZH 3QGNB 4INKA 1PQAA 1TMBH 2AGEX 1FNIA 4WMFA 1O2VA 2C4FH 1Z1JA 4I7YH 4UFFH 2CMYA 3A89A 5C1UA 1V2ST 3MU1A 5E0GA 3A82A 1F0RA 3PWCA 3GY4A 2TIOA 4DT7B 1IQFA 1EPTA 4HTCH 1SGIB 1P2MA 3I77A 3OU0A 2FOAA 1SOZA 2OQUA 3CENA 1CQQA 1IQNA 1ETRH 2GT7A 2FOHA 2BY7X 2ANWA 3ZV9A 3SNAA 4DIHH 1GBFA 2GZ8A 3ATLA 1XVMA 2FYRA 1C2JA 5C5NA 1MKWH 2UWPA 1NRRH 1NZQH 1ZPBA 1DY8A 2YNBA 1MAYA 1CT4E 2J2UA 1ANCA 1TE0A 2AFQB 3QK1A 4ZKOU 1MQ5A 1OYTH 1K1IA 1TMTH 1P2IA 1TGSZ 2P59A 1O36A 2FI5E 5E0HA 1O2MA 2ZCHP 3MNCA 3UFAA 2TPIZ 2RA3A 4KKDA 2FIRH 9ESTA 1JXPA 2ZZUH 3RXVA 2RG3A 1IQIA 3TJVA 2Z6BD 3RU4T 3A7XA 2Q1JA 3SOSA 1MTUA 3V13A 1WQSA 1AWHB 4NA8A 1MAXA 2XXLA 4NWLA 4UE7H 1XUIA 1TPPA 2UUFB 4IMZA 1KXEA 1F5LA 1A5GH 4CR5A 1CGHA 1MU8B 2ZQ1A 2WUCA 3RXKA 3EYDA 3KGPA 4O3TA 3TH2H 1O2QA 3ZZ3A 1C2DA 1HV7A 1DUAA 3PO1C 1P02A 1K21H 3P8OA 3UNRA 1O2IA 2XNIA 2ZPQA 1OWKA 2VJ1A 3NZIA 2P16A 3PO1B 2BDIA 3SGBE 3SZNA 1EZQA 1HXEH 4K2YA 1E34B 3MU0A 1Y5UT 1SC8U 1S0QA 1C5UA 3PWBA 3RXHA 1BRCE 3Q77A 1S84A 1FZZA 1F92A 4AG1A 1LHDH 1PPFE 1BRAA 2PGQB 1W7XH 1SSXA 1QBVH 1A1RA 5GXPA 2JETC 4H4FA 1IQEA 1CA0C 1C5ZB 5JYIA 4ABDA 1O3CA 1TQ7B 5T6FA 1KY9A 1SLUB 2JETB 2ZHDA 4Q7YA 1QL7A 2QXHA 4OS6A 3V7TA 3RXJA 4ZHAA 2A2QH 1V2UT 4CRCA 1QIXB 3RXFA 5A2MH 4YESB 2BX3A 5DKMA 3MO6A 4YT7H 1HAPH 3EDXB 3WY8A 3OYPA 4Y6DA 2A32A 1ZHPA 2G55A 3LU9B 3FFGA 3TNSA 1A0JA 2VB0A 2ZGXH 4AX9H 1O5DH 1ZYOA 1V2QT 3UNQA 2VNTA 3DT0H 1WBGB 3AW1A 1BCUH 4MNYA 5C1YA 1GI3A 1D6WA 4LZ1H 1WTGH 4SGBE 1HUTH 4CRGA 2GDEH 1C4Y2 2FOMB 1DE7H 1MD8A 2BZ6H 4NFFA 1TALA 3ZYDA 3T27A 2F91A 2A7CA 2FLBH 1TGBA 3LIWA 5H4IB 4Y0ZE 3N7OA 3NKKA 1GMCG 1EXFA 1MZDA 1LVBA 4WH6A 3LPRA 4U32A 1IHTH 1BTXA 2OC1A 2FLRH 2SGAA 2ALVA 2ZP0H 1V2TT 1WSSH 1D3PB 3FP6E 1ABIH 5AF9H 2A45B 1B5GH 4D9RA 1A2CH 2IN2A 5C5OA 1WU1A 2CHAB 4JYUH 1ESTA 3F9HA 1GBBA 3UUZA 5L2YH 3ATKA 1Z8JB 1X7AC 3A85A 1WV7H 1GL1A 2OK5A 2O8UA 2EA3A 1GMCF 1HAXB 1FY4A 4IC6A 1SOTA 4IN2A 3QGJA 1HLTH 1OWIA 2VWOA 2ZFRH 1DFPA 4IN1A 3ZYEA 1ZJDA 3FZDA 3OTPA 5E2PA 1IQHA 1HCGA 4JYVH 2RDLA 5DPAA 1EAXA 5EU8A 4GCHG 1GHXH 4KTCA 2F3CE 4ZXYH 1EB2A 2BQ7B 3RM2H 3QO6A 2ZDAH 2AMDA 4AGJA 2FWWA 1QJ1B 3IITA 1G3CA 1MBMA 3TK6A 3URCA 2BDYA 2Z9IA 5C67A 3DA9B 3CP7A 2OBQA 1C1UH 2O8WA 3A84A 1XUKA 1MTVA 1D4PB 1FDPA 2WPJS 1ORFA 3RXPA 1FMGA 2ODQA 2OBOA 5IDKA 2VIQA 5TCAA 1V2VT 2BD2A 1YPLH 1C1WH 4GCHF 1GI6A 5EW1H 2ZGBH 4NZQA 4YO9A 5DP6A 2RA0A 2ZU1A 1MTNC 3P8FA 3BTQE 1BZXE 1D3TB 1HAGE 2P94A 7LPRA 1NESE 1MTNB 1ESAA 1NFUA 1O3EA 1O34A 3RXMA 4D7FA 2BY6X 1QRWA 4WJG2 4FUIA 3GY7A 1TB6H 4LK4A 1ZTJA 2HNTE 2OXSA 2IJOB 1GJ4H 3GCOA 2Y7ZA 2DE9A 1TGTA 1MUEB 1O2UA 2YOLA 1C5OH 1LVOA 4BTTB 1P2JA 5FPTA 4K8BA 1HAZB 1PPCE 1E38B 1Q31A 1YYY1 4ISLA 3MTYA 1K2I1 5F6MA 4O97A 1PPZA 1CVWH 1O3BA 1ZLRA 1NU9A 1A3BH 3M3VA 1AE5A 1GGDC 3SGQE 2STBE 1FJSA 1QB9A 2CXVA 4X8UH 1E36B 1SGFG 2BQ6B 3KQDA 4DY7B 3E3TA 1AGJA 2H5DA 1BB0B 3TH4H 3TH3H 1GHAG 4HI3A 1P9SA 3DD2H 1GMDG 2IPHA 4Y8XA 5JBCS 4B73A 1HJ8A 1ABJH 5GWZA 2Q6DA 1DWDH 3Q3XA 2R0LA 2TGPZ 1V2JT 2SGEE 3I78A 5F8XA 2ILNA 1O2LA 1CA8B 1G3EA 2I6SA 4B75A 1C5RA 5FAHA 1HAIH 3UNSA 1TYNA 2KAIA 6CHAB 3BEFB 4MTBA 3A8DA 1O3PB 2J94A 5GJ4B 2SGQE 2Y5GA 2BD8A 1GHAF 1YF4A 2ZU4A 4BAOB 1GMDF 1H4WA 1RXPA 3PV2A 3BTWE 4K1EA 1K1JA 2V35A 4FUGA 2ODPA 2PR3A 1LVYA 2PTNA 1ELCA 5JBBS 1GBHA 4JK6A 3S7KB 1FIWA 1SG8B 1INCA 7GCHG 4X1RU 2H5CA 1ETTH 4I8KA 3GDSA 3M61U 4ZUHA 2BY8X 1GVKB 3LT3A 1AVXA 2Y5HA 1P2OA 1JWTA 5E0JA 7KMEH 1TA2A 1SFIA 3TJOA 2ZPSA 1HAVB 1TNIA 3SUFA 3ZV8A 1QJ7B 1AFEH 4K3JA 4DVAU 5AVDA 3NPSA 4TWWA 3ATIA 2D26C 3UQVA 1KSNA 3RM0H 1YBWA 5T1VA 1ZSJA 2WINI 3TGKE 1MMJN 3RC5A 2QC2A 1C5SA 1ZPZA 1TOCB 3FVFB 7GCHF 3BTFE 2BDBA 4VGCC 4JK5A 1RIWB 1EASA 3ZZAA 3U8RH 4VGCB 2I6QA 2G52A 4ISNA 3F1SB 1W12U 4ZH8A 3LH3A 3PM3A 3TJNA 1GJAB 1VZQH 1UTKA 1MH0A 2C8ZB 1O2XA 4R8TB 1C2LA 2VVCA 2XC5A 4NSVA 4Q7XA 5A8ZA 3M5NA 2BLVA 1HPGA 3S69A 4CRDA 2P3UB 4CHAC 2C8YB 2QF3A 1OXGA 2BOHB 2R0KA 3SI3H 1FIZA 1GI0A 1YPHC 4K60A 4LOYH 1KXDA 4CHAB 1P11E 3MOCA 3T28A 2GV7A 1ZMJA 2O8TA 3SU4A 2Q6GA 3F9EA 3VB6A 1YP9A 1GBIA 1H1BA 1OSSA 1UCYH 3RXSA 3ATWA 3RLWH 1QA7A 1TPSA 1NRPH 4FUCA 3AASA 1C2FA 1JMOH 1QJ6B 2TBSA 2XC4A 4K8YA 3ZZ7A 1O2KA 5FPYA 4ZKSU 3UPEA 2ZNKH 1AY6H 1Y3VA 1EZXC 1ZZZA 2ZHWH 4AGKA 1QBNA 1GI9B 1KTTB 1GBMA 3HK3B 4I8JA 3NK8A 1ZOMA 4FUFA 1OYQA 4HFPB 1Y5AT 2J9NA 4O03A 2ZIQH 1W14U 5DJ7A 3LC5A 2FDAA 2ZGJA 1O3HA 2F9NA 2QGRA 1FUJA 3SU5A 1L1JA 2ZU2A 3LJOA 1QB1A 5C2ZA 1FXYA 1C4V2 2XC0A 1XXDA 1P01A 1O5AB 2JH6D 3H5CB 1V2RT 2OC0A 1ZMNA 1O3GA 2W7SA 5HYOA 2OP9A 4O3UA 1H9IE 3P8NA 4AZ2B 1J17T 4BAMB 1YM0A 5G4BA 4Y11E 5JBTA 1V2MT 4Q80A 3SU1A 5L6NH 1Y59T 2G8TA 4AORA 1CE5A 1O2OA 4NIVA 4X0WU 2K1QA 4HZHA 1P3CA 3SJKA 1DWEH 3T25A 1GI2A 4D8NA 1UTPA 1K1NA 2BX4A 3SNCA 1C1OA 1HAYB 5A0CA 3SJIA 3RMMH 4A1XA 5LGOA 2XW9A 4INHA 1GBCA 4ABJA 3K9XB 3T2NA 3UQOA 5BRRE 1TRMA 5A8XA 5DP5A 4YT6H 4NG9H 3QN7A 3RDZA 1C5TA 1CU1A 1K22H 1CHGA 1WOFA 2BHGA 1AIXH 3GDUA 3BTDE 3QDZB 4Z0KA 1A5IA 4Y79A 1O2GH 4XSKU 3A7YA 2JKHA 4BTUB 1C2HA 1GI1A 5CE1A 1MQ6A 1O2TA 5HMAA 1SGDE 2PTCE 1D6RA 2ANYA 4NSYA 1UTOA 2GT8A 3FANA 1O3JA 5FBIA 2P93A 1SMFE 4D9QA 1IOEA 1CGJE 1EAUA 3ATMA 3RXOA 1GBKA 4OS4A 1P8VC 6GCHG 2ZC9H 3UIRA 4ZXXH 1TIOA 3EA7A 1F5RA 2M5TA 5TJXA 1BRUP 4A92A 4XBDA 2BLQA 3MU8A 1GJDB 3DFLA 4KTSA 1MBQA 1V2OT 2WYJA 1C5XB 1C5QA 3UOPA 4U01A 1F5KU 2GMTC 2FOBA 4OS7A 1H8DH 1XUJA 1EP5A 3KQCA 2NU4E 4B2CA 4X2VA 2GMTB 3STJA 3TK9A 1YPEH 3G01A 1GCTB 3KNXA 1BQYA 5GDSH 3NCLA 2PUXB 6GCHF 3MH4A 2EC9H 1TABE 1QY6A 5EQQA 1ZGVA 3BTEE 2CGAA 4GAWA 5T3HA 1S82A 3CS0A 3VB7A 4D76A 3PMAB 1RJXB 1EX3A 2XWBI 1FPHH 1O5CB 3A81A 1GWAA 1C2GA 3MI4A 2QY0B 1J14A 5L30H 1TNGA 4MPUA 3R3GB 4CH2B 3M5LA 1FQ3A 4JYTA 1SQTA 3E1XB 2CN0H 4Q2KA 1PYTD 3OTJE 5I25A 1SGEE 5GCHG 2Y6TA 1EP6A 3ZZ9A 5A0BA 5FCKA 1AD8H 4X2WA 2Z9JA 2EI8A 4X6PA 4YTAA 2FI3E 3URDA 1YLCA 1JBUH 2CJIA 2ZFTA 2GVFA 2VIDA 1GBEA 3SU3A 3E0NB 2P95A 3M7TA 3PLBA 3UWJH 1VJ9U 2NU2E 3P17H 1LHFH 3UR9A 4NZLA 5ESBA 3PTBA 1EJNA 2ODYB 1C1NA 1LPGB 4K1TA 1GBJA 1W7GH 3OY5U 2G5NA 1BHXF 4J2YB 1ZR0A 1HAHH 5GCHF 1LDTT 2UWOA 1BMLA 3T26A 2O8LA 1GJBB 3M7QA 1TPOA 5K7RA 4DJZB 4IBLH 3SV2H 3A87A 1GBAA 3L3TA 5F8ZA 1UVSH 2AS9A 8GCHG 1HBTH 4DW2U 1DX5M 4TPIZ 1EJMA 1O5GH 4XDEA 4AB8A 2Z3CA 3GY5A 5GNDA 1HGTH 3JZ2B 3MNSA 3ZVGA 2YNAA 3TLOA 4B6FA 1LHGH 3E8LA 2A31A 4MQAA 2ZTZA 3RXLA 2W3KA 5A09A 5I46H 1LMWB 1AU8A 3BEIB 3TGIE 1C9PA 1MD7A 1L1GA 3OSYA 4X6OA 1OP2A 1MCVA 2A1DB 1LPKB 3VGCB 1C5VA 1GDNA 3BG4C 5DP4A 5FPSA 2PSXA 5DGJA 1H9LB 2FX6A 3GCHB 3LGTA 5EXLA 3U98H 8GCHF 5DP8A 1DANH 1KDQB 3BG4B 2BVXH 2V6NA 2WV5A 1ETSH 1QR3E 1GI8B 3RXBA 4ZHLU 1KTSB 7ESTE 1TNLA 4BANB 1GJ5H 3GY8A 1B7XB 4X1QU 1S6HA 3BTHE 2QCYA 1GI4A 3SU6A 4RSPA 2UUKB 2OQ5A 2FI4E 1O3MA 2BQWB 3ZVEA 1EJAA 4MLFB 1MTSA 2BD5A 4WY3A 1ARBA 1UHBB 2ZECA 4E7NA 5EPYA 1KXCA 1Y3XA 3QZRA 1S85A 1CHOG 4FUDA 3GY3A 3A8AA 5DK1A 1SBWA 3SNDA 1AWFH 4I32A 1QB6A 4A7IB 3BTGE 5FXLA 1BHXB 1O3NA 3NUMA 1RS0A 2FOCA 2VGCB 1ZHRA 3VB3A 2ZFFH 3MO3A 2F4LA 4ABGA 2CHAC 4ABFA 3QTVH 1A61H 1C5MD 1T31A 1P2KA 1ANBA 2XBVA 3A83A 3SJ9A 4JZFH 1CHOF 1ZJKA 3LC3A 4TPYA 1B0EA 4MPVA 3K6ZA 2THFB 1YC0A 1QGFA 2BVRH 1OWDA 2G4TA 1C5PA 3GCTG 3MU4A 3VFEA 8KME2 3BSQA 2FP7B 1CGIE 3F9GA 3F9FA 4H6TA 2Q6FA 1NY22 1GG6C 2VU8E 4Y7AA 1O3AA 4CRFA 1UMAH 2ZI2H 1VITH 3KIDU 5SGAE 1GI7B 2D2DA 2ZGHA 4B2BA 3H7OA 1GG6B 4O9VA 2ULLA 1VGCC 2Z9KA 4DG4A 2A5AA 2C8XB 1BRBE 1SGPE 4ABEA 4LZ4B 1W13U 4K5ZA 4JMYA 4FUBA 1EAIA 5JDUB 2PKAB 1VGCB 1ZGIA 2G51A 3GCTF 1OX1A 2SGPE 3CS7A 4CBOA 3EAJA 1NO9H 2NU3E 1TRNA 2GX4A 4CREA 3S7HB 4A6LA 4UONA 1TFXA 1ANEA 5T6GA 1T8OA 1TOMH 3TIUA 3MFJA 2WZQA 4X8TH 1Y5BT 2LPRA 2AYWA 2VIWA 3D62A 2UWLA 3SI4H 1PQ8A 3EQ0H 1YLDA 3RXCA 4FU7A 5ETXA 3RMNH 3PB1E 2VWLA 1W10U 1WAYB 2GV6A 3U8TH 3B23B 1EAWA 1JIMA 1BTZA 1XM1A 3A7ZA 2A4OA 4WXVA 4GSOA 1Z8RA 1H9HE 1T8MA 1IHSH 4X2XA 4NA7A 3SUGA 3M5OA 2SGFE 2TGAA 8LPRA 4KELA 1EZSC 1YPHE 2FODA 2WPHS 2O8MA 5CHAB 4NA9H 3SHCH 3ITIA 1SLVB 3D65E 3A7VA 1HAOH 3RXDA 1RGQA 3P95A 1Z8GA 2J4IA 2J34A 1C1VH 1ZTLA 1RD3B 1BBRK 4MNXA 4MPWA 3QUMP 2PLXA 1SLXB 2HOBA 5LH8A 4U30A 1AHTH 4JZEH 1BBRH 1ELTA 4WF8A 5B6OA 5EPNA 4PROA 1KXFA 2BB4A 4OS5A 2XWAA 6CHAC 1A5HA 4NIWA 3E91A 1NFWA 4Y10E 2J95A 2OTVA 1N6YA 2CF8H 1MTWA 2BOKA 2AIPA 1YPGH 2B7DH 2O9QA 3FP8E 5EGMA 3RMOH 3U9AH 2ZFSA 1LKBA 4B71A 1ELGA 1UVPA 3UOUA 4X6NA 3KQEA 1AB9B 3SV8A 3A8BA 1PJPA 1Z7KA 2VVVA 1ZMLA 2ZO3H 1G3DA 1IQGA 3HPTB 4CBNA 1G2LA 4BAQB 2HNTF 2SFAA 3PYHA 4M7GA 2FM2A 1V2LT 3GYMA 1C5LH 2ZWLH 5GPIB 3E16B 3PLKA 3TU7H 5AFYH 1YPKH 1K28D 1F7ZA 3LGWA 1T4VH 4BXWA 4E05H 3AAVA 3E6PH 1HDTH 4DGJA 1QRZA 3UWIA 1E0FD 3BIVH 3P6ZB 4ABHA 1IQLA 1GHYH 1TONA 1PFXC 4Y71A 3TGJE 4OGXA 1HJAB 2AERH 1W11U 3MHWU 3AVZA 2QXIA 1NC6A 1WCZA 1EATA 1Z71A 2A5IA 4FVBA 1ELVA 2ZFQH 5L2ZH 1LHEH 3MH5A 4AOQA 1ESBA 1RIWC 4UFGH 2FOGA 2BMGB 4A5TS 1XVOA 1EZUC 2V3HH 1DY9A 2UUYA 3ZVFA 2ZTXA 2BLOA 2PWXA 1DXPA 1O2YA 2WPIS 1WUNH 3QTOH 1ID5H 2CF9H 5GIBA 4AB9A 4GPGA 5JBAS 5C20A 1V3XA 3LOXA 4MPXA 1EUFA 2VIPA 4INLA 1BJVA 3RP2A 1FY5A 4UEHH 5EXMA 3RXIA 3I29A 2Z94A 2BD4A 3L6PA 1UO6A 2ZFPH 2WV4A 1DICA 1BA8B 4BAKB 3QZQA 2PHBA 1P2NA 1T8LA 6ESTA 1O30A 1TPAE 1ELEE 3SQHE 4UFEH 2LNCA 4X6MA 1HIAA 4J1YA 4AG2A 3L33A 3S9BA 3O8DA 2NWNA 3LH1A 4ABBA 1O3FA 3PTNA 2SNVA 1FY3A 1OS8A 3VPKA 2XBWA 3SQEE 1UTNA 2ZA5A 1LVMA 1T8NA 5ABWA 4R0IA 4Y0YE 2STAE 4ESTE 1GHZA 1LCYA 3T5FH 1MKXK 1ELDE 4NIXA 3RLYH 2F9UA 1AKSA 3SW2B 2XTTB 3RXUA 1S0RA 1MKXH 3PMJA 1BTWA 4B76A 3FP7E 4B2AA 1S83A 2HRVA 4YZUA 1NN6A 3H09A 2XRCA 2A4QA 3M35A 6LPRA 1LQEA 1TMUH 4I8LA 3LGVA 1F0TA 1O2HA 4K69A 4YOIA 2A7HA 1GBDA 2BZAA 2GD4B 1C2MA 4NIYA 2A2XH 1BITA 3D23A 2TRMA 1FN6A 1NPMA 4FXGH 4IS5A 2AGIX 5FX6A 3RXEA 2WUBA 3GDVA 3AAUA 3NXPA 1GVZA 1SGYE 3KEEA 3MNBA 2ALPA 3STIA 3SHAH 1THPB 2NU1E 1O38A 2WV9A 2HLCA 1K9OE 4ZROA 3TVJB 1THRH 3TITA 3ZVCA 2ZCLP 4FUHA 3TJUA 4WH8A 4BOHA 4B6EA 3AK5A 1CT2E 1C5YB 4D7GA 1IQMA 2ZPRA 4NWKA 2WHXA 4WVPE 1OP8A 2A0QB 3AW0A 4ZKNU 3GISB 2C3SA 5LPFA 2ZDNA 1W0YH 4B74A 2QA9E 5HXFA 2W7UA 1UTMA 2A4GA 2IOTA 1J16A 2PW8H 1NRNH 1P0SH 2ANMH 1NT1A 2ZHFH 1UCYE 2J92A 1DLKB 2BD7A 4X8VH 4AFUA 3HKIB 1QA0A 4Z6AH 3A80A 1F2SE 1CBWB 3DUXH 4FUJA 3RC4A 4OS1A 4JZ1A 3M3TA 2VVUA 4NGAH 2HPQH 1C2KA 2WPMS 1TGCA 1TNJA 1P03A 2H9TH 2FXRA 4I8GA 4A1TA 5EW2H 1K1OA 1BJUA 3U1IB 3U69H 2Y81A 2ZGCA 4NFEA 1L2EA 1EOLA 1QRXA 4TY6A 2G81E 1KLIH 1SGNE 1P06A 1P2QA 4Y8YA 4BAHB 2AIQA 1KYNA 3LDXH 2XCNA 2WPKS 5AHGH 1TNHA 1DSUA 3U1JB 1P10A 3UTUH 1L1NA 1T7CA 2B8OH 1XMNB 2PV9B 2EI6A 1GCTC 4CR9A 1N8OB 3H7TA 4RKOB 1WXRA 2QXGA 1BT7A 1AVWA 1PPBH 1BOQA 3PMBB 2BDGA 2C90B 3GY6A 4ISIH 2P3FH 1HFDA 1EQ9A 3MU5A 1J9CH 3E90B 5B6LA 1UJ1A 3VXEH 4M9FA 2F9VA 2FTLE 1KXAA 1AQ7A 1SB1H 2ZDMA 1E37B 1Z6EA 1G9IE 3RXTA 3B9FH 1L4DA 1O37A 3ODDA 5C1XA 3M7UA 2FTMA 1UVUH 5HGGA 3A8CA 1LHCH 1EPTC 1V2PT 3BG8A 5J4QA 4MVNA 1AUTC 2WYGA 1MKWK 1YCPK 2HPPH 2J38A 3F68H 1EPTB 4ISOA 1E35B 4ABIA 2G5VA 1GJ6A 3PV5A 1DITH 2B5TB 1DM4B 1YCPH 2W26A 3MYWA 1J8AA 4AFZA 3SV6A 3QLPH 1GI5A 1A4WH 2C93B 2TGTA 4UD9H 2FZZA 4WMEA 1SVPA 2RCEA 2D1JA 2JH5D 4YM9A 4H42U 1FY1A 4ISHH 1O5EH 4HGCA 3UY9A 1VCPA 1YPJH 4XFQA 1UK2A 2H9EH 2ZHQH 5EQRA 5DP7A 3P92A 3HGPA 4GHTA 3R0FA 5EQSA 1GJ8B 2VWMA 1C5NH 3MNXA 3Q3KA 3A86A 1A0LA 3RXQA 1O2ZA 1SGRE 3VB4A 5PTPA 3GICB 1SGCA 4GHQA 1QCPA 5J4SA 1GHBG 1ZPCA 3FAOA 1AE8H 1IQKA 1HXFH 5FBEA 1DOJA 4TYDA 3OY6U 2GZ7A 3SN8A 3KQBA 3PLPA 5EXNA 3A88A 3RU4E 3SGAE 4RI0A 5AFZH 1TGNA 2ZCKP 3BIUH 1SGTA 3RXRA 4FU9A 2Z9GA 2ZDLA 4CRAA 1GBLA 2GCHG 3VGCC 3NWUA 1XUHA 5FHTA 1C4U2 1G2MA 1KDQA 3SNEA 1AUJA 3GCHC 3MMGA 1TNKA 1K1PA 1GHBF 3M37A 2H1UA 1F0SA 2VBCA 5E2OA 1C2EA 1SR5C 4WMDA 1C1PA 3ELAH 3JZ1B 1NU7B 2Z7FE 1SPJA 4YLUA 3KL6A 4X2YA 1S5SA 1CA0B 1VCQA 4AFSA 1EOJA 3EA9A 1DUEA 1UHBA 4I31A 4KTUA 2GCHF 1Z6JH 2Z9LA 4KGAA 9LPRA 3ZZ4A 3GCNA 4LXBH 1RFNA 3KF2A 3UR6A 2XYAA 3RXAA 4GVUA 1P05A 4MG3A 1GHVH 2QYIA 1O3OA 2GCTC 5FCRA 3ENSB 2Z3EA 4XBBA 4E06H 4DIIH 1BTHH 1Q2WA 4X8SH 4RKJB 2BXUH 1WQVH 2GKVE 5TCCA 4I33A 4BNRA 2GCTB 2W3IA 3U8OH 2GP9B 1TLDA 2ZTYA 4XE4A 2VGCC 1P57B 1BMNH 5A0AE 3EGKH 2VIVA 4YOGA 8ESTE 5LPRA 1AVGH 1V6DA 1MCTA 2OLGA 1A0HB 1THSH 1JIRA 1G37A 4FUEA 1IQJA 1TBQH 4XOJA 4RN6A 1D3QB 3W94A 4ZMAH 1MZAA 1ZSKA 3S9AA 1KXBA 1TX7A 2VIOA 1AMHA 1O3LA 1DT2A 4X1PU 3SJ8A 1FLEE 1AZZA 2BD9A 1Y8TA 1TWXB 2EEKA 5E8EH 1HB0B 3PMHB 5DG6A 3S0NA 4JCNA 1O31A 2QXJA 1A3EH 1RTKA 2F9PA 2V3OH 4TWYA 2UUJB 4MNVA 1NS3A 3VEQB 4ZKRU 1GCDA 1KLTA 3C1KA 3B8JA 3RMLH 1Z8IB 1UVTH 1K1MA 2PKAA 4OM9A
chains in the Genus database with same CATH superfamily
1HYLA 4FU8A 4Y76A 2A7JA 3A7WA 1FONA 2QAAA 2EI7A 4ABAA 4K1SA 1AFQC 1O2RA 1FAKH 1ZTKA 4FVDA 5F03A 2AH4X 5K0HA 2WSSD 2BVSH 1AFQB 1QURH 1DXWA 1SQOA 1SHHB 4MDSA 2Y7XA 2NU0E 4ZAEA 1SFQB 3QWCH 3MWIU 3K2UA 1Y3WA 2AGGX 2PFEA 1XKBC 1C1RA 4FETA 3P70B 1QQUA 5T6DA 2SGDE 1JOUB 1OP0A 3WWFA 2SNWA 2Y82A 1OWHA 1HNEE 3TK5A 2CK3D 3SORA 1OPHB 4JZDH 1C1MA 1DPOA 2FOEA 1ANDA 1YPMH 1XKAC 2ZG0H 1NFXA 4NCYA 2V0BA 2AEIH 1BTPA 3DHKH 2FYQA 2ZHEH 2LP6A 1B0FA 4F4OC 2FESH 3K6YA 4Q7ZA 4AN7A 1GJ7B 1SQRA 2C8WB 2PSYA 2GGVB 4F49A 3ZZ8A 2RDEA 3ESTA 5CHAC 1O33A 2R2MB 3C27B 2HALA 2AMPA 3SO3A 5C17A 1P9UA 1UTJA 3OAAD 5CMXH 2FEQH 2BXTH 3DSPA 2W5EA 2GZ9A 2ZU3A 3ZZCA 1TA6A 1O5FH 1O3KA 1RTFB 1T32A 4DOQA 3LONA 1FPCH 3BN9A 2VWNA 3N99A 4MNWA 3UREA 1UK4A 3RU4D 1CSOE 3SBKA 2FS9A 3DFJA 1MABB 1GDQA 3SU2A 3SYJA 4B1TA 1A46H 3SUEA 2BY5X 4ACAA 4YLQH 3TPIZ 1BIOA 1W3CA 5F8TA 1GPZA 3O8BA 1GGDB 1TRYA 3MH7A 1DVAH 5DP9A 2G4UA 2PUQH 1W2KH 1A7SA 1C9TA 1SQAA 4BXSA 4ZCNA 1W0ZU 1AB9C 2BLWA 3ODFA 5A8YA 1Y3YA 5LPEA 1KLJH 4XBCA 1QZ8A 3Q00A 1FI8A 1L4ZA 4KP0A 1HJ9A 3GYLB 3SU0A 5C3NA 2G00A 3D49H 1S6LA 3HK6B 3GS9A 4YOJA 3KN2A 1UK3A 2BDAA 3ZZ6A 2OC7A 3IWMA 1NRSH 4H6SB 3T29A 5BPEA 2BTCE 2Z3DA 1COWD 3ZZDA 3MO9A 1DWCH 1QBOA 1GJCB 1MU6B 1VR1H 4WWYA 1ZRKA 1HAVA 1LQDB 1VITG 1LTOA 5KEDA 1YGCH 2ASUB 1HJAC 1O2WA 1AZ8A 2A5KA 2KAIB 5EG4A 1DWBH 1XX9A 2FPZA 1BTUA 3W95A 2HGTH 1SL3A 1FN8A 3BEUA 2VH0A 4UFDH 1Z1IA 2ZQ2A 2OC8A 3SNBA 1Y3UA 1O2JA 1C1QA 3ZIAD 2QN5T 2ZF0H 2BY9X 4A1VA 1K1LA 2H6MA 2XBYA 1O39A 2FS8A 2B9LA 1C1SA 1ZRBA 2OUAA 1GVLA 1S81A 1VITF 1QTFA 1NRQH 1D3DB 2ZU5A 3QX5H 1EKBB 2HVXA 1V2NT 1KMHB 1UTLM 4IW4E 2BYAX 4WXIA 2P8OC 1PQ7A 1QL8A 1V2KT 3LGYA 2JIZD 1QQ4A 1BBRE 2P8OB 3ZZ5A 1SGFA 1TX8A 2R2WU 2JH0D 4Y8ZA 5JB9S 3RUOA 4BTIB 3VG8A 2ESTE 4U2WA 3SJOA 4AC9A 3T62A 1VJAU 1Q3XA 3E0PB 1WTHD 1G30B 3IG6B 3BTKE 4GUXA 2FO9A 5ESTE 2H2ZA 2HLDD 2ZDVH 1NBME 3SUDA 1L0ZA 1NTPA 1QL9A 2CV3A 3A7TA 1ARCA 1QHRB 1ZSLA 4AYYB 3V12A 2ANKH 1F0UA 3EA8A 2EQNA 2HNTC 4X1NU 1S6FA 1QFKH 4ZHMU 1O3IA 1P04A 3Q76A 1SGQE 3BV9B 1JRTA 3GOVB 2BM2A 1GJ9B 3TNTA 1PQ5A 1DLEA 3Q3YA 1NFYA 2R3YA 2HWLB 3K65B 3MH6A 4IMQA 2KCOA 2PKSC 1UCYK 1YLNA 3SZEA 1OWJA 2VINA 5HKKD 2F83A 2PKSB 1KIGH 1HIAB 1BMMH 1FAXA 1H8IH 2OCVB 2QIQA 2Y5FA 1P09A 1TQ0B 2F9OA 1TX6A 1LO6A 1O2NA 2B0FA 4DURA 5JPMH 1D9IA 2GTBA 3VXFH 1BUIA 1GL0E 3HKJB 1O3DA 1WYKA 4TY7A 1O2PA 1UVOA 2ZDKA 3O8RA 3F6UH 1ELBA 1NM6A 3GY2A 3M3SA 1JRSA 1UTQA 1YKTA 2IJD1 4UDWH 4THNH 1W8BH 1EB1H 1N6XA 1O32A 2FOFA 1AKSB 2GDDA 3PV4A 2FMJA 3O8CA 1AN1E 1ZHMA 4OGYA 3SV7A 4AYVB 1P12E 1NROH 1O35A 2OD3B 1O0DH 1AO5A 3F2GA 1SHYA 4JZIA 3OEHD 1OOKB 4I8HA 1XXFA 1LKAA 1E1QD 4IC5A 2P3TB 5IYTA 5CDFE 3OX7U 5DO4H 1TAWA 4CH8B 1RRKA 1C5WB 3KCGH 4HG6A 1HRTH 2XBXA 2BDCA 3PROA 3PRDA 1GMHG 3LGUA 1CT0E 1O5BB 1C2IA 2R3UA 2VH6A 2PGBB 3V0XA 1IAUA 3M5MA 4SGAE 4X1SU 1CO7E 1DDJA 5HM2A 3HGNA 3BTTE 1T4UH 3RXGA 4AFQA 2BDHA 1LPZB 1SI5H 1G32B 4GLYA 1V2WT 1YCPM 1U6QA 5FX5A 1BTYA 1ELFA 2AMQA 2Y80A 1QNJA 1G36A 3M36A 1SLWB 1C1TA 2V7QD 3LJJA 1ACBE 1GDUA 2FX4A 1GMHF 1CBWC 2K0QA 3V3MA 4CRBA 2ZEBA 4DCDA 2BD3A 1GHWH 3ZZBA 2LELA 4Y7BA 5FL7D 1P3EA 5HM9A 1BDAA 1DSTA 1XUGA 2QF0A 1XUFA 3EE0B 3ZVBA 5EODA 3SV9A 1BMAA 2DE8A 4ASHA 4QT8C 3S9CA 1PPEE 3VB5A 3ZVAA 1G3BA 1O2SA 1J15A 1GBTA 5EOKA 3RC6A 1RTLA 1FY8E 1PPHE 2H9HA 2DUCA 1OWEA 4IGDA 2A4RA 4F55A 3LGIA 1PPGE 5JB8S 1VCWA 1FV9A 3BF6H 3LKWA 1ELAA 3P8GA 1OKXA 3KHVA 1TBRH 2F9BH 2TGDA 2XCFA 1AI8H 2OINA 3ZVDA 5DP3A 4E7RG 2QV1A 3HATH 2ZKSA 2D8WA 3BTME 4OS2A 1N8OC 1DS2E 2WPLS 3FZZA 2R9PA 1N1LA 1PYTC 1M9UA 1TBZH 3QGNB 4INKA 1PQAA 3UB0A 1TMBH 2AGEX 1FNIA 4WMFA 1O2VA 2C4FH 1Z1JA 4I7YH 4UFFH 2CMYA 3A89A 5C1UA 1V2ST 3MU1A 5E0GA 1BMFD 1YY3A 3A82A 1F0RA 3PWCA 3GY4A 2TIOA 4DT7B 1IQFA 1EPTA 4HTCH 1SGIB 1P2MA 3I77A 3OU0A 2FOAA 1SOZA 2OQUA 2W6JD 1CQQA 1IQNA 1ETRH 3CENA 2GT7A 2FOHA 2BY7X 2ANWA 3ZV9A 3SNAA 4DIHH 2IPQX 1GBFA 2GZ8A 3ATLA 1XVMA 2FYRA 1C2JA 5C5NA 1MKWH 2UWPA 1NBMD 1NRRH 1NZQH 1ZPBA 1DY8A 2YNBA 1MAYA 1CT4E 2J2UA 1ANCA 1TE0A 2AFQB 3QK1A 4ZKOU 1MQ5A 1OYTH 1K1IA 1TMTH 1P2IA 1TGSZ 2P59A 1O36A 2FI5E 5E0HA 1O2MA 2ZCHP 3MNCA 3UFAA 2TPIZ 2RA3A 4KKDA 2FIRH 9ESTA 1JXPA 2ZZUH 3RXVA 2RG3A 2GJGA 1IQIA 3TJVA 2Z6BD 3RU4T 3OE7D 3A7XA 2Q1JA 3SOSA 1MTUA 3V13A 1WQSA 1AWHB 4NA8A 1MAXA 2XXLA 4NWLA 4UE7H 1XUIA 1TPPA 4RT1A 2UUFB 4IMZA 1KXEA 1F5LA 1A5GH 3OFND 4CR5A 1CGHA 1MU8B 2ZQ1A 2WUCA 1OHHD 3RXKA 3EYDA 3KGPA 4O3TA 3TH2H 1O2QA 3ZZ3A 1C2DA 1HV7A 1DUAA 3PO1C 1P02A 1K21H 3P8OA 3UNRA 1O2IA 2XNIA 2ZPQA 1OWKA 2VJ1A 3NZIA 2P16A 3PO1B 2BDIA 3SGBE 3SZNA 1EZQA 1HXEH 4K2YA 1E34B 3MU0A 1Y5UT 1SC8U 1S0QA 1C5UA 3PWBA 3RXHA 1BRCE 3Q77A 1S84A 1FZZA 1F92A 4AG1A 1LHDH 1PPFE 1BRAA 2PGQB 1W7XH 2XOKD 1SSXA 1QBVH 1A1RA 5GXPA 2JETC 4H4FA 1IQEA 1CA0C 1C5ZB 5JYIA 4ABDA 1O3CA 1TQ7B 5T6FA 1KY9A 1SLUB 2JETB 2ZHDA 4Q7YA 1QL7A 2QXHA 4OS6A 3V7TA 3RXJA 4ZHAA 2A2QH 1V2UT 4CRCA 3WW7A 1QIXB 3RXFA 5A2MH 4YESB 2BX3A 5DKMA 3MO6A 4YT7H 1HAPH 3EDXB 3WY8A 3OYPA 4Y6DA 2A32A 1ZHPA 2G55A 3LU9B 3FFGA 3TNSA 1A0JA 2VB0A 2ZGXH 4AX9H 1O5DH 1ZYOA 1V2QT 3UNQA 2VNTA 3DT0H 1WBGB 3AW1A 1BCUH 4MNYA 5C1YA 1GI3A 1D6WA 4LZ1H 1WTGH 4SGBE 3WWBA 1HUTH 4CRGA 2GDEH 1C4Y2 2FOMB 1DE7H 1MD8A 2BZ6H 4NFFA 1TALA 3ZYDA 3T27A 2F91A 2A7CA 2FLBH 1TGBA 3LIWA 5H4IB 4Y0ZE 3N7OA 3NKKA 1GMCG 1EXFA 1MZDA 1LVBA 4WH6A 3LPRA 4U32A 3U28C 1IHTH 1BTXA 2OC1A 2FLRH 2SGAA 2ALVA 2ZP0H 1V2TT 1WSSH 1D3PB 3FP6E 1ABIH 5AF9H 2A45B 1B5GH 4D9RA 1A2CH 2IN2A 5C5OA 1WU1A 2CHAB 3FN8A 4JYUH 1ESTA 3F9HA 1GBBA 3UUZA 5L2YH 3ATKA 1Z8JB 1X7AC 3A85A 1WV7H 1GL1A 2OK5A 2O8UA 3W1EA 2EA3A 1GMCF 1HAXB 1FY4A 4IC6A 1SOTA 4IN2A 3QGJA 1HLTH 1OWIA 2VWOA 2ZFRH 1DFPA 3OTPA 4IN1A 1ZJDA 3FZDA 3ZYEA 5E2PA 1IQHA 1HCGA 4JYVH 2RDLA 5DPAA 1EAXA 5EU8A 4GCHG 1GHXH 4KTCA 2F3CE 4ZXYH 1EB2A 2BQ7B 3RM2H 3QO6A 2ZDAH 2AMDA 4AGJA 2FWWA 1QJ1B 2YMSC 3IITA 1G3CA 1MBMA 3TK6A 3URCA 2BDYA 2Z9IA 5C67A 3DA9B 3CP7A 2OBQA 2YMSB 1C1UH 2O8WA 3A84A 1XUKA 1MTVA 1D4PB 1FDPA 2WPJS 1ORFA 3RXPA 1FMGA 2ODQA 2OBOA 5IDKA 2VIQA 5TCAA 1V2VT 2BD2A 1YPLH 1C1WH 4GCHF 1GI6A 5EW1H 2ZGBH 4NZQA 2K8IA 1YWUA 2KX4A 4YO9A 5DP6A 2RA0A 2ZU1A 1MTNC 3P8FA 3BTQE 1BZXE 1D3TB 1HAGE 2P94A 7LPRA 1NESE 1MTNB 1ESAA 1NFUA 1O3EA 1O34A 3RXMA 4D7FA 2BY6X 1QRWA 4WJG2 4FUIA 3GY7A 1TB6H 4LK4A 1ZTJA 2HNTE 2OXSA 5IK2D 2IJOB 1GJ4H 3GCOA 2Y7ZA 2DE9A 1TGTA 1MUEB 1O2UA 2YOLA 1C5OH 1LVOA 4BTTB 1P2JA 5FPTA 4K8BA 1HAZB 1PPCE 1E38B 1Q31A 1YYY1 4ISLA 3MTYA 1H8ED 1K2I1 5F6MA 4O97A 1PPZA 1CVWH 1O3BA 1ZLRA 1NU9A 1A3BH 3M3VA 1AE5A 1GGDC 3SGQE 2STBE 1FJSA 1QB9A 2CXVA 4X8UH 1E36B 1SGFG 2BQ6B 3KQDA 4DY7B 3E3TA 1AGJA 2H5DA 1BB0B 3TH4H 2J98B 3TH3H 1GHAG 4HI3A 1P9SA 4ASUD 3DD2H 1GMDG 2IPHA 4Y8XA 5JBCS 4B73A 1HJ8A 1ABJH 5GWZA 2Q6DA 1DWDH 3Q3XA 2R0LA 2TGPZ 1V2JT 2SGEE 3I78A 5F8XA 2ILNA 1O2LA 1CA8B 1G3EA 2I6SA 5EJZA 4B75A 1C5RA 5FAHA 1HAIH 3UNSA 3N7DA 1TYNA 2KAIA 6CHAB 3BEFB 4MTBA 3A8DA 1O3PB 5EIYA 2J94A 5GJ4B 2SGQE 2Y5GA 2BD8A 3OEED 1GHAF 1YF4A 2ZU4A 4BAOB 1GMDF 1H4WA 1RXPA 3PV2A 3BTWE 4K1EA 1K1JA 1FX0B 2V35A 4FUGA 2ODPA 2PR3A 1LVYA 2PTNA 2EY4C 1ELCA 5JBBS 1GBHA 4JK6A 3S7KB 1FIWA 2PP6A 1SG8B 1INCA 7GCHG 3F2FA 2H5CA 4X1RU 1ETTH 4I8KA 3GDSA 3M61U 4ZUHA 2BY8X 5DN6D 1GVKB 3LT3A 1AVXA 2Y5HA 1P2OA 5EJLA 1JWTA 5E0JA 7KMEH 1TA2A 1SFIA 3TJOA 2ZPSA 1HAVB 1TNIA 3SUFA 3ZV8A 1QJ7B 1AFEH 4K3JA 4DVAU 5AVDA 2JDID 3NPSA 4TWWA 3ATIA 2D26C 3UQVA 1KSNA 5T1VA 1YBWA 3RM0H 1ZSJA 2WINI 3TGKE 1MMJN 3RC5A 2QC2A 1C5SA 1ZPZA 1TOCB 3FVFB 7GCHF 3BTFE 2BDBA 4VGCC 4JK5A 1RIWB 1EASA 3ZZAA 3U8RH 4VGCB 2I6QA 2G52A 4ISNA 3F1SB 1W12U 4ZH8A 3LH3A 3PM3A 3TJNA 1GJAB 1VZQH 1UTKA 3FKSD 1MH0A 2C8ZB 1O2XA 4R8TB 1C2LA 2VVCA 2XC5A 4NSVA 4Q7XA 5A8ZA 3M5NA 2BLVA 1HPGA 3S69A 4CRDA 2P3UB 4CHAC 2C8YB 2QF3A 1OXGA 2BOHB 2R0KA 3SI3H 1FIZA 1GI0A 1YPHC 4K60A 4LOYH 4ACBA 1KXDA 4CHAB 1P11E 3MOCA 3T28A 2GV7A 1ZMJA 2O8TA 1WDIA 3SU4A 2Q6GA 3F9EA 3VB6A 1YP9A 1GBIA 1H1BA 1OSSA 1UCYH 3RXSA 3ATWA 3RLWH 1QA7A 1TPSA 3MQKC 1NRPH 4FUCA 3AASA 1C2FA 1JMOH 1QJ6B 2TBSA 2XC4A 4K8YA 3ZZ7A 1O2KA 5FPYA 4ZKSU 3UPEA 2ZNKH 1AY6H 1Y3VA 1EZXC 1ZZZA 2ZHWH 5KECA 4AGKA 1QBNA 1GI9B 1KTTB 1GBMA 3HK3B 4I8JA 3NK8A 1ZOMA 4FUFA 1OYQA 4HFPB 1Y5AT 2J9NA 4O03A 2ZIQH 1W14U 5DJ7A 3LC5A 2FDAA 2ZGJA 1O3HA 2F9NA 2QGRA 1FUJA 3SU5A 1L1JA 2ZU2A 3LJOA 1QB1A 5C2ZA 1FXYA 1C4V2 2XC0A 1XXDA 1P01A 1O5AB 2JH6D 3H5CB 1V2RT 2OC0A 1ZMNA 1O3GA 2W7SA 5HYOA 2OP9A 4TT3D 4O3UA 1H9IE 3P8NA 4AZ2B 1J17T 4BAMB 1YM0A 5G4BA 4Y11E 5JBTA 1V2MT 4Q80A 3SU1A 4P00A 2KCAA 5L6NH 1Y59T 2G8TA 4AORA 1CE5A 1O2OA 4NIVA 4X0WU 2K1QA 4HZHA 1P3CA 3SJKA 1DWEH 3T25A 1GI2A 4D8NA 1UTPA 1K1NA 2BX4A 3SNCA 1C1OA 1HAYB 5A0CA 1W0KD 3SJIA 3RMMH 4A1XA 5LGOA 2XW9A 4INHA 1GBCA 4ABJA 3K9XB 3T2NA 3UQOA 5BRRE 1TRMA 5A8XA 3NRLA 5DP5A 4YT6H 4NG9H 3QN7A 3RDZA 1C5TA 1CU1A 1K22H 1CHGA 1WOFA 2BHGA 1AIXH 3GDUA 3BTDE 3QDZB 4FOUC 4Z0KA 1A5IA 4Y79A 1O2GH 4XSKU 3A7YA 2JKHA 4BTUB 1C2HA 1GI1A 5CE1A 1MQ6A 1O2TA 5HMAA 1SGDE 2PTCE 1D6RA 2ANYA 4XRNA 4NSYA 1UTOA 2GT8A 3FANA 1O3JA 5FBIA 2P93A 1SMFE 4D9QA 1IOEA 1CGJE 1EAUA 3ATMA 3RXOA 1GBKA 1E1RD 4OS4A 1P8VC 6GCHG 2ZC9H 3UIRA 4ZXXH 1TIOA 3EA7A 1F5RA 2M5TA 5TJXA 1BRUP 4A92A 4XBDA 2BLQA 3MU8A 1GJDB 3DFLA 4KTSA 1MBQA 1V2OT 2L6OA 2WYJA 1C5XB 1C5QA 3UOPA 4U01A 1F5KU 2GMTC 2FOBA 4OS7A 1H8DH 1XUJA 1EP5A 2RFKC 3KQCA 2NU4E 4B2CA 4X2VA 2GMTB 3STJA 3F3BA 3TK9A 1YPEH 3G01A 1GCTB 3KNXA 1BQYA 5GDSH 3NCLA 2PUXB 6GCHF 3MH4A 4RT0A 2EC9H 1TABE 1QY6A 5EQQA 1ZGVA 3BTEE 2CGAA 4GAWA 5T3HA 1S82A 3CS0A 3VB7A 4D76A 3PMAB 1RJXB 1EX3A 2XWBI 1FPHH 1O5CB 3A81A 1GWAA 4Q4LA 1C2GA 3MI4A 2QY0B 1J14A 5L30H 5HIYA 1TNGA 4MPUA 3R3GB 4CH2B 3M5LA 1FQ3A 4JYTA 1SQTA 3E1XB 2CN0H 4Q2KA 1PYTD 3EE7A 3OTJE 5I25A 1SGEE 5GCHG 1H8HD 2W6ID 2Y6TA 1EP6A 3ZZ9A 5A0BA 5FCKA 1AD8H 4X2WA 2Z9JA 2EI8A 3FOAA 4X6PA 3KYGA 2FI3E 4YTAA 3URDA 1YLCA 1JBUH 2CJIA 2ZFTA 2GVFA 2VIDA 1GBEA 3SU3A 3E0NB 2P95A 3M7TA 3PLBA 3UWJH 1EFRD 1VJ9U 2NU2E 3P17H 1LHFH 3UR9A 4NZLA 5ESBA 3PTBA 1EJNA 2ODYB 1C1NA 1LPGB 4K1TA 1GBJA 1W7GH 3OY5U 2G5NA 1BHXF 4J2YB 1ZR0A 1HAHH 5GCHF 1LDTT 2UWOA 1BMLA 3T26A 2O8LA 1GJBB 3UAIC 3M7QA 1TPOA 5K7RA 4DJZB 4IBLH 3SV2H 3A87A 1GBAA 3L3TA 5F8ZA 1UVSH 2AS9A 8GCHG 1HBTH 4DW2U 1DX5M 4TPIZ 1EJMA 1O5GH 4XDEA 4AB8A 2Z3CA 3GY5A 5GNDA 1HGTH 3JZ2B 2KFWA 3MNSA 3ZVGA 2YNAA 3TLOA 4B6FA 5C0TA 1LHGH 3E8LA 2A31A 4MQAA 2ZTZA 3RXLA 2W3KA 5A09A 5I46H 1LMWB 1AU8A 3BEIB 3TGIE 1C9PA 1MD7A 1L1GA 3OSYA 4X6OA 1OP2A 1MCVA 2A1DB 1LPKB 3VGCB 1C5VA 1GDNA 3BG4C 2M2AA 5DP4A 5FPSA 2PSXA 5DGJA 1H9LB 2FX6A 3GCHB 3LGTA 5EXLA 3U98H 8GCHF 5DP8A 1DANH 1KDQB 3BG4B 2BVXH 2V6NA 2WV5A 1ETSH 1QR3E 1GI8B 3RXBA 2AHME 4ZHLU 1KTSB 7ESTE 1TNLA 4BANB 1GJ5H 3GY8A 1B7XB 4X1QU 2J5UA 1S6HA 3BTHE 2QCYA 1GI4A 3SU6A 4RSPA 2UUKB 2OQ5A 2FI4E 1O3MA 4P02A 2BQWB 3ZVEA 1EJAA 4MLFB 1MTSA 2BD5A 4WY3A 1ARBA 1UHBB 2ZECA 4E7NA 5EPYA 1KXCA 1Y3XA 3QZRA 1S85A 1CHOG 4FUDA 3GY3A 3A8AA 5DK1A 1SBWA 3SNDA 1AWFH 4I32A 1QB6A 4A7IB 3BTGE 5FXLA 1BHXB 1O3NA 3NUMA 1RS0A 2FOCA 2VGCB 1ZHRA 3VB3A 2ZFFH 2F4LA 3MO3A 4ABGA 2CHAC 4ABFA 3QTVH 2WPDD 1A61H 1C5MD 4I86A 1T31A 1P2KA 1ANBA 2XBVA 3A83A 3SJ9A 4JZFH 1CHOF 1ZJKA 5EJ1A 3FO8D 3LC3A 4TPYA 1B0EA 4MPVA 3K6ZA 2THFB 1YC0A 1QGFA 2BVRH 1OWDA 2G4TA 1C5PA 3GCTG 3MU4A 3VFEA 8KME2 3BSQA 2FP7B 1CGIE 3F9GA 3F9FA 4H6TA 2Q6FA 1NY22 1GG6C 2VU8E 4Y7AA 1O3AA 4CRFA 1UMAH 2ZI2H 1VITH 3KIDU 2KR7A 1GI7B 2D2DA 2ZGHA 5SGAE 4B2BA 3H7OA 1GG6B 4O9VA 2ULLA 1VGCC 2Z9KA 4DG4A 2A5AA 2C8XB 1BRBE 1SGPE 4ABEA 4LZ4B 1W13U 4K5ZA 4JMYA 4FUBA 1EAIA 5JDUB 2PKAB 1VGCB 1ZGIA 2G51A 3GCTF 1OX1A 2SGPE 3CS7A 4CBOA 3EAJA 1NO9H 2NU3E 2J97A 1TRNA 2GX4A 4CREA 3S7HB 4A6LA 2V3MA 4UONA 1TFXA 1ANEA 5T6GA 1T8OA 1TOMH 3TIUA 2L74A 3MFJA 2WZQA 4X8TH 1Y5BT 2LPRA 2AYWA 2VIWA 3D62A 2UWLA 3SI4H 1PQ8A 3EQ0H 1YLDA 3RXCA 4FU7A 5ETXA 3RMNH 3PB1E 2VWLA 1W10U 1WAYB 2GV6A 3U8TH 2QF4A 3B23B 1EAWA 1JIMA 1BTZA 1XM1A 5CHBA 3A7ZA 2A4OA 4WXVA 4GSOA 1Z8RA 1H9HE 1T8MA 1IHSH 4X2XA 4NA7A 3SUGA 3M5OA 2SGFE 2TGAA 8LPRA 4KELA 1EZSC 1YPHE 2FODA 2YMSD 2WPHS 2O8MA 5CHAB 2J98A 4NA9H 3SHCH 3ITIA 1SLVB 1K0HA 3D65E 3A7VA 1HAOH 3RXDA 1RGQA 3P95A 1Z8GA 2J4IA 2J34A 1C1VH 1ZTLA 1RD3B 1BBRK 4MNXA 4MPWA 3QUMP 2PLXA 1SLXB 2HOBA 5LH8A 4U30A 1AHTH 4JZEH 1BBRH 1ELTA 3DSGA 4WF8A 5B6OA 5EPNA 4PROA 1KXFA 2BB4A 4OS5A 2XWAA 6CHAC 1A5HA 4NIWA 3E91A 1NFWA 4Y10E 2J95A 2OTVA 1N6YA 2CF8H 1MTWA 2BOKA 2AIPA 1YPGH 2B7DH 2O9QA 3FP8E 5EGMA 3RMOH 3U9AH 2ZFSA 1LKBA 4B71A 1ELGA 2KCPA 1UVPA 3UOUA 4X6NA 3KQEA 1AB9B 3SV8A 3A8BA 1PJPA 1Z7KA 2VVVA 1ZMLA 2QF5A 2ZO3H 1G3DA 1IQGA 3HPTB 4CBNA 1G2LA 4BAQB 2HNTF 2SFAA 3PYHA 4M7GA 4XD7D 1VKYA 2FM2A 1V2LT 3GYMA 1C5LH 2ZWLH 5GPIB 3E16B 3PLKA 3TU7H 5AFYH 1YPKH 1K28D 1F7ZA 3LGWA 1T4VH 4BXWA 4E05H 3AAVA 3E6PH 1HDTH 4DGJA 1QRZA 3UWIA 1E0FD 3BIVH 3P6ZB 4ABHA 1IQLA 1GHYH 1TONA 1PFXC 4Y71A 3TGJE 4OGXA 1HJAB 2AERH 1W11U 3MHWU 3AVZA 2QXIA 1NC6A 1WCZA 1EATA 1Z71A 2A5IA 4FVBA 1ELVA 2ZFQH 5L2ZH 1LHEH 3MH5A 4AOQA 1ESBA 1RIWC 4UFGH 2FOGA 2BMGB 4A5TS 1XVOA 1EZUC 2KCYA 1DY9A 2UUYA 2V3HH 3ZVFA 2ZTXA 2BLOA 2PWXA 1DXPA 1O2YA 2WPIS 1WUNH 3QTOH 1ID5H 2CF9H 5GIBA 4AB9A 4GPGA 5JBAS 5C20A 1V3XA 3LOXA 4MPXA 1E79D 1EUFA 2VIPA 4INLA 1BJVA 3RP2A 1FY5A 4UEHH 5EXMA 3RXIA 3I29A 2Z94A 2BD4A 3L6PA 1UO6A 2ZFPH 2WV4A 1DICA 1BA8B 4BAKB 3QZQA 2PHBA 1P2NA 1T8LA 6ESTA 1O30A 1TPAE 1ELEE 3SQHE 4UFEH 2LNCA 4X6MA 1HIAA 4J1YA 4AG2A 3L33A 3S9BA 3O8DA 2NWNA 3LH1A 4ABBA 4Q63A 1O3FA 3PTNA 2SNVA 1FY3A 1OS8A 3VPKA 5HIZA 2XBWA 3SQEE 1UTNA 2ZA5A 1LVMA 1T8NA 2QE7D 4Z1MD 5ABWA 4R0IA 4Y0YE 2STAE 4ESTE 1GHZA 1LCYA 3T5FH 1MKXK 1ELDE 3KQ5A 4NIXA 2F9UA 1AKSA 3RLYH 3SW2B 2XTTB 3RXUA 1S0RA 1MKXH 3PMJA 1BTWA 4B76A 3FP7E 4B2AA 1S83A 2HRVA 4YZUA 1NN6A 3H09A 2XRCA 2A4QA 3M35A 6LPRA 1LQEA 1TMUH 4F48B 4I8LA 3LGVA 1F0TA 3KYFA 1O2HA 4K69A 4YOIA 2A7HA 1GBDA 2BZAA 2GD4B 1C2MA 4NIYA 2A2XH 1BITA 3D23A 2TRMA 1FN6A 1NPMA 4FXGH 4IS5A 2AGIX 5FX6A 3RXEA 2WUBA 3GDVA 3AAUA 5F53A 3NXPA 1GVZA 1SGYE 3KEEA 3MNBA 2ALPA 3STIA 3SHAH 1THPB 2NU1E 1O38A 2WV9A 2HLCA 1K9OE 4ZROA 3TVJB 1THRH 3TITA 3ZVCA 2ZCLP 4FUHA 3TJUA 4WH8A 4BOHA 4B6EA 3AK5A 1CT2E 1C5YB 4D7GA 1IQMA 5C0UA 2ZPRA 1UW7A 4NWKA 2WHXA 4WVPE 1OP8A 2A0QB 3AW0A 4ZKNU 3GISB 2C3SA 1SKYE 5LPFA 2ZDNA 1W0YH 4B74A 2QA9E 5HXFA 2W7UA 1UTMA 2A4GA 2IOTA 1J16A 2PW8H 1NRNH 1P0SH 2ANMH 1NT1A 2ZHFH 1UCYE 2J92A 2JJ1D 1DLKB 2BD7A 4X8VH 4AFUA 3HKIB 1QA0A 4Z6AH 3A80A 1F2SE 1CBWB 3DUXH 4FUJA 3RC4A 4OS1A 4JZ1A 3M3TA 2VVUA 4NGAH 2HPQH 1C2KA 2WPMS 1TGCA 1TNJA 1P03A 2H9TH 2FXRA 4I8GA 4A1TA 3F0OA 5EW2H 1K1OA 1BJUA 3U1IB 3U69H 2Y81A 2ZGCA 4NFEA 1L2EA 1EOLA 1QRXA 4TY6A 2G81E 3N7EA 1KLIH 1SGNE 1P06A 1P2QA 4Y8YA 4BAHB 2AIQA 1KYNA 3LDXH 2KM0A 2XCNA 2WPKS 5AHGH 1TNHA 1DSUA 3U1JB 1P10A 3UTUH 1L1NA 1T7CA 2B8OH 1XMNB 2PV9B 2EI6A 1GCTC 4CR9A 1N8OB 3H7TA 4RKOB 1WXRA 2QXGA 1BT7A 1AVWA 1PPBH 1BOQA 3PMBB 2BDGA 2C90B 3GY6A 4ISIH 2P3FH 1HFDA 1EQ9A 3MU5A 1J9CH 3E90B 5B6LA 1UJ1A 4M9FA 3VXEH 2F9VA 2FTLE 1KXAA 1AQ7A 1SB1H 2ZDMA 1E37B 1Z6EA 1G9IE 3RXTA 3B9FH 1L4DA 1O37A 3ODDA 5C1XA 3M7UA 2FTMA 1UVUH 5HGGA 3A8CA 1LHCH 1EPTC 1V2PT 3BG8A 3DCLA 5J4QA 4MVNA 1AUTC 2WYGA 1MKWK 1YCPK 2HPPH 2J38A 3DSOA 3F68H 4DT4A 1EPTB 4ISOA 1E35B 4ABIA 2G5VA 1GJ6A 3PV5A 1DITH 2B5TB 3F2HA 1DM4B 1YCPH 2W26A 3MYWA 1J8AA 4AFZA 3SV6A 3QLPH 1GI5A 1A4WH 2C93B 2TGTA 4UD9H 2FZZA 3CNRA 4WMEA 1SVPA 2RCEA 2D1JA 2JH5D 4YM9A 4H42U 1FY1A 4ISHH 1O5EH 4HGCA 3UY9A 2F43B 1VCPA 1YPJH 4XFQA 1UK2A 2H9EH 2JJ2D 2ZHQH 5DP7A 3P92A 5EQRA 3HGPA 2KZ4A 4GHTA 3R0FA 5EQSA 1GJ8B 2VWMA 4TSFD 1C5NH 3MNXA 3Q3KA 5DSFA 3A86A 4YXWD 1A0LA 3RXQA 1O2ZA 1SGRE 3VB4A 5PTPA 3GICB 5C94A 1SGCA 4GHQA 1QCPA 5J4SA 1GHBG 1ZPCA 3FAOA 1AE8H 1IQKA 1HXFH 5FBEA 1DOJA 4TYDA 3OY6U 2GZ7A 3SN8A 3KQBA 3PLPA 5EXNA 3A88A 3PRBA 3RU4E 3SGAE 4RI0A 5AFZH 1TGNA 2ZCKP 3BIUH 1SGTA 5KGOA 3RXRA 4FU9A 2Z9GA 2ZDLA 4CRAA 1GBLA 2GCHG 3VGCC 3NWUA 1XUHA 5FHTA 1C4U2 1G2MA 1KDQA 3F0PA 3SNEA 1AUJA 3GCHC 3MMGA 1TNKA 1K1PA 1GHBF 3M37A 2H1UA 1F0SA 2VBCA 5E2OA 1C2EA 1SR5C 4WMDA 1C1PA 3ELAH 3JZ1B 1NU7B 2Z7FE 1SPJA 2XNDD 4YLUA 3KL6A 4X2YA 1S5SA 1CA0B 1VCQA 4AFSA 1EOJA 3EA9A 1DUEA 1UHBA 4I31A 4KTUA 2GCHF 1Z6JH 2Z9LA 4KGAA 9LPRA 3ZZ4A 3GCNA 4LXBH 1RFNA 3KF2A 3UR6A 2XYAA 3RXAA 4GVUA 1P05A 4MG3A 1GHVH 2QYIA 1O3OA 2GCTC 5FCRA 3ENSB 2Z3EA 4XBBA 4E06H 4DIIH 1BTHH 1Q2WA 4X8SH 4RKJB 2BXUH 1WQVH 2GKVE 5TCCA 4I33A 4BNRA 2GCTB 2W3IA 3U8OH 2GP9B 1TLDA 2ZTYA 4XE4A 2VGCC 1P57B 1BMNH 5A0AE 3EGKH 2VIVA 4YOGA 8ESTE 5LPRA 1AVGH 1V6DA 1MCTA 2OLGA 1A0HB 1THSH 1JIRA 1G37A 4FUEA 1IQJA 1TBQH 4XOJA 4RN6A 1D3QB 1W0JD 3W94A 4ZMAH 1MZAA 1ZSKA 3S9AA 1KXBA 1TX7A 2VIOA 1AMHA 1O3LA 1DT2A 4X1PU 3SJ8A 1FLEE 1AZZA 2BD9A 1Y8TA 1TWXB 2EEKA 5E8EH 1HB0B 3PMHB 5DG6A 3S0NA 4JCNA 1O31A 2QXJA 1A3EH 1RTKA 2F9PA 2HVYB 2V3OH 4TWYA 2UUJB 4MNVA 1NS3A 3VEQB 4ZKRU 1GCDA 1KLTA 3C1KA 3B8JA 3RMLH 1Z8IB 1UVTH 1K1MA 2PKAA 4OM9A
chains in the Genus database with same CATH topology
1HYLA 4FU8A 4Y76A 2A7JA 3A7WA 1FONA 2QAAA 2EI7A 4ABAA 4K1SA 1AFQC 1O2RA 1FAKH 1ZTKA 4FVDA 5F03A 2AH4X 5K0HA 2WSSD 2BVSH 1AFQB 1QURH 1DXWA 1SQOA 1SHHB 4MDSA 2Y7XA 2NU0E 4ZAEA 1SFQB 3QWCH 3MWIU 3K2UA 1Y3WA 2AGGX 2PFEA 1XKBC 1C1RA 4FETA 3P70B 1QQUA 5T6DA 2SGDE 1JOUB 1OP0A 3WWFA 2SNWA 2Y82A 1OWHA 1HNEE 3TK5A 2CK3D 3SORA 1OPHB 4JZDH 1C1MA 1DPOA 2FOEA 1ANDA 1YPMH 1XKAC 2ZG0H 1NFXA 4NCYA 2V0BA 2AEIH 1BTPA 3DHKH 2FYQA 2ZHEH 1B0FA 4F4OC 2FESH 3K6YA 4Q7ZA 4AN7A 1GJ7B 2C8WB 2PSYA 2GGVB 4F49A 3ZZ8A 3ESTA 5CHAC 1O33A 2R2MB 3C27B 2HALA 2AMPA 3SO3A 5C17A 1P9UA 1UTJA 3OAAD 5CMXH 2FEQH 2BXTH 3DSPA 2W5EA 2GZ9A 2ZU3A 3ZZCA 1TA6A 1O5FH 1O3KA 1RTFB 1T32A 4DOQA 3LONA 1FPCH 3BN9A 2VWNA 3N99A 4MNWA 3UREA 1UK4A 3RU4D 1CSOE 3SBKA 2FS9A 3DFJA 1MABB 1GDQA 3SU2A 3SYJA 4B1TA 1A46H 3SUEA 2BY5X 4YLQH 3TPIZ 1BIOA 1W3CA 5F8TA 1GPZA 3O8BA 1GGDB 1TRYA 3MH7A 1DVAH 5DP9A 2G4UA 2PUQH 1W2KH 1A7SA 1C9TA 1SQAA 4BXSA 4ZCNA 1W0ZU 1AB9C 2BLWA 3ODFA 5A8YA 1Y3YA 5LPEA 1KLJH 4XBCA 3Q00A 1FI8A 1L4ZA 4KP0A 1HJ9A 3GYLB 3SU0A 5C3NA 2G00A 3D49H 1S6LA 3HK6B 3GS9A 4YOJA 3KN2A 1UK3A 2BDAA 3ZZ6A 2OC7A 3IWMA 1NRSH 4H6SB 3T29A 5BPEA 2BTCE 2Z3DA 1COWD 3ZZDA 3MO9A 1DWCH 1QBOA 1GJCB 1MU6B 1VR1H 4WWYA 1ZRKA 1HAVA 1LQDB 1VITG 1LTOA 1YGCH 2ASUB 1HJAC 1O2WA 1AZ8A 2A5KA 2KAIB 5EG4A 1DWBH 1XX9A 2FPZA 1BTUA 3W95A 2HGTH 1SL3A 1FN8A 3BEUA 2VH0A 4UFDH 1Z1IA 2ZQ2A 2OC8A 3SNBA 1Y3UA 1O2JA 1C1QA 3ZIAD 2QN5T 2ZF0H 2BY9X 4A1VA 1K1LA 2H6MA 2XBYA 1O39A 2FS8A 2B9LA 1C1SA 1ZRBA 2OUAA 1GVLA 1S81A 1VITF 1QTFA 1NRQH 1D3DB 2ZU5A 3QX5H 1EKBB 2HVXA 1V2NT 1KMHB 1UTLM 4IW4E 2BYAX 4WXIA 2P8OC 1PQ7A 1QL8A 1V2KT 3LGYA 2JIZD 1QQ4A 1BBRE 2P8OB 3ZZ5A 1SGFA 1TX8A 2R2WU 2JH0D 4Y8ZA 5JB9S 3RUOA 4BTIB 3VG8A 2ESTE 4U2WA 3SJOA 3T62A 1VJAU 1Q3XA 3E0PB 1WTHD 1G30B 3IG6B 3BTKE 4GUXA 2FO9A 5ESTE 2H2ZA 2HLDD 2ZDVH 1NBME 3SUDA 1L0ZA 1NTPA 1QL9A 2CV3A 3A7TA 1ARCA 1QHRB 1ZSLA 4AYYB 3V12A 2ANKH 1F0UA 3EA8A 2HNTC 4X1NU 1S6FA 1QFKH 4ZHMU 1O3IA 1P04A 3Q76A 1SGQE 3BV9B 1JRTA 3GOVB 2BM2A 1GJ9B 3TNTA 1PQ5A 1DLEA 3Q3YA 1NFYA 2R3YA 2HWLB 3K65B 3MH6A 4IMQA 2KCOA 2PKSC 1UCYK 3SZEA 1OWJA 2VINA 5HKKD 2F83A 2PKSB 1KIGH 1HIAB 1BMMH 1FAXA 1H8IH 2OCVB 2QIQA 2Y5FA 1P09A 1TQ0B 2F9OA 1TX6A 1LO6A 1O2NA 2B0FA 4DURA 5JPMH 1D9IA 2GTBA 3VXFH 1BUIA 1GL0E 3HKJB 1O3DA 1WYKA 4TY7A 1O2PA 1UVOA 2ZDKA 3O8RA 3F6UH 1ELBA 1NM6A 3GY2A 3M3SA 1JRSA 1UTQA 1YKTA 4UDWH 2IJD1 4THNH 1W8BH 1EB1H 1N6XA 1O32A 2FOFA 1AKSB 2GDDA 3PV4A 2FMJA 3O8CA 1AN1E 1ZHMA 4OGYA 3SV7A 4AYVB 1P12E 1NROH 1O35A 2OD3B 1O0DH 1AO5A 3F2GA 1SHYA 4JZIA 3OEHD 1OOKB 4I8HA 1XXFA 1LKAA 4IC5A 5IYTA 2P3TB 5DO4H 1E1QD 3OX7U 1TAWA 4CH8B 1RRKA 1C5WB 3KCGH 1HRTH 2XBXA 2BDCA 3PROA 3PRDA 1GMHG 3LGUA 1CT0E 1O5BB 1C2IA 2R3UA 2VH6A 2PGBB 3V0XA 1IAUA 3M5MA 4SGAE 4X1SU 1CO7E 1DDJA 5HM2A 3HGNA 3BTTE 1T4UH 3RXGA 4AFQA 2BDHA 1LPZB 1SI5H 1G32B 4GLYA 1V2WT 1YCPM 1U6QA 5FX5A 1BTYA 1ELFA 2AMQA 2Y80A 1QNJA 1G36A 3M36A 1SLWB 1C1TA 3LJJA 2V7QD 1ACBE 1GDUA 2FX4A 1GMHF 1CBWC 3V3MA 4CRBA 2K0QA 2ZEBA 4DCDA 2BD3A 1GHWH 3ZZBA 4Y7BA 2LELA 5FL7D 1P3EA 5HM9A 1BDAA 1DSTA 1XUGA 2QF0A 1XUFA 3EE0B 3ZVBA 5EODA 3SV9A 1BMAA 2DE8A 4ASHA 4QT8C 3S9CA 1PPEE 3VB5A 3ZVAA 1G3BA 1O2SA 1J15A 1GBTA 5EOKA 3RC6A 1RTLA 1FY8E 1PPHE 2H9HA 2DUCA 1OWEA 4IGDA 2A4RA 4F55A 3LGIA 1PPGE 5JB8S 1VCWA 1FV9A 3BF6H 3LKWA 1ELAA 3P8GA 1OKXA 3KHVA 1TBRH 2F9BH 2TGDA 2XCFA 1AI8H 2OINA 3ZVDA 5DP3A 4E7RG 2QV1A 3HATH 2ZKSA 2D8WA 3BTME 4OS2A 1N8OC 1DS2E 2WPLS 3FZZA 2R9PA 1N1LA 1PYTC 1M9UA 1TBZH 3QGNB 4INKA 1PQAA 3UB0A 1TMBH 2AGEX 1FNIA 4WMFA 1O2VA 2C4FH 1Z1JA 4I7YH 4UFFH 2CMYA 3A89A 5C1UA 1V2ST 3MU1A 5E0GA 1BMFD 3A82A 1F0RA 3PWCA 3GY4A 2TIOA 4DT7B 1IQFA 1EPTA 4HTCH 1SGIB 1P2MA 3I77A 3OU0A 2FOAA 1SOZA 2OQUA 3CENA 1CQQA 1IQNA 1ETRH 2W6JD 2GT7A 2FOHA 2BY7X 2ANWA 3ZV9A 3SNAA 4DIHH 1GBFA 2GZ8A 3ATLA 1XVMA 2FYRA 1C2JA 5C5NA 1MKWH 2UWPA 1NBMD 1NRRH 1NZQH 1ZPBA 1DY8A 2YNBA 1MAYA 1CT4E 2J2UA 1ANCA 1TE0A 2AFQB 3QK1A 4ZKOU 1MQ5A 1OYTH 1K1IA 1TMTH 1P2IA 1TGSZ 2P59A 1O36A 2FI5E 5E0HA 1O2MA 2ZCHP 3MNCA 3UFAA 2TPIZ 2RA3A 4KKDA 2FIRH 9ESTA 1JXPA 2ZZUH 3RXVA 2RG3A 1IQIA 3TJVA 2Z6BD 3RU4T 3OE7D 3A7XA 2Q1JA 3SOSA 1MTUA 3V13A 1WQSA 1AWHB 4NA8A 1MAXA 2XXLA 4NWLA 4UE7H 1XUIA 1TPPA 2UUFB 4IMZA 1KXEA 1F5LA 1A5GH 3OFND 4CR5A 1CGHA 1MU8B 2ZQ1A 2WUCA 1OHHD 3RXKA 3EYDA 3KGPA 4O3TA 3TH2H 1O2QA 3ZZ3A 1C2DA 1HV7A 1DUAA 3PO1C 1P02A 1K21H 3P8OA 3UNRA 1O2IA 2XNIA 2ZPQA 1OWKA 2VJ1A 3NZIA 2P16A 3PO1B 2BDIA 3SGBE 3SZNA 1EZQA 1HXEH 4K2YA 1E34B 3MU0A 1Y5UT 1SC8U 1S0QA 1C5UA 3PWBA 3RXHA 1BRCE 3Q77A 1S84A 1FZZA 1F92A 4AG1A 1LHDH 1PPFE 1BRAA 2PGQB 1W7XH 2XOKD 1SSXA 1QBVH 1A1RA 5GXPA 2JETC 4H4FA 1IQEA 1CA0C 1C5ZB 5JYIA 4ABDA 1O3CA 1TQ7B 5T6FA 1KY9A 1SLUB 2JETB 2ZHDA 4Q7YA 1QL7A 2QXHA 4OS6A 3V7TA 3RXJA 4ZHAA 2A2QH 1V2UT 4CRCA 3WW7A 1QIXB 3RXFA 5A2MH 4YESB 2BX3A 5DKMA 3MO6A 4YT7H 1HAPH 3EDXB 3WY8A 3OYPA 4Y6DA 2A32A 1ZHPA 2G55A 3LU9B 3FFGA 3TNSA 1A0JA 2VB0A 2ZGXH 4AX9H 1O5DH 1ZYOA 1V2QT 3UNQA 2VNTA 3DT0H 1WBGB 3AW1A 1BCUH 4MNYA 5C1YA 1GI3A 1D6WA 4LZ1H 1WTGH 4SGBE 1HUTH 3WWBA 4CRGA 2GDEH 1C4Y2 2FOMB 1DE7H 1MD8A 2BZ6H 4NFFA 1TALA 3ZYDA 3T27A 2F91A 2A7CA 2FLBH 1TGBA 3LIWA 5H4IB 4Y0ZE 3N7OA 3NKKA 1GMCG 1EXFA 1MZDA 1LVBA 4WH6A 3LPRA 4U32A 1IHTH 1BTXA 2OC1A 2FLRH 2SGAA 2ALVA 2ZP0H 1V2TT 1WSSH 1D3PB 3FP6E 1ABIH 5AF9H 2A45B 1B5GH 4D9RA 1A2CH 2IN2A 5C5OA 1WU1A 2CHAB 3FN8A 4JYUH 1ESTA 3F9HA 1GBBA 3UUZA 5L2YH 3ATKA 1Z8JB 1X7AC 3A85A 1WV7H 1GL1A 2OK5A 2O8UA 3W1EA 2EA3A 1GMCF 1HAXB 1FY4A 4IC6A 1SOTA 4IN2A 3QGJA 1HLTH 1OWIA 2VWOA 2ZFRH 1DFPA 4IN1A 3ZYEA 1ZJDA 3FZDA 3OTPA 5E2PA 1IQHA 1HCGA 4JYVH 2RDLA 5DPAA 1EAXA 5EU8A 4GCHG 1GHXH 4KTCA 2F3CE 4ZXYH 1EB2A 2BQ7B 3RM2H 3QO6A 2ZDAH 2AMDA 4AGJA 2FWWA 1QJ1B 2YMSC 3IITA 1G3CA 1MBMA 3TK6A 3URCA 2BDYA 2Z9IA 5C67A 3DA9B 3CP7A 2OBQA 2YMSB 1C1UH 2O8WA 3A84A 1XUKA 1MTVA 1D4PB 1FDPA 2WPJS 1ORFA 3RXPA 1FMGA 2ODQA 2OBOA 5IDKA 2VIQA 5TCAA 1V2VT 2BD2A 1YPLH 1C1WH 4GCHF 1GI6A 5EW1H 2ZGBH 4NZQA 2K8IA 4YO9A 5DP6A 2RA0A 2ZU1A 1MTNC 3P8FA 3BTQE 1BZXE 1D3TB 1HAGE 2P94A 7LPRA 1NESE 1MTNB 1ESAA 1NFUA 1O3EA 1O34A 3RXMA 4D7FA 2BY6X 1QRWA 4WJG2 4FUIA 3GY7A 1TB6H 4LK4A 1ZTJA 2HNTE 2OXSA 5IK2D 2IJOB 1GJ4H 3GCOA 2Y7ZA 2DE9A 1TGTA 1MUEB 1O2UA 2YOLA 1C5OH 1LVOA 4BTTB 1P2JA 5FPTA 4K8BA 1HAZB 1PPCE 1E38B 1Q31A 1YYY1 4ISLA 3MTYA 1K2I1 5F6MA 1H8ED 4O97A 1PPZA 1CVWH 1O3BA 1ZLRA 1NU9A 1A3BH 3M3VA 1AE5A 1GGDC 3SGQE 2STBE 1FJSA 1QB9A 2CXVA 4X8UH 1E36B 1SGFG 2BQ6B 3KQDA 4DY7B 3E3TA 1AGJA 2H5DA 1BB0B 3TH4H 3TH3H 1GHAG 4HI3A 1P9SA 4ASUD 3DD2H 1GMDG 2IPHA 4Y8XA 5JBCS 4B73A 1HJ8A 1ABJH 5GWZA 2Q6DA 1DWDH 3Q3XA 2R0LA 2TGPZ 1V2JT 2SGEE 3I78A 5F8XA 2ILNA 1O2LA 1CA8B 1G3EA 2I6SA 4B75A 1C5RA 5FAHA 1HAIH 3UNSA 3N7DA 1TYNA 2KAIA 6CHAB 3BEFB 4MTBA 3A8DA 1O3PB 2J94A 5GJ4B 2SGQE 2Y5GA 2BD8A 3OEED 1GHAF 1YF4A 2ZU4A 4BAOB 1GMDF 1H4WA 1RXPA 3PV2A 3BTWE 4K1EA 1K1JA 2V35A 4FUGA 1FX0B 2ODPA 2PR3A 1LVYA 2PTNA 1ELCA 5JBBS 1GBHA 4JK6A 3S7KB 1FIWA 1SG8B 1INCA 7GCHG 4X1RU 2H5CA 3F2FA 1ETTH 4I8KA 3GDSA 3M61U 4ZUHA 2BY8X 5DN6D 1GVKB 3LT3A 1AVXA 2Y5HA 1P2OA 1JWTA 5E0JA 7KMEH 1TA2A 1SFIA 3TJOA 2ZPSA 1HAVB 1TNIA 3SUFA 3ZV8A 1QJ7B 1AFEH 4K3JA 4DVAU 5AVDA 2JDID 3NPSA 4TWWA 3ATIA 2D26C 3UQVA 1KSNA 3RM0H 1YBWA 5T1VA 1ZSJA 2WINI 3TGKE 1MMJN 3RC5A 2QC2A 1C5SA 1ZPZA 1TOCB 3FVFB 7GCHF 3BTFE 2BDBA 4VGCC 4JK5A 1RIWB 1EASA 3ZZAA 3U8RH 4VGCB 2I6QA 2G52A 4ISNA 3F1SB 1W12U 4ZH8A 3LH3A 3PM3A 3TJNA 1GJAB 1VZQH 1UTKA 3FKSD 1MH0A 2C8ZB 1O2XA 4R8TB 1C2LA 2VVCA 2XC5A 4NSVA 4Q7XA 5A8ZA 3M5NA 2BLVA 1HPGA 3S69A 4CRDA 2P3UB 4CHAC 2C8YB 2QF3A 1OXGA 2BOHB 2R0KA 3SI3H 1FIZA 1GI0A 1YPHC 4K60A 4LOYH 1KXDA 4CHAB 1P11E 3MOCA 3T28A 2GV7A 1ZMJA 2O8TA 3SU4A 2Q6GA 3F9EA 3VB6A 1YP9A 1GBIA 1H1BA 1OSSA 1UCYH 3RXSA 3ATWA 3RLWH 1QA7A 1TPSA 1NRPH 4FUCA 3AASA 1C2FA 1JMOH 1QJ6B<