3KN2A

Hcv ns3 protease domain with ketoamide inhibitor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
181
structure length
181
Chain Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords HCV NS3 Protease Domain
publication title P4 capped amides and lactams as HCV NS3 protease inhibitors with improved potency and DMPK profile.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1a
total genus 42
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3kn2A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3kn2A01
1GG6B 1N6YA 3Q76A 2A45B 1K1NA 3O8CA 1S82A 4GLYA 8GCHG 3FANA 1O2NA 1BIOA 1GHAF 2FOEA 1FN6A 3LGTA 1SC8U 3VB3A 1YPJH 3R3GB 5EXLA 3QGJA 4WWYA 4Y11E 2PSYA 4M9FA 1RFNA 1VZQH 2A2QH 2CGAA 2QCYA 1V2TT 1C9PA 2C90B 2A1DB 4OS5A 1T8OA 3A8DA 5A09A 1GI2A 1A3EH 1C2KA 4R8TB 1B7XB 2C93B 3RXVA 2R3UA 1O3FA 1C5XB 3ZZ4A 1CBWC 3BG4B 1IHTH 3TGKE 1DY9A 4K2YA 1QA7A 1SLWB 2UWLA 1SB1H 5DP3A 3SU3A 1OYTH 5EXNA 5HMAA 3E1XB 4X6PA 1H9IE 1C5SA 1O2SA 1O3AA 2WV9A 3UTUH 4X8SH 5T6FA 4IMZA 1F2SE 1OWHA 2R2WU 2CF8H 3E8LA 3RXOA 4MNXA 2BVXH 3MHWU 5A0BA 2QF0A 2OBQA 3QZRA 1LVBA 2HVXA 3M5NA 3A7VA 1G3EA 1T8MA 4Y8XA 1P11E 1EPTA 3GY8A 1GI5A 1DS2E 4BAMB 1GHBF 1BBRH 1FXYA 5K0HA 5K7RA 3PMHB 4WXVA 3SU2A 2CHAB 4U30A 3V7TA 1HXFH 3TPIZ 1LPZB 1O2JA 1SGCA 1P02A 2CF9H 4YM9A 1JWTA 3SBKA 3TH3H 1UHBA 2THFB 3B9FH 5C67A 1Y3UA 3UR6A 3A7XA 1DFPA 1IQMA 3ZV8A 3MNXA 1D3QB 2GGVB 3ATLA 1LDTT 2WPLS 4ISNA 1RJXB 1BTWA 2EI7A 3HPTB 4Y76A 3I78A 4AG1A 1FDPA 4H6TA 3H7OA 4K1SA 3LONA 3GCTG 2BX3A 5EODA 5GJ4B 3UUZA 2FWWA 1KLIH 2V3HH 3PMJA 1LCYA 1DXWA 1O3EA 1A7SA 1JMOH 1GJ7B 2PKSC 2ULLA 2ZU1A 3LGUA 1PJPA 4YT7H 2ZDMA 1UVUH 2PW8H 1V6DA 1P3CA 4JZEH 2R0KA 2KAIB 3OSYA 1ZR0A 4X6MA 3A7TA 4RSPA 3A8AA 3RC4A 3PV5A 1K1IA 3ZZ6A 4YESB 2BB4A 2FIRH 1HAPH 2PKAB 3RC6A 1SQTA 4AN7A 1LMWB 4KGAA 1TX8A 1O2RA 2F9UA 2FI3E 3WY8A 3SGAE 4YT6H 4ZROA 1HRTH 1S6FA 1NS3A 3SJIA 1TIOA 3SNDA 4Y0ZE 1RD3B 5EPNA 1O3PB 4GPGA 1PYTD 1QHRB 5DP5A 1SHYA 1C2GA 2ANKH 4I8HA 1C5PA 4AORA 3MH5A 3A81A 4Q7YA 3UNQA 1HJAB 2Z9LA 1NFXA 1C5YB 4B6EA 3B23B 3UY9A 3U9AH 3LJJA 1ID5H 4GCHG 1MCVA 1A3BH 3P92A 1GMDF 3UNSA 1W11U 2B8OH 2BOKA 2ZGJA 4X2YA 1CHGA 1MUEB 1HIAB 3TK5A 3DFJA 1Y3YA 3D62A 4DVAU 4GVUA 3SU6A 1AB9B 4DOQA 4U01A 1HGTH 2PTNA 3A84A 2Y81A 3T26A 2WPJS 4UFDH 1TGNA 1KSNA 2J95A 1XUIA 1FNIA 1N8OC 2GCTB 1SSXA 1RS0A 4OS6A 2R9PA 2XNIA 4JMYA 1SGFG 3SU1A 1NU9A 3S7HB 3M3SA 4ISIH 8KME2 1Z7KA 3BTFE 2SFAA 1O3IA 5IYTA 1W7XH 1UK4A 3E16B 6CHAC 1BZXE 4UE7H 2G52A 1TRMA 2ZFPH 1TNHA 1CO7E 2VIDA 2FOGA 1P06A 3RU4T 1AQ7A 3SZEA 1GBFA 1JOUB 3NUMA 1GJ9B 3C1KA 1C2DA 2BD4A 4FVBA 4OS1A 1CGIE 3S9AA 1INCA 4ABFA 3UQVA 3K9XB 4DIHH 2GMTB 3TGJE 3BTDE 1Y8TA 2ZHDA 4AG2A 4B76A 1ABJH 1LPKB 1P9UA 4R0IA 5LH8A 1ABIH 1K1LA 5SGAE 3SUEA 1YP9A 3RM0H 1FIWA 1L4ZA 3KF2A 2VGCC 4IC5A 1UCYK 1ZHPA 1C1NA 2O8LA 1ELTA 2QXHA 1SG8B 2ZPQA 2A2XH 2WHXA 3MH7A 3SJ8A 3GY5A 2BY9X 1MBMA 4A1XA 1UJ1A 1O35A 3OX7U 5EQSA 2PUQH 2C8ZB 1YYY1 3LPRA 2J92A 1TNLA 1PPZA 4BTTB 4NGAH 5A8XA 1GMHG 4JYTA 3RXIA 3ZVBA 1C2MA 4JZ1A 1PPBH 1UVPA 1F0SA 1MMJN 4AB9A 4ZMAH 4UONA 3GYMA 1GGDC 1UVSH 5DKMA 3VB4A 4RI0A 2D2DA 7KMEH 4IBLH 5DP8A 4AZ2B 7LPRA 1NRRH 1Z8RA 1ZTLA 3FP6E 3VB6A 2P16A 3A7ZA 7GCHF 1BMMH 5FBEA 4IN1A 3KQEA 3SI3H 5L2YH 1GHXH 2GP9B 2OC8A 1TRNA 1D4PB 4Y79A 5T6DA 1FJSA 3SV2H 4WMFA 2BX4A 2V35A 5AHGH 2P3FH 2XRCA 2UWOA 4B71A 1BMAA 1S85A 4Q2KA 4AYYB 5JPMH 2XBYA 1WCZA 1O2UA 2QN5T 2Z6BD 4GHTA 2FDAA 1GMCG 3S69A 1J14A 1BTHH 1NC6A 3VGCB 1GI9B 1TOCB 1YF4A 1OWKA 1ZSKA 1BTPA 4LXBH 3BTME 1ARCA 3KHVA 2ZU5A 5DK1A 4HTCH 3URDA 4CRFA 3UIRA 2A5IA 1ZTKA 1ZJKA 4INHA 1BQYA 1NFYA 5FPYA 2GV6A 3M5OA 2QYIA 1AO5A 1Z8GA 4XBCA 2H5DA 1L1GA 2ZNKH 1GL1A 1VGCB 3RXCA 1KLJH 4IW4E 1CT4E 1T31A 3GDVA 4KELA 1AVWA 1O2VA 3LC5A 4Y71A 4CBOA 2GX4A 5EU8A 1YCPK 2RA3A 4XOJA 3AVZA 3ZZBA 2DE8A 1KXAA 1BOQA 1BBRE 1K28D 1YLCA 4CRBA 3V3MA 1DX5M 1FY8E 3ZVFA 4MPVA 3SGQE 2QA9E 4BTIB 4ABBA 5J4SA 3PO1B 3M5LA 3E0NB 4BTUB 2AEIH 2JH5D 4J2YB 4UFEH 2R0LA 3I29A 5E8EH 1ZMNA 2J2UA 1Z1JA 2XC5A 2STAE 2BD8A 1A5GH 4YOGA 4FUGA 1W0YH 1BMNH 4U2WA 4LZ1H 1J15A 3N7OA 1JXPA 3M5MA 1OX1A 1EJNA 4B74A 3SJKA 1GCTC 1GBJA 3VXEH 2SNVA 4MPUA 2QXJA 3VFEA 9ESTA 1EZUC 3RXLA 1QURH 2ZCLP 1RGQA 3H09A 4RKOB 2QC2A 1WOFA 6GCHF 5LPEA 1PQ8A 3CS7A 3EE0B 2CMYA 3ENSB 2BY7X 4TY7A 2BD9A 4GSOA 5IDKA 1E38B 1PPEE 2WPMS 3M37A 1QB9A 4I7YH 5T1VA 1TE0A 1PPCE 1TWXB 1GJAB 1MZDA 3LH3A 3SNEA 1ZGIA 4IC6A 4CRGA 4ABIA 1C4V2 2HWLB 2K1QA 3RM2H 3A83A 4OS4A 1W13U 4FUEA 4CR5A 3TITA 2GDDA 4CBNA 2GVFA 2WUCA 2PFEA 3NCLA 1A0LA 3RUOA 2WINI 1OPHB 2Q6GA 1CA8B 3QWCH 2A7CA 5DGJA 5DP4A 2VIOA 1O38A 1DT2A 2R3YA 1O3HA 5DP7A 2AIPA 3OY5U 2IOTA 4WMEA 1XX9A 1MCTA 3BTEE 1V2ST 1BMLA 5TJXA 1EATA 1SGTA 3TK6A 3U8RH 1AKSB 1KDQB 2AYWA 1NFWA 2I6SA 2XCNA 1S0QA 3ZVAA 4JK5A 5GWZA 1E0FD 4BANB 2HNTC 4ZXYH 3SN8A 4AFUA 3QZQA 1MTSA 1CBWB 1GBIA 2ZFQH 1EPTC 3RXDA 3Q00A 2ZFFH 4F49A 2BHGA 1EJAA 2BVSH 3MOCA 5FCRA 4ABHA 2A4GA 2ZG0H 2LPRA 3LIWA 2VU8E 1GI7B 1V2WT 2H1UA 2JKHA 1GI6A 3MFJA 1DLKB 3UR9A 2TBSA 1PFXC 1GWAA 4Q7XA 1A4WH 3EDXB 2XWAA 1C1PA 1AWHB 3SU0A 2D1JA 1V2PT 3M35A 1S0RA 1E34B 1SHHB 4GUXA 1BTZA 1C9TA 1QQ4A 1O34A 3HATH 1OYQA 3SNBA 1A5IA 3NXPA 5DP9A 2BLVA 5C1UA 5G4BA 2OINA 3CENA 4X2XA 5ESTE 3A7YA 3P8OA 1HAIH 1P09A 2FP7B 2FXRA 1DE7H 4NWLA 2BDGA 1UTPA 2H9TH 2XBVA 1HNEE 1YKTA 1HBTH 4O97A 1H1BA 2Q6FA 3KCGH 3BTGE 1W2KH 4I8JA 3GCOA 4MVNA 1QL9A 1TGTA 2H2ZA 1LKBA 2VH6A 1DPOA 2NU0E 4YLQH 1QJ7B 1GI4A 1RTFB 3BF6H 1J8AA 1LVOA 2O8UA 2XYAA 3P8FA 2HNTE 1EP6A 2BDIA 2Y82A 2PKSB 3FZDA 1EZXC 3NK8A 4AGKA 2BOHB 1H8DH 1UCYH 1MAXA 1TNKA 1T8LA 1Z8JB 4DCDA 2GTBA 1HAXB 2YNBA 1T8NA 2FOMB 3RP2A 2XW9A 1AU8A 1DUAA 2F91A 3P8GA 2GZ9A 3S9CA 4IGDA 1IQKA 2D8WA 1DWDH 2H9HA 2ZCKP 1GJDB 1NRNH 1Z6JH 3S9BA 4NIYA 1PQAA 1FAKH 2B0FA 4ZHLU 5ETXA 1VCWA 2WUBA 1FY3A 1YPHC 4XBDA 4H4FA 1GJ4H 1BA8B 5TCAA 4O03A 1MAYA 1MQ6A 3RDZA 1K1JA 2C3SA 1TQ7B 2TGTA 5JBTA 3G01A 4WF8A 1V2LT 1A5HA 1SMFE 3HKIB 1C2LA 3E91A 1O2MA 3AAUA 1W8BH 2G8TA 1WTGH 3UWJH 2VBCA 3OU0A 3BN9A 3E6PH 1GBCA 1MZAA 3BIVH 3NPSA 1YM0A 4X8UH 1C1UH 1ELBA 3PTBA 1TA2A 4NA9H 2F9NA 4MNWA 3PMBB 1N6XA 1RTKA 1P2KA 1V2VT 2BDAA 3L3TA 3VXFH 1HYLA 1P9SA 1TPSA 4ABEA 2W5EA 4ZKRU 1TGBA 3AASA 5A0AE 3R0FA 1QBOA 2IPHA 1YCPH 4HGCA 1V2JT 1RTLA 1TGCA 1AVGH 1ELFA 2BTCE 1N8OB 1QB1A 2ZHFH 3BTWE 3LJOA 1NN6A 3TH2H 4UFGH 1K1OA 3MNBA 4X8TH 1GVZA 5GCHG 2ZP0H 1HDTH 1P05A 2ZDLA 1H9HE 3ZYEA 4BAOB 6CHAB 1A0HB 1EAIA 2VWOA 2Y5HA 1A0JA 3BG8A 2ZO3H 1L2EA 1YPHE 2ZDVH 3MH4A 1ANEA 4E06H 1D3DB 2AMQA 3P8NA 2UUKB 4TPIZ 5A8ZA 1WTHD 1AGJA 1Z71A 1GDNA 3T28A 1KXEA 1O3NA 1BRAA 1VCQA 4GAWA 1P01A 3GDUA 1KTSB 1LQEA 4FUHA 5F03A 3U1IB 3EA8A 2GKVE 1V2NT 5F6MA 1G30B 5FBIA 2A32A 8GCHF 5F8XA 2QGRA 1GVKB 1C5TA 5B6OA 1DICA 1NTPA 2OC0A 1BDAA 3P70B 4ZUHA 4LK4A 1O5FH 2BDCA 2VGCB 3PLBA 2STBE 3VPKA 2FYRA 4FUFA 4YOJA 1K22H 1B0EA 3QDZB 1DWEH 3KQDA 4E05H 1HAGE 1O2YA 3CS0A 1RIWB 2O8WA 1P2QA 1DLEA 1ELEE 4FU7A 3W95A 2ZGCA 3LU9B 4FUIA 1GGDB 2ZIQH 2P94A 2Z7FE 3A87A 4A1VA 2OUAA 3RXEA 3FZZA 2W7UA 3SV9A 1MH0A 4TYDA 3RLYH 1O3OA 1QR3E 1FY4A 1NY22 1TLDA 2WPKS 2FPZA 3RXFA 3MO9A 4FUBA 5FPTA 5E2OA 1G9IE 2ODQA 3QO6A 4K3JA 1ZHRA 3SJOA 1O2KA 4MG3A 3ODFA 3LGWA 4OM9A 1WQVH 4DG4A 4WH8A 1SFIA 4BNRA 4UD9H 3A7WA 2TGAA 1O5AB 1SL3A 1TNIA 5C1YA 2P59A 2F9PA 2O8MA 2Y6TA 3STJA 3TJVA 2Z3EA 2ZHQH 1CE5A 1L4DA 2BXUH 3DFLA 2C8YB 3GICB 1TGSZ 2ZDAH 1W14U 4B1TA 3BSQA 1F7ZA 3TGIE 4JZDH 1O3GA 1EAWA 4FU8A 1UVOA 1C1TA 4TY6A 1Y5BT 3FP8E 1ESAA 5EQQA 2ZU3A 2A7HA 4KTSA 2YNAA 2P8OB 1YPEH 4A7IB 4WXIA 4NG9H 3GCTF 2XC4A 3O8DA 3TU7H 1C5VA 2SNWA 3PV2A 1WXRA 2ASUB 3ZVEA 2BY8X 1KDQA 2ESTE 5JBBS 2VIVA 2VVVA 1QGFA 1SGYE 4THNH 5FPSA 3ZZAA 4SGAE 1EZSC 1CVWH 3K6YA 2A0QB 2OBOA 4F4OC 2Z94A 4NFFA 1ZSJA 4D7FA 3ATIA 2OD3B 4Y8ZA 4X2WA 5F8TA 1S83A 2CHAC 1EJMA 1JRTA 1S6HA 2AH4X 2XCFA 1D3PB 1LHGH 2EA3A 4ZHMU 1LVYA 2J9NA 1O2ZA 3MU0A 2ZF0H 3K65B 2AMDA 1GJBB 3TNTA 3RXUA 1Y3VA 1P03A 1GDUA 4ABAA 3AK5A 3GCNA 1ETRH 5C5NA 3T29A 2ZDKA 4O3UA 1DSTA 1VITH 1YCPM 3SQHE 3TJOA 1D3TB 1X7AC 2RCEA 4I8GA 4YO9A 4BAQB 3FP7E 2OP9A 2VB0A 1UCYE 1DWCH 3DA9B 4X0WU 2ANMH 2FZZA 3U8OH 1GJCB 1EOLA 1SQAA 3D49H 1ELDE 3F6UH 3QN7A 2TGPZ 2J34A 1SR5C 1VR1H 3PLKA 3HGNA 2P3UB 1TNJA 4Y7AA 2Q1JA 1AFQC 4GCHF 1HAVA 2BLWA 2NWNA 3P95A 1C4Y2 1TRYA 1C4U2 2ANWA 1AVXA 3F1SB 2BY6X 1DDJA 1O2XA 1MU6B 3EGKH 5HM2A 2PTCE 1GBHA 1ZJDA 1EKBB 2G4UA 4E7RG 1NM6A 1P10A 4ABJA 2XC0A 1G37A 2AERH 1GHZA 1E36B 4XBBA 1EUFA 4E7NA 1A1RA 1AUTC 4JYUH 2VJ1A 1YBWA 2UWPA 1G3BA 2VWLA 3LOXA 3EA9A 1O31A 2OXSA 5GPIB 1RXPA 2BD5A 1M9UA 1DITH 3BEUA 1O3BA 1N1LA 1C1QA 3M3TA 1O5CB 1SFQB 1Y5AT 3FAOA 4K8BA 2J94A 4JYVH 1GI3A 4AFQA 4H42U 2IJD1 1YPMH 9LPRA 4CRDA 3BTKE 1EB1H 1EPTB 2C8XB 1E35B 3ZZ7A 5E0JA 3RMOH 1C1SA 3EA7A 5A8YA 2ZEBA 1ZGVA 1O5DH 3RU4E 1ORFA 1AB9C 1NFUA 1BJVA 3SW2B 1O2PA 2HLCA 3ELAH 4Y0YE 4DURA 1BTYA 1UHBB 1C2EA 1TPPA 1GBLA 2SGQE 1C1WH 1EASA 4AX9H 1GI8B 1BRBE 1QB6A 2BLOA 1TMBH 3BTHE 3PWBA 1SGEE 1TBZH 1GBBA 4TPYA 2PGQB 2PUXB 2J38A 1AUJA 2YOLA 2WPIS 3SOSA 1SLVB 2VH0A 1GMHF 1NRSH 3AW1A 1C2IA 3F68H 4DGJA 3PMAB 5L2ZH 3TNSA 4I8LA 1BB0B 1XMNB 1NT1A 2UUJB 1C5OH 2EI8A 4MTBA 2I6QA 4X1NU 2C4FH 4OGYA 2PHBA 1C5MD 2W26A 1EQ9A 3NZIA 2RA0A 1BUIA 1NRQH 3A80A 3GY4A 2GCHG 3LT3A 5FX6A 4J1YA 3SZNA 2FOCA 3QTVH 1CGHA 1W0ZU 1HAHH 1OSSA 2JH6D 4ESTE 2EI6A 1S5SA 1UTNA 2V0BA 2ZGBH 4OS2A 3EQ0H 1U6QA 1NZQH 2CXVA 4X6NA 3GY2A 1V2QT 5B6LA 1UK3A 1SPJA 3UWIA 4AOQA 1V2KT 3BEFB 1NROH 1TBRH 3PWCA 1C5ZB 1GMCF 3TJNA 1IQEA 3GCHB 4K1EA 4AYVB 4MPXA 1F5KU 2GT7A 3HK3B 3QGNB 1QA0A 4OS7A 4B73A 2C8WB 4AB8A 1LTOA 1EX3A 3PV4A 4NIXA 2FX4A 2R2MB 4D7GA 1XVOA 3ATMA 3U8TH 1VJ9U 2CV3A 1K1MA 2BDBA 3PM3A 1KXBA 4WMDA 1CHOG 1G3CA 1GBTA 1QJ1B 2OCVB 3TVJB 3PLPA 1HPGA 3MTYA 1G2MA 3SU5A 1IQFA 1FPHH 2KAIA 2OC7A 1SGRE 4AFSA 2G55A 4UFFH 3M3VA 1UMAH 5GDSH 3I77A 1QJ6B 1O2GH 3M61U 3VB5A 1YPLH 1HUTH 3JZ1B 2VWMA 2TIOA 5C20A 1CQQA 4U32A 1WQSA 1EOJA 1T32A 1TMTH 7ESTE 1THRH 2PKAA 1O36A 5EGMA 1O2TA 5EPYA 1O32A 2A4OA 1VCPA 1XKBC 5FHTA 1G32B 1LPGB 3FFGA 4X6OA 1LVMA 2A31A 2VINA 1ZLRA 3OYPA 4ISLA 3E90B 4NA8A 1DSUA 1MKXK 3KNXA 4NFEA 4B6FA 1K2I1 2P95A 1ZMLA 1SGPE 1VITG 1P04A 1LKAA 1D9IA 3MMGA 3DUXH 4VGCC 3SU4A 1HAOH 2OLGA 3ZVDA 1ZZZA 2BD2A 1WUNH 1V2RT 2UUFB 2GDEH 3HKJB 1AE8H 4X8VH 4YOIA 2FS8A 1ZTJA 1FQ3A 2VVUA 3T27A 3UOPA 1CT0E 4JZFH 2VIWA 1ZMJA 2WYJA 1SGDE 1PQ7A 1GL0E 4Y10E 1SBWA 5C5OA 4FXGH 2V3OH 4LOYH 3RXSA 2G51A 1GHAG 2F3CE 3ZVCA 1GJ8B 3GYLB 1IQIA 4IN2A 5L6NH 5E0GA 1HIAA 1P12E 2PV9B 2RDLA 3IITA 3SNAA 6ESTA 3LKWA 1HV7A 2FS9A 1W12U 5LPFA 1PPFE 1THSH 2Y7XA 1D6RA 2Z9IA 1G2LA 4XE4A 3H5CB 5LGOA 1Q2WA 1MKWK 3QUMP 3KEEA 1ESBA 1F92A 3RLWH 3RXTA 3ZZ8A 2H6MA 2ALVA 1O5BB 1UTOA 2M5TA 1AWFH 1NU7B 1OP8A 3QK1A 4DIIH 1DXPA 5HXFA 5LPRA 3W94A 3ODDA 4TWWA 3ZZCA 2F83A 4A1TA 1ELCA 2AS9A 3SUGA 5ABWA 3TLOA 1DANH 1O33A 1UTLM 5H4IB 1P3EA 4AFZA 1A2CH 1YGCH 4NIVA 2AGEX 1MU8B 1XXFA 3NKKA 2OQUA 1D6WA 3T62A 1YPGH 4IMQA 3LGVA 1W10U 2H9EH 2G81E 4ZXXH 2CN0H 1THPB 4ABGA 4NSVA 1GHBG 3GDSA 1FAXA 1P2IA 4D8NA 3F9GA 1V2UT 1FPCH 2WPHS 3KQBA 4WH6A 4CHAC 4H6SB 1AE5A 1G36A 1O3LA 3DD2H 2XWBI 3RXGA 1V2MT 2F9OA 4K5ZA 1NRPH 1P2JA 2A5KA 3ATWA 3MYWA 1OWIA 3BTTE 2PWXA 4WJG2 1EB2A 1P0SH 2QY0B 5GXPA 3C27B 1T4VH 1Q3XA 1FMGA 1GHYH 1C5WB 4SGBE 1ELAA 2XBXA 3RMLH 2BQ7B 2W3KA 2XXLA 1C5NH 4FUCA 1IHSH 3P17H 3KGPA 2HNTF 1XKAC 1UTKA 2NU3E 2BZAA 3IWMA 1IQGA 2LNCA 1AY6H 1QRXA 3T25A 2AMPA 2HALA 2B7DH 4O9VA 1CA0C 1WAYB 2Z3DA 3KN2A 4ISHH 1FZZA 3P6ZB 3FVFB 1HCGA 4JZIA 4D9QA 3PB1E 8LPRA 3RXQA 2ZPSA 1SLXB 4BXWA 4ABDA 2ILNA 1IAUA 1RRKA 5C3NA 2AFQB 2JETC 3PYHA 5DP6A 1XUGA 3ESTA 1FY1A 5JBAS 2PGBB 3OY6U 3MU8A 1TX7A 4I33A 1O30A 1TOMH 5AVDA 4NZLA 5A2MH 1MTNC 1CSOE 2FMJA 4ZAEA 2ZZUH 1FY5A 1KTTB 3RXPA 2RG3A 3UPEA 2Q6DA 5CHAC 3U69H 2O8TA 1V2OT 4FUJA 4B2CA 2IN2A 2OQ5A 1GBDA 5GIBA 1B5GH 1AFEH 3D65E 1C1MA 3ATKA 5FAHA 1WV7H 2ZFSA 3DT0H 2ODYB 4CH8B 1QL7A 1HAYB 1DWBH 3SI4H 2Y5GA 3EAJA 1GMDG 3F9FA 5E2PA 2A5AA 1B0FA 2ZWLH 1O2OA 5FX5A 1EAXA 1H8IH 1ESTA 1MD8A 2ZPRA 1GCDA 1BHXB 3Q3KA 1SOZA 4JCNA 5J4QA 4WVPE 1T7CA 3H7TA 2PR3A 3RXAA 4ASHA 1F0TA 1CGJE 2FODA 4ZH8A 4O3TA 1GBAA 5PTPA 4DY7B 1XM1A 1NO9H 4WY3A 3D23A 1T4UH 2IJOB 4ZKOU 1Y59T 1K9OE 4XFQA 4HZHA 2FLBH 1Z6EA 2Y5FA 1EXFA 1TFXA 1SVPA 2NU2E 4Y6DA 1ETSH 3RXMA 1AFQB 1SQOA 2QAAA 1C5RA 1HFDA 1SOTA 2G00A 2NU1E 3SNCA 1FV9A 3SUFA 3URCA 1OXGA 1O3CA 3A85A 4NWKA 1GG6C 4UEHH 2HRVA 2DE9A 3MI4A 1TBQH 2AIQA 4HI3A 4A5TS 1O3MA 5HGGA 1GBMA 1C1VH 3UOUA 2ZU2A 5A0CA 1ZPZA 2QIQA 1J17T 1OWEA 1QBVH 1FONA 2FI4E 4MLFB 1SLUB 5CE1A 2BYAX 4FUDA 1YLDA 3L33A 1TPAE 2FOHA 1WSSH 4I8KA 3S7KB 3BTQE 3ITIA 5GCHF 2BXTH 1NPMA 1KXFA 1LHFH 1OKXA 4BAHB 2TRMA 2G4TA 3RXJA 1O3DA 1Y3XA 1ZRKA 3BG4C 1C5LH 2ZHWH 4FVDA 2A4QA 5JYIA 2Z9KA 2HOBA 3MNSA 5DG6A 1OOKB 1KXDA 4D76A 1MKXH 3OTJE 4BOHA 2VNTA 3KL6A 1C1RA 4FU9A 5I25A 3ZVGA 5EW1H 3SO3A 4KKDA 3RU4D 3SYJA 2F4LA 2W7SA 1AKSA 2BM2A 4Q80A 3M7QA 4DT7B 2ZKSA 2B5TB 3K2UA 7GCHG 4ZKNU 3GISB 4I31A 4NIWA 4CRCA 2ZFRH 3HGPA 2AGGX 3TH4H 1OWJA 1O37A 1FN8A 2FYQA 4MNVA 3LC3A 1ZOMA 1IQJA 2UUYA 1EAUA 3EYDA 5AF9H 2VIQA 4D9RA 1S81A 3A8BA 5EOKA 2PLXA 3SJ9A 2Z3CA 3RMMH 1HJ8A 4BAKB 1PYTC 4I32A 4INKA 1MTUA 5T3HA 3OTPA 4XSKU 1SI5H 1FI8A 2QXIA 1MKWH 2ANYA 4A6LA 5L30H 1GCTB 3BV9B 1XVMA 2G5NA 1UO6A 3SGBE 3T5FH 4K60A 3A88A 1BT7A 1GVLA 3GOVB 1P2NA 1ZYOA 1P8VC 2J4IA 1XXDA 3QTOH 1O3JA 3KIDU 1J16A 3GY3A 1P2OA 4B2BA 2ALPA 3AAVA 1QQUA 1ELVA 1VJAU 2ZDNA 5HYOA 1C1OA 3Q3YA 4HFPB 3RXKA 2FOFA 5EQRA 1AN1E 1DM4B 1AIXH 1QBNA 1QRZA 5E0HA 2WZQA 2BZ6H 2FTLE 3QX5H 5T6GA 3VEQB 3KQCA 3MWIU 1O2HA 1L1NA 1YPKH 1GHWH 1BTUA 1HLTH 1TONA 4Z6AH 5F8ZA 2ZECA 1RIWC 2DUCA 4YLUA 3UQOA 1TB6H 1Y3WA 2FO9A 1O2QA 3RXBA 3Q77A 1IQNA 1LHCH 2FTMA 3RXHA 5JBCS 2QXGA 5FXLA 1IOEA 1GI0A 1O2LA 3GY7A 2BMGB 3SUDA 4ZHAA 1GJ5H 3M7TA 1PPHE 2SGPE 1AZ8A 3TJUA 4X1QU 1OP0A 4MDSA 4KP0A 4K8YA 4ISOA 1JIMA 1XUJA 2A7JA 1O39A 6GCHG 1HJAC 2BY5X 3HK6B 4UDWH 2F9BH 1QNJA 2GT8A 3VB7A 5C1XA 1SGNE 1BRUP 1MTVA 1W3CA 3V13A 2ZHEH 5CMXH 1AMHA 1TNGA 2HGTH 4X1RU 2EEKA 3ZZ3A 3K6ZA 1MBQA 2BDYA 3LH1A 4IS5A 4YTAA 1QIXB 2BDHA 3PROA 1HXEH 1L1JA 1BITA 1Z8IB 2O9QA 3BEIB 1JRSA 4CR9A 4XDEA 1Z1IA 2BD7A 1TALA 3LGYA 5C2ZA 1NESE 1ZHMA 4VGCB 5ESBA 2SGFE 3RMNH 4CH2B 3UNRA 3V12A 5GNDA 2QV1A 2P8OC 3MU5A 1EP5A 5EW2H 1DUEA 2V6NA 3NWUA 2GCTC 3MO3A 4MNYA 1TA6A 1BBRK 2QF3A 4Y8YA 3S0NA 2FX6A 3O8BA 3MO6A 2W3IA 1SGFA 2FESH 1QCPA 2FOAA 1V3XA 4NA7A 1BHXF 4KTUA 3TIUA 2JH0D 5AFZH 2ZTXA 5HM9A 1H9LB 3MNCA 1OP2A 1FLEE 2ZGXH 4Z0KA 4MPWA 6LPRA 1A46H 1JBUH 2NU4E 3IG6B 1UTMA 2ZQ2A 1DOJA 4K1TA 1SGIB 1UVTH 1PQ5A 2ZFTA 1AI8H 2BLQA 2TGDA 1GDQA 1KIGH 2GMTC 2WYGA 3LDXH 2WV5A 1OS8A 3M36A 3U98H 3T2NA 3V0XA 1L0ZA 4M7GA 1UTQA 3QLPH 3LGIA 4PROA 2OC1A 3MU4A 1LHDH 2BVRH 1QY6A 3GY6A 1G3DA 2FI5E 3AW0A 4B2AA 3E3TA 1MTWA 1SGQE 2GV7A 2Y7ZA 3ZZ9A 2BD3A 2H5CA 1P57B 1IQLA 1DY8A 1BRCE 1QL8A 4CHAB 4INLA 3B8JA 2ZU4A 1WU1A 1C2HA 2FLRH 2D26C 1P2MA 2ZTZA 1ANBA 3STIA 3MU1A 3A86A 2XBWA 5EG4A 4RN6A 4X1PU 2ZI2H 1HAZB 4YZUA 1TQ0B 1ZSLA 1O2WA 1UK2A 5BPEA 3DHKH 2Y80A 4X2VA 1O2IA 3TK9A 2FM2A 1GJ6A 5AFYH 4CRAA 5FCKA 2VWNA 2TPIZ 2CJIA 5DJ7A 1K1PA 1CT2E 2VVCA 1H4WA 3CP7A 4Q7ZA 1W7GH 1ACBE 3F9EA 1GPZA 3VGCC 1ELGA 3RXRA 1KY9A 1MD7A 2ZGHA 3M7UA 3E0PB 3SORA 1PPGE 1CA0B 1ANDA 1O3KA 1TMUH 1CU1A 1GI1A 2ZCHP 1QTFA 3BIUH 2GZ8A 4KTCA 1EZQA 1KYNA 1C5UA 2GZ7A 1F5LA 2BQWB 5TCCA 1XUFA 1GBEA 4TWYA 1E37B 1VGCC 5BRRE 1GBKA 4BXSA 5DO4H 2GCHF 4LZ4B 4A92A 1Q31A 1UTJA 2JETB 2SGDE 4DJZB 3SQEE 2OTVA 2GD4B 2XTTB 4Y7BA 2P3TB 3SHCH 1FUJA 3F9HA 1C2FA 1LQDB 3A8CA 3UFAA 4CREA 2AGIX 2EC9H 1MTNB 1IQHA 3PO1C 1AHTH 1O0DH 4JK6A 1QFKH 3ZZ5A 5CHAB 1F0UA 3RC5A 4ZKSU 1O5GH 5JB9S 4K69A 5JDUB 2ZA5A 3L6PA 1J9CH 2ZC9H 1JIRA 1GHVH 1ZPCA 2ODPA 2OK5A 3SV6A 4RKJB 2ZQ1A 1ZPBA 1TPOA 2FOBA 4QT8C 3O8RA 4DW2U 1C5QA 2BQ6B 1MQ5A 3SV7A 1CHOF 1HB0B 3UREA 2HPQH 3A89A 3Q3XA 4AGJA 3ZZDA 1DVAH 3JZ2B 4NZQA 4X1SU 1TX6A 1S84A 1HJ9A 1ZRBA 1F5RA 2FEQH 1WYKA 1Y5UT 1F0RA 1YC0A 4OGXA 5JB8S 2HPPH 4GHQA 1TYNA 2SGEE 1QRWA 1AZZA 1OWDA 1K21H 1HAVB 1LHEH 1TAWA 2G5VA 1WBGB 1AD8H 1TABE 4NSYA 2Z9GA 1LO6A 3ZYDA 1ETTH 5DPAA 2VIPA 2SGAA 3SHAH 4B75A 3A82A 1KXCA 1C2JA 1BJUA 3PTNA 5I46H 1KLTA 1FIZA 1XUHA 3GCHC 3SV8A 2P93A 2B9LA 2F9VA 4MQAA 1BCUH 1BTXA 1ANCA 3U1JB 5EXMA 8ESTE 2Z9JA 2PSXA 1XUKA 2ZTYA 1VITF 2A4RA 1O5EH 1ARBA 3ZV9A 3MH6A 4NCYA 1A61H 2WV4A
chains in the Genus database with same CATH superfamily
1GG6B 1N6YA 3Q76A 3KYFA 2A45B 1K1NA 3O8CA 1S82A 4GLYA 8GCHG 3FANA 1O2NA 1BIOA 1GHAF 2FOEA 1FN6A 3LGTA 1SC8U 3VB3A 1YPJH 3R3GB 5EXLA 3QGJA 4WWYA 4Y11E 2PSYA 4M9FA 1RFNA 1VZQH 2A2QH 2CGAA 2QCYA 1V2TT 1C9PA 2C90B 2A1DB 4OS5A 1T8OA 2XNDD 3A8DA 5A09A 1GI2A 1A3EH 1C2KA 4R8TB 1B7XB 2C93B 3RXVA 2R3UA 1O3FA 1C5XB 3ZZ4A 1CBWC 3BG4B 1IHTH 3TGKE 1DY9A 4K2YA 1QA7A 1SLWB 2UWLA 1SB1H 5DP3A 3SU3A 1OYTH 5EXNA 5HMAA 3E1XB 4X6PA 1H9IE 1C5SA 1O2SA 1O3AA 2WV9A 3UTUH 4X8SH 5T6FA 4IMZA 1F2SE 1OWHA 2R2WU 2CF8H 3E8LA 3RXOA 4MNXA 2BVXH 2YMSD 5EJLA 3MHWU 5A0BA 2QF0A 2OBQA 3QZRA 1LVBA 2HVXA 3M5NA 3A7VA 1G3EA 1T8MA 4Y8XA 1P11E 1EPTA 3GY8A 1GI5A 1DS2E 4BAMB 1GHBF 1BBRH 1FXYA 5K0HA 5K7RA 3PMHB 4WXVA 3SU2A 2CHAB 4U30A 3V7TA 1HXFH 3TPIZ 1LPZB 1O2JA 1SGCA 1P02A 2CF9H 4YM9A 1JWTA 3SBKA 3TH3H 1UHBA 2THFB 3B9FH 5C67A 1Y3UA 3UR6A 3A7XA 1DFPA 1IQMA 3ZV8A 3MNXA 1D3QB 2GGVB 3ATLA 1LDTT 4ACAA 2WPLS 4ISNA 1RJXB 1BTWA 2EI7A 3HPTB 4Y76A 3I78A 4AG1A 1FDPA 4H6TA 3H7OA 4K1SA 3LONA 3GCTG 2BX3A 5EODA 5GJ4B 3UUZA 2FWWA 1KLIH 2V3HH 3PMJA 1LCYA 1DXWA 1O3EA 1A7SA 1JMOH 1GJ7B 2PKSC 2ULLA 2ZU1A 3LGUA 1PJPA 4YT7H 2ZDMA 2WSSD 1UVUH 2PW8H 3FKSD 1V6DA 1P3CA 4JZEH 2R0KA 2KAIB 3OSYA 1ZR0A 2HLDD 4X6MA 3A7TA 4RSPA 3A8AA 3RC4A 3PV5A 1K1IA 3ZZ6A 4YESB 2BB4A 2FIRH 2KZ4A 2PKAB 3RC6A 1HAPH 1SQTA 4AN7A 1LMWB 4KGAA 1TX8A 1O2RA 2F9UA 2FI3E 3WY8A 3SGAE 4YT6H 4ZROA 1HRTH 1S6FA 1NS3A 3SJIA 1TIOA 3SNDA 4Y0ZE 1RD3B 1YY3A 5EPNA 1O3PB 4GPGA 1PYTD 1QHRB 5DP5A 1SHYA 1C2GA 2ANKH 4I8HA 1C5PA 4AORA 3MH5A 3A81A 4Q7YA 3UNQA 1HJAB 2Z9LA 1NFXA 1C5YB 4B6EA 3B23B 3UAIC 3UY9A 3U9AH 2KCAA 3LJJA 1ID5H 4GCHG 1MCVA 1A3BH 3P92A 1GMDF 3UNSA 1W11U 2B8OH 2BOKA 2ZGJA 4X2YA 1CHGA 1MUEB 1HIAB 3TK5A 3DFJA 1Y3YA 3DSPA 3D62A 4DVAU 4AC9A 4GVUA 3SU6A 1AB9B 4DOQA 4U01A 1HGTH 2PTNA 3A84A 2Y81A 3T26A 2WPJS 4UFDH 1TGNA 1KSNA 2J95A 1XUIA 1FNIA 1N8OC 2GCTB 1SSXA 1RS0A 4OS6A 2R9PA 2XNIA 4JMYA 5CDFE 1SGFG 3SU1A 1NU9A 3S7HB 3M3SA 4ISIH 8KME2 1Z7KA 3BTFE 2SFAA 1O3IA 5IYTA 1W7XH 1UK4A 3E16B 6CHAC 1BZXE 4UE7H 2G52A 1TRMA 2ZFPH 1TNHA 1CO7E 2VIDA 2FOGA 1P06A 3RU4T 1AQ7A 3SZEA 1GBFA 1JOUB 3NUMA 1GJ9B 3C1KA 1C2DA 2BD4A 4FVBA 4OS1A 1CGIE 3S9AA 1INCA 4ABFA 3UQVA 3K9XB 1H8HD 1QZ8A 3OEED 4DIHH 2GMTB 3TGJE 3BTDE 1Y8TA 2ZHDA 4AG2A 4B76A 1ABJH 1LPKB 1P9UA 4R0IA 5LH8A 1ABIH 1K1LA 5SGAE 3SUEA 1YP9A 3RM0H 1FIWA 1L4ZA 3KF2A 3KYGA 2VGCC 4IC5A 5DSFA 1UCYK 1ZHPA 1C1NA 2O8LA 1ELTA 2QXHA 1SG8B 2ZPQA 2A2XH 2WHXA 3MH7A 3SJ8A 3GY5A 4Z1MD 2BY9X 1MBMA 4A1XA 1UJ1A 2GJGA 1KMHB 1O35A 3OX7U 5EQSA 2PUQH 2C8ZB 2KX4A 1YYY1 3LPRA 2J92A 1TNLA 1PPZA 4BTTB 4NGAH 5A8XA 1GMHG 4JYTA 3RXIA 3ZVBA 1C2MA 4JZ1A 1PPBH 1UVPA 1F0SA 1MMJN 1SKYE 4AB9A 4UONA 3GYMA 4ZMAH 1GGDC 1UVSH 1H8ED 5DKMA 5C0TA 4RI0A 3VB4A 1WDIA 2D2DA 3N7EA 7KMEH 4IBLH 5DP8A 4AZ2B 7LPRA 1NRRH 1Z8RA 1ZTLA 3FP6E 3VB6A 2P16A 3A7ZA 4Q4LA 7GCHF 1BMMH 5FBEA 1MABB 3KQEA 4IN1A 3SI3H 1GHXH 2GP9B 2OC8A 1TRNA 5L2YH 1D4PB 4Y79A 5T6DA 1FJSA 3SV2H 4WMFA 2BX4A 2V35A 5AHGH 1K0HA 2P3FH 2XRCA 2UWOA 4B71A 1BMAA 1S85A 4Q2KA 4AYYB 5JPMH 2XBYA 1WCZA 1O2UA 2QN5T 2Z6BD 4GHTA 2FDAA 1GMCG 3S69A 1J14A 1BTHH 1NC6A 1E1RD 3VGCB 1GI9B 1TOCB 1YF4A 1OWKA 1ZSKA 1BTPA 4LXBH 3BTME 1ARCA 4HG6A 3KHVA 2ZU5A 5DK1A 4HTCH 3URDA 4CRFA 3UIRA 2A5IA 1ZTKA 1ZJKA 4INHA 1BQYA 1NFYA 5FPYA 2GV6A 3M5OA 2QYIA 1AO5A 1Z8GA 4XBCA 2H5DA 1L1GA 2ZNKH 1GL1A 1VGCB 3RXCA 1KLJH 4IW4E 1CT4E 1T31A 3GDVA 4KELA 1AVWA 1O2VA 3LC5A 4Y71A 4CBOA 2GX4A 2W6ID 5EU8A 1YCPK 2RA3A 4XOJA 3AVZA 3ZZBA 2DE8A 1KXAA 1BOQA 1BBRE 1K28D 1YLCA 4CRBA 3V3MA 1DX5M 1FY8E 3ZVFA 4MPVA 3SGQE 2QA9E 4BTIB 4ABBA 5J4SA 3PO1B 3M5LA 3E0NB 4BTUB 2AEIH 2JH5D 4J2YB 4UFEH 2R0LA 3I29A 5E8EH 1ZMNA 2J2UA 1Z1JA 2XC5A 2STAE 2BD8A 1A5GH 4YOGA 4FUGA 2W6JD 1W0YH 1BMNH 4U2WA 4LZ1H 1J15A 3N7OA 1JXPA 3M5MA 1OX1A 1EJNA 2PP6A 4B74A 3SJKA 1GCTC 1GBJA 3VXEH 2SNVA 4MPUA 2QXJA 3VFEA 3ZIAD 9ESTA 5EJ1A 1EZUC 3RXLA 1QURH 3F2FA 2ZCLP 1RGQA 3H09A 4RKOB 2QC2A 1WOFA 2KM0A 6GCHF 5LPEA 1PQ8A 3CS7A 3EE0B 2CMYA 3ENSB 2BY7X 4TY7A 2BD9A 4GSOA 5IDKA 1E38B 1PPEE 2WPMS 3M37A 1QB9A 4I7YH 5T1VA 1TE0A 1PPCE 1TWXB 1GJAB 1MZDA 3LH3A 3SNEA 1ZGIA 4IC6A 4CRGA 4ABIA 1C4V2 2QF4A 2HWLB 2K0QA 2K1QA 3RM2H 2EQNA 3A83A 4OS4A 1W13U 4FUEA 4CR5A 3TITA 2GDDA 4CBNA 2GVFA 2WUCA 4I86A 2PFEA 3NCLA 1A0LA 3RUOA 2WINI 1OPHB 2Q6GA 1CA8B 3QWCH 2A7CA 5DGJA 5DP4A 2VIOA 1O38A 1DT2A 2R3YA 1O3HA 2WPDD 5DP7A 2AIPA 3OY5U 2IOTA 1FX0B 1XX9A 4WMEA 1MCTA 3BTEE 1V2ST 1BMLA 5TJXA 1EATA 1SGTA 3TK6A 3U8RH 1AKSB 1KDQB 2AYWA 1NFWA 2I6SA 2XCNA 1S0QA 3ZVAA 4JK5A 5GWZA 1E0FD 4BANB 2HNTC 4ZXYH 3SN8A 4AFUA 3QZQA 1MTSA 1CBWB 1GBIA 2ZFQH 1EPTC 3RXDA 3Q00A 2ZFFH 4F49A 2BHGA 1EJAA 2BVSH 3MOCA 5FCRA 4ABHA 2A4GA 5EIYA 2ZG0H 2LPRA 3LIWA 2VU8E 1GI7B 1V2WT 2H1UA 2JKHA 1GI6A 3MFJA 1DLKB 3UR9A 2TBSA 1PFXC 1GWAA 4Q7XA 1A4WH 3EDXB 2XWAA 1C1PA 1AWHB 3SU0A 2D1JA 1V2PT 3M35A 1S0RA 1E34B 1SHHB 4GUXA 1BTZA 1C9TA 1QQ4A 1O34A 3HATH 1NBME 1OYQA 3SNBA 1A5IA 3NXPA 5DP9A 2BLVA 5C1UA 5G4BA 2KFWA 2OINA 3CENA 4X2XA 5ESTE 3A7YA 3P8OA 1EFRD 1HAIH 1P09A 2FP7B 2FXRA 1DE7H 4NWLA 2BDGA 1UTPA 2H9TH 2XBVA 1HNEE 1YKTA 1HBTH 3N99A 4O97A 4TSFD 1H1BA 2Q6FA 3KCGH 3BTGE 1W2KH 4I8JA 3GCOA 4MVNA 1QL9A 1TGTA 2H2ZA 1LKBA 2VH6A 1DPOA 2NU0E 4YLQH 1QJ7B 1GI4A 1RTFB 3BF6H 1J8AA 1LVOA 2O8UA 2XYAA 3P8FA 2HNTE 1EP6A 2BDIA 2Y82A 2PKSB 3FZDA 1EZXC 3NK8A 4YXWD 5HIZA 4AGKA 2BOHB 1H8DH 1UCYH 1MAXA 1TNKA 2V3MA 1T8LA 1Z8JB 4DCDA 2GTBA 1HAXB 2YNBA 3WWBA 1T8NA 2FOMB 4XRNA 3RP2A 3DSOA 2XW9A 1AU8A 1DUAA 2F91A 3P8GA 2GZ9A 3S9CA 4IGDA 1IQKA 2D8WA 3NRLA 1DWDH 2H9HA 2ZCKP 1GJDB 1NRNH 1Z6JH 2KCOA 3S9BA 4NIYA 1YWUA 1PQAA 1FAKH 2B0FA 4ZHLU 5ETXA 1VCWA 2WUBA 1FY3A 1YPHC 4XBDA 4H4FA 1GJ4H 1BA8B 5TCAA 4O03A 1MAYA 1MQ6A 3RDZA 1K1JA 2C3SA 1TQ7B 2TGTA 3FO8D 5JBTA 3G01A 4WF8A 5F53A 1V2LT 1A5HA 1SMFE 3HKIB 1C2LA 3E91A 1O2MA 3AAUA 1W8BH 2G8TA 1WTGH 3UWJH 2VBCA 3OU0A 3BN9A 3E6PH 1GBCA 1MZAA 3BIVH 3NPSA 1YM0A 4X8UH 1C1UH 1ELBA 3PTBA 1TA2A 4NA9H 2F9NA 4MNWA 3PMBB 1N6XA 1RTKA 1P2KA 1V2VT 2BDAA 3L3TA 3VXFH 1HYLA 1P9SA 1TPSA 4ABEA 2W5EA 4ZKRU 1TGBA 3AASA 3F0OA 5A0AE 3R0FA 1QBOA 2IPHA 1YCPH 4HGCA 1V2JT 1RTLA 1TGCA 1AVGH 1ELFA 2BTCE 1N8OB 1QB1A 2ZHFH 3BTWE 3LJOA 1NN6A 3TH2H 4UFGH 1K1OA 3MNBA 4X8TH 1GVZA 5GCHG 2ZP0H 1HDTH 1P05A 2ZDLA 1H9HE 3ZYEA 4BAOB 6CHAB 1A0HB 1EAIA 2VWOA 2Y5HA 1A0JA 3BG8A 2ZO3H 1L2EA 1YPHE 2ZDVH 3MH4A 1ANEA 4E06H 1D3DB 2AMQA 3UB0A 3P8NA 2KR7A 2UUKB 4TPIZ 5A8ZA 1WTHD 1AGJA 1Z71A 1GDNA 3T28A 1KXEA 3W1EA 1O3NA 1BRAA 1VCQA 4GAWA 1P01A 3GDUA 1KTSB 1LQEA 4FUHA 5F03A 3U1IB 2J98A 3EA8A 2GKVE 1V2NT 5F6MA 1G30B 5FBIA 2A32A 8GCHF 5F8XA 2QGRA 1GVKB 1C5TA 5B6OA 1E1QD 1DICA 1NTPA 2OC0A 1BDAA 3P70B 4ZUHA 4LK4A 3MQKC 1O5FH 2BDCA 2VGCB 3PLBA 2STBE 3VPKA 2FYRA 4FUFA 4YOJA 1K22H 1B0EA 3QDZB 1DWEH 3KQDA 4E05H 1HAGE 1O2YA 3FOAA 3CS0A 1RIWB 2O8WA 1P2QA 1DLEA 1ELEE 4FU7A 3W95A 2ZGCA 3LU9B 2YMSC 4FUIA 1GGDB 2ZIQH 2P94A 2Z7FE 3A87A 4A1VA 2OUAA 3RXEA 3FZZA 2W7UA 3SV9A 1MH0A 4TYDA 3RLYH 1O3OA 1QR3E 1FY4A 1NY22 1TLDA 2WPKS 2FPZA 3RXFA 3MO9A 4FUBA 5FPTA 5E2OA 5KEDA 1G9IE 2ODQA 3QO6A 4K3JA 1ZHRA 3SJOA 1O2KA 4MG3A 3ODFA 3LGWA 4OM9A 1WQVH 4DG4A 4WH8A 1SFIA 4BNRA 4UD9H 3A7WA 2TGAA 1O5AB 1SL3A 1TNIA 5C1YA 2F43B 2P59A 2F9PA 2O8MA 2Y6TA 3STJA 3TJVA 2Z3EA 2ZHQH 2AHME 1CE5A 1L4DA 2BXUH 3DFLA 2C8YB 3GICB 1TGSZ 2ZDAH 1W14U 4B1TA 3BSQA 1F7ZA 3TGIE 4JZDH 1O3GA 1EAWA 4FU8A 1UVOA 1C1TA 4TY6A 1Y5BT 3FP8E 1ESAA 5EQQA 2ZU3A 2A7HA 4KTSA 2YNAA 2P8OB 1YPEH 4A7IB 4WXIA 4NG9H 3GCTF 2XC4A 3O8DA 3TU7H 5KECA 1C5VA 2SNWA 3PV2A 1WXRA 2ASUB 3ZVEA 2BY8X 1KDQA 2ESTE 5JBBS 2VIVA 2VVVA 1QGFA 1SGYE 4THNH 5FPSA 1OHHD 3ZZAA 4SGAE 5HIYA 1EZSC 1CVWH 3K6YA 2A0QB 2OBOA 2M2AA 4F4OC 2Z94A 4NFFA 1ZSJA 4D7FA 3ATIA 2OD3B 3FN8A 4Y8ZA 4X2WA 5F8TA 1S83A 2CHAC 1EJMA 1JRTA 1S6HA 2AH4X 2XCFA 1D3PB 1LHGH 2EA3A 4ZHMU 1LVYA 2J9NA 1O2ZA 3MU0A 2ZF0H 3K65B 2AMDA 1GJBB 3TNTA 3RXUA 1Y3VA 1P03A 1GDUA 4ABAA 3AK5A 3GCNA 1ETRH 5C5NA 3T29A 2ZDKA 4O3UA 1DSTA 1VITH 1YCPM 3SQHE 3TJOA 1D3TB 1X7AC 2RCEA 4I8GA 4YO9A 4BAQB 3FP7E 2QF5A 2OP9A 2VB0A 1UCYE 1DWCH 3DA9B 5C0UA 4X0WU 2ANMH 2FZZA 3U8OH 1GJCB 1EOLA 1SQAA 3D49H 1ELDE 3F6UH 3QN7A 2TGPZ 2J34A 1SR5C 1VR1H 3PLKA 3KQ5A 3HGNA 2P3UB 1TNJA 4Y7AA 2Q1JA 1AFQC 4GCHF 1HAVA 2BLWA 2NWNA 3P95A 1C4Y2 1TRYA 1C4U2 2ANWA 1AVXA 2LP6A 2BY6X 1DDJA 3F1SB 1O2XA 1MU6B 3EGKH 5HM2A 2PTCE 1GBHA 1ZJDA 1EKBB 2G4UA 4E7RG 1NM6A 1P10A 4ABJA 2XC0A 1G37A 2AERH 3F2HA 1GHZA 1E36B 4XBBA 1EUFA 4E7NA 1A1RA 1AUTC 4JYUH 2VJ1A 1YBWA 2UWPA 1G3BA 2VWLA 3LOXA 3EA9A 1O31A 2OXSA 5GPIB 1RXPA 5EJZA 2BD5A 1M9UA 1DITH 3BEUA 1O3BA 1N1LA 1C1QA 3M3TA 1O5CB 1SFQB 1Y5AT 3FAOA 4K8BA 2J94A 4JYVH 1E79D 1GI3A 4AFQA 4H42U 2IJD1 1YPMH 9LPRA 4CRDA 3BTKE 1EB1H 1EPTB 2C8XB 1E35B 3ZZ7A 5E0JA 3RMOH 1C1SA 1W0KD 3EA7A 5A8YA 2ZEBA 1ZGVA 1O5DH 3RU4E 1ORFA 1AB9C 1NFUA 1BJVA 3SW2B 1O2PA 4TT3D 2HLCA 3ELAH 4RT1A 4Y0YE 4DURA 1BTYA 1UHBB 1C2EA 1TPPA 1GBLA 2SGQE 1C1WH 1EASA 4AX9H 1GI8B 1BRBE 1QB6A 2BLOA 1TMBH 2HVYB 3BTHE 3PWBA 1SGEE 1TBZH 1GBBA 4TPYA 2PGQB 2PUXB 3PRDA 2J38A 1AUJA 2YOLA 2WPIS 3SOSA 1SLVB 2VH0A 1GMHF 1NRSH 3AW1A 1C2IA 3F68H 4DGJA 3PMAB 5L2ZH 3TNSA 4I8LA 1BB0B 1XMNB 1NT1A 2KCPA 2UUJB 1C5OH 2EI8A 4MTBA 2I6QA 4X1NU 4ZCNA 2C4FH 4OGYA 2PHBA 1C5MD 2W26A 1EQ9A 3NZIA 2RA0A 1BUIA 1NRQH 3A80A 3GY4A 2GCHG 2QE7D 3LT3A 5FX6A 4J1YA 3SZNA 2IPQX 2FOCA 3QTVH 1CGHA 1W0ZU 1HAHH 1OSSA 2JH6D 4ESTE 2EI6A 1S5SA 1UTNA 2V0BA 2ZGBH 4OS2A 3EQ0H 1U6QA 1NZQH 2CXVA 2L74A 3F0PA 4X6NA 3GY2A 1V2QT 5B6LA 1UK3A 1SPJA 3UWIA 4AOQA 1V2KT 3BEFB 1NROH 1TBRH 3DCLA 1C5ZB 3PWCA 1GMCF 3TJNA 1IQEA 3GCHB 4K1EA 4AYVB 4MPXA 1F5KU 2GT7A 3HK3B 3QGNB 1QA0A 4OS7A 4B73A 2C8WB 4AB8A 1LTOA 1EX3A 3PV4A 4NIXA 2FX4A 2R2MB 3CNRA 1XVOA 3ATMA 3U8TH 4D7GA 1VJ9U 2CV3A 1K1MA 2BDBA 3PM3A 1KXBA 4WMDA 1CHOG 1G3CA 1GBTA 1QJ1B 2OCVB 3TVJB 3PLPA 1HPGA 3MTYA 1G2MA 4ACBA 3SU5A 1IQFA 1FPHH 3PRBA 2KAIA 2OC7A 1SGRE 4AFSA 3WWFA 2G55A 4UFFH 3M3VA 1UMAH 5GDSH 3I77A 1QJ6B 1O2GH 3M61U 3VB5A 1YPLH 1HUTH 3JZ1B 2VWMA 2TIOA 4ASUD 5C20A 1CQQA 4U32A 1WQSA 1EOJA 1T32A 1TMTH 7ESTE 1THRH 2PKAA 1O36A 3WW7A 5EGMA 4DT4A 1O2TA 5EPYA 1O32A 2A4OA 1VCPA 1XKBC 5FHTA 1G32B 1LPGB 3FFGA 4X6OA 1LVMA 2A31A 2VINA 1ZLRA 3OYPA 4ISLA 3E90B 4NA8A 1DSUA 1MKXK 3KNXA 4FETA 4NFEA 4B6FA 1K2I1 2P95A 1ZMLA 1SGPE 1VITG 1P04A 1LKAA 1D9IA 3MMGA 3DUXH 4VGCC 5CHBA 3SU4A 1HAOH 2OLGA 3ZVDA 1ZZZA 2BD2A 1WUNH 1V2RT 2UUFB 2GDEH 3HKJB 1AE8H 4X8VH 4YOIA 2FS8A 1ZTJA 1FQ3A 2VVUA 3T27A 3UOPA 1CT0E 4JZFH 2VIWA 1ZMJA 2WYJA 1SGDE 1PQ7A 1GL0E 4Y10E 5KGOA 1SBWA 5C5OA 4FXGH 2V3OH 4LOYH 3RXSA 2G51A 1GHAG 2F3CE 4RT0A 3ZVCA 1GJ8B 3GYLB 1IQIA 4IN2A 5L6NH 5E0GA 1HIAA 1P12E 2PV9B 2RDLA 3IITA 3SNAA 3OFND 6ESTA 3LKWA 1HV7A 2FS9A 1W12U 5LPFA 1PPFE 1THSH 2Y7XA 1D6RA 2Z9IA 1BMFD 1G2LA 4XE4A 3H5CB 5LGOA 1Q2WA 2K8IA 2RDEA 1MKWK 3QUMP 3KEEA 1ESBA 1F92A 2L6OA 3RLWH 3RXTA 3ZZ8A 2H6MA 2ALVA 1O5BB 1UTOA 2M5TA 1AWFH 1NU7B 1OP8A 3QK1A 4DIIH 1DXPA 3GS9A 5HXFA 5LPRA 3W94A 3ODDA 4TWWA 3ZZCA 2F83A 4A1TA 1ELCA 2AS9A 3SUGA 5ABWA 3TLOA 1DANH 1O33A 2EY4C 1UTLM 5H4IB 1P3EA 4AFZA 1A2CH 1YGCH 4NIVA 2AGEX 1MU8B 1XXFA 3NKKA 2OQUA 1D6WA 3T62A 1YPGH 4IMQA 3LGVA 1W10U 2H9EH 2G81E 4ZXXH 2CN0H 1THPB 4ABGA 4NSVA 1GHBG 3GDSA 1FAXA 1P2IA 4D8NA 3F9GA 1V2UT 1FPCH 2WPHS 3KQBA 4WH6A 4CHAC 4H6SB 1AE5A 1G36A 1O3LA 3DD2H 2XWBI 3RXGA 1V2MT 2F9OA 4K5ZA 1NRPH 1P2JA 2A5KA 3ATWA 3MYWA 1OWIA 3BTTE 2PWXA 4WJG2 1EB2A 1P0SH 2QY0B 5GXPA 3C27B 3F3BA 1T4VH 1Q3XA 1FMGA 1GHYH 1C5WB 4SGBE 1ELAA 2XBXA 3RMLH 2BQ7B 2W3KA 2XXLA 1C5NH 4FUCA 1IHSH 3P17H 3KGPA 2HNTF 1XKAC 1UTKA 2JDID 2NU3E 2BZAA 3IWMA 1IQGA 2LNCA 1AY6H 1QRXA 3T25A 3DSGA 2AMPA 2HALA 2B7DH 4O9VA 1CA0C 1WAYB 2Z3DA 3KN2A 4ISHH 4P02A 1FZZA 3P6ZB 3FVFB 1HCGA 4JZIA 4D9QA 3PB1E 8LPRA 3RXQA 2ZPSA 3EE7A 1SLXB 4BXWA 4ABDA 2ILNA 1IAUA 1RRKA 5C3NA 2AFQB 2JETC 3PYHA 5DP6A 1XUGA 3ESTA 1FY1A 5JBAS 2PGBB 3OY6U 3MU8A 1TX7A 4I33A 1O30A 1TOMH 5AVDA 4NZLA 5A2MH 1MTNC 1CSOE 2FMJA 2J97A 2ZZUH 4ZAEA 1FY5A 1KTTB 3RXPA 2JJ1D 2RG3A 3UPEA 2Q6DA 5CHAC 3U69H 2O8TA 1V2OT 4FUJA 4B2CA 2IN2A 2OQ5A 1GBDA 5GIBA 1B5GH 1AFEH 3D65E 1C1MA 3ATKA 5FAHA 1WV7H 3OAAD 2ZFSA 3DT0H 2ODYB 4CH8B 1QL7A 1HAYB 1DWBH 3SI4H 2Y5GA 3EAJA 1GMDG 3F9FA 5E2PA 2A5AA 1B0FA 2ZWLH 1O2OA 5FX5A 1EAXA 1H8IH 1ESTA 1MD8A 1SQRA 1GCDA 2ZPRA 1BHXB 3Q3KA 1SOZA 4JCNA 2V7QD 5J4QA 4WVPE 1T7CA 3H7TA 2PR3A 3RXAA 4ASHA 1F0TA 1CGJE 2FODA 4ZH8A 4O3TA 1GBAA 5PTPA 4DY7B 1XM1A 1NO9H 4WY3A 3D23A 3N7DA 1T4UH 2IJOB 4ZKOU 1Y59T 1K9OE 4XFQA 4HZHA 2FLBH 1Z6EA 2Y5FA 1EXFA 1TFXA 1SVPA 2NU2E 4Y6DA 1ETSH 3RXMA 1AFQB 1SQOA 2QAAA 1C5RA 1HFDA 1SOTA 2G00A 2NU1E 3SNCA 1FV9A 3SUFA 3URCA 1OXGA 1O3CA 3A85A 4NWKA 1GG6C 4UEHH 2HRVA 2DE9A 3MI4A 1TBQH 2AIQA 4HI3A 4A5TS 1O3MA 5HGGA 1GBMA 1C1VH 3UOUA 2ZU2A 5C94A 5A0CA 1ZPZA 2QIQA 1J17T 1OWEA 1QBVH 1FONA 2FI4E 4MLFB 1SLUB 5CE1A 2BYAX 4FUDA 1YLDA 3L33A 1TPAE 2FOHA 1WSSH 4I8KA 3S7KB 3BTQE 3ITIA 5GCHF 2BXTH 1NPMA 1KXFA 1LHFH 1OKXA 4BAHB 2TRMA 2G4TA 3RXJA 1O3DA 1Y3XA 1ZRKA 3BG4C 1C5LH 2ZHWH 4FVDA 2A4QA 5JYIA 2Z9KA 2HOBA 3MNSA 5DG6A 1OOKB 1KXDA 4D76A 1MKXH 3OTJE 4BOHA 2VNTA 3KL6A 1C1RA 4FU9A 5I25A 3ZVGA 5EW1H 3SO3A 4KKDA 3RU4D 3SYJA 2F4LA 2W7SA 1AKSA 2BM2A 5IK2D 4Q80A 3M7QA 4DT7B 2ZKSA 2B5TB 3K2UA 7GCHG 4ZKNU 3GISB 4I31A 4NIWA 4CRCA 5DN6D 2ZFRH 3HGPA 2AGGX 3TH4H 1OWJA 1O37A 1FN8A 2FYQA 4MNVA 3LC3A 1ZOMA 1IQJA 2UUYA 1EAUA 3EYDA 5AF9H 2VIQA 4D9RA 1S81A 3A8BA 5EOKA 2PLXA 3SJ9A 4Q63A 2Z3CA 3RMMH 1HJ8A 4XD7D 4BAKB 1PYTC 4I32A 4INKA 1MTUA 1COWD 3OTPA 4XSKU 5T3HA 1SI5H 1FI8A 3OE7D 2QXIA 1MKWH 2ANYA 4A6LA 5L30H 1GCTB 3BV9B 1XVMA 2G5NA 1UO6A 3SGBE 3T5FH 4K60A 3A88A 1BT7A 1GVLA 3GOVB 1P2NA 1ZYOA 1P8VC 2J4IA 1XXDA 3QTOH 1O3JA 3KIDU 1J16A 3GY3A 1P2OA 4B2BA 2ALPA 3AAVA 1QQUA 1ELVA 1VJAU 2ZDNA 5HYOA 1C1OA 3Q3YA 4HFPB 3RXKA 2FOFA 5EQRA 1AN1E 1DM4B 1AIXH 1QBNA 1QRZA 2WZQA 5E0HA 2BZ6H 2FTLE 3QX5H 5T6GA 3VEQB 3KQCA 3MWIU 1O2HA 1L1NA 1YPKH 1GHWH 1BTUA 1HLTH 1TONA 4Z6AH 5F8ZA 2ZECA 1RIWC 2DUCA 4YLUA 3UQOA 1TB6H 1Y3WA 2FO9A 1O2QA 3RXBA 3Q77A 1IQNA 1LHCH 2FTMA 3RXHA 5JBCS 2QXGA 4P00A 5FXLA 1IOEA 1GI0A 1O2LA 3GY7A 2BMGB 3SUDA 4ZHAA 1GJ5H 3M7TA 1PPHE 2SGPE 1AZ8A 3TJUA 4X1QU 1OP0A 4MDSA 4KP0A 4K8YA 4ISOA 1JIMA 1XUJA 2A7JA 1O39A 6GCHG 1HJAC 2BY5X 3HK6B 4UDWH 2F9BH 1QNJA 2GT8A 3VB7A 5C1XA 1SGNE 1BRUP 1MTVA 1W3CA 3V13A 2ZHEH 5CMXH 1AMHA 1TNGA 2HGTH 4X1RU 2EEKA 3ZZ3A 3K6ZA 1MBQA 2BDYA 3LH1A 4IS5A 4YTAA 1QIXB 2BDHA 3PROA 1HXEH 1L1JA 2RFKC 1BITA 1Z8IB 2XOKD 2O9QA 3BEIB 1JRSA 4CR9A 4XDEA 1Z1IA 2BD7A 1TALA 3LGYA 5C2ZA 1NESE 1ZHMA 4VGCB 5ESBA 2SGFE 3RMNH 4CH2B 3UNRA 3V12A 5GNDA 3OEHD 2QV1A 2P8OC 3MU5A 1EP5A 2KCYA 2LELA 5EW2H 1DUEA 2V6NA 3NWUA 2GCTC 4FOUC 3MO3A 4MNYA 1TA6A 1BBRK 2QF3A 1NBMD 4Y8YA 3S0NA 2FX6A 3O8BA 3MO6A 2W3IA 1SGFA 2FESH 1QCPA 2FOAA 1V3XA 4NA7A 1BHXF 4KTUA 2J98B 3TIUA 2JH0D 5AFZH 2ZTXA 5HM9A 1H9LB 3MNCA 1OP2A 1FLEE 2ZGXH 4Z0KA 4MPWA 6LPRA 1A46H 1JBUH 2NU4E 3IG6B 1UTMA 2ZQ2A 1DOJA 4K1TA 1SGIB 1UVTH 1PQ5A 2ZFTA 1AI8H 1YLNA 2BLQA 2TGDA 1GDQA 1KIGH 2GMTC 2WYGA 3LDXH 5FL7D 2WV5A 1OS8A 3M36A 3U98H 3T2NA 3V0XA 1L0ZA 4M7GA 1UTQA 3QLPH 3LGIA 4PROA 2OC1A 3MU4A 1LHDH 2BVRH 1QY6A 3GY6A 1G3DA 2FI5E 3AW0A 4B2AA 3E3TA 1MTWA 5C17A 1SGQE 2GV7A 2Y7ZA 3ZZ9A 2BD3A 2H5CA 1P57B 1IQLA 1DY8A 1BRCE 1QL8A 4CHAB 4INLA 3B8JA 2ZU4A 1WU1A 1C2HA 2FLRH 2D26C 1P2MA 2ZTZA 1ANBA 3STIA 3MU1A 3A86A 2XBWA 5EG4A 4RN6A 1S6LA 4X1PU 2ZI2H 2JIZD 1HAZB 2J5UA 1W0JD 4YZUA 1TQ0B 1ZSLA 1O2WA 1UK2A 5BPEA 3DHKH 2Y80A 4X2VA 1O2IA 3TK9A 2FM2A 1GJ6A 5AFYH 4CRAA 5FCKA 2VWNA 4F55A 2TPIZ 2CJIA 5DJ7A 1K1PA 1CT2E 2VVCA 1H4WA 3CP7A 4Q7ZA 1W7GH 1ACBE 3F9EA 1GPZA 3VGCC 1ELGA 3RXRA 1KY9A 1MD7A 2ZGHA 3M7UA 3E0PB 3SORA 1PPGE 1CA0B 1ANDA 1O3KA 1TMUH 3F2GA 1CU1A 1GI1A 2ZCHP 1QTFA 3BIUH 2GZ8A 4KTCA 1EZQA 1KYNA 1C5UA 2GZ7A 1F5LA 2BQWB 5TCCA 1XUFA 1GBEA 4TWYA 1E37B 1VGCC 5BRRE 1GBKA 4BXSA 5DO4H 2GCHF 4LZ4B 4A92A 1Q31A 1UTJA 2JETB 2SGDE 4DJZB 3SQEE 2OTVA 1UW7A 2GD4B 2XTTB 4Y7BA 2P3TB 3U28C 3SHCH 1FUJA 3F9HA 1C2FA 1LQDB 3A8CA 3UFAA 4CREA 2AGIX 4F48B 2EC9H 1MTNB 1IQHA 2JJ2D 3PO1C 1AHTH 1O0DH 4JK6A 1QFKH 3ZZ5A 5CHAB 1F0UA 3RC5A 4ZKSU 1O5GH 5JB9S 4K69A 5JDUB 2ZA5A 3L6PA 1J9CH 2ZC9H 5HKKD 1JIRA 1GHVH 1ZPCA 2ODPA 2OK5A 3SV6A 4RKJB 3VG8A 2ZQ1A 1ZPBA 1TPOA 2FOBA 4QT8C 3O8RA 4DW2U 2CK3D 1C5QA 2BQ6B 1MQ5A 3SV7A 1CHOF 1HB0B 3UREA 2HPQH 3A89A 3Q3XA 4AGJA 3ZZDA 1DVAH 3JZ2B 4NZQA 4X1SU 1TX6A 1S84A 1HJ9A 1ZRBA 1F5RA 2FEQH 1WYKA 1Y5UT 1F0RA 1YC0A 4OGXA 5JB8S 2HPPH 4GHQA 1TYNA 2SGEE 1QRWA 1AZZA 1OWDA 1K21H 1HAVB 1LHEH 1TAWA 2G5VA 1WBGB 1AD8H 1VKYA 1TABE 4NSYA 2Z9GA 1LO6A 3ZYDA 1ETTH 5DPAA 2VIPA 2SGAA 3SHAH 4B75A 3A82A 1KXCA 1C2JA 1BJUA 3PTNA 5I46H 1KLTA 1FIZA 1XUHA 3GCHC 3SV8A 2P93A 2B9LA 2F9VA 4MQAA 1BCUH 1BTXA 1ANCA 2YMSB 3U1JB 5EXMA 8ESTE 2Z9JA 2PSXA 1XUKA 2ZTYA 1VITF 2A4RA 1O5EH 1ARBA 3ZV9A 3MH6A 4NCYA 1A61H 2WV4A
chains in the Genus database with same CATH topology
1GG6B 1N6YA 3Q76A 2A45B 1K1NA 3O8CA 1S82A 4GLYA 8GCHG 3FANA 1O2NA 1BIOA 1GHAF 2FOEA 1FN6A 3LGTA 1SC8U 3VB3A 1YPJH 3R3GB 5EXLA 3QGJA 4WWYA 4Y11E 2PSYA 4M9FA 1RFNA 1VZQH 2A2QH 2CGAA 2QCYA 1V2TT 1C9PA 2C90B 2A1DB 4OS5A 1T8OA 2XNDD 3A8DA 5A09A 1GI2A 1A3EH 1C2KA 4R8TB 1B7XB 2C93B 3RXVA 2R3UA 1O3FA 1C5XB 3ZZ4A 1CBWC 3BG4B 1IHTH 3TGKE 1DY9A 4K2YA 1QA7A 1SLWB 2UWLA 1SB1H 5DP3A 3SU3A 1OYTH 5EXNA 5HMAA 3E1XB 4X6PA 1H9IE 1C5SA 1O2SA 1O3AA 2WV9A 3UTUH 4X8SH 5T6FA 4IMZA 1F2SE 1OWHA 2R2WU 2CF8H 3E8LA 3RXOA 4MNXA 2BVXH 2YMSD 3MHWU 5A0BA 2QF0A 2OBQA 3QZRA 1LVBA 2HVXA 3M5NA 3A7VA 1G3EA 1T8MA 4Y8XA 1P11E 1EPTA 3GY8A 1GI5A 1DS2E 4BAMB 1GHBF 1BBRH 1FXYA 5K0HA 5K7RA 3PMHB 4WXVA 3SU2A 2CHAB 4U30A 3V7TA 1HXFH 3TPIZ 1LPZB 1O2JA 1SGCA 1P02A 2CF9H 4YM9A 1JWTA 3SBKA 3TH3H 1UHBA 2THFB 3B9FH 5C67A 1Y3UA 3UR6A 3A7XA 1DFPA 1IQMA 3ZV8A 3MNXA 1D3QB 2GGVB 3ATLA 1LDTT 2WPLS 4ISNA 1RJXB 1BTWA 2EI7A 3HPTB 4Y76A 3I78A 4AG1A 1FDPA 4H6TA 3H7OA 4K1SA 3LONA 3GCTG 2BX3A 5EODA 5GJ4B 3UUZA 2FWWA 1KLIH 2V3HH 3PMJA 1LCYA 1DXWA 1O3EA 1A7SA 1JMOH 1GJ7B 2PKSC 2ULLA 2ZU1A 3LGUA 1PJPA 4YT7H 2ZDMA 2WSSD 1UVUH 2PW8H 3FKSD 1V6DA 1P3CA 4JZEH 2R0KA 2KAIB 3OSYA 1ZR0A 2HLDD 4X6MA 3A7TA 4RSPA 3A8AA 3RC4A 3PV5A 1K1IA 3ZZ6A 4YESB 2BB4A 2FIRH 1HAPH 2PKAB 3RC6A 2KZ4A 1SQTA 4AN7A 1LMWB 4KGAA 1TX8A 1O2RA 2F9UA 2FI3E 3WY8A 3SGAE 4YT6H 4ZROA 1HRTH 1S6FA 1NS3A 3SJIA 1TIOA 3SNDA 4Y0ZE 1RD3B 5EPNA 1O3PB 4GPGA 1PYTD 1QHRB 5DP5A 1SHYA 1C2GA 2ANKH 4I8HA 1C5PA 4AORA 3MH5A 3A81A 4Q7YA 3UNQA 1HJAB 2Z9LA 1NFXA 1C5YB 4B6EA 3B23B 3UY9A 3U9AH 2KCAA 3LJJA 1ID5H 4GCHG 1MCVA 1A3BH 3P92A 1GMDF 3UNSA 1W11U 2B8OH 2BOKA 2ZGJA 4X2YA 1CHGA 1MUEB 1HIAB 3TK5A 3DFJA 1Y3YA 3DSPA 3D62A 4DVAU 4GVUA 3SU6A 1AB9B 4DOQA 4U01A 1HGTH 2PTNA 3A84A 2Y81A 3T26A 2WPJS 4UFDH 1TGNA 1KSNA 2J95A 1XUIA 1FNIA 1N8OC 2GCTB 1SSXA 1RS0A 4OS6A 2R9PA 2XNIA 4JMYA 5CDFE 1SGFG 3SU1A 1NU9A 3S7HB 3M3SA 4ISIH 8KME2 1Z7KA 3BTFE 2SFAA 1O3IA 5IYTA 1W7XH 1UK4A 3E16B 6CHAC 1BZXE 4UE7H 2G52A 1TRMA 2ZFPH 1TNHA 1CO7E 2VIDA 2FOGA 1P06A 3RU4T 1AQ7A 3SZEA 1GBFA 1JOUB 3NUMA 1GJ9B 3C1KA 1C2DA 2BD4A 4FVBA 4OS1A 1CGIE 3S9AA 1INCA 4ABFA 3UQVA 3K9XB 1H8HD 4DIHH 3OEED 2GMTB 3TGJE 3BTDE 1Y8TA 2ZHDA 4AG2A 4B76A 1ABJH 1LPKB 1P9UA 4R0IA 5LH8A 1ABIH 1K1LA 5SGAE 3SUEA 1YP9A 3RM0H 1FIWA 1L4ZA 3KF2A 2VGCC 4IC5A 5DSFA 1UCYK 1ZHPA 1C1NA 2O8LA 1ELTA 2QXHA 1SG8B 2ZPQA 2A2XH 2WHXA 3MH7A 3SJ8A 3GY5A 4Z1MD 2BY9X 1MBMA 4A1XA 1UJ1A 1KMHB 1O35A 3OX7U 5EQSA 2PUQH 2C8ZB 1YYY1 3LPRA 2J92A 1TNLA 1PPZA 4BTTB 4NGAH 5A8XA 1GMHG 4JYTA 3RXIA 3ZVBA 1C2MA 4JZ1A 1PPBH 1UVPA 1F0SA 1MMJN 4AB9A 4ZMAH 4UONA 3GYMA 1SKYE 1GGDC 1UVSH 1H8ED 5DKMA 5C0TA 3VB4A 4RI0A 2D2DA 3N7EA 7KMEH 4IBLH 5DP8A 4AZ2B 7LPRA 1NRRH 1Z8RA 1ZTLA 3FP6E 3VB6A 2P16A 3A7ZA 7GCHF 4Q4LA 1BMMH 5FBEA 4IN1A 3KQEA 3SI3H 5L2YH 1GHXH 2GP9B 2OC8A 1TRNA 1MABB 1D4PB 4Y79A 5T6DA 1FJSA 3SV2H 4WMFA 2BX4A 2V35A 5AHGH 2P3FH 2XRCA 2UWOA 4B71A 1BMAA 1S85A 4Q2KA 4AYYB 5JPMH 2XBYA 1WCZA 1O2UA 2QN5T 2Z6BD 4GHTA 2FDAA 1GMCG 3S69A 1J14A 1BTHH 1NC6A 1E1RD 3VGCB 1GI9B 1TOCB 1YF4A 1OWKA 1ZSKA 1BTPA 4LXBH 3BTME 1ARCA 3KHVA 2ZU5A 5DK1A 4HTCH 3URDA 4CRFA 3UIRA 2A5IA 1ZTKA 1ZJKA 4INHA 1BQYA 1NFYA 5FPYA 2GV6A 3M5OA 2QYIA 1AO5A 1Z8GA 4XBCA 2H5DA 1L1GA 2ZNKH 1GL1A 1VGCB 3RXCA 1KLJH 4IW4E 1CT4E 1T31A 3GDVA 4KELA 1AVWA 1O2VA 3LC5A 4Y71A 4CBOA 2GX4A 5EU8A 2W6ID 1YCPK 2RA3A 4XOJA 3AVZA 3ZZBA 2DE8A 1KXAA 1BOQA 1BBRE 1K28D 1YLCA 4CRBA 3V3MA 1DX5M 1FY8E 3ZVFA 4MPVA 3SGQE 2QA9E 4BTIB 4ABBA 5J4SA 3PO1B 3M5LA 3E0NB 4BTUB 2AEIH 2JH5D 4J2YB 4UFEH 2R0LA 3I29A 5E8EH 1ZMNA 2J2UA 1Z1JA 2XC5A 2STAE 2BD8A 1A5GH 4YOGA 4FUGA 2W6JD 1W0YH 1BMNH 4U2WA 4LZ1H 1J15A 3N7OA 1JXPA 3M5MA 1OX1A 1EJNA 4B74A 3SJKA 1GCTC 1GBJA 3VXEH 2SNVA 4MPUA 2QXJA 3VFEA 3ZIAD 9ESTA 1EZUC 3RXLA 1QURH 3F2FA 2ZCLP 1RGQA 3H09A 4RKOB 2QC2A 1WOFA 6GCHF 2KM0A 5LPEA 1PQ8A 3CS7A 3EE0B 2CMYA 3ENSB 2BY7X 4TY7A 2BD9A 4GSOA 5IDKA 1E38B 1PPEE 2WPMS 3M37A 1QB9A 4I7YH 5T1VA 1TE0A 1PPCE 1TWXB 1GJAB 1MZDA 3LH3A 3SNEA 1ZGIA 4IC6A 4CRGA 4ABIA 1C4V2 2QF4A 2HWLB 2K1QA 2K0QA 3RM2H 3A83A 4OS4A 1W13U 4FUEA 4CR5A 3TITA 2GDDA 4CBNA 2GVFA 2WUCA 2PFEA 3NCLA 1A0LA 3RUOA 2WINI 1OPHB 2Q6GA 1CA8B 3QWCH 2A7CA 5DGJA 5DP4A 2VIOA 1O38A 1DT2A 2R3YA 1O3HA 2WPDD 5DP7A 2AIPA 3OY5U 2IOTA 4WMEA 1XX9A 1FX0B 1MCTA 3BTEE 1V2ST 1BMLA 5TJXA 1EATA 1SGTA 3TK6A 3U8RH 1AKSB 1KDQB 2AYWA 1NFWA 2I6SA 2XCNA 1S0QA 3ZVAA 4JK5A 5GWZA 1E0FD 4BANB 2HNTC 4ZXYH 3SN8A 4AFUA 3QZQA 1MTSA 1CBWB 1GBIA 2ZFQH 1EPTC 3RXDA 3Q00A 2ZFFH 4F49A 2BHGA 1EJAA 2BVSH 3MOCA 5FCRA 4ABHA 2A4GA 2ZG0H 2LPRA 3LIWA 2VU8E 1GI7B 1V2WT 2H1UA 2JKHA 1GI6A 3MFJA 1DLKB 3UR9A 2TBSA 1PFXC 1GWAA 4Q7XA 1A4WH 3EDXB 2XWAA 1C1PA 1AWHB 3SU0A 2D1JA 1V2PT 3M35A 1S0RA 1E34B 1SHHB 4GUXA 1BTZA 1C9TA 1QQ4A 1O34A 3HATH 1NBME 1OYQA 3SNBA 1A5IA 3NXPA 5DP9A 2BLVA 5C1UA 5G4BA 2KFWA 2OINA 3CENA 4X2XA 5ESTE 3A7YA 3P8OA 1EFRD 1HAIH 1P09A 2FP7B 2FXRA 1DE7H 4NWLA 2BDGA 1UTPA 2H9TH 2XBVA 1HNEE 1YKTA 1HBTH 4O97A 3N99A 4TSFD 1H1BA 2Q6FA 3KCGH 3BTGE 1W2KH 4I8JA 3GCOA 4MVNA 1QL9A 1TGTA 2H2ZA 1LKBA 2VH6A 1DPOA 2NU0E 4YLQH 1QJ7B 1GI4A 1RTFB 3BF6H 1J8AA 1LVOA 2O8UA 2XYAA 3P8FA 2HNTE 1EP6A 2BDIA 2Y82A 2PKSB 3FZDA 1EZXC 3NK8A 4YXWD 4AGKA 2BOHB 1H8DH 1UCYH 1MAXA 1TNKA 1T8LA 1Z8JB 4DCDA 2GTBA 1HAXB 2YNBA 3WWBA 1T8NA 2FOMB 3RP2A 3DSOA 2XW9A 1AU8A 1DUAA 2F91A 3P8GA 2GZ9A 3S9CA 4IGDA 1IQKA 2D8WA 3NRLA 1DWDH 2H9HA 2ZCKP 1GJDB 1NRNH 1Z6JH 3S9BA 2KCOA 4NIYA 1PQAA 1FAKH 2B0FA 4ZHLU 5ETXA 1VCWA 2WUBA 1FY3A 1YPHC 4XBDA 4H4FA 1GJ4H 1BA8B 5TCAA 4O03A 1MAYA 1MQ6A 3RDZA 1K1JA 2C3SA 1TQ7B 2TGTA 3FO8D 5JBTA 3G01A 4WF8A 5F53A 1V2LT 1A5HA 1SMFE 3HKIB 1C2LA 3E91A 1O2MA 3AAUA 1W8BH 2G8TA 1WTGH 3UWJH 2VBCA 3OU0A 3BN9A 3E6PH 1GBCA 1MZAA 3BIVH 3NPSA 1YM0A 4X8UH 1C1UH 1ELBA 3PTBA 1TA2A 4NA9H 2F9NA 4MNWA 3PMBB 1N6XA 1RTKA 1P2KA 1V2VT 2BDAA 3L3TA 3VXFH 1HYLA 1P9SA 1TPSA 4ABEA 2W5EA 4ZKRU 1TGBA 3AASA 3F0OA 5A0AE 3R0FA 1QBOA 2IPHA 1YCPH 4HGCA 1V2JT 1RTLA 1TGCA 1AVGH 1ELFA 2BTCE 1N8OB 1QB1A 2ZHFH 3BTWE 3LJOA 1NN6A 3TH2H 4UFGH 1K1OA 3MNBA 4X8TH 1GVZA 5GCHG 2ZP0H 1HDTH 1P05A 2ZDLA 1H9HE 3ZYEA 4BAOB 6CHAB 1A0HB 1EAIA 2VWOA 2Y5HA 1A0JA 3BG8A 2ZO3H 1L2EA 1YPHE 2ZDVH 3MH4A 1ANEA 4E06H 1D3DB 2AMQA 3UB0A 3P8NA 2UUKB 2KR7A 4TPIZ 5A8ZA 1WTHD 1AGJA 1Z71A 1GDNA 3T28A 1KXEA 3W1EA 1O3NA 1BRAA 1VCQA 4GAWA 1P01A 3GDUA 1KTSB 1LQEA 4FUHA 5F03A 3U1IB 3EA8A 2GKVE 1V2NT 5F6MA 1G30B 5FBIA 2A32A 8GCHF 5F8XA 2QGRA 1GVKB 1C5TA 5B6OA 1E1QD 1DICA 1NTPA 2OC0A 1BDAA 3P70B 4ZUHA 4LK4A 1O5FH 2BDCA 2VGCB 3PLBA 2STBE 3VPKA 2FYRA 4FUFA 4YOJA 1K22H 1B0EA 3QDZB 1DWEH 3KQDA 4E05H 1HAGE 1O2YA 3FOAA 3CS0A 1RIWB 2O8WA 1P2QA 1DLEA 1ELEE 4FU7A 3W95A 2ZGCA 3LU9B 2YMSC 4FUIA 1GGDB 2ZIQH 2P94A 2Z7FE 3A87A 4A1VA 2OUAA 3RXEA 3FZZA 2W7UA 3SV9A 1MH0A 4TYDA 3RLYH 1O3OA 1QR3E 1FY4A 1NY22 1TLDA 2WPKS 2FPZA 3RXFA 3MO9A 4FUBA 5FPTA 5E2OA 1G9IE 2ODQA 3QO6A 4K3JA 1ZHRA 3SJOA 1O2KA 4MG3A 3ODFA 3LGWA 4OM9A 1WQVH 4DG4A 4WH8A 1SFIA 4BNRA 4UD9H 3A7WA 2TGAA 1O5AB 1SL3A 1TNIA 5C1YA 2F43B 2P59A 2F9PA 2O8MA 2Y6TA 3STJA 3TJVA 2Z3EA 2ZHQH 2AHME 1CE5A 1L4DA 2BXUH 3DFLA 2C8YB 3GICB 1TGSZ 2ZDAH 1W14U 4B1TA 3BSQA 1F7ZA 3TGIE 4JZDH 1O3GA 1EAWA 4FU8A 1UVOA 1C1TA 4TY6A 1Y5BT 3FP8E 1ESAA 5EQQA 2ZU3A 2A7HA 4KTSA 2YNAA 2P8OB 1YPEH 4A7IB 4WXIA 4NG9H 3GCTF 2XC4A 3O8DA 3TU7H 1C5VA 2SNWA 3PV2A 1WXRA 2ASUB 3ZVEA 2BY8X 1KDQA 2ESTE 5JBBS 2VIVA 2VVVA 1QGFA 1SGYE 4THNH 5FPSA 1OHHD 3ZZAA 4SGAE 1EZSC 1CVWH 3K6YA 2A0QB 2OBOA 2M2AA 4F4OC 2Z94A 4NFFA 1ZSJA 4D7FA 3ATIA 2OD3B 3FN8A 4Y8ZA 4X2WA 5F8TA 1S83A 2CHAC 1EJMA 1JRTA 1S6HA 2AH4X 2XCFA 1D3PB 1LHGH 2EA3A 4ZHMU 1LVYA 2J9NA 1O2ZA 3MU0A 2ZF0H 3K65B 2AMDA 1GJBB 3TNTA 3RXUA 1Y3VA 1P03A 1GDUA 4ABAA 3AK5A 3GCNA 1ETRH 5C5NA 3T29A 2ZDKA 4O3UA 1DSTA 1VITH 1YCPM 3SQHE 3TJOA 1D3TB 1X7A