3VPKA

Crystal structure of 6-guanidinohexanoyl trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Crystal structure of 6-guanidinohexanoyl trypsin near the optimum pH reveals the acyl-enzyme intermediate to be deacylated
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vpkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vpkA02
2G4UA 4MQAA 4X1QU 5TJXA 2ANWA 1EP5A 1S5SA 1MU6B 3SGQE 1P2NA 1FPHH 1F0SA 4MTBA 3UNSA 1G2MA 2UWLA 2TGAA 1FONA 3HKJB 4YLQH 4Y8XA 1GI7B 4CRFA 3RC4A 3RXCA 2TGDA 1ANCA 3F9GA 1GJ8B 1QA0A 3C1KA 4FUCA 1AE5A 4ISIH 3MFJA 3NK8A 2PGQB 4IC5A 4WMEA 5BPEA 1TYNA 2XYAA 4CHAC 3MU5A 2FODA 5FAHA 1YBWA 3M5OA 4I32A 3LKWA 1HDTH 2XW9A 4OGXA 2J9NA 1E0FD 2OQUA 2VIQA 1SLUB 1O2TA 3A89A 3EDXB 2A7HA 3FAOA 5ESTE 4NGAH 4UONA 4JZFH 2J92A 3LONA 3RXPA 3TPIZ 2BZ6H 2C8ZB 3U9AH 3S0NA 5A0BA 4WXVA 1FY8E 3VB6A 2A0QB 2A31A 2B5TB 2PUXB 1LVMA 5AHGH 2BVSH 1O2IA 1GVLA 2PUQH 2VVVA 2PSXA 1QBNA 1O3MA 5FPYA 2H9EH 1P2KA 1SGTA 1T8OA 3HATH 3DFLA 1Z8RA 1K1PA 1AE8H 3RMOH 2BQ6B 2NWNA 1O2UA 1K1MA 2GT8A 3F68H 3GCTF 1O36A 2SGQE 1D9IA 2C8XB 3U98H 2UWOA 3SU0A 3TVJB 1DSUA 2OCVB 1C9TA 3SV2H 1WTHD 4BXWA 2ZP0H 4GHTA 1QJ7B 4IGDA 1O3NA 1GI5A 1O3EA 3SHAH 3S7HB 3RLYH 1OWEA 2ZDAH 1HLTH 1QTFA 1SQAA 3TNTA 5F8TA 4X6NA 3KQEA 2XNIA 1Y59T 2FOCA 2ZC9H 2G52A 1QHRB 4K2YA 1NO9H 1P12E 2SGAA 4WF8A 2STAE 2B8OH 1H8DH 2SNVA 4B76A 3GY4A 1YCPK 1DANH 3T2NA 1S85A 2VB0A 1C5YB 2F9PA 1C5SA 3L33A 2J34A 2ZI2H 2HVXA 4TWYA 4Y10E 2XC0A 4AORA 3RU4D 3P70B 4UD9H 3TJUA 2J2UA 2VIWA 2C4FH 1DLKB 3IITA 4NCYA 3SU5A 4A1XA 2EEKA 2ZDLA 2W26A 2OC0A 2BXTH 3SNCA 2FM2A 3GCOA 1EAWA 3LC5A 1FNIA 1WQVH 1CGHA 2ZA5A 1VGCB 2VIVA 5EG4A 1XXDA 3SI4H 2IOTA 4ZHAA 1JIRA 1P06A 3LOXA 3TH3H 5HM9A 2NU3E 1UK2A 1A1RA 1IHSH 1SL3A 1Z8JB 2XRCA 1QRXA 1F7ZA 1HB0B 3P8NA 4X8TH 1F92A 1GGDC 3I29A 3SJKA 3F1SB 2CN0H 5FPSA 1HPGA 3M3TA 3G01A 2BYAX 1E34B 3K6YA 3TITA 2FTLE 3BTEE 3OX7U 1LKAA 2FOAA 1EQ9A 3D49H 2ZFTA 1BDAA 3S9CA 2BD4A 1MD7A 1SOTA 3M35A 5AVDA 1TB6H 4ZMAH 4CBNA 1VITF 1UTPA 2LPRA 4INHA 1LQEA 2B7DH 2IN2A 1HAPH 1AGJA 1L1GA 1GL0E 2CXVA 4TWWA 3EAJA 3GY7A 1G36A 4K69A 3ZZDA 1SVPA 1WQSA 5LPEA 3RMLH 1O3DA 3UREA 2GV7A 3U1JB 1BZXE 1ZPBA 1GHBG 3BSQA 3Q3YA 4XBBA 4AB8A 5C5NA 3UIRA 3BTTE 2F83A 2GZ7A 1HAVB 2AYWA 3OSYA 1HJ8A 1TLDA 4B75A 3MU1A 5HXFA 2BZAA 1NZQH 1V2JT 5DJ7A 4BANB 1D6RA 1HJAB 2WUBA 2BB4A 3ZZ5A 1ZMNA 5B6OA 3LGWA 1S6FA 1P01A 2ZU5A 2HNTF 1YLDA 4DVAU 2VH6A 2QV1A 4B2AA 1UTKA 3EA8A 4FUDA 3RXUA 1O2HA 1VCQA 3EA7A 3M37A 3UOPA 1H4WA 5C5OA 1A7SA 3UR9A 1T31A 2ZFQH 3SV6A 1P02A 1DS2E 1ZZZA 1GI1A 2OQ5A 2ZEBA 2ZHEH 2G00A 2HPQH 4MLFB 1VZQH 1QJ1B 2RDLA 1GCTB 4YOGA 3TLOA 3GDSA 1SGQE 2ZKSA 5FBEA 4ZKOU 2ZPSA 4JK5A 1FLEE 1KY9A 1WSSH 1CU1A 3PWBA 5F6MA 4XOJA 1KXDA 3LU9B 2PKSB 3SZNA 1D4PB 7KMEH 3RXTA 1OS8A 4QT8C 3T5FH 2BDAA 4Y7AA 2OC7A 1BTWA 2BMGB 1O2MA 1T7CA 1YPHC 1GBDA 3R0FA 1ORFA 2G51A 2QCYA 1EPTA 1BTYA 2P94A 1WUNH 5DK1A 1TMUH 1V2VT 1GDQA 2ALPA 3MH5A 2W7UA 1ZTKA 3DFJA 3T25A 1FPCH 2Y5FA 4GLYA 2FI4E 1O3GA 1HAGE 1ZOMA 2KAIB 2O8WA 1SGPE 3RXKA 1ARCA 1BTPA 2V0BA 3UQVA 3HKIB 3BEUA 1OWDA 3RM2H 2K1QA 2OINA 3VXFH 1Y5AT 2GMTB 4YT7H 1JIMA 1V2PT 1PYTD 1O2XA 2ZG0H 2BVXH 4BAHB 4I8JA 1P2IA 1O32A 1E35B 2DUCA 4JZ1A 4KGAA 1FQ3A 1ELBA 1D3QB 3BTHE 1DICA 1OYQA 1FN6A 2WPHS 4INLA 3N7OA 8LPRA 1SHHB 4ISLA 1P04A 1N6YA 1EB1H 1CE5A 1C1OA 2AMPA 1XUFA 1AFEH 4ZH8A 1GJDB 1ID5H 3UFAA 2GTBA 4ZXXH 1LHDH 1DSTA 2AIQA 1TNKA 3D62A 2ODYB 3MI4A 1AKSB 1ESAA 2I6SA 1SGIB 4VGCB 5JB9S 2BD2A 2WYJA 3SJ8A 1XX9A 2ZWLH 2ZHQH 5DP6A 1PQ8A 1O2LA 5A2MH 5L2YH 5LGOA 1O2YA 1AZZA 1A0JA 3AW1A 2ZF0H 4MPUA 2OTVA 3GCHC 2C3SA 4GCHF 1YPLH 5DKMA 3BV9B 3ZVAA 1GG6B 2DE9A 2R2WU 4Q2KA 1Z6EA 1QBOA 4YM9A 3LGUA 1THRH 4FUHA 3RXSA 1NRSH 2F3CE 1P8VC 1O3FA 1A5GH 5FHTA 1HAVA 4BTIB 1TNGA 3AAVA 4E05H 3TH2H 4BAOB 1W13U 3P8OA 4NA9H 3I78A 5DO4H 2QIQA 1EZXC 3RXLA 4YO9A 5IDKA 3TK9A 2V3OH 4CRCA 1NROH 1W8BH 1DY8A 1P10A 1HAOH 3KCGH 4ASHA 2VGCB 3KQCA 2H1UA 1GJBB 3M7UA 1GBMA 1QFKH 1GBLA 1O39A 5AFYH 2RG3A 4Y7BA 4Y8YA 2DE8A 3QGJA 1TX6A 1JXPA 3GCNA 1O2NA 1GCDA 2FLBH 4BXSA 4TYDA 3SGAE 4NIYA 2CF8H 2A32A 2HOBA 1C5MD 3B9FH 2C8YB 2BLVA 3OYPA 3ZVEA 1TGTA 1S83A 1MH0A 3I77A 1OWIA 2BLWA 2H2ZA 4IMZA 4RKOB 1HBTH 4WMFA 3VGCC 1AVXA 8GCHF 5GWZA 2ZIQH 5C67A 4CRAA 3QTVH 3A80A 1GBCA 1RIWC 1RFNA 3E0PB 4CH2B 2AIPA 1XKAC 4X8VH 2PWXA 3RDZA 3TJVA 4BAMB 1VJAU 3FZZA 1D3TB 3AW0A 3TIUA 3A8CA 2P3UB 2ZU2A 4JZDH 2Y6TA 3ZVBA 3SOSA 1ZMLA 3QZQA 1T8LA 4PROA 3GDUA 1NRQH 1FI8A 1AN1E 1TPOA 3LC3A 1IQKA 1MAYA 3MMGA 1THSH 4ISOA 1BTHH 4ZROA 5EQSA 5L30H 2P59A 1C4U2 2KAIA 1SGCA 4YOIA 3STJA 4AG2A 4NIWA 7ESTE 4UEHH 7GCHF 3A8AA 5JBAS 1GHWH 2HRVA 2BLQA 1TQ0B 4WXIA 1AVWA 2Z9IA 3M36A 2WPMS 1EX3A 3PLPA 4FUFA 3PO1C 2Q6DA 5EQQA 1V2QT 3EE0B 4LZ4B 1FJSA 2AGIX 3NZIA 1G9IE 3BTFE 3SV7A 3CENA 1K1IA 2ZDVH 1P9UA 1V2UT 4HGCA 1C1PA 1F2SE 1LMWB 1KYNA 3LH3A 1L1NA 3GY2A 4AFZA 1RD3B 4LK4A 5HM2A 4X2VA 2ODPA 1S0QA 1AVGH 1GHYH 4GSOA 3UTUH 5A09A 1AUTC 4TPIZ 1BB0B 2Z94A 4O03A 2XXLA 2HNTE 1UVSH 1K1JA 3LT3A 1PYTC 2XCNA 4ZHLU 1J16A 1S82A 1YYY1 1W0ZU 3GYMA 2LNCA 5PTPA 2R0KA 1XVMA 3BIUH 3TH4H 2R3UA 1T32A 1VITG 5DP8A 1AU8A 2NU0E 2W5EA 3L6PA 1C5QA 2QXIA 7LPRA 1O2RA 2QYIA 2VJ1A 1BTXA 1Z8IB 4WMDA 1TX7A 3UUZA 3MO9A 1OSSA 4O3TA 4XE4A 2VIOA 1QA7A 1E36B 4E7NA 2GGVB 1MTVA 3IWMA 3FP8E 2BX4A 1HRTH 1IQLA 4Y0ZE 3F9FA 2ESTE 1UVOA 2W3IA 1DXWA 4CHAB 2BX3A 4AGKA 1F0TA 3FP6E 1CA8B 4UFFH 1LHEH 1LPGB 1P2JA 1MQ6A 1NT1A 3SUEA 6GCHF 3K6ZA 1G32B 3LH1A 4AFUA 4X2XA 5CMXH 5LH8A 1UVUH 3QGNB 4ABFA 4AOQA 1P9SA 1GBFA 5G4BA 1BHXB 1O33A 1CHOF 1LPKB 2ZZUH 3ZZ6A 2J94A 2ZNKH 3RMMH 1NPMA 1NU9A 2OD3B 4AB9A 1O3KA 1BUIA 4TPYA 4ABEA 3PMHB 2BDGA 2BD3A 1SQOA 4HZHA 1YCPM 2WYGA 3SU2A 1H8IH 1RGQA 1Z1JA 2D2DA 3A7VA 4U30A 1P11E 2J38A 3NCLA 2GCHG 1H9HE 2A4QA 1GI4A 1UTLM 2Y82A 3SJOA 2NU2E 1BJUA 1RXPA 4OS2A 2OBQA 1V6DA 1ELCA 3QTOH 1Z1IA 1HGTH 2R9PA 1DX5M 4DY7B 1KDQB 1V2KT 2ASUB 1XMNB 2FYQA 1FDPA 2STBE 3FVFB 1ETSH 5K0HA 1SFQB 3ZYEA 2A5KA 3PMAB 2D26C 1C2KA 1O2JA 1CSOE 3PTNA 1O5AB 3A88A 4I8HA 4NZLA 3BTME 1THPB 1ZMJA 1F0UA 4I33A 1O3BA 3SN8A 5C1UA 1KTTB 1L4ZA 3PB1E 1G3BA 1SBWA 1NFYA 1QB6A 1K1NA 1NTPA 1MKWH 3JZ2B 1QBVH 1O2GH 1W11U 2AFQB 2G55A 2EI8A 3UNRA 3ZZ8A 2SGPE 1RJXB 5EGMA 2BM2A 3RXEA 3RXGA 3MNBA 2PSYA 4TY6A 2SGEE 1J14A 2F9UA 3SV9A 2B9LA 4DT7B 2BY9X 2QA9E 1GJCB 2JH5D 1J17T 4ZKNU 1H9LB 1GHAF 3HK3B 3RXHA 1EZUC 1C1TA 2JH0D 2VIDA 3MYWA 1ELTA 1DWEH 3A7WA 2FIRH 3LDXH 1PPHE 3ATMA 1C5ZB 3IG6B 1W12U 3VB4A 1NY22 3CP7A 3T62A 1EKBB 1PPBH 3TK6A 1CT2E 1K1OA 4O9VA 2CV3A 2GKVE 3ZVGA 1C5TA 4KTCA 1W14U 1CA0C 1RTKA 1AFQB 3M3VA 1UVPA 4X2YA 2IJOB 1A5IA 1GGDB 3M7TA 1P0SH 2O8TA 4BTTB 4YT6H 1P2OA 2TGTA 2XWBI 2QC2A 4ISNA 2FO9A 2VWOA 4OS1A 2Y7XA 3DHKH 4XSKU 1F5RA 1GBJA 1AUJA 2CHAB 3KNXA 1C2HA 4X2WA 1L1JA 4B2BA 1GWAA 1K9OE 3GYLB 1QRZA 3GOVB 4XBCA 2J4IA 1KTSB 3BG8A 1C5RA 2BLOA 1EAUA 4GCHG 1ZRBA 2HPPH 2G5VA 3PTBA 1BQYA 3U8OH 1PPFE 4CRBA 3DUXH 4OS4A 2BD8A 4YLUA 5EOKA 4D9QA 4KP0A 2A7CA 3H7OA 8KME2 5GCHG 1O3PB 2IPHA 3GISB 2HALA 3Q77A 3ZVFA 4K8YA 1PPZA 1EJMA 3QLPH 4OS7A 1UTQA 1WOFA 1B5GH 4IS5A 3RXDA 1L2EA 2VU8E 2FOBA 4GAWA 5K7RA 3VB5A 1FIZA 1WV7H 3S9AA 2F9NA 4M7GA 1EOLA 3GY3A 2ZGCA 1XUJA 1J15A 1ZSJA 1PPEE 1MTNB 1DXPA 3SQEE 5A0AE 1HNEE 4WWYA 1C5NH 2FOHA 2ZECA 4Q80A 1A46H 1SMFE 1HYLA 3RU4T 1O3CA 4Y8ZA 1VJ9U 3PMJA 1Y5BT 1TRMA 2ZO3H 2ZGJA 3M5NA 3VB7A 1BTUA 4CR5A 2FESH 2VINA 1EPTC 1DFPA 3E3TA 4OS6A 1CGJE 2Z3DA 3KIDU 5A8YA 1YLCA 1GI2A 2A5AA 5C20A 1KDQA 1F0RA 3SNDA 3HK6B 3MU0A 1W0YH 1FMGA 3OY5U 3ODDA 8GCHG 1G2LA 1L0ZA 1ZRKA 1P03A 4AGJA 2XWAA 1KXBA 2GX4A 1C9PA 3UPEA 3WY8A 1XUKA 1NS3A 3EA9A 3MNCA 3RXQA 2JETB 4JZEH 4X8SH 4LZ1H 1KXEA 2C93B 2SGDE 4NA7A 3EGKH 3SUGA 1GHXH 3O8BA 1GMDF 3E0NB 1W7XH 1ELGA 4HTCH 1C5PA 1QCPA 2EI6A 4WH8A 3SNBA 1VR1H 2PLXA 4FVDA 1MTSA 2P95A 5DP7A 2AMQA 1GBEA 1TOCB 1Y3VA 1O38A 1TX8A 2GCTC 7GCHG 3V13A 1Q31A 1ZHMA 1O2PA 2OP9A 4UFGH 2OXSA 1XKBC 4K60A 4Z6AH 1GMCG 1FN8A 1S0RA 1SGFA 4CH8B 3SW2B 2ZDNA 1TGSZ 1V2NT 1DWDH 4FXGH 1HXFH 3ZVDA 4MNYA 1GBIA 3M5LA 4X6OA 5GXPA 3NXPA 5JDUB 1O3OA 2YOLA 3U8RH 2Z9GA 4E7RG 5HYOA 1XXFA 3RXVA 1QIXB 3BTQE 5F03A 1LHCH 1SLXB 1T8MA 1NN6A 1H9IE 1LHGH 3UR6A 2BD7A 2GZ9A 3MTYA 4Z0KA 1C1NA 1C2LA 1FY3A 1DDJA 3A7ZA 2BY5X 3PROA 3LGYA 3VFEA 1WAYB 1LPZB 3BG4C 4NFEA 4XDEA 1C1VH 1ANBA 4X1SU 4AZ2B 1G37A 4MNWA 4I7YH 1YM0A 1Z8GA 1SG8B 2HGTH 1BMNH 2BD9A 2ZDKA 2I6QA 1C1SA 4Y6DA 1TPAE 4ZXYH 1G3CA 1HJAC 3E6PH 4ISHH 3F6UH 3ELAH 1C1MA 1C5XB 1LO6A 2V35A 3LJJA 3U1IB 4AFSA 4UFEH 3P8GA 1NFUA 1SPJA 1CVWH 3K2UA 4K3JA 2GP9B 5EODA 1YGCH 1ZTLA 5TCAA 4YZUA 3A87A 3ZVCA 2ZCKP 1N1LA 5EU8A 5AF9H 3MHWU 1BRCE 4MDSA 3W94A 1DLEA 1FAKH 1E38B 3AVZA 4NIXA 3ZZCA 6GCHG 2ZGXH 1VCWA 1UHBB 1GCTC 2ZGHA 2FOMB 4O97A 3TGKE 2OBOA 2TRMA 4JCNA 2PTCE 1TAWA 4I31A 3T27A 2ANYA 1GI0A 1MD8A 2AH4X 3ZYDA 1O5EH 5DP4A 1K22H 5FX5A 5F8XA 1GJ5H 4DIHH 3EYDA 2P3TB 1MKXH 1CT4E 2XC5A 1GMHF 4BAKB 2BDIA 1YPJH 1TNJA 3VB3A 1IOEA 2BY6X 2SGFE 1Z71A 1NFWA 2V3HH 1CQQA 2Q1JA 1AIXH 3MNSA 1B0FA 4ABGA 5DP9A 5DPAA 1CT0E 1JBUH 4B71A 4BNRA 1UO6A 1GJ7B 1XM1A 1EAIA 1BRUP 1C2MA 3FZDA 5DP3A 1A5HA 1V3XA 3ATKA 3RXRA 5C3NA 3A86A 3ZZ4A 1FY5A 5E8EH 3C27B 2HNTC 3VGCB 4DGJA 2ILNA 1BMLA 3MU4A 1M9UA 1GBHA 2BDCA 1QL7A 1IQJA 1JRTA 4ABIA 4GPGA 1QR3E 2QXHA 1BBRH 3O8CA 3RLWH 3ZZBA 2QF3A 4TY7A 1ZJKA 2H5CA 4GUXA 3ATIA 2WUCA 1O0DH 1NRNH 1MBMA 5JBTA 1P2MA 2QGRA 2P8OC 3QWCH 3RXIA 1EAXA 5CHAC 2G5NA 2A45B 1GBAA 2O8MA 1C1QA 1O34A 2OC1A 1TRYA 5IYTA 1IQMA 2VVUA 5DG6A 5GJ4B 2ZQ2A 1GHAG 3GCTG 3HGPA 3V3MA 1O31A 1SHYA 1MKWK 5T6DA 2PHBA 1WU1A 1EJAA 1TONA 1GVZA 1MZAA 1C5LH 1GVKB 1TPSA 3HGNA 1GJ9B 1LVYA 1RTLA 3QN7A 2ZCHP 2J95A 1YPHE 1F5KU 5FBIA 1GBBA 4CRGA 1AB9C 1DPOA 1V2RT 2V6NA 3SI3H 2Y81A 5T6GA 1PQ7A 1T4VH 4O3UA 5DGJA 3H7TA 3TJOA 1IQFA 1G3EA 3RXMA 3LIWA 1BBRE 1BTZA 1CBWB 5F8ZA 1KLJH 4HI3A 1TNIA 5A8XA 2H5DA 2ZHFH 1N6XA 1AZ8A 2GD4B 4FU9A 1DY9A 1SSXA 2QXGA 5A0CA 1ACBE 1FV9A 2SNWA 2TIOA 5ETXA 4KTSA 3A7TA 3SU1A 1WYKA 1Z6JH 3R3GB 3E16B 5E2PA 4E06H 2C90B 1OYTH 1T4UH 4YTAA 2FI3E 1A0HB 3V12A 3PLBA 6CHAC 1QQ4A 2O8LA 1RTFB 1ZTJA 1MCTA 4KTUA 4DURA 1TWXB 1SFIA 2VVCA 1N8OB 5E2OA 4DCDA 4JZIA 1BHXF 2FP7B 1CO7E 1BT7A 1AWHB 2QXJA 1K1LA 2AERH 5FX6A 1PFXC 2JH6D 5JB8S 3T29A 1UHBA 1O2QA 1LTOA 4F49A 1Q2WA 1UTJA 4U32A 4D7GA 2CGAA 1IQEA 1ZYOA 2O9QA 1O2OA 1VCPA 1LHFH 1OKXA 3TU7H 5H4IB 1FXYA 4ABBA 1LDTT 4AN7A 4WY3A 5C1YA 2OC8A 1SQTA 1C2JA 1Z7KA 6ESTA 3MNXA 3URDA 2WPIS 1AKSA 1GDUA 1BOQA 1HUTH 1AD8H 3CS0A 1OWKA 3SHCH 1PQ5A 2A7JA 1WTGH 1IHTH 1LQDB 2ANKH 3DA9B 5BRRE 1GI3A 1GJ6A 2C8WB 2D8WA 5EW1H 1GHZA 1MAXA 2XC4A 3ZZ7A 1UMAH 3LGTA 2A4RA 2B0FA 3ZV8A 1V2TT 1EB2A 1Y5UT 3Q76A 1ELAA 5FXLA 1O3JA 3Q00A 5E0JA 4CR9A 1ZSKA 1GI9B 2FMJA 1C1WH 1V2WT 4YESB 3QX5H 5JBCS 2BDBA 3B23B 3UY9A 2CF9H 4A6LA 1BJVA 3NWUA 1O3IA 1P05A 3A83A 1A3EH 1GI8B 1ESTA 4AFQA 1TFXA 2F9VA 3SGBE 1GBTA 4ABDA 1TABE 2GT7A 2FDAA 1OWJA 3JZ1B 3RXFA 1GMDG 3MO3A 4X6MA 3M61U 1SC8U 3A81A 2OUAA 1Y3WA 1A4WH 1ESBA 1S84A 1FZZA 4NA8A 1O3HA 2WPLS 1DOJA 1P09A 3KQBA 3MH4A 4H6SB 1EZQA 3TGJE 1GDNA 4BOHA 3GY6A 3PLKA 4ABAA 1MTWA 1Y3XA 2HLCA 3BN9A 1W3CA 2HWLB 4K8BA 1OX1A 2BQWB 1ZR0A 1UK4A 4FUJA 4SGAE 1ZLRA 2RA0A 5LPFA 2FOGA 2A2XH 2BTCE 4D9RA 3B8JA 1C4V2 3P92A 1QJ6B 2G81E 3UWJH 1KXAA 2FLRH 4Y71A 2AGEX 4UDWH 1S6HA 1TALA 1UJ1A 4GVUA 1SGNE 1OP8A 3RC5A 1YKTA 5C2ZA 3HPTB 3BTWE 1CA0B 2PTNA 4B1TA 1G30B 1YPGH 2Z3EA 1PPGE 5ABWA 3ENSB 2ZFRH 1EP6A 3ZZAA 2PFEA 3P6ZB 4FU8A 3P95A 3URCA 4J1YA 1BITA 1A3BH 3A84A 1QL9A 1Y3UA 1LCYA 1TOMH 1MBQA 1ZGVA 1AMHA 4D7FA 1BRBE 1TBRH 4LXBH 4Q7XA 1IQIA 4Y11E 6LPRA 1B0EA 2A5IA 2O8UA 5C1XA 4J2YB 3SU6A 1EZSC 8ESTE 3SV8A 1O2WA 5JBBS 3RXAA 1GJAB 4ABJA 4I8GA 4X1NU 4DJZB 1HV7A 3F9HA 1GHVH 4THNH 4IBLH 4JYTA 4ZKSU 4WVPE 3A7XA 3M7QA 1K21H 3D23A 1P3CA 2Z9KA 4CRDA 2YNAA 3TGIE 4NIVA 4ZHMU 1UCYH 2BD5A 2EA3A 2BY7X 2Q6FA 1SOZA 2ZDMA 2H6MA 2THFB 1QB1A 1NM6A 3GDVA 3A7YA 5EPYA 1UTOA 3Q3XA 1NC6A 2UUFB 2WINI 1YC0A 3QO6A 1GMHG 3ZZ3A 4K1TA 1ELDE 3KGPA 3S69A 5J4SA 5E0GA 1G3DA 4IW4E 3PM3A 2RA3A 1HAXB 1GL1A 5TCCA 2R3YA 3SBKA 1SI5H 1EPTB 1WBGB 2R0LA 4H42U 1MKXK 1V2ST 2ZTZA 5HGGA 1GJ4H 3UNQA 3O8RA 1ARBA 1HIAB 4RN6A 4Y76A 2GVFA 1K2I1 2W3KA 4MPVA 1RRKA 1J9CH 4R0IA 3Q3KA 1ABJH 4FUGA 3T26A 1YP9A 1TNHA 3UWIA 1O5CB 1GI6A 2FS9A 1WCZA 3S7KB 5LPRA 2UUJB 3LGVA 1D6WA 1O2ZA 1UCYE 5L6NH 2G8TA 2VWLA 3QZRA 2ZQ1A 3SQHE 1OP0A 1O3LA 3MH6A 1SB1H 1CHGA 2PKAB 1EOJA 2TBSA 2XBVA 1YPMH 1RS0A 2A1DB 5EXMA 2GDEH 3P8FA 1C1UH 1QY6A 1AFQC 4XFQA 2ZFPH 1BBRK 2FYRA 4MNXA 2WPJS 3ITIA 2P93A 5ESBA 3SU4A 3KN2A 4KKDA 2M5TA 3RUOA 2TGPZ 2GCTB 2ZCLP 1T8NA 2BXUH 1IQNA 1H1BA 1QGFA 1NRRH 1EATA 1OPHB 2Y80A 3RP2A 1LKBA 4BTUB 3T28A 5J4QA 3BTDE 2FOEA 1UTNA 1PQAA 2CHAC 1AY6H 4NSYA 2BHGA 3RC6A 2NU1E 5SGAE 2FX6A 1INCA 4ZKRU 1O5BB 2JKHA 5JPMH 3NUMA 4K5ZA 1C2EA 1TA2A 2UUKB 1VGCC 5GDSH 1JMOH 2AGGX 4FU7A 2BQ7B 1HAYB 3SJ9A 1MCVA 4ESTE 1E37B 1TQ7B 3L3TA 1IQGA 1TBZH 3K9XB 3BG4B 3SNAA 3SUDA 3MH7A 1EUFA 3MU8A 3E90B 1AO5A 5EPNA 1D3DB 3E1XB 2R2MB 4RKJB 1Y8TA 3S9BA 4NG9H 2WV4A 1NRPH 1MTNC 1C5VA 5T3HA 1DVAH 2PGBB 1SGDE 4JMYA 1MUEB 4WJG2 4AYYB 1HJ9A 5FPTA 4FVBA 1SLWB 1QNJA 2ZU1A 2BY8X 1TGCA 2BDYA 2GCHF 3QDZB 1DITH 2EC9H 5EXLA 5I25A 2AMDA 4H6TA 1YF4A 3UOUA 3ZV9A 2ZHDA 3KEEA 1KLTA 1TMTH 4FUIA 2GV6A 1KLIH 3STIA 2FS8A 1ELVA 2P16A 3PWCA 3E8LA 1DT2A 2FOFA 1TMBH 1C2DA 1DUAA 4NWKA 3GICB 2QAAA 2AS9A 2AEIH 3LGIA 1AWFH 9ESTA 2JETC 2Z6BD 1ETTH 4MPXA 3OTJE 2NU4E 1O2VA 2Y7ZA 4UE7H 4X0WU 3FANA 3SORA 4D8NA 2SFAA 2Q6GA 3QUMP 4R8TB 1B7XB 4Y79A 2W7SA 3SUFA 1L4DA 4B73A 1ZPCA 2Z9LA 3A85A 1HXEH 3GCHB 1CGIE 2Y5GA 1UK3A 1HIAA 1GBKA 2ALVA 1DM4B 1X7AC 3V7TA 2YNBA 1FY4A 5GPIB 3A8BA 1EJNA 1FAXA 2D1JA 2VH0A 5AFZH 2BVRH 1ZGIA 1W2KH 4D76A 3H5CB 2XBWA 4DG4A 3OY6U 1OXGA 1CHOG 1ZPZA 1ETRH 1C1RA 2GDDA 1SGRE 3D65E 4Q7ZA 1GPZA 3AASA 3ODFA 5GIBA 2PKSC 2PKAA 2Y5HA 2BOHB 2XCFA 2ZPRA 3KHVA 4KELA 1YCPH 2FI5E 4MVNA 3BEIB 1U6QA 1JOUB 4ZUHA 2OLGA 1PPCE 4A7IB 1J8AA 2XBXA 4AG1A 3O8DA 1SGFG 4X1RU 1O5FH 2P8OB 3VPKA 3KF2A 4DIIH 3M3SA 5CHAB 1V2MT 4SGBE 1LVOA 3GY8A 1XUGA 3DT0H 4BAQB 3SJIA 2FXRA 1A2CH 1NESE 4X6PA 2FWWA 3FFGA 1HAIH 5CE1A 2H9HA 3MOCA 2EI7A 2ZTYA 3K65B 4MPWA 1C2IA 1ELEE 4MG3A 4U01A 4WH6A 1TGBA 4NSVA 4H4FA 3RM0H 4OGYA 1DWCH 1TGNA 3A82A 1D3PB 4I8KA 1RIWB 1AB9B 2CJIA 2QN5T 4JYVH 3NPSA 1P2QA 4DOQA 2Z7FE 4IN2A 1C5OH 2GMTC 3AAUA 3RXOA 2ZTXA 3TJNA 1BCUH 3W95A 3PMBB 2Z9JA 4NFFA 2QF0A 1ANEA 2F9OA 5GCHF 3SNEA 2QY0B 3TNSA 5FCKA 3MO6A 1QB9A 2FTMA 1A0LA 3BIVH 1YPKH 1BMMH 1BA8B 3LJOA 5E0HA 2ULLA 2BOKA 2GZ8A 2FZZA 3BTGE 3SU3A 3BF6H 5EXNA 1O30A 4NWLA 1TRNA 4LOYH 2WPKS 1AHTH 3PYHA 1C5UA 1JRSA 1JWTA 1KSNA 6CHAB 2WV5A 3MWIU 1HFDA 1TE0A 1MTUA 2VIPA 1F5LA 5EW2H 4GHQA 2ODQA 1TA6A 4VGCC 3BTKE 1XUIA 1VITH 3ESTA 3PO1B 4F4OC 1O2SA 1FUJA 1PJPA 3KQDA 1XVOA 5JYIA 1K28D 2FPZA 4AX9H 1O37A 2A2QH 1MZDA 2ZFSA 2UWPA 1ZJDA 1ANDA 2PW8H 3U69H 1GG6C 2F9BH 4UFDH 2RCEA 1EXFA 5HMAA 3LPRA 2H9TH 1Q3XA 3PV4A 3VEQB 1ZHRA 1O5GH 2ANMH 1GHBF 1OOKB 1DE7H 4XBDA 1DWBH 2XBYA 4ZAEA 2ZHWH 5T6FA 4A1VA 2BDHA 3RXJA 1UCYK 1NFXA 1AQ7A 1V2LT 1HCGA 2ZU4A 9LPRA 2VGCC 1O35A 1P57B 3RU4E 4JK6A 1C5WB 5FCRA 1XUHA 1SGEE 1LVBA 4RSPA 1IAUA 2VWMA 3V0XA 1IQHA 1EASA 1OP2A 1TPPA 3KL6A 4YOJA 1O2KA 3GY5A 4HFPB 2ZFFH 3TK5A 2UUYA 3ATLA 1OWHA 1C2FA 3F9EA 2A4OA 1A61H 2ZU3A 2CMYA 2G4TA 1MMJN 1ZHPA 1YPEH 1ABIH 4NZQA 1BRAA 4CREA 1ZSLA 1GMCF 4I8LA 1KIGH 1O5DH 1FIWA 4AYVB 2PV9B 4IMQA 4X1PU 1W10U 3UQOA 3EQ0H 2F91A 1HAHH 3QK1A 1QL8A 3ZZ9A 5I46H 3OU0A 2VNTA 4CBOA 5EQRA 1UTMA 1HAZB 1ELFA 1MU8B 1DUEA 1TNLA 3NKKA 4A5TS 1AI8H 1CBWC 2A4GA 3DD2H 5DP5A 1KXCA 4B2CA 4A92A 1O3AA 1P3EA 3A8DA 1KXFA 3ATWA 1C4Y2 2TPIZ 3BEFB 1C2GA 3CS7A 3FP7E 2ZGBH 2P3FH 2Z3CA 4K1SA 1Y3YA 2FX4A 1FY1A 1BMAA 1S81A 4MNVA 4B74A 4OS5A 1QQUA 4JYUH 4A1TA 2PR3A 3P17H 1MQ5A 1QURH 4FUBA 1N8OC 1BIOA 2XTTB 1SR5C 4Y0YE 1W7GH 3M5MA 3VXEH 1NU7B 1SGYE 4X8UH 4ABHA 2VWNA 4DW2U 1UVTH 1SLVB 5A8ZA 5L2ZH 2ZPQA 1TIOA 4Q7YA 3U8TH 1QRWA 4IN1A 3RMNH 3SO3A 3E91A 2FEQH 1V2OT 1TBQH 4IC6A 4FUEA 4K1EA 3RXBA 4INKA 4U2WA
chains in the Genus database with same CATH superfamily
2G4UA 4MQAA 4X1QU 5TJXA 2ANWA 1EP5A 1S5SA 1MU6B 3SGQE 1P2NA 1FPHH 5EIYA 1F0SA 4MTBA 3UNSA 1G2MA 2UWLA 5C0TA 2TGAA 1FONA 3HKJB 4YLQH 4Y8XA 1GI7B 4CRFA 3RC4A 3RXCA 2TGDA 1ANCA 3F9GA 1GJ8B 1QA0A 3C1KA 4FUCA 1AE5A 4ISIH 1BMFD 3MFJA 3NK8A 2PGQB 4IC5A 4WMEA 5BPEA 1TYNA 2AHME 2XYAA 4CHAC 3MU5A 2FODA 5FAHA 1YBWA 3M5OA 4I32A 3LKWA 1HDTH 2XW9A 4OGXA 2J9NA 1E0FD 2OQUA 2VIQA 1SLUB 1O2TA 3A89A 3EDXB 2A7HA 3FAOA 5ESTE 4NGAH 4RI0A 4UONA 4JZFH 3SYJA 2J92A 3LONA 3RXPA 3TPIZ 2BZ6H 2C8ZB 3U9AH 3S0NA 5A0BA 4WXVA 1FY8E 3VB6A 2A0QB 2A31A 2B5TB 2PUXB 1LVMA 5AHGH 2BVSH 1O2IA 1GVLA 2PUQH 5KEDA 2VVVA 2PSXA 1QBNA 1O3MA 5FPYA 2H9EH 1P2KA 1SGTA 1T8OA 3HATH 3DFLA 1Z8RA 1K1PA 1AE8H 3RMOH 2BQ6B 2NWNA 1O2UA 1K1MA 2GT8A 3F68H 3GCTF 1O36A 2SGQE 1D9IA 2C8XB 3U98H 2UWOA 3SU0A 3TVJB 1DSUA 2OCVB 1C9TA 3SV2H 1WTHD 4BXWA 2ZP0H 4GHTA 1QJ7B 4IGDA 1O3NA 1GI5A 1O3EA 3SHAH 3S7HB 3RLYH 1OWEA 2ZDAH 1HLTH 1QTFA 1SQAA 3TNTA 5F8TA 4X6NA 3KQEA 2XNIA 1Y59T 2FOCA 2ZC9H 2G52A 1QHRB 4K2YA 1NO9H 1P12E 2SGAA 4WF8A 2STAE 2YMSD 2B8OH 1H8DH 2SNVA 4B76A 3GY4A 1YCPK 1DANH 3T2NA 1S85A 2VB0A 1C5YB 2F9PA 1C5SA 3L33A 2J34A 2ZI2H 2HVXA 4TWYA 4Y10E 2XC0A 4AORA 3RU4D 2IPQX 3P70B 4UD9H 3TJUA 2J2UA 2VIWA 2C4FH 3AK5A 1DLKB 3IITA 4NCYA 3SU5A 4A1XA 2EEKA 2ZDLA 2W26A 2OC0A 2BXTH 3SNCA 2FM2A 3GCOA 1EAWA 3LC5A 1FNIA 1WQVH 1CGHA 2V3MA 2ZA5A 1VGCB 2K8IA 2VIVA 5EG4A 1XXDA 3SI4H 2IOTA 4ZHAA 1JIRA 1P06A 3LOXA 3TH3H 5HM9A 2NU3E 1UK2A 1A1RA 1IHSH 1SL3A 1Z8JB 2W6JD 2XRCA 1QRXA 1F7ZA 5CDFE 1HB0B 3P8NA 4X8TH 3DSPA 1F92A 1GGDC 3I29A 3SJKA 3F1SB 2CN0H 5FPSA 1HPGA 3M3TA 3G01A 2BYAX 1E34B 3K6YA 3TITA 2FTLE 3BTEE 3OX7U 1LKAA 2FOAA 1EQ9A 3D49H 2ZFTA 1BDAA 3S9CA 2BD4A 1MD7A 1SOTA 3M35A 5AVDA 1TB6H 4ZMAH 4CBNA 1VITF 1UTPA 2LPRA 4INHA 5EJZA 1LQEA 2B7DH 2IN2A 1HAPH 1AGJA 1L1GA 1GL0E 2CXVA 4TWWA 3EAJA 3FO8D 3GY7A 1G36A 1VKYA 4K69A 3ZZDA 1SVPA 1WQSA 5LPEA 3RMLH 1O3DA 3UREA 2GV7A 3U1JB 2L6OA 1BZXE 1ZPBA 1GHBG 3BSQA 3Q3YA 4XBBA 4AB8A 5C5NA 3UIRA 3BTTE 2F83A 2GZ7A 1HAVB 2AYWA 3FKSD 3OSYA 1HJ8A 1TLDA 2CK3D 4B75A 3MU1A 5HXFA 2BZAA 1NZQH 1V2JT 5DJ7A 4BANB 1D6RA 1HJAB 2WUBA 2BB4A 4HG6A 3ZZ5A 1ZMNA 5B6OA 3LGWA 1S6FA 1P01A 2ZU5A 2HNTF 1YLDA 4DVAU 2VH6A 2QV1A 4B2AA 1UTKA 3KYGA 3EA8A 4FUDA 3RXUA 1O2HA 3WWFA 1VCQA 3EA7A 3M37A 3UOPA 1H4WA 5C5OA 1A7SA 3UR9A 1T31A 2ZFQH 3SV6A 1P02A 1DS2E 1ZZZA 1GI1A 2EY4C 2OQ5A 2ZEBA 2ZHEH 2G00A 2HPQH 4MLFB 1VZQH 1QJ1B 2RDLA 1GCTB 4YOGA 3TLOA 3GDSA 1SGQE 2ZKSA 5FBEA 4ZKOU 2ZPSA 4I86A 4JK5A 1FLEE 1KY9A 1WSSH 1CU1A 3PWBA 5F6MA 4XOJA 1KXDA 3LU9B 2PKSB 2F4LA 3SZNA 1D4PB 7KMEH 3RXTA 1OS8A 4QT8C 3T5FH 2BDAA 4Y7AA 2OC7A 1BTWA 2BMGB 1O2MA 1T7CA 1YPHC 1GBDA 3R0FA 1ORFA 2G51A 4P00A 2QCYA 1EPTA 1BTYA 2P94A 1WUNH 3N99A 5DK1A 1TMUH 1V2VT 1GDQA 2ALPA 3MH5A 2W7UA 1ZTKA 3DFJA 3T25A 1FPCH 2Y5FA 4GLYA 5DN6D 2FI4E 1O3GA 1HAGE 1ZOMA 2KAIB 2O8WA 1SGPE 3RXKA 1ARCA 1BTPA 2V0BA 3UQVA 3HKIB 3BEUA 1OWDA 3RM2H 2K1QA 2OINA 3VXFH 1Y5AT 2GMTB 4OM9A 4YT7H 1JIMA 1V2PT 1PYTD 1O2XA 4Q63A 2ZG0H 2BVXH 4BAHB 4I8JA 1P2IA 1O32A 1E35B 2DUCA 4JZ1A 4KGAA 1FQ3A 1ELBA 1D3QB 3BTHE 1DICA 1OYQA 1FN6A 2WPHS 4INLA 3N7OA 8LPRA 1SHHB 4ISLA 1P04A 1N6YA 1EB1H 1CE5A 1C1OA 2AMPA 1XUFA 1AFEH 4ZH8A 1COWD 1GJDB 1ID5H 3UFAA 2GTBA 4ZXXH 1LHDH 1DSTA 2AIQA 1TNKA 3D62A 2ODYB 3MI4A 1AKSB 1ESAA 2I6SA 1SGIB 4VGCB 5JB9S 2BD2A 2WYJA 3SJ8A 1XX9A 2ZWLH 3KQ5A 2ZHQH 5DP6A 1PQ8A 1O2LA 5A2MH 5L2YH 5LGOA 1O2YA 3EE7A 1AZZA 1A0JA 3AW1A 2ZF0H 4MPUA 2OTVA 3GCHC 2C3SA 4GCHF 1YPLH 5DKMA 3BV9B 3ZVAA 1GG6B 2DE9A 2R2WU 4Q2KA 1Z6EA 1QBOA 4YM9A 3LGUA 1THRH 4FUHA 3RXSA 1NRSH 2F3CE 1P8VC 1O3FA 1A5GH 5FHTA 1HAVA 4BTIB 4TSFD 1TNGA 3AAVA 4E05H 3TH2H 2J5UA 4BAOB 4FOUC 1W13U 3P8OA 4NA9H 3I78A 5DO4H 2QIQA 1EZXC 3RXLA 4YO9A 5IDKA 3TK9A 2V3OH 4CRCA 1NROH 1W8BH 1DY8A 1P10A 1HAOH 3KCGH 4ASHA 2VGCB 3KQCA 2H1UA 1GJBB 3M7UA 1GBMA 1QFKH 1GBLA 1O39A 5AFYH 2RG3A 4Y7BA 4Y8YA 2DE8A 3QGJA 1TX6A 1JXPA 3GCNA 1O2NA 1GCDA 2FLBH 4BXSA 4TYDA 3SGAE 4NIYA 2CF8H 2HOBA 2A32A 1C5MD 3B9FH 2C8YB 2BLVA 1YLNA 2QF5A 3OYPA 3ZVEA 1TGTA 1S83A 1MH0A 3I77A 1OWIA 2BLWA 2H2ZA 4IMZA 4RKOB 1HBTH 4WMFA 3VGCC 1AVXA 8GCHF 5GWZA 2ZIQH 5C67A 1S6LA 4CRAA 3QTVH 3A80A 1GBCA 1RIWC 1RFNA 3E0PB 4CH2B 2AIPA 1XKAC 4X8VH 2PWXA 3RDZA 3PV2A 3TJVA 4BAMB 2KCPA 1VJAU 2W6ID 3FZZA 1D3TB 3AW0A 3TIUA 3A8CA 2KCYA 2P3UB 2ZU2A 4JZDH 2Y6TA 3ZVBA 3SOSA 5KGOA 1ZMLA 3QZQA 1T8LA 4PROA 3GDUA 1NRQH 1WXRA 1FI8A 1AN1E 2KM0A 1TPOA 3LC3A 1IQKA 1MAYA 3MMGA 1THSH 4ISOA 1BTHH 4ZROA 5EQSA 5L30H 2P59A 1C4U2 2KAIA 1SGCA 4YOIA 3STJA 4AG2A 4NIWA 7ESTE 4UEHH 7GCHF 3A8AA 5JBAS 1GHWH 2HRVA 1E1RD 2BLQA 1TQ0B 1QZ8A 1AVWA 2Z9IA 3M36A 4WXIA 2WPMS 1EX3A 3PLPA 4FUFA 3PO1C 2Q6DA 5EQQA 1V2QT 3EE0B 4LZ4B 1FJSA 2AGIX 3NZIA 1G9IE 3BTFE 3SV7A 3CENA 1K1IA 2ZDVH 1NBME 1P9UA 1V2UT 1WDIA 1C1PA 4HGCA 1F2SE 1LMWB 1KYNA 3LH3A 1L1NA 3GY2A 4AFZA 1RD3B 4LK4A 5HM2A 3MQKC 3W1EA 4X2VA 2ODPA 1S0QA 1AVGH 2EQNA 1GHYH 4GSOA 3UTUH 5A09A 1AUTC 4TPIZ 1BB0B 2Z94A 4O03A 2XXLA 2HNTE 1UVSH 1K1JA 3LT3A 1PYTC 2XCNA 4ZHLU 1J16A 1S82A 1YYY1 1W0ZU 3GYMA 2LNCA 3DSGA 5PTPA 2R0KA 1XVMA 3BIUH 3TH4H 2R3UA 1T32A 1VITG 4B6FA 5DP8A 1AU8A 2NU0E 2W5EA 3L6PA 1C5QA 2QXIA 7LPRA 1O2RA 3OFND 2QYIA 2VJ1A 1BTXA 1E79D 1Z8IB 1TX7A 4WMDA 3MO9A 1OSSA 4O3TA 4XE4A 3UUZA 2VIOA 1QA7A 1E36B 4E7NA 2GGVB 1MTVA 3IWMA 3FP8E 2BX4A 1HRTH 1IQLA 4Y0ZE 3F9FA 2ESTE 1UVOA 2W3IA 1DXWA 4CHAB 2BX3A 4AGKA 1F0TA 3FP6E 5C94A 1CA8B 4UFFH 1LHEH 1LPGB 1P2JA 1MQ6A 1NT1A 4YXWD 3SUEA 6GCHF 3K6ZA 1G32B 3LH1A 4AFUA 4X2XA 5CMXH 5LH8A 2KCOA 1UVUH 3QGNB 4ABFA 4AOQA 1P9SA 1GBFA 5G4BA 1BHXB 1O33A 1CHOF 1LPKB 2ZZUH 3ZZ6A 2J94A 2ZNKH 3RMMH 1NPMA 1NU9A 2OD3B 4AB9A 1O3KA 1BUIA 5C17A 4TPYA 4ABEA 3PMHB 2BDGA 2BD3A 1SQOA 4HZHA 1YCPM 3WW7A 2WYGA 3SU2A 1H8IH 1RGQA 1Z1JA 2D2DA 3A7VA 4U30A 5F53A 5HKKD 1P11E 2J38A 3NCLA 2GCHG 1H9HE 2A4QA 1GI4A 1UTLM 2Y82A 3SJOA 2NU2E 1BJUA 1RXPA 4OS2A 2OBQA 1V6DA 1ELCA 3QTOH 2KCAA 1Z1IA 1HGTH 2R9PA 1DX5M 4DY7B 1KDQB 1V2KT 2ASUB 1XMNB 2FYQA 1FDPA 2STBE 3FVFB 1ETSH 5K0HA 1SFQB 3ZYEA 2A5KA 3PMAB 2D26C 1C2KA 1O2JA 1CSOE 3PTNA 1O5AB 3A88A 4I8HA 4NZLA 3BTME 1THPB 1ZMJA 1F0UA 4I33A 1O3BA 3SN8A 5C1UA 1KTTB 1L4ZA 3PB1E 1G3BA 1SBWA 1NFYA 1QB6A 1K1NA 1NTPA 1MKWH 3JZ2B 1QBVH 1O2GH 1W11U 2AFQB 2G55A 4Z1MD 2EI8A 3UNRA 3ZZ8A 2SGPE 1RJXB 5EGMA 2BM2A 3RXEA 3RXGA 3MNBA 2PSYA 3ZIAD 4TY6A 2SGEE 1J14A 2F9UA 3SV9A 2B9LA 4DT7B 2F43B 2BY9X 2QA9E 1GJCB 2JH5D 1J17T 4ZKNU 1H9LB 1GHAF 3HK3B 3RXHA 2QF4A 1EZUC 1C1TA 2JH0D 2VIDA 3OEHD 3MYWA 1ELTA 1DWEH 1YY3A 2FIRH 3A7WA 3LDXH 1PPHE 3ATMA 1C5ZB 3IG6B 1W12U 3VB4A 2OK5A 1NY22 3CP7A 2JJ1D 3T62A 1EKBB 4B6EA 1PPBH 3TK6A 1CT2E 1K1OA 4O9VA 2CV3A 2GKVE 3ZVGA 1C5TA 4KTCA 1W14U 1CA0C 1RTKA 1AFQB 3M3VA 1UVPA 4X2YA 4AC9A 2IJOB 1A5IA 1GGDB 3M7TA 1P0SH 2O8TA 5FL7D 4BTTB 4YT6H 1P2OA 2TGTA 2XWBI 2QC2A 4ISNA 2FO9A 2VWOA 4OS1A 2Y7XA 5CHBA 3DHKH 4XSKU 1F5RA 1GBJA 1AUJA 2CHAB 3KNXA 1C2HA 4X2WA 1L1JA 4B2BA 1GWAA 1K9OE 3GYLB 1QRZA 3GOVB 4XBCA 2J4IA 1KTSB 3BG8A 1C5RA 4ZCNA 2BLOA 1EAUA 4GCHG 1ZRBA 2HPPH 2G5VA 3PTBA 1BQYA 3U8OH 1PPFE 4CRBA 3DUXH 4OS4A 2BD8A 4YLUA 5EOKA 4D9QA 4KP0A 2A7CA 3H7OA 8KME2 5GCHG 1O3PB 2IPHA 3GISB 2HALA 3Q77A 3ZVFA 4K8YA 1PPZA 1EJMA 3QLPH 4OS7A 1UTQA 1WOFA 1B5GH 4IS5A 3RXDA 1L2EA 2VU8E 2FOBA 4GAWA 5K7RA 1OHHD 3VB5A 1FIZA 1NBMD 1WV7H 3S9AA 2F9NA 4M7GA 1EOLA 3GY3A 2ZGCA 1XUJA 1J15A 1ZSJA 1PPEE 1MTNB 1DXPA 3SQEE 5A0AE 1HNEE 4WWYA 1C5NH 2FOHA 2ZECA 4Q80A 1A46H 1SMFE 1HYLA 3RU4T 1O3CA 4Y8ZA 1VJ9U 3PMJA 1Y5BT 1TRMA 2ZO3H 2ZGJA 1SKYE 3M5NA 3VB7A 1BTUA 4CR5A 2FESH 2VINA 3F2HA 1EPTC 1DFPA 3E3TA 4OS6A 1CGJE 2Z3DA 3KIDU 5A8YA 1YLCA 1GI2A 2A5AA 5C20A 1KDQA 1F0RA 3SNDA 3HK6B 3MU0A 1W0YH 1FMGA 3OY5U 3ODDA 8GCHG 1G2LA 1L0ZA 1ZRKA 1P03A 4AGJA 2XWAA 1KXBA 2GX4A 1C9PA 3UPEA 3WY8A 1XUKA 1NS3A 3EA9A 2RFKC 3MNCA 3RXQA 3OTPA 2JETB 4F48B 4JZEH 4RT1A 5T1VA 4X8SH 4LZ1H 1KXEA 2C93B 2SGDE 4NA7A 3EGKH 3SUGA 1GHXH 3O8BA 1GMDF 3E0NB 1W7XH 1ELGA 4HTCH 1C5PA 1QCPA 2EI6A 4WH8A 3SNBA 1VR1H 2PLXA 3FN8A 4FVDA 1MTSA 2P95A 5DP7A 2AMQA 1MABB 1GBEA 1TOCB 1Y3VA 1O38A 1TX8A 2GCTC 7GCHG 3V13A 1Q31A 1ZHMA 1O2PA 2OP9A 4UFGH 2OXSA 1XKBC 4K60A 4Z6AH 1GMCG 1FN8A 3F0PA 1S0RA 3OEED 1SGFA 4CH8B 3SW2B 2ZDNA 1TGSZ 1V2NT 1DWDH 1H8HD 4FXGH 1HXFH 3ZVDA 4MNYA 1GBIA 3M5LA 4X6OA 5GXPA 3NXPA 5JDUB 1O3OA 2YOLA 3U8RH 2Z9GA 4E7RG 5HYOA 1XXFA 3RXVA 1QIXB 3BTQE 5F03A 1LHCH 1SLXB 1T8MA 1NN6A 1H9IE 1LHGH 3UR6A 2BD7A 2GZ9A 3MTYA 4Z0KA 1C1NA 1C2LA 1FY3A 1DDJA 3A7ZA 2BY5X 3PROA 3LGYA 3VFEA 1WAYB 1LPZB 3BG4C 4NFEA 4XDEA 1C1VH 1ANBA 4X1SU 4AZ2B 1G37A 4MNWA 4I7YH 1YM0A 1Z8GA 1SG8B 2HGTH 1BMNH 2BD9A 2ZDKA 2I6QA 1C1SA 4Y6DA 1TPAE 4ZXYH 1G3CA 1HJAC 3E6PH 4ISHH 3F6UH 3ELAH 1C1MA 1C5XB 1LO6A 2V35A 3LJJA 3U1IB 4AFSA 4UFEH 3P8GA 1NFUA 1SPJA 2YMSC 1CVWH 4XD7D 3K2UA 4K3JA 2GP9B 5EODA 1YGCH 1W0KD 2J98B 1ZTLA 5TCAA 4YZUA 3A87A 5B6LA 3ZVCA 2ZCKP 1H8ED 1N1LA 5EU8A 5AF9H 3MHWU 1BRCE 4MDSA 3W94A 1DLEA 1FAKH 1E38B 3AVZA 4NIXA 3ZZCA 6GCHG 3UB0A 2ZGXH 1VCWA 1UHBB 1GCTC 2ZGHA 2FOMB 4O97A 3TGKE 2OBOA 2TRMA 4JCNA 2PTCE 1TAWA 4I31A 3T27A 2ANYA 1GI0A 1MD8A 2AH4X 3ZYDA 1O5EH 5DP4A 1K22H 5FX5A 5F8XA 1GJ5H 4DIHH 3EYDA 2P3TB 1MKXH 1CT4E 2XC5A 3OAAD 1GMHF 4BAKB 2BDIA 1YPJH 1TNJA 3FOAA 3VB3A 1IOEA 2BY6X 2SGFE 1Z71A 1NFWA 2V3HH 1CQQA 2Q1JA 1AIXH 3MNSA 1B0FA 4ABGA 5DP9A 5DPAA 1CT0E 1JBUH 4B71A 4BNRA 1UO6A 1GJ7B 1XM1A 1EAIA 1BRUP 1C2MA 3FZDA 5DP3A 1A5HA 1V3XA 3ATKA 3RXRA 5C3NA 3A86A 3ZZ4A 1FY5A 5E8EH 3C27B 2HNTC 3VGCB 4DGJA 2ILNA 1BMLA 3MU4A 1M9UA 1GBHA 2BDCA 1QL7A 1IQJA 3DCLA 1JRTA 4ABIA 4GPGA 1QR3E 2QXHA 1BBRH 3O8CA 3RLWH 3ZZBA 2QF3A 4TY7A 1ZJKA 2H5CA 4GUXA 3ATIA 2WUCA 1O0DH 1NRNH 2KX4A 1MBMA 5JBTA 1P2MA 2QGRA 2P8OC 3QWCH 3RXIA 1EAXA 2IJD1 5CHAC 2G5NA 2A45B 1GBAA 2O8MA 1C1QA 1O34A 2OC1A 1TRYA 5IYTA 1IQMA 2VVUA 5DG6A 5GJ4B 2ZQ2A 1GHAG 3GCTG 3HGPA 3V3MA 1O31A 1SHYA 1MKWK 5T6DA 2PHBA 1WU1A 1EJAA 1TONA 1GVZA 1MZAA 1C5LH 1GVKB 1TPSA 3HGNA 1GJ9B 1LVYA 1RTLA 3QN7A 2ZCHP 2J95A 1YPHE 1F5KU 5FBIA 1GBBA 4CRGA 1AB9C 1DPOA 1V2RT 2V6NA 3SI3H 2Y81A 5T6GA 1PQ7A 1T4VH 4O3UA 1W0JD 5DGJA 3H7TA 3TJOA 1IQFA 1G3EA 3RXMA 3LIWA 1BBRE 1BTZA 1CBWB 5F8ZA 1KLJH 4HI3A 1TNIA 5A8XA 2H5DA 2ZHFH 1N6XA 1AZ8A 2GD4B 4FU9A 1DY9A 1SSXA 2J97A 2QXGA 5A0CA 1ACBE 1FV9A 2SNWA 2TIOA 5ETXA 4KTSA 3A7TA 3SU1A 1WYKA 1Z6JH 3R3GB 3E16B 5E2PA 4E06H 2C90B 1OYTH 1T4UH 4YTAA 2FI3E 1A0HB 3V12A 3PLBA 6CHAC 1QQ4A 2O8LA 1RTFB 1ZTJA 1MCTA 2J98A 4KTUA 4DURA 3F2FA 1TWXB 1SFIA 2VVCA 1N8OB 5E2OA 4DCDA 4JZIA 1BHXF 2FP7B 1CO7E 1BT7A 1AWHB 2QXJA 1K1LA 2AERH 5FX6A 1PFXC 2JH6D 5JB8S 3T29A 1UHBA 1O2QA 1LTOA 4F49A 1Q2WA 1UTJA 4U32A 4D7GA 1SQRA 2CGAA 1IQEA 1ZYOA 2O9QA 1O2OA 1VCPA 1LHFH 1OKXA 3TU7H 5H4IB 1FXYA 4ABBA 1LDTT 4AN7A 4WY3A 5C1YA 2OC8A 1SQTA 1C2JA 1Z7KA 6ESTA 3MNXA 3URDA 2WPIS 1AKSA 1GDUA 1BOQA 1HUTH 1AD8H 3CS0A 1OWKA 3SHCH 1PQ5A 2A7JA 1WTGH 1IHTH 1LQDB 2ANKH 3DA9B 5BRRE 1GI3A 1GJ6A 2C8WB 2D8WA 5EW1H 1GHZA 1MAXA 2XC4A 3ZZ7A 1UMAH 3LGTA 2A4RA 2B0FA 5DSFA 3ZV8A 1V2TT 1EB2A 1Y5UT 2XOKD 3Q76A 1ELAA 5FXLA 1O3JA 3Q00A 5E0JA 4CR9A 1ZSKA 1GI9B 2FMJA 1C1WH 1V2WT 4YESB 3QX5H 5JBCS 2BDBA 3B23B 3UY9A 2CF9H 4A6LA 1BJVA 3NWUA 1O3IA 1P05A 3A83A 1A3EH 1GI8B 1ESTA 4AFQA 1TFXA 2F9VA 3SGBE 1GBTA 2GJGA 3OE7D 4ABDA 2L74A 1TABE 2GT7A 2FDAA 1OWJA 3JZ1B 3RXFA 1GMDG 3MO3A 4X6MA 3M61U 1SC8U 3A81A 2OUAA 1Y3WA 1A4WH 1ESBA 1S84A 1FZZA 4NA8A 1O3HA 2WPLS 1DOJA 3NRLA 1P09A 3KQBA 3MH4A 4H6SB 1EZQA 3TGJE 1GDNA 4BOHA 3GY6A 2M2AA 2WSSD 3PLKA 4ABAA 1MTWA 1Y3XA 2HLCA 2KZ4A 1W3CA 2HWLB 3BN9A 4K8BA 1OX1A 2BQWB 1ZR0A 1UK4A 4FUJA 4SGAE 1ZLRA 2RA0A 5LPFA 2XNDD 2FOGA 2A2XH 2BTCE 4D9RA 3B8JA 1C4V2 3P92A 1QJ6B 2LELA 2G81E 3UWJH 1KXAA 2FLRH 4Y71A 4ACAA 2AGEX 4UDWH 1S6HA 1TALA 1UJ1A 4GVUA 3PV5A 1SGNE 1OP8A 3RC5A 1YKTA 5C2ZA 3HPTB 3BTWE 1CA0B 2PTNA 4B1TA 4Q4LA 1G30B 1YPGH 2Z3EA 1PPGE 5ABWA 3ENSB 3WWBA 2ZFRH 1EP6A 3ZZAA 2PFEA 3P6ZB 4FU8A 3P95A 3URCA 4J1YA 1BITA 1A3BH 3A84A 1QL9A 1Y3UA 1LCYA 1TOMH 1MBQA 1ZGVA 1AMHA 4D7FA 1BRBE 1TBRH 4LXBH 4RT0A 4Q7XA 1IQIA 4Y11E 3UAIC 6LPRA 1B0EA 2A5IA 2O8UA 5C1XA 4J2YB 3SU6A 1EZSC 8ESTE 1FX0B 3SV8A 1O2WA 5JBBS 3RXAA 1GJAB 4ABJA 4I8GA 4X1NU 4DJZB 1HV7A 3F9HA 1GHVH 4THNH 4IBLH 4JYTA 4ZKSU 4WVPE 3A7XA 3M7QA 1K21H 3D23A 1P3CA 2Z9KA 5EJ1A 4CRDA 2YNAA 3TGIE 4NIVA 4ZHMU 1UCYH 2BD5A 2EA3A 2BY7X 2WPDD 2Q6FA 1SOZA 2ZDMA 2H6MA 2THFB 1QB1A 1NM6A 3GDVA 3A7YA 5EPYA 1UTOA 3Q3XA 2PP6A 1NC6A 2UUFB 2WINI 1YC0A 3QO6A 1GMHG 3ZZ3A 1K0HA 4K1TA 1ELDE 3KGPA 3S69A 5J4SA 5E0GA 3U28C 1G3DA 4IW4E 3PM3A 2RA3A 1HAXB 1GL1A 5TCCA 2R3YA 2K0QA 3SBKA 1SI5H 1EPTB 1WBGB 2R0LA 4H42U 1MKXK 1V2ST 2ZTZA 5HGGA 1GJ4H 3UNQA 3O8RA 1ARBA 1HIAB 4RN6A 4Y76A 2GVFA 1K2I1 2W3KA 4MPVA 1RRKA 1J9CH 4R0IA 3Q3KA 1ABJH 4FUGA 1UW7A 3T26A 1YP9A 1TNHA 3UWIA 1O5CB 1GI6A 2FS9A 1WCZA 3S7KB 5LPRA 2UUJB 3LGVA 1D6WA 1O2ZA 1UCYE 5GNDA 5L6NH 2G8TA 2VWLA 3QZRA 2ZQ1A 3SQHE 1OP0A 2HLDD 1O3LA 3MH6A 1SB1H 1CHGA 2PKAB 1EOJA 2TBSA 2XBVA 1YPMH 1RS0A 2A1DB 5EXMA 2GDEH 3P8FA 1C1UH 1QY6A 1AFQC 4XFQA 2ZFPH 1BBRK 2FYRA 4MNXA 2WPJS 3ITIA 2P93A 5ESBA 3SU4A 3KN2A 4KKDA 2M5TA 3RUOA 2TGPZ 4DT4A 2GCTB 3CNRA 2ZCLP 1T8NA 2BXUH 1IQNA 1H1BA 1QGFA 1NRRH 1EATA 1OPHB 2Y80A 3RP2A 1LKBA 4BTUB 3T28A 5J4QA 3BTDE 2FOEA 1UTNA 1PQAA 2CHAC 1AY6H 4NSYA 2BHGA 3RC6A 2NU1E 5SGAE 2FX6A 1INCA 4ZKRU 1O5BB 2JKHA 5JPMH 3NUMA 4K5ZA 1C2EA 1TA2A 2UUKB 1VGCC 5GDSH 1JMOH 2AGGX 4FU7A 2BQ7B 5HIZA 1HAYB 3SJ9A 1MCVA 4ESTE 1E37B 1TQ7B 3L3TA 1IQGA 1TBZH 3K9XB 3BG4B 3SNAA 3SUDA 3MH7A 1EUFA 3MU8A 3E90B 1AO5A 5EPNA 1D3DB 3E1XB 2R2MB 4RKJB 1Y8TA 3S9BA 4NG9H 2WV4A 1NRPH 1MTNC 3SZEA 1C5VA 5T3HA 1DVAH 2PGBB 1SGDE 2VBCA 4JMYA 1MUEB 2YMSB 4WJG2 4AYYB 1HJ9A 5FPTA 5KECA 4FVBA 1SLWB 1QNJA 2ZU1A 2BY8X 1TGCA 2BDYA 2GCHF 3QDZB 1DITH 2EC9H 5EXLA 5I25A 2AMDA 4H6TA 1YF4A 3UOUA 3ZV9A 2ZHDA 3KEEA 1KLTA 1TMTH 4FUIA 2GV6A 1KLIH 3VG8A 3STIA 2FS8A 1ELVA 2P16A 3PWCA 5EJLA 3E8LA 1DT2A 2WV9A 2FOFA 1TMBH 1C2DA 1DUAA 4NWKA 3GICB 2QAAA 2AS9A 2AEIH 3LGIA 1AWFH 9ESTA 3H09A 2JETC 2Z6BD 1ETTH 4MPXA 4FETA 3OTJE 2NU4E 1O2VA 2Y7ZA 4UE7H 4X0WU 3FANA 3SORA 4D8NA 2SFAA 2Q6GA 3QUMP 4R8TB 1B7XB 4Y79A 2W7SA 3SUFA 1L4DA 4B73A 1ZPCA 2Z9LA 3A85A 2JIZD 1HXEH 3GCHB 1CGIE 2Y5GA 1UK3A 1HIAA 1GBKA 2KFWA 2ALVA 1DM4B 2HVYB 1X7AC 3V7TA 2YNBA 1FY4A 5GPIB 3A8BA 4P02A 1EJNA 1FAXA 2D1JA 2VH0A 5AFZH 2BVRH 1ZGIA 1W2KH 4D76A 3H5CB 2XBWA 4DG4A 3OY6U 1OXGA 3GS9A 1CHOG 1ZPZA 1ETRH 1C1RA 2GDDA 1SGRE 3D65E 4Q7ZA 1GPZA 3AASA 3ODFA 5GIBA 2PKSC 2PKAA 2Y5HA 3PRBA 2BOHB 2XCFA 2ZPRA 3KHVA 4KELA 1YCPH 2FI5E 4MVNA 3BEIB 1U6QA 1JOUB 4ZUHA 2OLGA 1PPCE 4A7IB 1J8AA 2XBXA 4AG1A 4ASUD 3O8DA 1SGFG 4X1RU 1O5FH 2P8OB 3VPKA 3KF2A 4DIIH 3M3SA 5CHAB 1V2MT 4SGBE 1LVOA 3GY8A 5C0UA 3N7DA 1XUGA 3DT0H 4BAQB 3SJIA 2FXRA 1A2CH 1NESE 4TT3D 4X6PA 2FWWA 5IK2D 3FFGA 1HAIH 5CE1A 2H9HA 3MOCA 2EI7A 2ZTYA 3K65B 4MPWA 1C2IA 1ELEE 4MG3A 4U01A 4WH6A 4M9FA 1TGBA 2RDEA 4NSVA 4H4FA 3RM0H 4OGYA 1DWCH 1TGNA 3A82A 1D3PB 4I8KA 1RIWB 1EFRD 1AB9B 2CJIA 2QN5T 4JYVH 3NPSA 1P2QA 4DOQA 2Z7FE 4IN2A 1C5OH 2GMTC 3AAUA 3RXOA 2ZTXA 3TJNA 1BCUH 3W95A 3PMBB 2Z9JA 4NFFA 2QF0A 1ANEA 2F9OA 5GCHF 3SNEA 2QY0B 3TNSA 5FCKA 3MO6A 1QB9A 2FTMA 1A0LA 3BIVH 1YPKH 1BMMH 1BA8B 3LJOA 5E0HA 2ULLA 2BOKA 2GZ8A 2FZZA 3BTGE 3SU3A 3BF6H 5EXNA 1O30A 4NWLA 1TRNA 4LOYH 2WPKS 1AHTH 3PYHA 2V7QD 1C5UA 1JRSA 1JWTA 2KR7A 1KSNA 6CHAB 2JDID 2WV5A 1HFDA 1TE0A 3MWIU 1MTUA 2VIPA 1F5LA 5EW2H 3F0OA 4GHQA 2ODQA 1TA6A 4VGCC 3BTKE 4F55A 1XUIA 1VITH 3ESTA 3PO1B 4F4OC 1O2SA 1FUJA 1PJPA 3KQDA 1XVOA 5JYIA 1K28D 2FPZA 4AX9H 1O37A 2A2QH 1MZDA 2ZFSA 3KYFA 2UWPA 1ZJDA 1ANDA 2PW8H 3U69H 1GG6C 2F9BH 4UFDH 2RCEA 1EXFA 5HMAA 3LPRA 2H9TH 1Q3XA 3PV4A 3VEQB 1ZHRA 4ACBA 1O5GH 2ANMH 1GHBF 1OOKB 1DE7H 4XBDA 1DWBH 2XBYA 4ZAEA 2ZHWH 5T6FA 1YWUA 2WZQA 4A1VA 2BDHA 3RXJA 1UCYK 1NFXA 1AQ7A 1V2LT 1HCGA 2ZU4A 9LPRA 2VGCC 2QE7D 1O35A 1P57B 3RU4E 4JK6A 1C5WB 5FCRA 1XUHA 1SGEE 1LVBA 4RSPA 1IAUA 2VWMA 3V0XA 1IQHA 1EASA 1OP2A 1TPPA 3KL6A 4YOJA 1O2KA 3GY5A 4HFPB 2ZFFH 3TK5A 2UUYA 3ATLA 1OWHA 1C2FA 3N7EA 3F9EA 2A4OA 1A61H 2ZU3A 2CMYA 2G4TA 1MMJN 1ZHPA 1YPEH 2JJ2D 1ABIH 4NZQA 1BRAA 4CREA 1ZSLA 2WHXA 1GMCF 4I8LA 1KIGH 1O5DH 1FIWA 4AYVB 2PV9B 4IMQA 1E1QD 3PRDA 4X1PU 1W10U 3UQOA 3EQ0H 2F91A 1HAHH 3QK1A 1QL8A 3ZZ9A 5I46H 3OU0A 2VNTA 4CBOA 1KMHB 2LP6A 4XRNA 5EQRA 1UTMA 1HAZB 1ELFA 1MU8B 1DUEA 1TNLA 3NKKA 4A5TS 3DSOA 1AI8H 1CBWC 2A4GA 3DD2H 5DP5A 1KXCA 4B2CA 4A92A 1O3AA 5HIYA 1P3EA 3A8DA 1KXFA 3ATWA 1C4Y2 2TPIZ 3BEFB 1C2GA 3CS7A 3FP7E 2ZGBH 2P3FH 2Z3CA 4K1SA 1Y3YA 2FX4A 1FY1A 1BMAA 1S81A 4MNVA 4B74A 3F3BA 4OS5A 1QQUA 3F2GA 4JYUH 4A1TA 2PR3A 3P17H 1MQ5A 1QURH 4FUBA 1N8OC 1BIOA 2XTTB 1SR5C 4Y0YE 1W7GH 3M5MA 3VXEH 1NU7B 1SGYE 4X8UH 4ABHA 2VWNA 4DW2U 1UVTH 1SLVB 5A8ZA 5L2ZH 2ZPQA 1TIOA 4Q7YA 3U8TH 1QRWA 4IN1A 3RMNH 3SO3A 3E91A 2FEQH 1V2OT 1TBQH 4IC6A 4FUEA 4K1EA 3RXBA 4INKA 4U2WA
chains in the Genus database with same CATH topology
2G4UA 4MQAA 4X1QU 5TJXA 2ANWA 1EP5A 1S5SA 1MU6B 3SGQE 1P2NA 1FPHH 1F0SA 4MTBA 3UNSA 1G2MA 2UWLA 2TGAA 1FONA 3HKJB 4YLQH 4Y8XA 1GI7B 4CRFA 3RC4A 3RXCA 2TGDA 1ANCA 3F9GA 1GJ8B 1QA0A 3C1KA 4FUCA 1AE5A 4ISIH 3MFJA 3NK8A 2PGQB 4IC5A 4WMEA 5BPEA 1TYNA 2XYAA 4CHAC 3MU5A 2FODA 5FAHA 1YBWA 3M5OA 4I32A 3LKWA 1HDTH 2XW9A 4OGXA 2J9NA 1E0FD 2OQUA 2VIQA 1SLUB 1O2TA 3A89A 3EDXB 2A7HA 3FAOA 5ESTE 4NGAH 4UONA 4JZFH 2J92A 3LONA 3RXPA 3TPIZ 2BZ6H 2C8ZB 3U9AH 3S0NA 5A0BA 4WXVA 1FY8E 3VB6A 2A0QB 2A31A 2B5TB 2PUXB 1LVMA 5AHGH 2BVSH 1O2IA 1GVLA 2PUQH 2VVVA 2PSXA 1QBNA 1O3MA 5FPYA 2H9EH 1P2KA 1SGTA 1T8OA 3HATH 3DFLA 1Z8RA 1K1PA 1AE8H 3RMOH 2BQ6B 2NWNA 1O2UA 1K1MA 2GT8A 3F68H 3GCTF 1O36A 2SGQE 1D9IA 2C8XB 3U98H 2UWOA 3SU0A 3TVJB 1DSUA 2OCVB 1C9TA 3SV2H 1WTHD 4BXWA 2ZP0H 4GHTA 1QJ7B 4IGDA 1O3NA 1GI5A 1O3EA 3SHAH 3S7HB 3RLYH 1OWEA 2ZDAH 1HLTH 1QTFA 1SQAA 3TNTA 5F8TA 4X6NA 3KQEA 2XNIA 1Y59T 2FOCA 2ZC9H 2G52A 1QHRB 4K2YA 1NO9H 1P12E 2SGAA 4WF8A 2STAE 2B8OH 1H8DH 2SNVA 4B76A 3GY4A 1YCPK 1DANH 3T2NA 1S85A 2VB0A 1C5YB 2F9PA 1C5SA 3L33A 2J34A 2ZI2H 2HVXA 4TWYA 4Y10E 2XC0A 4AORA 3RU4D 3P70B 4UD9H 3TJUA 2J2UA 2VIWA 2C4FH 1DLKB 3IITA 4NCYA 3SU5A 4A1XA 2EEKA 2ZDLA 2W26A 2OC0A 2BXTH 3SNCA 2FM2A 3GCOA 1EAWA 3LC5A 1FNIA 1WQVH 1CGHA 2ZA5A 1VGCB 2VIVA 5EG4A 1XXDA 3SI4H 2IOTA 4ZHAA 1JIRA 1P06A 3LOXA 3TH3H 5HM9A 2NU3E 1UK2A 1A1RA 1IHSH 1SL3A 1Z8JB 2XRCA 1QRXA 1F7ZA 1HB0B 3P8NA 4X8TH 1F92A 1GGDC 3I29A 3SJKA 3F1SB 2CN0H 5FPSA 1HPGA 3M3TA 3G01A 2BYAX 1E34B 3K6YA 3TITA 2FTLE 3BTEE 3OX7U 1LKAA 2FOAA 1EQ9A 3D49H 2ZFTA 1BDAA 3S9CA 2BD4A 1MD7A 1SOTA 3M35A 5AVDA 1TB6H 4ZMAH 4CBNA 1VITF 1UTPA 2LPRA 4INHA 1LQEA 2B7DH 2IN2A 1HAPH 1AGJA 1L1GA 1GL0E 2CXVA 4TWWA 3EAJA 3GY7A 1G36A 4K69A 3ZZDA 1SVPA 1WQSA 5LPEA 3RMLH 1O3DA 3UREA 2GV7A 3U1JB 1BZXE 1ZPBA 1GHBG 3BSQA 3Q3YA 4XBBA 4AB8A 5C5NA 3UIRA 3BTTE 2F83A 2GZ7A 1HAVB 2AYWA 3OSYA 1HJ8A 1TLDA 4B75A 3MU1A 5HXFA 2BZAA 1NZQH 1V2JT 5DJ7A 4BANB 1D6RA 1HJAB 2WUBA 2BB4A 3ZZ5A 1ZMNA 5B6OA 3LGWA 1S6FA 1P01A 2ZU5A 2HNTF 1YLDA 4DVAU 2VH6A 2QV1A 4B2AA 1UTKA 3EA8A 4FUDA 3RXUA 1O2HA 1VCQA 3EA7A 3M37A 3UOPA 1H4WA 5C5OA 1A7SA 3UR9A 1T31A 2ZFQH 3SV6A 1P02A 1DS2E 1ZZZA 1GI1A 2OQ5A 2ZEBA 2ZHEH 2G00A 2HPQH 4MLFB 1VZQH 1QJ1B 2RDLA 1GCTB 4YOGA 3TLOA 3GDSA 1SGQE 2ZKSA 5FBEA 4ZKOU 2ZPSA 4JK5A 1FLEE 1KY9A 1WSSH 1CU1A 3PWBA 5F6MA 4XOJA 1KXDA 3LU9B 2PKSB 3SZNA 1D4PB 7KMEH 3RXTA 1OS8A 4QT8C 3T5FH 2BDAA 4Y7AA 2OC7A 1BTWA 2BMGB 1O2MA 1T7CA 1YPHC 1GBDA 3R0FA 1ORFA 2G51A 2QCYA 1EPTA 1BTYA 2P94A 1WUNH 5DK1A 1TMUH 1V2VT 1GDQA 2ALPA 3MH5A 2W7UA 1ZTKA 3DFJA 3T25A 1FPCH 2Y5FA 4GLYA 2FI4E 1O3GA 1HAGE 1ZOMA 2KAIB 2O8WA 1SGPE 3RXKA 1ARCA 1BTPA 2V0BA 3UQVA 3HKIB 3BEUA 1OWDA 3RM2H 2K1QA 2OINA 3VXFH 1Y5AT 2GMTB 4YT7H 1JIMA 1V2PT 1PYTD 1O2XA 2ZG0H 2BVXH 4BAHB 4I8JA 1P2IA 1O32A 1E35B 2DUCA 4JZ1A 4KGAA 1FQ3A 1ELBA 1D3QB 3BTHE 1DICA 1OYQA 1FN6A 2WPHS 4INLA 3N7OA 8LPRA 1SHHB 4ISLA 1P04A 1N6YA 1EB1H 1CE5A 1C1OA 2AMPA 1XUFA 1AFEH 4ZH8A 1GJDB 1ID5H 3UFAA 2GTBA 4ZXXH 1LHDH 1DSTA 2AIQA 1TNKA 3D62A 2ODYB 3MI4A 1AKSB 1ESAA 2I6SA 1SGIB 4VGCB 5JB9S 2BD2A 2WYJA 3SJ8A 1XX9A 2ZWLH 2ZHQH 5DP6A 1PQ8A 1O2LA 5A2MH 5L2YH 5LGOA 1O2YA 1AZZA 1A0JA 3AW1A 2ZF0H 4MPUA 2OTVA 3GCHC 2C3SA 4GCHF 1YPLH 5DKMA 3BV9B 3ZVAA 1GG6B 2DE9A 2R2WU 4Q2KA 1Z6EA 1QBOA 4YM9A 3LGUA 1THRH 4FUHA 3RXSA 1NRSH 2F3CE 1P8VC 1O3FA 1A5GH 5FHTA 1HAVA 4BTIB 1TNGA 3AAVA 4E05H 3TH2H 4BAOB 1W13U 3P8OA 4NA9H 3I78A 5DO4H 2QIQA 1EZXC 3RXLA 4YO9A 5IDKA 3TK9A 2V3OH 4CRCA 1NROH 1W8BH 1DY8A 1P10A 1HAOH 3KCGH 4ASHA 2VGCB 3KQCA 2H1UA 1GJBB 3M7UA 1GBMA 1QFKH 1GBLA 1O39A 5AFYH 2RG3A 4Y7BA 4Y8YA 2DE8A 3QGJA 1TX6A 1JXPA 3GCNA 1O2NA 1GCDA 2FLBH 4BXSA 4TYDA 3SGAE 4NIYA 2CF8H 2A32A 2HOBA 1C5MD 3B9FH 2C8YB 2BLVA 3OYPA 3ZVEA 1TGTA 1S83A 1MH0A 3I77A 1OWIA 2BLWA 2H2ZA 4IMZA 4RKOB 1HBTH 4WMFA 3VGCC 1AVXA 8GCHF 5GWZA 2ZIQH 5C67A 4CRAA 3QTVH 3A80A 1GBCA 1RIWC 1RFNA 3E0PB 4CH2B 2AIPA 1XKAC 4X8VH 2PWXA 3RDZA 3TJVA 4BAMB 1VJAU 3FZZA 1D3TB 3AW0A 3TIUA 3A8CA 2P3UB 2ZU2A 4JZDH 2Y6TA 3ZVBA 3SOSA 1ZMLA 3QZQA 1T8LA 4PROA 3GDUA 1NRQH 1FI8A 1AN1E 1TPOA 3LC3A 1IQKA 1MAYA 3MMGA 1THSH 4ISOA 1BTHH 4ZROA 5EQSA 5L30H 2P59A 1C4U2 2KAIA 1SGCA 4YOIA 3STJA 4AG2A 4NIWA 7ESTE 4UEHH 7GCHF 3A8AA 5JBAS 1GHWH 2HRVA 2BLQA 1TQ0B 4WXIA 1AVWA 2Z9IA 3M36A 2WPMS 1EX3A 3PLPA 4FUFA 3PO1C 2Q6DA 5EQQA 1V2QT 3EE0B 4LZ4B 1FJSA 2AGIX 3NZIA 1G9IE 3BTFE 3SV7A 3CENA 1K1IA 2ZDVH 1P9UA 1V2UT 4HGCA 1C1PA 1F2SE 1LMWB 1KYNA 3LH3A 1L1NA 3GY2A 4AFZA 1RD3B 4LK4A 5HM2A 4X2VA 2ODPA 1S0QA 1AVGH 1GHYH 4GSOA 3UTUH 5A09A 1AUTC 4TPIZ 1BB0B 2Z94A 4O03A 2XXLA 2HNTE 1UVSH 1K1JA 3LT3A 1PYTC 2XCNA 4ZHLU 1J16A 1S82A 1YYY1 1W0ZU 3GYMA 2LNCA 5PTPA 2R0KA 1XVMA 3BIUH 3TH4H 2R3UA 1T32A 1VITG 5DP8A 1AU8A 2NU0E 2W5EA 3L6PA 1C5QA 2QXIA 7LPRA 1O2RA 2QYIA 2VJ1A 1BTXA 1Z8IB 4WMDA 1TX7A 3UUZA 3MO9A 1OSSA 4O3TA 4XE4A 2VIOA 1QA7A 1E36B 4E7NA 2GGVB 1MTVA 3IWMA 3FP8E 2BX4A 1HRTH 1IQLA 4Y0ZE 3F9FA 2ESTE 1UVOA 2W3IA 1DXWA 4CHAB 2BX3A 4AGKA 1F0TA 3FP6E 1CA8B 4UFFH 1LHEH 1LPGB 1P2JA 1MQ6A 1NT1A 3SUEA 6GCHF 3K6ZA 1G32B 3LH1A 4AFUA 4X2XA 5CMXH 5LH8A 1UVUH 3QGNB 4ABFA 4AOQA 1P9SA 1GBFA 5G4BA 1BHXB 1O33A 1CHOF 1LPKB 2ZZUH 3ZZ6A 2J94A 2ZNKH 3RMMH 1NPMA 1NU9A 2OD3B 4AB9A 1O3KA 1BUIA 4TPYA 4ABEA 3PMHB 2BDGA 2BD3A 1SQOA 4HZHA 1YCPM 2WYGA 3SU2A 1H8IH 1RGQA 1Z1JA 2D2DA 3A7VA 4U30A 1P11E 2J38A 3NCLA 2GCHG 1H9HE 2A4QA 1GI4A 1UTLM 2Y82A 3SJOA 2NU2E 1BJUA 1RXPA 4OS2A 2OBQA 1V6DA 1ELCA 3QTOH 1Z1IA 1HGTH 2R9PA 1DX5M 4DY7B 1KDQB 1V2KT 2ASUB 1XMNB 2FYQA 1FDPA 2STBE 3FVFB 1ETSH 5K0HA 1SFQB 3ZYEA 2A5KA 3PMAB 2D26C 1C2KA 1O2JA 1CSOE 3PTNA 1O5AB 3A88A 4I8HA 4NZLA 3BTME 1THPB 1ZMJA 1F0UA 4I33A 1O3BA 3SN8A 5C1UA 1KTTB 1L4ZA 3PB1E 1G3BA 1SBWA 1NFYA 1QB6A 1K1NA 1NTPA 1MKWH 3JZ2B 1QBVH 1O2GH 1W11U 2AFQB 2G55A 2EI8A 3UNRA 3ZZ8A 2SGPE 1RJXB 5EGMA 2BM2A 3RXEA 3RXGA 3MNBA 2PSYA 4TY6A 2SGEE 1J14A 2F9UA 3SV9A 2B9LA 4DT7B 2BY9X 2QA9E 1GJCB 2JH5D 1J17T 4ZKNU 1H9LB 1GHAF 3HK3B 3RXHA 1EZUC 1C1TA 2JH0D 2VIDA 3MYWA 1ELTA 1DWEH 3A7WA 2FIRH 3LDXH 1PPHE 3ATMA 1C5ZB 3IG6B 1W12U 3VB4A 1NY22 3CP7A 3T62A 1EKBB 1PPBH 3TK6A 1CT2E 1K1OA 4O9VA 2CV3A 2GKVE 3ZVGA 1C5TA 4KTCA 1W14U 1CA0C 1RTKA 1AFQB 3M3VA 1UVPA 4X2YA 2IJOB 1A5IA 1GGDB 3M7TA 1P0SH 2O8TA 4BTTB 4YT6H 1P2OA 2TGTA 2XWBI 2QC2A 4ISNA 2FO9A 2VWOA 4OS1A 2Y7XA 3DHKH 4XSKU 1F5RA 1GBJA 1AUJA 2CHAB 3KNXA 1C2HA 4X2WA 1L1JA 4B2BA 1GWAA 1K9OE 3GYLB 1QRZA 3GOVB 4XBCA 2J4IA 1KTSB 3BG8A 1C5RA 2BLOA 1EAUA 4GCHG 1ZRBA 2HPPH 2G5VA 3PTBA 1BQYA 3U8OH 1PPFE 4CRBA 3DUXH 4OS4A 2BD8A 4YLUA 5EOKA 4D9QA 4KP0A 2A7CA 3H7OA 8KME2 5GCHG 1O3PB 2IPHA 3GISB 2HALA 3Q77A 3ZVFA 4K8YA 1PPZA 1EJMA 3QLPH 4OS7A 1UTQA 1WOFA 1B5GH 4IS5A 3RXDA 1L2EA 2VU8E 2FOBA 4GAWA 5K7RA 3VB5A 1FIZA 1WV7H 3S9AA 2F9NA 4M7GA 1EOLA 3GY3A 2ZGCA 1XUJA 1J15A 1ZSJA 1PPEE 1MTNB 1DXPA 3SQEE 5A0AE 1HNEE 4WWYA 1C5NH 2FOHA 2ZECA 4Q80A 1A46H 1SMFE 1HYLA 3RU4T 1O3CA 4Y8ZA 1VJ9U 3PMJA 1Y5BT 1TRMA 2ZO3H 2ZGJA 3M5NA 3VB7A 1BTUA 4CR5A 2FESH 2VINA 1EPTC 1DFPA 3E3TA 4OS6A 1CGJE 2Z3DA 3KIDU 5A8YA 1YLCA 1GI2A 2A5AA 5C20A 1KDQA 1F0RA 3SNDA 3HK6B 3MU0A 1W0YH 1FMGA 3OY5U 3ODDA 8GCHG 1G2LA 1L0ZA 1ZRKA 1P03A 4AGJA 2XWAA 1KXBA 2GX4A 1C9PA 3UPEA 3WY8A 1XUKA 1NS3A 3EA9A 3MNCA 3RXQA 2JETB 4JZEH 4X8SH 4LZ1H 1KXEA 2C93B 2SGDE 4NA7A 3EGKH 3SUGA 1GHXH 3O8BA 1GMDF 3E0NB 1W7XH 1ELGA 4HTCH 1C5PA 1QCPA 2EI6A 4WH8A 3SNBA 1VR1H 2PLXA 4FVDA 1MTSA 2P95A 5DP7A 2AMQA 1GBEA 1TOCB 1Y3VA 1O38A 1TX8A 2GCTC 7GCHG 3V13A 1Q31A 1ZHMA 1O2PA 2OP9A 4UFGH 2OXSA 1XKBC 4K60A 4Z6AH 1GMCG 1FN8A 1S0RA 1SGFA 4CH8B 3SW2B 2ZDNA 1TGSZ 1V2NT 1DWDH 4FXGH 1HXFH 3ZVDA 4MNYA 1GBIA 3M5LA 4X6OA 5GXPA 3NXPA 5JDUB 1O3OA 2YOLA 3U8RH 2Z9GA 4E7RG 5HYOA 1XXFA 3RXVA 1QIXB 3BTQE 5F03A 1LHCH 1SLXB 1T8MA 1NN6A 1H9IE 1LHGH 3UR6A 2BD7A 2GZ9A 3MTYA 4Z0KA 1C1NA 1C2LA 1FY3A 1DDJA 3A7ZA 2BY5X 3PROA 3LGYA 3VFEA 1WAYB 1LPZB 3BG4C 4NFEA 4XDEA 1C1VH 1ANBA 4X1SU 4AZ2B 1G37A 4MNWA 4I7YH 1YM0A 1Z8GA 1SG8B 2HGTH 1BMNH 2BD9A