3VPKA

Crystal structure of 6-guanidinohexanoyl trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Crystal structure of 6-guanidinohexanoyl trypsin near the optimum pH reveals the acyl-enzyme intermediate to be deacylated
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vpkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vpkA02
4X2XA 1KLIH 2H6MA 3T25A 4OS6A 1ZHMA 4K69A 2FS8A 4MNWA 2F9BH 3L6PA 1GI9B 3GCTG 3QZRA 1XUGA 1VITG 2FODA 1K1LA 1L1GA 1ZRKA 3VB4A 1N6XA 1SBWA 5JB9S 3BEFB 3VB3A 3T27A 1O3LA 2P93A 2FIRH 1GI7B 3RM0H 1ZGIA 4TYDA 3S69A 3HK6B 1GBDA 3B23B 3ZZ3A 1SSXA 2Z9GA 3KNXA 3SGQE 6LPRA 1V2QT 2BB4A 3RC5A 6CHAB 4YZUA 1EASA 1MBMA 4BXSA 1UVPA 1WU1A 4WVPE 3TK5A 3UNQA 2BY9X 1C1PA 5CHAB 3P92A 1Y3XA 5DG6A 3OYPA 1JBUH 1LDTT 1GJ9B 1KSNA 1G32B 4IMZA 1GMHG 4BAOB 2ZZUH 3TK9A 3U69H 1PQ8A 1EOJA 1DXWA 2XC5A 1ZOMA 3SNDA 4Q7ZA 5FCKA 6GCHF 3EQ0H 2ZIQH 2GT8A 1HAIH 1TABE 2ZQ2A 4DCDA 1AFEH 1H9LB 3B9FH 1F5KU 1ACBE 4B2BA 3PYHA 2ZGHA 1SGRE 1GGDC 1MU6B 4Y76A 1TMTH 1Z6JH 4ABAA 1AVWA 4O3UA 1V2ST 3BV9B 1BRUP 1ETTH 1C5MD 1DY9A 3VB7A 1GCDA 1PPEE 4B2AA 1IQNA 2BDIA 1A7SA 2BD8A 1FNIA 4I8LA 1MTWA 1D4PB 4AYVB 1BCUH 2XWAA 4NIXA 1HLTH 1VCQA 1D3DB 4MVNA 2RG3A 1ZGVA 2XW9A 2EI6A 2O8TA 4D8NA 1F0RA 1G2MA 1O36A 3TJUA 1B0FA 4FUDA 2CMYA 3NK8A 2VIWA 3DA9B 1QB9A 1C2KA 2D26C 3MH5A 3P17H 1O3GA 2SGPE 3UPEA 2WV5A 2LPRA 1EXFA 4XOJA 1ELDE 1GMCF 3ESTA 1MKXK 7GCHF 1A0JA 1HAOH 3A7TA 1SGYE 2HRVA 1XUKA 1MTSA 5ESBA 1PPZA 1S0RA 1SC8U 3HATH 1F0TA 4AOQA 2KAIB 2ZPRA 1H9IE 1OWHA 1QIXB 1TRYA 2WV4A 4X2YA 1SQTA 2Y81A 4HTCH 1TBRH 1O2IA 1FUJA 1KTTB 2FWWA 5LH8A 5C2ZA 3MHWU 4NIWA 3P8NA 4CR9A 5JBBS 1CT2E 3UY9A 4ABIA 3TGJE 3AW0A 1J14A 2BVXH 5EGMA 3MNXA 4F4OC 2Z6BD 3MWIU 4XE4A 1QL9A 1BTWA 2FTLE 2A7JA 1NPMA 3P70B 5J4QA 2LNCA 3MTYA 3ZZ7A 3L3TA 1BMNH 1EJNA 4LOYH 1TBQH 1GJBB 4NSVA 1EZQA 1CGHA 3QLPH 2A2XH 4E7NA 2FYQA 3SUFA 3SV7A 1AKSA 4YLUA 3A7YA 1HJ8A 3ZVGA 1LPZB 1C2MA 1MTNB 4A1XA 4VGCC 3JZ1B 3SW2B 2A5KA 1HRTH 4Y10E 3E6PH 1H9HE 1WUNH 5DPAA 3ZVAA 1KXEA 1O2SA 1YLCA 2BDAA 2BD5A 3H7OA 3UOUA 2ZHEH 2YOLA 5DP4A 4X6OA 3F1SB 1TNIA 1AUJA 1NO9H 1WSSH 2ALPA 4THNH 2FS9A 2B9LA 3FP8E 4DY7B 2AERH 2QXHA 4X1PU 1V2MT 2A31A 4NFFA 2AS9A 2V6NA 2ZGJA 1RIWC 4D7FA 2F3CE 1UTMA 1XX9A 1IQKA 4KTSA 1SHYA 4XBCA 1CHOF 1C5RA 2NU3E 1GJ6A 3NCLA 2F91A 1ZMLA 2G81E 3NPSA 3V3MA 3A83A 3SV9A 2OP9A 2GP9B 4I7YH 2CF9H 4WH6A 2BQ7B 4H4FA 4ZMAH 4DJZB 1TX7A 5DKMA 2B8OH 1EJAA 5GXPA 1F2SE 2FOCA 2AGGX 1MAXA 1ZSJA 2C3SA 2SGDE 4DT7B 2BDHA 2G5VA 1FPHH 4ESTE 1VITH 2IPHA 1PJPA 1OXGA 5FAHA 1ZTLA 1P3CA 1GI6A 1YBWA 1C1RA 3SBKA 6CHAC 1TB6H 4I31A 2VU8E 4O9VA 2HOBA 3BTHE 3LGUA 3DHKH 1QRXA 3MO9A 2GT7A 5CHAC 1O2WA 3LGIA 2A32A 1GDQA 1BB0B 4B71A 5JBTA 1Q31A 1TLDA 3TGKE 3HKJB 3RXHA 2VGCB 5LPFA 5E0HA 1Z8GA 4D76A 1EB2A 1ZTKA 2UWOA 3MOCA 1TX6A 3SNCA 1Q2WA 1BQYA 2PGQB 2JKHA 1MKWK 2AYWA 2FOBA 3RXBA 3SO3A 3RXJA 2VNTA 1GHZA 1JIRA 1HJAB 4ZAEA 5DP9A 4JK5A 1HBTH 1O3JA 1QL7A 1A1RA 1EAXA 1K1OA 2G00A 2ZCLP 4K1TA 4NFEA 2H5DA 1LHDH 3SJKA 1GBKA 3O8BA 2PKSB 1BHXB 1CHGA 4J2YB 1NU9A 1O2KA 1GI1A 3MU1A 1O38A 1WQSA 2STBE 4JYTA 4B2CA 4CR5A 1JRSA 1LKAA 1SGFG 1Z6EA 2XRCA 1MTVA 2IOTA 1O3NA 1DWEH 2ZTYA 2Z94A 1V2KT 2WINI 1QA0A 3LH1A 3BTTE 3GICB 4ABEA 2VH0A 1K1MA 1QJ6B 1NRQH 3RXPA 4DIIH 2ZGXH 5J4SA 4HI3A 1C9TA 1ZPCA 1BZXE 4JZFH 1L4DA 1UK3A 4DW2U 4OS4A 1RTKA 3MO3A 3SNAA 4WH8A 2PW8H 5EG4A 3AAUA 2ULLA 3T29A 1GL0E 3MU0A 5L2YH 3MU8A 2OC1A 1W2KH 1FI8A 4R8TB 3STJA 3HKIB 3E16B 4FU7A 4B73A 2R2MB 4E06H 1TQ0B 1B0EA 1RS0A 2CV3A 3SJ9A 1O3FA 4A92A 1AQ7A 2G5NA 3PLPA 1GBMA 3I77A 1DPOA 3Q3KA 1GHBF 1Y3YA 1Z1JA 2WPHS 3LKWA 3PWBA 1ANCA 3RXTA 2PTCE 3E0NB 2RDLA 4SGBE 2BLOA 1KYNA 2ASUB 3UOPA 2OBQA 3Q77A 2XXLA 4WXVA 2YNAA 4B75A 3TU7H 4CRBA 4WF8A 1Y3WA 3U8OH 1GJCB 2R2WU 1O3DA 2NU0E 3TJOA 1SPJA 3QTOH 3EGKH 1O3PB 1P10A 5K7RA 5DO4H 1J16A 2FOMB 5A8ZA 1SLXB 1SGQE 1DX5M 3TITA 3A7XA 2BQWB 1NY22 1Z7KA 1UTKA 2H1UA 5JBAS 1TA6A 1TNLA 4I8GA 3S7KB 2QIQA 1L0ZA 2EC9H 1TBZH 1P9UA 2ZA5A 1A0LA 5C1XA 2ZFFH 1C5WB 2ZFTA 2Q6GA 3UNSA 1H8DH 3A7WA 1U6QA 5I46H 3LC5A 1IAUA 4J1YA 1HAVB 1DICA 1ZZZA 2VB0A 2BVRH 5HXFA 1P8VC 1O2RA 1G9IE 1QQUA 2W7SA 1MTNC 2GTBA 4CHAB 2P3FH 1NFUA 1FIWA 1ZPBA 2VH6A 3SNEA 1K22H 1AUTC 2OC8A 4AG2A 4Y7BA 1O3AA 2KAIA 3KHVA 5C5NA 2GCHG 1SG8B 2PLXA 1SFIA 3QWCH 5H4IB 1WOFA 3LGTA 5A0AE 3GCHB 2Y7ZA 1K1JA 2FESH 2UWLA 3JZ2B 4KKDA 2A7CA 3SU1A 5L2ZH 3PLKA 2I6QA 3LOXA 3TH2H 3ODDA 3PMAB 2A45B 4TWYA 2XBVA 3A8BA 1ZJDA 1H8IH 3LU9B 3M5NA 4DGJA 4CRFA 5AF9H 3K6ZA 1QGFA 4XBDA 3UNRA 3M7UA 4Q80A 2FDAA 1C1VH 2QCYA 1FY5A 1G3CA 3PLBA 1FLEE 3SOSA 3M5OA 3RXMA 2YNBA 1BHXF 1MCTA 4MG3A 1QRWA 4ZKSU 1DWDH 3UUZA 4O03A 2PKAB 1O3KA 2BHGA 2AMPA 1GDNA 1ZRBA 4LZ4B 4OS7A 2WPJS 4NIYA 1FY3A 1C5PA 3CP7A 4M7GA 2XTTB 3A80A 5TCAA 9LPRA 1V2OT 2BOKA 2ODQA 1KTSB 3D49H 1NFXA 5ESTE 4A1VA 1KLTA 5GPIB 1AU8A 1BTUA 1EATA 3OX7U 3TPIZ 3SJOA 3RXLA 3HGNA 4OS1A 5GJ4B 1ZSLA 4ZUHA 5JPMH 1YCPK 5EXMA 4JMYA 1ELTA 3GY8A 2VGCC 1W11U 5T6DA 3UQVA 2J4IA 1UVUH 2SGEE 3TH4H 1T8NA 2FTMA 4LXBH 2GDEH 3AW1A 3B8JA 3KGPA 1ESTA 1AE8H 3MFJA 4MNYA 2H9EH 1QB1A 3HK3B 1OWIA 3EYDA 4HFPB 3E1XB 5HMAA 2BY7X 1H4WA 1HJAC 3KEEA 1T8MA 4JCNA 1C4V2 3BG4B 2BDGA 5EOKA 2W3KA 5FPSA 3OY5U 1J8AA 1K28D 1TX8A 4IC6A 1C2FA 2UUFB 3PMHB 4DVAU 1HCGA 2ANYA 1HDTH 4E05H 2W7UA 3GYMA 1DXPA 2VIQA 2ODPA 2PKSC 4NSYA 1JXPA 1P2JA 1LMWB 1TPAE 1OS8A 1XM1A 3FP7E 1QA7A 2J92A 3EA9A 1QNJA 3BSQA 1GI4A 1GI8B 2A5IA 3RXQA 1Z71A 2RCEA 1QL8A 3LGYA 1WYKA 1O30A 1UK4A 1UTOA 1A3BH 4ZKOU 4AFUA 2BX4A 2Y5GA 2A4QA 2BMGB 2OD3B 4XSKU 1GWAA 2Y5HA 4FUIA 1HXFH 4KGAA 3CENA 1G37A 1NESE 1CT4E 4UFFH 3K6YA 4JZIA 1XXDA 2QA9E 4MLFB 4AX9H 2VWOA 1C1QA 1T8LA 3SV2H 3MYWA 2AEIH 2FZZA 1MMJN 5A09A 1HYLA 2V0BA 2ZU3A 3M5MA 2WPMS 1ELAA 2HALA 1YPHC 4BTTB 1XUJA 1E35B 2IN2A 1QBOA 3LONA 2R3YA 2O8MA 6ESTA 1W13U 1EPTB 2BLWA 3SJ8A 1EKBB 2JH0D 2XBWA 2W5EA 1S5SA 8GCHF 2FOAA 1LKBA 2CHAB 4ZH8A 1O5BB 3GY7A 4D9RA 3SUGA 4K60A 5CMXH 2A7HA 3ZZAA 2ZTZA 4CREA 4LZ1H 1YYY1 7ESTE 1TPOA 1W12U 3RXVA 3MH7A 4X6PA 3A7ZA 4OGYA 1L4ZA 1HAHH 1Y3UA 2NU1E 3KCGH 2ZU4A 3VXEH 4K3JA 1DANH 3M7QA 3GDVA 5HM9A 5FX6A 1HGTH 1F92A 4JZ1A 4CRCA 5JBCS 4ISLA 4X8VH 1P09A 4MPWA 3MNBA 1YPGH 1VGCB 2PSXA 1C5LH 3F9GA 1O5EH 4IS5A 1WBGB 5HM2A 4K1SA 2V3OH 2FLRH 1GVLA 8KME2 1F5RA 3TJVA 1GJ5H 2GZ7A 2ZHDA 1ZMJA 4CHAC 4K8YA 3VB6A 2QGRA 1C5XB 2FM2A 4AFSA 1W8BH 1AI8H 4FUCA 1HNEE 3G01A 1MKXH 1C1SA 3Q76A 2Y6TA 2AMDA 1BJUA 4FUBA 1HXEH 1NM6A 2ZF0H 3ZVBA 3M36A 1C5UA 4MNXA 3STIA 1GJ7B 2Z3EA 1P2IA 4FU9A 3GY5A 3BN9A 1C5QA 2G4UA 2UWPA 1YPEH 3O8DA 3SI4H 2Y5FA 1T4VH 1O2XA 2QN5T 1N6YA 1JMOH 2Z3CA 3BG8A 3RC4A 1QRZA 5T6GA 1C4U2 2SGAA 1G3EA 1GL1A 4YM9A 1TNKA 2ZFPH 1S85A 1CU1A 1DOJA 1QFKH 1YPLH 1LO6A 1C1TA 1O2YA 4KELA 1EAWA 1Y5BT 4FUHA 2FOHA 2HGTH 2ZHWH 1XUIA 1UVTH 2JH5D 5EPNA 1O34A 1FAXA 3RU4D 2BX3A 2HVXA 1YC0A 2CJIA 4B1TA 1CO7E 4CRAA 1MD7A 1Y5UT 3FP6E 2ZPQA 1CT0E 3AAVA 1IQLA 6GCHG 1LTOA 5TJXA 1V3XA 5E2OA 2FEQH 1O3BA 4ZHLU 1C5VA 4Y8ZA 3UWIA 1HAVA 4BTUB 2A4GA 5C1YA 4H6SB 2P16A 1E36B 1WAYB 1A5HA 3BTGE 4UFEH 5FCRA 3PROA 1H1BA 1O3IA 4AN7A 3URDA 4ZXXH 5C20A 4XFQA 1TGTA 1N8OB 2ZCKP 2ZHFH 2Z9LA 2D8WA 1NROH 2BVSH 2JH6D 2Q1JA 4GSOA 5CE1A 3ZVFA 4MPUA 1UTLM 3E91A 1BRCE 4YOGA 2UUKB 4AGJA 3VPKA 4ASHA 1CE5A 3LPRA 1A5IA 1IQIA 4NWLA 5FBIA 1YM0A 1SGPE 1ZJKA 1MQ6A 2BZ6H 4NZQA 1RTFB 1YLDA 7LPRA 2BY6X 1UTPA 1V2TT 2ZPSA 5F8XA 1HIAB 1GJ8B 2ZO3H 1GCTB 3GCOA 3I78A 3RMNH 1K9OE 3MU5A 3A89A 3BG4C 3HGPA 1GMCG 1TQ7B 4NCYA 7GCHG 1O33A 1S81A 4Z6AH 3GOVB 2A4OA 3BTKE 3SU6A 2BY5X 2PSYA 4I33A 4ISHH 1KLJH 1P3EA 1TONA 3MNCA 1QHRB 3ITIA 2BDYA 2OQUA 1AVGH 1LVBA 2J95A 4X1NU 1QURH 1C1NA 1P04A 1NFWA 3SUEA 1EJMA 2FI3E 3VGCB 3KN2A 3ZZ4A 3ODFA 4ISIH 1OWEA 2DUCA 1PPCE 1F7ZA 3A84A 3M3SA 1GG6B 1RJXB 2BY8X 2IJOB 3KQCA 3NUMA 4IN2A 4AFZA 3Q3YA 2R0LA 2AIQA 2FI5E 1ELGA 1F0SA 3L33A 2BQ6B 5FXLA 3KIDU 3R3GB 4CH8B 2ZWLH 4DG4A 2VJ1A 1V6DA 1A5GH 1VZQH 4MDSA 1O3EA 4R0IA 3NKKA 2CGAA 1YCPM 5AFYH 2ZGBH 4FXGH 3DFJA 3KF2A 2TRMA 3EDXB 3SI3H 1Y8TA 1LPGB 3QZQA 1PPBH 2QF3A 1EP6A 1W0ZU 1IQFA 4Y71A 1WTHD 4DURA 1DLEA 4Y0YE 1O0DH 2ZP0H 1S82A 2CHAC 1YF4A 1GJAB 1MKWH 1DUEA 1BRAA 4JZDH 1ELCA 4XDEA 3E90B 5DP5A 2PUQH 1C4Y2 2CXVA 3LT3A 3S7HB 2FYRA 1EP5A 3FFGA 1WTGH 5FPTA 4IBLH 1UTNA 1MTUA 2V35A 1O2PA 4Y8XA 2VIOA 1NRNH 1P03A 4NG9H 2TGDA 1PQ7A 1DLKB 3T26A 3M37A 4NA7A 1L1JA 1XMNB 2GKVE 3ATMA 2VIDA 2ZEBA 4WJG2 3FANA 1PQ5A 3D65E 3VB5A 3GY4A 4O3TA 4A5TS 3CS0A 4D9QA 1VGCC 2UUJB 1SOZA 1WCZA 1CHOG 4X6MA 1OYTH 2ILNA 1BBRK 3GYLB 4AG1A 4FUFA 1G30B 4HZHA 4GCHF 5LGOA 1ESBA 5E0GA 1GBBA 4AFQA 4NGAH 4MTBA 2QC2A 1P2KA 3T2NA 2DE9A 2GMTB 1XVMA 4RKJB 1Y5AT 5EQQA 1KXFA 2F9NA 3S0NA 3GY6A 2F9PA 1SR5C 1P2MA 5DGJA 2HNTE 1GBJA 3WY8A 1YPKH 1BTHH 1FY1A 2GZ8A 3A85A 3RLYH 4X1RU 1NRRH 1V2VT 1EZUC 1MBQA 1DFPA 1CA0B 5ETXA 1TWXB 1Z1IA 1OKXA 1O2VA 2NU2E 2ANWA 5HYOA 3DT0H 1RXPA 1DSUA 1Z8IB 3LH3A 5AHGH 2ZFRH 3SU0A 2ANMH 5JDUB 2AFQB 3UQOA 1EZSC 1V2UT 1GMDF 2J38A 4BAHB 1C1OA 3P8GA 1KXBA 1W3CA 3UIRA 1GBIA 1A46H 4KP0A 5AVDA 1QR3E 1GI0A 2VINA 1KY9A 1DS2E 1W14U 3QN7A 3LIWA 3T5FH 2OUAA 2RA3A 3ATKA 3M35A 3PO1B 1KXDA 3RXAA 5T6FA 1GBLA 3T62A 1RD3B 1K1PA 1W7XH 2P95A 4TY6A 1V2PT 4XBBA 5E0JA 3U98H 1V2LT 4SGAE 1O2QA 3P6ZB 5A8YA 1OWKA 4D7GA 1ETSH 4Y11E 2EA3A 3MH4A 1N8OC 1ZHPA 5AFZH 1YPMH 1SL3A 3V13A 1DUAA 3ZZ9A 3EE0B 3RXRA 3C1KA 1O2OA 1JWTA 3ATWA 3RMOH 4A6LA 5LPRA 2A0QB 5IDKA 5T3HA 1DWCH 1SMFE 1BMLA 4BNRA 1AVXA 1DITH 1O3CA 2GD4B 1HAGE 3Q3XA 3A86A 4BTIB 4BAMB 1GCTC 3HPTB 3A88A 1AHTH 2ZCHP 4YOIA 1GHAF 1KXAA 5EW1H 1DSTA 1CA8B 3URCA 4K5ZA 1TMUH 4K8BA 2C8YB 2PWXA 7KMEH 2OQ5A 3EA8A 1NZQH 1ZMNA 4I32A 4U32A 1O5GH 1S6HA 1YP9A 1VCPA 2J94A 1OWJA 3VGCC 1GHBG 1QBNA 1VJAU 1UCYK 1NRPH 1O2MA 1GVZA 3PV4A 3T28A 2BM2A 1O2NA 1GI2A 3PTNA 1GG6C 2AGIX 5EXLA 1MZAA 3GY2A 1EUFA 1GBFA 5C1UA 1BT7A 1C5ZB 1P06A 1FQ3A 1TALA 1BTZA 2OCVB 1PFXC 3E8LA 1TPPA 4FVDA 1V2RT 4X0WU 5JB8S 3ZYDA 1YCPH 4DIHH 1C9PA 3UR6A 5FHTA 5BRRE 1DT2A 1O37A 5SGAE 5C3NA 3RXGA 3TGIE 2Z7FE 1W7GH 3W95A 1HIAA 1AWFH 1XVOA 3K9XB 1TOMH 3SQHE 1UTQA 5A2MH 1FXYA 4NA8A 4ABDA 3NWUA 3QGJA 3RDZA 1AIXH 2Q6DA 3BTWE 1MH0A 1SQAA 5FPYA 1O32A 4Y8YA 2G51A 1P11E 4GUXA 2BYAX 2BXUH 3BTQE 4NWKA 1TYNA 2JETB 1AFQB 3U8TH 4E7RG 4MNVA 5F03A 1ESAA 1SB1H 1AKSB 2BD2A 2PTNA 2ZU1A 2QXIA 4LK4A 1BBRE 1ARCA 1OOKB 1J15A 3SV8A 4H6TA 1VJ9U 1LVOA 4AB9A 1GI3A 3U1JB 2GV6A 3QDZB 1GPZA 1O5CB 1RRKA 4UEHH 2P94A 5EQRA 4Q7XA 3ZZ5A 3ELAH 1QJ1B 3N7OA 1JIMA 2XCFA 1AZ8A 2C8ZB 3QUMP 2GVFA 1SLWB 3RXOA 2ZI2H 5E8EH 1AD8H 4K1EA 1THRH 4MPXA 2B7DH 3P95A 5GWZA 5GCHF 1A4WH 2EI8A 3M3TA 2TGTA 2QY0B 1SGNE 4ZKRU 5EXNA 2Q6FA 4ABHA 3ATLA 1MQ5A 4ZXYH 3DD2H 2C93B 2Y7XA 1A0HB 1CA0C 4A7IB 1D6WA 4Q7YA 1SGIB 3LGWA 3SQEE 2B0FA 1X7AC 4IC5A 1AY6H 1MCVA 3U9AH 3MO6A 5IYTA 3GCTF 1CVWH 1XXFA 1VITF 5B6OA 3PMJA 1FN6A 2FPZA 1O3HA 3K65B 3UR9A 1BMMH 1FMGA 1HAZB 4FUJA 3TVJB 3V0XA 1VR1H 1B5GH 4WY3A 4ISOA 5DP8A 5A0BA 2BTCE 2FOFA 2WUCA 1GBAA 2ZHQH 5F6MA 4UE7H 1ANDA 1J17T 1S6FA 3ZVCA 4ZROA 3SGAE 1ZHRA 1MU8B 2QAAA 3PO1C 1P12E 1FONA 1TOCB 2HWLB 5EODA 4X8SH 5ABWA 1EAIA 4FUEA 4JYUH 1P05A 1SQOA 2BD3A 4YO9A 1GMHF 4X2WA 2FOGA 2A5AA 3SU2A 1L2EA 4B76A 4AORA 1WQVH 1SLVB 2STAE 3PB1E 4AZ2B 4NZLA 5DK1A 3M5LA 4GHTA 3A87A 2PFEA 1SI5H 4H42U 4FU8A 4TY7A 3U8RH 3E0PB 4FVBA 3S9CA 1BTPA 3Q00A 3TJNA 2Z9IA 2WYGA 3CS7A 1OX1A 2ZDVH 2ZC9H 5L30H 2ZG0H 4X8TH 4Y0ZE 5JYIA 1KDQB 1MUEB 2HPQH 1C1MA 2BD7A 1T8OA 2VIPA 1IOEA 3ATIA 2BDBA 1P0SH 4UFDH 3D62A 2D2DA 4Z0KA 2BD4A 4RSPA 1V2NT 1FDPA 1OP8A 1C5OH 2QXGA 1BIOA 1SHHB 3FAOA 3F9EA 2ZKSA 1UCYE 1TMBH 5L6NH 3SV6A 4RKOB 3VXFH 1THPB 3F9FA 4A1TA 3ZV8A 1AZZA 5K0HA 1O5AB 1W10U 2P8OB 1LHFH 1TNJA 5BPEA 2XNIA 2FO9A 2W3IA 4TPYA 1O31A 8GCHG 1UO6A 2TBSA 2ZGCA 3IG6B 1GI5A 4U2WA 3GCHC 3ZZDA 2NWNA 1BTYA 1NU7B 1TNGA 1NRSH 1AO5A 5DP6A 5LPEA 2QV1A 3ZYEA 4UFGH 3FZZA 4GVUA 1MAYA 1TGCA 1D6RA 1GVKB 1HB0B 2FXRA 3TNSA 1O5FH 4INLA 3SU4A 1GHVH 5EPYA 2ZU2A 2BD9A 3GISB 1BDAA 3BIVH 3VFEA 1GJDB 4I8HA 3ENSB 1FPCH 1NTPA 1C2DA 8LPRA 1C2JA 3SU5A 2OC7A 3QTVH 3KQBA 4RN6A 1LHCH 1LVYA 1TPSA 1M9UA 2OTVA 3SHCH 3AASA 5F8TA 2NU4E 5G4BA 3PM3A 1RTLA 2GV7A 1OP2A 1FZZA 4U01A 3KQDA 2SFAA 2ZDAH 3KL6A 1G3DA 1P2NA 1AWHB 1OWDA 2JETC 4BXWA 3GDUA 1S83A 1AFQC 1O2ZA 2FP7B 2P3UB 1O2GH 3LDXH 4WMFA 1AB9B 3MU4A 2J9NA 3MNSA 1T7CA 1TE0A 4ZHMU 1C2LA 2VWLA 1VCWA 3ZZ6A 3RM2H 4Q2KA 3RXDA 1BA8B 3RXUA 2TGPZ 3TLOA 1Y3VA 2Z9JA 1B7XB 1E37B 2ZNKH 3OY6U 1E38B 3SN8A 3SORA 3V12A 1P9SA 1C2IA 2B5TB 1UHBB 3QX5H 2H9TH 2ZQ1A 1HFDA 2WPKS 2FX4A 3IITA 1D9IA 2Y82A 1HAYB 2AGEX 2RA0A 4WMDA 3KQEA 1FN8A 3BTME 4X1QU 2PKAA 4F49A 4HGCA 3ZZ8A 1TGSZ 4GPGA 1QJ7B 4ABBA 1ANBA 4UONA 1ZYOA 2SNWA 3MH6A 4B74A 3RXEA 1SGTA 2SNVA 2ZDKA 2UUYA 3BTEE 4X2VA 5EW2H 1ELEE 1D3QB 1RGQA 4CRGA 4YESB 4OS2A 5TCCA 1JRTA 1AE5A 1ZLRA 2H2ZA 1DM4B 1QB6A 1FAKH 3PMBB 4QT8C 1GJ4H 3UTUH 1HAXB 2XBXA 4IW4E 1CBWB 2OBOA 1F0UA 1GBEA 2R9PA 1OP0A 2C4FH 1O2LA 2AH4X 2F9VA 3M7TA 3FVFB 3K2UA 4GAWA 4AB8A 1ORFA 1Z8RA 2D1JA 2OINA 2ZECA 3EA7A 1EPTC 1MZDA 1C5NH 2C8XB 1NFYA 3GDSA 1BBRH 3A8AA 5FBEA 2GCTB 1LHEH 3A8CA 4O97A 2BXTH 4JK6A 1ZR0A 3O8CA 1DWBH 1NC6A 2C8WB 5A0CA 1CGIE 1INCA 1HJ9A 3RP2A 2BZAA 5A8XA 1HUTH 4GHQA 3EAJA 1P57B 4Y6DA 2FOEA 4IN1A 1TGBA 2A2QH 2XWBI 1NS3A 1OPHB 1TNHA 3PWCA 1O2UA 1TAWA 4ZKNU 2ODYB 3TIUA 1ARBA 2CF8H 2ZFSA 4UD9H 3ZZBA 1GHXH 3QK1A 4AYYB 1K1NA 3FZDA 1XUHA 1QBVH 2VWMA 1DE7H 3A7VA 1IHSH 1GBTA 4WMEA 4JYVH 1SGEE 1BTXA 2VVVA 1SGCA 1C5TA 1C2HA 1GHYH 2J2UA 3DFLA 3RUOA 4YT6H 1KXCA 2ZDNA 3BEIB 1TA2A 3A8DA 1PQAA 2P8OC 2R3UA 1SOTA 4MQAA 1LPKB 3A81A 1ETRH 3H7TA 3QGNB 1EPTA 3NXPA 3GCNA 1T4UH 4BANB 2VVUA 2W26A 1D3TB 1BITA 1EQ9A 2XYAA 2PHBA 3SNBA 5I25A 2ZTXA 4WWYA 5DJ7A 1C1UH 2Y80A 2H5CA 3OU0A 2FMJA 1SGDE 4ABGA 1TRNA 3ZVEA 1GHWH 2QF0A 3O8RA 1Z8JB 1GBCA 1OYQA 2I6SA 1T31A 3RU4E 1DY8A 1O2JA 3P8OA 4BOHA 1IQGA 2ANKH 2ZDMA 1O3OA 4K2YA 1PYTC 3BIUH 1S0QA 3ZZCA 1KDQA 3MMGA 1CSOE 1IQMA 2ZDLA 4ZHAA 1C1WH 4CRDA 3SU3A 3M61U 1IQHA 4PROA 3UWJH 2WPLS 4OGXA 2A1DB 1WV7H 2EI7A 3LGVA 1K2I1 2HNTF 4GCHG 3DUXH 1N1LA 1G3BA 2R0KA 1J9CH 2K1QA 1THSH 2C90B 1P2QA 4YOJA 1GDUA 2P3TB 1SLUB 4JZEH 1EOLA 1A2CH 1G36A 1AGJA 1O35A 4WXIA 1UJ1A 1AB9C 1TIOA 4DOQA 1L1NA 2ZFQH 5HGGA 1FY8E 2SGFE 8ESTE 1HV7A 3C27B 3U1IB 1RFNA 1EX3A 2PV9B 4ISNA 1UCYH 1W0YH 1EB1H 4CBNA 1FY4A 2VVCA 2THFB 1V2WT 1CQQA 1UVOA 1QQ4A 3RMMH 2GCHF 5F8ZA 1SFQB 2O9QA 2O8LA 1GMDG 4Y7AA 1XKAC 1Q3XA 5C67A 4FUGA 4TWWA 1HPGA 1PPFE 1NT1A 2XC4A 1ZTJA 3SJIA 3LJJA 3D23A 1ABJH 5DP3A 3I29A 1C2EA 3SHAH 1FJSA 1T32A 2M5TA 1EAUA 1O3MA 5GDSH 3UFAA 2J34A 1QY6A 2AMQA 4NIVA 2EEKA 1PPHE 1O5DH 2Z9KA 2GX4A 2HNTC 2XBYA 5PTPA 1SGFA 2BLQA 3RXCA 3SUDA 2QXJA 4TPIZ 1UK2A 3BTDE 1EZXC 3ZVDA 4Y79A 2TGAA 1GGDB 3IWMA 4I8JA 1CBWC 4KTCA 2O8WA 1E0FD 4YTAA 3OTJE 1LCYA 2DE8A 1O39A 2G55A 1IQEA 3UREA 2ESTE 2H9HA 1BMAA 1UHBA 5E2PA 1GHAG 2BOHB 2VIVA 4INKA 1BRBE 3VEQB 2GZ9A 2F9OA 1LQDB 5EU8A 2GCTC 2SGQE 3M3VA 1BOQA 1TGNA 1LQEA 5C5OA 4X1SU 1ELBA 3TNTA 2Z3DA 1YPHE 4AGKA 1ELVA 2OLGA 1C2GA 3BEUA 1V2JT 2FLBH 2FI4E 4OS5A 4BAKB 1Y59T 3RLWH 1IHTH 1AN1E 1KIGH 4CH2B 2BLVA 1MD8A 2VWNA 5EQSA 3NZIA 4X8UH 1ZPZA 4ABJA 3QO6A 9ESTA 4ABFA 5GIBA 3E3TA 3P8FA 4BAQB 1NN6A 2BDCA 3BF6H 1E34B 1S84A 2WPIS 1A61H 1IQJA 3SZNA 3PTBA 1YKTA 1XKBC 3W94A 2TIOA 2OXSA 1G2LA 2OC0A 1FIZA 4X6NA 1YGCH 1D3PB 2F83A 1ELFA 3S9BA 3MI4A 1O2HA 3OSYA 4UDWH 2XC0A 1C5YB 2GMTC 1QCPA 3TK6A 1YPJH 2HLCA 2GGVB 1DDJA 5FX5A 1LVMA 2ALVA 5DP7A 4MPVA 4GLYA 2XCNA 1O2TA 1ID5H 1ZSKA 2HPPH 3F6UH 2P59A 2PUXB 3RU4T 3A82A 1LHGH 1P01A 3RMLH 1UVSH 2G4TA 1C5SA 3RXSA 2TPIZ 1XUFA 4IMQA 2F9UA 2QYIA 2ZU5A 4CBOA 2PGBB 4INHA 3AVZA 4YT7H 1K1IA 1P2OA 3SGBE 3F9HA 4U30A 1DVAH 1TFXA 4YLQH 4NA9H 4VGCB 2CN0H 2G8TA 2AIPA 3BTFE 3S9AA 4I8KA 1P02A 3LC3A 2G52A 4KTUA 2GDDA 3TH3H 2WUBA 3H5CB 2WYJA 1GBHA 1UTJA 1AMHA 3GY3A 1CGJE 1ABIH 1UMAH 1OSSA 1HAPH 2FX6A 2O8UA 2PR3A 2A4RA 2V3HH 3R0FA 1PPGE 1K21H 1SVPA 1FV9A 5GCHG 3RXFA 1RIWB 1PYTD 1ANEA 4IGDA 3V7TA 3RC6A 1QTFA 1TRMA 3RXIA 3RXKA 1JOUB 1BUIA 3F68H 3ZV9A 1A3EH 3LJOA 1BJVA 1F5LA
chains in the Genus database with same CATH superfamily
4X2XA 1KLIH 5CDFE 2H6MA 3T25A 4OS6A 1ZHMA 4K69A 2FS8A 4MNWA 2F9BH 3L6PA 1GI9B 3GCTG 3QZRA 1XUGA 1VITG 2FODA 1K1LA 1L1GA 1ZRKA 3VB4A 2KFWA 1N6XA 1SBWA 5JB9S 3BEFB 3VB3A 3T27A 1O3LA 2P93A 2FIRH 1GI7B 2KCYA 3RM0H 1ZGIA 4TYDA 3S69A 3HK6B 1GBDA 3B23B 3ZZ3A 1SSXA 2Z9GA 3KNXA 3SGQE 6LPRA 1V2QT 2BB4A 3RC5A 6CHAB 4YZUA 1EASA 1MBMA 4BXSA 1UVPA 1WU1A 3DSGA 4WVPE 3TK5A 3UNQA 2BY9X 1C1PA 5CHAB 3P92A 1Y3XA 5DG6A 3OYPA 1JBUH 1LDTT 1GJ9B 1KSNA 1G32B 4IMZA 1GMHG 4BAOB 2ZZUH 3TK9A 3U69H 1PQ8A 1EOJA 1DXWA 2XC5A 1ZOMA 3SNDA 4Q7ZA 5FCKA 1SKYE 6GCHF 3EQ0H 2ZIQH 2GT8A 1HAIH 1TABE 2ZQ2A 4DCDA 1AFEH 1H9LB 3B9FH 1F5KU 1ACBE 4B2BA 1NBMD 3PYHA 2ZGHA 1SGRE 1GGDC 1MU6B 4Y76A 1TMTH 4ASUD 1Z6JH 4ABAA 1AVWA 4O3UA 1V2ST 3BV9B 1BRUP 1ETTH 1C5MD 1DY9A 3VB7A 1E1RD 1GCDA 1PPEE 4B2AA 1IQNA 2BDIA 1A7SA 2BD8A 1FNIA 4I8LA 1MTWA 1D4PB 4AYVB 1BCUH 2XWAA 4NIXA 1HLTH 1VCQA 1D3DB 4MVNA 2RG3A 5KECA 1ZGVA 2XW9A 2EI6A 2O8TA 4D8NA 2WSSD 1F0RA 1G2MA 1O36A 3TJUA 1B0FA 2K8IA 4FUDA 2CMYA 3NK8A 2GJGA 2VIWA 3DA9B 1QB9A 1C2KA 2D26C 3MH5A 3P17H 1O3GA 2SGPE 3UPEA 2WV5A 2LPRA 1EXFA 4XOJA 1ELDE 1GMCF 3ESTA 2V7QD 1MKXK 7GCHF 1A0JA 1HAOH 3A7TA 1SGYE 2HRVA 2JJ2D 1XUKA 1MTSA 2YMSD 5ESBA 1PPZA 1S0RA 1SC8U 3HATH 1F0TA 4AOQA 2KAIB 2ZPRA 1H9IE 1OWHA 1QIXB 1TRYA 2WV4A 4X2YA 1SQTA 2HLDD 2Y81A 4HTCH 1TBRH 1O2IA 1FUJA 1KTTB 2FWWA 3AK5A 3UB0A 3EE7A 5LH8A 5C2ZA 3MHWU 4NIWA 3P8NA 4CR9A 5JBBS 1CT2E 3UY9A 4ABIA 3TGJE 3AW0A 1J14A 2BVXH 5EGMA 3MNXA 4F4OC 2Z6BD 3MWIU 4XE4A 1QL9A 3WW7A 1BTWA 2FTLE 2A7JA 1NPMA 3P70B 5EIYA 2LNCA 5J4QA 2KCAA 3MTYA 3ZZ7A 3L3TA 1BMNH 1EJNA 2W6JD 4LOYH 1TBQH 1GJBB 4NSVA 1EZQA 1CGHA 3QLPH 2A2XH 4E7NA 2FYQA 3SUFA 3SV7A 1AKSA 4YLUA 3A7YA 1HJ8A 3ZVGA 1LPZB 1C2MA 1MTNB 4A1XA 4VGCC 2L6OA 3JZ1B 3SW2B 2A5KA 1HRTH 4Y10E 3E6PH 1H9HE 1WUNH 1WDIA 5DPAA 3ZVAA 1KXEA 1O2SA 1YLCA 2BDAA 2BD5A 3H7OA 3UOUA 2ZHEH 2YOLA 5DP4A 4X6OA 3F1SB 1TNIA 2QF4A 1AUJA 1NO9H 1WSSH 2ALPA 4THNH 2FS9A 2B9LA 3FP8E 4DY7B 2AERH 2QXHA 4X1PU 1V2MT 2A31A 4NFFA 2AS9A 2V6NA 2ZGJA 1RIWC 4D7FA 2F3CE 1UTMA 1XX9A 1IQKA 4KTSA 2OK5A 1SHYA 4XBCA 1CHOF 1C5RA 2NU3E 1GJ6A 3DSPA 3NCLA 2F91A 1ZMLA 2G81E 3NPSA 3V3MA 3A83A 3SV9A 2OP9A 2GP9B 4I7YH 2CF9H 4WH6A 2BQ7B 4H4FA 4ZMAH 4DJZB 1TX7A 5DKMA 2B8OH 1EJAA 5GXPA 1F2SE 2FOCA 1WXRA 2AGGX 1MAXA 1ZSJA 2C3SA 2SGDE 4DT7B 2BDHA 2G5VA 1FPHH 4ESTE 1VITH 2IPHA 1PJPA 1OXGA 5FAHA 1ZTLA 1P3CA 1GI6A 1YBWA 1C1RA 3SBKA 6CHAC 1TB6H 4I31A 2VU8E 4O9VA 2HOBA 3BTHE 3LGUA 3DHKH 1QRXA 3MO9A 2GT7A 5CHAC 1O2WA 3LGIA 2A32A 1GDQA 1BB0B 3OE7D 4B71A 5JBTA 1Q31A 1TLDA 3TGKE 3HKJB 3RXHA 2VGCB 5LPFA 5E0HA 1Z8GA 4D76A 1EB2A 1ZTKA 2UWOA 3MOCA 1TX6A 3SNCA 1Q2WA 1BQYA 2PGQB 2JKHA 1MKWK 2AYWA 2FOBA 3RXBA 3SO3A 3RXJA 2VNTA 1GHZA 1JIRA 1HJAB 4ZAEA 5DP9A 4JK5A 1HBTH 1O3JA 1QL7A 1A1RA 1EAXA 1K1OA 2G00A 2F4LA 2ZCLP 4K1TA 4NFEA 2H5DA 1LHDH 3SJKA 1GBKA 3O8BA 2PKSB 1BHXB 1CHGA 4J2YB 1NU9A 1O2KA 1GI1A 3MU1A 1O38A 1WQSA 2STBE 4JYTA 4B2CA 4CR5A 1JRSA 1LKAA 1SGFG 1Z6EA 2XRCA 1MTVA 2IOTA 1O3NA 1DWEH 2ZTYA 2Z94A 1V2KT 2WINI 1QA0A 3LH1A 3BTTE 3GICB 4ABEA 2VH0A 1K1MA 1QJ6B 1YWUA 1NRQH 3RXPA 4DIIH 2ZGXH 5J4SA 4HI3A 1C9TA 1ZPCA 1BZXE 4JZFH 1L4DA 1UK3A 4DW2U 4OS4A 5EJLA 1RTKA 5FL7D 2J98B 3MO3A 3SNAA 4WH8A 2PW8H 5EG4A 3AAUA 2ULLA 3T29A 1GL0E 3MU0A 5L2YH 3MU8A 2OC1A 1W2KH 1FI8A 4R8TB 3STJA 3HKIB 3E16B 4FU7A 4B73A 2R2MB 4E06H 1TQ0B 1B0EA 1RS0A 2CV3A 3SJ9A 1O3FA 3W1EA 4A92A 1AQ7A 2G5NA 3PLPA 1GBMA 3I77A 1DPOA 3Q3KA 1GHBF 1Y3YA 1Z1JA 2WPHS 3LKWA 3PWBA 1ANCA 3RXTA 2PTCE 3E0NB 2RDLA 4SGBE 2BLOA 1KYNA 2ASUB 3UOPA 2OBQA 3Q77A 2XXLA 4WXVA 2YNAA 4B75A 3TU7H 4CRBA 4WF8A 1Y3WA 3U8OH 1GJCB 2R2WU 1O3DA 2NU0E 3TJOA 1SPJA 1VKYA 3QTOH 3EGKH 1O3PB 1P10A 5K7RA 5DO4H 1J16A 2FOMB 5A8ZA 1SLXB 1SGQE 1DX5M 3TITA 3A7XA 2BQWB 1NY22 1Z7KA 1UTKA 2RDEA 2H1UA 5JBAS 1TA6A 1TNLA 4I8GA 3S7KB 2QIQA 1L0ZA 2EC9H 1TBZH 1P9UA 2ZA5A 1A0LA 5C1XA 2ZFFH 1C5WB 2ZFTA 2XNDD 2Q6GA 3UNSA 1H8DH 3A7WA 1U6QA 5I46H 3LC5A 1IAUA 4J1YA 1HAVB 1DICA 1ZZZA 2VB0A 2BVRH 5HXFA 1P8VC 1O2RA 1G9IE 1QQUA 2W7SA 1MTNC 2GTBA 4CHAB 2P3FH 1NFUA 1FIWA 3N7DA 1ZPBA 2VH6A 3SNEA 1K22H 1AUTC 4FOUC 2OC8A 4AG2A 4Y7BA 1O3AA 2KAIA 3KHVA 5C5NA 2GCHG 1SG8B 2PLXA 1SFIA 3QWCH 5H4IB 1WOFA 2KM0A 3LGTA 5A0AE 3GCHB 2Y7ZA 1K1JA 2FESH 2UWLA 3JZ2B 4KKDA 2A7CA 3SU1A 5L2ZH 3PLKA 2I6QA 3LOXA 3TH2H 3ODDA 3PMAB 2A45B 3FKSD 4TWYA 2XBVA 3A8BA 1ZJDA 1H8IH 3LU9B 3M5NA 4DGJA 4CRFA 5AF9H 3K6ZA 1QGFA 4XBDA 3UNRA 2QE7D 3M7UA 4Q80A 2FDAA 1C1VH 2QCYA 1FY5A 1G3CA 3PLBA 1FLEE 3SOSA 3M5OA 3RXMA 2YNBA 1BHXF 1MCTA 4MG3A 1QRWA 4ZKSU 1DWDH 3UUZA 4O03A 2PKAB 1O3KA 2BHGA 2AMPA 1GDNA 1ZRBA 4LZ4B 4OS7A 2WPJS 4NIYA 1FY3A 1C5PA 3CP7A 4M7GA 2XTTB 3A80A 5TCAA 9LPRA 1V2OT 2BOKA 2ODQA 1KTSB 4TT3D 3D49H 1NFXA 5ESTE 4A1VA 1KLTA 5GPIB 1AU8A 1BTUA 1EATA 3OX7U 3TPIZ 3SJOA 3RXLA 3HGNA 4OS1A 5GJ4B 1ZSLA 4ZUHA 5JPMH 1YCPK 5EXMA 4JMYA 1ELTA 3GY8A 2VGCC 1W11U 5T6DA 3UQVA 2J4IA 1UVUH 2SGEE 3FN8A 3TH4H 1T8NA 2FTMA 4LXBH 2GDEH 3AW1A 3B8JA 3KGPA 1ESTA 1AE8H 3MFJA 4MNYA 2H9EH 1QB1A 3HK3B 1OWIA 3EYDA 4HFPB 3E1XB 5HMAA 2BY7X 2KR7A 1H4WA 1HJAC 3KEEA 1T8MA 4JCNA 1C4V2 3BG4B 2BDGA 5EOKA 2W3KA 5FPSA 5C0UA 3OY5U 1J8AA 1K28D 1TX8A 4IC6A 1C2FA 2UUFB 3PMHB 4DVAU 1HCGA 2ANYA 1HDTH 4E05H 2W7UA 3GYMA 1DXPA 2VIQA 4B6FA 2ODPA 2PKSC 4NSYA 1JXPA 1P2JA 1LMWB 1TPAE 1OS8A 1XM1A 3FP7E 1QA7A 2J92A 3EA9A 2IJD1 1QNJA 3BSQA 1GI4A 1GI8B 2A5IA 3RXQA 1Z71A 2RCEA 1QL8A 3LGYA 1WYKA 1O30A 1UK4A 1UTOA 1A3BH 4ZKOU 4AFUA 2BX4A 2Y5GA 2A4QA 2BMGB 2OD3B 4XSKU 1GWAA 2Y5HA 4FUIA 1HXFH 4KGAA 3CENA 1G37A 1NESE 1CT4E 4UFFH 3K6YA 4JZIA 1XXDA 2QA9E 4MLFB 4AX9H 2VWOA 1C1QA 1T8LA 5HIZA 3F2HA 3MYWA 3SV2H 2AEIH 2FZZA 1MMJN 5A09A 3F0OA 1HYLA 2V0BA 2ZU3A 3M5MA 2WPMS 1ELAA 2HALA 1YPHC 4BTTB 1XUJA 1E35B 2IN2A 1QBOA 1OHHD 3LONA 1BMFD 2R3YA 2O8MA 6ESTA 1W13U 1EPTB 2BLWA 3SJ8A 1EKBB 2JH0D 2XBWA 5C17A 5DSFA 2W5EA 1S5SA 8GCHF 4RT0A 2FOAA 1LKBA 2CHAB 4ZH8A 1O5BB 3GY7A 4D9RA 3SUGA 4K60A 5CMXH 2A7HA 3ZZAA 2ZTZA 4CREA 2J5UA 4LZ1H 1YYY1 3OTPA 7ESTE 1TPOA 1W12U 3RXVA 3MH7A 4X6PA 3A7ZA 4OGYA 1L4ZA 1HAHH 4P00A 1Y3UA 2NU1E 3KCGH 2ZU4A 5HKKD 3VXEH 4K3JA 1DANH 3M7QA 2WPDD 4OM9A 2KCPA 3GDVA 5HM9A 5FX6A 1HGTH 1F92A 4JZ1A 4CRCA 5JBCS 4ISLA 4X8VH 1P09A 4MPWA 3MNBA 1YPGH 1VGCB 2PSXA 1C5LH 3F9GA 1O5EH 4IS5A 1WBGB 5HM2A 4K1SA 2V3OH 2FLRH 1GVLA 8KME2 1F5RA 3TJVA 1GJ5H 2GZ7A 2ZHDA 2J98A 1ZMJA 4CHAC 4K8YA 3VB6A 2QGRA 1C5XB 2FM2A 4AFSA 4P02A 1W8BH 3OAAD 1AI8H 4FUCA 1HNEE 3G01A 1MKXH 1C1SA 3Q76A 2Y6TA 2AMDA 1BJUA 4FUBA 1HXEH 1NM6A 2M2AA 2WHXA 2ZF0H 3ZVBA 3M36A 1C5UA 4MNXA 3STIA 1GJ7B 2Z3EA 1P2IA 4FU9A 3GY5A 3BN9A 1C5QA 2G4UA 2UWPA 1YPEH 3O8DA 3SI4H 2Y5FA 1T4VH 1O2XA 2QN5T 3WWBA 1N6YA 2AHME 1JMOH 2Z3CA 3BG8A 3RC4A 1QRZA 5T6GA 1C4U2 2SGAA 1G3EA 1GL1A 4YM9A 1TNKA 2ZFPH 1S85A 1CU1A 1DOJA 1QFKH 1YPLH 1LO6A 1C1TA 1O2YA 4KELA 1EAWA 1W0KD 1Y5BT 4FUHA 2LP6A 2FOHA 2HGTH 2ZHWH 1XUIA 1UVTH 2JH5D 5EPNA 1O34A 1FAXA 3RU4D 2BX3A 2IPQX 2HVXA 1YC0A 2CJIA 4B1TA 1CO7E 4CRAA 1MD7A 1Y5UT 3FP6E 2ZPQA 1CT0E 3AAVA 1IQLA 1K0HA 6GCHG 1LTOA 5TJXA 1V3XA 5E2OA 2FEQH 1O3BA 4ZHLU 1C5VA 4Y8ZA 3UWIA 1HAVA 4BTUB 3PV5A 2A4GA 5C1YA 4H6SB 2P16A 1E36B 1WAYB 1A5HA 3BTGE 4UFEH 5FCRA 3PROA 1H1BA 1O3IA 4AN7A 3URDA 4ZXXH 5C20A 4XFQA 1TGTA 1N8OB 2ZCKP 2ZHFH 2Z9LA 2D8WA 1NROH 2BVSH 2JH6D 2Q1JA 4GSOA 5CE1A 3ZVFA 4MPUA 1UTLM 3E91A 1BRCE 4YOGA 2UUKB 4AGJA 3VPKA 4ASHA 1CE5A 5KGOA 3LPRA 1A5IA 1IQIA 4NWLA 5FBIA 1YM0A 1SGPE 3SZEA 1ZJKA 1MQ6A 2BZ6H 5EJ1A 4NZQA 1RTFB 1YLDA 7LPRA 2BY6X 1UTPA 1V2TT 2ZPSA 5F8XA 1HIAB 1GJ8B 2ZO3H 1GCTB 3GCOA 3I78A 3RMNH 1K9OE 3MU5A 3A89A 3BG4C 3HGPA 1GMCG 1TQ7B 4NCYA 7GCHG 1O33A 1S81A 4Z6AH 3GOVB 2A4OA 3BTKE 3SU6A 2BY5X 2PSYA 4I33A 4ISHH 1KLJH 1P3EA 1TONA 3MNCA 1QHRB 3ITIA 2BDYA 2OQUA 1AVGH 2W6ID 1LVBA 2J95A 4X1NU 1QURH 1C1NA 1P04A 1NFWA 3SUEA 1EJMA 1COWD 2FI3E 3VGCB 3KN2A 3ZZ4A 3ODFA 4ISIH 1OWEA 2DUCA 1PPCE 1F7ZA 4B6EA 3A84A 3M3SA 1GG6B 1RJXB 2BY8X 2IJOB 3KQCA 3NUMA 4IN2A 4AFZA 3Q3YA 2R0LA 2AIQA 2FI5E 1ELGA 1F0SA 3L33A 2BQ6B 5FXLA 3KIDU 3R3GB 4CH8B 2ZWLH 4DG4A 2VJ1A 1V6DA 1A5GH 1VZQH 4MDSA 1O3EA 4R0IA 3NKKA 2CGAA 1YCPM 5AFYH 2ZGBH 4FXGH 3DFJA 3KF2A 2TRMA 3EDXB 1FX0B 3SI3H 1Y8TA 1LPGB 3QZQA 1PPBH 2QF3A 1KMHB 4TSFD 1EP6A 1W0ZU 1IQFA 4Y71A 1WTHD 4DURA 1DLEA 4Y0YE 1O0DH 2ZP0H 1S82A 2CHAC 1YF4A 1GJAB 1MKWH 1DUEA 1BRAA 4JZDH 1ELCA 4XDEA 3E90B 3U28C 5DP5A 2PUQH 1C4Y2 2CXVA 3LT3A 3S7HB 2FYRA 1EP5A 3FFGA 1WTGH 5FPTA 4IBLH 1UTNA 1MTUA 2V35A 1O2PA 4Y8XA 2VIOA 1NRNH 1P03A 4NG9H 2TGDA 1PQ7A 1DLKB 3T26A 3M37A 4NA7A 1L1JA 1XMNB 2GKVE 3ATMA 2VIDA 4Q4LA 2ZEBA 4WJG2 3FANA 1PQ5A 3D65E 3VB5A 3GY4A 4O3TA 3PRDA 4A5TS 3CS0A 4D9QA 1VGCC 2UUJB 1SOZA 1WCZA 1NBME 1CHOG 4X6MA 1OYTH 2ILNA 1BBRK 3GYLB 4AG1A 4FUFA 1G30B 4HZHA 4GCHF 5LGOA 1ESBA 5E0GA 1GBBA 4AFQA 4NGAH 4MTBA 2QC2A 1P2KA 3T2NA 2DE9A 2GMTB 1XVMA 2XOKD 4RKJB 1Y5AT 5EQQA 1KXFA 2F9NA 3S0NA 3GY6A 5HIYA 2F9PA 5EJZA 2RFKC 1SR5C 1P2MA 5DGJA 2HNTE 1GBJA 3WY8A 1YPKH 1BTHH 1FY1A 2GZ8A 3A85A 3RLYH 4X1RU 1NRRH 1V2VT 1EZUC 1MBQA 1DFPA 1CA0B 5ETXA 1TWXB 1Z1IA 1OKXA 1O2VA 2NU2E 2ANWA 5HYOA 3DT0H 1RXPA 1DSUA 1Z8IB 3LH3A 5AHGH 2K0QA 2ZFRH 3SU0A 2ANMH 5JDUB 2AFQB 3UQOA 1EZSC 1V2UT 1GMDF 2J38A 4BAHB 1C1OA 3P8GA 1KXBA 1W3CA 3UIRA 1YLNA 1GBIA 1A46H 4KP0A 5AVDA 1QR3E 1GI0A 2VINA 1KY9A 1DS2E 1W14U 3QN7A 3LIWA 3T5FH 5C94A 2OUAA 2RA3A 3ATKA 3M35A 3PO1B 1KXDA 3RXAA 5GNDA 5T6FA 1GBLA 3T62A 1RD3B 1K1PA 1W7XH 2P95A 4TY6A 1V2PT 4XBBA 5E0JA 3U98H 1V2LT 4SGAE 1O2QA 3P6ZB 5A8YA 1OWKA 4D7GA 1ETSH 4Y11E 2EA3A 3MH4A 1N8OC 1ZHPA 1W0JD 1YPMH 1SL3A 5AFZH 3V13A 1DUAA 3ZZ9A 3EE0B 3RXRA 2JJ1D 3C1KA 1O2OA 1JWTA 3ATWA 3RMOH 4A6LA 5LPRA 2A0QB 5IDKA 5T3HA 1DWCH 4DT4A 1SMFE 1BMLA 4BNRA 1AVXA 1DITH 5DN6D 1O3CA 2GD4B 1HAGE 3Q3XA 3A86A 4BTIB 4BAMB 1GCTC 3HPTB 3A88A 1AHTH 2ZCHP 4YOIA 1GHAF 1KXAA 5EW1H 1DSTA 1CA8B 3URCA 2EY4C 4K5ZA 1TMUH 4K8BA 2C8YB 2PWXA 7KMEH 2OQ5A 1UW7A 3EA8A 1NZQH 1ZMNA 4I32A 4U32A 1O5GH 1S6HA 1YP9A 3NRLA 1S6LA 1VCPA 2J94A 1OWJA 3VGCC 1GHBG 1QBNA 1VJAU 1UCYK 1NRPH 1O2MA 1GVZA 3PV4A 3T28A 2BM2A 1O2NA 3KYFA 1GI2A 3PTNA 1GG6C 2AGIX 5EXLA 1MZAA 3GY2A 1EUFA 1GBFA 5C1UA 1BT7A 1C5ZB 5KEDA 1P06A 1FQ3A 1TALA 1BTZA 2OCVB 1PFXC 3E8LA 1TPPA 4FVDA 1V2RT 4X0WU 5JB8S 3ZYDA 1YCPH 4DIHH 1C9PA 3UR6A 5FHTA 5BRRE 1DT2A 1O37A 5SGAE 5C3NA 5F53A 3ZIAD 3RXGA 3TGIE 2Z7FE 1W7GH 3W95A 1HIAA 1AWFH 1XVOA 3K9XB 1TOMH 3SQHE 1UTQA 5A2MH 1FXYA 4NA8A 4ABDA 3NWUA 3QGJA 3RDZA 1AIXH 2Q6DA 3BTWE 1MH0A 1SQAA 5FPYA 2CK3D 1O32A 4Y8YA 2G51A 1P11E 4GUXA 2BYAX 2BXUH 3BTQE 4NWKA 1TYNA 3WWFA 2JETB 1AFQB 3U8TH 4E7RG 4MNVA 5F03A 1ESAA 1SB1H 3F0PA 1AKSB 2BD2A 2PTNA 2ZU1A 2QXIA 4LK4A 1BBRE 1ARCA 2L74A 1OOKB 1J15A 3CNRA 3SV8A 4H6TA 1VJ9U 1LVOA 4AB9A 1GI3A 3U1JB 2GV6A 3QDZB 1GPZA 1O5CB 3OFND 1RRKA 2KCOA 4UEHH 2P94A 5EQRA 4Q7XA 3ZZ5A 2V3MA 3ELAH 1QJ1B 3N7OA 1JIMA 2QF5A 2XCFA 1AZ8A 2C8ZB 3QUMP 2VBCA 2GVFA 1SLWB 3RXOA 2ZI2H 5E8EH 1AD8H 4K1EA 1THRH 5T1VA 4MPXA 2B7DH 3P95A 5GWZA 5GCHF 1A4WH 2EI8A 3M3TA 2TGTA 2QY0B 1SGNE 5C0TA 4ZKRU 5EXNA 2Q6FA 4ABHA 3ATLA 1MQ5A 4ZXYH 3DD2H 2C93B 2Y7XA 1A0HB 1CA0C 4A7IB 1D6WA 4Q7YA 1SGIB 3LGWA 4M9FA 3SQEE 2B0FA 1X7AC 4IC5A 1AY6H 1MCVA 3U9AH 3MO6A 5IYTA 3GCTF 1CVWH 1XXFA 1VITF 5B6OA 2WZQA 3PMJA 1FN6A 2FPZA 1O3HA 3K65B 3UR9A 1BMMH 1FMGA 1HAZB 4FUJA 3TVJB 3V0XA 1VR1H 1B5GH 4WY3A 4ISOA 5DP8A 5A0BA 2F43B 2BTCE 2FOFA 2WUCA 3OEED 1GBAA 2ZHQH 5F6MA 4UE7H 2JDID 1ANDA 1J17T 1S6FA 3ZVCA 4ZROA 3SGAE 1ZHRA 1MU8B 2QAAA 3PO1C 1P12E 1FONA 1TOCB 2HWLB 5EODA 4X8SH 5ABWA 1EAIA 4FUEA 4JYUH 1P05A 1SQOA 2BD3A 4YO9A 1GMHF 4X2WA 2FOGA 2A5AA 3SU2A 1L2EA 4B76A 4AORA 1WQVH 1SLVB 2STAE 3PB1E 4AZ2B 4NZLA 5DK1A 3M5LA 4GHTA 3A87A 2PFEA 1SI5H 4H42U 2EQNA 4FU8A 4TY7A 3U8RH 3E0PB 4FVBA 3S9CA 1BTPA 3Q00A 3TJNA 2Z9IA 2WYGA 3CS7A 5B6LA 1OX1A 2ZDVH 2ZC9H 5L30H 2ZG0H 2KX4A 4X8TH 4Y0ZE 5JYIA 1KDQB 1MUEB 2HPQH 1C1MA 2BD7A 1T8OA 2VIPA 1IOEA 3ATIA 2BDBA 1P0SH 4UFDH 3D62A 2D2DA 4Z0KA 2BD4A 4RSPA 1V2NT 1FDPA 1OP8A 1C5OH 2QXGA 1BIOA 1SHHB 3FAOA 3F9EA 2ZKSA 1UCYE 1TMBH 5L6NH 3SV6A 4RKOB 3VXFH 1THPB 3F9FA 4A1TA 3ZV8A 1AZZA 5K0HA 1O5AB 1W10U 2P8OB 1LHFH 1TNJA 5BPEA 2XNIA 2FO9A 2W3IA 4TPYA 1O31A 8GCHG 1UO6A 2TBSA 2ZGCA 3IG6B 1GI5A 4U2WA 4XRNA 3GCHC 3ZZDA 2NWNA 1BTYA 1NU7B 4ACBA 1TNGA 1NRSH 1AO5A 5DP6A 5LPEA 2QV1A 3ZYEA 4UFGH 3FZZA 4GVUA 5CHBA 1MAYA 1TGCA 1D6RA 1GVKB 1HB0B 2FXRA 3TNSA 1O5FH 4INLA 3SU4A 1GHVH 5EPYA 2ZU2A 2BD9A 3N99A 3GISB 1BDAA 3BIVH 3VFEA 1GJDB 4I8HA 3ENSB 1FPCH 1NTPA 1C2DA 8LPRA 1C2JA 3SU5A 2OC7A 3QTVH 3KQBA 4RN6A 1LHCH 1LVYA 1TPSA 1M9UA 2OTVA 3SHCH 3AASA 5F8TA 2NU4E 5G4BA 3PM3A 1RTLA 3VG8A 2GV7A 1OP2A 1FZZA 4U01A 3KQDA 2SFAA 2ZDAH 3KL6A 1G3DA 4RT1A 3F3BA 1P2NA 1AWHB 1OWDA 2JETC 4BXWA 3GDUA 1S83A 1AFQC 1O2ZA 2FP7B 2P3UB 1O2GH 3LDXH 4WMFA 1AB9B 3MU4A 2J9NA 3MNSA 1T7CA 1TE0A 4ZHMU 1C2LA 4HG6A 2VWLA 1VCWA 3ZZ6A 3FOAA 3RM2H 4Q2KA 3RXDA 1BA8B 3RXUA 2TGPZ 3TLOA 1Y3VA 2Z9JA 1B7XB 1E37B 2ZNKH 3OY6U 1E38B 3SN8A 3SORA 3V12A 1P9SA 1C2IA 2B5TB 1UHBB 3QX5H 1QZ8A 2H9TH 2ZQ1A 2HVYB 1HFDA 2WPKS 2FX4A 3IITA 1D9IA 2Y82A 1HAYB 2AGEX 2RA0A 4WMDA 3KQEA 1FN8A 3BTME 4X1QU 2PKAA 4F49A 4HGCA 3ZZ8A 1TGSZ 4GPGA 1QJ7B 4ABBA 1ANBA 4UONA 1ZYOA 2SNWA 3MH6A 4B74A 3RXEA 1SGTA 2SNVA 2ZDKA 2UUYA 3BTEE 4X2VA 5EW2H 1ELEE 1D3QB 4YXWD 1RGQA 4CRGA 4YESB 4OS2A 5TCCA 1JRTA 1AE5A 1MABB 1ZLRA 2H2ZA 1DM4B 1QB6A 1FAKH 3PMBB 4QT8C 1GJ4H 3UTUH 3N7EA 1HAXB 2XBXA 4IW4E 1CBWB 2OBOA 1F0UA 1GBEA 2R9PA 1OP0A 2C4FH 1O2LA 2AH4X 2F9VA 3M7TA 3FVFB 3K2UA 4GAWA 4AB8A 3MQKC 1ORFA 1Z8RA 2D1JA 2OINA 2ZECA 3EA7A 3F2FA 1EPTC 1MZDA 1C5NH 2C8XB 1NFYA 3GDSA 1BBRH 3A8AA 5FBEA 2GCTB 1LHEH 2YMSB 3A8CA 4O97A 2BXTH 4JK6A 1ZR0A 3O8CA 1DWBH 1NC6A 2C8WB 5A0CA 1CGIE 1INCA 1HJ9A 3RP2A 2BZAA 5A8XA 1HUTH 4GHQA 3EAJA 1P57B 4Y6DA 2FOEA 4IN1A 1TGBA 2A2QH 2XWBI 1NS3A 1OPHB 1TNHA 3PWCA 1O2UA 1TAWA 4ZKNU 2ODYB 3TIUA 1ARBA 2CF8H 2ZFSA 4UD9H 3ZZBA 4ZCNA 1GHXH 3QK1A 4AYYB 3KQ5A 1K1NA 3FZDA 1XUHA 1QBVH 2VWMA 1DE7H 3A7VA 1IHSH 1GBTA 4WMEA 4JYVH 1SGEE 1BTXA 2VVVA 1SGCA 2JIZD 1C5TA 1C2HA 1GHYH 2J2UA 3DFLA 3RUOA 4YT6H 1KXCA 2ZDNA 3BEIB 1TA2A 3A8DA 3DCLA 1PQAA 2P8OC 2R3UA 1SOTA 4MQAA 1LPKB 3A81A 1ETRH 3H7TA 3QGNB 1EPTA 3NXPA 3GCNA 1T4UH 4BANB 2VVUA 2W26A 1D3TB 1BITA 1EQ9A 2XYAA 2PHBA 3SNBA 5I25A 2ZTXA 4WWYA 5DJ7A 1C1UH 2Y80A 2H5CA 3OU0A 3PV2A 2FMJA 1SGDE 4ABGA 1TRNA 1H8HD 3ZVEA 1GHWH 2QF0A 3O8RA 1Z8JB 1GBCA 1OYQA 2I6SA 1T31A 3RU4E 1DY8A 1O2JA 3P8OA 4BOHA 1IQGA 2ANKH 2ZDMA 1O3OA 4K2YA 1PYTC 1YY3A 3BIUH 1S0QA 3ZZCA 1KDQA 3MMGA 1CSOE 1IQMA 2ZDLA 4ZHAA 1C1WH 4CRDA 3SU3A 4AC9A 3M61U 1IQHA 4PROA 3UWJH 2WPLS 4OGXA 2A1DB 1E1QD 1WV7H 2EI7A 3LGVA 1K2I1 2HNTF 4GCHG 3DUXH 1N1LA 1G3BA 2R0KA 1J9CH 2K1QA 1THSH 2C90B 1P2QA 4YOJA 1GDUA 2P3TB 1SLUB 4JZEH 1EOLA 1A2CH 1G36A 1AGJA 1O35A 3F2GA 4WXIA 1UJ1A 1AB9C 1TIOA 4DOQA 1L1NA 2ZFQH 5HGGA 1FY8E 2SGFE 3PRBA 8ESTE 1HV7A 3C27B 3U1IB 3KYGA 1RFNA 1EX3A 4F48B 4F55A 2PV9B 4ISNA 1UCYH 1W0YH 1EB1H 4CBNA 1FY4A 2VVCA 4Q63A 2THFB 1V2WT 1CQQA 1UVOA 1QQ4A 3RMMH 2GCHF 5F8ZA 1SFQB 2O9QA 2O8LA 1GMDG 4Y7AA 1XKAC 1Q3XA 5C67A 3H09A 4FUGA 4TWWA 1HPGA 2PP6A 1PPFE 1NT1A 2XC4A 1ZTJA 3SJIA 3LJJA 3D23A 1ABJH 5DP3A 3I29A 1C2EA 3SHAH 1FJSA 1T32A 2M5TA 1EAUA 1O3MA 5GDSH 3UFAA 2J34A 1QY6A 2AMQA 4NIVA 2EEKA 1PPHE 1O5DH 2Z9KA 2GX4A 2HNTC 2XBYA 5PTPA 1E79D 1SGFA 2BLQA 3RXCA 3SUDA 2QXJA 4TPIZ 1UK2A 3BTDE 1EZXC 3ZVDA 4Y79A 2TGAA 1GGDB 3IWMA 4I8JA 1CBWC 4KTCA 2O8WA 1E0FD 4YTAA 3OTJE 1LCYA 2DE8A 1O39A 2G55A 1IQEA 3UREA 2ESTE 2H9HA 2KZ4A 1BMAA 1UHBA 5E2PA 1GHAG 2BOHB 2VIVA 4INKA 1BRBE 3VEQB 2GZ9A 2F9OA 1LQDB 5EU8A 2GCTC 2SGQE 3M3VA 2YMSC 1BOQA 1TGNA 1LQEA 5C5OA 4X1SU 1ELBA 3FO8D 3TNTA 3UAIC 2Z3DA 1YPHE 4AGKA 1ELVA 2OLGA 1C2GA 3BEUA 1V2JT 2FLBH 2FI4E 4OS5A 4BAKB 4RI0A 1Y59T 3RLWH 1IHTH 1AN1E 1KIGH 4CH2B 2BLVA 1MD8A 2VWNA 5EQSA 4FETA 3SYJA 3NZIA 4X8UH 1ZPZA 4ABJA 3QO6A 9ESTA 4ABFA 5GIBA 3E3TA 3P8FA 4BAQB 1NN6A 2BDCA 3BF6H 4I86A 1E34B 1S84A 2WPIS 1A61H 1IQJA 3SZNA 2LELA 3PTBA 1YKTA 1XKBC 3W94A 2TIOA 2OXSA 1G2LA 2OC0A 1FIZA 4X6NA 1YGCH 1D3PB 2F83A 2WV9A 1ELFA 1SQRA 3S9BA 1EFRD 3MI4A 1O2HA 3OSYA 4UDWH 2XC0A 1C5YB 2GMTC 1QCPA 3TK6A 1YPJH 2HLCA 2GGVB 1DDJA 5FX5A 1LVMA 2ALVA 5DP7A 4MPVA 4GLYA 1H8ED 2XCNA 1O2TA 1ID5H 1ZSKA 2HPPH 3F6UH 2P59A 2PUXB 3RU4T 3A82A 1LHGH 1P01A 3RMLH 1UVSH 2G4TA 1C5SA 3RXSA 2J97A 4XD7D 2TPIZ 1XUFA 4IMQA 2F9UA 2QYIA 2ZU5A 4CBOA 2PGBB 4INHA 3AVZA 4YT7H 1K1IA 1P2OA 3SGBE 5IK2D 3F9HA 4U30A 1DVAH 1TFXA 4YLQH 3GS9A 4NA9H 4VGCB 2CN0H 2G8TA 2AIPA 3BTFE 3S9AA 4I8KA 1P02A 3LC3A 2G52A 4KTUA 2GDDA 3TH3H 2WUBA 3H5CB 2WYJA 1GBHA 1UTJA 1AMHA 3GY3A 1CGJE 1ABIH 1UMAH 1OSSA 1HAPH 2FX6A 2O8UA 2PR3A 2A4RA 2V3HH 3DSOA 3OEHD 3R0FA 1PPGE 1K21H 1SVPA 1FV9A 5GCHG 3RXFA 1RIWB 1PYTD 1ANEA 4IGDA 3V7TA 3RC6A 4Z1MD 1QTFA 1TRMA 3RXIA 3RXKA 1JOUB 1BUIA 3F68H 3ZV9A 1A3EH 4ACAA 3LJOA 1BJVA 1F5LA
chains in the Genus database with same CATH topology
4X2XA 1KLIH 2H6MA 3T25A 4OS6A 1ZHMA 4K69A 2FS8A 4MNWA 2F9BH 3L6PA 1GI9B 3GCTG 3QZRA 1XUGA 1VITG 2FODA 1K1LA 1L1GA 1ZRKA 3VB4A 1N6XA 1SBWA 5JB9S 3BEFB 3VB3A 3T27A 1O3LA 2P93A 2FIRH 1GI7B 3RM0H 1ZGIA 4TYDA 3S69A 3HK6B 1GBDA 3B23B 3ZZ3A 1SSXA 2Z9GA 3KNXA 3SGQE 6LPRA 1V2QT 2BB4A 3RC5A 6CHAB 4YZUA 1EASA 1MBMA 4BXSA 1UVPA 1WU1A 4WVPE 3TK5A 3UNQA 2BY9X 1C1PA 5CHAB 3P92A 1Y3XA 5DG6A 3OYPA 1JBUH 1LDTT 1GJ9B 1KSNA 1G32B 4IMZA 1GMHG 4BAOB 2ZZUH 3TK9A 3U69H 1PQ8A 1EOJA 1DXWA 2XC5A 1ZOMA 3SNDA 4Q7ZA 5FCKA 6GCHF 3EQ0H 2ZIQH 2GT8A 1HAIH 1TABE 2ZQ2A 4DCDA 1AFEH 1H9LB 3B9FH 1F5KU 1ACBE 4B2BA 3PYHA 2ZGHA 1SGRE 1GGDC 1MU6B 4Y76A 1TMTH 1Z6JH 4ABAA 1AVWA 4O3UA 1V2ST 3BV9B 1BRUP 1ETTH 1C5MD 1DY9A 3VB7A 1GCDA 1PPEE 4B2AA 1IQNA 2BDIA 1A7SA 2BD8A 1FNIA 4I8LA 1MTWA 1D4PB 4AYVB 1BCUH 2XWAA 4NIXA 1HLTH 1VCQA 1D3DB 4MVNA 2RG3A 1ZGVA 2XW9A 2EI6A 2O8TA 4D8NA 1F0RA 1G2MA 1O36A 3TJUA 1B0FA 4FUDA 2CMYA 3NK8A 2VIWA 3DA9B 1QB9A 1C2KA 2D26C 3MH5A 3P17H 1O3GA 2SGPE 3UPEA 2WV5A 2LPRA 1EXFA 4XOJA 1ELDE 1GMCF 3ESTA 1MKXK 7GCHF 1A0JA 1HAOH 3A7TA 1SGYE 2HRVA 1XUKA 1MTSA 5ESBA 1PPZA 1S0RA 1SC8U 3HATH 1F0TA 4AOQA 2KAIB 2ZPRA 1H9IE 1OWHA 1QIXB 1TRYA 2WV4A 4X2YA 1SQTA 2Y81A 4HTCH 1TBRH 1O2IA 1FUJA 1KTTB 2FWWA 5LH8A 5C2ZA 3MHWU 4NIWA 3P8NA 4CR9A 5JBBS 1CT2E 3UY9A 4ABIA 3TGJE 3AW0A 1J14A 2BVXH 5EGMA 3MNXA 4F4OC 2Z6BD 3MWIU 4XE4A 1QL9A 1BTWA 2FTLE 2A7JA 1NPMA 3P70B 5J4QA 2LNCA 3MTYA 3ZZ7A 3L3TA 1BMNH 1EJNA 4LOYH 1TBQH 1GJBB 4NSVA 1EZQA 1CGHA 3QLPH 2A2XH 4E7NA 2FYQA 3SUFA 3SV7A 1AKSA 4YLUA 3A7YA 1HJ8A 3ZVGA 1LPZB 1C2MA 1MTNB 4A1XA 4VGCC 3JZ1B 3SW2B 2A5KA 1HRTH 4Y10E 3E6PH 1H9HE 1WUNH 5DPAA 3ZVAA 1KXEA 1O2SA 1YLCA 2BDAA 2BD5A 3H7OA 3UOUA 2ZHEH 2YOLA 5DP4A 4X6OA 3F1SB 1TNIA 1AUJA 1NO9H 1WSSH 2ALPA 4THNH 2FS9A 2B9LA 3FP8E 4DY7B 2AERH 2QXHA 4X1PU 1V2MT 2A31A 4NFFA 2AS9A 2V6NA 2ZGJA 1RIWC 4D7FA 2F3CE 1UTMA 1XX9A 1IQKA 4KTSA 1SHYA 4XBCA 1CHOF 1C5RA 2NU3E 1GJ6A 3NCLA 2F91A 1ZMLA 2G81E 3NPSA 3V3MA 3A83A 3SV9A 2OP9A 2GP9B 4I7YH 2CF9H 4WH6A 2BQ7B 4H4FA 4ZMAH 4DJZB 1TX7A 5DKMA 2B8OH 1EJAA 5GXPA 1F2SE 2FOCA 2AGGX 1MAXA 1ZSJA 2C3SA 2SGDE 4DT7B 2BDHA 2G5VA 1FPHH 4ESTE 1VITH 2IPHA 1PJPA 1OXGA 5FAHA 1ZTLA 1P3CA 1GI6A 1YBWA 1C1RA 3SBKA 6CHAC 1TB6H 4I31A 2VU8E 4O9VA 2HOBA 3BTHE 3LGUA 3DHKH 1QRXA 3MO9A 2GT7A 5CHAC 1O2WA 3LGIA 2A32A 1GDQA 1BB0B 4B71A 5JBTA 1Q31A 1TLDA 3TGKE 3HKJB 3RXHA 2VGCB 5LPFA 5E0HA 1Z8GA 4D76A 1EB2A 1ZTKA 2UWOA 3MOCA 1TX6A 3SNCA 1Q2WA 1BQYA 2PGQB 2JKHA 1MKWK 2AYWA 2FOBA 3RXBA 3SO3A 3RXJA 2VNTA 1GHZA 1JIRA 1HJAB 4ZAEA 5DP9A 4JK5A 1HBTH 1O3JA 1QL7A 1A1RA 1EAXA 1K1OA 2G00A 2ZCLP 4K1TA 4NFEA 2H5DA 1LHDH 3SJKA 1GBKA 3O8BA 2PKSB 1BHXB 1CHGA 4J2YB 1NU9A 1O2KA 1GI1A 3MU1A 1O38A 1WQSA 2STBE 4JYTA 4B2CA 4CR5A 1JRSA 1LKAA 1SGFG 1Z6EA 2XRCA 1MTVA 2IOTA 1O3NA 1DWEH 2ZTYA 2Z94A 1V2KT 2WINI 1QA0A 3LH1A 3BTTE 3GICB 4ABEA 2VH0A 1K1MA 1QJ6B 1NRQH 3RXPA 4DIIH 2ZGXH 5J4SA 4HI3A 1C9TA 1ZPCA 1BZXE 4JZFH 1L4DA 1UK3A 4DW2U 4OS4A 1RTKA 3MO3A 3SNAA 4WH8A 2PW8H 5EG4A 3AAUA 2ULLA 3T29A 1GL0E 3MU0A 5L2YH 3MU8A 2OC1A 1W2KH 1FI8A 4R8TB 3STJA 3HKIB 3E16B 4FU7A 4B73A 2R2MB 4E06H 1TQ0B 1B0EA 1RS0A 2CV3A 3SJ9A 1O3FA 4A92A 1AQ7A 2G5NA 3PLPA 1GBMA 3I77A 1DPOA 3Q3KA 1GHBF 1Y3YA 1Z1JA 2WPHS 3LKWA 3PWBA 1ANCA 3RXTA 2PTCE 3E0NB 2RDLA 4SGBE 2BLOA 1KYNA 2ASUB 3UOPA 2OBQA 3Q77A 2XXLA 4WXVA 2YNAA 4B75A 3TU7H 4CRBA 4WF8A 1Y3WA 3U8OH 1GJCB 2R2WU 1O3DA 2NU0E 3TJOA 1SPJA 3QTOH 3EGKH 1O3PB 1P10A 5K7RA 5DO4H 1J16A 2FOMB 5A8ZA 1SLXB 1SGQE 1DX5M 3TITA 3A7XA 2BQWB 1NY22 1Z7KA 1UTKA 2H1UA 5JBAS 1TA6A 1TNLA 4I8GA 3S7KB 2QIQA 1L0ZA 2EC9H 1TBZH 1P9UA 2ZA5A 1A0LA 5C1XA 2ZFFH 1C5WB 2ZFTA 2Q6GA 3UNSA 1H8DH 3A7WA 1U6QA 5I46H 3LC5A 1IAUA 4J1YA 1HAVB 1DICA 1ZZZA 2VB0A 2BVRH 5HXFA 1P8VC 1O2RA 1G9IE 1QQUA 2W7SA 1MTNC 2GTBA 4CHAB 2P3FH 1NFUA 1FIWA 1ZPBA 2VH6A 3SNEA 1K22H 1AUTC 2OC8A 4AG2A 4Y7BA 1O3AA 2KAIA 3KHVA 5C5NA 2GCHG 1SG8B 2PLXA 1SFIA 3QWCH 5H4IB 1WOFA 3LGTA 5A0AE 3GCHB 2Y7ZA 1K1JA 2FESH 2UWLA 3JZ2B 4KKDA 2A7CA 3SU1A 5L2ZH 3PLKA 2I6QA 3LOXA 3TH2H 3ODDA 3PMAB 2A45B 4TWYA 2XBVA 3A8BA 1ZJDA 1H8IH 3LU9B 3M5NA 4DGJA 4CRFA 5AF9H 3K6ZA 1QGFA 4XBDA 3UNRA 3M7UA 4Q80A 2FDAA 1C1VH 2QCYA 1FY5A 1G3CA 3PLBA 1FLEE 3SOSA 3M5OA 3RXMA 2YNBA 1BHXF 1MCTA 4MG3A 1QRWA 4ZKSU 1DWDH 3UUZA 4O03A 2PKAB 1O3KA 2BHGA 2AMPA 1GDNA 1ZRBA 4LZ4B 4OS7A 2WPJS 4NIYA 1FY3A 1C5PA 3CP7A 4M7GA 2XTTB 3A80A 5TCAA 9LPRA 1V2OT 2BOKA 2ODQA 1KTSB 3D49H 1NFXA 5ESTE 4A1VA 1KLTA 5GPIB 1AU8A 1BTUA 1EATA 3OX7U 3TPIZ 3SJOA 3RXLA 3HGNA 4OS1A 5GJ4B 1ZSLA 4ZUHA 5JPMH 1YCPK 5EXMA 4JMYA 1ELTA 3GY8A 2VGCC 1W11U 5T6DA 3UQVA 2J4IA 1UVUH 2SGEE 3TH4H 1T8NA 2FTMA 4LXBH 2GDEH 3AW1A 3B8JA 3KGPA 1ESTA 1AE8H 3MFJA 4MNYA 2H9EH 1QB1A 3HK3B 1OWIA 3EYDA 4HFPB 3E1XB 5HMAA 2BY7X 1H4WA 1HJAC 3KEEA 1T8MA 4JCNA 1C4V2 3BG4B 2BDGA 5EOKA 2W3KA 5FPSA 3OY5U 1J8AA 1K28D 1TX8A 4IC6A 1C2FA 2UUFB 3PMHB 4DVAU 1HCGA 2ANYA 1HDTH 4E05H 2W7UA 3GYMA 1DXPA 2VIQA 2ODPA 2PKSC 4NSYA 1JXPA 1P2JA 1LMWB 1TPAE 1OS8A 1XM1A 3FP7E 1QA7A 2J92A 3EA9A 1QNJA 3BSQA 1GI4A 1GI8B 2A5IA 3RXQA 1Z71A 2RCEA 1QL8A 3LGYA 1WYKA 1O30A 1UK4A 1UTOA 1A3BH 4ZKOU 4AFUA 2BX4A 2Y5GA 2A4QA 2BMGB 2OD3B 4XSKU 1GWAA 2Y5HA 4FUIA 1HXFH 4KGAA 3CENA 1G37A 1NESE 1CT4E 4UFFH 3K6YA 4JZIA 1XXDA 2QA9E 4MLFB 4AX9H 2VWOA 1C1QA 1T8LA 3SV2H 3MYWA 2AEIH 2FZZA 1MMJN 5A09A 1HYLA 2V0BA 2ZU3A 3M5MA 2WPMS 1ELAA 2HALA 1YPHC 4BTTB 1XUJA 1E35B 2IN2A 1QBOA 3LONA 2R3YA 2O8MA 6ESTA 1W13U 1EPTB 2BLWA 3SJ8A 1EKBB 2JH0D 2XBWA 2W5EA 1S5SA 8GCHF 2FOAA 1LKBA 2CHAB 4ZH8A 1O5BB 3GY7A 4D9RA 3SUGA 4K60A 5CMXH 2A7HA 3ZZAA 2ZTZA 4CREA 4LZ1H 1YYY1 7ESTE 1TPOA 1W12U 3RXVA 3MH7A 4X6PA 3A7ZA 4OGYA 1L4ZA 1HAHH 1Y3UA 2NU1E 3KCGH 2ZU4A 3VXEH 4K3JA 1DANH 3M7QA 3GDVA 5HM9A 5FX6A 1HGTH 1F92A 4JZ1A 4CRCA 5JBCS 4ISLA 4X8VH 1P09A 4MPWA 3MNBA 1YPGH 1VGCB 2PSXA 1C5LH 3F9GA 1O5EH 4IS5A 1WBGB 5HM2A 4K1SA 2V3OH 2FLRH 1GVLA 8KME2 1F5RA 3TJVA 1GJ5H 2GZ7A 2ZHDA 1ZMJA 4CHAC 4K8YA 3VB6A 2QGRA 1C5XB 2FM2A 4AFSA 1W8BH 1AI8H 4FUCA 1HNEE 3G01A 1MKXH 1C1SA 3Q76A 2Y6TA 2AMDA 1BJUA 4FUBA 1HXEH 1NM6A 2ZF0H 3ZVBA 3M36A 1C5UA 4MNXA 3STIA 1GJ7B 2Z3EA 1P2IA 4FU9A 3GY5A 3BN9A 1C5QA 2G4UA 2UWPA 1YPEH 3O8DA 3SI4H 2Y5FA 1T4VH 1O2XA 2QN5T 1N6YA 1JMOH 2Z3CA 3BG8A 3RC4A 1QRZA 5T6GA 1C4U2 2SGAA 1G3EA 1GL1A 4YM9A 1TNKA 2ZFPH 1S85A 1CU1A 1DOJA 1QFKH 1YPLH 1LO6A 1C1TA 1O2YA 4KELA 1EAWA 1Y5BT 4FUHA 2FOHA 2HGTH 2ZHWH 1XUIA 1UVTH 2JH5D 5EPNA 1O34A 1FAXA 3RU4D 2BX3A 2HVXA 1YC0A 2CJIA 4B1TA 1CO7E 4CRAA 1MD7A 1Y5UT 3FP6E 2ZPQA 1CT0E 3AAVA 1IQLA 6GCHG 1LTOA 5TJXA 1V3XA 5E2OA 2FEQH 1O3BA 4ZHLU 1C5VA 4Y8ZA 3UWIA 1HAVA 4BTUB 2A4GA 5C1YA 4H6SB 2P16A 1E36B 1WAYB 1A5HA 3BTGE 4UFEH 5FCRA 3PROA 1H1BA 1O3IA 4AN7A 3URDA 4ZXXH 5C20A 4XFQA 1TGTA 1N8OB 2ZCKP 2ZHFH 2Z9LA 2D8WA 1NROH 2BVSH 2JH6D 2Q1JA 4GSOA 5CE1A 3ZVFA 4MPUA 1UTLM 3E91A 1BRCE 4YOGA 2UUKB 4AGJA 3VPKA 4ASHA 1CE5A 3LPRA 1A5IA 1IQIA 4NWLA 5FBIA 1YM0A 1SGPE 1ZJKA 1MQ6A 2BZ6H 4NZQA 1RTFB 1YLDA 7LPRA 2BY6X 1UTPA 1V2TT 2ZPSA 5F8XA 1HIAB 1GJ8B 2ZO3H 1GCTB 3GCOA 3I78A 3RMNH 1K9OE 3MU5A 3A89A 3BG4C 3HGPA 1GMCG 1TQ7B 4NCYA 7GCHG 1O33A 1S81A 4Z6AH 3GOVB 2A4OA 3BTKE 3SU6A 2BY5X 2PSYA 4I33A 4ISHH 1KLJH 1P3EA 1TONA 3MNCA 1QHRB 3ITIA 2BDYA 2OQUA 1AVGH 1LVBA 2J95A 4X1NU 1QURH 1C1NA 1P04A 1NFWA 3SUEA 1EJMA 2FI3E 3VGCB 3KN2A 3ZZ4A 3ODFA 4ISIH 1OWEA 2DUCA 1PPCE 1F7ZA 3A84A 3M3SA 1GG6B 1RJXB 2BY8X 2IJOB 3KQCA 3NUMA 4IN2A 4AFZA 3Q3YA 2R0LA 2AIQA 2FI5E 1ELGA 1F0SA 3L33A 2BQ6B 5FXLA 3KIDU 3R3GB 4CH8B 2ZWLH 4DG4A 2VJ1A 1V6DA 1A5GH 1VZQH 4MDSA 1O3EA 4R0IA 3NKKA 2CGAA 1YCPM 5AFYH 2ZGBH 4FXGH 3DFJA 3KF2A 2TRMA 3EDXB 3SI3H 1Y8TA 1LPGB 3QZQA 1PPBH 2QF3A 1EP6A 1W0ZU 1IQFA 4Y71A 1WTHD 4DURA 1DLEA 4Y0YE 1O0DH 2ZP0H 1S82A 2CHAC 1YF4A 1GJAB 1MKWH 1DUEA 1BRAA 4JZDH 1ELCA 4XDEA 3E90B 5DP5A 2PUQH 1C4Y2 2CXVA 3LT3A 3S7HB 2FYRA 1EP5A 3FFGA 1WTGH 5FPTA 4IBLH 1UTNA 1MTUA 2V35A 1O2PA 4Y8XA 2VIOA 1NRNH 1P03A 4NG9H 2TGDA 1PQ7A 1DLKB 3T26A 3M37A 4NA7A 1L1JA 1XMNB 2GKVE 3ATMA 2VIDA