3VPKA

Crystal structure of 6-guanidinohexanoyl trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 6-guanidinohexanoyl trypsin near the optimum pH reveals the acyl-enzyme intermediate to be deacylated
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vpkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vpkA02
1BRCE 1C5WB 1VR1H 3L6PA 3M36A 5EG4A 4DGJA 3TJOA 3A8DA 3PLKA 1BT7A 2BD8A 1CGIE 4X6NA 3RC4A 3O8CA 2RA3A 2C8WB 2V3HH 2OTVA 4CH2B 2RG3A 4RN6A 1D3DB 2G4UA 3LGYA 4Q80A 3M61U 1B0EA 2F83A 2ZCKP 3D23A 4DURA 2J34A 4OS1A 1GJ9B 1P2NA 7GCHF 4AFQA 4ABIA 4BTIB 1V2WT 1NT1A 4K5ZA 2PTCE 1OWDA 1YLCA 3TLOA 2VVVA 1O2PA 1EPTA 1YF4A 4X6OA 2ZTYA 1E34B 1C4U2 1UTLM 4Q7YA 4GSOA 2VIWA 1HJ9A 3UY9A 2Z3EA 5HYOA 2AMQA 4U2WA 1JRSA 1SMFE 4KGAA 4INKA 3U1IB 3STIA 1JIRA 1P57B 5AHGH 4Y71A 4KTSA 1GBFA 2BDYA 1GJ6A 1OWEA 3Q3YA 4B73A 2OLGA 1C1TA 2H9HA 1CHGA 1P02A 2FIRH 4DOQA 3I78A 2ZU4A 4SGAE 4WWYA 3A84A 1DSTA 1LVOA 1H9IE 3TNSA 2P3UB 1TNHA 1RIWB 1RTFB 5EXMA 2JH0D 1O5DH 1C5YB 2PSXA 5HXFA 4Y76A 1DY9A 1O3LA 1C5RA 2EI7A 2FMJA 4A92A 3H7TA 5T6FA 1FY5A 1OWHA 1QRWA 2FI3E 1SGRE 4FUIA 1F2SE 1OKXA 3EE0B 1KDQA 5C3NA 1CBWB 5BRRE 3GY6A 1CSOE 1EJAA 3ZZ8A 2ZDKA 1O32A 2UUKB 3QUMP 5EPNA 1GJ5H 1G2MA 5EGMA 4ISOA 3MNCA 1RGQA 3BTME 3S69A 6ESTA 1FDPA 1AKSA 4FUBA 4A1TA 4CRDA 3MNSA 2D26C 1XUIA 4NZLA 4X8UH 1DE7H 2O9QA 1S83A 4U01A 2PW8H 4X2YA 3F9GA 3SGQE 4TY7A 1L1GA 1TNJA 2P8OC 1C5NH 3MH4A 4GLYA 4Y7AA 1PYTD 1C1NA 3FZDA 3BTWE 4K1SA 3KQDA 1QL9A 1BDAA 3B9FH 1ZJDA 5BPEA 3PM3A 1FZZA 1GHVH 3A8BA 1G3DA 1YGCH 2A0QB 5A0BA 1SGPE 4AB9A 3MOCA 3UNQA 4A5TS 1G9IE 3E3TA 1ESAA 5FPTA 1IQHA 3UQVA 3V0XA 1Z8RA 3ZZ5A 4IGDA 1FIWA 2OINA 2IOTA 2FOBA 1FN6A 4ZKOU 1S85A 1W8BH 1V2ST 2P94A 1HCGA 1P2KA 1VCQA 1Z8JB 1QA7A 2BQ7B 4GVUA 1LTOA 4F4OC 1ABJH 1C4V2 3RU4E 1C5LH 1NS3A 1RTKA 4R0IA 2C3SA 2K1QA 3LC3A 1SGIB 3LU9B 3CS7A 2P16A 2ZP0H 3SOSA 3HPTB 2FESH 3SJ8A 2GMTB 1LO6A 3AASA 3TVJB 1D3QB 2AEIH 1BMAA 4NZQA 4DY7B 2G5NA 2BTCE 3I77A 3LC5A 1GCDA 1DWEH 3TK9A 4JYVH 3NXPA 3LT3A 2DE9A 1S5SA 1QA0A 1P12E 2V35A 2LNCA 2XNIA 1V2NT 3SUEA 1FY8E 7KMEH 2ZFQH 5JBCS 4RKOB 3LDXH 1GGDC 3ZZ9A 1UTKA 2GVFA 3FVFB 1V2VT 1YKTA 4AG2A 2ZFFH 4GAWA 5K7RA 3V7TA 3ZZCA 2QC2A 2A2QH 1C5XB 3NCLA 4WVPE 2FO9A 1P03A 3UWIA 1V2OT 5I25A 2WV4A 4J2YB 4AYVB 1WBGB 1QRZA 4NSVA 1GJCB 1DANH 1KLIH 1PQAA 1TPAE 2A7HA 2ZGXH 3BTGE 1BIOA 4WF8A 3LGTA 4CR5A 3RMMH 1ETRH 1GI0A 5ESTE 1UTOA 1D9IA 3TNTA 3VXEH 2BHGA 3F6UH 2AGIX 4E7NA 3DUXH 1K1JA 3GY5A 3FP7E 1HXFH 4X6PA 2HALA 3HK6B 4U32A 1PPZA 1SGFG 4O97A 1OYQA 5LPRA 3TGKE 1C1MA 2XCFA 4X1NU 4TYDA 2NWNA 4AG1A 2RCEA 4NCYA 2TGPZ 1Q3XA 2OD3B 2AS9A 5FHTA 1FY4A 4CBOA 4ABFA 1O35A 4FVDA 2HPPH 4CHAC 2W3IA 1ZR0A 1UVTH 2BY8X 1FI8A 2QXHA 4IS5A 3HKJB 1GVKB 1KXCA 1EX3A 1GBDA 1NU7B 1O2MA 4ISHH 1BHXF 4MVNA 1DDJA 4VGCC 3SUGA 4YOIA 2H5DA 1CT2E 3P95A 5C5NA 1DS2E 4INLA 3E6PH 2FOHA 3DFJA 3ATWA 4I8GA 3UQOA 1BBRE 1CT4E 1YP9A 3ZZDA 2PKAB 3E91A 3A81A 5HM2A 2GV7A 4Y8ZA 2J95A 3AW1A 5JYIA 2Y5FA 1GI7B 4TY6A 1GJ7B 1TMBH 3Q77A 1TALA 1EZQA 1F0TA 2UWOA 4MTBA 2QXJA 1CBWC 3BIUH 4JZDH 2FOCA 4UFDH 1S81A 2Z7FE 3ITIA 2ZGBH 4B71A 2PR3A 1K1PA 3LH1A 1JIMA 3GCTF 5F8ZA 1SHHB 2VGCB 4YZUA 1UVPA 3LJOA 2F9PA 4FUHA 3C27B 3ZVAA 2RA0A 1CVWH 3GY7A 1SR5C 1C2HA 2AGEX 1H1BA 4MNVA 1MMJN 1MKWH 4WXVA 3PLPA 5E0JA 1TNIA 1TX6A 3QWCH 1EB1H 3NKKA 1UO6A 1O3KA 3FP6E 3RC5A 1C5UA 3VGCB 1GBJA 4BTUB 1DY8A 1K1OA 1VCWA 2ANMH 3RMOH 5L30H 4AORA 1C5OH 1LMWB 1J15A 3NK8A 2ALPA 5F03A 2HGTH 1ZPCA 1G37A 3RXSA 1DVAH 1LQDB 1YPGH 1DXPA 1HIAB 3BTTE 1ANCA 3EA9A 1BA8B 3E90B 3E8LA 2QN5T 1KXBA 2G00A 4B1TA 2Y5HA 2A2XH 1GMDF 1KLJH 3FAOA 3M37A 3OU0A 1C2GA 1EAWA 1T7CA 1V2RT 1XUHA 4A6LA 1UTMA 4NA7A 4OS2A 1TE0A 1UTPA 2WPJS 3MO6A 1GJ8B 1F5RA 3BSQA 4H6SB 2SGPE 2W5EA 5C67A 2FS8A 3ZZ4A 2OCVB 3QX5H 3ZVCA 8LPRA 1ZGIA 1DX5M 1O2WA 1SL3A 4MG3A 1HLTH 4KTCA 1GI1A 2BD4A 3UOPA 1G3EA 2G52A 4O3TA 2QGRA 4JZ1A 2C93B 1AB9B 1FN8A 3FP8E 2J2UA 2WPIS 3BF6H 4AFZA 3JZ2B 1C5ZB 2ZGHA 1O2VA 3L33A 1QB6A 4DW2U 1IHSH 1MTUA 1QTFA 1ZYOA 4OS5A 1DUEA 4THNH 3M7UA 1QBOA 4GUXA 1VJAU 1L4ZA 1O3BA 1ZRBA 5EXLA 8GCHF 4LK4A 3KQEA 5CMXH 4BAMB 2VNTA 1AVXA 1ARBA 1C1OA 4DIIH 1TRNA 2ZDLA 1ZJKA 2GTBA 4U30A 2A4GA 2XWAA 3RXGA 3SU5A 1JBUH 1OP0A 2GZ8A 1P04A 5FX6A 1P2IA 1C2KA 1GPZA 9LPRA 1TGSZ 1MTWA 5T6DA 5DPAA 4I31A 1A4WH 1IQGA 2JKHA 3S7KB 3GYLB 4IW4E 4ABHA 2PKSC 1AKSB 1JOUB 2AIPA 1F0UA 4MNWA 3MU8A 4Y6DA 1F5KU 5FPYA 2P3FH 4Y11E 1KY9A 1GI2A 1MTVA 3EGKH 1XMNB 1LPKB 1BITA 4YT6H 4MNXA 4DVAU 1O3DA 2SNVA 1C2IA 3MU1A 2ZIQH 3DFLA 1YM0A 1AUJA 1RS0A 1DFPA 1SGNE 2QAAA 1GG6B 3RXDA 2C8YB 1C2JA 1WAYB 2P95A 3GCOA 1GMCG 2ZU3A 4Q2KA 3RLYH 3U8OH 1GVZA 1O2LA 4GCHF 1BMMH 1CO7E 1AU8A 2ZDNA 1HFDA 2H5CA 1YYY1 2FEQH 1C2LA 2XCNA 1F0RA 2J38A 4XOJA 1CHOG 1Z8GA 2HVXA 3S9AA 1RJXB 1W3CA 3TJUA 1H9LB 1P0SH 2NU1E 4I32A 2ZF0H 1O3JA 3MU4A 3MHWU 1A5GH 3KIDU 2Z9IA 1V6DA 3RXEA 2A32A 2SGEE 1FLEE 2W7SA 1Y3WA 1PPBH 3BTKE 1SFQB 4UEHH 1TBRH 1C1QA 4AFUA 1RRKA 3GY8A 3RXBA 3ELAH 1G30B 1FPCH 2BD3A 5JBAS 3M7QA 3SHCH 3M3SA 1QB1A 1NRNH 2XC0A 5FAHA 5F6MA 4AGJA 2ZECA 3LONA 4O03A 2CHAB 1IOEA 2IN2A 1HIAA 3VB5A 1C5MD 2STAE 3MNXA 4HGCA 2CMYA 2FP7B 2R2WU 2BDHA 1GL1A 3A85A 4JZIA 4OS4A 2WPLS 1S84A 2J94A 1NESE 3U69H 4ABGA 3QN7A 4ZKSU 5ETXA 4X8SH 1IQIA 1ZSJA 3SHAH 3A8AA 3B8JA 4NGAH 2GCHF 1AVGH 2RDLA 1XUJA 3G01A 2R3YA 2G55A 2A5AA 1Y3UA 1IQFA 1H8DH 1LVBA 3IITA 2FWWA 1IQNA 1YCPM 3SW2B 3BEUA 2PUQH 3T5FH 1QB9A 2Q6DA 2I6SA 3SJOA 1LHGH 3P70B 3PWBA 2H1UA 1O2OA 2ZHFH 1FAKH 3MH6A 2AERH 3S7HB 1J17T 1HAVA 1C5SA 3DHKH 1GHBG 3V3MA 2P3TB 1O5FH 4Z6AH 1G32B 1SVPA 2GCTB 5TCAA 1UK3A 4NA8A 3V12A 2BDGA 1P3EA 2AMDA 1GWAA 3QK1A 4CH8B 4O3UA 5FBIA 3VB7A 2PSYA 5GPIB 1AWHB 2QY0B 2M5TA 4WJG2 5LPEA 3PROA 4MPXA 1A0JA 1O2JA 3LJJA 1CGHA 4UD9H 1O2ZA 3P6ZB 5GXPA 3IG6B 3PYHA 1Y5AT 2O8LA 1L2EA 1P2MA 1A0HB 4ZUHA 1DWCH 1O3NA 1T32A 2AGGX 1GBBA 2G51A 1WSSH 2PLXA 3JZ1B 2PKAA 3TK5A 2F9BH 2NU0E 2OUAA 1N8OB 1TNGA 1GDNA 2ZDVH 4ISNA 5DO4H 1BTYA 4JCNA 3PMBB 4D9RA 1SGQE 2GP9B 3DD2H 1MKXH 4ZROA 3TGIE 3SUFA 3K9XB 1Z6JH 1G36A 2BQ6B 1OOKB 3CP7A 1MBMA 1WUNH 2P59A 1W7GH 3K6ZA 2FOAA 1A2CH 1PJPA 2C4FH 1HV7A 5C1YA 2ZDMA 1OXGA 7ESTE 1A5IA 2HNTC 3CS0A 1A0LA 1XKBC 3RUOA 3KEEA 3I29A 3KL6A 3LIWA 2GT7A 3ENSB 1MKXK 3PTBA 4NG9H 3SU2A 1DWBH 5CE1A 1C1PA 1TFXA 1W11U 2WUBA 2ZO3H 3BEFB 1O30A 2FOFA 3M5OA 1NRQH 2G4TA 2XBYA 1HJ8A 1SLWB 1GG6C 1GHBF 1QGFA 3A7YA 1ZSKA 1OYTH 4JYTA 1BMNH 2VWOA 2HRVA 1L0ZA 1SGCA 4D76A 1C2EA 1AN1E 2WPMS 1ZTKA 1XXFA 1WQSA 5FCKA 1DM4B 1EKBB 1AFEH 4ZXYH 2VIQA 3SNCA 1O2UA 1GL0E 5DP9A 1EZXC 1WQVH 1DT2A 1QY6A 3KGPA 1ESBA 2FOEA 2ZFTA 1VITG 2BOKA 4HI3A 2GD4B 1V2QT 4H4FA 4XDEA 2PV9B 3RXJA 1GHAG 4NIWA 1HAOH 3UNSA 1O31A 3SNDA 2XC4A 3SI3H 2FZZA 1SLVB 1BJVA 4KTUA 1BUIA 1GHAF 3K2UA 2AMPA 2Z6BD 1HUTH 1YPLH 3W95A 3S0NA 1BB0B 2YOLA 1VCPA 3NWUA 2ZHEH 1AI8H 3PMAB 3BG8A 4FU7A 1W13U 2ZCHP 3TJVA 4I8KA 2P8OB 2BXTH 3KF2A 2ZI2H 3EAJA 1D4PB 1CQQA 3ZV8A 1BTWA 1VITF 2F9VA 2SNWA 3VB3A 1XVOA 3SU1A 4O9VA 2BVXH 1T4VH 1ZRKA 1TGTA 3P8FA 2OQUA 3SN8A 1AE5A 2UUJB 3ESTA 4YOGA 3VPKA 3RC6A 5EXNA 2NU3E 1EJNA 1ELAA 1NFYA 2W3KA 1AZZA 1O3AA 2OP9A 1O3FA 3Q76A 2ZTXA 1ELDE 2Y5GA 2R0LA 2A1DB 1TBZH 2NU4E 1BZXE 1CE5A 1VITH 4IC6A 1C5PA 2EI6A 5C2ZA 3RXKA 3ODFA 3UR6A 1UVUH 1ZHMA 2ZFPH 8KME2 1O38A 2CJIA 4XSKU 1AQ7A 3STJA 5L2YH 2CHAC 4Z0KA 2BLQA 1ZHRA 1D3PB 1FXYA 3BEIB 2HLCA 1O3OA 4K8BA 3UFAA 1K9OE 1U6QA 1MQ5A 1RXPA 1FUJA 1XKAC 3SU6A 4A7IB 1MAXA 1QL7A 1O3PB 4VGCB 3ODDA 1C1RA 1YCPH 5CHAB 1TPOA 3GDSA 2BD7A 1OS8A 3P92A 3P8OA 4FUEA 1IQMA 4BAKB 1HAIH 4A1VA 3F9FA 1N6YA 2ZC9H 1J8AA 1HAGE 2DE8A 2HNTF 2JH5D 3D49H 1Z7KA 2F9OA 2O8MA 1LPZB 1XVMA 5K0HA 3QDZB 1YPMH 2BD5A 3RMNH 1UCYE 4UDWH 2Z9GA 3L3TA 1EZUC 2AFQB 2C8ZB 2B9LA 1HJAC 1M9UA 1CA0B 2B5TB 3ATMA 3TH3H 4PROA 4MPWA 1P2JA 2UWPA 4Y8YA 5EW2H 1IAUA 5HM9A 2EEKA 2O8WA 4YESB 3SNAA 5A09A 3PMJA 3MO9A 1N8OC 2VIPA 1FV9A 3U8TH 1P2QA 1GDQA 2H2ZA 1O2IA 1AZ8A 1BTXA 1TX8A 4WMEA 1JRTA 1QJ6B 4ABDA 2XW9A 3RXHA 3VGCC 5DP4A 1C9PA 1ZPBA 1ETSH 1K1MA 3IWMA 4E06H 1D3TB 3RXLA 6LPRA 5EODA 5JBTA 1HAZB 1XM1A 1EASA 1O3CA 1O5GH 1LQEA 2O8TA 1BTPA 1K1NA 3M5LA 2BDIA 2ZGCA 1MKWK 1QR3E 3KHVA 4B2BA 4X1PU 4AX9H 1MU6B 3SJIA 2P93A 4DCDA 2ZFSA 3MH5A 2VIVA 4K8YA 3GYMA 1O5BB 2ODQA 3RXVA 1T8MA 4LZ4B 4IMZA 2J4IA 4JYUH 4GHTA 1BTHH 2XBWA 1IQLA 1ANEA 1EJMA 1AVWA 3BG4B 1TABE 4BTTB 3SQEE 4Y10E 3SU3A 4E05H 2FX6A 6GCHF 5L6NH 2D1JA 1SOZA 1EQ9A 1P06A 1A1RA 1SGYE 1BRAA 1V2MT 2Z3CA 1CT0E 2A7CA 3ZYDA 4DG4A 2V0BA 4FVBA 1E37B 4BAQB 1EPTB 1E36B 5DKMA 1SOTA 1XXDA 5TCCA 2SGQE 1K21H 5JDUB 1VGCC 3KCGH 1O5CB 7LPRA 1D6RA 4JZFH 5JPMH 4NSYA 3M35A 2FI5E 1NFXA 2A31A 2JETB 1GJ4H 2WPHS 4UE7H 1HYLA 1SGTA 1P9UA 3GY3A 1TMTH 2Y80A 1AY6H 2XC5A 4D7FA 1DXWA 3ZZ3A 6CHAB 3NPSA 3BTQE 1THPB 2FLBH 1VJ9U 4WXIA 6GCHG 1QQUA 3SI4H 2TGDA 2Z9LA 1TPSA 1UHBB 3UTUH 4MNYA 4ZAEA 1S6FA 2FDAA 4BAHB 1A46H 4AZ2B 4JZEH 1FNIA 3UIRA 1DICA 2Z9KA 1ELCA 3MH7A 1AGJA 1WYKA 2PKSB 1RFNA 1AIXH 1G3BA 2BD9A 1FY1A 1Z8IB 2C90B 2UUYA 1NRRH 1O37A 1NRPH 2F3CE 1QURH 1WOFA 4RSPA 1TRMA 4CRBA 4IBLH 4I8HA 3GY2A 1FJSA 3CENA 1AO5A 4Q7ZA 4ISIH 3H7OA 5LH8A 3EA7A 1SQAA 3ZVDA 1QNJA 3RXFA 1GCTB 1NFUA 3M5NA 1O2NA 3UR9A 2GCHG 3PMHB 1GI5A 2PGQB 5EQSA 1SLUB 1O2HA 3LGWA 4DIHH 2WPKS 3O8DA 2TIOA 3SV8A 2QA9E 1Y5UT 2KAIA 2VB0A 3TU7H 1TIOA 1GI4A 1GI8B 1UVOA 5DK1A 1HDTH 1SC8U 1C1VH 2BDBA 1ORFA 1Y3VA 2ASUB 2IPHA 3MTYA 2XRCA 4ZHLU 3S9BA 3O8RA 3EQ0H 3BTDE 1IQKA 1ID5H 2WINI 3QLPH 3T25A 1TGCA 3VB4A 3FZZA 1V2TT 3MWIU 5SGAE 2PHBA 3M7TA 1Y8TA 1AE8H 1O2QA 2PGBB 4ABBA 1SGFA 1LHFH 2VWNA 1ZSLA 1W10U 3SU0A 1O2TA 1GBTA 2PWXA 1UTQA 1GI3A 1GHZA 1GI6A 3URCA 1DOJA 1QFKH 1H8IH 1O0DH 4ZHMU 1NRSH 3SBKA 5DJ7A 2AH4X 3A80A 1YLDA 2VWLA 1Q2WA 5L2ZH 1IQEA 2ZTZA 1RD3B 4HFPB 3T2NA 1OSSA 1CGJE 1S0QA 1MTSA 2VVUA 1UHBA 3F9HA 1GBCA 1SGDE 3QO6A 1SHYA 2FYQA 1TGBA 2A4QA 4M7GA 1K1LA 4MDSA 2ANYA 3GCHB 2XYAA 5JBBS 1DITH 4X2VA 1QCPA 1CA0C 2FOMB 4K2YA 4OS6A 1KTSB 1IHTH 1XX9A 1KLTA 3A7ZA 1QRXA 3Q00A 1GHYH 4XBCA 1O2XA 3BTFE 3ZV9A 1GHXH 5FX5A 4TPIZ 1J16A 1PQ8A 1UCYH 5DGJA 1LVMA 1C9TA 2JH6D 4KP0A 1C1WH 4CHAB 2A4RA 2BYAX 1TA6A 2HPQH 2PUXB 2VIDA 4NWLA 2OC8A 3MMGA 2ANWA 2V3OH 2BDAA 2HWLB 5GDSH 7GCHG 1L4DA 3F1SB 4AGKA 4AB8A 2A5KA 5E2PA 1PPCE 1GDUA 3RXOA 2BLOA 1GBLA 4KKDA 3HGPA 4GHQA 1P8VC 1S82A 3LGIA 4FUDA 1GGDB 2J9NA 2SGFE 4TWYA 5DG6A 1PPHE 5E0HA 2FI4E 2GZ9A 2Y6TA 2GGVB 2VINA 1QJ7B 1MQ6A 4YO9A 3SV9A 4CRFA 3MFJA 2BXUH 3A8CA 3SORA 3BG4C 3RU4D 4NFEA 4ABAA 1KXEA 5FCRA 3GY4A 4X1QU 1ELVA 1Z6EA 5A8YA 3A86A 3BTEE 5EU8A 3PO1B 3MYWA 3SUDA 1ELBA 1INCA 1OPHB 2VGCC 3UPEA 3UNRA 2WYGA 3QTOH 4YLQH 1AD8H 1MZAA 1Z71A 1BQYA 3LOXA 1SI5H 4NA9H 2QXIA 3A7VA 4K3JA 1VGCB 4DJZB 5ABWA 1AFQC 1OX1A 1TYNA 2TGTA 2YNBA 3QGNB 4Y0ZE 2CF9H 1EAUA 4Y0YE 1EZSC 4I8LA 3PTNA 1V2KT 3Q3KA 4IN1A 9ESTA 4XBBA 2B7DH 1PYTC 4ESTE 1Z1IA 3E16B 3RXAA 3A88A 1TWXB 3ZZ6A 3A82A 4SGBE 1F7ZA 2WUCA 1ACBE 1ABIH 3GDUA 4I8JA 1X7AC 2QYIA 5GIBA 1K2I1 1AMHA 1J14A 2ZHWH 3E1XB 4BXSA 3O8BA 1THRH 1C5QA 2ZU5A 2ZPQA 1O2KA 2Z94A 1O34A 1PQ5A 1SQOA 2ZKSA 1Y59T 3MU5A 3VXFH 1DLEA 1PPFE 3SNBA 1HBTH 1GBIA 3BTHE 4NWKA 4CREA 2ZNKH 4FU8A 4H42U 3EA8A 3TJNA 2ZPRA 1C2MA 3KN2A 1GBEA 2TBSA 4ASHA 2FOGA 4LZ1H 4KELA 1PPGE 2QIQA 4OS7A 2LPRA 1TX7A 3QZRA 4TPYA 5GCHF 1SPJA 1GMHG 2ALVA 3TGJE 3GCTG 1KIGH 5AVDA 2PFEA 2BVRH 3SJ9A 2ZPSA 5C1UA 1GMHF 2XTTB 4AN7A 2SFAA 2F91A 5DP5A 1LDTT 1P09A 1O3HA 4FXGH 1BCUH 3BV9B 2VWMA 3RXQA 2SGDE 3FANA 1EB2A 1P01A 4JK6A 1NU9A 1OWJA 8GCHG 2Y7ZA 2VVCA 3ATKA 3RXCA 1MTNC 4D8NA 1O39A 1DWDH 4JMYA 2D2DA 4LXBH 4OGYA 4X8TH 5A0CA 1ZTJA 3ATLA 5DP8A 3UWJH 3KNXA 1H9HE 3DA9B 2QCYA 2TRMA 3MI4A 4XBDA 4ZKNU 1W2KH 2UWLA 1NO9H 3SJKA 4FUJA 1Y5BT 2BD2A 1FONA 5IYTA 3RM0H 4Q7XA 1SSXA 1ETTH 1HNEE 1AUTC 3GCHC 5JB9S 1TQ7B 8ESTE 1THSH 1G3CA 4K69A 1A3BH 1HAHH 1W12U 2F9UA 3LGVA 3V13A 1NPMA 1QBNA 5T3HA 1EAIA 4WY3A 1L1JA 1ZMNA 2VIOA 2ZU1A 3ZVGA 4I33A 1PQ7A 5H4IB 2IJOB 4B74A 3TIUA 2WV5A 2ZEBA 4CRAA 4I7YH 4B2AA 1TNLA 3N7OA 1V2JT 3HGNA 4NFFA 4AOQA 1MAYA 4YM9A 3OTJE 2BZAA 2XBVA 1KXDA 4F49A 3SV2H 3PO1C 2EC9H 4GCHG 5LGOA 3VEQB 1B5GH 1W7XH 5DP3A 3A83A 4LOYH 1O2YA 1TMUH 1MCTA 3SGAE 4B2CA 2G81E 4HZHA 1QBVH 3SZNA 5GJ4B 1TQ0B 4GPGA 4XFQA 1GMDG 5IDKA 4NIVA 1LVYA 3T62A 1FMGA 1LPGB 4X8VH 2D8WA 1ANBA 3AAVA 2F9NA 2W7UA 4ZKRU 1D6WA 3U9AH 2BLWA 2BDCA 2VU8E 5F8TA 3TITA 1FY3A 1P11E 3LH3A 1Z1JA 3EYDA 1HAYB 1GMCF 3P17H 3PB1E 3SO3A 2I6QA 2C8XB 3RDZA 1YBWA 2O8UA 4X6MA 3URDA 2W26A 3SV6A 1NC6A 2NU2E 2TGAA 1TBQH 3H5CB 3ATIA 3QGJA 2BY7X 2OQ5A 3R3GB 2XXLA 4FUFA 1EOLA 5EOKA 5A0AE 1L1NA 2A7JA 3F9EA 4Y8XA 1N6XA 1YPJH 1GCTC 2FM2A 2ZU2A 3MU0A 3SGBE 1KXAA 1QHRB 1BTUA 1A5HA 4UFEH 4YT7H 2GX4A 1TPPA 3OYPA 1GBKA 4MPUA 2TPIZ 1BMLA 5DP6A 1W0YH 1O3IA 2FTMA 1E0FD 3RXRA 2BOHB 1E35B 4HTCH 2BY5X 5ESBA 4QT8C 2XBXA 5FXLA 1TNKA 2R0KA 1MD7A 2AIQA 4MLFB 1T8OA 2BQWB 4YTAA 4K60A 2J92A 1C2FA 1BTZA 5E8EH 2R3UA 4WMFA 2JETC 1DPOA 3BN9A 1ZZZA 2GZ7A 4K1TA 5C5OA 3ZZ7A 1H4WA 2A4OA 1NZQH 2PTNA 2ZG0H 1P3CA 4B76A 2ZA5A 1B7XB 1MD8A 1C5TA 3QZQA 1UCYK 2Y82A 6CHAC 3A7WA 1EUFA 3AW0A 2FTLE 1T8LA 5I46H 1A61H 5AF9H 1CU1A 3MNBA 5EQQA 5E2OA 1DSUA 1SGEE 1UTJA 1J9CH 2GDDA 3T27A 4JK5A 1ZHPA 2GDEH 4XE4A 1KTTB 3P8GA 3Q3XA 1LKBA 2H9EH 1GVLA 1UTNA 1CHOF 2QXGA 1KDQB 1EOJA 3ZZBA 1HB0B 3OY5U 1WCZA 1PPEE 1ELGA 1PFXC 1MTNB 4TWWA 5C1XA 2GCTC 4UFFH 1O2SA 4ZHAA 3RMLH 2CGAA 3LKWA 1E38B 1NM6A 1XUFA 3K6YA 1YPEH 3SQHE 2ZGJA 3PWCA 1F92A 3D62A 1KYNA 5HMAA 1UK2A 3KQCA 3T26A 1YPHC 4BOHA 4ZXXH 1AHTH 2CV3A 4IN2A 5E0GA 4X1SU 2BVSH 4CRCA 1F5LA 4D7GA 5HGGA 2ANKH 1C5VA 1TONA 1ELTA 1V2LT 1S0RA 1T8NA 3NZIA 5EQRA 3FFGA 4FUCA 5T6GA 1TLDA 3LPRA 2OC7A 3SU4A 1HAXB 2BMGB 1QQ4A 1T31A 1MZDA 2ZFRH 3EDXB 2Y81A 2H9TH 2Y7XA 3GOVB 1P05A 4X0WU 5DP7A 2G8TA 1KXFA 4BANB 3TK6A 3PV4A 3ZVEA 1EXFA 4BNRA 1SG8B 2BM2A 3SNEA 4CBNA 2R9PA 2QF3A 1DLKB 1LHCH 3GDVA 2Q6GA 2BX3A 2QV1A 4Y79A 1QL8A 3RP2A 1V2UT 1MBQA 4ABEA 1BHXB 3F68H 1HRTH 1BRUP 3UREA 1ELEE 2DUCA 3HK3B 3RLWH 2BY6X 2EI8A 4YOJA 1TB6H 2B8OH 1ELFA 1LCYA 3RM2H 4INHA 1F0SA 2THFB 2GV6A 3A89A 5FPSA 1C1SA 1KSNA 4BAOB 1NTPA 4R8TB 3OY6U 3NUMA 1ZLRA 2HNTE 2XWBI 3KQBA 1WTHD 1GHWH 2A5IA 1TGNA 3A7TA 1ANDA 2ZDAH 2OC0A 1O5AB 3TPIZ 2R2MB 1OWKA 3GISB 1TOCB 2BY9X 5TJXA 1B0FA 2BLVA 4AYYB 2ZWLH 3HATH 3M3TA 1ZPZA 1V2PT 4X2WA 2A45B 2AYWA 2OBQA 2BZ6H 1MCVA 1VZQH 1O36A 1O3GA 1UVSH 4NIYA 1MH0A 2B0FA 3GICB 2CN0H 3T29A 4J1YA 2FXRA 1OP2A 4UFGH 1DUAA 1S6HA 3RXIA 3M3VA 1NN6A 1NROH 4WH6A 4WH8A 4AFSA 1UJ1A 4D9QA 2H6MA 2CXVA 1QIXB 4ZH8A 3B23B 3QTVH 3ZVFA 1HXEH 1YPHE 3VB6A 1ARCA 1GBAA 1LKAA 3ZVBA 5CHAC 1V3XA 1O2GH 1RIWC 2Z9JA 1P2OA 1HAVB 5LPFA 1O2RA 1BBRH 2Q1JA 4OGXA 4FUGA 1JXPA 1K1IA 1TRYA 1K28D 4RKJB 2QF0A 2FPZA 1SFIA 5C20A 3T28A 3A7XA 4NIXA 4YLUA 1SBWA 1FPHH 4IMQA 1A3EH 2WYJA 2V6NA 2ZHQH 4H6TA 1EATA 1YC0A 1HJAB 2ZCLP 3TH4H 1SLXB 1GJBB 3RXPA 5A8XA 1A7SA 1HAPH 3P8NA 4ZMAH 1O3MA 1CA8B 1WV7H 3TH2H 1GBMA 3DT0H 3E0PB 2FODA 3RXTA 2OC1A 5B6OA 3U1JB 5AFYH 1LHDH 2ILNA 3BIVH 1FAXA 1FQ3A 1MU8B 1QJ1B 2HOBA 4B75A 3OX7U 1MUEB 3U8RH 1NFWA 4X2XA 1TOMH 1SQTA 2YNAA 3RU4T 3AAUA 1ZMJA 3MO3A 2ODYB 1EP5A 2CF8H 3SV7A 3UUZA 2SGAA 2ZHDA 2GKVE 2OBOA 3W94A 5G4BA 5J4SA 1Y3YA 1RTLA 1UMAH 1GI9B 1P10A 1O33A 4CR9A 1ZTLA 1TAWA 2GT8A 4X1RU 1OP8A 1BOQA 1XUGA 5FBEA 3D65E 3M5MA 3R0FA 2VJ1A 4Y7BA 5GCHG 2FX4A 1Y3XA 1TA2A 3GCNA 2FYRA 3WY8A 1NY22 2ZQ1A 1AWFH 1OWIA 2UUFB 1EAXA 1LHEH 2BX4A 5JB8S 1O3EA 1ZMLA 1BJUA 2VH0A 3OSYA 5EPYA 3C1KA 4IC5A 1GBHA 2ESTE 1ZGVA 3UOUA 4ISLA 1W0ZU 5EW1H 1SB1H 1YPKH 2Z3DA 1W14U 1G2LA 2OXSA 2VH6A 1IQJA 1EPTC 2Q6FA 3S9CA 1C1UH 4CRGA 4DT7B 1FIZA 2STBE 1BRBE 1T4UH 2EA3A 2G5VA 3K65B 2BB4A 2KAIB 1JMOH 3E0NB 1Q31A 2ZQ2A 4A1XA 5AFZH 2GMTC 5F8XA 1O5EH 1GJAB 1AB9C 1JWTA 3PLBA 1EP6A 5A8ZA 2ULLA 3A87A 4FU9A 3AVZA 1GJDB 1YCPK 1UK4A 2FLRH 1C2DA 1AFQB 5A2MH 4MQAA 1HPGA 3RXUA 1K22H 3RXMA 1HGTH 5GWZA 2ZZUH 3VFEA 1BBRK 1P9SA 3HKIB 3U98H 4UONA 1ESTA 1C4Y2 1N1LA 2ODPA 3LGUA 5PTPA 1WTGH 1ZOMA 4BXWA 4WMDA 3ZYEA 5J4QA 1XUKA 4E7RG 2FS9A 3ZZAA 4MPVA 4K1EA 4ABJA 1WU1A
chains in the Genus database with same CATH superfamily
1BRCE 1C5WB 1VR1H 3L6PA 3M36A 5EG4A 4DGJA 3TJOA 3A8DA 3PLKA 1BT7A 2BD8A 1CGIE 4X6NA 3RC4A 3O8CA 2RA3A 2C8WB 2V3HH 2OTVA 4CH2B 2RG3A 4RN6A 1D3DB 2G4UA 3LGYA 4Q80A 3M61U 1B0EA 2F83A 2ZCKP 3D23A 4DURA 2J34A 4OS1A 1GJ9B 1P2NA 7GCHF 4AFQA 4ABIA 4BTIB 1V2WT 1NT1A 4K5ZA 2PTCE 1OWDA 1YLCA 2OK5A 3TLOA 2VVVA 1O2PA 1EPTA 2KCOA 1YF4A 4X6OA 2ZTYA 1E34B 1C4U2 1UTLM 4HG6A 4GSOA 2VIWA 1HJ9A 4Q7YA 3UY9A 2Z3EA 5HYOA 2AMQA 4U2WA 1JRSA 5C0TA 1SMFE 4KGAA 4INKA 3U1IB 3STIA 1JIRA 1P57B 5AHGH 4Y71A 4KTSA 1GBFA 2BDYA 1S6LA 1GJ6A 1OWEA 3Q3YA 4B73A 2OLGA 1C1TA 2H9HA 1CHGA 1P02A 2FIRH 4DOQA 3I78A 2ZU4A 4SGAE 4WWYA 3A84A 1DSTA 1LVOA 1H9IE 3TNSA 2P3UB 5HIZA 1TNHA 1RIWB 1RTFB 5EXMA 2JH0D 1O5DH 1C5YB 2PSXA 5HXFA 4Y76A 1DY9A 1O3LA 1C5RA 2EI7A 2FMJA 4A92A 3H7TA 5T6FA 1FY5A 1OWHA 1QRWA 2FI3E 1SGRE 4FUIA 1F2SE 1OKXA 3EE0B 1KDQA 5C3NA 1CBWB 5BRRE 3GY6A 3F3BA 1CSOE 4AC9A 1EJAA 3ZZ8A 2ZDKA 1O32A 2UUKB 3QUMP 5EPNA 3FO8D 1GJ5H 1G2MA 5EGMA 4ISOA 3MNCA 1RGQA 3BTME 3S69A 6ESTA 1FDPA 1AKSA 4FUBA 4A1TA 4CRDA 3MNSA 2D26C 1XUIA 4NZLA 4X8UH 1DE7H 2O9QA 1S83A 4U01A 2PW8H 2WSSD 3F9GA 4X2YA 3SGQE 4TY7A 1L1GA 1TNJA 2P8OC 1C5NH 3MH4A 4GLYA 4Y7AA 1PYTD 1C1NA 3FZDA 4ACBA 3BTWE 4K1SA 3KQDA 1FX0B 1QL9A 1BDAA 3B9FH 1ZJDA 5BPEA 3PM3A 1FZZA 1GHVH 3A8BA 1G3DA 1YGCH 2A0QB 5A0BA 1SGPE 4AB9A 3MOCA 3UNQA 4A5TS 1G9IE 3E3TA 3DSPA 1ESAA 5FPTA 1IQHA 3UQVA 2F4LA 1Z8RA 2IPQX 3V0XA 3ZZ5A 4IGDA 1FIWA 2OINA 2IOTA 2FOBA 2JIZD 1FN6A 4ZKOU 1OHHD 1S85A 1W8BH 1V2ST 2P94A 1HCGA 1P2KA 1VCQA 1Z8JB 1QA7A 2BQ7B 4GVUA 1LTOA 4F4OC 1ABJH 1C4V2 3RU4E 1C5LH 1NS3A 1RTKA 4R0IA 2C3SA 2K1QA 2CK3D 3LC3A 1SGIB 3LU9B 3CS7A 2P16A 2ZP0H 3SOSA 3HPTB 2FESH 3SJ8A 2GMTB 1LO6A 3AASA 3TVJB 1D3QB 2AEIH 1BMAA 4NZQA 4DY7B 2G5NA 2BTCE 4YXWD 3I77A 3LC5A 1GCDA 1DWEH 3TK9A 4JYVH 3NXPA 3LT3A 2DE9A 1S5SA 1QA0A 1P12E 2V35A 2LNCA 2XNIA 1V2NT 3SUEA 1FY8E 3NRLA 7KMEH 2ZFQH 2QF5A 5JBCS 4RKOB 3LDXH 1GGDC 3ZZ9A 1UTKA 2GVFA 3FVFB 1V2VT 1YKTA 4AG2A 2ZFFH 4GAWA 5K7RA 3V7TA 3ZZCA 2QC2A 1YWUA 1C5XB 2A2QH 3NCLA 4WVPE 2FO9A 1P03A 3UWIA 1V2OT 5I25A 2WV4A 4J2YB 4B6EA 4AYVB 1WBGB 1QRZA 4NSVA 1GJCB 1DANH 1KLIH 1PQAA 1TPAE 2A7HA 2ZGXH 3BTGE 1BIOA 4WF8A 3LGTA 4CR5A 4RI0A 3RMMH 1ETRH 1GI0A 5ESTE 1UTOA 4Z1MD 1D9IA 3TNTA 3VXEH 2BHGA 3F6UH 2AGIX 4E7NA 3DUXH 1UW7A 1K1JA 3GY5A 3FP7E 1HXFH 4X6PA 2HALA 3HK6B 4U32A 1PPZA 1SGFG 4O97A 1OYQA 5LPRA 3TGKE 1C1MA 2XCFA 4X1NU 4TYDA 2NWNA 4AG1A 2RCEA 4NCYA 2TGPZ 1Q3XA 2OD3B 2AS9A 5FHTA 1FY4A 4CBOA 4ABFA 1O35A 4FVDA 2HPPH 4CHAC 2W3IA 1ZR0A 1UVTH 2BY8X 1FI8A 2QXHA 4IS5A 3HKJB 1GVKB 1KXCA 1EX3A 1GBDA 1NU7B 1O2MA 4ISHH 1BHXF 4MVNA 1DDJA 4VGCC 3SUGA 4YOIA 2H5DA 1CT2E 3P95A 5C5NA 1DS2E 4INLA 3E6PH 2FOHA 3DFJA 3ATWA 4I8GA 3UQOA 1BBRE 1CT4E 1YP9A 3ZZDA 2PKAB 3E91A 3A81A 5HM2A 2GV7A 4Y8ZA 2J95A 3AW1A 5JYIA 2Y5FA 1GI7B 4TY6A 1GJ7B 1TMBH 3Q77A 1TALA 1EZQA 1F0TA 2UWOA 4MTBA 2QXJA 1CBWC 5FL7D 3BIUH 4JZDH 2FOCA 2XOKD 4UFDH 1S81A 2Z7FE 3ITIA 2ZGBH 4B71A 1H8HD 2PR3A 1K1PA 3LH1A 1JIMA 3GCTF 5F8ZA 1SHHB 2VGCB 4YZUA 1UVPA 3LJOA 2F9PA 4FUHA 3C27B 3ZVAA 2RA0A 1SKYE 1CVWH 2JDID 3GY7A 1SR5C 1C2HA 2AGEX 1H1BA 4MNVA 1MMJN 1MKWH 4WXVA 3PLPA 5E0JA 1TNIA 1TX6A 3QWCH 1EB1H 3NKKA 1UO6A 1O3KA 3FP6E 3RC5A 1C5UA 3VGCB 1GBJA 2M2AA 4BTUB 1DY8A 1K1OA 1VCWA 2ANMH 3RMOH 4F55A 4AORA 5L30H 1C5OH 1LMWB 1J15A 3NK8A 2ALPA 5F03A 2HGTH 1ZPCA 1G37A 3RXSA 3PRBA 1DVAH 1LQDB 1YPGH 1DXPA 1HIAB 3BTTE 1ANCA 3EA9A 1BA8B 3E90B 3E8LA 2QN5T 1KXBA 2G00A 4B1TA 3F0OA 2Y5HA 2A2XH 1GMDF 1KLJH 3DSGA 3FAOA 3M37A 3OU0A 1C2GA 1EAWA 1T7CA 1V2RT 1XUHA 4A6LA 1UTMA 4NA7A 4OS2A 1TE0A 1UTPA 2WPJS 3MO6A 3FOAA 1GJ8B 1F5RA 1E1QD 3BSQA 4H6SB 4TT3D 2SGPE 2W5EA 5C67A 2FS8A 2LP6A 3ZZ4A 2OCVB 3QX5H 3ZVCA 8LPRA 1ZGIA 1DX5M 1O2WA 1SL3A 4MG3A 1HLTH 4Q63A 4KTCA 1GI1A 2BD4A 3UOPA 1G3EA 2G52A 4O3TA 2QGRA 4JZ1A 2C93B 1AB9B 1FN8A 3FP8E 3PRDA 5KECA 2KCAA 2J2UA 2WPIS 3BF6H 5EJZA 4AFZA 3JZ2B 1C5ZB 2ZGHA 1O2VA 3L33A 1QB6A 4DW2U 2JJ1D 1IHSH 1MTUA 1QTFA 1ZYOA 4OS5A 1DUEA 4THNH 3M7UA 1QBOA 4GUXA 1VJAU 1L4ZA 1O3BA 1ZRBA 5EXLA 8GCHF 4LK4A 3KQEA 5CMXH 4BAMB 2VNTA 1AVXA 1ARBA 1C1OA 4DIIH 1TRNA 2ZDLA 1ZJKA 2GTBA 4U30A 2A4GA 2XWAA 3RXGA 3SU5A 3OE7D 1JBUH 1OP0A 2GZ8A 1P04A 5FX6A 1P2IA 1C2KA 1GPZA 9LPRA 1TGSZ 1MTWA 5T6DA 5DPAA 4I31A 1A4WH 1IQGA 2GJGA 2JKHA 3S7KB 3GYLB 4IW4E 4ABHA 2PKSC 1AKSB 1JOUB 2AIPA 1F0UA 4MNWA 3MU8A 4Y6DA 1F5KU 5FPYA 2P3FH 4Y11E 1KY9A 1GI2A 1MTVA 3WW7A 3EGKH 1XMNB 1LPKB 1BITA 4YT6H 4MNXA 4DVAU 1O3DA 2SNVA 1C2IA 3MU1A 2ZIQH 3DFLA 1YM0A 1AUJA 1RS0A 1DFPA 1SGNE 2QAAA 1GG6B 3RXDA 2C8YB 3UAIC 1C2JA 1WAYB 2P95A 3GCOA 1GMCG 2ZU3A 4Q2KA 3RLYH 3ZIAD 3U8OH 1GVZA 1O2LA 4GCHF 1BMMH 1CO7E 1AU8A 2ZDNA 1HFDA 2H5CA 1YYY1 2FEQH 1C2LA 2XCNA 5C0UA 1F0RA 2J38A 4ASUD 4XOJA 1CHOG 1Z8GA 2HVXA 4P02A 3S9AA 1RJXB 1W3CA 3TJUA 1H9LB 1P0SH 2NU1E 4I32A 2QE7D 2ZF0H 1O3JA 3MU4A 3MHWU 1A5GH 3KIDU 2Z9IA 1V6DA 3RXEA 2A32A 2SGEE 1FLEE 4RT0A 2W7SA 1Y3WA 1PPBH 3BTKE 1SFQB 4UEHH 1TBRH 1C1QA 4AFUA 1RRKA 3GY8A 3RXBA 3ELAH 1G30B 1FPCH 2BD3A 2L6OA 5JBAS 3M7QA 3SHCH 3M3SA 1QB1A 1NRNH 2XC0A 5FAHA 5F6MA 4AGJA 2ZECA 3LONA 3N99A 2HLDD 2CHAB 1IOEA 4O03A 2IN2A 2LELA 1HIAA 3VB5A 2J5UA 1C5MD 2STAE 3MNXA 4HGCA 2CMYA 2FP7B 2R2WU 2BDHA 1GL1A 3A85A 4JZIA 2L74A 4OS4A 2WPLS 1S84A 4FETA 2J94A 1NESE 3U69H 4ABGA 3QN7A 4ZKSU 5ETXA 4X8SH 1IQIA 2W6ID 1ZSJA 3SHAH 3A8AA 3B8JA 4NGAH 2GCHF 1AVGH 2RDLA 1XUJA 3G01A 2R3YA 2G55A 2A5AA 1Y3UA 1IQFA 1H8DH 1LVBA 3IITA 2FWWA 1IQNA 3KYGA 1YCPM 3SW2B 3BEUA 2PUQH 3T5FH 2W6JD 1QB9A 2Q6DA 2I6SA 3SJOA 2K8IA 1LHGH 3P70B 3PWBA 2H1UA 1O2OA 2ZHFH 1FAKH 3MH6A 2AERH 3S7HB 1J17T 1HAVA 1C5SA 3DHKH 1GHBG 3V3MA 2P3TB 1O5FH 4Z6AH 1G32B 5EJ1A 1SVPA 2GCTB 5TCAA 1UK3A 4NA8A 3V12A 2BDGA 1P3EA 2AMDA 1GWAA 3QK1A 4CH8B 4O3UA 5FBIA 3VB7A 2PSYA 5GPIB 1AWHB 2QY0B 1YLNA 2M5TA 4WJG2 5LPEA 3PROA 4MPXA 1A0JA 1O2JA 3LJJA 1CGHA 4UD9H 1O2ZA 3P6ZB 5GXPA 3IG6B 3PYHA 1Y5AT 2O8LA 1L2EA 1P2MA 1A0HB 4ZUHA 1DWCH 1O3NA 1T32A 2AGGX 1GBBA 2G51A 5DSFA 1WSSH 2PLXA 3JZ1B 2PKAA 3TK5A 2F9BH 2NU0E 2OUAA 1N8OB 1TNGA 1GDNA 2ZDVH 4ISNA 5DO4H 1BTYA 4JCNA 3PMBB 4D9RA 1SGQE 2GP9B 2KX4A 3DD2H 1MKXH 4ZROA 3TGIE 3SUFA 3K9XB 1Z6JH 1G36A 2BQ6B 1OOKB 3CP7A 3DSOA 1MBMA 1WUNH 2P59A 1W7GH 3K6ZA 2FOAA 1A2CH 2XNDD 1PJPA 2C4FH 1HV7A 5C1YA 2ZDMA 1OXGA 7ESTE 1A5IA 2HNTC 3CS0A 1A0LA 1XKBC 3RUOA 3KEEA 3I29A 3KL6A 3W1EA 3LIWA 2GT7A 3ENSB 1MKXK 3PTBA 4NG9H 3SU2A 1DWBH 5CE1A 1C1PA 1TFXA 1W11U 2WUBA 2ZO3H 3BEFB 1O30A 2FOFA 3M5OA 1NRQH 2G4TA 2XBYA 1HJ8A 1SLWB 1GG6C 1GHBF 1QGFA 3A7YA 1ZSKA 1OYTH 4JYTA 1BMNH 2VWOA 2HRVA 1L0ZA 1SGCA 4D76A 1C2EA 1W0KD 1AN1E 2WPMS 1ZTKA 1XXFA 1WQSA 5FCKA 3FKSD 1DM4B 1EKBB 1AFEH 4ZXYH 2VIQA 3SNCA 1O2UA 1GL0E 5DP9A 1EZXC 1WQVH 1DT2A 1QY6A 3KGPA 1ESBA 2FOEA 2ZFTA 1VITG 2BOKA 4HI3A 2GD4B 1V2QT 2KZ4A 4H4FA 2PV9B 4XDEA 1GHAG 4NIWA 3RXJA 3UNSA 1HAOH 1O31A 3SNDA 2XC4A 3SI3H 2FZZA 1SLVB 1BJVA 4KTUA 1BUIA 1GHAF 3K2UA 2AMPA 2Z6BD 1HUTH 1YPLH 3W95A 3S0NA 1BB0B 2YOLA 1VCPA 3NWUA 2ZHEH 1AI8H 1EFRD 3PMAB 3BG8A 4FU7A 1W13U 2ZCHP 3TJVA 4I8KA 2P8OB 2BXTH 3KF2A 2ZI2H 3EAJA 1D4PB 1CQQA 3ZV8A 1BTWA 1VITF 2F9VA 2SNWA 3VB3A 1XVOA 3SU1A 4O9VA 2BVXH 1T4VH 1ZRKA 1TGTA 3P8FA 2OQUA 3SN8A 1AE5A 2UUJB 3ESTA 4YOGA 3VPKA 3RC6A 5EXNA 2NU3E 1EJNA 1ELAA 1NFYA 2W3KA 1AZZA 1O3AA 2OP9A 1O3FA 3Q76A 2ZTXA 1ELDE 2Y5GA 2R0LA 1K0HA 2A1DB 3SYJA 1TBZH 2NU4E 1BZXE 1CE5A 1VITH 4IC6A 1C5PA 2EI6A 5C2ZA 3RXKA 3ODFA 3UR6A 1UVUH 1ZHMA 2ZFPH 8KME2 1O38A 2CJIA 4XSKU 1AQ7A 3STJA 5L2YH 2CHAC 4Z0KA 2BLQA 1ZHRA 1D3PB 1FXYA 3BEIB 2HLCA 1O3OA 3FN8A 4K8BA 3UFAA 1K9OE 1U6QA 1MQ5A 1RXPA 1FUJA 1XKAC 3SU6A 4A7IB 1MAXA 1QL7A 1O3PB 4VGCB 3ODDA 1C1RA 1YCPH 5CHAB 1TPOA 3GDSA 2BD7A 1NBMD 1OS8A 3P92A 3P8OA 4FUEA 1IQMA 4BAKB 1HAIH 4A1VA 3F9FA 1N6YA 2ZC9H 1J8AA 1HAGE 2DE8A 2HNTF 2JH5D 3D49H 5KEDA 1Z7KA 2F9OA 2O8MA 1LPZB 1XVMA 5K0HA 3QDZB 1YPMH 5B6LA 2BD5A 3RMNH 3CNRA 1UCYE 4UDWH 1KMHB 2Z9GA 3L3TA 1EZUC 2AFQB 2C8ZB 3U28C 1YY3A 2B9LA 1HJAC 1M9UA 1CA0B 2B5TB 3ATMA 3TH3H 4PROA 4MPWA 1P2JA 2UWPA 4Y8YA 5EW2H 1IAUA 5HM9A 2EEKA 2O8WA 4YESB 3SNAA 5A09A 3PMJA 3MO9A 1N8OC 2VIPA 1FV9A 3U8TH 1P2QA 1GDQA 4ACAA 2H2ZA 1O2IA 1AZ8A 1BTXA 1TX8A 4WMEA 1JRTA 1QJ6B 4ABDA 2XW9A 3RXHA 3VGCC 5DP4A 1C9PA 1ZPBA 1ETSH 1K1MA 3IWMA 4E06H 1D3TB 3RXLA 6LPRA 5EODA 5JBTA 1HAZB 1XM1A 1EASA 1O3CA 1O5GH 1LQEA 2O8TA 2PP6A 1BTPA 1K1NA 3M5LA 2BDIA 2ZGCA 1MKWK 1QR3E 3KHVA 4B2BA 4X1PU 4AX9H 1MU6B 3SJIA 2P93A 4DCDA 2ZFSA 3MH5A 2VIVA 4K8YA 3GYMA 1O5BB 2ODQA 3RXVA 1T8MA 4LZ4B 4IMZA 2J4IA 4JYUH 4GHTA 5GNDA 1BTHH 2XBWA 1IQLA 1ANEA 1EJMA 3PV2A 1AVWA 3BG4B 1TABE 4BTTB 3SQEE 4Y10E 3SU3A 4E05H 2FX6A 6GCHF 5L6NH 2D1JA 2YMSC 1SOZA 1EQ9A 1P06A 1A1RA 1SGYE 1BRAA 1V2MT 2Z3CA 1CT0E 2A7CA 3ZYDA 4DG4A 2V0BA 4FVBA 1E37B 4BAQB 1EPTB 1E36B 5DKMA 1SOTA 1XXDA 3PV5A 5TCCA 2SGQE 1K21H 2WPDD 5JDUB 1VGCC 3KCGH 1O5CB 7LPRA 1D6RA 4JZFH 5JPMH 4NSYA 3M35A 2FI5E 1NFXA 2A31A 2JETB 2J98A 1GJ4H 2WPHS 4UE7H 1HYLA 1SGTA 1P9UA 3GY3A 1TMTH 2Y80A 1AY6H 2XC5A 4D7FA 1DXWA 3ZZ3A 6CHAB 3NPSA 3BTQE 1THPB 1E79D 2FLBH 1VJ9U 4WXIA 6GCHG 1QQUA 3SI4H 2TGDA 2Z9LA 1VKYA 1TPSA 1UHBB 3UTUH 4MNYA 4ZAEA 1S6FA 2FDAA 4BAHB 1A46H 2HVYB 4AZ2B 4JZEH 1FNIA 3UIRA 1DICA 2Z9KA 1ELCA 3MH7A 1AGJA 1WYKA 2PKSB 1RFNA 1AIXH 1G3BA 2BD9A 3OFND 1FY1A 1Z8IB 2C90B 2UUYA 1NRRH 1O37A 1NRPH 2F3CE 1QURH 1WOFA 4RSPA 1TRMA 4CRBA 4IBLH 4I8HA 3GY2A 1FJSA 2KFWA 3CENA 1AO5A 4Q7ZA 4ISIH 3H7OA 5LH8A 3EA7A 1SQAA 3ZVDA 1QNJA 3RXFA 1GCTB 1NFUA 3M5NA 1O2NA 3UR9A 2GCHG 3PMHB 1GI5A 2PGQB 5EQSA 1SLUB 2F43B 1O2HA 2V7QD 3LGWA 4DIHH 2WPKS 3O8DA 2TIOA 3SV8A 2QA9E 1Y5UT 2KAIA 2VB0A 3TU7H 1TIOA 1GI4A 1GI8B 1UVOA 5DK1A 1HDTH 2WV9A 1SC8U 1C1VH 1WDIA 2BDBA 5T1VA 1ORFA 1Y3VA 2ASUB 2IPHA 3MTYA 2XRCA 4ZHLU 3S9BA 3O8RA 3EQ0H 3BTDE 1IQKA 1ID5H 2WINI 3QLPH 3T25A 1TGCA 3VB4A 3FZZA 1V2TT 3MWIU 5SGAE 2PHBA 3M7TA 1Y8TA 1AE8H 1O2QA 2PGBB 4ABBA 1SGFA 1LHFH 2VWNA 1ZSLA 1W10U 3SU0A 1O2TA 1GBTA 2PWXA 1UTQA 1GI3A 1GHZA 1GI6A 3URCA 1DOJA 1QFKH 1H8IH 1O0DH 4ZHMU 1NRSH 3SBKA 5DJ7A 2AH4X 3A80A 1YLDA 2VWLA 1Q2WA 5L2ZH 1IQEA 2ZTZA 1RD3B 4HFPB 3T2NA 1OSSA 1CGJE 1S0QA 1MTSA 2VVUA 1UHBA 1W0JD 3F9HA 1GBCA 1SGDE 3QO6A 1SHYA 2FYQA 1TGBA 2A4QA 3AK5A 4M7GA 1K1LA 4MDSA 2ANYA 3GCHB 2XYAA 5JBBS 1DITH 4X2VA 1QCPA 1CA0C 2FOMB 4K2YA 4OS6A 1KTSB 2K0QA 1IHTH 1XX9A 1KLTA 3A7ZA 1QRXA 3Q00A 1GHYH 4XBCA 1O2XA 3BTFE 3ZV9A 1GHXH 5FX5A 4TPIZ 1J16A 1PQ8A 1UCYH 5DGJA 1LVMA 1C9TA 2JH6D 4KP0A 1C1WH 4CHAB 2A4RA 2BYAX 1TA6A 2HPQH 2PUXB 2VIDA 4NWLA 2OC8A 3MMGA 2ANWA 2V3OH 2BDAA 2HWLB 3WWFA 5GDSH 7GCHG 1L4DA 3F1SB 4AGKA 4AB8A 2A5KA 5E2PA 1PPCE 1GDUA 3RXOA 2BLOA 1GBLA 3KQ5A 4KKDA 5HKKD 3HGPA 4GHQA 1P8VC 1S82A 3LGIA 4FUDA 1GGDB 2J9NA 2SGFE 4TWYA 5DG6A 1PPHE 5E0HA 2FI4E 2GZ9A 2Y6TA 2GGVB 2VINA 1QJ7B 3F2HA 1MQ6A 4YO9A 3SV9A 4CRFA 3MFJA 2BXUH 3A8CA 3SORA 3BG4C 3RU4D 4NFEA 4ABAA 1KXEA 5FCRA 3GY4A 4X1QU 1ELVA 2EY4C 1Z6EA 5A8YA 3A86A 2VBCA 3BTEE 5EU8A 3PO1B 3MYWA 3SUDA 1ELBA 1INCA 1OPHB 2VGCC 3UPEA 3UNRA 2WYGA 3QTOH 4YLQH 1AD8H 1MZAA 2WHXA 4B6FA 3SZEA 1Z71A 1BQYA 3LOXA 1SI5H 2QF4A 4NA9H 5C17A 2QXIA 3A7VA 3F2GA 1VGCB 4K3JA 4DJZB 5ABWA 1AFQC 1OX1A 1TYNA 2TGTA 2YNBA 3QGNB 4Y0ZE 2CF9H 4OM9A 1EAUA 4Y0YE 1EZSC 4I8LA 3PTNA 1V2KT 3Q3KA 4IN1A 9ESTA 4XBBA 2B7DH 1PYTC 4ESTE 1Z1IA 3E16B 3RXAA 3A88A 3GS9A 1TWXB 3ZZ6A 3A82A 4SGBE 1F7ZA 2WUCA 1ACBE 1ABIH 3GDUA 4I8JA 1X7AC 2QYIA 5GIBA 1K2I1 1AMHA 1J14A 2ZHWH 3E1XB 4BXSA 3O8BA 1THRH 1C5QA 2ZU5A 2ZPQA 1O2KA 2Z94A 1O34A 2JJ2D 1PQ5A 1SQOA 2ZKSA 1Y59T 3MU5A 3VXFH 1DLEA 1PPFE 3SNBA 1HBTH 1GBIA 3BTHE 4NWKA 4CREA 2ZNKH 4FU8A 4H42U 3OAAD 3EA8A 3TJNA 2ZPRA 1C2MA 3KN2A 1GBEA 2TBSA 4ASHA 2FOGA 4LZ1H 4KELA 5KGOA 1PPGE 2QIQA 4OS7A 2LPRA 1TX7A 3QZRA 4TPYA 5GCHF 1SPJA 1GMHG 2ALVA 3TGJE 3GCTG 1KIGH 5AVDA 2PFEA 2BVRH 3SJ9A 2KR7A 2ZPSA 5C1UA 1GMHF 2XTTB 4AN7A 2SFAA 2F91A 5DP5A 1LDTT 1P09A 1O3HA 2J97A 4FXGH 1BCUH 3BV9B 2VWMA 3RXQA 2SGDE 3FANA 1EB2A 1P01A 4JK6A 1NU9A 1OWJA 8GCHG 2Y7ZA 2VVCA 3ATKA 3RXCA 1MTNC 2RFKC 4D8NA 1O39A 1WXRA 1DWDH 4JMYA 2D2DA 4LXBH 4OGYA 4X8TH 5A0CA 1ZTJA 3ATLA 5DP8A 3UWJH 3KNXA 1H9HE 3DA9B 2QCYA 2TRMA 3MI4A 4XBDA 4ZKNU 1W2KH 2UWLA 1NO9H 3SJKA 4FUJA 1Y5BT 2BD2A 1FONA 5IYTA 3RM0H 3F2FA 4Q7XA 1SSXA 1ETTH 1HNEE 1AUTC 3GCHC 5JB9S 1TQ7B 8ESTE 1THSH 1G3CA 4K69A 1A3BH 1HAHH 1W12U 2F9UA 3LGVA 3V13A 1NPMA 1QBNA 3VG8A 5T3HA 1EAIA 4WY3A 1L1JA 1ZMNA 2VIOA 2ZU1A 3ZVGA 4I33A 1PQ7A 5H4IB 2IJOB 4B74A 3TIUA 2WV5A 2ZEBA 4CRAA 4I7YH 4B2AA 1TNLA 3N7OA 1V2JT 3HGNA 4NFFA 4AOQA 1MAYA 4YM9A 1NBME 3OTJE 2V3MA 2BZAA 2XBVA 1KXDA 4F49A 3OTPA 3SV2H 3PO1C 2EC9H 4GCHG 5LGOA 3VEQB 2J98B 1B5GH 1W7XH 5DP3A 3A83A 4LOYH 1O2YA 1TMUH 1MCTA 3SGAE 4B2CA 2G81E 4HZHA 1QBVH 3SZNA 5GJ4B 1TQ0B 4GPGA 4XFQA 1GMDG 5IDKA 4Q4LA 4NIVA 1LVYA 3T62A 1FMGA 1LPGB 4X8VH 4TSFD 2D8WA 3MQKC 1ANBA 3AAVA 2F9NA 2W7UA 4ZKRU 1D6WA 3U9AH 2BLWA 2BDCA 5EIYA 2VU8E 5F8TA 3TITA 1FY3A 1P11E 3LH3A 1Z1JA 3EYDA 1HAYB 1GMCF 3P17H 3PB1E 3SO3A 2I6QA 2C8XB 3RDZA 5EJLA 1YBWA 2O8UA 4X6MA 3URDA 2W26A 3SV6A 1NC6A 2NU2E 3H09A 2TGAA 3KYFA 1TBQH 2YMSD 3H5CB 3ATIA 3QGJA 2BY7X 2OQ5A 3DCLA 3R3GB 2XXLA 4FUFA 1EOLA 3F0PA 5EOKA 5A0AE 1L1NA 2A7JA 3F9EA 4Y8XA 3UB0A 1N6XA 1YPJH 3N7DA 1GCTC 2FM2A 2ZU2A 3MU0A 3SGBE 1KXAA 1QHRB 1BTUA 1A5HA 4UFEH 4YT7H 2GX4A 1TPPA 3OYPA 1GBKA 4MPUA 2TPIZ 1BMLA 5DP6A 5CHBA 1W0YH 1O3IA 2FTMA 1E0FD 3RXRA 2BOHB 1E35B 4HTCH 2BY5X 2KCPA 5ESBA 4QT8C 2XBXA 5FXLA 1TNKA 2R0KA 1MD7A 2AIQA 4MLFB 1T8OA 2BQWB 4YTAA 4K60A 2J92A 1C2FA 1BTZA 5E8EH 2R3UA 4WMFA 2JETC 1DPOA 3BN9A 1ZZZA 2GZ7A 2IJD1 4K1TA 5C5OA 3ZZ7A 1H4WA 2A4OA 1NZQH 2PTNA 2ZG0H 1P3CA 4B76A 2ZA5A 1B7XB 1MD8A 1C5TA 3QZQA 1UCYK 2Y82A 6CHAC 3A7WA 1EUFA 3AW0A 2FTLE 1T8LA 5I46H 1A61H 5AF9H 1CU1A 3MNBA 5EQQA 5E2OA 1DSUA 1SGEE 1UTJA 1J9CH 2GDDA 1QZ8A 3T27A 4JK5A 4RT1A 1ZHPA 2GDEH 4XE4A 1KTTB 3P8GA 3Q3XA 1LKBA 2H9EH 1GVLA 1UTNA 1CHOF 2QXGA 1KDQB 1EOJA 3ZZBA 1HB0B 3OY5U 1WCZA 1PPEE 1ELGA 1PFXC 1MTNB 4TWWA 4FOUC 5C1XA 2GCTC 4UFFH 1O2SA 4ZHAA 3RMLH 2CGAA 3LKWA 1E38B 1NM6A 1XUFA 1BMFD 3K6YA 1YPEH 3SQHE 2ZGJA 3PWCA 1F92A 3D62A 1KYNA 5HMAA 1UK2A 3KQCA 3T26A 1YPHC 4BOHA 4ZXXH 1AHTH 2CV3A 4IN2A 5E0GA 4X1SU 2BVSH 4CRCA 1F5LA 4D7GA 5HGGA 2ANKH 1C5VA 1TONA 1ELTA 1V2LT 2YMSB 1S0RA 4F48B 1T8NA 3NZIA 5EQRA 3FFGA 4FUCA 5T6GA 1TLDA 3LPRA 2OC7A 3SU4A 1HAXB 2BMGB 1QQ4A 1T31A 1MZDA 2ZFRH 3EDXB 2Y81A 2H9TH 2Y7XA 3GOVB 4I86A 1P05A 4X0WU 5DP7A 2G8TA 1KXFA 4BANB 3TK6A 2WZQA 3PV4A 3ZVEA 1EXFA 4BNRA 1SG8B 2BM2A 3SNEA 4CBNA 2R9PA 3OEHD 2QF3A 1DLKB 1LHCH 3GDVA 4DT4A 5DN6D 4XRNA 2Q6GA 2BX3A 2QV1A 4Y79A 1QL8A 3RP2A 1V2UT 1MBQA 4ABEA 1BHXB 3F68H 1HRTH 1BRUP 3UREA 1ELEE 2DUCA 3HK3B 3RLWH 5CDFE 2BY6X 2EI8A 4YOJA 1TB6H 2B8OH 1ELFA 1LCYA 3RM2H 4INHA 1F0SA 2THFB 2GV6A 3A89A 5FPSA 3N7EA 4P00A 1C1SA 1KSNA 2KM0A 4BAOB 1NTPA 4R8TB 3OY6U 3NUMA 1ZLRA 2HNTE 2XWBI 3KQBA 1WTHD 1GHWH 1MABB 2A5IA 1TGNA 3A7TA 4M9FA 1ANDA 2ZDAH 2OC0A 1O5AB 3TPIZ 2R2MB 1OWKA 3GISB 1TOCB 2BY9X 5TJXA 1B0FA 2BLVA 4AYYB 2ZWLH 3HATH 2RDEA 3M3TA 1ZPZA 1V2PT 4X2WA 2A45B 2AYWA 2OBQA 2BZ6H 1MCVA 1VZQH 1O36A 1O3GA 1UVSH 4NIYA 1MH0A 2B0FA 3GICB 2CN0H 3T29A 4J1YA 2FXRA 1OP2A 4UFGH 1DUAA 1S6HA 3RXIA 3M3VA 1NN6A 1NROH 4WH6A 4WH8A 4AFSA 1UJ1A 4D9QA 2H6MA 2CXVA 1QIXB 4ZH8A 3B23B 3QTVH 3ZVFA 1HXEH 1YPHE 3VB6A 1ARCA 1GBAA 5C94A 1LKAA 3ZVBA 5CHAC 1V3XA 1O2GH 1RIWC 1COWD 1P2OA 2Z9JA 1HAVB 5LPFA 1O2RA 1BBRH 2Q1JA 4OGXA 4FUGA 4XD7D 1H8ED 1JXPA 1K1IA 1TRYA 1K28D 4RKJB 2QF0A 2FPZA 1SFIA 5C20A 3T28A 3A7XA 4NIXA 4YLUA 1SBWA 1FPHH 4IMQA 1A3EH 2WYJA 2V6NA 2ZHQH 4H6TA 1EATA 1YC0A 1HJAB 2ZCLP 3TH4H 1SLXB 1E1RD 1GJBB 3RXPA 4ZCNA 5A8XA 1A7SA 3OEED 1HAPH 3P8NA 4ZMAH 1O3MA 1CA8B 1WV7H 3TH2H 1GBMA 3DT0H 3E0PB 2FODA 3RXTA 2OC1A 5B6OA 3U1JB 5AFYH 5F53A 1LHDH 2ILNA 3BIVH 1FAXA 1FQ3A 1MU8B 1QJ1B 2HOBA 4B75A 3OX7U 1MUEB 3U8RH 1NFWA 4X2XA 1TOMH 1SQTA 2YNAA 3RU4T 3AAUA 1ZMJA 3MO3A 2ODYB 1EP5A 2CF8H 3SV7A 3UUZA 2AHME 2SGAA 2ZHDA 2GKVE 2OBOA 3W94A 5G4BA 5J4SA 5IK2D 1Y3YA 1RTLA 1UMAH 1GI9B 1P10A 1O33A 4CR9A 1ZTLA 1TAWA 2GT8A 4X1RU 1OP8A 1BOQA 1XUGA 5FBEA 3D65E 2EQNA 3M5MA 3R0FA 2VJ1A 4Y7BA 5GCHG 2FX4A 1Y3XA 1TA2A 3GCNA 2FYRA 3WY8A 1NY22 2ZQ1A 1AWFH 1OWIA 2UUFB 1EAXA 1LHEH 2BX4A 5JB8S 1O3EA 1ZMLA 1BJUA 2VH0A 3OSYA 3EE7A 5EPYA 3C1KA 4IC5A 1GBHA 2ESTE 1ZGVA 3UOUA 4ISLA 1W0ZU 5EW1H 1SB1H 1YPKH 2Z3DA 1W14U 1G2LA 2OXSA 2VH6A 1IQJA 1EPTC 2Q6FA 3S9CA 1C1UH 4CRGA 4DT7B 1FIZA 2STBE 1BRBE 1T4UH 2EA3A 2G5VA 3K65B 2BB4A 2KAIB 1JMOH 3E0NB 1Q31A 3WWBA 2ZQ2A 4A1XA 5AFZH 2GMTC 5F8XA 1O5EH 1GJAB 5HIYA 1AB9C 1JWTA 3PLBA 1EP6A 5A8ZA 2ULLA 3A87A 4FU9A 3AVZA 1GJDB 1YCPK 1UK4A 2FLRH 1C2DA 1AFQB 5A2MH 4MQAA 2KCYA 1SQRA 1HPGA 1K22H 3RXMA 1HGTH 3RXUA 5GWZA 2ZZUH 3VFEA 1BBRK 1P9SA 3HKIB 3U98H 4UONA 1ESTA 1C4Y2 1N1LA 2ODPA 3LGUA 5PTPA 1WTGH 1ZOMA 4BXWA 4WMDA 3ZYEA 5J4QA 1XUKA 4E7RG 2FS9A 3ZZAA 4MPVA 4K1EA 4ABJA 1WU1A
chains in the Genus database with same CATH topology
1BRCE 1C5WB 1VR1H 3L6PA 3M36A 5EG4A 4DGJA 3TJOA 3A8DA 3PLKA 1BT7A 2BD8A 1CGIE 4X6NA 3RC4A 3O8CA 2RA3A 2C8WB 2V3HH 2OTVA 4CH2B 2RG3A 4RN6A 1D3DB 2G4UA 3LGYA 4Q80A 3M61U 1B0EA 2F83A 2ZCKP 3D23A 4DURA 2J34A 4OS1A 1GJ9B 1P2NA 7GCHF 4AFQA 4ABIA 4BTIB 1V2WT 1NT1A 4K5ZA 2PTCE 1OWDA 1YLCA 3TLOA 2VVVA 1O2PA 1EPTA 1YF4A 4X6OA 2ZTYA 1E34B 1C4U2 1UTLM 4Q7YA 4GSOA 2VIWA 1HJ9A 3UY9A 2Z3EA 5HYOA 2AMQA 4U2WA 1JRSA 1SMFE 4KGAA 4INKA 3U1IB 3STIA 1JIRA 1P57B 5AHGH 4Y71A 4KTSA 1GBFA 2BDYA 1GJ6A 1OWEA 3Q3YA 4B73A 2OLGA 1C1TA 2H9HA 1CHGA 1P02A 2FIRH 4DOQA 3I78A 2ZU4A 4SGAE 4WWYA 3A84A 1DSTA 1LVOA 1H9IE 3TNSA 2P3UB 1TNHA 1RIWB 1RTFB 5EXMA 2JH0D 1O5DH 1C5YB 2PSXA 5HXFA 4Y76A 1DY9A 1O3LA 1C5RA 2EI7A 2FMJA 4A92A 3H7TA 5T6FA 1FY5A 1OWHA 1QRWA 2FI3E 1SGRE 4FUIA 1F2SE 1OKXA 3EE0B 1KDQA 5C3NA 1CBWB 5BRRE 3GY6A 1CSOE 1EJAA 3ZZ8A 2ZDKA 1O32A 2UUKB 3QUMP 5EPNA 1GJ5H 1G2MA 5EGMA 4ISOA 3MNCA 1RGQA 3BTME 3S69A 6ESTA 1FDPA 1AKSA 4FUBA 4A1TA 4CRDA 3MNSA 2D26C 1XUIA 4NZLA 4X8UH 1DE7H 2O9QA 1S83A 4U01A 2PW8H 4X2YA 3F9GA 3SGQE 4TY7A 1L1GA 1TNJA 2P8OC 1C5NH 3MH4A 4GLYA 4Y7AA 1PYTD 1C1NA 3FZDA 3BTWE 4K1SA 3KQDA 1QL9A 1BDAA 3B9FH 1ZJDA 5BPEA 3PM3A 1FZZA 1GHVH 3A8BA 1G3DA 1YGCH 2A0QB 5A0BA 1SGPE 4AB9A 3MOCA 3UNQA 4A5TS 1G9IE 3E3TA 1ESAA 5FPTA 1IQHA 3UQVA 3V0XA 1Z8RA 3ZZ5A 4IGDA 1FIWA 2OINA 2IOTA 2FOBA 1FN6A 4ZKOU 1S85A 1W8BH 1V2ST 2P94A 1HCGA 1P2KA 1VCQA 1Z8JB 1QA7A 2BQ7B 4GVUA 1LTOA 4F4OC 1ABJH 1C4V2 3RU4E 1C5LH 1NS3A 1RTKA 4R0IA 2C3SA 2K1QA 3LC3A 1SGIB 3LU9B 3CS7A 2P16A 2ZP0H 3SOSA 3HPTB 2FESH 3SJ8A 2GMTB 1LO6A 3AASA 3TVJB 1D3QB 2AEIH 1BMAA 4NZQA 4DY7B 2G5NA 2BTCE 3I77A 3LC5A 1GCDA 1DWEH 3TK9A 4JYVH 3NXPA 3LT3A 2DE9A 1S5SA 1QA0A 1P12E 2V35A 2LNCA 2XNIA 1V2NT 3SUEA 1FY8E 7KMEH 2ZFQH 5JBCS 4RKOB 3LDXH 1GGDC 3ZZ9A 1UTKA 2GVFA 3FVFB 1V2VT 1YKTA 4AG2A 2ZFFH 4GAWA 5K7RA 3V7TA 3ZZCA 2QC2A 2A2QH 1C5XB 3NCLA 4WVPE 2FO9A 1P03A 3UWIA 1V2OT 5I25A 2WV4A 4J2YB 4AYVB 1WBGB 1QRZA 4NSVA 1GJCB 1DANH 1KLIH 1PQAA 1TPAE 2A7HA 2ZGXH 3BTGE 1BIOA 4WF8A 3LGTA 4CR5A 3RMMH 1ETRH 1GI0A 5ESTE 1UTOA 1D9IA 3TNTA 3VXEH 2BHGA 3F6UH 2AGIX 4E7NA 3DUXH 1K1JA 3GY5A 3FP7E 1HXFH 4X6PA 2HALA 3HK6B 4U32A 1PPZA 1SGFG 4O97A 1OYQA 5LPRA 3TGKE 1C1MA 2XCFA 4X1NU 4TYDA 2NWNA 4AG1A 2RCEA 4NCYA 2TGPZ 1Q3XA 2OD3B 2AS9A 5FHTA 1FY4A 4CBOA 4ABFA 1O35A 4FVDA 2HPPH 4CHAC 2W3IA 1ZR0A 1UVTH 2BY8X 1FI8A 2QXHA 4IS5A 3HKJB 1GVKB 1KXCA 1EX3A 1GBDA 1NU7B 1O2MA 4ISHH 1BHXF 4MVNA 1DDJA 4VGCC 3SUGA 4YOIA 2H5DA 1CT2E 3P95A 5C5NA 1DS2E 4INLA 3E6PH 2FOHA 3DFJA 3ATWA 4I8GA 3UQOA 1BBRE 1CT4E 1YP9A 3ZZDA 2PKAB 3E91A 3A81A 5HM2A 2GV7A 4Y8ZA 2J95A 3AW1A 5JYIA 2Y5FA 1GI7B 4TY6A 1GJ7B 1TMBH 3Q77A 1TALA 1EZQA 1F0TA 2UWOA 4MTBA 2QXJA 1CBWC 3BIUH 4JZDH 2FOCA 4UFDH 1S81A 2Z7FE 3ITIA 2ZGBH 4B71A 2PR3A 1K1PA 3LH1A 1JIMA 3GCTF 5F8ZA 1SHHB 2VGCB 4YZUA 1UVPA 3LJOA 2F9PA 4FUHA 3C27B 3ZVAA 2RA0A 1CVWH 3GY7A 1SR5C 1C2HA 2AGEX 1H1BA 4MNVA 1MMJN 1MKWH 4WXVA 3PLPA 5E0JA 1TNIA 1TX6A 3QWCH 1EB1H 3NKKA 1UO6A 1O3KA 3FP6E 3RC5A 1C5UA 3VGCB 1GBJA 4BTUB 1DY8A 1K1OA 1VCWA 2ANMH 3RMOH 5L30H 4AORA 1C5OH 1LMWB 1J15A 3NK8A 2ALPA 5F03A 2HGTH 1ZPCA 1G37A 3RXSA 1DVAH 1LQDB 1YPGH 1DXPA 1HIAB 3BTTE 1ANCA 3EA9A 1BA8B 3E90B 3E8LA 2QN5T 1KXBA 2G00A 4B1TA 2Y5HA 2A2XH 1GMDF 1KLJH 3FAOA 3M37A 3OU0A 1C2GA 1EAWA 1T7CA 1V2RT 1XUHA 4A6LA 1UTMA 4NA7A 4OS2A 1TE0A 1UTPA 2WPJS 3MO6A 1GJ8B 1F5RA 3BSQA 4H6SB 2SGPE 2W5EA 5C67A 2FS8A 3ZZ4A 2OCVB 3QX5H 3ZVCA 8LPRA 1ZGIA 1DX5M 1O2WA 1SL3A 4MG3A 1HLTH 4KTCA 1GI1A 2BD4A 3UOPA 1G3EA 2G52A 4O3TA 2QGRA 4JZ1A 2C93B 1AB9B 1FN8A 3FP8E 2J2UA 2WPIS 3BF6H 4AFZA 3JZ2B 1C5ZB 2ZGHA 1O2VA 3L33A 1QB6A 4DW2U 1IHSH 1MTUA 1QTFA 1ZYOA 4OS5A 1DUEA 4THNH 3M7UA 1QBOA 4GUXA 1VJAU 1L4ZA 1O3BA 1ZRBA 5EXLA 8GCHF 4LK4A 3KQEA 5CMXH 4BAMB 2VNTA 1AVXA 1ARBA 1C1OA 4DIIH 1TRNA 2ZDLA 1ZJKA 2GTBA 4U30A 2A4GA 2XWAA 3RXGA 3SU5A 1JBUH 1OP0A 2GZ8A 1P04A 5FX6A 1P2IA 1C2KA 1GPZA 9LPRA 1TGSZ 1MTWA 5T6DA 5DPAA 4I31A 1A4WH 1IQGA 2JKHA 3S7KB 3GYLB 4IW4E 4ABHA 2PKSC 1AKSB 1JOUB 2AIPA 1F0UA 4MNWA 3MU8A 4Y6DA 1F5KU 5FPYA 2P3FH 4Y11E 1KY9A 1GI2A 1MTVA 3EGKH 1XMNB 1LPKB 1BITA 4YT6H 4MNXA 4DVAU 1O3DA 2SNVA 1C2IA 3MU1A 2ZIQH 3DFLA 1YM0A 1AUJA 1RS0A 1DFPA 1SGNE 2QAAA 1GG6B 3RXDA 2C8YB 1C2JA 1WAYB 2P95A 3GCOA 1GMCG 2ZU3A 4Q2KA 3RLYH 3U8OH 1GVZA 1O2LA 4GCHF 1BMMH 1CO7E 1AU8A 2ZDNA 1HFDA 2H5CA 1YYY1 2FEQH 1C2LA 2XCNA 1F0RA 2J38A 4XOJA 1CHOG 1Z8GA 2HVXA 3S9AA 1RJXB 1W3CA 3TJUA 1H9LB 1P0SH 2NU1E 4I32A 2ZF0H 1O3JA 3MU4A 3MHWU 1A5GH 3KIDU 2Z9IA 1V6DA 3RXEA 2A32A 2SGEE 1FLEE 2W7SA 1Y3WA 1PPBH 3BTKE 1SFQB 4UEHH 1TBRH 1C1QA 4AFUA 1RRKA 3GY8A 3RXBA 3ELAH 1G30B 1FPCH 2BD3A 5JBAS 3M7QA 3SHCH 3M3SA 1QB1A 1NRNH 2XC0A 5FAHA 5F6MA 4AGJA 2ZECA 3LONA 4O03A 2CHAB 1IOEA 2IN2A 1HIAA 3VB5A 1C5MD 2STAE 3MNXA 4HGCA 2CMYA 2FP7B 2R2WU 2BDHA 1GL1A 3A85A 4JZIA 4OS4A 2WPLS 1S84A 2J94A 1NESE 3U69H 4ABGA 3QN7A 4ZKSU 5ETXA 4X8SH 1IQIA 1ZSJA 3SHAH 3A8AA 3B8JA 4NGAH 2GCHF 1AVGH 2RDLA 1XUJA 3G01A 2R3YA 2G55A 2A5AA 1Y3UA 1IQFA 1H8DH 1LVBA 3IITA 2FWWA 1IQNA 1YCPM 3SW2B 3BEUA 2PUQH 3T5FH 1QB9A 2Q6DA 2I6SA 3SJOA 1LHGH 3P70B 3PWBA 2H1UA 1O2OA 2ZHFH 1FAKH 3MH6A 2AERH 3S7HB 1J17T 1HAVA 1C5SA 3DHKH 1GHBG 3V3MA 2P3TB 1O5FH 4Z6AH 1G32B 1SVPA 2GCTB 5TCAA 1UK3A 4NA8A 3V12A 2BDGA 1P3EA 2AMDA 1GWAA 3QK1A 4CH8B 4O3UA 5FBIA 3VB7A 2PSYA 5GPIB 1AWHB 2QY0B 2M5TA 4WJG2 5LPEA 3PROA 4MPXA 1A0JA 1O2JA 3LJJA 1CGHA 4UD9H 1O2ZA 3P6ZB 5GXPA 3IG6B 3PYHA 1Y5AT 2O8LA 1L2EA 1P2MA 1A0HB 4ZUHA 1DWCH 1O3NA 1T32A 2AGGX 1GBBA 2G51A 1WSSH 2PLXA 3JZ1B 2PKAA 3TK5A 2F9BH 2NU0E 2OUAA 1N8OB 1TNGA 1GDNA 2ZDVH 4ISNA 5DO4H 1BTYA 4JCNA 3PMBB 4D9RA 1SGQE 2GP9B 3DD2H 1MKXH 4ZROA 3TGIE 3SUFA 3K9XB 1Z6JH 1G36A 2BQ6B 1OOKB 3CP7A 1MBMA 1WUNH 2P59A 1W7GH 3K6ZA 2FOAA 1A2CH 1PJPA 2C4FH 1HV7A 5C1YA 2ZDMA 1OXGA 7ESTE 1A5IA 2HNTC 3CS0A 1A0LA 1XKBC 3RUOA 3KEEA 3I29A 3KL6A 3LIWA 2GT7A 3ENSB 1MKXK 3PTBA 4NG9H 3SU2A 1DWBH 5CE1A 1C1PA 1TFXA 1W11U 2WUBA 2ZO3H 3BEFB 1O30A 2FOFA 3M5OA 1NRQH 2G4TA 2XBYA 1HJ8A 1SLWB 1GG6C 1GHBF 1QGFA 3A7YA 1ZSKA 1OYTH 4JYTA 1BMNH 2VWOA 2HRVA 1L0ZA 1SGCA 4D76A 1C2EA 1AN1E 2WPMS 1ZTKA 1XXFA 1WQSA 5FCKA 1DM4B 1EKBB 1AFEH 4ZXYH 2VIQA 3SNCA 1O2UA 1GL0E 5DP9A 1EZXC 1WQVH 1DT2A 1QY6A 3KGPA 1ESBA 2FOEA 2ZFTA 1VITG 2BOKA 4HI3A 2GD4B 1V2QT 4H4FA 4XDEA 2PV9B 3RXJA 1GHAG 4NIWA 1HAOH 3UNSA 1O31A 3SNDA 2XC4A 3SI3H 2FZZA 1SLVB 1BJVA 4KTUA 1BUIA 1GHAF 3K2UA 2AMPA 2Z6BD 1HUTH 1YPLH 3W95A 3S0NA 1BB0B 2YOLA 1VCPA 3NWUA 2ZHEH 1AI8H 3PMAB 3BG8A 4FU7A 1W13U 2ZCHP 3TJVA 4I8KA 2P8OB 2BXTH 3KF2A 2ZI2H 3EAJA 1D4PB 1CQQA 3ZV8A 1BTWA 1VITF 2F9VA 2SNWA 3VB3A 1XVOA 3SU1A 4O9VA 2BVXH 1T4VH 1ZRKA 1TGTA 3P8FA 2OQUA 3SN8A 1AE5A 2UUJB 3ESTA 4YOGA 3VPKA 3RC6A 5EXNA 2NU3E 1EJNA 1ELAA 1NFYA 2W3KA 1AZZA 1O3AA 2OP9A 1O3FA 3Q76A 2ZTXA 1ELDE 2Y5GA 2R0LA 2A1DB 1TBZH 2NU4E 1BZXE 1CE5A 1VITH 4IC6A 1C5PA 2EI6A 5C2ZA 3RXKA 3ODFA 3UR6A 1UVUH 1ZHMA 2ZFPH 8KME2 1O38A 2CJIA 4XSKU 1AQ7A 3STJA 5L2YH 2CHAC 4Z0KA 2BLQA 1ZHRA 1D3PB 1FXYA 3BEIB 2HLCA 1O3OA 4K8BA 3UFAA 1K9OE 1U6QA 1MQ5A 1RXPA 1FUJA 1XKAC 3SU6A 4A7IB 1MAXA 1QL7A 1O3PB 4VGCB 3ODDA 1C1RA 1YCPH 5CHAB 1TPOA 3GDSA 2BD7A 1OS8A 3P92A 3P8OA 4FUEA 1IQMA 4BAKB 1HAIH 4A1VA 3F9FA 1N6YA 2ZC9H 1J8AA 1HAGE 2DE8A 2HNTF 2JH5D 3D49H 1Z7KA 2F9OA 2O8MA 1LPZB 1XVMA 5K0HA 3QDZB 1YPMH 2BD5A 3RMNH 1UCYE 4UDWH 2Z9GA 3L3TA 1EZUC 2AFQB 2C8ZB 2B9LA 1HJAC 1M9UA 1CA0B 2B5TB 3ATMA 3TH3H 4PROA 4MPWA 1P2JA 2UWPA 4Y8YA 5EW2H 1IAUA 5HM9A 2EEKA 2O8WA 4YESB 3SNAA 5A09A 3PMJA 3MO9A 1N8OC 2VIPA 1FV9A 3U8TH 1P2QA 1GDQA 2H2ZA 1O2IA 1AZ8A 1BTXA 1TX8A 4WMEA 1JRTA 1QJ6B 4ABDA 2XW9A 3RXHA 3VGCC 5DP4A 1C9PA 1ZPBA 1ETSH 1K1MA 3IWMA 4E06H 1D3TB 3RXLA 6LPRA 5EODA 5JBTA 1HAZB 1XM1A 1EASA 1O3CA 1O5GH 1LQEA 2O8TA 1BTPA 1K1NA 3M5LA 2BDIA 2ZGCA 1MKWK 1QR3E 3KHVA 4B2BA 4X1PU 4AX9H 1MU6B 3SJIA 2P93A 4DCDA 2ZFSA 3MH5A 2VIVA 4K8YA 3GYMA 1O5BB 2ODQA 3RXVA 1T8MA 4LZ4B 4IMZA 2J4IA 4JYUH 4GHTA 1BTHH 2XBWA 1IQLA 1ANEA 1EJMA 1AVWA 3BG4B 1TABE 4BTTB 3SQEE