3VPKA

Crystal structure of 6-guanidinohexanoyl trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Crystal structure of 6-guanidinohexanoyl trypsin near the optimum pH reveals the acyl-enzyme intermediate to be deacylated
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vpkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vpkA02
2VIWA 1SGCA 1T4VH 3QDZB 1O2XA 1P2MA 2J95A 1GJ6A 4J2YB 2OCVB 2PUQH 2VIDA 1V2OT 3ATMA 3RXGA 3K65B 3UOPA 2O8LA 1KSNA 4LZ1H 4IC5A 1QR3E 3FANA 1P9UA 3ESTA 3H7TA 1GBHA 1IQLA 1AFEH 3RXSA 4JZEH 1IAUA 2VB0A 2F9PA 1GBCA 1G2LA 1L0ZA 1OYTH 3SV2H 3GISB 1HYLA 8ESTE 3F9GA 4CBNA 2I6SA 1YCPK 4CRBA 3KQEA 1A3EH 1AGJA 1L1JA 1EZUC 1ZRBA 1AY6H 1LHGH 1IQNA 2LPRA 1P02A 1XKAC 1ZMLA 1O3KA 4BAMB 2JH6D 2PKSB 4X1SU 4PROA 1YLDA 2WINI 1PPZA 3UNSA 3PROA 1VGCC 4BAOB 1NPMA 1W0YH 3P8GA 1QGFA 1FXYA 2FOFA 2ZGHA 2G00A 4BOHA 2BDIA 1QJ6B 3VB5A 5G4BA 1P03A 2ZGBH 1GBKA 2PW8H 1BTUA 3M36A 1KIGH 4GCHF 1C5YB 1MTNB 5LPRA 3ZZAA 3PMAB 3AW0A 1GI8B 4UFDH 2DUCA 1S83A 1TONA 2AEIH 3FZZA 1E35B 3O8RA 3PTBA 3T2NA 1P0SH 1VITF 1C9TA 2JH5D 1SLXB 4Y8ZA 3S7KB 5FX5A 1UK3A 2BD9A 3GY3A 1PPEE 3A7WA 1SGDE 1C1OA 3AAVA 1O5AB 2QV1A 1N8OC 2ZHEH 8LPRA 2Z6BD 1XUHA 5A8YA 4Y71A 5E0GA 2AFQB 2ZDNA 7ESTE 2BXUH 4D9RA 2NU4E 2ZQ2A 2ASUB 1MD8A 1O5DH 2AIPA 3O8BA 2BY6X 1OXGA 3RP2A 1O3EA 2FYRA 3AVZA 4ESTE 3E3TA 3M3TA 5JB8S 1GJCB 3PTNA 4YESB 1C5SA 1RTFB 1UCYE 4Y7AA 1GVKB 1TLDA 1QTFA 3SOSA 4IW4E 2WPIS 3M5MA 1FV9A 1SOTA 4KGAA 3TGJE 3BIVH 1G3CA 3LGYA 1T8OA 2FS9A 1NU9A 1ACBE 1EJAA 3LGTA 1MZAA 1RTKA 1EP6A 4F49A 1O3AA 1UTMA 2SGDE 1HUTH 1SGEE 2RA0A 3URDA 1O32A 1XUFA 2UWLA 4KTSA 1OX1A 5FPYA 4ABAA 5DKMA 4IC6A 3U8RH 1GJDB 1BTYA 2SGEE 1C1VH 4AYYB 2EA3A 1C5OH 1HAIH 1F0UA 2O9QA 1UCYH 3R3GB 4JK6A 1TWXB 3BTDE 1RFNA 1S6FA 5JPMH 2FO9A 3ATLA 4X8UH 5DK1A 3ZVEA 2ZNKH 4DIIH 1C1NA 3VB4A 1ZPZA 1KDQA 4IGDA 1BBRH 1GJ4H 3E16B 1Z1IA 1TPSA 3SU0A 3PMBB 3MWIU 5DGJA 3LDXH 2B9LA 1MQ5A 3V12A 1FIWA 3BTWE 4OS1A 3EAJA 4VGCC 1GBEA 3Q3XA 4SGAE 3A7ZA 1BRAA 1YPEH 1ANEA 3RC6A 1QFKH 3MU0A 3ZZCA 1AFQC 5T6FA 4JMYA 3RC4A 1NROH 1AI8H 1ID5H 1UTQA 1G30B 1WU1A 2P16A 3A8AA 2PTCE 3LGUA 2BD5A 4UFEH 1WSSH 3A7XA 1TPPA 5HMAA 1WTHD 1SOZA 2PKAB 3SGBE 1MU6B 2HPPH 1NRRH 1W10U 1ZPBA 1DM4B 3ZVBA 1AWHB 3R0FA 3ZZ3A 3Q3YA 4INLA 1XM1A 2WYGA 1HCGA 1OWJA 2FOBA 1KTTB 1SGFG 4CH2B 3UQVA 1ELTA 1A0LA 1S81A 4RN6A 1TGSZ 3TITA 4DURA 1F5LA 1SGYE 3MU5A 1O2VA 4Y10E 2P8OC 3PO1C 2SGPE 4KELA 4NCYA 1BRBE 2SGAA 1FPCH 1G32B 1V6DA 4K2YA 2BM2A 4B75A 3RXHA 2VH6A 4I7YH 1TNJA 1EJMA 2IOTA 1HGTH 2FLRH 4NZQA 4OS7A 4HI3A 3QZQA 1O30A 1TMTH 5C2ZA 4AB9A 1ZTJA 2XBYA 3W94A 1O3IA 1LVBA 2VVCA 2Q6FA 1O3PB 1D3PB 5GXPA 1ZSLA 1GBIA 4U01A 1ZPCA 3SGAE 1GMHG 5F03A 2PV9B 1ABJH 2Y80A 2R2WU 5CHAB 1BMLA 2XNIA 4WXIA 1TNHA 1SI5H 3MO3A 1T31A 1LKAA 4NIWA 7GCHG 1MU8B 2ZFQH 1TGCA 1NZQH 1HDTH 2H1UA 2HPQH 4ISOA 4X6OA 4BTUB 4H6TA 2I6QA 1UCYK 4CRDA 3I78A 1F92A 2IN2A 2ILNA 1BHXB 1LVYA 2EI7A 3ITIA 3MHWU 3RMMH 4ZHLU 1P04A 2ZC9H 3A7VA 4INKA 1VJAU 3V3MA 3URCA 4B2AA 1GG6C 1DWCH 1BBRK 1G36A 2Z9LA 4MG3A 1B5GH 1H1BA 1JIMA 1W7GH 4CBOA 4Y7BA 3B23B 3MH7A 5HM9A 4XDEA 2ZPSA 1DXPA 1FMGA 8GCHF 3SU4A 1JXPA 1XVMA 3V7TA 3IWMA 5PTPA 2IPHA 2FS8A 6CHAB 3K6ZA 2TBSA 5DP8A 4I32A 5DP7A 3C27B 3VXEH 1GJ5H 1UK2A 2P3UB 1GBBA 1HIAB 3MU4A 3FAOA 3TNSA 1PPCE 1YKTA 1LO6A 2BY5X 2XC0A 1WQSA 4QT8C 3OSYA 1LKBA 4DG4A 1W13U 2A45B 5ESBA 3A8BA 1P12E 1AHTH 3A86A 2W7SA 1GHWH 4CRGA 2BYAX 2STBE 4D7FA 2FZZA 1DICA 2XCNA 2A5IA 4ZKOU 3MTYA 1TYNA 4MLFB 1GBTA 2ZFRH 4WF8A 2Q6DA 5L2ZH 2DE8A 4M7GA 1OOKB 1J14A 4FUGA 1IQIA 2ZGCA 4B74A 3B9FH 2ANMH 4ISLA 1BT7A 1TOMH 4K8BA 1KXFA 4YOGA 3VFEA 5LGOA 3SHAH 1PJPA 3VB6A 3LH1A 4AG2A 3SI4H 3SBKA 1QQ4A 2FDAA 3TGKE 3RMNH 3P17H 2Z3DA 2F9BH 2AGIX 2PSYA 9ESTA 1SGRE 2FX4A 1TALA 3A82A 4FUFA 1NRQH 2QXGA 3RM2H 1FAXA 3QGJA 1CHOF 3RXJA 2QXIA 1NU7B 3MYWA 5BPEA 1O36A 1AQ7A 6GCHF 2FI4E 2Y82A 4D76A 3DHKH 1SGPE 1O2YA 3S9CA 4DCDA 4IMQA 4AFZA 2QXHA 2ZCLP 1TX6A 3MNCA 1UVTH 3DFJA 1YF4A 4FUDA 3SUGA 3ZZ4A 4MPXA 2F83A 1IOEA 1CVWH 2C3SA 1P2QA 2VIQA 1WUNH 2OP9A 1FY5A 2XBXA 1CT4E 4IS5A 4XFQA 2CHAC 3TJVA 2VVUA 1ANDA 3SV7A 1Y59T 2FTLE 3RXKA 3SI3H 1PQ8A 5JBTA 2VGCB 4Q7YA 3ZYEA 1ELFA 3KF2A 4DT7B 1C1WH 1C2MA 2OINA 1WQVH 1AKSB 4JYUH 2QY0B 3NWUA 2FODA 1B0EA 3QTOH 1F5KU 1O34A 4ZHAA 1HJAC 4X2XA 2GV7A 2BD3A 2ZQ1A 2D8WA 3S69A 1NFWA 2BDCA 1BB0B 3UUZA 3PLKA 1SLUB 1OKXA 1LVOA 1AZZA 2RDLA 4NFFA 5FPTA 3QO6A 4IMZA 3ZZDA 2D26C 4ABGA 3M5NA 2EI8A 2A7CA 1WAYB 1SQAA 2SNVA 1AIXH 3ZVCA 2XBWA 1TNGA 2A7JA 2AIQA 1U6QA 1O2PA 4NZLA 1O5EH 3GICB 3D49H 3DA9B 4XE4A 2TGDA 1FNIA 3U9AH 2FI5E 3GYLB 4HZHA 3DT0H 3GY6A 1TB6H 4X2YA 1J15A 1Z8RA 1C9PA 1V2ST 5CMXH 1NFXA 3RXUA 2ANKH 1C5MD 1LVMA 1RIWC 2H2ZA 1JRSA 3GY7A 3MMGA 4F4OC 3F9EA 1QL7A 2P95A 1CSOE 2NU2E 1TABE 3NKKA 3A80A 3UR6A 3F9HA 3T26A 2JKHA 2OBOA 3M61U 2VWMA 2ZHQH 3SZNA 2ZU3A 1FI8A 1CE5A 1ANCA 1YPGH 1RGQA 2FEQH 5ESTE 3SNBA 4KTCA 1BCUH 1GJ9B 5T3HA 1GBDA 3LKWA 3BSQA 4I33A 2PTNA 5GJ4B 1NRNH 1HRTH 4ISHH 1KY9A 2BVSH 2FWWA 2P3TB 1A7SA 3NXPA 3QUMP 1HIAA 1HAVB 1OWKA 1HAGE 1SQTA 1GHVH 2FX6A 4I8GA 1KXCA 3SJIA 3RC5A 5F8TA 1LHDH 3BTEE 1BMNH 4JZ1A 1BTPA 4NIYA 1EAUA 1OWIA 2QF0A 1EZQA 1V2WT 1BA8B 2Y5HA 2A31A 4NA8A 1NO9H 2A0QB 2FOHA 1CA0B 1TIOA 2J92A 3SORA 3S9BA 1CBWB 2CJIA 4AFQA 3MU8A 1D3QB 1UTOA 1AE5A 1K1IA 1A0JA 1PFXC 1XUIA 1C5UA 2J34A 2CGAA 1AVGH 5AVDA 5C3NA 1YYY1 5A0BA 3RLYH 1P2OA 2GV6A 3CS7A 1AMHA 1DITH 1GI3A 3RMLH 4CRCA 4GUXA 1GCTC 2GDEH 1SLVB 2V35A 1C5VA 3M5OA 4NSVA 2G8TA 1FAKH 2BHGA 4I8KA 1CT2E 1FUJA 2D2DA 2G4UA 1GI0A 4X1QU 2B5TB 1BRUP 2UWOA 4WMEA 1P3CA 2Y7XA 2Q6GA 2AGEX 3ZVAA 1IHSH 2ZP0H 3ZVGA 1LPGB 3RXPA 2ZDVH 4H4FA 2R3UA 4BAQB 1JBUH 4DOQA 1NESE 4ABBA 1OPHB 4YLQH 1SLWB 2BQWB 1PYTC 1NTPA 1UTPA 1QB9A 2ODPA 2WUBA 4FUIA 3DFLA 3P92A 4Z6AH 4TWWA 2AMQA 3LIWA 3PLPA 1AKSA 1UTJA 1HLTH 1O2QA 2W3IA 3BEIB 2TRMA 2BX3A 3SU5A 1DY8A 5EXLA 2W26A 5GCHF 3GY4A 5DO4H 2BDBA 1L2EA 3SUEA 2GZ8A 4BTIB 2Z9JA 5GDSH 1C2FA 1V2LT 2OQUA 1NC6A 4B1TA 1FONA 3PMHB 2IJOB 2UUKB 4CHAC 1C1SA 3CENA 1AB9B 1QBNA 1AE8H 1SC8U 2F9NA 2PR3A 3TU7H 1AVWA 2ZHDA 1CGHA 2WPJS 2TGPZ 1RD3B 1RTLA 3A7TA 3A83A 2OUAA 3TK9A 2KAIB 1D6RA 1O2ZA 7LPRA 1EJNA 5L6NH 4MPUA 2XRCA 3F68H 1TGNA 3P8OA 1TQ7B 4DJZB 4ZKNU 4MVNA 2FM2A 1HFDA 2BDYA 2AMPA 2OLGA 4X6PA 4WY3A 1FQ3A 1QJ1B 2ALVA 2GMTB 1DOJA 3GCHB 4X0WU 1C1RA 1GBAA 2ZG0H 4UD9H 1E0FD 3TVJB 1T7CA 1UO6A 3LONA 2Y5GA 3M7TA 1Y5AT 3UWJH 1S0RA 2C8YB 4K1SA 5ETXA 4R0IA 3E8LA 1DANH 1SR5C 4TYDA 1SBWA 4ABEA 1GDUA 1KXEA 1O2UA 2R2MB 4O03A 2TGAA 1O5CB 1J16A 4JZIA 3D23A 1BBRE 2A1DB 1O2JA 4BXSA 3SV9A 1TRNA 3RXVA 3U8OH 3V13A 1MH0A 2SGFE 2TIOA 1SVPA 2FOEA 4DVAU 1YPJH 5AFYH 5F8ZA 4AZ2B 3VPKA 3PMJA 4AB8A 4WWYA 1SFQB 1DLKB 1HAVA 5A2MH 1P01A 1DDJA 1SQOA 1Z7KA 2QXJA 1AVXA 4WXVA 4J1YA 5AFZH 1H9LB 5A09A 3TIUA 1ZHRA 1UHBB 4X8TH 2AS9A 2ZI2H 2JETC 1GI1A 1ZOMA 3ATKA 2CF8H 1O3MA 1PPFE 1Y3VA 1IHTH 1O3LA 3UOUA 1TBZH 4TY6A 1A3BH 1ELGA 1ESAA 3MI4A 1CO7E 3P95A 4Q7XA 4K69A 3VGCC 4CRAA 2H5CA 3AAUA 5JBAS 1T8MA 1O3OA 5GWZA 4AORA 4RSPA 1HAOH 1A5GH 3I29A 1LTOA 4YLUA 1YCPM 3ZV8A 2BX4A 4GPGA 1C2GA 1SGFA 4ZKSU 3B8JA 1HJ8A 2OD3B 1C2HA 1FY8E 4UDWH 3PV4A 1NN6A 4Q7ZA 2EC9H 3LGIA 1C2DA 3S9AA 1GGDB 2C8WB 4GAWA 4FUCA 2RG3A 3U69H 4A1XA 4LXBH 4ABJA 1VJ9U 1DX5M 1UTNA 4NA7A 3KEEA 4DW2U 1H9IE 4NIVA 3VXFH 1GBMA 1EXFA 1HXFH 4D8NA 1ANBA 1EPTB 1ZLRA 3Q77A 1NRPH 2A32A 3BG4C 1EQ9A 3ZZ8A 1H8IH 1F0SA 2F3CE 2CMYA 1CA8B 2HGTH 4ZXYH 4E05H 1HB0B 1O3HA 1P57B 1QQUA 4B73A 4NFEA 4B2BA 4I31A 2EEKA 1K1MA 1FY4A 3M7UA 1FPHH 3SO3A 2C8ZB 3RXCA 2XC4A 1ORFA 1G37A 2PUXB 4O3UA 1QURH 4FVBA 3H7OA 5FCKA 2ALPA 2BVRH 4KP0A 1EAIA 2YNAA 4K1TA 4YT6H 1NFYA 1Z71A 1LHFH 1DSUA 1EOJA 1GHAG 1RXPA 3TJUA 4A92A 3EA8A 1DWBH 5EG4A 4BNRA 1AD8H 1GHBG 1TX8A 1G9IE 2FXRA 2GZ9A 5J4SA 1SSXA 2WUCA 4X1RU 4Y6DA 1HAYB 1RS0A 2BD2A 1F5RA 1INCA 2Y81A 1QL8A 1V2NT 2VIOA 2ZTYA 3C1KA 2WV5A 4BTTB 1O2RA 3ODDA 2RCEA 1XXFA 4FUJA 2HRVA 4UEHH 1CA0C 4ZXXH 2GCTB 4DIHH 1O31A 5TCAA 1TGTA 5K0HA 1TE0A 2NU1E 2VWLA 1OS8A 3PM3A 3QWCH 1BITA 3RXQA 2Z94A 4YO9A 4JYTA 2BOKA 1S84A 1QRZA 2XTTB 2Y5FA 3A88A 2A5KA 3GCTG 3H5CB 1O3NA 1ESBA 4ISNA 5TJXA 4BXWA 4RKJB 3F6UH 2BVXH 5F6MA 1ETSH 1P8VC 2PSXA 2UUJB 2ZDAH 1AWFH 1LCYA 1ELEE 2C90B 2CF9H 1SHYA 3ZZ6A 4NWKA 1EKBB 1T8LA 4ZROA 4Y0ZE 5I25A 1NT1A 3RU4E 1CHOG 4GSOA 1ESTA 4JZFH 1DUAA 2P3FH 6GCHG 1MAYA 2H9TH 5JBCS 3LC5A 4MNVA 2OBQA 2ZCHP 3T29A 4ZKRU 1O0DH 2BY7X 4H42U 2F9UA 1C1TA 1TPAE 3HATH 1YM0A 1V2PT 1VGCB 2ZECA 4AGJA 1K1LA 1MCVA 1Y3UA 2FPZA 1E36B 2ZDLA 4ZMAH 2OC0A 2WPMS 1UHBA 2PKSC 2THFB 1GI4A 2R9PA 1LPZB 2SFAA 1BTZA 3M7QA 1O3BA 1F0RA 1GMHF 1S0QA 1C2KA 5JDUB 1MTSA 1BQYA 3QGNB 1A46H 1XUKA 1TOCB 1P09A 1MTNC 2J94A 2W7UA 5LH8A 4IN2A 3BEUA 3E0NB 7GCHF 3AW1A 1T8NA 5EW1H 4MDSA 4MNXA 4YT7H 1N8OB 2G5NA 1XXDA 4A5TS 2GCHG 1FIZA 1O35A 1WV7H 2BTCE 3SHCH 4CRFA 3NZIA 1JOUB 4O97A 2FMJA 3LC3A 4WVPE 3QK1A 5C67A 5DP9A 1QNJA 2ODQA 2UUYA 3P8FA 3TK5A 1O3FA 1RRKA 1P11E 4AGKA 2ESTE 1J8AA 2BD4A 1BJVA 3HKIB 3BIUH 4AG1A 2PKAA 3HK3B 4AFUA 1DSTA 1G3EA 2PFEA 1UVOA 4NA9H 3ZVDA 1DWEH 1VCPA 2ODYB 3OY5U 1SGIB 1EPTA 4BAKB 4OGYA 1MAXA 2QAAA 3MH6A 5E2OA 1QB1A 3VB7A 1ZHMA 4X6NA 2QYIA 4TWYA 3PWBA 4AOQA 1HJ9A 3TNTA 3Q00A 1C5QA 1TNIA 1GJAB 1OWDA 3A8DA 1GMCG 4WH8A 1BDAA 1LHCH 5EW2H 1UJ1A 4Z0KA 4UFFH 1HXEH 4NWLA 1IQKA 1SGNE 2UWPA 4E06H 3E90B 1OSSA 2H9EH 2PHBA 2W3KA 1L1GA 5LPFA 1O2LA 1S85A 1Z8GA 1PPGE 2GZ7A 3UIRA 1DFPA 1YGCH 2LNCA 3A84A 4WJG2 4TPIZ 1V2QT 5TCCA 2G51A 1C5RA 2HLCA 1C2IA 1EASA 4GHTA 5J4QA 4ABIA 1EB1H 1UMAH 1QRWA 2XXLA 2AH4X 4OS5A 1GVLA 2O8WA 1A0HB 2BZ6H 2M5TA 2O8UA 2A2QH 5FAHA 4NGAH 3LGWA 1FLEE 1KLTA 3QZRA 1A61H 1XUGA 3ENSB 4UONA 2ZZUH 3FFGA 3QTVH 1K28D 5E0JA 4I8LA 2GGVB 1AFQB 3LU9B 4ZHMU 8KME2 5HYOA 1SMFE 5A0CA 1VZQH 5DP3A 1GMDG 5IYTA 3U98H 1O2WA 1OP8A 1P2IA 1OP2A 3ATIA 1ZMNA 1P2NA 2YNBA 3SU3A 4CREA 3K2UA 1E34B 3A8CA 3K6YA 4NIXA 3MH4A 2J9NA 2BY9X 1V2VT 3W95A 3FP7E 2FLBH 3SUDA 1AO5A 2H6MA 1J17T 1AUTC 1GBFA 2XYAA 3G01A 1HNEE 2WYJA 2ZFTA 3VB3A 1Y3XA 4A6LA 2ZHFH 1RJXB 3BTGE 3L33A 3SJ8A 1DVAH 5FBEA 3TH3H 3RLWH 2P8OB 1EPTC 3PO1B 1G3DA 2ZEBA 2FIRH 3E1XB 3K9XB 5GPIB 3KQDA 2R0KA 1W3CA 3DD2H 3QN7A 4D9QA 4KTUA 2A5AA 3FP6E 1KLIH 2G52A 5DJ7A 3KGPA 1J9CH 5JYIA 2A2XH 3IG6B 2O8TA 5JBBS 2VH0A 3FZDA 5FHTA 3FP8E 2BY8X 1MUEB 1O3JA 2G5VA 2Q1JA 4K5ZA 3HGNA 3UTUH 2SGQE 4Q80A 4FUBA 1K1OA 3SV6A 3GDUA 5EQQA 2R0LA 1GDQA 4MNYA 1D9IA 1G2MA 5IDKA 1D3DB 4WH6A 2BB4A 5EQSA 3EGKH 1QIXB 1A1RA 4GCHG 1TQ0B 1O2GH 2BMGB 3E6PH 4ZAEA 5HGGA 4NSYA 4H6SB 2C93B 3TJOA 1T32A 1O2KA 1BTHH 4K1EA 1ZTLA 5CHAC 1QB6A 1LHEH 1VITG 2BXTH 2O8MA 1MKXH 1W12U 3RMOH 1GL0E 2PGBB 4R8TB 3KN2A 1GHXH 2QCYA 1JIRA 1SB1H 2BLOA 1BJUA 3I77A 3SNDA 4LK4A 4DGJA 1FN6A 3RUOA 2D1JA 1BTXA 1C2JA 1NRSH 1XX9A 1C4U2 3HGPA 4JYVH 1GG6B 1GHYH 3RDZA 2B7DH 1C5PA 4I8JA 2DE9A 2Y6TA 2J2UA 3ELAH 3V0XA 4Y8XA 1Z1JA 1A5IA 4Y11E 5CE1A 1BMMH 4A1VA 3RM0H 2ZA5A 1SG8B 3KQCA 1A2CH 2J4IA 3LJOA 2H5DA 1ARBA 3A87A 1DPOA 1N1LA 1BHXF 2Z3EA 3AASA 1CQQA 2PGQB 3BN9A 5EPYA 1HBTH 3T5FH 1SGTA 6CHAC 1PQ7A 3BTTE 4ASHA 1QBOA 3Q3KA 1THPB 3KQBA 2P93A 2P59A 3M3SA 2ZPQA 1ETTH 1H4WA 7KMEH 1N6XA 1Z8IB 1LPKB 1Q2WA 2WV4A 4AYVB 1AZ8A 1C4Y2 4X1NU 1MTWA 2ZFSA 1Y3YA 1F7ZA 5FCRA 2FOAA 3RXEA 4Y8YA 2PLXA 1X7AC 4YOIA 2VINA 2OC7A 1Y5UT 4RKOB 4B2CA 1C1PA 3RXBA 3EA7A 3UQOA 4TY7A 1BOQA 1YP9A 4AFSA 1GI2A 4CR9A 4SGBE 2FOGA 1BUIA 1ELVA 1TFXA 1VCWA 2Z3CA 1GI5A 4GHQA 2V0BA 3UPEA 4LZ4B 1IQEA 3RXTA 2RA3A 1XUJA 3STIA 2V3OH 4FU8A 4Q2KA 4HTCH 2JH0D 3LH3A 1L4ZA 1TMBH 1BIOA 1LQDB 4FU9A 2SNWA 1V2MT 1O37A 3SNAA 1O33A 4OS6A 3TK6A 3E91A 2OQ5A 1O38A 3MO9A 3UWIA 1Q3XA 2BOHB 3L3TA 4X2WA 1ZSJA 3UNQA 1TA2A 5C1XA 1UVSH 2B8OH 2BQ6B 3GOVB 3NK8A 1OWEA 3PYHA 4CH8B 2QGRA 4E7NA 3ZV9A 3LT3A 2XWBI 3MOCA 2QC2A 4MQAA 4A1TA 1UTLM 3RXFA 2CHAB 9LPRA 5C5OA 3GDVA 3UNRA 1O2MA 2XC5A 2AYWA 1O3CA 2V3HH 3TLOA 3ZZBA 1UVPA 1MKXK 1V2JT 1WTGH 1QJ7B 3KL6A 3UREA 3BTKE 3ODFA 3SJKA 1O3DA 2Z9KA 3ZYDA 1S82A 2GP9B 1K2I1 4YZUA 2XCFA 1ELBA 2BLQA 2VGCC 1D6WA 1HJAB 1DE7H 1O39A 3ATWA 4JCNA 1IQHA 2GD4B 5EQRA 4ZUHA 4GVUA 2F9VA 1ELDE 1FN8A 5EGMA 5FX6A 3SN8A 3SJOA 1TAWA 5FPSA 1GI6A 2GVFA 4UE7H 2V6NA 2XW9A 5B6OA 3GDSA 4O3TA 1FY3A 2J38A 1C5XB 1GHZA 1K22H 1T4UH 6ESTA 4U30A 3BTQE 3O8DA 5DPAA 3SU2A 5EU8A 4FUHA 3A7YA 3GY5A 5K7RA 3MNBA 3UY9A 3S7HB 3A89A 1V3XA 1DXWA 5C20A 4D7GA 1HV7A 1W0ZU 5C5NA 3ZZ7A 1VR1H 2VVVA 3SQEE 2ZFPH 1A4WH 1NS3A 4B76A 1KYNA 1EOLA 2ZU1A 1THSH 1NY22 3PB1E 1RIWB 2ZHWH 1FY1A 1B7XB 3SNEA 2BD8A 2TGTA 3KCGH 3LGVA 4XSKU 1QL9A 1IQMA 2HVXA 1NM6A 1TA6A 1O3GA 4HFPB 4YOJA 4GLYA 2HNTC 1XKBC 1HAXB 1BTWA 1NFUA 1V2KT 1THRH 5E0HA 4YM9A 1QY6A 2ZWLH 2VIVA 3IITA 2GTBA 3BTFE 3JZ1B 1D4PB 5T6DA 1F0TA 3HKJB 5FBIA 2Z9IA 5HXFA 3O8CA 2WPLS 2WPKS 1AU8A 2FTMA 3TJNA 1A5HA 2CV3A 5L30H 1QA7A 2HNTF 1YPHC 8GCHG 1ZSKA 4BANB 1MBMA 2NWNA 4XBBA 1XMNB 2ZU4A 2GX4A 5FXLA 4X2VA 2ZU2A 4FU7A 3KHVA 5EXMA 1V2RT 1O2IA 1EAWA 3EYDA 2OXSA 1MCTA 3UR9A 3RXAA 3M3VA 3L6PA 1EP5A 3SU1A 3HPTB 1ARCA 2HALA 3PWCA 1XVOA 2A4RA 1K1PA 1WCZA 1ABIH 3TH4H 1K1JA 3TPIZ 4X6MA 2KAIA 1TRMA 1C4V2 1MBQA 2ZTXA 1O2NA 2QF3A 1Z6EA 3NUMA 2ZPRA 1CBWC 3KNXA 1ETRH 1MKWH 2BDHA 1GJ8B 2OC8A 3M37A 1E37B 1GI9B 5C1UA 2FP7B 4OS2A 1O2SA 1S5SA 3CP7A 5EOKA 1GCTB 4MPVA 1SL3A 1VITH 1W11U 4AN7A 3WY8A 2BZAA 1H8DH 3ZZ5A 4X8SH 2YOLA 2VIPA 4HGCA 1O2HA 4OGXA 1ELAA 2BD7A 2BDAA 3MH5A 2GT8A 3BG8A 3GYMA 3JZ2B 2A4GA 4KKDA 3RXIA 3CS0A 4AX9H 1GJ7B 1SFIA 3BF6H 1ZMJA 1YLCA 2K1QA 2ANYA 3P70B 1CGJE 2P94A 1YBWA 3NPSA 3SJ9A 3MU1A 1JWTA 2C4FH 5DP6A 3VEQB 1AN1E 5DP5A 1PPHE 3RXRA 1SHHB 1M9UA 1C2LA 3EQ0H 4TPYA 3GY8A 3F9FA 4XBDA 2BDGA 3OY6U 2QA9E 2BLVA 2VWOA 3UFAA 2VWNA 1MMJN 1GHAF 1TRYA 3FVFB 1W8BH 2ZTZA 2GKVE 3GY2A 1SPJA 3OYPA 1GHBF 3OX7U 5AF9H 2ZKSA 5A8XA 1TNKA 4JK5A 4UFGH 4XBCA 1QRXA 1C2EA 2A7HA 1LQEA 2VNTA 1SGQE 4CHAB 1Z8JB 1VCQA 1C5TA 1ZRKA 2B0FA 3SQHE 5EODA 1GVZA 5E8EH 2ZGJA 1TMUH 1DY9A 1Q31A 1ZJKA 5BRRE 3LOXA 1TX7A 1GI7B 3D65E 1PQ5A 1AB9C 1DUEA 2CN0H 3EE0B 1PYTD 1EB2A 1ZGVA 1MQ6A 2FYQA 1CHGA 1TBQH 2FI3E 1YPKH 2ANWA 1Y8TA 2G55A 4WMDA 2EI6A 1ZR0A 1ELCA 1FDPA 1FJSA 3GCTF 1N6YA 1O5BB 3HK6B 2ZDMA 2R3YA 2NU0E 3MO6A 3DUXH 4K60A 5DG6A 1Z6JH 1CU1A 2GDDA 3P6ZB 1ZGIA 1MZDA 1ZHPA 2Z7FE 2W5EA 1DS2E 1D3TB 1EX3A 4X1PU 6LPRA 5SGAE 5JB9S 2ZCKP 1C5NH 2F91A 1EZSC 1G3BA 1GBLA 2HNTE 2TPIZ 1KXBA 2GMTC 3GCHC 4JZDH 2AERH 1W14U 1UTKA 1WYKA 1P2JA 1GWAA 1O2TA 1WBGB 3M35A 3PLBA 3OU0A 2QIQA 2ZDKA 4LOYH 4FXGH 1UK4A 4A7IB 3RXLA 2H9HA 3F1SB 3MNXA 3S0NA 1YPHE 2OTVA 2ZGXH 2UUFB 1TPOA 1MKWK 2ZF0H 1ZTKA 1BZXE 1QBVH 2AMDA 4YTAA 3U1JB 2A4OA 2FOMB 2AGGX 3T28A 4MNWA 1AUJA 4IBLH 4U32A 2CXVA 4U2WA 3RXDA 2VU8E 1IQJA 1K21H 1LMWB 2QN5T 3RXOA 4E7RG 2HOBA 4ABDA 2JETB 1LDTT 5I46H 4THNH 3GCNA 3RU4T 1OYQA 3Q76A 1GPZA 1P10A 2BLWA 2WPHS 5GIBA 1P06A 2FOCA 2ZFFH 3QLPH 2ZO3H 3SGQE 1S6HA 1P05A 3BTME 1K9OE 2NU3E 3EDXB 3TH2H 1MTVA 1QHRB 3VGCB 5EXNA 1O5GH 3RXMA 2G81E 1L4DA 4VGCB 4OS4A 2Z9GA 5F8XA 1C5WB 1WOFA 3RU4D 2XBVA 2GCHF 3BTHE 1YPMH 1HPGA 3ZVFA 1DT2A 1MTUA 4NG9H 4ZH8A 4X8VH 1V2UT 3SUFA 2F9OA 3BV9B 5ABWA 3U1IB 5A8ZA 3ZZ9A 1GCDA 3BEFB 1K1NA 1Y5BT 3GCOA 1O5FH 2FESH 1YCPH 1IQFA 1C5LH 3NCLA 1UVUH 4INHA 3A81A 2Y7ZA 1BRCE 1MD7A 4MTBA 4B71A 1GBJA 3M5LA 4XOJA 1P9SA 1GGDC 3D62A 1HAPH 3E0PB 2VJ1A 1FZZA 2ULLA 1KTSB 4IN1A 1CT0E 4Y76A 1W7XH 1HAHH 3STJA 4DY7B 5HM2A 3BG4B 3KIDU 2BQ7B 2C8XB 1OP0A 4Y79A 1DWDH 1F2SE 1GDNA 4K3JA 1PQAA 2G4TA 1YC0A 1ZJDA 5A0AE 1GMCF 2ZIQH 3MFJA 3LPRA 4WMFA 3A85A 4CR5A 1OWHA 2STAE 3EA9A 4MPWA 5AHGH 3TGIE 3QX5H 1KLJH 4Y0YE 3T62A 1EUFA 1JRTA 1C1QA 1L1NA 1TGBA 3T25A 1P2KA 1PPBH 1O2OA 1Y3WA 1TBRH 4FUEA 1ZYOA 4BAHB 1W2KH 5L2YH 2XWAA 1EAXA 2A4QA 1TNLA 1P3EA 4I8HA 3T27A 1BMAA 1GJBB 2PWXA 2GT7A 1DLEA 5GCHG 1ZZZA 1B0FA 4O9VA 1EZXC 1KDQB 1KXDA 1YPLH 3LJJA 3U8TH 1V2TT 1E38B 5C1YA 4ABHA 1JMOH 5EPNA 3SU6A 1KXAA 1EATA 1C5ZB 4K8YA 3SW2B 3SV8A 3P8NA 3MNSA 1IQGA 1QCPA 1GL1A 2ZU5A 2HWLB 5DP4A 5H4IB 1QA0A 1GMDF 1H9HE 1HAZB 4ABFA 1CGIE 1C1UH 2GCTC 3N7OA 3OTJE 4ISIH 5E2PA 5LPEA 5T6GA 1C1MA 3SNCA 2OC1A 4FVDA
chains in the Genus database with same CATH superfamily
2VIWA 1SGCA 1T4VH 3QDZB 1O2XA 1P2MA 2J95A 1GJ6A 4J2YB 1KMHB 2OCVB 2PUQH 2VIDA 1V2OT 3ATMA 3RXGA 3K65B 3UOPA 2O8LA 1KSNA 4LZ1H 4IC5A 1QR3E 3FANA 1P9UA 3ESTA 3H7TA 1GBHA 1IQLA 1AFEH 2QF4A 3RXSA 4JZEH 1IAUA 2VB0A 2F9PA 3UAIC 1GBCA 1G2LA 1L0ZA 3WWBA 1OYTH 3SV2H 3GISB 1HYLA 2EQNA 8ESTE 3F9GA 4CBNA 2I6SA 1YCPK 4CRBA 3KQEA 1A3EH 1AGJA 1L1JA 1EZUC 1ZRBA 1AY6H 1LHGH 1IQNA 2LPRA 1P02A 1XKAC 1ZMLA 1O3KA 4BAMB 2JH6D 2PKSB 4X1SU 4PROA 1YLDA 2WINI 1PPZA 3UNSA 3PROA 1VGCC 4BAOB 1NPMA 1W0YH 3P8GA 1QGFA 1FXYA 2FOFA 2ZGHA 2G00A 4BOHA 2BDIA 1QJ6B 3VB5A 5G4BA 1P03A 2ZGBH 1GBKA 2PW8H 1BTUA 1K0HA 3M36A 1KIGH 4GCHF 1C5YB 1MTNB 5LPRA 3ZZAA 3PMAB 3AW0A 1GI8B 4UFDH 2DUCA 1S83A 1TONA 2AEIH 3FZZA 1E35B 3O8RA 3PTBA 3T2NA 1P0SH 1VITF 1C9TA 2JH5D 2F4LA 1SLXB 4Y8ZA 3S7KB 5FX5A 1UK3A 2BD9A 3GY3A 1PPEE 3A7WA 1SGDE 1C1OA 3AAVA 1O5AB 2QV1A 1N8OC 2ZHEH 8LPRA 2Z6BD 2WZQA 1XUHA 5A8YA 4Y71A 5E0GA 2AFQB 2ZDNA 7ESTE 2BXUH 4D9RA 2NU4E 2ZQ2A 2ASUB 1MD8A 1O5DH 2AIPA 3O8BA 2BY6X 1OXGA 4P00A 1O3EA 2FYRA 3AVZA 3RP2A 4ESTE 3E3TA 3M3TA 5JB8S 1EFRD 1GJCB 3PTNA 4YESB 1C5SA 2YMSC 1RTFB 1UCYE 4Y7AA 1GVKB 1TLDA 1QTFA 3SOSA 4IW4E 1S6LA 2WPIS 3M5MA 1FV9A 1SOTA 4KGAA 3TGJE 3BIVH 1G3CA 3LGYA 1T8OA 2FS9A 1NU9A 1ACBE 1EJAA 3LGTA 1MZAA 1RTKA 1EP6A 4F49A 1O3AA 1UTMA 2SGDE 1HUTH 1SGEE 2RA0A 3URDA 1O32A 1XUFA 2UWLA 4KTSA 1OX1A 5FPYA 4ABAA 5DKMA 3N99A 4IC6A 2J5UA 3U8RH 1GJDB 1BTYA 2SGEE 1C1VH 4AYYB 2EA3A 1C5OH 1HAIH 1F0UA 2O9QA 1UCYH 3R3GB 4JK6A 1TWXB 3BTDE 1RFNA 1S6FA 1YWUA 5JPMH 3OTPA 2FO9A 3ATLA 4X8UH 5DK1A 3ZVEA 2ZNKH 4DIIH 1C1NA 3VB4A 1ZPZA 1KDQA 4IGDA 1BBRH 1GJ4H 3E16B 1Z1IA 1TPSA 3SU0A 3PMBB 1VKYA 3MWIU 5DGJA 3LDXH 2B9LA 1MQ5A 3FN8A 3V12A 1FIWA 3BTWE 4OS1A 3EAJA 4TSFD 1GBEA 4VGCC 3Q3XA 4SGAE 3A7ZA 1BRAA 1YPEH 1ANEA 3RC6A 1QFKH 3MU0A 3ZZCA 1AFQC 5T6FA 4JMYA 3RC4A 1NROH 1AI8H 1E1RD 1ID5H 1UTQA 1G30B 1WU1A 2P16A 3A8AA 2PTCE 3LGUA 2BD5A 4UFEH 1WSSH 3A7XA 1TPPA 5HMAA 1WTHD 1SOZA 2PKAB 3SGBE 1MU6B 2HPPH 1NRRH 1W10U 1ZPBA 1DM4B 3ZVBA 1AWHB 3R0FA 3ZZ3A 3Q3YA 4INLA 1XM1A 2WYGA 1HCGA 1OWJA 2FOBA 1KTTB 1SGFG 4CH2B 3UQVA 1ELTA 1A0LA 1S81A 4RN6A 1TGSZ 3TITA 4DURA 1F5LA 1SGYE 3MU5A 1O2VA 4Y10E 2P8OC 3PO1C 2SGPE 4KELA 4NCYA 1BRBE 2SGAA 1FPCH 1G32B 1V6DA 4K2YA 2BM2A 4B75A 3RXHA 2VH6A 4I7YH 1TNJA 3SYJA 1EJMA 2IOTA 1HGTH 2FLRH 4NZQA 4OS7A 4HI3A 3QZQA 1O30A 1TMTH 5C2ZA 4AB9A 1ZTJA 2XBYA 3W94A 1O3IA 2HLDD 1LVBA 2VVCA 3N7DA 2Q6FA 1O3PB 1D3PB 5GXPA 1ZSLA 1GBIA 2V7QD 4U01A 1ZPCA 3SGAE 1GMHG 5F03A 2PV9B 1ABJH 2Y80A 2R2WU 5EIYA 5CHAB 1BMLA 2XNIA 4WXIA 1TNHA 1SI5H 3MO3A 1T31A 1LKAA 4NIWA 2IPQX 7GCHG 1MU8B 2ZFQH 1TGCA 2J98A 1NZQH 1HDTH 2H1UA 2HPQH 4ISOA 4X6OA 4BTUB 4H6TA 2I6QA 2F43B 1UCYK 4CRDA 3I78A 1F92A 2IN2A 2ILNA 1BHXB 1LVYA 2EI7A 3ITIA 3MHWU 3RMMH 4ZHLU 1P04A 2ZC9H 2KR7A 3A7VA 4INKA 1VJAU 3EE7A 3V3MA 3URCA 4B2AA 1GG6C 1DWCH 1BBRK 1G36A 3FOAA 4Q63A 2Z9LA 4MG3A 1COWD 1B5GH 1H1BA 1JIMA 1W7GH 4CBOA 4Y7BA 3B23B 3MH7A 5HM9A 4XDEA 2ZPSA 1DXPA 1FMGA 8GCHF 3SU4A 1JXPA 1XVMA 3V7TA 3IWMA 5PTPA 2IPHA 2FS8A 6CHAB 3K6ZA 2TBSA 3NRLA 5DP8A 4I32A 5DP7A 3C27B 3VXEH 1GJ5H 1UK2A 2P3UB 1GBBA 1HIAB 3CNRA 3FAOA 3MU4A 3TNSA 3OFND 1PPCE 1YKTA 1LO6A 2BY5X 2XC0A 1WQSA 5HKKD 4QT8C 3OSYA 1LKBA 4DG4A 1W13U 4RT1A 2A45B 1FX0B 5ESBA 3A8BA 1P12E 1AHTH 3A86A 2W7SA 1GHWH 4CRGA 2BYAX 2STBE 4D7FA 2FZZA 1DICA 3F3BA 2XCNA 2A5IA 4ZKOU 3MTYA 1TYNA 4MLFB 1GBTA 2ZFRH 4WF8A 2Q6DA 5C94A 5L2ZH 2DE8A 4M7GA 1OOKB 1J14A 4FUGA 1IQIA 2ZGCA 4B74A 5DN6D 3B9FH 2ANMH 4ISLA 1BT7A 1TOMH 4K8BA 1KXFA 4YOGA 3VFEA 5LGOA 3SHAH 1PJPA 3VB6A 3LH1A 4AG2A 3SI4H 3SBKA 1QQ4A 2FDAA 3TGKE 3RMNH 3P17H 2Z3DA 2F9BH 2AGIX 2PSYA 9ESTA 1SGRE 2FX4A 1TALA 3A82A 4FUFA 1NRQH 2QXGA 3RM2H 1FAXA 5IK2D 3QGJA 1CHOF 3RXJA 2QXIA 1NU7B 3MYWA 5BPEA 1O36A 1H8HD 1AQ7A 6GCHF 2KCAA 2FI4E 2Y82A 4D76A 3DHKH 1SGPE 1O2YA 3S9CA 4DCDA 4IMQA 4AFZA 2QXHA 2ZCLP 1TX6A 3MNCA 1UVTH 3DFJA 1YF4A 4FUDA 3SUGA 3ZZ4A 4MPXA 2F83A 1IOEA 1CVWH 2C3SA 5KGOA 1P2QA 2VIQA 1WUNH 2OP9A 1FY5A 2XBXA 1CT4E 4IS5A 4XFQA 2CHAC 3TJVA 2VVUA 1ANDA 3SV7A 1Y59T 2FTLE 3RXKA 3SI3H 1PQ8A 5JBTA 2VGCB 4Q7YA 3ZYEA 1ELFA 1E1QD 3KF2A 1C1WH 1C2MA 2OINA 1WQVH 1AKSB 4DT7B 4JYUH 2QY0B 3NWUA 2FODA 1B0EA 3QTOH 1F5KU 1SQRA 1O34A 4ZHAA 1HJAC 4X2XA 2GV7A 2BD3A 2ZQ1A 2D8WA 3S69A 1NFWA 2BDCA 1BB0B 3UUZA 3PLKA 1SLUB 1OKXA 1LVOA 1AZZA 2RDLA 4NFFA 5FPTA 3QO6A 4IMZA 3ZZDA 2D26C 4ABGA 3M5NA 2EI8A 2A7CA 1WAYB 1SQAA 2SNVA 1AIXH 4RT0A 3ZVCA 2XBWA 1TNGA 2A7JA 2AIQA 1U6QA 1O2PA 4NZLA 1O5EH 3GICB 3D49H 3DA9B 4XE4A 2TGDA 1FNIA 3U9AH 2FI5E 3GYLB 4HZHA 3F2GA 3DT0H 3GY6A 1TB6H 4X2YA 1J15A 1Z8RA 1C9PA 1V2ST 5CMXH 1NFXA 3RXUA 2ANKH 1C5MD 5EJ1A 1LVMA 1RIWC 2H2ZA 1JRSA 3GY7A 3MMGA 4F4OC 3F9EA 1QL7A 2P95A 1CSOE 2NU2E 1TABE 3NKKA 3A80A 3UR6A 3F9HA 3T26A 2JKHA 2OBOA 3M61U 2VWMA 2ZHQH 3SZNA 2ZU3A 1FI8A 1CE5A 1ANCA 1YPGH 1RGQA 2FEQH 5ESTE 3SNBA 4KTCA 1BCUH 1GJ9B 5T3HA 1GBDA 3LKWA 3BSQA 4I33A 2PTNA 5GJ4B 1NRNH 2LELA 2AHME 1HRTH 4ISHH 1KY9A 2BVSH 2FWWA 2P3TB 1A7SA 3NXPA 3QUMP 1HIAA 1HAVB 1OWKA 1HAGE 1SQTA 1GHVH 2FX6A 4I8GA 1KXCA 3SJIA 3RC5A 5F8TA 4F55A 1LHDH 3BTEE 1BMNH 4JZ1A 1BTPA 4NIYA 1EAUA 1OWIA 2QF0A 1EZQA 1V2WT 1BA8B 2Y5HA 2HVYB 2A31A 4NA8A 1NO9H 2A0QB 2FOHA 1CA0B 1TIOA 2J92A 3SORA 3S9BA 1CBWB 2CJIA 4AFQA 3MU8A 1D3QB 1UTOA 1AE5A 1K1IA 1A0JA 1PFXC 1XUIA 1C5UA 2J34A 2CGAA 1AVGH 5AVDA 5C3NA 1YYY1 3W1EA 5A0BA 3RLYH 1P2OA 2GV6A 3CS7A 1AMHA 1DITH 1GI3A 3RMLH 4CRCA 4GUXA 1GCTC 2GDEH 2KM0A 1SLVB 2V35A 1C5VA 1W0KD 3M5OA 4NSVA 2G8TA 5GNDA 1FAKH 2BHGA 4I8KA 1CT2E 1FUJA 2D2DA 2G4UA 1GI0A 4X1QU 2B5TB 2VBCA 1BRUP 2UWOA 3PV2A 4WMEA 1P3CA 2Y7XA 2Q6GA 2AGEX 3ZVAA 1IHSH 2ZP0H 3ZVGA 4Z1MD 1LPGB 3RXPA 2ZDVH 4H4FA 2R3UA 2L74A 1JBUH 4BAQB 4DOQA 1NESE 4ABBA 1OPHB 4YLQH 1SLWB 2RFKC 3WW7A 2BQWB 1PYTC 1NTPA 1UTPA 1QB9A 2ODPA 2WUBA 4FUIA 3DFLA 3P92A 4Z6AH 4TWWA 2AMQA 3LIWA 3PLPA 1AKSA 1UTJA 1HLTH 1O2QA 2W3IA 3BEIB 4OM9A 2TRMA 2BX3A 2QE7D 3SU5A 1DY8A 5EXLA 2W26A 5GCHF 3GY4A 5DO4H 2BDBA 1L2EA 3SUEA 2GZ8A 4BTIB 2Z9JA 5GDSH 4ACBA 1C2FA 1V2LT 2OQUA 1NC6A 4B1TA 1FONA 2OC1A 3PMHB 2IJOB 2UUKB 4CHAC 1C1SA 3CENA 1AB9B 1QBNA 1AE8H 1SC8U 2F9NA 2PR3A 3TU7H 1AVWA 2ZHDA 1CGHA 2WPJS 2TGPZ 1RD3B 1RTLA 3A7TA 3A83A 2OUAA 3TK9A 2KAIB 2KFWA 1D6RA 1O2ZA 7LPRA 1EJNA 5L6NH 4MPUA 2XRCA 3F68H 1TGNA 3P8OA 1TQ7B 4DJZB 4ZKNU 4MVNA 2FM2A 1HFDA 1SKYE 2JJ1D 2BDYA 2AMPA 2OLGA 4X6PA 4WY3A 1FQ3A 5FL7D 1QJ1B 2ALVA 2GMTB 1DOJA 3GCHB 1WDIA 4X0WU 1C1RA 1GBAA 2ZG0H 4UD9H 1E0FD 3TVJB 1T7CA 1UO6A 3LONA 2Y5GA 3M7TA 3MQKC 1Y5AT 3UWJH 1S0RA 2C8YB 4K1SA 5ETXA 4R0IA 3E8LA 1DANH 1SR5C 4TYDA 1SBWA 4ABEA 1GDUA 1KXEA 1O2UA 5CDFE 2R2MB 4O03A 2TGAA 1O5CB 1J16A 4JZIA 3D23A 1BBRE 2A1DB 4BXSA 3SV9A 1TRNA 3RXVA 3U8OH 3V13A 1MH0A 2SGFE 2TIOA 1SVPA 2FOEA 4DVAU 1YPJH 5HIZA 5AFYH 5F8ZA 4AZ2B 3VPKA 3PMJA 4AB8A 4WWYA 1SFQB 1DLKB 1HAVA 5A2MH 1P01A 1DDJA 1SQOA 1Z7KA 2QXJA 1AVXA 4WXVA 4J1YA 5AFZH 1H9LB 5A09A 3TIUA 1ZHRA 1UHBB 4X8TH 2AS9A 2ZI2H 2JETC 1GI1A 1ZOMA 3ATKA 2CF8H 1O3MA 1PPFE 1Y3VA 2WSSD 3GS9A 1IHTH 1O3LA 3UOUA 1TBZH 4TY6A 1A3BH 1ELGA 1ESAA 3MI4A 1CO7E 3P95A 4Q7XA 4K69A 3VGCC 4CRAA 2H5CA 3AAUA 5JBAS 1T8MA 1O3OA 5GWZA 4AORA 5KEDA 4RSPA 1HAOH 1A5GH 3I29A 1LTOA 4YLUA 1YCPM 3ZV8A 2BX4A 4GPGA 1C2GA 1SGFA 4ZKSU 3B8JA 1HJ8A 2OD3B 1C2HA 1FY8E 4UDWH 3PV4A 1NN6A 4Q7ZA 2EC9H 3LGIA 1C2DA 3S9AA 1GGDB 2C8WB 4GAWA 2XOKD 4FUCA 2RG3A 3U69H 4A1XA 4LXBH 4ABJA 1VJ9U 1DX5M 1UTNA 4NA7A 3KEEA 4DW2U 1H9IE 4NIVA 3VXFH 1GBMA 1EXFA 1HXFH 4D8NA 1ANBA 1EPTB 1ZLRA 3Q77A 3SZEA 1NRPH 2A32A 3BG4C 1EQ9A 3ZZ8A 1H8IH 5C17A 1F0SA 2F3CE 2CMYA 1CA8B 2HGTH 4ZXYH 4E05H 1HB0B 1O3HA 1P57B 1QQUA 4B73A 4NFEA 4B2BA 4I31A 2EEKA 1K1MA 1FY4A 3M7UA 1FPHH 3SO3A 2C8ZB 3RXCA 2XC4A 3FO8D 1ORFA 3DSOA 1G37A 2PUXB 4O3UA 1QURH 4FVBA 3H7OA 5FCKA 2ALPA 2BVRH 4KP0A 1EAIA 2YNAA 4K1TA 4YT6H 1NFYA 1Z71A 1LHFH 1DSUA 1EOJA 1GHAG 1RXPA 3TJUA 4A92A 3EA8A 1DWBH 5EG4A 4BNRA 1AD8H 1GHBG 1TX8A 1G9IE 2FXRA 2GZ9A 5J4SA 5C0UA 3FKSD 1SSXA 2WUCA 4X1RU 4Y6DA 1HAYB 1RS0A 2BD2A 1F5RA 1INCA 2Y81A 1QL8A 1V2NT 2VIOA 2ZTYA 3C1KA 2WV5A 4BTTB 1O2RA 3ODDA 2RCEA 1XXFA 4FUJA 2HRVA 4UEHH 1CA0C 4ZXXH 2GCTB 4DIHH 1O31A 5TCAA 1TGTA 5K0HA 1TE0A 2NU1E 3KYGA 1UW7A 2VWLA 1OS8A 3PM3A 3QWCH 1BITA 3RXQA 2Z94A 4YO9A 4JYTA 2BOKA 1S84A 1QRZA 2XTTB 2Y5FA 2K8IA 3A88A 2A5KA 3GCTG 3H5CB 1NBME 1O3NA 1ESBA 4ISNA 5TJXA 4BXWA 4RKJB 3F6UH 2BVXH 5F6MA 1ETSH 1P8VC 2PSXA 2UUJB 2ZDAH 1AWFH 1LCYA 1ELEE 2C90B 2CF9H 1SHYA 3ZZ6A 4NWKA 1EKBB 1T8LA 3N7EA 5T1VA 4ZROA 4Y0ZE 5I25A 5B6LA 1NT1A 3RU4E 1CHOG 4GSOA 1ESTA 4JZFH 1DUAA 2P3FH 6GCHG 1MAYA 2H9TH 5JBCS 3LC5A 4MNVA 2OBQA 2ZCHP 3T29A 4ZKRU 1O0DH 2BY7X 2QF5A 3UB0A 4H42U 2F9UA 1C1TA 1TPAE 3HATH 1YM0A 1V2PT 1VGCB 2OK5A 2ZECA 4AGJA 1K1LA 1MCVA 1Y3UA 2FPZA 1E36B 2ZDLA 4ZMAH 2OC0A 2WPMS 1UHBA 2PKSC 2THFB 1GI4A 2R9PA 1LPZB 2SFAA 1BTZA 3M7QA 1O3BA 1F0RA 1GMHF 1S0QA 1C2KA 5JDUB 1MTSA 1BQYA 3QGNB 1A46H 1XUKA 1TOCB 1P09A 1MTNC 2J94A 2W7UA 5LH8A 4IN2A 3BEUA 3E0NB 7GCHF 3AW1A 1T8NA 5EW1H 4MDSA 4MNXA 4ZCNA 4YT7H 1N8OB 2G5NA 1XXDA 4A5TS 2GCHG 1FIZA 1O35A 1WV7H 2BTCE 2L6OA 3SHCH 4CRFA 3NZIA 1JOUB 4O97A 2FMJA 3LC3A 4WVPE 5EJLA 3QK1A 5C67A 5DP9A 1QNJA 2ODQA 1MABB 2UUYA 3P8FA 2KCYA 1O3FA 3TK5A 1RRKA 1P11E 4AGKA 2ESTE 1J8AA 2BD4A 1BJVA 3HKIB 3BIUH 4AG1A 2PKAA 3HK3B 4AFUA 1DSTA 2YMSB 1G3EA 2PFEA 1UVOA 4NA9H 3ZVDA 1DWEH 1VCPA 2ODYB 3OY5U 1SGIB 1EPTA 4BAKB 4OGYA 1MAXA 2QAAA 3MH6A 5E2OA 1QB1A 3VB7A 1ZHMA 4X6NA 2LP6A 2QYIA 4TWYA 3PWBA 4AOQA 1HJ9A 3TNTA 3Q00A 1C5QA 1TNIA 1GJAB 1OWDA 3OE7D 3A8DA 1GMCG 4WH8A 1BDAA 1LHCH 5EW2H 1UJ1A 4Z0KA 4XRNA 4UFFH 1YY3A 1HXEH 4NWLA 1IQKA 1SGNE 2UWPA 4E06H 3E90B 1OSSA 2H9EH 2PHBA 5KECA 2W3KA 1L1GA 5LPFA 1O2LA 1S85A 1Z8GA 2YMSD 1PPGE 2GZ7A 3UIRA 1DFPA 1YGCH 2LNCA 3A84A 4WJG2 4TPIZ 1V2QT 5TCCA 2G51A 1C5RA 2HLCA 1C2IA 1EASA 4GHTA 5J4QA 4ABIA 1EB1H 1UMAH 1QRWA 2XXLA 3ZIAD 2AH4X 3AK5A 4OS5A 1GVLA 2O8WA 1A0HB 2BZ6H 2M5TA 2O8UA 2A2QH 5FAHA 4NGAH 3LGWA 2JIZD 1FLEE 1KLTA 3QZRA 1A61H 1XUGA 3ENSB 4UONA 2ZZUH 3FFGA 3QTVH 1K28D 5E0JA 4I8LA 2GGVB 4FOUC 1AFQB 3LU9B 4ZHMU 8KME2 5HYOA 1SMFE 5A0CA 1VZQH 5DP3A 1GMDG 5IYTA 3U98H 1O2WA 1OP8A 1P2IA 1OP2A 3ATIA 1ZMNA 1P2NA 2YNBA 3SU3A 4CREA 3K2UA 1E34B 3A8CA 3K6YA 4NIXA 3MH4A 2J9NA 2BY9X 1V2VT 2KX4A 3FP7E 3W95A 4AC9A 2FLBH 3SUDA 1AO5A 2H6MA 1E79D 1YLNA 1J17T 1AUTC 4DT4A 1GBFA 3OEED 2XYAA 3G01A 1HNEE 2WYJA 2ZFTA 3VB3A 1Y3XA 4A6LA 2ZHFH 1RJXB 3BTGE 3L33A 3SJ8A 3PV5A 1DVAH 5FBEA 3TH3H 3RLWH 2P8OB 1EPTC 3PO1B 1G3DA 2ZEBA 2FIRH 3E1XB 3K9XB 5GPIB 3KQDA 2R0KA 1W3CA 3DD2H 3QN7A 4D9QA 4KTUA 2A5AA 3FP6E 1KLIH 2G52A 5DJ7A 3KGPA 1J9CH 5JYIA 2WV9A 2A2XH 3IG6B 2O8TA 5JBBS 2VH0A 3FZDA 5FHTA 2V3MA 3FP8E 2BY8X 2RDEA 3U28C 1MUEB 1O3JA 2G5VA 2Q1JA 4K5ZA 3HGNA 3UTUH 2SGQE 4Q80A 4FUBA 1K1OA 3SV6A 3GDUA 5EQQA 2R0LA 1GDQA 4MNYA 1D9IA 1G2MA 5IDKA 1D3DB 4WH6A 2BB4A 5EQSA 3EGKH 1QIXB 1A1RA 4GCHG 1TQ0B 1O2GH 2BMGB 3E6PH 4ZAEA 5HGGA 4NSYA 4H6SB 2C93B 3TJOA 1T32A 1O2KA 1BTHH 4K1EA 1ZTLA 5CHAC 1QB6A 1LHEH 1VITG 2BXTH 2O8MA 1MKXH 1W12U 3RMOH 1GL0E 2PGBB 4R8TB 3KN2A 1GHXH 2QCYA 1JIRA 1SB1H 2BLOA 1BJUA 3I77A 3SNDA 4LK4A 4DGJA 1FN6A 3RUOA 2D1JA 1BTXA 1C2JA 1NRSH 1XX9A 1C4U2 3HGPA 4JYVH 1GG6B 1GHYH 3RDZA 2B7DH 1C5PA 4FETA 2DE9A 4I8JA 2Y6TA 3WWFA 2J2UA 3ELAH 3V0XA 2KCOA 1Z1JA 1A5IA 4Y8XA 4Y11E 5CE1A 1BMMH 4A1VA 3RM0H 2ZA5A 1SG8B 3KQCA 1A2CH 2J4IA 3LJOA 2H5DA 1ARBA 5DSFA 3A87A 1DPOA 1N1LA 1OHHD 1BHXF 2Z3EA 3AASA 1CQQA 2PGQB 3BN9A 5EPYA 1HBTH 3T5FH 1SGTA 6CHAC 1PQ7A 3BTTE 4ASHA 1QBOA 3Q3KA 1WXRA 1THPB 3KQBA 2P93A 4B6EA 2P59A 3M3SA 2ZPQA 1ETTH 1H4WA 2K0QA 7KMEH 3F2FA 1N6XA 1Z8IB 1LPKB 1Q2WA 2WV4A 4AYVB 1AZ8A 1C4Y2 4X1NU 1MTWA 2J97A 2ZFSA 1Y3YA 1F7ZA 5FCRA 2FOAA 3RXEA 4Y8YA 2PLXA 5EJZA 1X7AC 4YOIA 2VINA 2OC7A 1Y5UT 4RKOB 4B2CA 1C1PA 3RXBA 3EA7A 3UQOA 4TY7A 1BOQA 1YP9A 4AFSA 1GI2A 4CR9A 4SGBE 2FOGA 1BUIA 1ELVA 1TFXA 3DSGA 1VCWA 2Z3CA 1GI5A 4GHQA 2V0BA 3UPEA 4LZ4B 1IQEA 2M2AA 3RXTA 3PRDA 2RA3A 1XUJA 2IJD1 3STIA 4M9FA 2V3OH 4FU8A 4Q2KA 4HTCH 5C0TA 2JH0D 3LH3A 2J98B 1L4ZA 1TMBH 1BIOA 1LQDB 4FU9A 2SNWA 1V2MT 2PP6A 1O37A 3SNAA 1O33A 4OS6A 3TK6A 3DCLA 3E91A 2OQ5A 1O38A 3MO9A 3UWIA 1Q3XA 2BOHB 2JDID 3L3TA 4X2WA 1ZSJA 3UNQA 1TA2A 5C1XA 1UVSH 2B8OH 2BQ6B 3GOVB 3NK8A 1OWEA 3PYHA 4CH8B 2QGRA 4E7NA 3ZV9A 3LT3A 2XWBI 3MOCA 2QC2A 4MQAA 4A1TA 1UTLM 3RXFA 2CHAB 9LPRA 5C5OA 3GDVA 3UNRA 1O2MA 2XC5A 2AYWA 1O3CA 2V3HH 3TLOA 3ZZBA 1UVPA 1MKXK 4TT3D 1QZ8A 1V2JT 1WTGH 1QJ7B 3KL6A 3DSPA 3UREA 3BTKE 3ODFA 3SJKA 1O3DA 2Z9KA 3ZYDA 1S82A 2GP9B 1K2I1 4YZUA 2XCFA 1ELBA 2BLQA 2VGCC 1D6WA 1HJAB 1DE7H 1O39A 3ATWA 4JCNA 1IQHA 2GD4B 5EQRA 4ZUHA 4GVUA 2F9VA 1ELDE 1FN8A 5EGMA 5FX6A 3SN8A 3SJOA 1TAWA 5FPSA 1GI6A 2GVFA 4UE7H 2V6NA 2XW9A 5B6OA 3GDSA 4O3TA 1FY3A 2J38A 1C5XB 1GHZA 1K22H 1T4UH 6ESTA 4U30A 3BTQE 3O8DA 5DPAA 3SU2A 5EU8A 4FUHA 3A7YA 3GY5A 5K7RA 3MNBA 3UY9A 3S7HB 3A89A 1V3XA 5HIYA 1DXWA 5C20A 4D7GA 1HV7A 1W0ZU 5C5NA 3ZZ7A 1VR1H 2VVVA 3SQEE 2ZFPH 1A4WH 1NS3A 2KZ4A 4B76A 1KYNA 1EOLA 2ZU1A 1THSH 1NY22 3PB1E 5CHBA 1RIWB 2ZHWH 1FY1A 1B7XB 3SNEA 2BD8A 2TGTA 3KCGH 3LGVA 4XSKU 1QL9A 1IQMA 2HVXA 3F0OA 1NM6A 1TA6A 4P02A 1O3GA 4HFPB 4YOJA 2EY4C 2HNTC 1XKBC 4GLYA 1HAXB 1BTWA 1NFUA 1V2KT 1THRH 5E0HA 4YM9A 1QY6A 2ZWLH 2VIVA 3IITA 2GTBA 3BTFE 3JZ1B 1D4PB 5T6DA 1F0TA 3HKJB 5FBIA 2Z9IA 5HXFA 3O8CA 2WPLS 2WPKS 1AU8A 2FTMA 3TJNA 1A5HA 2CV3A 5L30H 1QA7A 2HNTF 1YPHC 8GCHG 1ZSKA 4BANB 1MBMA 2NWNA 3OAAD 4XBBA 1XMNB 2ZU4A 2GX4A 5FXLA 4X2VA 2ZU2A 4FU7A 3KHVA 5EXMA 1V2RT 1O2IA 1EAWA 3EYDA 2OXSA 1MCTA 3UR9A 3RXAA 3M3VA 3L6PA 1EP5A 3SU1A 3PRBA 4I86A 3HPTB 1ARCA 2HALA 2WPDD 3PWCA 1XVOA 2A4RA 1K1PA 1WCZA 1ABIH 3TH4H 1K1JA 3TPIZ 4X6MA 2KAIA 1TRMA 1C4V2 1MBQA 2ZTXA 1O2NA 2QF3A 1Z6EA 3NUMA 2ZPRA 1CBWC 3KNXA 1ETRH 1MKWH 2BDHA 1GJ8B 2OC8A 3M37A 1E37B 1GI9B 5C1UA 2FP7B 4OS2A 1O2SA 1S5SA 3CP7A 4ACAA 5EOKA 1GCTB 4MPVA 1SL3A 1VITH 1W11U 4AN7A 3WY8A 4F48B 2BZAA 1H8DH 3ZZ5A 4X8SH 2YOLA 2VIPA 4HGCA 1O2HA 4OGXA 1ELAA 2BD7A 2BDAA 3MH5A 2GT8A 3BG8A 3GYMA 3JZ2B 2A4GA 4KKDA 3RXIA 3CS0A 4AX9H 1GJ7B 1SFIA 3BF6H 1ZMJA 1YLCA 2K1QA 2ANYA 3P70B 1CGJE 2P94A 1YBWA 2XNDD 3NPSA 3SJ9A 3MU1A 1JWTA 2C4FH 5DP6A 3VEQB 1AN1E 5DP5A 1PPHE 5F53A 3RXRA 1SHHB 1M9UA 1C2LA 3EQ0H 4TPYA 3GY8A 3F9FA 4XBDA 2BDGA 3OY6U 2QA9E 3KYFA 2BLVA 3VG8A 2VWOA 3UFAA 2VWNA 1MMJN 1GHAF 1TRYA 3FVFB 1W8BH 2ZTZA 2GKVE 3GY2A 1SPJA 3OYPA 1GHBF 3OX7U 5AF9H 2ZKSA 5A8XA 1TNKA 4JK5A 4UFGH 4XBCA 1QRXA 1C2EA 2A7HA 1LQEA 2VNTA 2JJ2D 1SGQE 4CHAB 1Z8JB 1VCQA 1C5TA 1ZRKA 2B0FA 3SQHE 5EODA 1GVZA 5E8EH 2ZGJA 1TMUH 1DY9A 1Q31A 1ZJKA 5BRRE 3LOXA 1TX7A 1GI7B 3D65E 4YXWD 1PQ5A 1AB9C 1DUEA 2GJGA 2W6ID 2CN0H 3EE0B 1PYTD 1EB2A 1ZGVA 1MQ6A 2FYQA 1CHGA 1TBQH 2FI3E 1YPKH 2ANWA 1Y8TA 2G55A 4WMDA 2EI6A 1ZR0A 1ELCA 1FDPA 1FJSA 3GCTF 1N6YA 1O5BB 3HK6B 2ZDMA 2R3YA 2NU0E 3MO6A 3DUXH 4K60A 5DG6A 1Z6JH 1CU1A 2GDDA 3P6ZB 1ZGIA 1MZDA 1ZHPA 2Z7FE 2W5EA 1DS2E 1D3TB 1EX3A 4X1PU 6LPRA 5SGAE 5JB9S 2ZCKP 1C5NH 2F91A 1EZSC 1G3BA 1GBLA 2HNTE 2TPIZ 1KXBA 2GMTC 3GCHC 4JZDH 2AERH 1W14U 1UTKA 1WYKA 1P2JA 2WHXA 1GWAA 1O2TA 1WBGB 3M35A 3PLBA 3OU0A 2QIQA 2ZDKA 4LOYH 4FXGH 1UK4A 4A7IB 3RXLA 2H9HA 3F1SB 3MNXA 3S0NA 1YPHE 2OTVA 3F2HA 2ZGXH 2UUFB 1TPOA 1MKWK 2ZF0H 1ZTKA 1BZXE 1QBVH 2AMDA 4YTAA 3U1JB 2CK3D 2A4OA 2FOMB 2AGGX 3T28A 4MNWA 1AUJA 4IBLH 4U32A 2CXVA 4U2WA 3RXDA 2VU8E 1IQJA 1K21H 1LMWB 2QN5T 3RXOA 4E7RG 2HOBA 3F0PA 4ABDA 2JETB 1LDTT 5I46H 4THNH 1NBMD 3GCNA 3RU4T 1OYQA 3Q76A 1GPZA 1P10A 2BLWA 2WPHS 5GIBA 3KQ5A 1P06A 2FOCA 2ZFFH 4B6FA 2ZO3H 3QLPH 4Q4LA 3SGQE 1S6HA 1P05A 3BTME 1K9OE 2NU3E 3EDXB 3TH2H 1MTVA 1QHRB 3VGCB 5EXNA 1O5GH 3RXMA 2G81E 1L4DA 4VGCB 4OS4A 2Z9GA 5F8XA 1C5WB 1WOFA 3RU4D 2XBVA 2GCHF 4RI0A 3BTHE 1YPMH 1HPGA 3ZVFA 1DT2A 1MTUA 4NG9H 4ZH8A 4X8VH 1V2UT 3SUFA 2F9OA 3BV9B 5ABWA 3U1IB 5A8ZA 3ZZ9A 1GCDA 3BEFB 1K1NA 1Y5BT 3GCOA 1O5FH 2FESH 1YCPH 1IQFA 1C5LH 3NCLA 1UVUH 4INHA 3A81A 2Y7ZA 3H09A 1BRCE 1MD7A 4MTBA 4B71A 1GBJA 3M5LA 4XOJA 1P9SA 1GGDC 3D62A 1HAPH 3E0PB 2VJ1A 1FZZA 2ULLA 1KTSB 4IN1A 1CT0E 4Y76A 1W7XH 1HAHH 3STJA 4DY7B 5HM2A 3BG4B 3KIDU 2BQ7B 2C8XB 1OP0A 4Y79A 1DWDH 1F2SE 1GDNA 4K3JA 1PQAA 2G4TA 1YC0A 1ZJDA 5A0AE 1GMCF 2ZIQH 3MFJA 3LPRA 4WMFA 3A85A 4CR5A 1OWHA 2KCPA 4XD7D 2STAE 3EA9A 4MPWA 5AHGH 3TGIE 3QX5H 1KLJH 4Y0YE 3T62A 1EUFA 1JRTA 1C1QA 1L1NA 1TGBA 3T25A 1P2KA 1PPBH 1O2OA 1Y3WA 1TBRH 4FUEA 1ZYOA 4BAHB 3OEHD 1W2KH 5L2YH 2XWAA 1EAXA 2A4QA 1TNLA 1P3EA 4I8HA 3T27A 1BMAA 1GJBB 2PWXA 2GT7A 1DLEA 5GCHG 1ZZZA 1B0FA 4O9VA 1EZXC 1KDQB 1KXDA 1YPLH 3LJJA 3U8TH 1V2TT 1E38B 5C1YA 1H8ED 4ABHA 1JMOH 5EPNA 3SU6A 1KXAA 1EATA 1W0JD 1C5ZB 4K8YA 3SW2B 3SV8A 3P8NA 3MNSA 1IQGA 1QCPA 1GL1A 2ZU5A 2HWLB 4HG6A 5DP4A 5H4IB 1QA0A 1GMDF 1H9HE 1HAZB 4ABFA 1CGIE 1C1UH 2GCTC 4ASUD 3N7OA 2W6JD 3OTJE 4ISIH 1BMFD 5E2PA 5LPEA 5T6GA 1C1MA 3SNCA 1O2JA 4FVDA
chains in the Genus database with same CATH topology
2VIWA 1SGCA 1T4VH 3QDZB 1O2XA 1P2MA 2J95A 1GJ6A 4J2YB 2OCVB 2PUQH 2VIDA 1V2OT 3ATMA 3RXGA 3K65B 3UOPA 2O8LA 1KSNA 4LZ1H 4IC5A 1QR3E 3FANA 1P9UA 3ESTA 3H7TA 1GBHA 1IQLA 1AFEH 3RXSA 4JZEH 1IAUA 2VB0A 2F9PA 1GBCA 1G2LA 1L0ZA 1OYTH 3SV2H 3GISB 1HYLA 8ESTE 3F9GA 4CBNA 2I6SA 1YCPK 4CRBA 3KQEA 1A3EH 1AGJA 1L1JA 1EZUC 1ZRBA 1AY6H 1LHGH 1IQNA 2LPRA 1P02A 1XKAC 1ZMLA 1O3KA 4BAMB 2JH6D 2PKSB 4X1SU 4PROA 1YLDA 2WINI 1PPZA 3UNSA 3PROA 1VGCC 4BAOB 1NPMA 1W0YH 3P8GA 1QGFA 1FXYA 2FOFA 2ZGHA 2G00A 4BOHA 2BDIA 1QJ6B 3VB5A 5G4BA 1P03A 2ZGBH 1GBKA 2PW8H 1BTUA 3M36A 1KIGH 4GCHF 1C5YB 1MTNB 5LPRA 3ZZAA 3PMAB 3AW0A 1GI8B 4UFDH 2DUCA 1S83A 1TONA 2AEIH 3FZZA 1E35B 3O8RA 3PTBA 3T2NA 1P0SH 1VITF 1C9TA 2JH5D 1SLXB 4Y8ZA 3S7KB 5FX5A 1UK3A 2BD9A 3GY3A 1PPEE 3A7WA 1SGDE 1C1OA 3AAVA 1O5AB 2QV1A 1N8OC 2ZHEH 8LPRA 2Z6BD 1XUHA 5A8YA 4Y71A 5E0GA 2AFQB 2ZDNA 7ESTE 2BXUH 4D9RA 2NU4E 2ZQ2A 2ASUB 1MD8A 1O5DH 2AIPA 3O8BA 2BY6X 1OXGA 3RP2A 1O3EA 2FYRA 3AVZA 4ESTE 3E3TA 3M3TA 5JB8S 1GJCB 3PTNA 4YESB 1C5SA 1RTFB 1UCYE 4Y7AA 1GVKB 1TLDA 1QTFA 3SOSA 4IW4E 2WPIS 3M5MA 1FV9A 1SOTA 4KGAA 3TGJE 3BIVH 1G3CA 3LGYA 1T8OA 2FS9A 1NU9A 1ACBE 1EJAA 3LGTA 1MZAA 1RTKA 1EP6A 4F49A 1O3AA 1UTMA 2SGDE 1HUTH 1SGEE 2RA0A 3URDA 1O32A 1XUFA 2UWLA 4KTSA 1OX1A 5FPYA 4ABAA 5DKMA 4IC6A 3U8RH 1GJDB 1BTYA 2SGEE 1C1VH 4AYYB 2EA3A 1C5OH 1HAIH 1F0UA 2O9QA 1UCYH 3R3GB 4JK6A 1TWXB 3BTDE 1RFNA 1S6FA 5JPMH 2FO9A 3ATLA 4X8UH 5DK1A 3ZVEA 2ZNKH 4DIIH 1C1NA 3VB4A 1ZPZA 1KDQA 4IGDA 1BBRH 1GJ4H 3E16B 1Z1IA 1TPSA 3SU0A 3PMBB 3MWIU 5DGJA 3LDXH 2B9LA 1MQ5A 3V12A 1FIWA 3BTWE 4OS1A 3EAJA 4VGCC 1GBEA 3Q3XA 4SGAE 3A7ZA 1BRAA 1YPEH 1ANEA 3RC6A 1QFKH 3MU0A 3ZZCA 1AFQC 5T6FA 4JMYA 3RC4A 1NROH 1AI8H 1ID5H 1UTQA 1G30B 1WU1A 2P16A 3A8AA 2PTCE 3LGUA 2BD5A 4UFEH 1WSSH 3A7XA 1TPPA 5HMAA 1WTHD 1SOZA 2PKAB 3SGBE 1MU6B 2HPPH 1NRRH 1W10U 1ZPBA 1DM4B 3ZVBA 1AWHB 3R0FA 3ZZ3A 3Q3YA 4INLA 1XM1A 2WYGA 1HCGA 1OWJA 2FOBA 1KTTB 1SGFG 4CH2B 3UQVA 1ELTA 1A0LA 1S81A 4RN6A 1TGSZ 3TITA 4DURA 1F5LA 1SGYE 3MU5A 1O2VA 4Y10E 2P8OC 3PO1C 2SGPE 4KELA 4NCYA 1BRBE 2SGAA 1FPCH 1G32B 1V6DA 4K2YA 2BM2A 4B75A 3RXHA 2VH6A 4I7YH 1TNJA 1EJMA 2IOTA 1HGTH 2FLRH 4NZQA 4OS7A 4HI3A 3QZQA 1O30A 1TMTH 5C2ZA 4AB9A 1ZTJA 2XBYA 3W94A 1O3IA 1LVBA 2VVCA 2Q6FA 1O3PB 1D3PB 5GXPA 1ZSLA 1GBIA 4U01A 1ZPCA 3SGAE 1GMHG 5F03A 2PV9B 1ABJH 2Y80A 2R2WU 5CHAB 1BMLA 2XNIA 4WXIA 1TNHA 1SI5H 3MO3A 1T31A 1LKAA 4NIWA 7GCHG 1MU8B 2ZFQH 1TGCA 1NZQH 1HDTH 2H1UA 2HPQH 4ISOA 4X6OA 4BTUB 4H6TA 2I6QA 1UCYK 4CRDA 3I78A 1F92A 2IN2A 2ILNA 1BHXB 1LVYA 2EI7A 3ITIA 3MHWU 3RMMH 4ZHLU 1P04A 2ZC9H 3A7VA 4INKA 1VJAU 3V3MA 3URCA 4B2AA 1GG6C 1DWCH 1BBRK 1G36A 2Z9LA 4MG3A 1B5GH 1H1BA 1JIMA 1W7GH 4CBOA 4Y7BA 3B23B 3MH7A 5HM9A 4XDEA 2ZPSA 1DXPA 1FMGA 8GCHF 3SU4A 1JXPA 1XVMA 3V7TA 3IWMA 5PTPA 2IPHA 2FS8A 6CHAB 3K6ZA 2TBSA 5DP8A 4I32A 5DP7A 3C27B 3VXEH 1GJ5H 1UK2A 2P3UB 1GBBA 1HIAB 3MU4A 3FAOA 3TNSA 1PPCE 1YKTA 1LO6A 2BY5X 2XC0A 1WQSA 4QT8C 3OSYA 1LKBA 4DG4A 1W13U 2A45B 5ESBA 3A8BA 1P12E 1AHTH 3A86A 2W7SA 1GHWH 4CRGA 2BYAX 2STBE 4D7FA 2FZZA 1DICA 2XCNA 2A5IA 4ZKOU 3MTYA 1TYNA 4MLFB 1GBTA 2ZFRH 4WF8A 2Q6DA 5L2ZH 2DE8A 4M7GA 1OOKB 1J14A 4FUGA 1IQIA 2ZGCA 4B74A 3B9FH 2ANMH 4ISLA 1BT7A 1TOMH 4K8BA 1KXFA 4YOGA 3VFEA 5LGOA 3SHAH 1PJPA 3VB6A 3LH1A 4AG2A 3SI4H 3SBKA 1QQ4A 2FDAA 3TGKE 3RMNH 3P17H 2Z3DA 2F9BH 2AGIX 2PSYA 9ESTA 1SGRE 2FX4A 1TALA 3A82A 4FUFA 1NRQH 2QXGA 3RM2H 1FAXA 3QGJA 1CHOF 3RXJA 2QXIA 1NU7B 3MYWA 5BPEA 1O36A 1AQ7A 6GCHF 2FI4E 2Y82A 4D76A 3DHKH 1SGPE 1O2YA 3S9CA 4DCDA 4IMQA 4AFZA 2QXHA 2ZCLP 1TX6A 3MNCA 1UVTH 3DFJA 1YF4A 4FUDA 3SUGA 3ZZ4A 4MPXA 2F83A 1IOEA 1CVWH 2C3SA 1P2QA 2VIQA 1WUNH 2OP9A 1FY5A 2XBXA 1CT4E 4IS5A 4XFQA 2CHAC 3TJVA 2VVUA 1ANDA 3SV7A 1Y59T 2FTLE 3RXKA 3SI3H 1PQ8A 5JBTA 2VGCB 4Q7YA 3ZYEA 1ELFA 3KF2A 4DT7B 1C1WH 1C2MA 2OINA 1WQVH 1AKSB 4JYUH 2QY0B 3NWUA 2FODA 1B0EA 3QTOH 1F5KU 1O34A 4ZHAA 1HJAC 4X2XA 2GV7A 2BD3A 2ZQ1A 2D8WA 3S69A 1NFWA 2BDCA 1BB0B 3UUZA 3PLKA 1SLUB 1OKXA 1LVOA 1AZZA 2RDLA 4NFFA 5FPTA 3QO6A 4IMZA 3ZZDA 2D26C 4ABGA 3M5NA 2EI8A 2A7CA 1WAYB 1SQAA 2SNVA 1AIXH 3ZVCA 2XBWA 1TNGA 2A7JA 2AIQA 1U6QA 1O2PA 4NZLA 1O5EH 3GICB 3D49H 3DA9B 4XE4A 2TGDA 1FNIA 3U9AH 2FI5E 3GYLB 4HZHA 3DT0H 3GY6A 1TB6H 4X2YA 1J15A 1Z8RA 1C9PA 1V2ST 5CMXH 1NFXA 3RXUA 2ANKH 1C5MD 1LVMA 1RIWC 2H2ZA 1JRSA 3GY7A 3MMGA 4F4OC 3F9EA 1QL7A 2P95A 1CSOE 2NU2E 1TABE 3NKKA 3A80A 3UR6A 3F9HA 3T26A 2JKHA 2OBOA 3M61U 2VWMA 2ZHQH 3SZNA 2ZU3A 1FI8A 1CE5A 1ANCA 1YPGH 1RGQA 2FEQH 5ESTE 3SNBA 4KTCA 1BCUH 1GJ9B 5T3HA 1GBDA 3LKWA 3BSQA 4I33A 2PTNA 5GJ4B 1NRNH 1HRTH 4ISHH 1KY9A 2BVSH 2FWWA 2P3TB 1A7SA 3NXPA 3QUMP 1HIAA 1HAVB 1OWKA 1HAGE 1SQTA 1GHVH 2FX6A 4I8GA 1KXCA 3SJIA 3RC5A 5F8TA 1LHDH 3BTEE 1BMNH 4JZ1A 1BTPA 4NIYA 1EAUA 1OWIA 2QF0A 1EZQA 1V2WT 1BA8B 2Y5HA 2A31A 4NA8A 1NO9H 2A0QB 2FOHA 1CA0B 1TIOA 2J92A 3SORA 3S9BA 1CBWB 2CJIA 4AFQA 3MU8A 1D3QB 1UTOA 1AE5A 1K1IA 1A0JA 1PFXC 1XUIA 1C5UA 2J34A 2CGAA 1AVGH 5AVDA 5C3NA 1YYY1 5A0BA 3RLYH 1P2OA 2GV6A 3CS7A 1AMHA 1DITH 1GI3A 3RMLH 4CRCA 4GUXA 1GCTC 2GDEH 1SLVB 2V35A 1C5VA 3M5OA 4NSVA 2G8TA 1FAKH 2BHGA 4I8KA 1CT2E 1FUJA 2D2DA 2G4UA 1GI0A 4X1QU 2B5TB 1BRUP 2UWOA 4WMEA 1P3CA 2Y7XA 2Q6GA 2AGEX 3ZVAA 1IHSH 2ZP0H 3ZVGA 1LPGB 3RXPA 2ZDVH 4H4FA 2R3UA 4BAQB 1JBUH 4DOQA 1NESE 4ABBA 1OPHB 4YLQH 1SLWB 2BQWB 1PYTC 1NTPA 1UTPA 1QB9A 2ODPA 2WUBA 4FUIA 3DFLA 3P92A 4Z6AH 4TWWA 2AMQA 3LIWA 3PLPA 1AKSA 1UTJA 1HLTH 1O2QA 2W3IA 3BEIB 2TRMA 2BX3A 3SU5A 1DY8A 5EXLA 2W26A 5GCHF 3GY4A 5DO4H 2BDBA 1L2EA 3SUEA 2GZ8A 4BTIB 2Z9JA 5GDSH 1C2FA 1V2LT 2OQUA 1NC6A 4B1TA 1FONA 3PMHB 2IJOB 2UUKB 4CHAC 1C1SA 3CENA 1AB9B 1QBNA 1AE8H 1SC8U 2F9NA 2PR3A 3TU7H 1AVWA 2ZHDA 1CGHA 2WPJS 2TGPZ 1RD3B 1RTLA 3A7TA 3A83A 2OUAA 3TK9A 2KAIB 1D6RA 1O2ZA 7LPRA 1EJNA 5L6NH 4MPUA 2XRCA 3F68H 1TGNA 3P8OA 1TQ7B 4DJZB 4ZKNU 4MVNA 2FM2A 1HFDA 2BDYA 2AMPA 2OLGA 4X6PA 4WY3A 1FQ3A 1QJ1B 2ALVA 2GMTB 1DOJA 3GCHB 4X0WU 1C1RA 1GBAA 2ZG0H 4UD9H 1E0FD 3TVJB 1T7CA 1UO6A 3LONA 2Y5GA 3M7TA 1Y5AT 3UWJH 1S0RA 2C8YB 4K1SA 5ETXA 4R0IA 3E8LA 1DANH 1SR5C 4TYDA 1SBWA 4ABEA 1GDUA 1KXEA 1O2UA 2R2MB 4O03A 2TGAA 1O5CB 1J16A 4JZIA 3D23A 1BBRE 2A1DB 1O2JA 4BXSA 3SV9A 1TRNA 3RXVA 3U8OH 3V13A 1MH0A 2SGFE 2TIOA 1SVPA 2FOEA 4DVAU 1YPJH 5AFYH 5F8ZA 4AZ2B 3VPKA 3PMJA 4AB8A 4WWYA 1SFQB 1DLKB 1HAVA 5A2MH 1P01A 1DDJA 1SQOA 1Z7KA 2QXJA 1AVXA 4WXVA 4J1YA 5AFZH 1H9LB 5A09A 3TIUA 1ZHRA 1UHBB 4X8TH 2AS9A 2ZI2H 2JETC 1GI1A 1ZOMA 3ATKA 2CF8H 1O3MA 1PPFE 1Y3VA 1IHTH 1O3LA 3UOUA 1TBZH 4TY6A 1A3BH 1ELGA 1ESAA 3MI4A 1CO7E 3P95A 4Q7XA 4K69A 3VGCC 4CRAA 2H5CA 3AAUA 5JBAS 1T8MA 1O3OA 5GWZA 4AORA 4RSPA 1HAOH 1A5GH 3I29A 1LTOA 4YLUA 1YCPM 3ZV8A 2BX4A 4GPGA 1C2GA 1SGFA 4ZKSU 3B8JA 1HJ8A 2OD3B 1C2HA 1FY8E 4UDWH 3PV4A 1NN6A 4Q7ZA 2EC9H 3LGIA 1C2DA 3S9AA 1GGDB 2C8WB 4GAWA 4FUCA 2RG3A 3U69H 4A1XA 4LXBH 4ABJA 1VJ9U 1DX5M 1UTNA 4NA7A 3KEEA 4DW2U 1H9IE 4NIVA 3VXFH 1GBMA 1EXFA 1HXFH 4D8NA 1ANBA 1EPTB 1ZLRA 3Q77A 1NRPH 2A32A 3BG4C 1EQ9A 3ZZ8A 1H8IH 1F0SA 2F3CE 2CMYA 1CA8B 2HGTH 4ZXYH 4E05H 1HB0B 1O3HA 1P57B 1QQUA 4B73A 4NFEA 4B2BA 4I31A 2EEKA 1K1MA 1FY4A 3M7UA 1FPHH 3SO3A 2C8ZB 3RXCA 2XC4A 1ORFA 1G37A 2PUXB 4O3UA 1QURH 4FVBA 3H7OA 5FCKA 2ALPA 2BVRH 4KP0A 1EAIA 2YNAA 4K1TA 4YT6H 1NFYA 1Z71A 1LHFH 1DSUA 1EOJA 1GHAG 1RXPA 3TJUA 4A92A 3EA8A 1DWBH 5EG4A 4BNRA 1AD8H 1GHBG 1TX8A 1G9IE 2FXRA 2GZ9A 5J4SA 1SSXA 2WUCA 4X1RU 4Y6DA 1HAYB 1RS0A 2BD2A 1F5RA 1INCA 2Y81A 1QL8A 1V2NT 2VIOA 2ZTYA 3C1KA 2WV5A 4BTTB 1O2RA 3ODDA 2RCEA 1XXFA 4FUJA 2HRVA 4UEHH 1CA0C 4ZXXH 2GCTB 4DIHH 1O31A 5TCAA 1TGTA 5K0HA 1TE0A 2NU1E 2VWLA 1OS8A 3PM3A 3QWCH 1BITA 3RXQA 2Z94A 4YO9A 4JYTA 2BOKA 1S84A 1QRZA 2XTTB 2Y5FA 3A88A 2A5KA 3GCTG 3H5CB 1O3NA 1ESBA 4ISNA 5TJXA 4BXWA 4RKJB 3F6UH 2BVXH 5F6MA 1ETSH 1P8VC 2PSXA 2UUJB 2ZDAH 1AWFH 1LCYA 1ELEE 2C90B 2CF9H 1SHYA 3ZZ6A 4NWKA 1EKBB 1T8LA 4ZROA 4Y0ZE 5I25A 1NT1A 3RU4E 1CHOG 4GSOA 1ESTA 4JZFH 1DUAA 2P3FH 6GCHG 1MAYA 2H9TH 5JBCS 3LC5A