3VPKA

Crystal structure of 6-guanidinohexanoyl trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 6-guanidinohexanoyl trypsin near the optimum pH reveals the acyl-enzyme intermediate to be deacylated
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vpkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vpkA02
1HJAC 2P93A 2BQ6B 3SQHE 1O3MA 4Y8YA 1GGDC 1KXFA 1SGTA 4D9QA 2STBE 2XCNA 2O8UA 1CHOF 1HFDA 4CH8B 3LGTA 4YOIA 1C1WH 4X8SH 1TPOA 1HAZB 1SG8B 3H7OA 4DURA 3O8DA 4ISHH 1CU1A 2BLVA 1MTSA 2OC0A 5EW1H 2A0QB 1LVOA 1EZUC 1IQNA 2ANWA 1GG6C 3SU5A 4ABHA 1KLTA 5L6NH 1GBHA 4LZ1H 2I6QA 3RXKA 2Z3EA 1FPCH 2XCFA 1G32B 1P57B 1P0SH 2OQ5A 4ZKOU 3M7QA 3TNSA 4X6MA 1C1TA 3SV7A 2J38A 4UD9H 2FOCA 1FUJA 4UFDH 1UJ1A 1MD7A 1PPFE 2GCHG 3HPTB 3RXTA 3UREA 5EQQA 4KTCA 1KIGH 1C5LH 3ODDA 4X0WU 3TH3H 3RXSA 3BTHE 1FAKH 3U8OH 1QGFA 2BDGA 5DKMA 1WQSA 1SFIA 2TGTA 3Q77A 4I8JA 1YPJH 2BY5X 4ZHAA 1GVKB 4BTIB 1OWJA 1UHBB 1HV7A 1MAXA 1C2HA 1PQ5A 1AWFH 1NY22 2FOBA 1NRPH 1C2IA 4MNXA 1GBAA 3EGKH 3UNRA 3KQEA 1W3CA 3ZZ7A 4ZXXH 4A6LA 2ANKH 1Y3VA 1C9PA 3GISB 1QTFA 1D4PB 5F6MA 1MBQA 2OC7A 3JZ2B 5CMXH 1KTSB 2ZPQA 1V3XA 5FCKA 3LPRA 5JB9S 4MPUA 1XUJA 1BTPA 1K1LA 2NWNA 4QT8C 1K1JA 1TONA 3KHVA 1EAIA 2AH4X 2ZCHP 2A7JA 2BLWA 2HGTH 1NN6A 1D9IA 1O34A 1BBRH 1SMFE 1EZQA 1TA6A 4BNRA 1WTHD 2BD5A 2IN2A 2HRVA 1ESBA 2CMYA 2VWLA 1LHDH 4GAWA 2EI7A 2BZAA 1VJ9U 2GT7A 3PLKA 3PM3A 1GMCF 2FDAA 2HWLB 4PROA 2GCTB 1SC8U 1N1LA 1PPBH 1HJAB 3I78A 3UFAA 2FPZA 2OUAA 3S7KB 5HGGA 2ZFQH 5F8XA 3P8FA 1ANDA 1TRMA 2D26C 1F92A 5C67A 1ZRKA 4FVBA 4ABGA 5AF9H 2QYIA 1PYTC 1UMAH 1DXPA 3SOSA 1HBTH 2XBXA 1ARBA 5JBBS 1DLKB 3SGBE 2ALVA 3AASA 3Q00A 3C1KA 5JBCS 4XBDA 3BV9B 2THFB 5GWZA 2ZDVH 4Y6DA 1TGSZ 5TJXA 1ELTA 2C93B 3MTYA 1KY9A 1TMBH 2BVSH 3SU4A 1HXFH 2BD3A 3MH5A 4H42U 5EXLA 3RXLA 2PR3A 3ATKA 6GCHF 4NGAH 2AYWA 2BY9X 4NA7A 1TMTH 1XUKA 5GCHF 1G3DA 3F1SB 2BQWB 3CENA 4X6PA 3DD2H 1QR3E 3UQOA 2ZU3A 1C5XB 3BTQE 5DG6A 2H5DA 2WV4A 4OS7A 3SJIA 2CXVA 1LPZB 1E35B 5A09A 2P16A 4MNVA 1C4Y2 4I32A 2VINA 3EA8A 5DP7A 1XXDA 1GCDA 3NK8A 5DP4A 2B7DH 1F0UA 5FPSA 4H6SB 2XBYA 4CRFA 4A1XA 1GMDF 1O36A 3EA7A 1THPB 1S82A 1OYTH 2FOFA 3VB7A 2VIQA 3A83A 4Y71A 2G52A 3R0FA 3VFEA 2A5IA 1ACBE 2EI8A 2IOTA 1O2ZA 1O5CB 5DJ7A 2HOBA 1AFEH 3UR9A 3G01A 3UOPA 1EPTC 4RKJB 2J34A 4B1TA 1BT7A 1O3HA 1U6QA 1ZPZA 3ATWA 1NFWA 2VH6A 4NG9H 1B0FA 2EC9H 4NCYA 1KDQA 1F5LA 1LVYA 2WPJS 3QZRA 4FUGA 1XUGA 3D49H 4MPVA 1GI7B 1AQ7A 2AIQA 1VCWA 2FX4A 2IPHA 1WYKA 1AZZA 1WTGH 2GV6A 4CRBA 1TGCA 2XBVA 2F9UA 3QN7A 1SGPE 2P3TB 4YLQH 2Y5GA 1BTHH 1HCGA 1MKWH 1UTLM 1XXFA 2TBSA 1TNJA 1A0LA 2R9PA 1LVBA 4F4OC 1A5GH 2CF8H 4X8VH 1J9CH 1S0QA 1H8DH 1DS2E 3RXMA 1LPKB 2CHAB 5EOKA 4NFEA 2FEQH 1J17T 2EEKA 1QBNA 4X2XA 3M35A 1CBWC 2VWNA 3VPKA 2WPHS 5EW2H 2UUYA 1OOKB 4CHAC 2P8OB 1K1MA 1MCTA 1O3JA 1O5FH 1O2WA 1AB9B 1QFKH 4OS5A 4XDEA 5AHGH 2FI4E 1BTUA 1YM0A 1C5YB 1O3FA 4WXIA 2FOMB 1UVPA 3MNCA 3UY9A 2VJ1A 4LOYH 1NZQH 5FAHA 1O37A 1NFXA 2W5EA 1XKAC 2H9EH 1NTPA 1FZZA 3RXRA 1K22H 2GP9B 1HGTH 3LJJA 4K69A 3QX5H 3LGYA 1OSSA 1KXCA 2VIDA 5TCCA 1FDPA 1TX7A 1DLEA 1V6DA 1HAVA 2R2MB 2ZU2A 4RSPA 4AG2A 2ZGJA 4YLUA 4CBOA 2O8MA 3RU4T 4D8NA 2SGPE 1IQEA 2PTCE 3PTNA 1SOZA 5T3HA 2CF9H 3SV6A 3HK3B 3A89A 1ELAA 5JDUB 3TH2H 3ZVFA 3BG8A 4NA9H 2P94A 1O2OA 1BHXF 3SUDA 2G00A 3TK6A 4B2AA 4IGDA 2VVVA 1IQIA 4WH6A 1XVOA 4ISOA 2VH0A 2GD4B 4VGCB 4X6NA 1Z6JH 3F9HA 1Y59T 3MU8A 1C2LA 3RMNH 1O5AB 3P17H 2ZDKA 1T8LA 3U1IB 3SU2A 1AFQB 3QK1A 2ZP0H 1ZYOA 1O30A 1GDNA 1PPCE 2GKVE 1F5KU 1ZSLA 3NXPA 1UHBA 2STAE 5E0JA 5A2MH 3L3TA 1BRBE 4AYVB 5GXPA 2GDDA 3K65B 4Q2KA 3NPSA 1YPHC 2ZECA 4A7IB 5A0BA 2GZ7A 3RU4E 1OWDA 1S83A 1LHGH 1O2VA 3LC5A 1HAGE 3RXGA 3HGNA 1YPHE 3HKIB 3LJOA 1V2ST 1YKTA 1AFQC 5L2YH 1UTOA 2Z9IA 1SGNE 1FLEE 1A4WH 2VIPA 3P8OA 1O2MA 4IN1A 3NKKA 1MTWA 3EDXB 3L6PA 2XYAA 4XFQA 1IAUA 3RU4D 3RXUA 1GBBA 1W2KH 2D2DA 3ZYDA 3UWJH 2K1QA 5I25A 1SSXA 2VIOA 4AFQA 2BD8A 2VWOA 3BTFE 1QRXA 1P11E 2ANMH 3E0PB 1A3BH 1VGCB 3QDZB 1UTQA 3MWIU 1NC6A 2BTCE 1WV7H 1GJAB 4O97A 4MPXA 4AB8A 2P3UB 2PHBA 1RFNA 4B2CA 5A8XA 1MTNC 1J15A 1V2PT 3TU7H 1UVTH 1GDUA 1PYTD 2H9HA 3E91A 5LGOA 3JZ1B 2FI5E 4ABDA 2JETB 1B5GH 2FYRA 4WXVA 3S69A 1P03A 3M36A 1ZPCA 1NM6A 3GCNA 3IWMA 1Y8TA 3M61U 4GHTA 3RXQA 2FS9A 2BXTH 4Y0ZE 4GUXA 2GMTB 3A7TA 1PJPA 1GHZA 1TNGA 1CVWH 1C2EA 8KME2 2A4QA 4KGAA 5K7RA 2WINI 1O2PA 2PSYA 1GMCG 3RXIA 1GJ8B 4KKDA 1BOQA 7LPRA 1P2IA 5FBIA 1DANH 1TBRH 1TPSA 2VVUA 3O8RA 1TGBA 3F6UH 1W11U 1O2LA 3SNCA 2WUBA 4X2VA 1GHAF 3MU4A 1RTLA 1CSOE 2SGAA 3ITIA 3R3GB 1O0DH 1IHTH 4GSOA 2ZWLH 1Z8JB 5E2OA 1O2XA 4I33A 1O3BA 3SU0A 1ZJKA 1IQHA 1SLXB 1PPZA 4OS6A 4IBLH 1MMJN 3I29A 3W94A 3ZVGA 1VJAU 4ZROA 2OP9A 1EP6A 1AWHB 2WV5A 1ZTLA 4MDSA 1AMHA 1O3DA 1EX3A 3M3TA 3TH4H 2F9BH 1LTOA 3P70B 3FVFB 3T27A 1D6WA 2XWBI 3GCOA 5EODA 2BZ6H 7GCHF 1GBJA 1T8OA 2PW8H 2HPPH 2PKAA 1G37A 1GBCA 1D3QB 3FAOA 1ESAA 2YNAA 1N6XA 1O5EH 1HDTH 4JYUH 5GPIB 1P9SA 1SGIB 2W3IA 1G3CA 1ELVA 1GMHG 4IS5A 5C20A 2Y5HA 1S6HA 1Q3XA 3RXHA 1GJ6A 1N8OC 1FI8A 3RXVA 1KSNA 4JYVH 3E8LA 4ISLA 3UNQA 3CS7A 2ODQA 1EB2A 5HXFA 3ATLA 1AZ8A 3LGVA 1QBOA 3BN9A 3EQ0H 4SGBE 5CHAC 3BTWE 1X7AC 1NU9A 1VCQA 3T5FH 4BANB 1ESTA 1NS3A 3KQCA 3KQDA 2ANYA 3A81A 3LT3A 4ZHLU 3KGPA 1FN8A 2SNWA 1F0RA 2DUCA 2FOHA 1PQ8A 1LQEA 1P2NA 1GHAG 1PFXC 1P3EA 1BMMH 2WPLS 3V0XA 3F9EA 4Y76A 3D65E 1UK4A 3DT0H 2Y7ZA 2C4FH 1AI8H 2BYAX 1DUEA 1EXFA 4BAKB 1AVXA 3MH6A 5F03A 5BRRE 3ZZ4A 1DE7H 2FOEA 1MTUA 1GBMA 3FP6E 3RC6A 1TQ0B 3ZYEA 1O2IA 1DPOA 2ZHEH 3AW1A 2ESTE 1CO7E 2ZGHA 5TCAA 2IJOB 2Y5FA 2ZHWH 3SBKA 4D7GA 1B0EA 1LQDB 2QN5T 2V3OH 1YF4A 1DWBH 3TGIE 1KXAA 2FP7B 1JRSA 4BAQB 1O3IA 5H4IB 3URCA 2BDBA 1TA2A 3TITA 2NU4E 2ZCLP 1ZOMA 2F9OA 3QZQA 2PUXB 1EATA 1EASA 1HYLA 1QA7A 4BAOB 4CRCA 3DFLA 2CHAC 1HAPH 2ODPA 1YBWA 1C5RA 2W26A 3CS0A 1DM4B 1YPMH 1BQYA 2G51A 1QY6A 2AERH 3DFJA 1P3CA 2PFEA 4OGYA 4Y79A 3V12A 1BRAA 1GMHF 2VB0A 3BG4C 1GI1A 1O3LA 1MQ5A 4UFEH 1A61H 2XW9A 1RJXB 4XOJA 3UTUH 5AVDA 2OLGA 2B9LA 1IQGA 4YM9A 2R3YA 2RG3A 1C1NA 1GL1A 1AVWA 1ZJDA 1C1MA 3M3VA 1SB1H 2OC1A 4IC5A 1S84A 2UWOA 1E38B 1K1PA 2BLOA 4MNWA 4ZKNU 2C8ZB 5E8EH 4Y11E 1AUJA 3VEQB 1DDJA 4BAMB 1YPKH 5DP9A 4A92A 1OX1A 1F0SA 1V2QT 3EA9A 1NO9H 4YT6H 1HAYB 1HAIH 2ZPSA 4GCHF 1V2OT 9ESTA 4Q80A 3MH4A 2XC0A 3KEEA 4ZAEA 1O2GH 2J94A 3SGAE 1GJDB 3WY8A 1P09A 1C5TA 4K1SA 2OBQA 2V6NA 4NFFA 2Q6FA 1GBTA 1XVMA 1G3EA 1W14U 1GPZA 2A5AA 1TQ7B 2ZKSA 1IQJA 5EXNA 1FY4A 3FZDA 2ZEBA 2BY6X 1SLVB 3RXJA 1ZTJA 2ZG0H 1LMWB 4UFGH 1Y3UA 3A7YA 1CA8B 3LKWA 1O3GA 4FU8A 4XE4A 2BDIA 4JZEH 4KELA 1FY8E 2C90B 1P2KA 2H2ZA 3O8BA 3MNXA 2BDAA 1KLIH 1GI6A 3STIA 3KIDU 1L1JA 4AYYB 1GBKA 1BMNH 3F68H 4O3TA 1CGHA 1JBUH 2R0LA 2RCEA 3PB1E 4IMQA 1ZMLA 3KL6A 2P3FH 4ABJA 4I8GA 1O2RA 4D7FA 3U98H 3BEUA 3P92A 4FUFA 1TBZH 1RTFB 3GY4A 2Y81A 1CT4E 1P05A 1P8VC 4JMYA 4B74A 2Z3CA 2FS8A 5FPTA 3KN2A 2HLCA 2GDEH 1TIOA 1UCYE 2ZF0H 4I8LA 3SNDA 4A5TS 2F91A 1YPEH 3Q3KA 6ESTA 1C5WB 1JOUB 3GDVA 3AAVA 1NRSH 1EOLA 4Y8ZA 2ZFSA 5A0CA 2O8WA 4BXSA 1T7CA 2BMGB 3UQVA 2OC8A 3Q3XA 2JKHA 3BTME 3ZZ8A 5EPYA 4NSVA 1V2MT 1Y5UT 3GY3A 3ZZ5A 1LHFH 2AGGX 4YZUA 4Y0YE 1MBMA 1KDQB 2SFAA 3VB6A 1GBEA 1QJ1B 1BRUP 1DWCH 3K6ZA 1YYY1 1P10A 4NZQA 2HNTE 3A8CA 5FPYA 1OKXA 1P04A 3Q3YA 2Z7FE 4THNH 1BZXE 1RRKA 1ABJH 1F0TA 1S85A 1UTKA 4ABBA 1CE5A 3GOVB 3TJOA 4IMZA 2SNVA 1LO6A 3NUMA 3LIWA 1NFYA 1OP2A 3PLBA 2PUQH 3RC4A 1W7GH 2LNCA 4HZHA 1C1RA 1UTJA 7ESTE 1OPHB 1SR5C 1WU1A 3TLOA 4F49A 4INLA 3QUMP 1DUAA 2WYJA 1D6RA 2NU0E 3I77A 2A31A 4U32A 4B75A 3UNSA 1C2DA 2P8OC 5L2ZH 1QB1A 3BF6H 3PO1B 3E90B 3SNBA 1C5UA 1WUNH 1CA0C 1MH0A 3TGJE 5EQSA 2VGCB 3KNXA 3V3MA 2QCYA 6CHAC 6GCHG 2G5VA 4K3JA 2GGVB 1HB0B 1EAWA 1F5RA 3Q76A 5EGMA 3BEFB 3MO3A 2PGQB 3HGPA 1BTZA 4GHQA 1XKBC 2OD3B 3M5NA 2FTMA 2R0KA 4ZKSU 3SN8A 4AGJA 2FXRA 3T26A 1G36A 3TGKE 3URDA 1JIRA 1EUFA 2ZA5A 3RLWH 1G2LA 1SHHB 5EXMA 1QCPA 3TJVA 2VVCA 4ABFA 1SGEE 2BXUH 3S9BA 1LCYA 1GMDG 1UK3A 2AGIX 3A8BA 1PQAA 4AFSA 2AMQA 1SGQE 3SO3A 4O3UA 3KCGH 1NESE 1HRTH 4Y7BA 1IQMA 1SVPA 2XXLA 3QGJA 2QXGA 2A4GA 5C1XA 1EZSC 5DK1A 2FZZA 1O3OA 3RM0H 1G30B 4KP0A 4AX9H 4X1PU 1INCA 2FWWA 2R2WU 1DWEH 1SGFA 3OY5U 4NSYA 4B76A 8ESTE 1VITH 3A7WA 1QIXB 1AY6H 1H9IE 4UFFH 3W95A 2B8OH 1HLTH 3VGCB 5ETXA 1YPLH 3A87A 4K1TA 4A1TA 1QL9A 6LPRA 4Y10E 1GI8B 1V2LT 1GBFA 2G5NA 3MNSA 4JYTA 3O8CA 3ODFA 3VGCC 1FAXA 1ZSKA 2C8YB 2BLQA 2FIRH 2ZCKP 2BX4A 1J14A 1SQAA 4ZXYH 4DCDA 1K1OA 3TJUA 3SNAA 1P2JA 3UIRA 1BCUH 1QRWA 2F9PA 2A4OA 1KXEA 1J16A 4DG4A 1TOCB 2UWPA 1HPGA 4I31A 3RXFA 3TK9A 1Y5AT 1O5GH 2J2UA 3TNTA 4VGCC 1GGDB 2ZGCA 2OCVB 2ODYB 2G81E 2ZDNA 3HKJB 4M7GA 4XSKU 4ZMAH 1NFUA 1YCPH 2HNTC 3MH7A 2H1UA 4CRGA 4XBCA 3QLPH 1SLWB 2A2XH 1G9IE 2YOLA 2Y6TA 3HK6B 3MMGA 1TALA 2VWMA 3SW2B 3BTTE 3SU6A 1GI2A 1O2QA 4Z6AH 4H4FA 1UTMA 2G8TA 5PTPA 1O2SA 1ZHRA 4U01A 4X1NU 1VZQH 1QQ4A 1ZHMA 1L0ZA 4AGKA 1HAVB 1EJAA 2QIQA 3ZZDA 5DGJA 3IITA 1EKBB 1RIWB 1TNLA 2RDLA 5GCHG 4WMFA 1TPAE 2ZPRA 1TX8A 2RA0A 1C9TA 1UTNA 3RXCA 1BMAA 5ABWA 1WCZA 1VR1H 1QHRB 1DT2A 3VB3A 2AFQB 2I6SA 3LH3A 3RXBA 5CE1A 1MKXK 3LC3A 1Z6EA 3P8NA 2XTTB 1QRZA 2OXSA 3SV9A 3ZZCA 5HM9A 3A8DA 2FODA 1Y3WA 1PPGE 2BHGA 4K1EA 1BIOA 5DO4H 4XBBA 1TX6A 1TPPA 1AU8A 3MYWA 1GBIA 3T2NA 3SUFA 1DOJA 3SI4H 2F83A 1FY5A 2BY8X 5DP8A 1ZR0A 4CRAA 3A88A 1GJCB 2J4IA 1K21H 1A5IA 1CHOG 2BX3A 4BTUB 3P95A 5C5NA 4DIIH 3E0NB 3RUOA 3T25A 3T62A 3LGIA 3U9AH 2PSXA 1Z8IB 2GCHF 1O31A 1O3KA 4X1RU 1O2NA 3H5CB 5T6FA 4FXGH 1P2QA 5B6OA 3LONA 4Y8XA 1C5QA 1O5BB 3SHCH 2PLXA 3M5MA 2XRCA 4MPWA 1QA0A 1GBLA 3PWCA 1A2CH 1UCYH 1VGCC 1W8BH 3GY8A 3QO6A 1L4ZA 1SL3A 5FX5A 2D8WA 2ZTYA 1DY8A 1ELBA 2HNTF 1ETTH 1DWDH 1FV9A 1AIXH 4U2WA 3RXDA 3UOUA 1RIWC 3A86A 5EPNA 1A7SA 4DW2U 1D3DB 3GCHC 3SUEA 3RMMH 4GLYA 3BTKE 4R8TB 1SQOA 1RGQA 1GHVH 2DE9A 1ELCA 1ELDE 4MLFB 1GI9B 3RXOA 2O8LA 4HTCH 2V35A 1HAXB 1UVSH 2AS9A 1VCPA 2Z9KA 2W7SA 4NWKA 1FIWA 3F9GA 1FQ3A 3E1XB 1LKAA 4FU9A 1L1NA 1HJ8A 2QF3A 3OYPA 4X2YA 1M9UA 1O3EA 1O2KA 1DY9A 2OINA 2VIVA 1SOTA 1HJ9A 1V2WT 2UUJB 3PTBA 3ZZ9A 1Z1IA 1TNHA 3A84A 1T8MA 1UTPA 1ZTKA 1GHBG 5GIBA 3F9FA 4WVPE 4B2BA 4U30A 2BY7X 1C5SA 2D1JA 1OP0A 3SUGA 2ZHQH 1ELFA 1TE0A 4IW4E 4CR5A 2G4UA 2UUFB 1MQ6A 4CREA 5GJ4B 4GVUA 1C5NH 1UCYK 2H9TH 1SGFG 2ZTZA 2ZFFH 3OU0A 1MKWK 1BTWA 3OX7U 1KYNA 3RC5A 1JRTA 1TWXB 1O3PB 1SHYA 2Z9LA 5EQRA 2GTBA 3M5OA 4NWLA 5J4SA 4ABAA 1K1IA 1IQFA 3FP7E 1BTXA 1IQLA 2B0FA 3QWCH 1F7ZA 1AKSB 3AAUA 4X2WA 3RP2A 1YGCH 2AEIH 1NROH 2ZU4A 1Z8RA 4K5ZA 3ELAH 4AORA 1FXYA 1TLDA 1Y3YA 1MUEB 1ANBA 2ZGBH 5LH8A 3RDZA 4JZDH 4YT7H 3U69H 2BM2A 1PPEE 2BD2A 3M3SA 3FFGA 1RS0A 1V2UT 2Z6BD 2R3UA 4Q7YA 3L33A 1DSTA 3LGWA 2QV1A 3GY7A 3RLYH 1MTNB 4UONA 2LPRA 3K6YA 3ZZAA 1GJBB 1JXPA 2V0BA 2XC5A 1N8OB 3SORA 1PQ7A 4ISIH 4OS2A 3QTVH 1MKXH 1OWKA 4E05H 1UO6A 1O32A 1ETSH 5CHAB 2BOKA 2J95A 2OQUA 1KLJH 1MD8A 3BTDE 3GICB 4JZFH 1WOFA 2YNBA 1C5VA 3SU3A 1SQTA 4CBNA 8GCHF 3BTGE 4MNYA 1XM1A 2F3CE 4FUIA 5FX6A 5JBAS 1AE8H 1YC0A 1L4DA 3U8TH 5A8YA 5FBEA 1V2JT 3ESTA 2RA3A 1C5ZB 3VXEH 1W7XH 1QB9A 4H6TA 1YCPK 4JZIA 3K9XB 4O9VA 2HPQH 2A45B 2UWLA 4D76A 4INHA 4JK5A 3RM2H 2JETC 2M5TA 1K1NA 3M37A 5BPEA 1O35A 1RD3B 2XBWA 1D3TB 2TPIZ 4MG3A 4AFZA 1FY3A 1EB1H 1LHEH 2FO9A 4NIYA 1IHSH 2PKSC 3BIVH 3A7XA 4WMDA 3SGQE 1FNIA 3VB4A 2C8WB 4X6OA 4BAHB 1V2RT 1C5MD 1BITA 1CBWB 4FUEA 1TRNA 1SGRE 2JH6D 1TGNA 5F8TA 1MU8B 4TYDA 4CHAB 1T4UH 1E36B 5FHTA 3SJ9A 3SHAH 3PMHB 1ORFA 4Y7AA 1DX5M 5G4BA 3SV8A 3ZV9A 1WAYB 2SGDE 4TPIZ 1GJ9B 4FUJA 3ENSB 1YCPM 2ZFPH 1H9LB 1TB6H 1S5SA 2GVFA 4AN7A 1BMLA 3E6PH 2PKAB 2OTVA 1O33A 4MTBA 1TNIA 2ZHFH 1UVUH 2WPMS 1T8NA 1EJMA 1S0RA 3QGNB 1IQKA 1BHXB 1C1VH 1QNJA 1ELEE 3ATIA 3MU0A 2VGCC 1NRNH 7GCHG 4LK4A 2FOAA 3SJOA 2FESH 1QURH 2BD9A 2QGRA 1CT2E 5JPMH 1ANCA 1W0YH 2FYQA 3ZVEA 4MVNA 2BDHA 3EE0B 3UWIA 1GDQA 1GCTC 1EPTB 1BJUA 1AB9C 1C2MA 1AGJA 3B8JA 2W3KA 5LPEA 1AUTC 5ESBA 1GBDA 1GVLA 2GV7A 2CJIA 3M7UA 3ZVCA 1QB6A 3MHWU 2O9QA 1FY1A 5JBTA 5E0GA 1XX9A 4SGAE 4E7RG 3TVJB 2PGBB 2Z9JA 3PV4A 4ABEA 1D3PB 1GHBF 5LPFA 4KTUA 2GCTC 1TOMH 2P95A 4AB9A 1FIZA 2QY0B 3RMLH 2PV9B 1L2EA 2FX6A 4WWYA 3RXAA 2ZIQH 2A1DB 1RXPA 3EYDA 1C1PA 1UK2A 1C5OH 2HVXA 3RMOH 1V2TT 2FI3E 1C4U2 1A5HA 3LH1A 2BDYA 4ASHA 2ZDLA 1TNKA 1OS8A 4DY7B 1C2JA 1TAWA 4CH2B 2G4TA 1DITH 2F9NA 2ZDAH 1J8AA 2GMTC 2FTLE 3T29A 2QC2A 4BTTB 1GI3A 1C5PA 1SLUB 1FPHH 1T31A 3GCHB 4X8TH 1ZHPA 4TWWA 1T4VH 3ZZBA 3P8GA 3BG4B 3PO1C 1YPGH 8LPRA 3M7TA 5ESTE 4K2YA 1QL8A 1XUHA 1TGTA 1ZMJA 3ATMA 5IYTA 2TRMA 1T32A 1GI0A 1C2KA 5C1UA 1GWAA 1ZGVA 4WMEA 1AVGH 1AN1E 3PROA 4MQAA 1KXBA 1A46H 3SI3H 1A3EH 1W0ZU 4NA8A 2ZGXH 2ALPA 1LHCH 1BB0B 1QJ6B 4Z0KA 4TWYA 3DUXH 1DVAH 1OWHA 1E0FD 5F8ZA 1GI5A 2C3SA 2AMPA 1MTVA 3TIUA 2Z9GA 1K2I1 3A7VA 4OS4A 4HGCA 2BVRH 1FMGA 1G3BA 5LPRA 1FN6A 2ZQ1A 2QXJA 1BTYA 1SPJA 2EA3A 3BIUH 1GJ5H 5I46H 3BSQA 4X1SU 3ZVBA 4TY6A 5A0AE 5DP3A 1SI5H 1XUFA 2Y82A 5FXLA 1DSUA 1GL0E 2ZQ2A 3LGUA 4ESTE 1CHGA 2VNTA 1VITG 2VIWA 4TPYA 4BOHA 1XMNB 2FLBH 1IOEA 6CHAB 1LPGB 2B5TB 4ZH8A 1WSSH 1BUIA 3BEIB 5AFZH 5E2PA 5FCRA 4ZUHA 2OBOA 4GCHG 1O2JA 1H4WA 1H8IH 1TBQH 2DE8A 3A85A 3MFJA 4YESB 5IDKA 2CN0H 3TK5A 2Q1JA 4HFPB 2TGPZ 4TY7A 1A0JA 1SGYE 1BA8B 4A1VA 2CGAA 2WYGA 4IC6A 4K8BA 5DP6A 1EPTA 1YLCA 1A1RA 4AZ2B 4E06H 2BQ7B 4J2YB 2KAIB 1MZDA 3IG6B 2A7HA 4BXWA 2EI6A 2PKSB 1F2SE 1O38A 3P6ZB 1MAYA 2GZ8A 3GDSA 4WY3A 1CGJE 1E34B 1TFXA 4RN6A 1ZLRA 3S9AA 3A8AA 3UR6A 3KF2A 3FP8E 3E16B 3S9CA 2Z94A 2W7UA 3SJKA 4CRDA 2PTNA 3E3TA 1W12U 2NU1E 4NIXA 1GJ7B 3MO9A 1NU7B 3ZZ3A 1YLDA 4ISNA 1THRH 2QAAA 2ZTXA 1O2YA 4YTAA 2ZFRH 1BJVA 1QQUA 2Q6GA 4DJZB 2PWXA 3OSYA 1O2TA 1TRYA 2GX4A 3H7TA 2FOGA 5L30H 4WJG2 4YOGA 1SGCA 2ASUB 3D23A 2P59A 1HIAA 4X8UH 5JYIA 1OWEA 5C3NA 1OXGA 2TGAA 1C1SA 4B71A 1O3CA 1O3AA 4FU7A 5E0HA 1O5DH 2AGEX 4X1QU 2H5CA 1P9UA 1C2GA 1THSH 2WPKS 1EJNA 1DFPA 2FM2A 2ZZUH 1S6FA 2SGQE 2QA9E 1CGIE 1C1UH 1JIMA 2TIOA 2ZU1A 1NPMA 3B9FH 1GHYH 2GZ9A 1PPHE 3AVZA 4FUHA 3MI4A 3SZNA 1EP5A 2XWAA 1N6YA 2BD7A 4UEHH 1XUIA 3PWBA 1P06A 2Z3DA 1GG6B 4JCNA 1DXWA 3ZVDA 2JH0D 5DPAA 2SGEE 7KMEH 4NIWA 2G55A 1ZZZA 1P2MA 3HATH 2BDCA 1EOJA 1HAHH 4I8KA 1UVOA 4WH8A 5DP5A 1SBWA 2ZO3H 3S7HB 1B7XB 3GCTG 1KTTB 3GDUA 2KAIA 3S0NA 3MU5A 4NZLA 2Y7XA 2V3HH 2ULLA 1Y3XA 3MNBA 1HXEH 1K28D 3LOXA 4WF8A 4GPGA 3CP7A 4HI3A 3TPIZ 2QF0A 2AIPA 2ZC9H 4AOQA 1GJ4H 3OY6U 2VU8E 2BOHB 1O2HA 4FUCA 3SJ8A 4K8YA 4D9RA 1L1GA 3GY5A 2C8XB 3GYLB 3C27B 2A4RA 4JZ1A 2BVXH 1S81A 4UE7H 4ZKRU 1P02A 2BD4A 4IN2A 3SU1A 1Z71A 3V7TA 4B73A 1QL7A 3MOCA 5C2ZA 2Y80A 5J4QA 4YO9A 1QJ7B 1V2VT 4FUBA 1H9HE 1QBVH 1O3NA 1AKSA 4FVDA 2H6MA 1ID5H 1P12E 1C2FA 1JMOH 4Q7XA 1BBRK 1Y5BT 2SGFE 5JB8S 1GCTB 4Q7ZA 2ZDMA 1SGDE 1CQQA 1HUTH 4DT7B 1MZAA 1GHXH 2A2QH 4LXBH 4KTSA 1ZGIA 1Q31A 2A32A 3DA9B 1BDAA 2FLRH 2XC4A 1ABIH 4E7NA 3A80A 3NCLA 4RKOB 1NRQH 1HIAB 1ETRH 1MCVA 1TMUH 4ABIA 3ZVAA 1HNEE 3UPEA 1OYQA 1ANEA 3FZZA 5C1YA 3VXFH 5C5OA 1A0HB 1ELGA 4LZ4B 3PMJA 3DHKH 1LDTT 3FANA 1O39A 1EAXA 4DGJA 2AMDA 1TABE 2FMJA 8GCHG 3LDXH 4I7YH 2ZHDA 4K60A 1E37B 1NRRH 1AO5A 1MU6B 3PMAB 3RXEA 5EU8A 1GHWH 3SNEA 3MU1A 1Z7KA 5T6DA 3U1JB 3T28A 1AHTH 5HYOA 3N7OA 5K0HA 1VITF 3A82A 1GVZA 3GY6A 4DOQA 2ZI2H 3STJA 1K9OE 3PYHA 3GCTF 3UUZA 1BBRE 1C1OA 1ZPBA 2BB4A 2GT8A 1CT0E 2HALA 3K2UA 1LKBA 2J92A 2WUCA 1Z1JA 3QTOH 1C1QA 3M5LA 3RXPA 2QXIA 4YOJA 1EAUA 1TYNA 3ZV8A 1CA0B 1FJSA 1P2OA 3NWUA 2A5KA 3GYMA 2ZNKH 1ZMNA 2JH5D 5HM2A 4INKA 1AD8H 2UUKB 2ILNA 5EG4A 3VB5A 2F9VA 3GY2A 1W10U 1EQ9A 1ZRBA 1WBGB 1P01A 4I8HA 1HAOH 3BTEE 1RTKA 4NIVA 3V13A 2NU3E 9LPRA 1EZXC 1BRCE 3NZIA 4OS1A 2NU2E 1V2NT 5GDSH 1Q2WA 1SFQB 3ZZ6A 3EAJA 3PLPA 3A7ZA 2TGDA 3TJNA 1C4V2 1G2MA 3B23B 1V2KT 2O8TA 1YP9A 3AW0A 1AE5A 1KXDA 2Q6DA 4JK6A 4AG1A 1W13U 2WPIS 2QXHA 1ZSJA 1NT1A 1FONA 4DVAU 4R0IA 5T6GA 4J1YA 5SGAE 1JWTA 2ZU5A 5HMAA 2XNIA 4OGXA 1ARCA 1Z8GA 4CR9A 3SQEE 3LU9B 3SV2H 4O03A 3U8RH 3KQBA 3PMBB 1OP8A 4ZHMU 2A7CA 3MO6A 2ZFTA 3D62A 1H1BA 4DIHH 1LVMA 4FUDA 1WQVH 4AFUA 1OWIA 4UDWH 5AFYH 3OTJE 5A8ZA 1DICA 2J9NA 2CV3A 1GI4A 1O2UA
chains in the Genus database with same CATH superfamily
1HJAC 2P93A 2BQ6B 3SQHE 1O3MA 4Y8YA 1GGDC 1KXFA 1SGTA 4D9QA 2STBE 2XCNA 2O8UA 1CHOF 1HFDA 4CH8B 3LGTA 4YOIA 1C1WH 4X8SH 1TPOA 1HAZB 1SG8B 3H7OA 4DURA 3O8DA 4ISHH 1CU1A 2BLVA 1MTSA 2OC0A 5EW1H 2A0QB 1LVOA 1EZUC 1IQNA 2ANWA 1GG6C 3SU5A 4ABHA 1KLTA 5L6NH 1GBHA 4LZ1H 2I6QA 3RXKA 3OFND 2Z3EA 1FPCH 2XCFA 1G32B 1P57B 1P0SH 2OQ5A 4ZKOU 3M7QA 3TNSA 4X6MA 1C1TA 3SV7A 2J38A 4UD9H 2FOCA 1FUJA 4UFDH 1UJ1A 1MD7A 1PPFE 2GCHG 3N7EA 3HPTB 3RXTA 3UREA 5EQQA 2V3MA 2W6ID 4ZCNA 4KTCA 1KIGH 1C5LH 3ODDA 4X0WU 3TH3H 3RXSA 3BTHE 1FAKH 3U8OH 1QGFA 2PP6A 2BDGA 5DKMA 1WQSA 2RDEA 1SFIA 2TGTA 3Q77A 4I8JA 1YPJH 2BY5X 4ZHAA 1GVKB 4BTIB 1OWJA 1UHBB 1HV7A 1MAXA 1C2HA 1PQ5A 1AWFH 1WDIA 1NY22 2FOBA 1NRPH 1C2IA 4MNXA 1GBAA 3EGKH 3UNRA 3KQEA 1W3CA 3ZZ7A 4ZXXH 4A6LA 2ANKH 1Y3VA 1C9PA 3GISB 5EJLA 1QTFA 1D4PB 4RT0A 5F6MA 1MBQA 2OC7A 3JZ2B 5CMXH 1KTSB 2ZPQA 1V3XA 5FCKA 3LPRA 5JB9S 4MPUA 1XUJA 1BTPA 1K1LA 4M9FA 2NWNA 5EIYA 2L74A 1K1JA 1TONA 3KHVA 1EAIA 4QT8C 2AH4X 2ZCHP 2A7JA 2BLWA 2HGTH 1NN6A 1D9IA 1O34A 1BBRH 1SMFE 1EZQA 1TA6A 4BNRA 1WTHD 2BD5A 1YLNA 2IN2A 2HRVA 1ESBA 2CMYA 2VWLA 1LHDH 4GAWA 2EI7A 2BZAA 1VJ9U 2GT7A 3PLKA 3PM3A 1GMCF 2FDAA 2HWLB 4PROA 2GCTB 1SC8U 1N1LA 1PPBH 1HJAB 3I78A 5B6LA 3UFAA 2FPZA 2OUAA 3S7KB 5HGGA 2ZFQH 5F8XA 3P8FA 1ANDA 1TRMA 2D26C 1F92A 5C67A 1ZRKA 4FVBA 4ABGA 5AF9H 2QYIA 3KYFA 1PYTC 1UMAH 1DXPA 3SOSA 1HBTH 2XBXA 1ARBA 2XNDD 5JBBS 1DLKB 3SGBE 2ALVA 3AASA 3Q00A 3C1KA 5JBCS 4XBDA 3BV9B 2THFB 5GWZA 2ZDVH 4Y6DA 1TGSZ 5TJXA 1ELTA 2C93B 3MTYA 1KY9A 1TMBH 2BVSH 3SU4A 2K8IA 1HXFH 2BD3A 2JDID 3MH5A 4H42U 5EXLA 3RXLA 2PR3A 3ATKA 6GCHF 4NGAH 2AYWA 2BY9X 4NA7A 1TMTH 1XUKA 5GCHF 1G3DA 3F1SB 2BQWB 3CENA 4X6PA 3DD2H 1QR3E 3UQOA 2ZU3A 1C5XB 3BTQE 5DG6A 2H5DA 2WV4A 4OS7A 3SJIA 2CXVA 1LPZB 1E35B 5A09A 2P16A 4MNVA 1C4Y2 4I32A 2VINA 3EA8A 5DP7A 1XXDA 1GCDA 3NK8A 5DP4A 2B7DH 1F0UA 5FPSA 4H6SB 2XBYA 4CRFA 4TT3D 4A1XA 2OK5A 1GMDF 1O36A 3EA7A 1THPB 1S82A 1OYTH 2FOFA 3VB7A 2VIQA 3A83A 4Y71A 2G52A 3R0FA 3VFEA 2A5IA 1ACBE 2EI8A 2IOTA 1O2ZA 1O5CB 5DJ7A 2HOBA 1AFEH 3UR9A 3G01A 3UOPA 1EPTC 4RKJB 2J34A 4B1TA 1BT7A 1O3HA 1U6QA 1ZPZA 3ATWA 1NFWA 2VH6A 4NG9H 1B0FA 2EC9H 4NCYA 1KDQA 3GS9A 1F5LA 1LVYA 2WPJS 3QZRA 4FUGA 3N7DA 1XUGA 3D49H 4MPVA 1GI7B 1AQ7A 2AIQA 1VCWA 2FX4A 2IPHA 4Q63A 1WYKA 5FL7D 1AZZA 1WTGH 2GV6A 4CRBA 1TGCA 2XBVA 2F9UA 3QN7A 1SGPE 2P3TB 4YLQH 5C17A 2Y5GA 1BTHH 1HCGA 1MKWH 1UTLM 1XXFA 2TBSA 1TNJA 1E1QD 1A0LA 2R9PA 1LVBA 4F4OC 2WHXA 1A5GH 2CF8H 4X8VH 1J9CH 1S0QA 1H8DH 1DS2E 3RXMA 5DN6D 1LPKB 2GJGA 2CHAB 5EOKA 1NBME 4NFEA 2FEQH 1J17T 2EEKA 1QBNA 4X2XA 2WZQA 3M35A 1CBWC 2VWNA 3VPKA 2WPHS 5EW2H 2UUYA 1OOKB 4CHAC 2P8OB 1K1MA 1MCTA 1O3JA 1O5FH 1O2WA 1AB9B 1QFKH 4OS5A 4XDEA 5AHGH 2FI4E 1BTUA 1YM0A 1C5YB 1O3FA 4WXIA 2FOMB 1UVPA 3MNCA 3UY9A 2VJ1A 2CK3D 4LOYH 1NZQH 5FAHA 1O37A 1NFXA 2W5EA 1XKAC 2H9EH 2KCPA 1NTPA 1FZZA 3RXRA 1K22H 2GP9B 2VBCA 1HGTH 3LJJA 4K69A 3QX5H 3LGYA 1OSSA 1KXCA 2VIDA 5TCCA 1FDPA 1TX7A 1DLEA 1V6DA 1HAVA 2R2MB 2ZU2A 4RSPA 4AG2A 2ZGJA 4YLUA 4CBOA 2O8MA 3RU4T 4D8NA 2SGPE 1IQEA 2PTCE 3PTNA 1SOZA 5T3HA 2CF9H 3SV6A 3HK3B 3A89A 1ELAA 3VG8A 5JDUB 5KEDA 3TH2H 3ZVFA 2QF5A 3BG8A 4NA9H 2P94A 1O2OA 1BHXF 3SUDA 2G00A 3TK6A 4B2AA 4IGDA 2VVVA 1IQIA 4WH6A 1XVOA 4ISOA 2VH0A 2GD4B 4VGCB 4X6NA 1Z6JH 3F9HA 1Y59T 3MU8A 1C2LA 3RMNH 1O5AB 3P17H 2ZDKA 3CNRA 5HKKD 1T8LA 3U1IB 3SU2A 1AFQB 3QK1A 2ZP0H 1ZYOA 1O30A 1GDNA 1PPCE 2EY4C 2GKVE 1F5KU 1ZSLA 3NXPA 1UHBA 2STAE 5E0JA 5A2MH 3L3TA 1BRBE 4AYVB 5GXPA 2GDDA 3K65B 4Q2KA 3NPSA 1YPHC 2ZECA 4A7IB 5A0BA 2GZ7A 3RU4E 1OWDA 1S83A 1LHGH 1O2VA 3LC5A 1HAGE 3RXGA 3HGNA 1YPHE 3HKIB 3LJOA 1V2ST 1YKTA 1AFQC 5L2YH 1UTOA 2Z9IA 3F2GA 1SGNE 1FLEE 1A4WH 2VIPA 3P8OA 1O2MA 4IN1A 3NKKA 1MTWA 3EDXB 3L6PA 2XYAA 4XFQA 1IAUA 3RU4D 3RXUA 1GBBA 1W2KH 2D2DA 3ZYDA 3UWJH 2K1QA 5I25A 1SSXA 2VIOA 4AFQA 2BD8A 2VWOA 3BTFE 2J98B 1QRXA 1P11E 2ANMH 3E0PB 1A3BH 1VGCB 3QDZB 1UTQA 3MWIU 1UW7A 1NC6A 2BTCE 1WV7H 1GJAB 1EFRD 4MPXA 4O97A 4AB8A 2P3UB 2PHBA 1RFNA 4B2CA 5A8XA 1MTNC 1J15A 1V2PT 3PRBA 3TU7H 1UVTH 1GDUA 1PYTD 2H9HA 3E91A 5LGOA 3JZ1B 2FI5E 4ABDA 2JETB 1B5GH 2FYRA 4WXVA 3S69A 2HVYB 1P03A 3M36A 1ZPCA 1NM6A 3GCNA 3IWMA 1Y8TA 3M61U 4GHTA 3RXQA 2KCAA 2FS9A 1COWD 2BXTH 4B6EA 4Y0ZE 4GUXA 2GMTB 3A7TA 1PJPA 1GHZA 1TNGA 1CVWH 1C2EA 8KME2 2A4QA 4KGAA 5K7RA 2WINI 1O2PA 2PSYA 1GMCG 3RXIA 1GJ8B 4KKDA 1BOQA 7LPRA 1P2IA 5FBIA 1DANH 1TBRH 1TPSA 2VVUA 3O8RA 1TGBA 3F6UH 1W11U 1O2LA 3SNCA 2WUBA 4X2VA 1GHAF 3MU4A 1RTLA 1CSOE 2SGAA 3ITIA 3R3GB 1O0DH 1IHTH 4GSOA 2ZWLH 4FOUC 1Z8JB 5E2OA 1O2XA 4I33A 1O3BA 3SU0A 1ZJKA 1IQHA 1SLXB 1PPZA 4OS6A 3W1EA 4IBLH 1MMJN 3I29A 3W94A 3ZVGA 1VJAU 4ZROA 2OP9A 1EP6A 1AWHB 2WV5A 1ZTLA 4MDSA 1AMHA 1O3DA 1EX3A 3M3TA 3TH4H 2F9BH 1LTOA 3P70B 3FVFB 3T27A 1D6WA 2XWBI 3GCOA 5EODA 2BZ6H 7GCHF 1GBJA 1T8OA 2PW8H 1BMFD 2HPPH 2PKAA 1G37A 1GBCA 1D3QB 3FAOA 1ESAA 2YNAA 1N6XA 1O5EH 1HDTH 4JYUH 5GPIB 1P9SA 1SGIB 3WWBA 2W3IA 1G3CA 1ELVA 1GMHG 4IS5A 5C20A 2Y5HA 1S6HA 1Q3XA 3RXHA 1GJ6A 1N8OC 1FI8A 3RXVA 1KSNA 4JYVH 3E8LA 4ISLA 3UNQA 4B6FA 3CS7A 2ODQA 1EB2A 5HXFA 3ATLA 1QZ8A 1AZ8A 3LGVA 1QBOA 3BN9A 3EQ0H 4SGBE 5CHAC 3BTWE 1X7AC 1NU9A 1VCQA 3T5FH 4BANB 1ESTA 1NS3A 3KQCA 3KQDA 2ANYA 3A81A 3LT3A 4ZHLU 3KGPA 1FN8A 2SNWA 1F0RA 2DUCA 2FOHA 1PQ8A 1LQEA 1P2NA 1GHAG 1PFXC 1P3EA 1BMMH 2WPLS 3V0XA 3F9EA 4Y76A 3D65E 1UK4A 3DT0H 2Y7ZA 2C4FH 1AI8H 2BYAX 1DUEA 1EXFA 4BAKB 1AVXA 3MH6A 5F03A 5BRRE 3ZZ4A 1DE7H 2FOEA 1MTUA 1GBMA 3FP6E 3RC6A 1TQ0B 3ZYEA 1O2IA 1DPOA 2ZHEH 3AW1A 2ESTE 1CO7E 2ZGHA 5TCAA 1W0JD 2IJOB 2Y5FA 2ZHWH 3SBKA 4D7GA 1B0EA 1LQDB 3AK5A 2QN5T 2V3OH 1YF4A 1DWBH 3TGIE 1KXAA 2FP7B 1JRSA 4BAQB 1O3IA 5H4IB 3URCA 2BDBA 1TA2A 3TITA 2NU4E 2ZCLP 1ZOMA 2F9OA 3QZQA 2PUXB 1EATA 1EASA 1HYLA 1QA7A 4BAOB 4CRCA 3DFLA 2CHAC 1HAPH 2ODPA 1YBWA 1C5RA 2W26A 3CS0A 1DM4B 1YPMH 1BQYA 2G51A 1QY6A 2AERH 3DFJA 1WXRA 1P3CA 2PFEA 4OGYA 4Y79A 3V12A 1BRAA 1GMHF 2VB0A 3BG4C 1GI1A 1O3LA 1MQ5A 4UFEH 1A61H 2XW9A 1KMHB 1RJXB 4XOJA 3UTUH 5AVDA 2OLGA 2B9LA 1IQGA 4YM9A 2R3YA 2RG3A 1C1NA 1GL1A 1AVWA 1ZJDA 1C1MA 3M3VA 1SB1H 2OC1A 4IC5A 1S84A 2UWOA 1E38B 1K1PA 2BLOA 4MNWA 4ZKNU 2C8ZB 5E8EH 4Y11E 1AUJA 4RT1A 1DDJA 3VEQB 4BAMB 1YPKH 5DP9A 3DCLA 4A92A 1OX1A 3UAIC 1F0SA 1V2QT 1E79D 3EA9A 1NO9H 4YT6H 1HAYB 3SYJA 1HAIH 2ZPSA 3PRDA 4GCHF 1V2OT 9ESTA 4Q80A 3MH4A 2XC0A 3KEEA 4ZAEA 1O2GH 2J94A 3SGAE 1GJDB 3WY8A 1P09A 1C5TA 4K1SA 2OBQA 2V6NA 2HLDD 4NFFA 2Q6FA 1GBTA 4OM9A 1XVMA 1G3EA 1W14U 1GPZA 2A5AA 1TQ7B 2ZKSA 1IQJA 2IJD1 5EXNA 1FY4A 3FZDA 2ZEBA 2BY6X 1SLVB 3RXJA 1ZTJA 2ZG0H 1LMWB 4UFGH 1Y3UA 3A7YA 1CA8B 3LKWA 1O3GA 4FU8A 4XE4A 2BDIA 4JZEH 4KELA 1FY8E 2C90B 1P2KA 2H2ZA 3O8BA 3MNXA 2BDAA 1KLIH 1GI6A 3STIA 3KIDU 1L1JA 4AYYB 1GBKA 1BMNH 3F68H 4O3TA 1CGHA 1JBUH 2R0LA 2RCEA 3PB1E 4IMQA 1ZMLA 3KL6A 2P3FH 4ABJA 4I8GA 1O2RA 4D7FA 3U98H 3BEUA 3P92A 4FUFA 2J97A 1TBZH 1RTFB 3GY4A 2Y81A 1CT4E 1P05A 1P8VC 4JMYA 4B74A 2Z3CA 2FS8A 5FPTA 3KN2A 2HLCA 2GDEH 1TIOA 1UCYE 2ZF0H 4I8LA 3SNDA 4A5TS 2F91A 1YPEH 3Q3KA 6ESTA 1C5WB 1JOUB 3GDVA 2KR7A 3AAVA 1NRSH 1EOLA 4Y8ZA 2ZFSA 5A0CA 2O8WA 4BXSA 1T7CA 2BMGB 3UQVA 2OC8A 3Q3XA 2JKHA 3BTME 3ZZ8A 5EPYA 4NSVA 1E1RD 1V2MT 1Y5UT 3GY3A 3ZZ5A 1LHFH 2AGGX 4YZUA 4Y0YE 1MBMA 1KDQB 2SFAA 3VB6A 1GBEA 1QJ1B 1BRUP 1DWCH 3K6ZA 1YYY1 1P10A 4NZQA 2HNTE 3A8CA 5FPYA 1OKXA 1P04A 3Q3YA 2Z7FE 4THNH 1BZXE 1RRKA 1ABJH 1F0TA 1S85A 1UTKA 4ABBA 1CE5A 3GOVB 3TJOA 4IMZA 2SNVA 1LO6A 3NUMA 3LIWA 1NFYA 3F0PA 1OP2A 3PLBA 2PUQH 3RC4A 2JIZD 1W7GH 2LNCA 3OE7D 4HZHA 1C1RA 1UTJA 7ESTE 1OPHB 1SR5C 1WU1A 3TLOA 4F49A 4INLA 3QUMP 1DUAA 2WYJA 1D6RA 5HIZA 2NU0E 3I77A 2A31A 4U32A 4B75A 3UNSA 1C2DA 2P8OC 5L2ZH 1QB1A 3BF6H 3PO1B 3E90B 3SNBA 1C5UA 1WUNH 1CA0C 4TSFD 1MH0A 3TGJE 5EQSA 2VGCB 3KNXA 3V3MA 2QCYA 6CHAC 6GCHG 2G5VA 4K3JA 2GGVB 1HB0B 1EAWA 1F5RA 3Q76A 5EGMA 3BEFB 3MO3A 2PGQB 3HGPA 3FO8D 1BTZA 4GHQA 1XKBC 2OD3B 3M5NA 2FTMA 2R0KA 4ZKSU 3SN8A 4AGJA 2FXRA 3T26A 1G36A 3TGKE 3URDA 1JIRA 1EUFA 2ZA5A 3RLWH 1G2LA 1SHHB 5EXMA 1QCPA 3TJVA 2VVCA 4ABFA 1SGEE 2BXUH 3S9BA 1LCYA 1GMDG 1UK3A 2AGIX 3A8BA 1PQAA 4AFSA 2AMQA 1SGQE 3SO3A 3MQKC 4O3UA 3KCGH 1NESE 1HRTH 4Y7BA 1IQMA 1SVPA 4ACAA 2XXLA 3QGJA 2QXGA 2A4GA 5C1XA 1EZSC 5DK1A 2FZZA 1O3OA 3RM0H 1G30B 4KP0A 4AX9H 2L6OA 3KYGA 1NBMD 4X1PU 1INCA 2FWWA 2R2WU 2LELA 1DWEH 1SGFA 3OY5U 4NSYA 4B76A 8ESTE 1VITH 3A7WA 1QIXB 1AY6H 1H9IE 4UFFH 3W95A 2B8OH 1HLTH 3VGCB 5ETXA 1YPLH 3A87A 4K1TA 2YMSD 2YMSC 4A1TA 1QL9A 6LPRA 4Y10E 1GI8B 2W6JD 1V2LT 1GBFA 2G5NA 3MNSA 4JYTA 3O8CA 3ODFA 3VGCC 1FAXA 1ZSKA 2C8YB 2BLQA 2FIRH 5GNDA 2ZCKP 2BX4A 1J14A 1SQAA 4ZXYH 4DCDA 1K1OA 3TJUA 2KX4A 3SNAA 1P2JA 3UIRA 1BCUH 2JJ2D 1QRWA 4I86A 2F9PA 2A4OA 1KXEA 1J16A 4DG4A 1TOCB 2UWPA 1HPGA 4I31A 3RXFA 3TK9A 1Y5AT 1O5GH 2J2UA 3TNTA 4VGCC 1GGDB 2ZGCA 2OCVB 2ODYB 2G81E 2ZDNA 3HKJB 3OEHD 4M7GA 4XSKU 4ZMAH 1NFUA 1YCPH 2HNTC 3MH7A 2J5UA 4FETA 5KECA 2H1UA 4CRGA 4XBCA 3QLPH 1SLWB 2A2XH 1G9IE 2YOLA 2Y6TA 3HK6B 1H8HD 1TALA 2VWMA 3MMGA 3BTTE 3SU6A 3SW2B 1GI2A 1O2QA 5DSFA 4H4FA 4Z6AH 1UTMA 2G8TA 5PTPA 1O2SA 1ZHRA 4U01A 4X1NU 1VZQH 1QQ4A 1ZHMA 1L0ZA 4AGKA 1HAVB 1EJAA 2QIQA 3ZZDA 5DGJA 3IITA 1EKBB 1RIWB 2J98A 1TNLA 2RDLA 5GCHG 4WMFA 1TPAE 2ZPRA 1TX8A 2RA0A 5IK2D 1C9TA 1UTNA 3RXCA 1BMAA 5ABWA 3F3BA 1WCZA 1VR1H 1QHRB 1DT2A 3VB3A 2AFQB 2I6SA 3LH3A 3RXBA 5CE1A 1MKXK 3LC3A 1Z6EA 3P8NA 2XTTB 1QRZA 2OXSA 3SV9A 3ZZCA 5HM9A 3A8DA 2FODA 1Y3WA 2WV9A 1PPGE 2BHGA 4K1EA 1BIOA 5DO4H 4XBBA 1TX6A 1TPPA 1AU8A 3MYWA 1GBIA 1VKYA 3T2NA 3SUFA 1DOJA 3SI4H 2F83A 1FY5A 2BY8X 5DP8A 1ZR0A 4CRAA 3A88A 4P02A 1GJCB 2J4IA 1K21H 1A5IA 3PV5A 1CHOG 2BX3A 4BTUB 3P95A 5C5NA 4DIIH 3E0NB 4XD7D 3RUOA 3T25A 3T62A 3LGIA 5T1VA 3U9AH 2PSXA 1Z8IB 2GCHF 1O31A 2EQNA 1O3KA 4X1RU 1O2NA 3H5CB 5T6FA 4FXGH 1P2QA 4RI0A 5B6OA 3LONA 4Y8XA 1C5QA 1O5BB 3SHCH 2PLXA 3M5MA 2XRCA 4MPWA 5C0UA 1QA0A 1GBLA 3PWCA 1A2CH 1UCYH 1VGCC 1W8BH 3GY8A 3QO6A 1L4ZA 1SL3A 5FX5A 2D8WA 2K0QA 2ZTYA 1DY8A 1ELBA 2HNTF 1ETTH 1DWDH 1FV9A 1AIXH 4U2WA 3RXDA 3UOUA 1RIWC 3A86A 5EPNA 1A7SA 4DW2U 1D3DB 3GCHC 1S6LA 3SUEA 3RMMH 4GLYA 3BTKE 4R8TB 1SQOA 1RGQA 1GHVH 3UB0A 2DE9A 4DT4A 1ELCA 1ELDE 4MLFB 1GI9B 3RXOA 2O8LA 4HTCH 2V35A 1HAXB 1UVSH 4P00A 2AS9A 5C94A 1VCPA 2Z9KA 2W7SA 4NWKA 1FIWA 3F9GA 1FQ3A 3E1XB 1LKAA 4FU9A 1L1NA 1HJ8A 2QF3A 3OYPA 4X2YA 1M9UA 1O3EA 1O2KA 1DY9A 2OINA 2VIVA 1SOTA 1HJ9A 1V2WT 2UUJB 3PTBA 3ZZ9A 1Z1IA 1TNHA 3A84A 1T8MA 1UTPA 1ZTKA 1GHBG 5GIBA 3F2FA 3F9FA 4WVPE 4B2BA 4U30A 2BY7X 1C5SA 2D1JA 1OP0A 3SUGA 2ZHQH 1ELFA 1TE0A 4IW4E 4CR5A 2G4UA 2UUFB 1MQ6A 4CREA 5GJ4B 4HG6A 4GVUA 1C5NH 1UCYK 2H9TH 5F53A 1SGFG 2ZTZA 2ZFFH 3H09A 3OU0A 1MKWK 1BTWA 3OX7U 1KYNA 3RC5A 1JRTA 1TWXB 1O3PB 1SHYA 2Z9LA 5EQRA 2GTBA 3M5OA 4NWLA 5J4SA 4ABAA 1K1IA 1IQFA 3FP7E 1BTXA 1IQLA 2B0FA 3QWCH 1F7ZA 1AKSB 3AAUA 4X2WA 3RP2A 1YGCH 1MABB 2AEIH 1NROH 2ZU4A 1Z8RA 4K5ZA 3ELAH 4AORA 1FXYA 1TLDA 1Y3YA 1MUEB 1ANBA 2ZGBH 5LH8A 3RDZA 2XOKD 4JZDH 4YT7H 3U69H 2BM2A 1PPEE 2BD2A 3M3SA 3FFGA 1RS0A 1V2UT 3EE7A 2Z6BD 2R3UA 4Q7YA 3L33A 1DSTA 3LGWA 2QV1A 3GY7A 3RLYH 1MTNB 4UONA 2LPRA 3OTPA 3K6YA 3ZZAA 1GJBB 1JXPA 2V0BA 2XC5A 1N8OB 2QF4A 4Z1MD 1YWUA 3SORA 1PQ7A 4ISIH 4OS2A 3QTVH 1MKXH 1OWKA 4E05H 1UO6A 1O32A 1ETSH 5CHAB 2BOKA 2J95A 2OQUA 1KLJH 1MD8A 3BTDE 3GICB 4JZFH 1WOFA 2YNBA 1C5VA 3SU3A 1SQTA 4CBNA 8GCHF 3BTGE 4MNYA 1XM1A 2F3CE 4FUIA 5FX6A 5JBAS 1AE8H 1YC0A 4AC9A 1L4DA 3U8TH 5A8YA 5FBEA 1V2JT 4XRNA 3ESTA 1K0HA 2RA3A 5CHBA 1C5ZB 3VXEH 1W7XH 1QB9A 4H6TA 1YCPK 4JZIA 3K9XB 4O9VA 2HPQH 2A45B 2UWLA 4D76A 4INHA 4JK5A 3RM2H 2JETC 2M5TA 1K1NA 3M37A 5BPEA 1O35A 5EJZA 1RD3B 1D3TB 2TPIZ 2XBWA 4MG3A 4AFZA 1FY3A 1EB1H 1LHEH 2FO9A 4NIYA 1IHSH 2PKSC 3BIVH 3A7XA 4WMDA 3SGQE 1FNIA 3VB4A 2C8WB 4X6OA 4BAHB 4Q4LA 1V2RT 1C5MD 1BITA 1CBWB 4FUEA 1TRNA 5CDFE 1SGRE 2JH6D 1TGNA 5F8TA 1MU8B 4TYDA 2QE7D 4CHAB 1T4UH 2RFKC 1E36B 5FHTA 3SJ9A 3SHAH 3PMHB 1ORFA 4Y7AA 1DX5M 5G4BA 3SV8A 3ZV9A 1WAYB 2SGDE 2JJ1D 4TPIZ 1GJ9B 4FUJA 3ENSB 1YCPM 2ZFPH 1H9LB 1TB6H 1S5SA 2GVFA 4AN7A 1BMLA 3E6PH 2WSSD 2PKAB 2OTVA 1O33A 2YMSB 3FN8A 4MTBA 1TNIA 2ZHFH 1UVUH 2WPMS 1T8NA 1EJMA 1S0RA 3QGNB 1IQKA 1BHXB 1C1VH 1QNJA 1ELEE 3ATIA 3MU0A 2VGCC 1NRNH 7GCHG 4LK4A 2FOAA 3SJOA 2FESH 1QURH 2BD9A 2QGRA 1CT2E 5JPMH 1ANCA 1W0YH 2FYQA 3ZVEA 4MVNA 2BDHA 3EE0B 3UWIA 1GDQA 1GCTC 1EPTB 1BJUA 1AB9C 1C2MA 1AGJA 3B8JA 2W3KA 5LPEA 1AUTC 5ESBA 1GBDA 1GVLA 2GV7A 2CJIA 3M7UA 3ZVCA 4ACBA 1QB6A 3MHWU 2O9QA 1FY1A 5JBTA 5E0GA 1XX9A 4SGAE 4E7RG 3TVJB 2PGBB 2Z9JA 3PV4A 4ABEA 3FOAA 1D3PB 1GHBF 2LP6A 1SQRA 5LPFA 4KTUA 2GCTC 1TOMH 2P95A 3WWFA 4AB9A 1FIZA 2QY0B 3RMLH 2PV9B 1L2EA 2FX6A 4WWYA 3RXAA 2ZIQH 2A1DB 1RXPA 3EYDA 1C1PA 1UK2A 3SZEA 1C5OH 2HVXA 3RMOH 1V2TT 2FI3E 1C4U2 1A5HA 3LH1A 2BDYA 4ASHA 2ZDLA 2KZ4A 1TNKA 1OS8A 4DY7B 1C2JA 1TAWA 4CH2B 2G4TA 1DITH 2F9NA 2ZDAH 1J8AA 2GMTC 2FTLE 3T29A 2QC2A 4BTTB 1GI3A 1C5PA 1SLUB 1FPHH 1T31A 3GCHB 4X8TH 1ZHPA 4TWWA 1T4VH 3ZZBA 3P8GA 3BG4B 3PO1C 1YPGH 8LPRA 3M7TA 5ESTE 4K2YA 1QL8A 1XUHA 1TGTA 1ZMJA 3ATMA 3DSOA 5IYTA 2TRMA 1T32A 1GI0A 1C2KA 5C1UA 1GWAA 1ZGVA 4WMEA 1AVGH 1AN1E 3PROA 3U28C 4MQAA 1KXBA 1A46H 3SI3H 1A3EH 1W0ZU 4NA8A 2ZGXH 2ALPA 1LHCH 1BB0B 1QJ6B 4Z0KA 4TWYA 3DUXH 1DVAH 1OWHA 1E0FD 5F8ZA 1GI5A 2C3SA 3NRLA 2AMPA 1MTVA 3TIUA 2Z9GA 1K2I1 3A7VA 4OS4A 4HGCA 2BVRH 1FMGA 1G3BA 5LPRA 1FN6A 2ZQ1A 2QXJA 1BTYA 1SPJA 2EA3A 2KFWA 1GJ5H 3BIUH 5I46H 3BSQA 4X1SU 3ZVBA 4TY6A 5A0AE 5DP3A 1SI5H 1XUFA 2Y82A 5FXLA 1SKYE 1YY3A 1DSUA 1GL0E 2ZQ2A 3LGUA 4ESTE 1CHGA 2VNTA 1VITG 2VIWA 4TPYA 4BOHA 1XMNB 2FLBH 1IOEA 3DSGA 6CHAB 1LPGB 2B5TB 4ZH8A 1WSSH 1BUIA 3BEIB 5AFZH 5E2PA 5FCRA 4ZUHA 2OBOA 4GCHG 1O2JA 1H4WA 1H8IH 1TBQH 2DE8A 3A85A 3MFJA 4YESB 5IDKA 3ZIAD 2CN0H 3TK5A 2Q1JA 4HFPB 2TGPZ 4TY7A 1A0JA 1SGYE 1BA8B 4A1VA 2CGAA 2WYGA 4IC6A 4K8BA 5DP6A 1EPTA 1YLCA 1A1RA 4AZ2B 4E06H 2BQ7B 4J2YB 2KAIB 1MZDA 3IG6B 2A7HA 4BXWA 2EI6A 2PKSB 1F2SE 1O38A 3P6ZB 1MAYA 2GZ8A 3GDSA 4WY3A 1CGJE 1E34B 1TFXA 4RN6A 1ZLRA 3S9AA 3A8AA 3UR6A 5EJ1A 3KF2A 3FP8E 3E16B 4F55A 3S9CA 2Z94A 2W7UA 3SJKA 4CRDA 2PTNA 3DSPA 3F2HA 3E3TA 1W12U 2NU1E 4NIXA 1GJ7B 3MO9A 1NU7B 3ZZ3A 1YLDA 4ISNA 1THRH 2QAAA 2ZTXA 1O2YA 4YTAA 2ZFRH 1BJVA 1QQUA 2Q6GA 3PV2A 4DJZB 2PWXA 3OSYA 1O2TA 1TRYA 2GX4A 3H7TA 2FOGA 2M2AA 5L30H 4WJG2 4YOGA 2AHME 1SGCA 2ASUB 3D23A 2P59A 1HIAA 4X8UH 5JYIA 1OWEA 5C3NA 1OXGA 2TGAA 1C1SA 4B71A 1O3CA 4F48B 1O3AA 4FU7A 5E0HA 1O5DH 2AGEX 4X1QU 2H5CA 1P9UA 1C2GA 1THSH 2WPKS 1EJNA 1DFPA 2FM2A 2ZZUH 1S6FA 2SGQE 2QA9E 1CGIE 1C1UH 1JIMA 2TIOA 2ZU1A 1NPMA 3B9FH 1GHYH 2GZ9A 1PPHE 3AVZA 3WW7A 4FUHA 3MI4A 3SZNA 1EP5A 2XWAA 1N6YA 2BD7A 4UEHH 1XUIA 3PWBA 1P06A 2Z3DA 1GG6B 4JCNA 1DXWA 3ZVDA 2JH0D 5DPAA 2SGEE 7KMEH 4NIWA 4YXWD 2G55A 1ZZZA 1P2MA 3HATH 3KQ5A 2BDCA 1EOJA 1HAHH 4I8KA 2IPQX 1UVOA 4WH8A 5DP5A 3OEED 1SBWA 2ZO3H 3S7HB 1B7XB 3GCTG 1KTTB 2WPDD 2KAIA 3GDUA 3S0NA 3MU5A 4NZLA 2Y7XA 2V3HH 2ULLA 1Y3XA 3MNBA 1HXEH 1K28D 3LOXA 4WF8A 4GPGA 3CP7A 4HI3A 3TPIZ 2QF0A 2AIPA 2ZC9H 4AOQA 1GJ4H 3OY6U 3N99A 2VU8E 2BOHB 1O2HA 4FUCA 3SJ8A 4K8YA 4D9RA 1L1GA 3GY5A 2C8XB 3GYLB 3C27B 2A4RA 4JZ1A 2BVXH 1S81A 4UE7H 4ZKRU 1P02A 2BD4A 4IN2A 3SU1A 1Z71A 3V7TA 2KCYA 4B73A 1QL7A 3MOCA 5C2ZA 2Y80A 5J4QA 4YO9A 1QJ7B 1V2VT 4FUBA 1H9HE 1QBVH 1O3NA 1AKSA 3F0OA 4FVDA 2H6MA 1ID5H 1P12E 1C2FA 1JMOH 4Q7XA 1BBRK 1Y5BT 2SGFE 5JB8S 1GCTB 4Q7ZA 2ZDMA 1SGDE 1CQQA 1HUTH 4DT7B 1MZAA 1GHXH 2A2QH 4LXBH 4KTSA 1ZGIA 1Q31A 2A32A 3DA9B 1BDAA 2FLRH 2XC4A 1ABIH 4E7NA 3A80A 3NCLA 4RKOB 1NRQH 1HIAB 1ETRH 1MCVA 1TMUH 4ABIA 3ZVAA 1HNEE 3UPEA 1OYQA 1ANEA 3FZZA 5C1YA 3VXFH 5C5OA 1A0HB 1ELGA 4LZ4B 3PMJA 3DHKH 1LDTT 3FANA 1O39A 1EAXA 4DGJA 2AMDA 1TABE 2FMJA 4ASUD 8GCHG 3LDXH 4I7YH 2ZHDA 4K60A 1E37B 1NRRH 1AO5A 1MU6B 3PMAB 3RXEA 5EU8A 1GHWH 3SNEA 3MU1A 1Z7KA 5T6DA 3U1JB 3OAAD 3T28A 1W0KD 1AHTH 5HYOA 2F4LA 3N7OA 5K0HA 5HIYA 1VITF 3A82A 1GVZA 3GY6A 4DOQA 2ZI2H 3STJA 1K9OE 3PYHA 3GCTF 3UUZA 1BBRE 1C1OA 1ZPBA 2BB4A 2GT8A 3FKSD 1CT0E 2HALA 3K2UA 5KGOA 1LKBA 2J92A 2WUCA 1Z1JA 3QTOH 1C1QA 3M5LA 3RXPA 2QXIA 4YOJA 1EAUA 1TYNA 3ZV8A 1CA0B 1FJSA 1P2OA 3NWUA 2A5KA 3GYMA 5C0TA 2ZNKH 1ZMNA 2JH5D 5HM2A 4INKA 1AD8H 2UUKB 2ILNA 5EG4A 3VB5A 2F9VA 3GY2A 1W10U 1EQ9A 1ZRBA 1WBGB 1P01A 1FX0B 4I8HA 1HAOH 3BTEE 1RTKA 4NIVA 3V13A 2NU3E 9LPRA 1EZXC 1BRCE 3NZIA 4OS1A 2NU2E 1V2NT 5GDSH 1Q2WA 1SFQB 3ZZ6A 3EAJA 3PLPA 3A7ZA 2TGDA 3TJNA 1C4V2 1G2MA 3B23B 1V2KT 2O8TA 2V7QD 1YP9A 3AW0A 1AE5A 1KXDA 2Q6DA 4JK6A 4AG1A 2KM0A 1W13U 2WPIS 2QXHA 1ZSJA 1NT1A 1FONA 4DVAU 4R0IA 5T6GA 4J1YA 5SGAE 1JWTA 2ZU5A 5HMAA 2XNIA 4OGXA 2KCOA 1ARCA 1Z8GA 4CR9A 3SQEE 3LU9B 3SV2H 4O03A 3U8RH 3KQBA 2F43B 3PMBB 1OP8A 4ZHMU 2A7CA 3MO6A 2ZFTA 3D62A 1H1BA 4DIHH 1LVMA 4FUDA 1WQVH 4AFUA 1H8ED 1OWIA 1OHHD 4UDWH 5AFYH 3OTJE 5A8ZA 1DICA 2J9NA 2CV3A 1GI4A 1O2UA
chains in the Genus database with same CATH topology
1HJAC 2P93A 2BQ6B 3SQHE 1O3MA 4Y8YA 1GGDC 1KXFA 1SGTA 4D9QA 2STBE 2XCNA 2O8UA 1CHOF 1HFDA 4CH8B 3LGTA 4YOIA 1C1WH 4X8SH 1TPOA 1HAZB 1SG8B 3H7OA 4DURA 3O8DA 4ISHH 1CU1A 2BLVA 1MTSA 2OC0A 5EW1H 2A0QB 1LVOA 1EZUC 1IQNA 2ANWA 1GG6C 3SU5A 4ABHA 1KLTA 5L6NH 1GBHA 4LZ1H 2I6QA 3RXKA 2Z3EA 1FPCH 2XCFA 1G32B 1P57B 1P0SH 2OQ5A 4ZKOU 3M7QA 3TNSA 4X6MA 1C1TA 3SV7A 2J38A 4UD9H 2FOCA 1FUJA 4UFDH 1UJ1A 1MD7A 1PPFE 2GCHG 3HPTB 3RXTA 3UREA 5EQQA 4KTCA 1KIGH 1C5LH 3ODDA 4X0WU 3TH3H 3RXSA 3BTHE 1FAKH 3U8OH 1QGFA 2BDGA 5DKMA 1WQSA 1SFIA 2TGTA 3Q77A 4I8JA 1YPJH 2BY5X 4ZHAA 1GVKB 4BTIB 1OWJA 1UHBB 1HV7A 1MAXA 1C2HA 1PQ5A 1AWFH 1NY22 2FOBA 1NRPH 1C2IA 4MNXA 1GBAA 3EGKH 3UNRA 3KQEA 1W3CA 3ZZ7A 4ZXXH 4A6LA 2ANKH 1Y3VA 1C9PA 3GISB 1QTFA 1D4PB 5F6MA 1MBQA 2OC7A 3JZ2B 5CMXH 1KTSB 2ZPQA 1V3XA 5FCKA 3LPRA 5JB9S 4MPUA 1XUJA 1BTPA 1K1LA 2NWNA 4QT8C 1K1JA 1TONA 3KHVA 1EAIA 2AH4X 2ZCHP 2A7JA 2BLWA 2HGTH 1NN6A 1D9IA 1O34A 1BBRH 1SMFE 1EZQA 1TA6A 4BNRA 1WTHD 2BD5A 2IN2A 2HRVA 1ESBA 2CMYA 2VWLA 1LHDH 4GAWA 2EI7A 2BZAA 1VJ9U 2GT7A 3PLKA 3PM3A 1GMCF 2FDAA 2HWLB 4PROA 2GCTB 1SC8U 1N1LA 1PPBH 1HJAB 3I78A 3UFAA 2FPZA 2OUAA 3S7KB 5HGGA 2ZFQH 5F8XA 3P8FA 1ANDA 1TRMA 2D26C 1F92A 5C67A 1ZRKA 4FVBA 4ABGA 5AF9H 2QYIA 1PYTC 1UMAH 1DXPA 3SOSA 1HBTH 2XBXA 1ARBA 5JBBS 1DLKB 3SGBE 2ALVA 3AASA 3Q00A 3C1KA 5JBCS 4XBDA 3BV9B 2THFB 5GWZA 2ZDVH 4Y6DA 1TGSZ 5TJXA 1ELTA 2C93B 3MTYA 1KY9A 1TMBH 2BVSH 3SU4A 1HXFH 2BD3A 3MH5A 4H42U 5EXLA 3RXLA 2PR3A 3ATKA 6GCHF 4NGAH 2AYWA 2BY9X 4NA7A 1TMTH 1XUKA 5GCHF 1G3DA 3F1SB 2BQWB 3CENA 4X6PA 3DD2H 1QR3E 3UQOA 2ZU3A 1C5XB 3BTQE 5DG6A 2H5DA 2WV4A 4OS7A 3SJIA 2CXVA 1LPZB 1E35B 5A09A 2P16A 4MNVA 1C4Y2 4I32A 2VINA 3EA8A 5DP7A 1XXDA 1GCDA 3NK8A 5DP4A 2B7DH 1F0UA 5FPSA 4H6SB 2XBYA 4CRFA 4A1XA 1GMDF 1O36A 3EA7A 1THPB 1S82A 1OYTH 2FOFA 3VB7A 2VIQA 3A83A 4Y71A 2G52A 3R0FA 3VFEA 2A5IA 1ACBE 2EI8A 2IOTA 1O2ZA 1O5CB 5DJ7A 2HOBA 1AFEH 3UR9A 3G01A 3UOPA 1EPTC 4RKJB 2J34A 4B1TA 1BT7A 1O3HA 1U6QA 1ZPZA 3ATWA 1NFWA 2VH6A 4NG9H 1B0FA 2EC9H 4NCYA 1KDQA 1F5LA 1LVYA 2WPJS 3QZRA 4FUGA 1XUGA 3D49H 4MPVA 1GI7B 1AQ7A 2AIQA 1VCWA 2FX4A 2IPHA 1WYKA 1AZZA 1WTGH 2GV6A 4CRBA 1TGCA 2XBVA 2F9UA 3QN7A 1SGPE 2P3TB 4YLQH 2Y5GA 1BTHH 1HCGA 1MKWH 1UTLM 1XXFA 2TBSA 1TNJA 1A0LA 2R9PA 1LVBA 4F4OC 1A5GH 2CF8H 4X8VH 1J9CH 1S0QA 1H8DH 1DS2E 3RXMA 1LPKB 2CHAB 5EOKA 4NFEA 2FEQH 1J17T 2EEKA 1QBNA 4X2XA 3M35A 1CBWC 2VWNA 3VPKA 2WPHS 5EW2H 2UUYA 1OOKB 4CHAC 2P8OB 1K1MA 1MCTA 1O3JA 1O5FH 1O2WA 1AB9B 1QFKH 4OS5A 4XDEA 5AHGH 2FI4E 1BTUA 1YM0A 1C5YB 1O3FA 4WXIA 2FOMB 1UVPA 3MNCA 3UY9A 2VJ1A 4LOYH 1NZQH 5FAHA 1O37A 1NFXA 2W5EA 1XKAC 2H9EH 1NTPA 1FZZA 3RXRA 1K22H 2GP9B 1HGTH 3LJJA 4K69A 3QX5H 3LGYA 1OSSA 1KXCA 2VIDA 5TCCA 1FDPA 1TX7A 1DLEA 1V6DA 1HAVA 2R2MB 2ZU2A 4RSPA 4AG2A 2ZGJA 4YLUA 4CBOA 2O8MA 3RU4T 4D8NA 2SGPE 1IQEA 2PTCE 3PTNA 1SOZA 5T3HA 2CF9H 3SV6A 3HK3B 3A89A 1ELAA 5JDUB 3TH2H 3ZVFA 3BG8A 4NA9H 2P94A 1O2OA 1BHXF 3SUDA 2G00A 3TK6A 4B2AA 4IGDA 2VVVA 1IQIA 4WH6A 1XVOA 4ISOA 2VH0A 2GD4B 4VGCB 4X6NA 1Z6JH 3F9HA 1Y59T 3MU8A 1C2LA 3RMNH 1O5AB 3P17H 2ZDKA 1T8LA 3U1IB 3SU2A 1AFQB 3QK1A 2ZP0H 1ZYOA 1O30A 1GDNA 1PPCE 2GKVE 1F5KU 1ZSLA 3NXPA 1UHBA 2STAE 5E0JA 5A2MH 3L3TA 1BRBE 4AYVB 5GXPA 2GDDA 3K65B 4Q2KA 3NPSA 1YPHC 2ZECA 4A7IB 5A0BA 2GZ7A 3RU4E 1OWDA 1S83A 1LHGH 1O2VA 3LC5A 1HAGE 3RXGA 3HGNA 1YPHE 3HKIB 3LJOA 1V2ST 1YKTA 1AFQC 5L2YH 1UTOA 2Z9IA 1SGNE 1FLEE 1A4WH 2VIPA 3P8OA 1O2MA 4IN1A 3NKKA 1MTWA 3EDXB 3L6PA 2XYAA 4XFQA 1IAUA 3RU4D 3RXUA 1GBBA 1W2KH 2D2DA 3ZYDA 3UWJH 2K1QA 5I25A 1SSXA 2VIOA 4AFQA 2BD8A 2VWOA 3BTFE 1QRXA 1P11E 2ANMH 3E0PB 1A3BH 1VGCB 3QDZB 1UTQA 3MWIU 1NC6A 2BTCE 1WV7H 1GJAB 4O97A 4MPXA 4AB8A 2P3UB 2PHBA 1RFNA 4B2CA 5A8XA 1MTNC 1J15A 1V2PT 3TU7H 1UVTH 1GDUA 1PYTD 2H9HA 3E91A 5LGOA 3JZ1B 2FI5E 4ABDA 2JETB 1B5GH 2FYRA 4WXVA 3S69A 1P03A 3M36A 1ZPCA 1NM6A 3GCNA 3IWMA 1Y8TA 3M61U 4GHTA 3RXQA 2FS9A 2BXTH 4Y0ZE 4GUXA 2GMTB 3A7TA 1PJPA 1GHZA 1TNGA 1CVWH 1C2EA 8KME2 2A4QA 4KGAA 5K7RA 2WINI 1O2PA 2PSYA 1GMCG 3RXIA 1GJ8B 4KKDA 1BOQA 7LPRA 1P2IA 5FBIA 1DANH 1TBRH 1TPSA 2VVUA 3O8RA 1TGBA 3F6UH 1W11U 1O2LA 3SNCA 2WUBA 4X2VA 1GHAF 3MU4A 1RTLA 1CSOE 2SGAA 3ITIA 3R3GB 1O0DH 1IHTH 4GSOA 2ZWLH 1Z8JB 5E2OA 1O2XA 4I33A 1O3BA 3SU0A 1ZJKA 1IQHA 1SLXB 1PPZA 4OS6A 4IBLH 1MMJN 3I29A 3W94A 3ZVGA 1VJAU 4ZROA 2OP9A 1EP6A 1AWHB 2WV5A 1ZTLA 4MDSA 1AMHA 1O3DA 1EX3A 3M3TA 3TH4H 2F9BH 1LTOA 3P70B 3FVFB 3T27A 1D6WA 2XWBI 3GCOA 5EODA 2BZ6H 7GCHF 1GBJA 1T8OA 2PW8H 2HPPH 2PKAA 1G37A 1GBCA 1D3QB 3FAOA 1ESAA 2YNAA 1N6XA 1O5EH 1HDTH 4JYUH 5GPIB 1P9SA 1SGIB 2W3IA 1G3CA 1ELVA 1GMHG 4IS5A 5C20A 2Y5HA 1S6HA 1Q3XA 3RXHA 1GJ6A 1N8OC 1FI8A 3RXVA 1KSNA 4JYVH 3E8LA 4ISLA 3UNQA 3CS7A 2ODQA 1EB2A 5HXFA 3ATLA 1AZ8A 3LGVA 1QBOA 3BN9A 3EQ0H 4SGBE 5CHAC 3BTWE 1X7AC 1NU9A 1VCQA 3T5FH 4BANB 1ESTA 1NS3A 3KQCA 3KQDA 2ANYA 3A81A 3LT3A 4ZHLU 3KGPA 1FN8A 2SNWA 1F0RA 2DUCA 2FOHA 1PQ8A 1LQEA 1P2NA 1GHAG 1PFXC 1P3EA 1BMMH 2WPLS 3V0XA 3F9EA 4Y76A 3D65E 1UK4A 3DT0H 2Y7ZA 2C4FH 1AI8H 2BYAX 1DUEA 1EXFA 4BAKB 1AVXA 3MH6A 5F03A 5BRRE 3ZZ4A 1DE7H 2FOEA 1MTUA 1GBMA 3FP6E 3RC6A 1TQ0B 3ZYEA 1O2IA 1DPOA 2ZHEH 3AW1A 2ESTE 1CO7E 2ZGHA 5TCAA 2IJOB 2Y5FA 2ZHWH 3SBKA 4D7GA 1B0EA 1LQDB 2QN5T 2V3OH 1YF4A 1DWBH 3TGIE 1KXAA 2FP7B 1JRSA 4BAQB 1O3IA 5H4IB 3URCA 2BDBA 1TA2A 3TITA 2NU4E 2ZCLP 1ZOMA 2F9OA 3QZQA 2PUXB 1EATA 1EASA 1HYLA 1QA7A 4BAOB 4CRCA 3DFLA 2CHAC 1HAPH 2ODPA 1YBWA 1C5RA 2W26A 3CS0A 1DM4B 1YPMH 1BQYA 2G51A 1QY6A 2AERH 3DFJA 1P3CA 2PFEA 4OGYA 4Y79A 3V12A 1BRAA 1GMHF 2VB0A 3BG4C 1GI1A 1O3LA 1MQ5A 4UFEH 1A61H 2XW9A 1RJXB 4XOJA 3UTUH 5AVDA 2OLGA 2B9LA 1IQGA 4YM9A 2R3YA 2RG3A 1C1NA 1GL1A 1AVWA 1ZJDA 1C1MA 3M3VA 1SB1H 2OC1A 4IC5A 1S84A 2UWOA 1E38B 1K1PA 2BLOA 4MNWA 4ZKNU 2C8ZB 5E8EH 4Y11E 1AUJA 3VEQB 1DDJA 4BAMB 1YPKH 5DP9A 4A92A 1OX1A 1F0SA 1V2QT 3EA9A 1NO9H 4YT6H 1HAYB 1HAIH 2ZPSA 4GCHF 1V2OT 9ESTA 4Q80A 3MH4A 2XC0A 3KEEA 4ZAEA 1O2GH 2J94A 3SGAE 1GJDB 3WY8A 1P09A 1C5TA 4K1SA 2OBQA 2V6NA 4NFFA 2Q6FA 1GBTA 1XVMA 1G3EA 1W14U 1GPZA 2A5AA 1TQ7B 2ZKSA 1IQJA 5EXNA 1FY4A 3FZDA 2ZEBA 2BY6X 1SLVB 3RXJA 1ZTJA 2ZG0H 1LMWB 4UFGH 1Y3UA 3A7YA 1CA8B 3LKWA 1O3GA 4FU8A 4XE4A 2BDIA 4JZEH 4KELA 1FY8E 2C90B 1P2KA 2H2ZA 3O8BA 3MNXA 2BDAA 1KLIH 1GI6A 3STIA 3KIDU 1L1JA 4AYYB 1GBKA 1BMNH 3F68H 4O3TA 1CGHA 1JBUH 2R0LA 2RCEA 3PB1E 4IMQA 1ZMLA 3KL6A 2P3FH 4ABJA 4I8GA 1O2RA 4D7FA 3U98H 3BEUA 3P92A 4FUFA 1TBZH 1RTFB 3GY4A 2Y81A 1CT4E 1P05A 1P8VC 4JMYA 4B74A 2Z3CA 2FS8A 5FPTA 3KN2A 2HLCA 2GDEH 1TIOA 1UCYE 2ZF0H 4I8LA 3SNDA 4A5TS 2F91A 1YPEH 3Q3KA 6ESTA 1C5WB 1JOUB 3GDVA 3AAVA 1NRSH 1EOLA 4Y8ZA 2ZFSA 5A0CA 2O8WA 4BXSA 1T7CA 2BMGB 3UQVA 2OC8A 3Q3XA 2JKHA 3BTME 3ZZ8A 5EPYA 4NSVA 1V2MT 1Y5UT 3GY3A 3ZZ5A 1LHFH 2AGGX 4YZUA 4Y0YE 1MBMA 1KDQB 2SFAA 3VB6A 1GBEA 1QJ1B 1BRUP 1DWCH 3K6ZA 1YYY1 1P10A 4NZQA 2HNTE 3A8CA 5FPYA 1OKXA 1P04A 3Q3YA 2Z7FE 4THNH 1BZXE 1RRKA 1ABJH 1F0TA 1S85A 1UTKA 4ABBA 1CE5A 3GOVB 3TJOA 4IMZA 2SNVA 1LO6A 3NUMA 3LIWA 1NFYA 1OP2A 3PLBA 2PUQH 3RC4A 1W7GH 2LNCA 4HZHA 1C1RA 1UTJA 7ESTE 1OPHB 1SR5C 1WU1A 3TLOA 4F49A 4INLA 3QUMP 1DUAA 2WYJA 1D6RA 2NU0E 3I77A 2A31A 4U32A 4B75A 3UNSA 1C2DA 2P8OC 5L2ZH 1QB1A 3BF6H 3PO1B 3E90B 3SNBA 1C5UA 1WUNH 1CA0C 1MH0A 3TGJE 5EQSA 2VGCB 3KNXA 3V3MA 2QCYA 6CHAC 6GCHG 2G5VA 4K3JA 2GGVB 1HB0B 1EAWA 1F5RA 3Q76A 5EGMA 3BEFB 3MO3A 2PGQB 3HGPA 1BTZA 4GHQA 1XKBC 2OD3B 3M5NA 2FTMA 2R0KA 4ZKSU 3SN8A 4AGJA 2FXRA 3T26A 1G36A 3TGKE 3URDA 1JIRA 1EUFA 2ZA5A 3RLWH 1G2LA 1SHHB 5EXMA 1QCPA 3TJVA 2VVCA 4ABFA 1SGEE 2BXUH 3S9BA 1LCYA 1GMDG 1UK3A 2AGIX 3A8BA 1PQAA 4AFSA 2AMQA 1SGQE 3SO3A 4O3UA 3KCGH 1NESE 1HRTH 4Y7BA 1IQMA 1SVPA 2XXLA 3QGJA 2QXGA 2A4GA 5C1XA 1EZSC 5DK1A 2FZZA 1O3OA 3RM0H 1G30B 4KP0A 4AX9H 4X1PU 1INCA 2FWWA 2R2WU 1DWEH 1SGFA 3OY5U 4NSYA 4B76A 8ESTE 1VITH 3A7WA 1QIXB 1AY6H 1H9IE 4UFFH 3W95A 2B8OH 1HLTH 3VGCB 5ETXA 1YPLH 3A87A 4K1TA 4A1TA 1QL9A 6LPRA 4Y10E 1GI8B 1V2LT 1GBFA 2G5NA 3MNSA 4JYTA 3O8CA