3VPKA

Crystal structure of 6-guanidinohexanoyl trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Crystal structure of 6-guanidinohexanoyl trypsin near the optimum pH reveals the acyl-enzyme intermediate to be deacylated
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vpkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vpkA02
3VB5A 4B2BA 3QGJA 1ARBA 1S81A 1QB1A 1ESAA 2XXLA 4Y71A 2G4TA 3TK5A 4K3JA 1C2KA 4Y7BA 3RLYH 1LPZB 1W7GH 1HJAB 3H5CB 1P05A 3UQOA 2ALPA 5C1UA 1O3DA 4MTBA 2VU8E 1BTUA 1Z8RA 1ZLRA 1FXYA 1YCPK 5F8TA 1IHSH 3BTWE 3UIRA 2QN5T 1F5RA 1GI1A 1EAIA 1MH0A 1G3EA 1S83A 2GV7A 1ETRH 4ZKSU 1P0SH 9LPRA 3B23B 1O5BB 1LQEA 1XUHA 2ZEBA 1THRH 2ZFPH 2VH0A 3SO3A 4KTSA 3M5OA 3GDSA 4X8SH 1UTQA 5ABWA 1ZGVA 1O3NA 2BQWB 1MCTA 4GAWA 4Y6DA 2OUAA 4ZXYH 1W14U 5I25A 3GY2A 2CXVA 1KY9A 3CP7A 3NXPA 1Z1JA 1IQFA 2QA9E 4H42U 1GCTB 4J2YB 4CH8B 4ABHA 1SGDE 3GCOA 1DPOA 2FI4E 2FI5E 4I32A 1HV7A 3EYDA 4B2CA 4CRCA 5HM9A 2FI3E 1BRUP 7KMEH 4DW2U 3LOXA 2BQ7B 1SG8B 5LPRA 2WINI 1C5RA 1MD8A 2DE8A 3D23A 4OGXA 3A7XA 3STIA 1UJ1A 4AFSA 2PGBB 1BHXB 1DS2E 2JETB 3EE0B 3MYWA 2Z7FE 2PLXA 3A8CA 4FVDA 2A4OA 3F1SB 1BTHH 1DUAA 3NUMA 1RTFB 3TNTA 3S0NA 1SPJA 4IBLH 1IQLA 3PYHA 3MH5A 3BSQA 5GPIB 2J92A 1CT0E 1QQ4A 1A5GH 2ZCLP 4NA7A 4AFZA 1K1MA 1Y3XA 3TH4H 2GDDA 5F8ZA 3MHWU 1V3XA 2Q6FA 3QTOH 1K1OA 2VGCC 2BDHA 5A8YA 9ESTA 1CGHA 2V3HH 3A85A 2AMPA 2ALVA 1A2CH 4BXSA 1SGIB 5EU8A 1VZQH 2FOBA 3RMMH 1ABJH 1PQ5A 4XBCA 3M7UA 4CRBA 1KXFA 1RRKA 5F6MA 3ATLA 3GY8A 1K1PA 1AB9C 1KTSB 1S84A 4JZFH 2QAAA 1KIGH 2FLRH 4NCYA 1ANDA 4X1RU 2GTBA 3BTHE 3ESTA 2AMQA 2PHBA 4NIWA 4DY7B 1T8LA 4IMQA 2R9PA 3U98H 1QBVH 3RXOA 5CE1A 4MPUA 1B0FA 5FX6A 1T8NA 1DICA 2BVSH 1LKBA 3QO6A 1MKWH 5L6NH 3HKJB 1YGCH 3PLKA 1NT1A 4UFGH 2D26C 2FTLE 3FP6E 3QZRA 1AE5A 2W7UA 4KGAA 3BTGE 1NESE 2FM2A 1G9IE 3W95A 1G3BA 1ZSKA 2FOMB 3ZZ7A 4B2AA 4ABEA 4GCHG 1OWIA 1A0HB 1THSH 5AHGH 5DP7A 3I78A 2FX6A 4AFUA 1AN1E 3RMNH 2BOKA 1P2IA 1QR3E 1FPCH 3TJOA 3HATH 4MLFB 4A92A 1MU8B 4D9QA 3SZNA 2CMYA 4CRFA 1JMOH 1BJUA 2QF3A 1S6FA 3URCA 3RXCA 3ENSB 4ISNA 1D6WA 3QWCH 1HB0B 1O31A 2AIQA 3UOPA 4UD9H 4ZXXH 1E36B 1HGTH 4GLYA 3A81A 3KN2A 1MZAA 3A80A 1XM1A 1Q2WA 3KCGH 1L1JA 1SHHB 1IQNA 3MU1A 2F9UA 4K69A 1LHGH 5A0BA 1A46H 1C1TA 3P8FA 1J17T 4I8LA 3GCTG 3GCNA 5IDKA 4B1TA 1EZXC 1FZZA 4TY7A 1P2JA 3E0PB 1DITH 3SI4H 5EW2H 5AVDA 4B76A 1TGCA 2NU2E 4AB8A 2FWWA 1V2NT 3GISB 4O9VA 2IJOB 1GGDC 1BRAA 1UCYK 2FO9A 3PLPA 4UFEH 1GI7B 2BD4A 2OTVA 4K60A 3TLOA 1E0FD 3PMAB 3GCHB 1EPTA 1JIMA 1V2LT 1C4Y2 1LHEH 2Y81A 4GCHF 4M7GA 4ZHMU 3RXMA 1O35A 4IC6A 3RU4E 2VWOA 3EAJA 1YCPH 2VGCB 1F0SA 1XXDA 4ZAEA 1ZPBA 4ISOA 5J4SA 1QNJA 3D65E 1TX6A 4FXGH 3SV2H 4ZKNU 1ZSJA 1EOLA 3GDUA 4YLQH 3TVJB 3P8OA 1SGYE 3A86A 2H9TH 1O3PB 2HNTE 1AB9B 3QUMP 1A61H 1TA6A 2PUQH 4JZDH 2P94A 2GX4A 1N8OC 1A1RA 1GBTA 1DWCH 3EA8A 3SHCH 4AB9A 1Y5AT 2O9QA 4BAOB 1HJ9A 2ZWLH 3WY8A 2F83A 4A5TS 4HFPB 4YOGA 3R0FA 2ZECA 1QB9A 3GCTF 3K9XB 5BPEA 2ZDNA 3K2UA 1OWJA 3T29A 1AWHB 1O2MA 4LZ1H 2ZGJA 1P3EA 3T2NA 4INLA 1WUNH 5J4QA 2OCVB 3LIWA 4FU7A 2Q6GA 2A5KA 1OP8A 1W7XH 6GCHG 4X1NU 3RXQA 3V13A 1SHYA 2ZKSA 4YZUA 1PQAA 2JH6D 3M7QA 4K2YA 3PMBB 4Q7XA 3RXJA 3RXTA 4ZHAA 4IW4E 4THNH 1O3CA 2BD5A 4X2WA 4TYDA 1GVKB 1UTJA 1YPMH 1AKSB 1DM4B 1TNIA 3F6UH 4ABIA 2IOTA 2FPZA 1BA8B 3DFLA 3MH4A 1MTUA 3ZV9A 2H6MA 4A6LA 1Y3UA 1OWHA 1G32B 4LOYH 5DP3A 1DANH 5EPYA 3SN8A 3C1KA 3MNBA 4K8YA 3NZIA 3BTQE 4Y8YA 2D8WA 4X8VH 1MCVA 1TE0A 5DP8A 5EOKA 1NPMA 2OQUA 3KL6A 1GHYH 3PTNA 1ZZZA 1FNIA 4X6OA 3RU4D 5EQQA 1QQUA 2SGPE 3LH3A 2CF9H 1C5XB 2GT8A 1CU1A 1FPHH 3RXSA 5B6OA 4H6TA 1GMDF 2XC0A 4INKA 2XBWA 1GJ9B 5K0HA 5E8EH 4R8TB 2XNIA 1ZTLA 1FY5A 1GGDB 2R0LA 5ESTE 5K7RA 1WAYB 4I33A 3UNRA 2TBSA 3HGPA 3ZVAA 2I6SA 2HPQH 2FX4A 1P12E 3SU0A 1AWFH 4I8HA 6GCHF 1J16A 1P9UA 1C1MA 1W13U 1VITG 3QK1A 1GPZA 1BBRE 4K1SA 3Q00A 1TPAE 3P92A 5EQSA 1BCUH 1EJMA 3LKWA 3V3MA 3UTUH 2CJIA 1Z6JH 2ZQ1A 5GIBA 2QF0A 3NWUA 1Z7KA 3E90B 3A84A 3D49H 1SGRE 1V2UT 1S0RA 4KP0A 1O2LA 1T4UH 1XUGA 1C5YB 3ZZAA 1CVWH 4RSPA 3JZ1B 1JOUB 1S85A 1N8OB 1JRSA 4MDSA 1KDQA 1W11U 1BQYA 3H7TA 1TRMA 1BTWA 1TQ7B 1HAOH 2NU1E 4OS4A 3ZVEA 1C2MA 2A2XH 2ZDMA 2VNTA 1P04A 1KYNA 4HGCA 1EP6A 3KEEA 4AG2A 1DFPA 3VB4A 1CT2E 1HIAA 1WCZA 3CENA 1NRSH 4MG3A 2O8WA 1HXEH 1ANEA 2Z9LA 1N1LA 4AG1A 2J94A 3SNDA 3OY6U 3BG4C 1E34B 1CSOE 2HRVA 1TOMH 4Y10E 3ZZ5A 2W3IA 1UCYH 2BB4A 2A0QB 3GY4A 1EXFA 1GI0A 1LHFH 5T3HA 1VITF 2GZ7A 3U1IB 4E7NA 1F5LA 4AGJA 2ZHWH 1FUJA 4WH8A 2FDAA 4BAMB 2C8YB 2DE9A 3E6PH 1O3KA 1SL3A 1UTNA 1WSSH 4WXIA 4LXBH 1SSXA 3RXHA 1TIOA 3VB3A 4BAQB 1XUJA 1A3BH 1NO9H 2ZFFH 4AYYB 1DVAH 1FAKH 1P2QA 1ZRBA 2AGEX 4KTCA 3T62A 2P59A 1IAUA 1A7SA 1GHAF 2BM2A 2HGTH 1PPHE 1WTHD 3RMOH 1MU6B 1CA8B 1UK2A 4Y7AA 5E2OA 1FDPA 1G3DA 1SGFG 3SJKA 1LHDH 2TIOA 4I8KA 2A5AA 1LHCH 5E0HA 2QCYA 1BJVA 2BHGA 1MKXH 2WPJS 2Y80A 1SQOA 3SJIA 1NRNH 1SLXB 2JH5D 8LPRA 1BTXA 1OYQA 3IITA 3MI4A 3SV6A 3Q3YA 4WJG2 3P6ZB 2BY8X 2BZ6H 3QLPH 8ESTE 1NTPA 1V2RT 4Y0ZE 4XFQA 5C20A 1GWAA 1ORFA 2EI8A 2VIDA 5DPAA 5A2MH 1EASA 2LNCA 1O2PA 1O3LA 2FOHA 1ZGIA 2P3FH 2XWAA 2O8MA 2BX4A 1MKWK 1BHXF 2XBVA 2PKSC 4KTUA 1GHBF 1D3TB 2XBXA 1SQTA 2BY9X 2GKVE 1NN6A 1XKAC 2PSXA 3SUGA 2BX3A 3ZZ9A 1LVOA 2ZU4A 1OPHB 3LC5A 1D3PB 4Q2KA 3LGTA 1ACBE 3P95A 1ZHMA 1PQ7A 4FU8A 1IQGA 1V2ST 1HUTH 3OX7U 1FLEE 1P2OA 3OU0A 4GHQA 2GMTC 1V2KT 1O0DH 2QXHA 2SFAA 3A8AA 5EG4A 3P17H 2ZCKP 3F9EA 1TPSA 2YNBA 1HBTH 1GJ7B 4MVNA 1X7AC 1D9IA 1TPPA 4CR9A 2BXUH 2P8OC 1TLDA 2GVFA 3ATWA 1QFKH 1KXBA 3ATMA 4YT7H 1V2VT 1NFUA 1FONA 3MO9A 2FS8A 1QJ6B 2XW9A 2AYWA 1DDJA 3UNSA 1GVLA 2J9NA 3LGWA 3UWIA 4I7YH 5A8XA 3LONA 2BD7A 3DA9B 2PTNA 3SUFA 3BG4B 1MUEB 1NROH 3OYPA 3SQHE 1GDUA 4Z6AH 4U2WA 3E3TA 4XE4A 4F49A 1N6XA 1C1SA 2ZPSA 1T31A 4XSKU 4YO9A 4UONA 4Q80A 1ELFA 3SI3H 5JYIA 1AZZA 1HAPH 2ZFSA 3TGKE 1GBDA 1VJAU 3M36A 3UR6A 3GICB 2SGQE 2ZGXH 2EEKA 1J14A 1C4U2 1HYLA 2ZIQH 3SU6A 3SW2B 1GL1A 2V35A 2G51A 4U32A 1LPKB 5C1YA 1GVZA 1S5SA 1TGTA 1FY3A 2F9PA 1PFXC 5JBAS 1FIWA 1O2RA 2AERH 3BTTE 1L0ZA 1AY6H 3G01A 3RXIA 3E91A 1C9PA 1VGCC 4X8TH 3M3TA 1G3CA 4OS1A 4MNVA 2BY7X 4X2XA 2AIPA 5ESBA 2GCTC 4H4FA 5JBCS 1H4WA 2A7HA 1AZ8A 5L2YH 4AYVB 1EAWA 1RJXB 1TA2A 1RGQA 4BTIB 4BOHA 7GCHF 2H5CA 1TYNA 2A7JA 4NIXA 1QCPA 1YKTA 1GI6A 1QA7A 2Z3CA 2LPRA 4UFDH 2PKSB 1GDQA 3RLWH 1L4DA 2ANYA 1BMNH 1W3CA 2UWOA 4JZIA 5DG6A 1ELEE 4CRAA 3S7KB 2HWLB 2XTTB 3S9BA 1FMGA 2TRMA 4MNXA 3HK6B 4XBBA 1IHTH 3ZVCA 3TK9A 2VVUA 4NZQA 1EATA 1DWDH 3ELAH 3EGKH 2GMTB 1IQJA 1BTYA 2BLWA 1K9OE 5DJ7A 1O3GA 1HDTH 1V6DA 2XCNA 3U9AH 2G5VA 1JIRA 1OWDA 2P8OB 3M3VA 5EQRA 3A8DA 1YPGH 2WPIS 4OS5A 5JBBS 3OTJE 3V7TA 5EPNA 1MMJN 3JZ2B 2Z9IA 3BV9B 1Y3VA 4JK6A 2A5IA 2XC4A 3DT0H 5EXMA 3HPTB 5GJ4B 5LGOA 3OY5U 3VPKA 3HK3B 5AF9H 1YP9A 5DP9A 1F92A 1ID5H 1AI8H 4HTCH 2FOEA 4WH6A 2Z6BD 1UVTH 1MD7A 1JRTA 1MTNC 5DP6A 6CHAC 2HVXA 3TGIE 1O2QA 3ATIA 1C2GA 2O8LA 1BZXE 2RCEA 2GGVB 2UUJB 5JDUB 1ZMLA 2ASUB 3RXKA 1AUJA 4FUHA 2A7CA 2TPIZ 2PW8H 2A4GA 4IGDA 4F4OC 3LC3A 3U1JB 2PKAB 3RXEA 3FZZA 4NGAH 1V2PT 2ODQA 2H5DA 4FUFA 4B73A 1O3EA 4NG9H 2FOAA 3T5FH 1C2HA 1SGEE 3VXFH 3AW0A 4HZHA 1CGIE 1TBQH 4Y0YE 2VVVA 1GJCB 1SMFE 3PWBA 2W26A 2RDLA 3DUXH 1VGCB 1GJAB 3EQ0H 2C4FH 3PROA 1TBZH 3RXFA 2GCTB 1NU9A 1DXPA 2H1UA 2BD8A 2ZC9H 3BEFB 1AKSA 3ZZBA 2ZQ2A 4I31A 2UWLA 5TCAA 3MWIU 3RXGA 1FY4A 2TGDA 1V2MT 3EDXB 2A4QA 4ESTE 3A87A 3UWJH 1QL9A 2FIRH 2H9EH 3P8GA 1JXPA 3U8RH 1C2FA 2ZFTA 2GP9B 2GD4B 3PV4A 3O8CA 2OC0A 2ZCHP 4JZ1A 4JYTA 2PR3A 2J34A 1G37A 4OS6A 4D8NA 1O2OA 2ZHDA 3E1XB 3MFJA 3O8RA 2QXGA 1XXFA 1GHVH 1SGCA 2A4RA 2BTCE 2Q6DA 1G2LA 2BD9A 1K2I1 4FU9A 2ZHFH 4X8UH 3O8BA 3M5MA 5C67A 1EPTC 1DWBH 2WYJA 4NFEA 3RM0H 1SB1H 4DGJA 1HJ8A 1L4ZA 1ZTKA 2Z3DA 5F03A 1O3OA 2QYIA 2ZHQH 1GCDA 1K22H 1O2YA 1MBMA 3SJ8A 3L3TA 2BVRH 3TJUA 1OYTH 2PV9B 5DGJA 4FUCA 1H8DH 1O3HA 1QB6A 1ELTA 4WMFA 1MKXK 1O3BA 3M7TA 2GT7A 1MTNB 6CHAB 2QGRA 3A88A 3UPEA 2BDBA 4IMZA 1YM0A 4JMYA 3ODDA 5FPSA 3UNQA 5HXFA 1DUEA 1GDNA 5LH8A 4DG4A 1O39A 1O5CB 3P70B 3F9GA 1UK3A 1C1QA 3UOUA 2ULLA 3QTVH 5L30H 2C8XB 1NRQH 3TK6A 1SVPA 1EZUC 2FZZA 3UY9A 1SGQE 5T6FA 1VR1H 1TOCB 4XBDA 1SQAA 3LJOA 2C3SA 2HNTF 2R2MB 1P2NA 1VITH 4IN2A 4ABFA 2OINA 1BITA 4X6PA 1BMLA 1C2DA 2QXIA 2KAIB 5L2ZH 5C5OA 1GMCG 3RU4T 1P2KA 4A1TA 4CREA 1W12U 5PTPA 4KELA 2V3OH 1ZPCA 4ZMAH 1TABE 2BXTH 3TH2H 1GBIA 1P06A 2ZNKH 2F9VA 4DVAU 1MAYA 5GXPA 4WF8A 4ZKRU 1TMTH 4HI3A 3ZZ4A 2UUYA 1GI2A 2A45B 4ISLA 1HNEE 3RXUA 2PSYA 1OXGA 2QIQA 1QIXB 1WU1A 1EB1H 1ETSH 1UHBB 4WMEA 4DIIH 2BY6X 2STBE 1SGPE 4O03A 1CQQA 1THPB 2CHAC 3SV9A 4YESB 2ZA5A 2SGFE 4O3UA 4OS7A 2VIVA 1K1LA 2BOHB 2Z9GA 5JB9S 1BB0B 5A8ZA 4ABBA 1ZSLA 2ZTXA 3PB1E 1KXAA 1O3MA 2ODPA 1O2NA 3ZV8A 5FAHA 2GDEH 2ANKH 2PGQB 5ETXA 1GI5A 2FS9A 4ABGA 1OS8A 3W94A 3B9FH 3A7YA 1C5MD 4TWWA 1OWEA 1MTSA 1GBFA 1TB6H 1RD3B 2XYAA 3SU1A 1CA0C 1DXWA 1HAGE 5FCRA 1O34A 3RXPA 1O3IA 1TMBH 1C1UH 4YM9A 3PWCA 5EXNA 2D2DA 4FUIA 4K5ZA 4YLUA 1QTFA 3UQVA 1YLCA 1UTOA 4PROA 2ANWA 2BDGA 2WYGA 3RUOA 4MNYA 1EAUA 1NRPH 3SU5A 2YOLA 1PPCE 3BIVH 3QZQA 4IS5A 3M61U 1YPEH 2F9OA 1A4WH 2Z3EA 5E2PA 4DT7B 1H9IE 4TPIZ 3RDZA 1B5GH 2BDAA 1GG6C 1H9HE 3EA7A 4D9RA 1NC6A 5DKMA 2A2QH 1TGSZ 4D76A 2OBQA 1IQEA 2VVCA 1O2XA 1AHTH 2W3KA 2AMDA 2ILNA 1GBEA 1ZHPA 2H2ZA 1H9LB 1HAZB 4GPGA 3V0XA 1XUKA 1C5PA 1C1RA 1SLUB 2RG3A 1K1NA 4O97A 3T25A 1GJ5H 4MPXA 3RXBA 1UTMA 2OQ5A 3SNEA 1ZMNA 3TU7H 1AVWA 2WPHS 4A1VA 1Z8IB 3SGBE 2FTMA 3A8BA 3BTEE 4A7IB 2BZAA 1BMAA 1KLJH 2ZGBH 3DHKH 2W7SA 1F2SE 1UO6A 4RKJB 3SNBA 4X0WU 2P93A 1AVXA 2FYQA 1XUFA 1DY9A 3TGJE 3KF2A 2ZU2A 4JYUH 3KIDU 1NRRH 5E0JA 5T6GA 4DIHH 2FODA 1LKAA 1M9UA 4TPYA 4XDEA 2AGIX 1UTPA 2ZGHA 4BAHB 1ZPZA 1P03A 1C2LA 1TWXB 3QN7A 2QXJA 1QBOA 2CHAB 2FYRA 1A5IA 4E7RG 1GMHG 2FEQH 3TJNA 1T32A 2HLCA 3V12A 5HYOA 4CBOA 2C90B 1O2IA 3FP7E 4CRGA 1W0ZU 2CV3A 1GJ4H 1PYTC 1WOFA 3ODFA 1D4PB 1GI8B 1SC8U 1JWTA 1O38A 2UWPA 4BAKB 1C9TA 3MTYA 2ZU5A 3SU4A 5FPYA 2BQ6B 3KNXA 2IN2A 2ANMH 2BLOA 3GDVA 3L6PA 3RXRA 1OWKA 5FBIA 3UUZA 1T8OA 1Y5UT 1CA0B 1SOZA 2R2WU 4I8GA 4Y79A 4NZLA 1A3EH 1AUTC 2PWXA 1LVYA 4Q7ZA 3KQBA 3ZZ6A 3BTME 1F0RA 1YPJH 3LJJA 3Q77A 2BLQA 4VGCC 1DY8A 1TONA 3MNSA 4AN7A 1FQ3A 1VCQA 1K1JA 1ZJDA 1UTKA 1GCTC 1Y59T 1ANBA 4NWKA 1P57B 4U01A 1W0YH 1TNLA 1RFNA 1O5GH 3S69A 2K1QA 5A0AE 1OOKB 4YTAA 1O2VA 1YLDA 1C5ZB 2OLGA 1PYTD 3ZYEA 4AOQA 1IQKA 3A7ZA 1XKBC 3QGNB 4UEHH 4Y8XA 4ZROA 2JETC 1AE8H 4ABDA 1C1WH 1HRTH 2SNWA 2R3UA 2SGEE 2VIPA 1C2IA 5GWZA 4BNRA 1BUIA 4BXWA 3AAVA 1P3CA 1HXFH 3SJOA 1NU7B 1J8AA 1ELVA 3SOSA 1ESTA 1MTWA 2FXRA 1ELBA 4GHTA 3K65B 1GJDB 1XVMA 1TNGA 3GYMA 3A7VA 2ZPQA 2BMGB 1S0QA 5F8XA 4YOIA 4CHAC 1SGFA 2QY0B 3K6ZA 4CRDA 1QL7A 3ATKA 3BEUA 1UCYE 1WBGB 4AZ2B 3BG8A 1AD8H 1CHOG 1QA0A 1Y3WA 2BYAX 3VB7A 1DWEH 2J4IA 3STJA 1SLVB 2Y5FA 2ZU1A 4Q7YA 5DP4A 4IC5A 4JCNA 4GSOA 2BDIA 3VGCC 2F3CE 2TGTA 1RXPA 2ZFQH 3PMHB 1OSSA 3Q3KA 1O3AA 2VB0A 5LPFA 1O5FH 3E8LA 1KLTA 1YPHC 1AVGH 2QV1A 2GCHG 2OC7A 3NKKA 3ZZ8A 1TBRH 3RC4A 1DSUA 3SORA 5CHAC 5C1XA 3U8TH 1O2SA 1Q31A 1SGNE 1IQMA 1P2MA 1O5DH 2PKAA 2BD3A 1GBMA 2FLBH 2ZDAH 1SFQB 5FX5A 1C5QA 1YBWA 3UR9A 2Z94A 3ZVGA 4WMDA 1DE7H 1H1BA 2JKHA 1BBRK 1N6YA 1D3DB 3GY6A 3K6YA 4FUJA 1C5NH 2PUXB 2CF8H 2PFEA 3MMGA 3FP8E 3RXVA 2GZ8A 2M5TA 2ZP0H 3PLBA 2CN0H 1ESBA 4WY3A 1IOEA 4B74A 2WPKS 4FUEA 2BDYA 1JBUH 1CBWC 3LDXH 3A7WA 2ZGCA 1TNKA 1ZRKA 2EI7A 1HAVB 1NFXA 5JB8S 3O8DA 4VGCB 3BTKE 5EW1H 4NA9H 1TQ0B 2NU3E 1CHOF 2IPHA 1GHXH 1EAXA 4BANB 2HPPH 1V2OT 3VEQB 1BRCE 1ANCA 1P09A 3A83A 2WUCA 1EUFA 1UVOA 2ZG0H 3MOCA 2GCHF 5C5NA 3TH3H 3M5LA 3A7TA 2Q1JA 3SHAH 1W2KH 3H7OA 1AQ7A 3NK8A 1EOJA 1J9CH 5HGGA 1LCYA 2W5EA 1C5VA 3T27A 4D7GA 4H6SB 1KXCA 3ITIA 1O3JA 3M5NA 2P16A 1SR5C 1EP5A 2HALA 2WV4A 3KGPA 3MO6A 3BF6H 5TJXA 3KHVA 5FHTA 3GCHC 1EX3A 2C93B 3TIUA 3MNCA 4CHAB 1ETTH 2Y5GA 4WXVA 2EC9H 5EODA 1UK4A 3SQEE 3AVZA 3RC6A 4NSVA 1TX7A 4NSYA 1GJ8B 1Z6EA 1ELGA 2R0KA 1MTVA 4FUBA 2B8OH 4R0IA 1XX9A 6LPRA 2B9LA 1B0EA 1AIXH 2THFB 4YOJA 3Q3XA 1CGJE 3U8OH 4X6NA 1QRXA 1PPZA 3GY5A 5EGMA 3FVFB 1HFDA 3VGCB 2AGGX 4TWYA 1GBLA 3MNXA 2ZZUH 4ABJA 3S9CA 1O2ZA 3ZVFA 2P3TB 1F5KU 3HGNA 5FXLA 1F0UA 3HKIB 1TGBA 1ABIH 5CHAB 2A31A 1F0TA 4Y11E 4X6MA 1O33A 4NFFA 4X2YA 4LZ4B 1V2WT 1YCPM 2B5TB 4ISHH 4B71A 4Z0KA 3SUEA 1DX5M 1WQVH 3C27B 1FV9A 1KXDA 5SGAE 1CE5A 1O2TA 1TMUH 1Y5BT 2ZFRH 2XC5A 3SGQE 2VWLA 1YPLH 3URDA 2KAIA 2R3YA 4NIYA 3L33A 5FCKA 2BVXH 1GJBB 3BN9A 3GY3A 5FBEA 4ZH8A 1CBWB 3BEIB 4JZEH 1AFQC 5DK1A 3B8JA 1C5LH 2FMJA 3KQEA 3SNCA 3IWMA 4CH2B 3DFJA 3AASA 1K1IA 4I8JA 1SFIA 1C2EA 1AGJA 1HCGA 3SJ9A 1QRZA 3S9AA 1UHBA 1O36A 1Z71A 4UFFH 4OGYA 3ZYDA 3SGAE 4SGBE 1SBWA 3M35A 1WQSA 1NFYA 1T8MA 5JPMH 1BIOA 1OKXA 3F9HA 1TGNA 1OX1A 4DCDA 2A32A 2ZTZA 1HLTH 1LO6A 1AU8A 4X2VA 1EZSC 1LVMA 3OSYA 2EI6A 3LPRA 4ZKOU 3TNSA 1ELCA 2XBYA 2G55A 3PMJA 1V2JT 1ZHRA 2ZO3H 3UFAA 2DUCA 3CS7A 1EZQA 1GJ6A 2GV6A 1FY1A 3FAOA 2RA0A 3PO1C 1C5OH 1C5UA 2V0BA 4ISIH 4BTTB 3D62A 1E37B 2AEIH 1TALA 1BBRH 3BTFE 4AFQA 1IQHA 1UVUH 1D6RA 2Y7ZA 2ZTYA 1GBHA 5FPTA 2RA3A 2P95A 2Z9KA 1Y8TA 7ESTE 4BTUB 1T4VH 2TGPZ 2AH4X 1YPKH 1HAHH 2O8TA 1FJSA 1PPBH 1WV7H 5AFZH 3I29A 3RP2A 4JYVH 2BD2A 4YT6H 1TRNA 3MU4A 1GBKA 4RN6A 2C8ZB 4FVBA 1P01A 1WYKA 4WWYA 1QY6A 4J1YA 3SUDA 4X1QU 1O2UA 1RTLA 1OP0A 4ABAA 1TNJA 1LVBA 1TAWA 4OS2A 1GMDG 1TRYA 1Z8GA 3F68H 5DP5A 1C1NA 2G00A 1A5HA 3R3GB 3GOVB 1GBJA 1O2WA 1GHWH 3FFGA 1G2MA 3MH7A 1NFWA 1OP2A 1C5TA 3GYLB 4ZUHA 4D7FA 3NCLA 4UE7H 4IN1A 4MNWA 3T28A 1SI5H 2OD3B 1QJ1B 1PJPA 3RC5A 2FP7B 2OC1A 1GI4A 3TPIZ 1P9SA 1SGTA 2BY5X 2HNTC 2ZDVH 3M3SA 1AFQB 2B7DH 3RXLA 4E06H 1FI8A 3LGYA 4KKDA 1NS3A 1K28D 2G52A 3IG6B 1HPGA 1EKBB 1EQ9A 1GBCA 2FESH 1V2QT 4AORA 1LDTT 1ZR0A 1C2JA 1XMNB 1ZOMA 2WPMS 1BTPA 1P02A 3RXDA 2I6QA 3LGUA 1NZQH 3SV8A 4GVUA 2VIWA 2G8TA 1V2TT 1C5SA 2TGAA 2OXSA 5A09A 1EJNA 2F91A 1O3FA 2YNAA 2HOBA 2NU4E 1S82A 1QJ7B 1C1VH 1CO7E 2BDCA 1EPTB 1TX8A 3ZVBA 5GCHG 5H4IB 1DOJA 1UVSH 3RM2H 1FY8E 1U6QA 1GMCF 2PTCE 4QT8C 6ESTA 1O2KA 1CHGA 1O2HA 4RKOB 1XVOA 3SBKA 3BIUH 1BTZA 1KLIH 3PO1B 1PQ8A 1Z1IA 3VXEH 3E16B 2VIQA 1QRWA 4E05H 3KQDA 1ZTJA 2SGAA 2VJ1A 1D3QB 1MQ6A 1O5EH 4MPWA 1P8VC 4JK5A 1TFXA 1TNHA 2FOFA 3AW1A 3RMLH 5A0CA 3P8NA 4XOJA 2ZF0H 4Y76A 1A0JA 1ZYOA 3VFEA 1H8IH 1FN8A 1O2GH 2CGAA 3LH1A 1AO5A 4Y8ZA 1O37A 3BTDE 1P11E 2VWMA 4DOQA 1KXEA 1J15A 1QHRB 3RXAA 3KQCA 1GHAG 3LGVA 4U30A 1S6HA 1T7CA 2P3UB 2VIOA 1UVPA 3MO3A 4CBNA 1EB2A 3ZZ3A 3A89A 3PM3A 3U69H 1PPFE 2ESTE 1YC0A 4ZHLU 2NU0E 1VJ9U 3M37A 3TJVA 1RTKA 1SLWB 1ZMJA 2G81E 5HMAA 4DURA 3N7OA 2ZHEH 1AFEH 1INCA 2G5NA 3E0NB 3NPSA 1QGFA 4O3TA 1ELDE 1G36A 1UTLM 5DO4H 1GBAA 2F9NA 1O30A 5I46H 1MZDA 2QC2A 2WPLS 1GL0E 2J38A 3MH6A 2STAE 5GCHF 2XCFA 3LGIA 4WVPE 1E38B 1A0LA 3SU2A 4K1TA 1RIWC 3LU9B 1K21H 3CS0A 1Q3XA 3MU8A 1HAXB 2GZ9A 1GI9B 1DT2A 1VCWA 4INHA 1YYY1 1DSTA 4MQAA 1GHBG 5JBTA 1BDAA 3S7HB 2VINA 1Z8JB 1MAXA 3A82A 3QDZB 3SU3A 3TITA 8GCHG 2XRCA 1UMAH 1HJAC 1W10U 1C1OA 1GHZA 1W8BH 2Y7XA 2Y82A 3ZZDA 1GBBA 5LPEA 4NA8A 4DJZB 1C4V2 1QURH 2FOCA 4NIVA 1B7XB 1ARCA 4MPVA 1C5WB 5C2ZA 1VCPA 1NY22 2B0FA 3MU0A 3FANA 4CR5A 3I77A 2ZPRA 4A1XA 1LPGB 5BRRE 1TPOA 3EA9A 1MQ5A 3T26A 4K1EA 1XUIA 3Q76A 2H9HA 2J2UA 2BLVA 1ZJKA 1KSNA 1MBQA 4K8BA 8KME2 3MU5A 2VWNA 1NM6A 3SNAA 2Y6TA 1LTOA 3FZDA 2ZDLA 2AFQB 1C1PA 1O32A 1G30B 1Y3YA 4SGAE 4TY6A 1EJAA 1HAIH 2WV5A 1PPEE 5CMXH 1GG6B 1HAVA 1FIZA 2A1DB 1BT7A 2EA3A 4B75A 1FAXA 1BMMH 1P10A 1QBNA 3VB6A 1AMHA 2VH6A 2V6NA 2OBOA 1GI3A 2ZI2H 1BOQA 4GUXA 5G4BA 2UUFB 8GCHF 1LMWB 5EXLA 1GMHF 3DD2H 4AGKA 4X1SU 1KDQB 1O2JA 2C8WB 5E0GA 2Z9JA 2ODYB 2UUKB 1YPHE 3SV7A 2G4UA 1E35B 1L1NA 1WTGH 3GY7A 1BRBE 4NWLA 4FUGA 1PPGE 1L2EA 1QL8A 5IYTA 1DLKB 1RS0A 4X1PU 1O5AB 2OC8A 3QX5H 2XWBI 5HM2A 1ELAA 1HIAB 2SGDE 3ZZCA 4UDWH 2D1JA 3PTBA 2F9BH 5T6DA 1HAYB 1KTTB 5C3NA 4AX9H 2JH0D 2ZDKA 1IQIA 1CT4E 2ZU3A 2WUBA 3UREA 3ZVDA 7LPRA 1SOTA 2FOGA 1YF4A 1FN6A 1DLEA 1RIWB 2NWNA 3AAUA 2O8UA 7GCHG 2OP9A 2J95A 4LK4A 5AFYH 3F9FA 1LQDB 4FUDA 1F7ZA 3LT3A 1L1GA 2Y5HA 2AS9A 5GDSH 2SNVA 4ASHA 5TCCA
chains in the Genus database with same CATH superfamily
3VB5A 4B2BA 3QGJA 1ARBA 3OFND 1S81A 1QB1A 1ESAA 2XXLA 4Y71A 2G4TA 3TK5A 4K3JA 1C2KA 4Y7BA 3RLYH 1LPZB 1W7GH 1HJAB 3H5CB 1P05A 3UQOA 2ALPA 5C1UA 1O3DA 2KCYA 4MTBA 2VU8E 1BTUA 1Z8RA 1ZLRA 1FXYA 1YCPK 5F8TA 1IHSH 3BTWE 3UIRA 2QN5T 1F5RA 1GI1A 1EAIA 1MH0A 5EJ1A 1G3EA 1S83A 2GV7A 1ETRH 4ZKSU 1P0SH 9LPRA 3B23B 1O5BB 2KCOA 1LQEA 1XUHA 2ZEBA 1THRH 2ZFPH 2VH0A 3SO3A 4KTSA 3M5OA 3GDSA 4X8SH 1UTQA 4I86A 5ABWA 1ZGVA 1O3NA 2BQWB 1MCTA 4GAWA 4Y6DA 2OUAA 4ZXYH 5HIZA 1W14U 5I25A 3GY2A 2CXVA 1KY9A 3CP7A 3NXPA 1Z1JA 1IQFA 2QA9E 4H42U 1GCTB 4J2YB 4CH8B 4ABHA 1SGDE 3GCOA 1DPOA 2FI4E 2FI5E 4I32A 1HV7A 3EYDA 4B2CA 4CRCA 5HM9A 2FI3E 1BRUP 7KMEH 4DW2U 3LOXA 2BQ7B 1SG8B 5LPRA 2WINI 1C5RA 2OK5A 1MD8A 2DE8A 3D23A 4OGXA 3A7XA 3STIA 1UJ1A 4AFSA 2PGBB 3DSGA 1BHXB 3OAAD 1DS2E 2JETB 3EE0B 3MYWA 3MQKC 2Z7FE 2PLXA 3A8CA 4FVDA 2A4OA 3F1SB 1BTHH 1DUAA 3NUMA 1RTFB 3TNTA 3DSOA 3S0NA 1SPJA 4IBLH 1IQLA 3PYHA 3MH5A 3BSQA 5GPIB 2J92A 1CT0E 1QQ4A 1A5GH 2ZCLP 4NA7A 4AFZA 1K1MA 1Y3XA 3TH4H 2GDDA 5F8ZA 3MHWU 1V3XA 2Q6FA 3QTOH 1K1OA 2VGCC 2BDHA 5A8YA 9ESTA 1CGHA 2V3HH 3A85A 2AMPA 2ALVA 1A2CH 4BXSA 1SGIB 5EIYA 5EU8A 1VZQH 2FOBA 3RMMH 1ABJH 5HKKD 1PQ5A 4XBCA 3M7UA 4CRBA 1KXFA 1RRKA 5F6MA 3ATLA 3GY8A 1K1PA 1AB9C 1KTSB 1S84A 4JZFH 2QAAA 1KIGH 2FLRH 4NCYA 1ANDA 4X1RU 2GTBA 3BTHE 3ESTA 2AMQA 2PHBA 4NIWA 4DY7B 2IJD1 1T8LA 4IMQA 2R9PA 3U98H 1QBVH 3RXOA 1BMFD 5CE1A 4MPUA 5EJZA 1B0FA 5FX6A 1T8NA 1DICA 2BVSH 1LKBA 3QO6A 1MKWH 5L6NH 3HKJB 1YGCH 3PLKA 1NT1A 2K8IA 2D26C 4UFGH 2V3MA 2FTLE 3FP6E 3KYFA 3QZRA 1AE5A 2W7UA 4KGAA 3BTGE 1NESE 2FM2A 1G9IE 3W95A 1G3BA 1ZSKA 2FOMB 3ZZ7A 4B2AA 4ABEA 4GCHG 1OWIA 1A0HB 1THSH 5AHGH 5DP7A 3I78A 2FX6A 4AFUA 1AN1E 3RMNH 2BOKA 1E79D 1OHHD 1P2IA 1QR3E 1FPCH 3TJOA 3HATH 4MLFB 4A92A 1MU8B 4D9QA 3SZNA 2CMYA 4CRFA 1JMOH 1BJUA 2QF3A 1S6FA 3URCA 3RXCA 3ENSB 4ISNA 1D6WA 3QWCH 1HB0B 1O31A 2AIQA 3UOPA 4UD9H 4ZXXH 1E36B 1HGTH 4GLYA 3A81A 3KN2A 1MZAA 3A80A 1XM1A 1Q2WA 3KCGH 1L1JA 1SHHB 1IQNA 3MU1A 2F9UA 4K69A 1LHGH 5A0BA 1A46H 1C1TA 3P8FA 1J17T 4I8LA 3GCTG 3GCNA 5IDKA 4B1TA 1EZXC 1FZZA 4TY7A 3W1EA 1P2JA 2F4LA 3E0PB 1YY3A 1DITH 3SI4H 5EW2H 5AVDA 4B76A 1TGCA 2NU2E 4AB8A 2FWWA 1V2NT 3GISB 4O9VA 2IJOB 1GGDC 1BRAA 1UCYK 2FO9A 2F43B 3PLPA 4UFEH 1GI7B 2BD4A 2OTVA 4K60A 3TLOA 1E0FD 3PMAB 3GCHB 1EPTA 1JIMA 1V2LT 2GJGA 1C4Y2 1LHEH 2Y81A 4GCHF 4M7GA 4ZHMU 3RXMA 1O35A 4IC6A 3RU4E 2VWOA 3EAJA 1YCPH 2VGCB 1F0SA 1XXDA 4ZAEA 1ZPBA 4ISOA 5J4SA 1QNJA 3D65E 1TX6A 4FXGH 3SV2H 5B6LA 4ZKNU 1ZSJA 3U28C 1EOLA 3GDUA 4YLQH 3TVJB 3P8OA 1SGYE 3A86A 5CDFE 2H9TH 1O3PB 2HNTE 1AB9B 3QUMP 1A61H 1TA6A 1FX0B 2PUQH 4JZDH 2P94A 2GX4A 1N8OC 1A1RA 1GBTA 1DWCH 3EA8A 3SHCH 4F55A 4AB9A 1Y5AT 2O9QA 4BAOB 1HJ9A 2ZWLH 3WY8A 2F83A 2J97A 4A5TS 4HFPB 4YOGA 3R0FA 2ZECA 1QB9A 1H8HD 3GCTF 3K9XB 2ZDNA 5BPEA 3K2UA 1OWJA 3T29A 1AWHB 1O2MA 4LZ1H 2ZGJA 1P3EA 3T2NA 4INLA 1WUNH 5J4QA 2OCVB 3LIWA 4FU7A 2Q6GA 2A5KA 1OP8A 1W7XH 6GCHG 4X1NU 3RXQA 3V13A 1SHYA 2ZKSA 4YZUA 1PQAA 2JH6D 3M7QA 4K2YA 3PMBB 3FKSD 4Q7XA 3RXJA 3RXTA 4ZHAA 4IW4E 4THNH 1O3CA 2BD5A 4X2WA 4TYDA 1GVKB 1UTJA 1YPMH 1AKSB 1DM4B 1TNIA 3F6UH 4ABIA 2IOTA 2FPZA 1BA8B 3DFLA 3MH4A 1MTUA 3ZV9A 2H6MA 4A6LA 1Y3UA 1OWHA 1G32B 4LOYH 5DP3A 1DANH 5EPYA 3SN8A 3C1KA 3MNBA 4K8YA 3NZIA 3BTQE 4Y8YA 2D8WA 4X8VH 4B6FA 1MCVA 1TE0A 5DP8A 5EOKA 1NPMA 2OQUA 3KL6A 1GHYH 3PTNA 1ZZZA 1FNIA 4X6OA 3RU4D 5EQQA 1QQUA 3GS9A 2L74A 2SGPE 3LH3A 2RFKC 2CF9H 1C5XB 2GT8A 1CU1A 1FPHH 3RXSA 5B6OA 4H6TA 1GMDF 2XC0A 4INKA 2XBWA 1GJ9B 4M9FA 2QE7D 5E8EH 5K0HA 4R8TB 4ZCNA 2XNIA 1ZTLA 1FY5A 1GGDB 2R0LA 5ESTE 5K7RA 1WAYB 4I33A 3UNRA 4ACAA 2TBSA 3HGPA 3ZVAA 2I6SA 2KFWA 2HPQH 2FX4A 1P12E 4OM9A 4TSFD 3SU0A 1AWFH 4I8HA 6GCHF 1J16A 1P9UA 1C1MA 1W13U 1VITG 3F2GA 3QK1A 1GPZA 1BBRE 4K1SA 3Q00A 1TPAE 3P92A 5EQSA 1BCUH 1EJMA 3LKWA 3V3MA 3UTUH 2CJIA 5FL7D 1Z6JH 2ZQ1A 5GIBA 2QF0A 3NWUA 1Z7KA 3E90B 3A84A 3D49H 1SGRE 1V2UT 1S0RA 4KP0A 1O2LA 1T4UH 1XUGA 1C5YB 3ZZAA 1CVWH 4RSPA 3JZ1B 1JOUB 1S85A 1N8OB 1JRSA 4MDSA 1KDQA 1W11U 1BQYA 3H7TA 1TRMA 1BTWA 1TQ7B 1HAOH 2NU1E 3F0OA 4OS4A 3ZVEA 1C2MA 2A2XH 2ZDMA 2VNTA 1P04A 1KYNA 4HGCA 1EP6A 3KEEA 4AG2A 1DFPA 3VB4A 1CT2E 1HIAA 1WCZA 3CENA 1NRSH 4MG3A 2O8WA 1HXEH 1ANEA 2Z9LA 1N1LA 4AG1A 2J94A 3SNDA 3OY6U 3BG4C 1E34B 1CSOE 2HRVA 1TOMH 4Y10E 3ZZ5A 2W3IA 1UCYH 2BB4A 2A0QB 3GY4A 1EXFA 1GI0A 1LHFH 5T3HA 1VITF 2GZ7A 3U1IB 4E7NA 1F5LA 4AGJA 2ZHWH 1FUJA 4WH8A 2FDAA 4BAMB 2C8YB 2DE9A 2J98B 3E6PH 1O3KA 1SL3A 1UTNA 1WSSH 4WXIA 4LXBH 1SSXA 3RXHA 1TIOA 3VB3A 4BAQB 1XUJA 1A3BH 1NO9H 2ZFFH 4AYYB 1DVAH 1FAKH 1P2QA 1ZRBA 2AGEX 4KTCA 3T62A 2P59A 1IAUA 1A7SA 1GHAF 2BM2A 2HGTH 1PPHE 1WTHD 3RMOH 1MU6B 1CA8B 1UK2A 4Y7AA 5E2OA 1FDPA 1G3DA 1SGFG 3SJKA 1LHDH 2TIOA 4I8KA 2A5AA 1LHCH 5E0HA 2QCYA 1BJVA 2BHGA 1MKXH 2WPJS 2Y80A 1SQOA 3SJIA 1NRNH 1SLXB 2JH5D 8LPRA 1BTXA 1OYQA 3IITA 3MI4A 3SV6A 3Q3YA 2J5UA 4WJG2 3P6ZB 2BY8X 2BZ6H 3QLPH 2W6JD 8ESTE 1NTPA 1V2RT 4Y0ZE 4XFQA 5C20A 1GWAA 1ORFA 2KZ4A 2PP6A 2EI8A 2VIDA 5DPAA 5A2MH 1EASA 2LNCA 1O2PA 1O3LA 2FOHA 1ZGIA 2P3FH 2XWAA 2O8MA 2BX4A 1MKWK 1BHXF 2XBVA 2PKSC 4KTUA 1GHBF 1D3TB 2XBXA 1SQTA 2BY9X 2GKVE 2K0QA 1NN6A 1XKAC 2PSXA 3SUGA 2BX3A 3ZZ9A 5F53A 1LVOA 2ZU4A 1OPHB 3LC5A 1D3PB 4Q2KA 3LGTA 1ACBE 3P95A 1ZHMA 1PQ7A 4FU8A 1IQGA 1V2ST 1HUTH 3OX7U 1FLEE 1S6LA 1P2OA 3OU0A 4GHQA 2GMTC 1V2KT 1O0DH 2QXHA 2SFAA 3A8AA 5EG4A 3P17H 2ZCKP 3F9EA 1TPSA 2YNBA 1HBTH 1GJ7B 4MVNA 1X7AC 1D9IA 1TPPA 4CR9A 2BXUH 2P8OC 3CNRA 1TLDA 2GVFA 3ATWA 1QFKH 1KXBA 3ATMA 4YT7H 1V2VT 1NFUA 1FONA 3SYJA 3MO9A 2FS8A 1QJ6B 2XW9A 2AYWA 1EFRD 1DDJA 3UNSA 1GVLA 2J9NA 3LGWA 3UWIA 4I7YH 5A8XA 3LONA 2BD7A 3DA9B 2PTNA 3SUFA 3BG4B 1MUEB 1NROH 3OYPA 3SQHE 1GDUA 4Z6AH 4U2WA 3WW7A 3E3TA 4XE4A 4F49A 1N6XA 1C1SA 2ZPSA 1T31A 4XSKU 4YO9A 4UONA 4Q80A 1ELFA 3SI3H 5JYIA 1AZZA 1HAPH 2ZFSA 3TGKE 1GBDA 1VJAU 3M36A 3UR6A 3GICB 2SGQE 2ZGXH 2EEKA 1J14A 1C4U2 1HYLA 2ZIQH 3SU6A 3SW2B 1GL1A 2V35A 2G51A 4U32A 1LPKB 5C1YA 1GVZA 1S5SA 1TGTA 1WDIA 1FY3A 2F9PA 1YWUA 1PFXC 5JBAS 1FIWA 1O2RA 2AERH 3BTTE 1L0ZA 1AY6H 3G01A 3RXIA 3E91A 1C9PA 1VGCC 4X8TH 3M3TA 1G3CA 4OS1A 4MNVA 2BY7X 4X2XA 2AIPA 5ESBA 2GCTC 4H4FA 5JBCS 1H4WA 2A7HA 1AZ8A 5L2YH 4AYVB 1EAWA 1RJXB 1TA2A 1RGQA 4BTIB 4BOHA 7GCHF 2H5CA 1TYNA 2A7JA 4NIXA 1QCPA 1YKTA 4AC9A 1GI6A 1QA7A 2Z3CA 2LPRA 4UFDH 2PKSB 1GDQA 3RLWH 1L4DA 2ANYA 1BMNH 1W3CA 2UWOA 4JZIA 5DG6A 1ELEE 4CRAA 3S7KB 2HWLB 2XTTB 3S9BA 1FMGA 2TRMA 4MNXA 3HK6B 4XBBA 1IHTH 3ZVCA 3TK9A 2VVUA 4NZQA 1EATA 1DWDH 3ELAH 3EGKH 2GMTB 1IQJA 1BTYA 2BLWA 1K9OE 5DJ7A 1O3GA 1HDTH 1V6DA 2HLDD 2XCNA 1W0KD 3U9AH 2G5VA 1JIRA 1OWDA 2P8OB 3M3VA 5EQRA 2KCPA 3N7DA 3A8DA 1YPGH 2WPIS 4OS5A 5JBBS 3OTJE 3V7TA 5EPNA 1MMJN 3JZ2B 2Z9IA 3BV9B 1Y3VA 4JK6A 2A5IA 2XC4A 3DT0H 5EXMA 3HPTB 5GJ4B 5LGOA 3OY5U 3VPKA 3HK3B 5AF9H 1YP9A 5DP9A 1F92A 1ID5H 1AI8H 4HTCH 2FOEA 4WH6A 2Z6BD 1UVTH 1K0HA 1MD7A 1JRTA 1MTNC 5DP6A 6CHAC 2HVXA 3TGIE 1O2QA 3ATIA 1C2GA 2O8LA 1BZXE 2RCEA 2GGVB 2UUJB 5JDUB 1ZMLA 2ASUB 3RXKA 1AUJA 4FUHA 2A7CA 2TPIZ 2PW8H 2A4GA 4IGDA 4F4OC 3LC3A 3U1JB 2PKAB 3RXEA 3F2HA 3FZZA 4NGAH 1V2PT 2ODQA 2H5DA 4FUFA 4B73A 1O3EA 3OTPA 4NG9H 2FOAA 3T5FH 1C2HA 1SGEE 3VXFH 3AW0A 4HZHA 1CGIE 1TBQH 4Y0YE 3UAIC 2VVVA 1GJCB 1SMFE 3PWBA 2W26A 2RDLA 3DUXH 1VGCB 1GJAB 3EQ0H 2C4FH 3PROA 1TBZH 3RXFA 2GCTB 1NU9A 1DXPA 2H1UA 2BD8A 5KECA 2ZC9H 3BEFB 1AKSA 3ZZBA 4HG6A 2ZQ2A 4I31A 2UWLA 5TCAA 2QF4A 3MWIU 3RXGA 1FY4A 2TGDA 1V2MT 3EDXB 2XOKD 2A4QA 4ESTE 3A87A 3UWJH 1QL9A 2FIRH 2H9EH 3P8GA 1JXPA 3U8RH 1C2FA 2ZFTA 2GP9B 2GD4B 3PV4A 3O8CA 2OC0A 2ZCHP 2M2AA 4JZ1A 4JYTA 4RT1A 2PR3A 2J34A 1G37A 4OS6A 4D8NA 1O2OA 2ZHDA 3E1XB 3MFJA 3O8RA 2QXGA 1XXFA 1GHVH 1SGCA 2A4RA 2BTCE 2Q6DA 1G2LA 2BD9A 1K2I1 4FU9A 2ZHFH 4X8UH 3O8BA 3M5MA 5C67A 1EPTC 1DWBH 2WYJA 4NFEA 3RM0H 1SB1H 3OEED 4DGJA 1HJ8A 1L4ZA 1ZTKA 2Z3DA 5F03A 1O3OA 2QYIA 2ZHQH 1GCDA 1K22H 1O2YA 1MBMA 3SJ8A 3L3TA 2BVRH 3TJUA 2YMSC 1OYTH 2PV9B 2WV9A 5DGJA 4FUCA 1H8DH 1O3HA 1QB6A 1ELTA 4WMFA 1MKXK 1O3BA 3M7TA 2GT7A 1MTNB 2IPQX 6CHAB 2QGRA 3A88A 3UPEA 2BDBA 4IMZA 1YM0A 4JMYA 3ODDA 5FPSA 3UNQA 5HXFA 1DUEA 1GDNA 5LH8A 4DG4A 1O39A 1O5CB 3P70B 3F9GA 1UK3A 1C1QA 3UOUA 2ULLA 3QTVH 5L30H 2C8XB 1NRQH 3TK6A 1SVPA 1EZUC 2FZZA 3UY9A 1SGQE 5T6FA 1VR1H 1TOCB 4XBDA 1SQAA 4Z1MD 3LJOA 2C3SA 2HNTF 2R2MB 1P2NA 1VITH 4IN2A 4ABFA 2OINA 1BITA 4X6PA 1BMLA 1C2DA 2QXIA 2KAIB 5L2ZH 5C5OA 1GMCG 3RU4T 1P2KA 4A1TA 4CREA 1W12U 5PTPA 4KELA 2V3OH 1ZPCA 4ZMAH 1TABE 2BXTH 3TH2H 1GBIA 1P06A 2ZNKH 2F9VA 4DVAU 1MAYA 5GXPA 4WF8A 4ZKRU 1TMTH 4HI3A 3ZZ4A 2UUYA 1GI2A 2A45B 4ISLA 1HNEE 3RXUA 2PSYA 1OXGA 2QIQA 1QIXB 3PV5A 1WU1A 1EB1H 1ETSH 1UHBB 4WMEA 4DIIH 2BY6X 2STBE 1SGPE 2J98A 4O03A 1CQQA 1THPB 2CHAC 3SV9A 4YESB 2ZA5A 2SGFE 4O3UA 4OS7A 2VIVA 1K1LA 2BOHB 2Z9GA 5JB9S 1BB0B 5A8ZA 4ABBA 1ZSLA 2ZTXA 3PB1E 1KXAA 2LP6A 1O3MA 2ODPA 1O2NA 3ZIAD 3ZV8A 5FAHA 2GDEH 2ANKH 2PGQB 5ETXA 1GI5A 2FS9A 3F2FA 4ABGA 1OS8A 3W94A 3B9FH 3A7YA 1C5MD 4TWWA 1OWEA 1MTSA 1GBFA 1TB6H 1RD3B 2XYAA 2JDID 3SU1A 1CA0C 1DXWA 1HAGE 5FCRA 1O34A 3RXPA 1O3IA 1TMBH 1C1UH 4YM9A 3PWCA 5EXNA 2D2DA 4FUIA 4K5ZA 4YLUA 1QTFA 3UQVA 1YLCA 1UTOA 4PROA 4TT3D 2ANWA 2BDGA 2WYGA 3RUOA 4MNYA 1EAUA 1NRPH 3SU5A 2YOLA 1PPCE 3BIVH 3QZQA 4IS5A 3M61U 1YPEH 2F9OA 1A4WH 2V7QD 2Z3EA 5E2PA 4DT7B 1H9IE 3FO8D 4TPIZ 3RDZA 1WXRA 1B5GH 2BDAA 1GG6C 1H9HE 3EA7A 4D9RA 4F48B 1NC6A 5DKMA 2A2QH 5DN6D 1TGSZ 4D76A 2OBQA 1IQEA 2VVCA 1O2XA 1AHTH 2W3KA 2AMDA 2ILNA 1GBEA 1ZHPA 2H2ZA 1H9LB 1HAZB 4GPGA 3V0XA 1XUKA 5CHBA 1C5PA 1C1RA 1SLUB 2RG3A 1K1NA 4O97A 3T25A 5C17A 1GJ5H 4MPXA 3RXBA 1UTMA 2OQ5A 3SNEA 1ZMNA 3TU7H 1AVWA 2WPHS 4A1VA 1Z8IB 3SGBE 2FTMA 3A8BA 3BTEE 4A7IB 2BZAA 1BMAA 1KLJH 2ZGBH 3OE7D 3DHKH 2W7SA 1F2SE 1UO6A 4RKJB 3SNBA 4X0WU 2P93A 4XD7D 1AVXA 2FYQA 1XUFA 1DY9A 3TGJE 3KF2A 2ZU2A 4JYUH 3KIDU 1NRRH 5E0JA 5T6GA 4DIHH 2FODA 1LKAA 1M9UA 4TPYA 4XDEA 2AGIX 1UTPA 2ZGHA 4BAHB 1ZPZA 1P03A 1C2LA 1TWXB 3QN7A 2QXJA 1QBOA 2CHAB 2FYRA 1A5IA 4E7RG 1GMHG 2FEQH 3TJNA 1T32A 2HLCA 3V12A 5HYOA 4CBOA 2C90B 1O2IA 3FP7E 4CRGA 1W0ZU 2CV3A 1GJ4H 1PYTC 1WOFA 3ODFA 4P02A 1D4PB 1GI8B 1SC8U 1JWTA 1O38A 2UWPA 4BAKB 1C9TA 2JJ1D 3MTYA 2ZU5A 3SU4A 5FPYA 2BQ6B 3KNXA 2IN2A 2ANMH 2BLOA 3GDVA 3L6PA 3RXRA 1OWKA 5FBIA 3UUZA 1T8OA 1Y5UT 1CA0B 1SOZA 2R2WU 4I8GA 4Y79A 4NZLA 5GNDA 1A3EH 1AUTC 1YLNA 2PWXA 2KM0A 1LVYA 4Q7ZA 3KQBA 3ZZ6A 3BTME 4ASUD 1F0RA 1YPJH 3LJJA 3Q77A 2BLQA 4VGCC 1DY8A 1TONA 3MNSA 4AN7A 1FQ3A 1VCQA 1K1JA 1ZJDA 1UTKA 5C94A 1GCTC 1Y59T 1ANBA 4NWKA 1P57B 4U01A 1W0YH 1TNLA 1RFNA 4ACBA 1O5GH 3S69A 2K1QA 5A0AE 1OOKB 3DSPA 4RI0A 1O2VA 1YLDA 4YTAA 1C5ZB 2OLGA 1PYTD 4P00A 3ZYEA 4AOQA 1IQKA 3A7ZA 1XKBC 3QGNB 4UEHH 4Y8XA 4ZROA 2JJ2D 2JETC 1AE8H 4ABDA 1C1WH 1HRTH 2SNWA 2R3UA 2SGEE 2VIPA 1C2IA 5GWZA 1VKYA 3PV2A 4BNRA 1BUIA 4BXWA 3AAVA 1P3CA 1HXFH 3SJOA 1NU7B 1J8AA 1QZ8A 1ELVA 3SOSA 1ESTA 1MTWA 2WHXA 2FXRA 1ELBA 4GHTA 3K65B 1GJDB 1XVMA 1COWD 1TNGA 3GYMA 3A7VA 2ZPQA 1MABB 2BMGB 1S0QA 5F8XA 4YOIA 4CHAC 1SGFA 2QY0B 3K6ZA 4CRDA 1QL7A 1E1QD 3ATKA 3BEUA 1UCYE 1WBGB 4AZ2B 2LELA 3BG8A 1AD8H 1CHOG 1QA0A 1Y3WA 2BYAX 3VB7A 1DWEH 2J4IA 3STJA 1SLVB 2Y5FA 2ZU1A 4Q7YA 5DP4A 4IC5A 4JCNA 4GSOA 2BDIA 3VGCC 2F3CE 2TGTA 1RXPA 2ZFQH 3PMHB 1OSSA 3Q3KA 1O3AA 2VB0A 5LPFA 1O5FH 3E8LA 1KLTA 1YPHC 1AVGH 2QV1A 2GCHG 2OC7A 3NKKA 3ZZ8A 1H8ED 1TBRH 3RC4A 1DSUA 3SORA 5CHAC 5C1XA 3U8TH 2JIZD 3WWBA 1O2SA 1Q31A 1SGNE 1IQMA 1P2MA 1O5DH 2PKAA 2BD3A 1GBMA 2FLBH 2ZDAH 1SFQB 5FX5A 1C5QA 1YBWA 3PRBA 3UR9A 2Z94A 3ZVGA 4WMDA 1DE7H 1H1BA 2JKHA 1BBRK 1N6YA 1D3DB 3GY6A 3K6YA 4FUJA 1C5NH 2PUXB 2CF8H 2PFEA 3MMGA 3FP8E 3RXVA 2GZ8A 2M5TA 2ZP0H 3PLBA 2CN0H 1ESBA 4WY3A 1IOEA 4B74A 3F0PA 1KMHB 2WPKS 4FUEA 2BDYA 1JBUH 1CBWC 3LDXH 3A7WA 2ZGCA 1TNKA 1ZRKA 2EI7A 1HAVB 1NFXA 5JB8S 3O8DA 4VGCB 3BTKE 5EW1H 4NA9H 3UB0A 1TQ0B 2NU3E 1CHOF 2IPHA 1GHXH 3DCLA 1EAXA 4BANB 2HPPH 1V2OT 3VEQB 1BRCE 3PRDA 1ANCA 1P09A 3A83A 2WUCA 1EUFA 1UVOA 2ZG0H 3MOCA 2GCHF 5C5NA 3TH3H 3M5LA 3A7TA 2Q1JA 3SHAH 1W2KH 3H7OA 1AQ7A 3NK8A 2HVYB 1EOJA 1J9CH 5HGGA 1LCYA 2W5EA 1C5VA 3T27A 4D7GA 4H6SB 1KXCA 4Q63A 3ITIA 1O3JA 5C0UA 3M5NA 2P16A 1SR5C 1EP5A 2HALA 2WV4A 3KGPA 3MO6A 3BF6H 5TJXA 3KHVA 5FHTA 3GCHC 1EX3A 2C93B 3TIUA 3MNCA 4CHAB 1ETTH 2Y5GA 4WXVA 2EC9H 5EODA 5T1VA 1UK4A 3SQEE 3AVZA 3RC6A 4NSVA 1TX7A 4NSYA 1GJ8B 1Z6EA 1ELGA 2R0KA 1MTVA 4FUBA 2B8OH 4R0IA 1XX9A 6LPRA 2B9LA 1B0EA 1AIXH 2THFB 4YOJA 4Q4LA 3Q3XA 1CGJE 3U8OH 4X6NA 1QRXA 1PPZA 3GY5A 5EGMA 3FVFB 1HFDA 3VGCB 2AGGX 4TWYA 1GBLA 1NBME 3MNXA 2ZZUH 4ABJA 3S9CA 1O2ZA 3ZVFA 2P3TB 1F5KU 3HGNA 5FXLA 1F0UA 3HKIB 1TGBA 1ABIH 5CHAB 2A31A 1F0TA 4Y11E 4X6MA 1O33A 4NFFA 4X2YA 4LZ4B 1V2WT 1YCPM 2B5TB 4ISHH 4B71A 4Z0KA 3SUEA 1DX5M 3H09A 1WQVH 3C27B 1FV9A 1KXDA 5SGAE 1CE5A 1O2TA 1TMUH 1Y5BT 2ZFRH 2XC5A 3SGQE 2VWLA 4FOUC 1YPLH 2VBCA 3URDA 2KAIA 2R3YA 4NIYA 3L33A 5FCKA 2BVXH 1GJBB 3BN9A 3GY3A 5FBEA 3AK5A 4ZH8A 4FETA 1CBWB 3BEIB 4JZEH 1AFQC 5DK1A 3B8JA 1C5LH 2FMJA 2L6OA 3KQEA 3SNCA 2WSSD 3IWMA 4CH2B 3DFJA 3AASA 1K1IA 4I8JA 1SFIA 1C2EA 1AGJA 1HCGA 3SJ9A 1QRZA 3S9AA 1UHBA 1O36A 1Z71A 4UFFH 4OGYA 3ZYDA 3SGAE 4SGBE 1SBWA 3M35A 1WQSA 1NFYA 1T8MA 5JPMH 1BIOA 2KX4A 1OKXA 3F9HA 1TGNA 1OX1A 4DCDA 2XNDD 2A32A 2ZTZA 1HLTH 1LO6A 1AU8A 4X2VA 3FN8A 1EZSC 5DSFA 1LVMA 3OSYA 2EI6A 3LPRA 4ZKOU 3TNSA 3KYGA 1ELCA 2XBYA 1SQRA 3SZEA 2G55A 3PMJA 1V2JT 1ZHRA 2ZO3H 3UFAA 2DUCA 3CS7A 1NBMD 1EZQA 1GJ6A 2GV6A 1FY1A 3FAOA 2RA0A 3PO1C 1C5OH 1C5UA 2V0BA 4ISIH 4BTTB 3D62A 1E37B 2AEIH 1TALA 1BBRH 3BTFE 4AFQA 1IQHA 1UVUH 1D6RA 2QF5A 2Y7ZA 2ZTYA 1GBHA 5FPTA 2RA3A 2P95A 2Z9KA 1Y8TA 7ESTE 4BTUB 1T4VH 2TGPZ 2WPDD 2AH4X 1YPKH 1HAHH 2O8TA 4DT4A 1FJSA 1PPBH 1WV7H 5AFZH 3I29A 3RP2A 4JYVH 2BD2A 4YT6H 1TRNA 3MU4A 1GBKA 4RN6A 4RT0A 2C8ZB 4FVBA 1P01A 1WYKA 2EQNA 1QY6A 4J1YA 4WWYA 3SUDA 4X1QU 1O2UA 1RTLA 1OP0A 4ABAA 1TNJA 2KR7A 1LVBA 1TAWA 3EE7A 1GMDG 4OS2A 1TRYA 1Z8GA 3F68H 5DP5A 1C1NA 2G00A 1A5HA 3R3GB 3GOVB 1GBJA 1O2WA 1GHWH 3FFGA 1G2MA 2YMSD 3MH7A 1NFWA 1OP2A 1C5TA 3GYLB 4ZUHA 4D7FA 3NCLA 4UE7H 4IN1A 4MNWA 3T28A 1SI5H 2OD3B 1QJ1B 1PJPA 3RC5A 2FP7B 2OC1A 1GI4A 3TPIZ 1P9SA 1SGTA 2BY5X 2HNTC 2ZDVH 3M3SA 1AFQB 2B7DH 3RXLA 4E06H 1FI8A 3LGYA 4KKDA 1NS3A 1K28D 2G52A 3IG6B 1HPGA 1EKBB 5HIYA 1EQ9A 1GBCA 2FESH 1SKYE 1V2QT 4AORA 1LDTT 1ZR0A 1C2JA 1XMNB 1ZOMA 2WPMS 1BTPA 1P02A 3RXDA 2I6QA 3LGUA 1NZQH 3SV8A 4GVUA 2VIWA 2G8TA 1V2TT 1C5SA 2TGAA 2OXSA 5A09A 1EJNA 2F91A 1O3FA 2YNAA 2HOBA 2NU4E 1S82A 1QJ7B 1C1VH 3F3BA 1CO7E 2BDCA 5KEDA 1EPTB 1TX8A 3ZVBA 5GCHG 5H4IB 1DOJA 1UVSH 3RM2H 1FY8E 1U6QA 1GMCF 2PTCE 4QT8C 6ESTA 1O2KA 1CHGA 1O2HA 4RKOB 1XVOA 3SBKA 3BIUH 1BTZA 1KLIH 3PO1B 1PQ8A 2YMSB 1Z1IA 3VXEH 3E16B 2VIQA 1QRWA 4E05H 3KQDA 1ZTJA 2SGAA 2VJ1A 1D3QB 1MQ6A 1O5EH 4MPWA 1P8VC 4JK5A 1TFXA 1TNHA 2FOFA 3AW1A 3RMLH 5A0CA 3P8NA 4XOJA 2ZF0H 4Y76A 1A0JA 3FOAA 1ZYOA 3VFEA 1H8IH 1FN8A 1O2GH 2CGAA 3LH1A 1E1RD 2RDEA 1AO5A 2CK3D 4Y8ZA 1O37A 3BTDE 3VG8A 1P11E 2VWMA 4DOQA 1KXEA 1J15A 1QHRB 3RXAA 3KQCA 1GHAG 3LGVA 4U30A 1S6HA 1T7CA 2P3UB 2VIOA 1UVPA 3MO3A 4CBNA 1EB2A 3ZZ3A 3A89A 3PM3A 3U69H 1PPFE 2ESTE 1YC0A 5IK2D 4ZHLU 2NU0E 1VJ9U 3M37A 3TJVA 1RTKA 1SLWB 1ZMJA 2G81E 5HMAA 4DURA 3N7OA 2ZHEH 4YXWD 1AFEH 1INCA 2G5NA 3E0NB 3NPSA 2KCAA 4B6EA 1QGFA 4O3TA 1ELDE 1G36A 1UTLM 5DO4H 1GBAA 2F9NA 1O30A 5I46H 1MZDA 2QC2A 2WPLS 1GL0E 2J38A 3MH6A 2STAE 5GCHF 2XCFA 3LGIA 4WVPE 1E38B 1A0LA 3SU2A 5EJLA 4K1TA 1RIWC 3LU9B 1K21H 3CS0A 1Q3XA 3MU8A 3N99A 1HAXB 2GZ9A 1GI9B 1DT2A 1VCWA 4INHA 2WZQA 1YYY1 3WWFA 1DSTA 4MQAA 1GHBG 5JBTA 1BDAA 3S7HB 2VINA 1Z8JB 1MAXA 3A82A 3QDZB 3SU3A 3TITA 8GCHG 2XRCA 1UMAH 1HJAC 1W10U 1C1OA 1GHZA 1W8BH 2Y7XA 2Y82A 3ZZDA 1GBBA 5LPEA 4NA8A 4DJZB 1C4V2 1QURH 2FOCA 2W6ID 4NIVA 1B7XB 1ARCA 4MPVA 1C5WB 5C2ZA 1VCPA 1NY22 2B0FA 3MU0A 3FANA 4CR5A 3I77A 2ZPRA 4A1XA 1LPGB 5BRRE 1TPOA 3EA9A 1MQ5A 5C0TA 3T26A 4K1EA 1XUIA 3Q76A 2H9HA 2J2UA 2BLVA 2EY4C 1ZJKA 1KSNA 1MBQA 4K8BA 8KME2 3MU5A 2VWNA 3NRLA 1NM6A 1UW7A 2Y6TA 3SNAA 1LTOA 3FZDA 4XRNA 2ZDLA 1W0JD 2AFQB 1C1PA 1O32A 1G30B 1Y3YA 4SGAE 4TY6A 1EJAA 1HAIH 2WV5A 1PPEE 5CMXH 1GG6B 1HAVA 1FIZA 2A1DB 1BT7A 2EA3A 4B75A 1FAXA 1BMMH 1P10A 1QBNA 3VB6A 1AMHA 2VH6A 2V6NA 2OBOA 1GI3A 2ZI2H 1BOQA 4GUXA 5KGOA 5G4BA 2UUFB 8GCHF 1LMWB 5EXLA 1GMHF 2AHME 3DD2H 4AGKA 4X1SU 1KDQB 1O2JA 2C8WB 5E0GA 2Z9JA 2ODYB 2UUKB 1YPHE 3SV7A 2G4UA 1E35B 1L1NA 3KQ5A 1WTGH 3GY7A 1BRBE 4NWLA 4FUGA 1PPGE 1L2EA 1QL8A 5IYTA 1DLKB 1RS0A 4X1PU 1O5AB 2OC8A 3QX5H 2XWBI 5HM2A 1ELAA 1HIAB 2SGDE 3ZZCA 4UDWH 2D1JA 3PTBA 2F9BH 5T6DA 1HAYB 1KTTB 5C3NA 4AX9H 2JH0D 2ZDKA 1IQIA 1CT4E 2ZU3A 2WUBA 3UREA 3ZVDA 7LPRA 1SOTA 2FOGA 1YF4A 3OEHD 1FN6A 1DLEA 1RIWB 2NWNA 3AAUA 3N7EA 2O8UA 7GCHG 2OP9A 2J95A 4LK4A 5AFYH 3F9FA 1LQDB 4FUDA 1F7ZA 3LT3A 1L1GA 2Y5HA 2AS9A 5GDSH 2SNVA 4ASHA 5TCCA
chains in the Genus database with same CATH topology
3VB5A 4B2BA 3QGJA 1ARBA 1S81A 1QB1A 1ESAA 2XXLA 4Y71A 2G4TA 3TK5A 4K3JA 1C2KA 4Y7BA 3RLYH 1LPZB 1W7GH 1HJAB 3H5CB 1P05A 3UQOA 2ALPA 5C1UA 1O3DA 4MTBA 2VU8E 1BTUA 1Z8RA 1ZLRA 1FXYA 1YCPK 5F8TA 1IHSH 3BTWE 3UIRA 2QN5T 1F5RA 1GI1A 1EAIA 1MH0A 1G3EA 1S83A 2GV7A 1ETRH 4ZKSU 1P0SH 9LPRA 3B23B 1O5BB 1LQEA 1XUHA 2ZEBA 1THRH 2ZFPH 2VH0A 3SO3A 4KTSA 3M5OA 3GDSA 4X8SH 1UTQA 5ABWA 1ZGVA 1O3NA 2BQWB 1MCTA 4GAWA 4Y6DA 2OUAA 4ZXYH 1W14U 5I25A 3GY2A 2CXVA 1KY9A 3CP7A 3NXPA 1Z1JA 1IQFA 2QA9E 4H42U 1GCTB 4J2YB 4CH8B 4ABHA 1SGDE 3GCOA 1DPOA 2FI4E 2FI5E 4I32A 1HV7A 3EYDA 4B2CA 4CRCA 5HM9A 2FI3E 1BRUP 7KMEH 4DW2U 3LOXA 2BQ7B 1SG8B 5LPRA 2WINI 1C5RA 1MD8A 2DE8A 3D23A 4OGXA 3A7XA 3STIA 1UJ1A 4AFSA 2PGBB 1BHXB 1DS2E 2JETB 3EE0B 3MYWA 2Z7FE 2PLXA 3A8CA 4FVDA 2A4OA 3F1SB 1BTHH 1DUAA 3NUMA 1RTFB 3TNTA 3S0NA 1SPJA 4IBLH 1IQLA 3PYHA 3MH5A 3BSQA 5GPIB 2J92A 1CT0E 1QQ4A 1A5GH 2ZCLP 4NA7A 4AFZA 1K1MA 1Y3XA 3TH4H 2GDDA 5F8ZA 3MHWU 1V3XA 2Q6FA 3QTOH 1K1OA 2VGCC 2BDHA 5A8YA 9ESTA 1CGHA 2V3HH 3A85A 2AMPA 2ALVA 1A2CH 4BXSA 1SGIB 5EU8A 1VZQH 2FOBA 3RMMH 1ABJH 1PQ5A 4XBCA 3M7UA 4CRBA 1KXFA 1RRKA 5F6MA 3ATLA 3GY8A 1K1PA 1AB9C 1KTSB 1S84A 4JZFH 2QAAA 1KIGH 2FLRH 4NCYA 1ANDA 4X1RU 2GTBA 3BTHE 3ESTA 2AMQA 2PHBA 4NIWA 4DY7B 1T8LA 4IMQA 2R9PA 3U98H 1QBVH 3RXOA 5CE1A 4MPUA 1B0FA 5FX6A 1T8NA 1DICA 2BVSH 1LKBA 3QO6A 1MKWH 5L6NH 3HKJB 1YGCH 3PLKA 1NT1A 4UFGH 2D26C 2FTLE 3FP6E 3QZRA 1AE5A 2W7UA 4KGAA 3BTGE 1NESE 2FM2A 1G9IE 3W95A 1G3BA 1ZSKA 2FOMB 3ZZ7A 4B2AA 4ABEA 4GCHG 1OWIA 1A0HB 1THSH 5AHGH 5DP7A 3I78A 2FX6A 4AFUA 1AN1E 3RMNH 2BOKA 1P2IA 1QR3E 1FPCH 3TJOA 3HATH 4MLFB 4A92A 1MU8B 4D9QA 3SZNA 2CMYA 4CRFA 1JMOH 1BJUA 2QF3A 1S6FA 3URCA 3RXCA 3ENSB 4ISNA 1D6WA 3QWCH 1HB0B 1O31A 2AIQA 3UOPA 4UD9H 4ZXXH 1E36B 1HGTH 4GLYA 3A81A 3KN2A 1MZAA 3A80A 1XM1A 1Q2WA 3KCGH 1L1JA 1SHHB 1IQNA 3MU1A 2F9UA 4K69A 1LHGH 5A0BA 1A46H 1C1TA 3P8FA 1J17T 4I8LA 3GCTG 3GCNA 5IDKA 4B1TA 1EZXC 1FZZA 4TY7A 1P2JA 3E0PB 1DITH 3SI4H 5EW2H 5AVDA 4B76A 1TGCA 2NU2E 4AB8A 2FWWA 1V2NT 3GISB 4O9VA 2IJOB 1GGDC 1BRAA 1UCYK 2FO9A 3PLPA 4UFEH 1GI7B 2BD4A 2OTVA 4K60A 3TLOA 1E0FD 3PMAB 3GCHB 1EPTA 1JIMA 1V2LT 1C4Y2 1LHEH 2Y81A 4GCHF 4M7GA 4ZHMU 3RXMA 1O35A 4IC6A 3RU4E 2VWOA 3EAJA 1YCPH 2VGCB 1F0SA 1XXDA 4ZAEA 1ZPBA 4ISOA 5J4SA 1QNJA 3D65E 1TX6A 4FXGH 3SV2H 4ZKNU 1ZSJA 1EOLA 3GDUA 4YLQH 3TVJB 3P8OA 1SGYE 3A86A 2H9TH 1O3PB 2HNTE 1AB9B 3QUMP 1A61H 1TA6A 2PUQH 4JZDH 2P94A 2GX4A 1N8OC 1A1RA 1GBTA 1DWCH 3EA8A 3SHCH 4AB9A 1Y5AT 2O9QA 4BAOB 1HJ9A 2ZWLH 3WY8A 2F83A 4A5TS 4HFPB 4YOGA 3R0FA 2ZECA 1QB9A 3GCTF 3K9XB 5BPEA 2ZDNA 3K2UA 1OWJA 3T29A 1AWHB 1O2MA 4LZ1H 2ZGJA 1P3EA 3T2NA 4INLA 1WUNH 5J4QA 2OCVB 3LIWA 4FU7A 2Q6GA 2A5KA 1OP8A 1W7XH 6GCHG 4X1NU 3RXQA 3V13A 1SHYA 2ZKSA 4YZUA 1PQAA 2JH6D 3M7QA 4K2YA 3PMBB 4Q7XA 3RXJA 3RXTA 4ZHAA 4IW4E 4THNH 1O3CA 2BD5A 4X2WA 4TYDA 1GVKB 1UTJA 1YPMH 1AKSB 1DM4B 1TNIA 3F6UH 4ABIA 2IOTA 2FPZA 1BA8B 3DFLA 3MH4A 1MTUA 3ZV9A 2H6MA 4A6LA 1Y3UA 1OWHA 1G32B 4LOYH 5DP3A 1DANH 5EPYA 3SN8A 3C1KA 3MNBA 4K8YA 3NZIA 3BTQE 4Y8YA 2D8WA 4X8VH 1MCVA 1TE0A 5DP8A 5EOKA 1NPMA 2OQUA 3KL6A 1GHYH 3PTNA 1ZZZA 1FNIA 4X6OA 3RU4D 5EQQA 1QQUA 2SGPE 3LH3A 2CF9H 1C5XB 2GT8A 1CU1A 1FPHH 3RXSA 5B6OA 4H6TA 1GMDF 2XC0A 4INKA 2XBWA 1GJ9B 5K0HA 5E8EH 4R8TB 2XNIA 1ZTLA 1FY5A 1GGDB 2R0LA 5ESTE 5K7RA 1WAYB 4I33A 3UNRA 2TBSA 3HGPA 3ZVAA 2I6SA 2HPQH 2FX4A 1P12E 3SU0A 1AWFH 4I8HA 6GCHF 1J16A 1P9UA 1C1MA 1W13U 1VITG 3QK1A 1GPZA 1BBRE 4K1SA 3Q00A 1TPAE 3P92A 5EQSA 1BCUH 1EJMA 3LKWA 3V3MA 3UTUH 2CJIA 1Z6JH 2ZQ1A 5GIBA 2QF0A 3NWUA 1Z7KA 3E90B 3A84A 3D49H 1SGRE 1V2UT 1S0RA 4KP0A 1O2LA 1T4UH 1XUGA 1C5YB 3ZZAA 1CVWH 4RSPA 3JZ1B 1JOUB 1S85A 1N8OB 1JRSA 4MDSA 1KDQA 1W11U 1BQYA 3H7TA 1TRMA 1BTWA 1TQ7B 1HAOH 2NU1E 4OS4A 3ZVEA 1C2MA 2A2XH 2ZDMA 2VNTA 1P04A 1KYNA 4HGCA 1EP6A 3KEEA 4AG2A 1DFPA 3VB4A 1CT2E 1HIAA 1WCZA 3CENA 1NRSH 4MG3A 2O8WA 1HXEH 1ANEA 2Z9LA 1N1LA 4AG1A 2J94A 3SNDA 3OY6U 3BG4C 1E34B 1CSOE 2HRVA 1TOMH 4Y10E 3ZZ5A 2W3IA 1UCYH 2BB4A 2A0QB 3GY4A 1EXFA 1GI0A 1LHFH 5T3HA 1VITF 2GZ7A 3U1IB 4E7NA 1F5LA 4AGJA 2ZHWH 1FUJA 4WH8A 2FDAA 4BAMB 2C8YB 2DE9A 3E6PH 1O3KA 1SL3A 1UTNA 1WSSH 4WXIA 4LXBH 1SSXA 3RXHA 1TIOA 3VB3A 4BAQB 1XUJA 1A3BH 1NO9H 2ZFFH 4AYYB 1DVAH 1FAKH 1P2QA 1ZRBA 2AGEX 4KTCA 3T62A 2P59A 1IAUA 1A7SA 1GHAF 2BM2A 2HGTH 1PPHE 1WTHD 3RMOH 1MU6B 1CA8B 1UK2A 4Y7AA 5E2OA 1FDPA 1G3DA 1SGFG 3SJKA 1LHDH 2TIOA 4I8KA 2A5AA 1LHCH 5E0HA 2QCYA 1BJVA 2BHGA 1MKXH 2WPJS 2Y80A 1SQOA 3SJIA 1NRNH 1SLXB 2JH5D 8LPRA 1BTXA 1OYQA 3IITA 3MI4A 3SV6A 3Q3YA 4WJG2 3P6ZB 2BY8X 2BZ6H 3QLPH 8ESTE 1NTPA 1V2RT 4Y0ZE 4XFQA 5C20A 1GWAA 1ORFA 2EI8A 2VIDA 5DPAA 5A2MH 1EASA 2LNCA 1O2PA 1O3LA 2FOHA 1ZGIA 2P3FH 2XWAA 2O8MA 2BX4A 1MKWK 1BHXF 2XBVA 2PKSC 4KTUA 1GHBF 1D3TB 2XBXA 1SQTA 2BY9X 2GKVE 1NN6A 1XKAC 2PSXA 3SUGA 2BX3A 3ZZ9A 1LVOA 2ZU4A 1OPHB 3LC5A 1D3PB 4Q2KA 3LGTA 1ACBE 3P95A 1ZHMA 1PQ7A 4FU8A 1IQGA 1V2ST 1HUTH 3OX7U 1FLEE 1P2OA 3OU0A 4GHQA 2GMTC 1V2KT 1O0DH 2QXHA 2SFAA 3A8AA 5EG4A 3P17H 2ZCKP 3F9EA 1TPSA 2YNBA 1HBTH 1GJ7B 4MVNA 1X7AC 1D9IA 1TPPA 4CR9A 2BXUH 2P8OC 1TLDA 2GVFA 3ATWA 1QFKH 1KXBA 3ATMA 4YT7H 1V2VT 1NFUA 1FONA 3MO9A 2FS8A 1QJ6B 2XW9A 2AYWA 1DDJA 3UNSA 1GVLA 2J9NA 3LGWA 3UWIA 4I7YH 5A8XA 3LONA 2BD7A 3DA9B 2PTNA 3SUFA 3BG4B 1MUEB 1NROH 3OYPA 3SQHE 1GDUA 4Z6AH 4U2WA 3E3TA 4XE4A 4F49A 1N6XA 1C1SA 2ZPSA 1T31A 4XSKU 4YO9A 4UONA 4Q80A 1ELFA 3SI3H 5JYIA 1AZZA 1HAPH 2ZFSA 3TGKE 1GBDA 1VJAU 3M36A 3UR6A 3GICB 2SGQE 2ZGXH 2EEKA 1J14A 1C4U2 1HYLA 2ZIQH 3SU6A 3SW2B 1GL1A 2V35A 2G51A 4U32A 1LPKB 5C1YA 1GVZA 1S5SA 1TGTA 1FY3A 2F9PA 1PFXC 5JBAS 1FIWA 1O2RA 2AERH 3BTTE 1L0ZA 1AY6H 3G01A 3RXIA 3E91A 1C9PA 1VGCC 4X8TH 3M3TA 1G3CA 4OS1A 4MNVA 2BY7X 4X2XA 2AIPA 5ESBA 2GCTC 4H4FA 5JBCS 1H4WA 2A7HA 1AZ8A 5L2YH 4AYVB 1EAWA 1RJXB 1TA2A 1RGQA 4BTIB 4BOHA 7GCHF 2H5CA 1TYNA 2A7JA 4NIXA 1QCPA 1YKTA 1GI6A 1QA7A 2Z3CA 2LPRA 4UFDH 2PKSB 1GDQA 3RLWH 1L4DA 2ANYA 1BMNH 1W3CA 2UWOA 4JZIA 5DG6A 1ELEE 4CRAA 3S7KB 2HWLB 2XTTB 3S9BA 1FMGA 2TRMA 4MNXA 3HK6B 4XBBA 1IHTH 3ZVCA 3TK9A 2VVUA 4NZQA 1EATA 1DWDH 3ELAH 3EGKH 2GMTB 1IQJA 1BTYA 2BLWA 1K9OE 5DJ7A 1O3GA 1HDTH 1V6DA 2XCNA 3U9AH 2G5VA 1JIRA 1OWDA 2P8OB 3M3VA 5EQRA 3A8DA 1YPGH 2WPIS 4OS5A 5JBBS 3OTJE 3V7TA 5EPNA 1MMJN 3JZ2B 2Z9IA 3BV9B 1Y3VA 4JK6A 2A5IA 2XC4A 3DT0H 5EXMA 3HPTB 5GJ4B 5LGOA 3OY5U 3VPKA 3HK3B 5AF9H 1YP9A 5DP9A 1F92A 1ID5H 1AI8H 4HTCH 2FOEA 4WH6A 2Z6BD 1UVTH 1MD7A 1JRTA 1MTNC 5DP6A 6CHAC 2HVXA 3TGIE 1O2QA 3ATIA 1C2GA 2O8LA 1BZXE 2RCEA 2GGVB 2UUJB 5JDUB 1ZMLA 2ASUB 3RXKA 1AUJA 4FUHA 2A7CA 2TPIZ 2PW8H 2A4GA 4IGDA 4F4OC 3LC3A 3U1JB 2PKAB 3RXEA 3FZZA 4NGAH 1V2PT 2ODQA 2H5DA 4FUFA 4B73A 1O3EA 4NG9H 2FOAA 3T5FH 1C2HA 1SGEE 3VXFH 3AW0A 4HZHA 1CGIE 1TBQH 4Y0YE 2VVVA 1GJCB 1SMFE 3PWBA 2W26A 2RDLA 3DUXH 1VGCB 1GJAB 3EQ0H 2C4FH 3PROA 1TBZH 3RXFA 2GCTB 1NU9A 1DXPA 2H1UA 2BD8A 2ZC9H 3BEFB 1AKSA 3ZZBA 2ZQ2A 4I31A 2UWLA 5TCAA 3MWIU 3RXGA 1FY4A 2TGDA 1V2MT 3EDXB 2A4QA 4ESTE 3A87A 3UWJH 1QL9A 2FIRH 2H9EH 3P8GA 1JXPA 3U8RH 1C2FA 2ZFTA 2GP9B 2GD4B 3PV4A 3O8CA 2OC0A 2ZCHP 4JZ1A 4JYTA 2PR3A 2J34A 1G37A 4OS6A 4D8NA 1O2OA 2ZHDA 3E1XB 3MFJA 3O8RA 2QXGA 1XXFA 1GHVH 1SGCA 2A4RA 2BTCE 2Q6DA 1G2LA 2BD9A 1K2I1 4FU9A 2ZHFH 4X8UH 3O8BA 3M5MA 5C67A 1EPTC 1DWBH 2WYJA 4NFEA 3RM0H 1SB1H 4DGJA 1HJ8A 1L4ZA 1ZTKA 2Z3DA 5F03A 1O3OA 2QYIA 2ZHQH 1GCDA 1K22H 1O2YA 1MBMA 3SJ8A 3L3TA 2BVRH 3TJUA 1OYTH 2PV9B 5DGJA 4FUCA 1H8DH 1O3HA 1QB6A 1ELTA 4WMFA 1MKXK 1O3BA 3M7TA 2GT7A 1MTNB 6CHAB 2QGRA 3A88A 3UPEA 2BDBA 4IMZA 1YM0A 4JMYA 3ODDA 5FPSA 3UNQA 5HXFA 1DUEA 1GDNA 5LH8A 4DG4A 1O39A 1O5CB 3P70B 3F9GA 1UK3A 1C1QA 3UOUA 2ULLA 3QTVH 5L30H 2C8XB 1NRQH 3TK6A 1SVPA 1EZUC 2FZZA 3UY9A 1SGQE 5T6FA 1VR1H 1TOCB 4XBDA 1SQAA 3LJOA 2C3SA 2HNTF 2R2MB 1P2NA 1VITH 4IN2A 4ABFA 2OINA 1BITA 4X6PA 1BMLA 1C2DA 2QXIA 2KAIB 5L2ZH 5C5OA 1GMCG 3RU4T 1P2KA 4A1TA 4CREA 1W12U 5PTPA 4KELA 2V3OH 1ZPCA 4ZMAH 1TABE 2BXTH 3TH2H 1GBIA 1P06A 2ZNKH 2F9VA