1OSSA

T190p streptomyces griseus trypsin in complex with benzamidine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
VVGGTRAAQGEFPFMVRLSMGCGGALYAQDIVLTAAHCVSGSGNNTSITATGGVVDLQSSSAVKVRSTKVLQAPGYNGTGKDWALIKLAQPINQPTLKIATTTAYNQGTFTVAGWGANREGGSQQRYLLKANVPFVSDAACRSAYGNELVANEEICAGYPDTGGVDPCQGDSGGPMFRKDNADEWIQVGIVSWGYGCARPGYPGVYTEVSTFASAIASAARTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords trypsin
publication title Engineering the Primary Substrate Specificity of Streptomyces griseus Trypsin.
pubmed doi rcsb
source organism Streptomyces griseus
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ossA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ossA02
1YCPM 2ZHWH 2FESH 3A8CA 1DXPA 3RU4D 2R0LA 1C1TA 4DIHH 1GI5A 2EI8A 3F9EA 1LHEH 2FPZA 2IJOB 1GBMA 3QGJA 2QYIA 1V2WT 1IOEA 2FOMB 3ZZ7A 1KDQB 1LQEA 3T2NA 2G55A 4DIIH 1GHXH 2F9UA 3VB6A 3GY7A 2HOBA 1G37A 5E2PA 3LH3A 1BHXF 1MBMA 1F5RA 1ANEA 1YPJH 1EPTC 3A88A 4ZXXH 4AGJA 5CMXH 4FUEA 1TE0A 3VB7A 5C3NA 1ABIH 3SNAA 3BTEE 1T8MA 4K5ZA 1GBCA 1HAHH 1BITA 1V2VT 1NO9H 4ABAA 1WQVH 4J2YB 5GWZA 2Y81A 1LPKB 2Y7ZA 4AORA 2FWWA 1Y8TA 4KTCA 1GJCB 1L4DA 1C1NA 1S83A 2UWPA 1QL9A 4NGAH 2AGIX 2FDAA 2WV4A 3LGIA 4INLA 2UWOA 1C5PA 5FAHA 2PKAB 1TA6A 2FI4E 1D3QB 2CMYA 3D49H 4GCHF 1P09A 5E0HA 2VB0A 4MNYA 3A7YA 2VWMA 2H6MA 5HM9A 3RXLA 4Y8YA 3JZ1B 2PR3A 3QN7A 4B2CA 1C4Y2 3OTJE 2D2DA 1A0LA 2ULLA 4FU8A 2TBSA 5DP5A 1TPSA 5CHAC 2V6NA 3OU0A 1ZPCA 1C5YB 1P57B 1XKBC 2WINI 2FX4A 1Y5UT 1IQGA 2ZPRA 3SJ8A 3TJNA 3SV7A 4XBDA 3N7OA 3Q00A 4MPXA 1ETRH 3DFLA 2RA0A 3H7TA 1C1SA 1QGFA 1ID5H 3SI3H 1ZGIA 2B0FA 1GGDB 1Y5AT 1AUTC 1MTWA 1UO6A 1CVWH 1KXEA 4OS5A 1GJ5H 4X2VA 1SGCA 2PWXA 4X1RU 2AH4X 3M3SA 4GLYA 5GXPA 1GMDF 1O35A 3SW2B 2Z3CA 2XXLA 3SZNA 2BY8X 5L2ZH 3IG6B 3PWCA 5EQQA 2G5VA 3ZV9A 2QAAA 1P9UA 1UK2A 1QB9A 1H9HE 3STIA 3F68H 3QLPH 3MH4A 1BB0B 4NA8A 3LC5A 4UFFH 2P95A 4YT6H 1EZUC 4X0WU 3D62A 1GI7B 4ZKRU 1S84A 4X8UH 4ZKSU 1BBRE 1BBRH 1JXPA 1P05A 1LMWB 4LZ4B 1GL0E 3MU4A 3U9AH 3MH5A 2OC8A 3SU5A 5JYIA 5JB8S 1IQMA 2C93B 5EODA 4AB9A 2RDLA 2G81E 1O3JA 1PPHE 4Z0KA 2ZECA 1DSUA 2BLOA 1SBWA 2HNTE 1TBQH 1FI8A 2JETC 3MHWU 1PYTD 2A4QA 1WOFA 5HXFA 1WV7H 2WV5A 1BTHH 1C2MA 3GICB 3Q3XA 1GBEA 2BVSH 4WF8A 4FUIA 1HAPH 1CT0E 3PLBA 2OLGA 1O3CA 1FAXA 3P17H 1GHAF 1T8LA 2FIRH 3U8OH 1FY5A 1BTWA 5JBCS 2DE9A 1BDAA 2ZQ2A 5GJ4B 1G3DA 4NSVA 2ZO3H 4A92A 1GCTC 5G4BA 3CENA 3SBKA 3RC5A 5A8YA 1HXFH 1AQ7A 1BMNH 4LZ1H 1ELVA 1DX5M 1ZRBA 1QB6A 3OYPA 4UFGH 2Z9LA 3KL6A 2M5TA 3UPEA 3SHCH 1EKBB 5JBAS 4ISLA 1KXFA 2STAE 1K1PA 2P59A 4WMDA 1OWIA 4BTUB 1G3BA 2ALPA 1A7SA 2SNWA 1YGCH 1QY6A 1CGJE 1T32A 4NG9H 2ZG0H 1KYNA 1VITF 1FV9A 1P11E 3ZVGA 2AEIH 2F3CE 3UOPA 4ZH8A 1MQ6A 4FU7A 4AFZA 3E90B 3RXAA 1XVMA 4MDSA 2C90B 1UCYE 1EASA 1UCYH 1DS2E 4X2YA 3LC3A 1P02A 2F9VA 5EXLA 3RXOA 1DUAA 1E0FD 2Q1JA 1INCA 1TPPA 1E35B 1NFUA 5FBIA 2AGEX 2ZP0H 1DLEA 2YOLA 1Z6EA 1AY6H 2OD3B 2BZ6H 4MPUA 4K3JA 3TITA 1RS0A 4AGKA 5TCCA 4FVDA 4FUGA 1P12E 1QBOA 4ABEA 1DXWA 2GP9B 1SG8B 2FEQH 1JBUH 1ZJDA 2A5IA 7KMEH 1NC6A 3P95A 1K2I1 1LHGH 2EI7A 3RMOH 3ZVBA 4E05H 1A61H 1OYTH 4TWYA 1BRCE 1ELTA 3FP6E 2Z9KA 1H9IE 3M3VA 4X6OA 2AIPA 1LVMA 1GBIA 3CS0A 1EJMA 5DO4H 1RGQA 3SU2A 4GPGA 1O3NA 3TH2H 1EZXC 3O8CA 1CA0C 1QIXB 1P2MA 1PJPA 1QHRB 5C1XA 3EA7A 2A5AA 4ABBA 4BAQB 3NKKA 1QCPA 2ZPSA 5T6FA 3MH6A 6CHAB 1P2IA 1S0QA 1SGRE 2HGTH 4ISIH 4TPYA 1O36A 4NIXA 1Y3UA 2GVFA 1LHDH 1MKXK 2GMTB 3MO9A 3EA8A 1VCQA 3MO6A 1DPOA 1MD7A 1KXDA 4OGXA 2BYAX 3KNXA 2BZAA 5DP7A 4BTTB 4DT7B 2IPHA 2ZI2H 1SLXB 2FTMA 3PYHA 2B9LA 1S0RA 3PTBA 5FCKA 3NPSA 1D3PB 1MKWK 3SUFA 3K6YA 4DGJA 8LPRA 1UHBA 2HNTC 4AOQA 1C2FA 4NWLA 1JOUB 1HJ8A 4R8TB 2C8YB 1K9OE 1EQ9A 4D9RA 3LKWA 1D9IA 3MNSA 5FCRA 2BQ6B 4YLQH 2BVXH 5E0GA 4YTAA 2ZFTA 3LDXH 1TGBA 4UEHH 4K1TA 5DK1A 3UWJH 1EPTA 1AMHA 5J4QA 2H5DA 3PWBA 1LHCH 3ATMA 3BIVH 3RU4T 1UVTH 1XUGA 1EJNA 3GY5A 4MLFB 1O3LA 1BJUA 1O2LA 1GJ8B 3LJOA 1QJ7B 5EPNA 1TRYA 5GCHG 1OKXA 3H7OA 1V3XA 2GDDA 1GJDB 2FOEA 2ALVA 3M5NA 2NWNA 1EAIA 3RXDA 3F9FA 1O2VA 3NUMA 3PB1E 4ABIA 3RXJA 1GG6B 5C1UA 3TU7H 5A09A 1NZQH 1P2OA 4YOIA 4M7GA 3ZVDA 3BTWE 1RTKA 3UR9A 2ZQ1A 3KQEA 1NM6A 1P06A 2HNTF 3SGBE 1V2JT 1GI9B 1NESE 2AGGX 1YBWA 1AGJA 5AF9H 3RMMH 4IGDA 5GPIB 3V0XA 4CR5A 3SU0A 1GI6A 4YLUA 3BTHE 1KLTA 1AIXH 1ESTA 2ZGBH 5C2ZA 1EZQA 3KCGH 1WQSA 1A4WH 1O2HA 2ZKSA 3A8BA 1V2KT 1FN6A 2CGAA 3IWMA 1SVPA 1BOQA 4O97A 1O2PA 4ESTE 2PSYA 3SQEE 1AB9C 1T8NA 3RP2A 3BTDE 1P3CA 2A4RA 5IDKA 3ITIA 1THRH 3DUXH 2F83A 1VR1H 3JZ2B 1MUEB 3UQOA 5JBBS 4ISHH 5A0AE 3LGVA 1P01A 1ANDA 2R3YA 3PMBB 1F2SE 2GD4B 3BEIB 5EW2H 5F6MA 5T6DA 3OY5U 4YOGA 4F4OC 3I78A 2ZCKP 1BJVA 3MU1A 4FU9A 3M7QA 1RD3B 3EDXB 1FONA 4Q2KA 2STBE 1TNGA 2J2UA 4PROA 1O3MA 3EE0B 1DUEA 2PTCE 3SUDA 1C2HA 3VGCB 2WPMS 4B76A 1OPHB 4JCNA 1XUFA 2PLXA 4BXSA 4ABFA 2HRVA 1IAUA 3VB5A 3M3TA 4JZFH 3GY2A 2J95A 2VIQA 4I8JA 1C2GA 5DP3A 4AFUA 3BTFE 1O2SA 4X6PA 1ZHPA 3RDZA 3SNCA 6GCHF 2CHAC 4TPIZ 2BDGA 2GX4A 4TWWA 2XC5A 3U69H 1HYLA 1DY8A 1O5BB 3SGAE 5DG6A 3RM2H 1EZSC 2ODQA 1HB0B 3W94A 1O3BA 2BXUH 1CA8B 1C2DA 2ZU3A 3FP7E 1P3EA 4I33A 1EP5A 2O8LA 3RXMA 1SB1H 3A82A 1ORFA 3HATH 2CV3A 4DJZB 1SI5H 3GCTG 3K9XB 4Y79A 2ZF0H 2WPIS 5F8TA 3SN8A 1GBTA 1UTOA 2Q6DA 1P2NA 1EXFA 1D6WA 1FZZA 2CXVA 5EU8A 2FS9A 5B6OA 5DGJA 3UNQA 1N8OB 1MCTA 1F0UA 4TY6A 1C2LA 1E38B 1O2OA 2UUJB 2ZIQH 1BA8B 5I46H 1KXBA 3O8RA 4IN2A 2OINA 4CRCA 1GBJA 1QB1A 2ZU2A 4YESB 1TALA 3B9FH 3UY9A 1ZTJA 2VH6A 1C5OH 1YKTA 1KTTB 1O2KA 1PQ8A 5DP6A 1MZAA 4XE4A 3ATIA 3VGCC 1VZQH 5EPYA 1KLIH 2BLQA 1IHSH 2XWBI 2DE8A 2C4FH 3G01A 2I6QA 1TQ7B 7GCHG 3B23B 4XDEA 2TIOA 3RMLH 1ZMLA 1WUNH 4KP0A 4B73A 1K28D 2W26A 3F6UH 2BY9X 2OXSA 1HLTH 3H5CB 1IQFA 1C5SA 1NT1A 1OP8A 4HI3A 1ZPBA 4Y10E 4YO9A 2SGQE 3NK8A 2GV6A 3C1KA 2YNAA 4E7RG 2CN0H 1XKAC 1HJAB 1G2LA 2VNTA 1FY4A 1THSH 4WWYA 3ESTA 2VIPA 1SQTA 5ETXA 3MNBA 2A45B 4INHA 2EA3A 1NN6A 1CHGA 1NFXA 1MTNB 1K1IA 2R3UA 3LGUA 1PQAA 1SL3A 4WMEA 3KEEA 4JYUH 1GI0A 4Y76A 3P8NA 3TJVA 3QK1A 1N8OC 1C1VH 1TOCB 5TCAA 1C2EA 1DOJA 4U01A 1GMCF 1O34A 1O5AB 4ZUHA 1V2LT 1LVOA 4CHAC 3O8BA 5E0JA 1UVOA 3ZZ5A 2FP7B 4CR9A 1CSOE 1TLDA 4I8LA 3A85A 3UQVA 5LGOA 3MNCA 1Y3WA 1TQ0B 1WSSH 1O3GA 1W7GH 3A84A 5JPMH 1MZDA 2ODYB 2ZDNA 2WYJA 1UK4A 5JBTA 3A83A 1W3CA 3AVZA 1CHOF 4A1TA 2VIWA 2GZ7A 4E06H 1UK3A 1LPGB 1DVAH 4MTBA 2F91A 4ZROA 1VCWA 3LGYA 2QXGA 1ZSJA 1K1OA 1HDTH 2XBYA 5K7RA 1C5VA 1YP9A 1GJ4H 5FHTA 6LPRA 1NRSH 5HMAA 1TMUH 1SFIA 2BDIA 2ZDKA 3TJUA 3S0NA 2LPRA 2ZFPH 3PLKA 2BDCA 3P6ZB 3LJJA 3NXPA 3E16B 2XCNA 4ABGA 2H9HA 3VFEA 2K1QA 3DA9B 3VXEH 1D3TB 3I29A 3C27B 1EP6A 2QF3A 1O33A 1EAWA 1DSTA 2THFB 3TGKE 2C3SA 3Q76A 2FOGA 1ZHMA 4YM9A 1WYKA 1YPKH 1DT2A 3ZZAA 2NU2E 1W2KH 4Y11E 3VPKA 2V3OH 1Z8GA 1HJ9A 3MTYA 3STJA 3MYWA 3V7TA 1GHBF 1ZRKA 1LHFH 1TAWA 3QZRA 3E0NB 1XUIA 2IN2A 7LPRA 1V6DA 1HAVA 3WY8A 1C5UA 1ZJKA 3T28A 1GWAA 4D7FA 2SGDE 4Y0ZE 1C2IA 3P92A 2F9NA 1Z8JB 2A7CA 1ZLRA 4A1VA 2VGCB 1SGDE 1OX1A 3BTTE 4DY7B 1QRWA 1OWJA 3ZZ6A 1HAXB 4TY7A 4KELA 4I8KA 1T4UH 1ETSH 1NFWA 1ZTLA 3GCTF 4XBBA 1JWTA 2SGPE 5EXNA 1YCPH 2Z9JA 1BMAA 5E2OA 2TGDA 1GDQA 2YNBA 5SGAE 2GCTB 3BN9A 3M36A 1BRAA 1K1NA 2RA3A 4AG1A 3ODDA 4R0IA 4MNXA 2ODPA 1O0DH 1MCVA 4GHTA 2ZHEH 1OXGA 2FOCA 4X1NU 1M9UA 4ZMAH 1GGDC 8KME2 3MOCA 1SGIB 1W7XH 1O2QA 4I8HA 1BTUA 2OC0A 3T26A 1E34B 1UJ1A 3DFJA 4RKJB 4Q7ZA 1AFQB 2G4TA 2BD8A 1L1GA 3UWIA 4IN1A 3LIWA 4JMYA 3SI4H 4X8SH 1NPMA 2BQWB 1V2ST 4JZDH 1N1LA 1QURH 1X7AC 1O37A 5ESBA 1EAXA 3BTME 4KTSA 1VGCB 1XUKA 2ZDAH 3TVJB 1A0JA 1CT4E 1YPLH 4RKOB 1PQ7A 3BV9B 2GKVE 4NFEA 2QXHA 2BOHB 2GT8A 1L2EA 1G3EA 5C67A 2VVUA 4THNH 2UUFB 5A2MH 1FY3A 3O8DA 4GAWA 3NCLA 1VJ9U 3T25A 1BTXA 4ZHLU 3RU4E 1C4U2 3KN2A 1QJ1B 3MFJA 1ARCA 2G51A 1FLEE 1A5HA 5A0BA 1YF4A 1W0YH 2ANMH 1ZZZA 3M5LA 1TFXA 4AFSA 3QTOH 4DG4A 3BSQA 3A8DA 3ZZDA 1SGNE 1EJAA 3RXGA 1O2TA 3A89A 1EOJA 3PV4A 3P8OA 1VJAU 2WYGA 3SUEA 4BAHB 1HAZB 5K0HA 4LK4A 3TK5A 3BTQE 1P04A 3M7UA 1H9LB 1EATA 1MU8B 1W0ZU 2C8XB 2Z6BD 4UFDH 1W8BH 4AG2A 3SOSA 1SQOA 3SQHE 4NCYA 1ACBE 4FUJA 1U6QA 4ZHAA 1ESBA 1F0SA 5FPTA 1AFQC 2RCEA 2SGFE 1GCDA 2OTVA 3A7TA 4ISOA 1ZMNA 1XUHA 3FZZA 3SV8A 1DDJA 2ANKH 1FQ3A 2J38A 2ZTXA 2HWLB 3DT0H 3U1IB 3UIRA 1S82A 3GOVB 1GDNA 1Y3XA 4A7IB 2JH5D 1FMGA 1NRPH 4Y7BA 5ABWA 2Y80A 1J9CH 4CBNA 3ZZCA 1XXDA 2ZGJA 1TABE 4AYVB 1AI8H 4SGAE 1HRTH 4F49A 1P0SH 1EX3A 1BBRK 1C1QA 2OUAA 5L6NH 1AE8H 3E8LA 1JIRA 1O3FA 1XMNB 3ZZ4A 1SGYE 1D3DB 1TWXB 1DY9A 1JIMA 2PKSB 1AVWA 1AUJA 3PO1B 5EQRA 3Q3KA 1DWBH 1MTUA 2ZFQH 1HIAA 2QY0B 1C5MD 2AMQA 1GMHG 1OWDA 3E0PB 2TGAA 3QWCH 1L0ZA 1MTSA 3VB3A 1FPCH 2JH6D 1IQKA 1SOZA 2ZEBA 4Z6AH 1RFNA 1S81A 3SU4A 2BX3A 4D76A 1ZSKA 3M37A 1D6RA 3K2UA 2W3KA 1CBWB 1LDTT 2D26C 5DPAA 1LKAA 1P2JA 2OC1A 3D23A 4UD9H 2QN5T 1HFDA 4YZUA 3S9AA 7ESTE 1O2GH 2BD2A 2QCYA 2WPKS 1A1RA 1AKSA 1GBBA 3ATWA 4B75A 2Z94A 1W10U 4I7YH 3EAJA 4X1SU 4MVNA 3ZVAA 1O32A 1P03A 1P8VC 1FY1A 3GY8A 1BTPA 4JZ1A 5EXMA 1L1JA 3RM0H 3M35A 3M5OA 3TNTA 1PPEE 4JYTA 4ZXYH 4IW4E 2FI3E 4K1SA 1TA2A 2VJ1A 1HAGE 1NRRH 5BPEA 1Y59T 1C5WB 4O3TA 1P10A 1YLCA 2CF8H 1TX6A 3LT3A 3QUMP 2ZZUH 1P9SA 2TRMA 2XWAA 2OC7A 2PKSC 6CHAC 2GZ9A 2CJIA 3ZZ8A 2Y82A 1FPHH 3V3MA 1HAOH 3TJOA 1ZHRA 2PTNA 4GHQA 4AYYB 1ABJH 2FODA 2GMTC 1UCYK 4IC5A 3MO3A 3E6PH 3E1XB 5ESTE 1IQJA 4ASHA 2G5NA 5C1YA 4CH2B 5BRRE 1T7CA 3EYDA 4SGBE 2SGAA 4ABHA 3EQ0H 1TNHA 1SQAA 2PUXB 2OQ5A 2HLCA 2W5EA 4ZKNU 3T27A 4D7GA 1ELEE 1QBNA 1FIZA 2UUYA 2ZU1A 5HM2A 2WPJS 1Y5BT 4JYVH 4AZ2B 1SGFG 1C5LH 1EB2A 2C8ZB 2XCFA 1OP0A 1QA7A 3S69A 4XSKU 5AHGH 4H6TA 3TGJE 2O8WA 3SNEA 2J94A 4KTUA 2JH0D 3ZYDA 1Y3VA 4D9QA 1QBVH 3KHVA 1V2NT 1DFPA 1O2YA 1GBAA 1H4WA 2P3TB 4XFQA 1S6FA 1KIGH 3HGPA 2JKHA 4FVBA 2UWLA 3KQDA 4WH8A 4X1PU 3BIUH 1QTFA 1TNIA 1O2UA 1O3EA 1E37B 1SMFE 1XM1A 4LOYH 1SGEE 2FX6A 2RG3A 9LPRA 4ABJA 1UTKA 2Y7XA 1TBRH 4JZEH 4MQAA 3F1SB 1GVLA 4UONA 1TNKA 1ELDE 3RC4A 5FPSA 1BTYA 1LVYA 1PPBH 3FZDA 4NZQA 3SORA 1RIWB 1O2NA 4OS7A 4ISNA 2PKAA 3URDA 1DE7H 1SHHB 4X6MA 1PPFE 1O2RA 1E36B 1NTPA 1YPMH 2GGVB 4VGCB 3RXHA 4OS4A 1T4VH 1GI8B 1GG6C 3TH3H 3E3TA 1SC8U 4YT7H 3A7ZA 2A4GA 4WXVA 3SHAH 4D8NA 1BHXB 2D1JA 2ANYA 3MU8A 3RXPA 1ZSLA 2G4UA 2ZHDA 2ESTE 1WU1A 3AAUA 2EEKA 5IYTA 1LTOA 4MNWA 4HFPB 1O2JA 1KXCA 1OOKB 1WTHD 1CT2E 1NROH 1GBFA 3LH1A 2G52A 1UMAH 2W7UA 1SGTA 2OQUA 3HK6B 2OCVB 1TNJA 2GT7A 4O9VA 1HCGA 1FJSA 2Z9GA 1BRUP 3AASA 2XRCA 2ZDLA 3BG4B 1TMBH 3PTNA 1WCZA 3RLWH 1DWCH 4WJG2 1B7XB 1UVUH 2G00A 3ATLA 2P93A 2BB4A 1PPZA 3QO6A 1GBDA 2BVRH 4I8GA 2AMPA 2XTTB 3FVFB 4H6SB 1GJBB 3SJKA 5EG4A 1UHBB 3ZVEA 4O3UA 5DP4A 4X1QU 1XX9A 2BD9A 4HTCH 1Z8RA 1J14A 2BD3A 1FN8A 2V0BA 3QGNB 1YYY1 1GI3A 1H8DH 3ZVFA 2ZDVH 1ZPZA 4FXGH 2NU0E 1V2UT 1A2CH 1UVPA 1GVKB 5C5OA 1ELAA 1A0HB 4VGCC 2P16A 3SU6A 1K22H 2NU4E 2Y5FA 3GDVA 5HYOA 1HV7A 1EPTB 3F9HA 1DM4B 1LCYA 2QXJA 3KIDU 4HZHA 4I32A 2BOKA 4LXBH 1BTZA 3NWUA 1O2IA 5AFZH 5GIBA 4WY3A 1K1MA 3SNBA 1AZZA 2XBVA 5JDUB 1AVGH 1O3PB 1UTLM 3S9BA 1PPGE 5LPEA 2O9QA 2VWOA 5GDSH 3R3GB 2AS9A 1P2KA 3ZV8A 1TYNA 1A3BH 1RJXB 1H1BA 1BUIA 1QRXA 1IQLA 1QRZA 4B1TA 1LO6A 4AN7A 4TYDA 1O2MA 1KTSB 2OP9A 2P8OB 2VIVA 1Q3XA 3KQCA 3M61U 1IQEA 2ZU5A 1NRQH 2BD5A 5EOKA 2ZGCA 1UTPA 3UOUA 4NZLA 5CHAB 5GCHF 1O5EH 2KAIA 1TGNA 2BDYA 1VITG 4YOJA 3UNRA 3LU9B 1ZGVA 4RSPA 4BTIB 2ZCHP 1AWFH 3TIUA 5A0CA 1ELCA 3B8JA 1SSXA 4Y8XA 3MU5A 4H4FA 1Z7KA 1O3KA 2WPHS 1SHYA 1XUJA 1WTGH 3ODFA 8ESTE 3PMHB 3MH7A 1P2QA 2OBOA 4MPVA 3IITA 4NIYA 4OS6A 1GL1A 2B7DH 2H9EH 3RXVA 1K1LA 2FLRH 1W13U 3A7WA 4HGCA 3U8TH 1C1PA 4ZHMU 2H1UA 2GTBA 4O03A 1OS8A 2Z9IA 3ELAH 1G32B 3MMGA 1IQHA 3A7XA 2A31A 1Q2WA 2BD7A 2CF9H 1YLDA 1L1NA 1BMMH 2ZHQH 1EOLA 4UFEH 3BEUA 2A7HA 3V12A 3P8FA 1GBLA 3BG8A 1ESAA 1DANH 1GJ6A 2PW8H 1HJAC 2FI5E 3K6ZA 5I25A 2ZNKH 2QV1A 1JRSA 1C1MA 1W12U 1O3AA 3DHKH 2ZWLH 2P8OC 1C1OA 3HKIB 1MTNC 1O3DA 3ENSB 4CREA 1W11U 1NRNH 3FAOA 2FYRA 1F7ZA 3SJ9A 3V13A 3AAVA 3F9GA 3ATKA 3OSYA 4X6NA 5F8ZA 1A5GH 2JETB 1EB1H 1MD8A 3S7HB 1T31A 1FIWA 1D4PB 1QQUA 3SUGA 3GY3A 1GHZA 1V2MT 2AIQA 4Y8ZA 1XVOA 1G30B 4DW2U 1HGTH 1TGCA 4NA9H 1B0FA 1SLVB 1NU7B 3TGIE 1GCTB 1NS3A 2BTCE 1AWHB 1J15A 1TX7A 1WAYB 2SGEE 2DUCA 3ZVCA 1AU8A 1KSNA 2BY5X 4X8TH 2F9OA 4FUBA 1Z1IA 2BLVA 1EAUA 1BT7A 3A80A 2PGQB 3UTUH 1AO5A 1SGPE 1KXAA 3QTVH 1AFEH 1GDUA 5F03A 2A5KA 3DD2H 3RXIA 1BIOA 2QGRA 1CE5A 3GCOA 3GCHB 3K65B 3RXEA 1IQIA 3S9CA 2HPQH 5AFYH 3VXFH 5FPYA 5JB9S 1TIOA 3SO3A 2Z3DA 3FFGA 1J8AA 4K8BA 4UE7H 1Q31A 1QL7A 1C5TA 8GCHG 2NU3E 1GJAB 3T62A 1MKXH 1C1UH 2H2ZA 2V3HH 6ESTA 3BEFB 1C2KA 2A0QB 1JMOH 1RRKA 2A1DB 1FXYA 3PMJA 1O5CB 3RXFA 2FOBA 2GCHG 3GDUA 5DJ7A 1QJ6B 4CRBA 1TPAE 4MNVA 2BD4A 1ANCA 4K8YA 1THPB 2FTLE 3D65E 1MKWH 7GCHF 1CQQA 2AYWA 2Q6FA 1SLWB 1UTQA 1GI2A 4CRGA 3MI4A 2EC9H 2O8UA 3RXKA 2AMDA 1BMLA 2Z7FE 2ZGHA 1ZTKA 3BTGE 3SU3A 3QX5H 3BTKE 3L3TA 1CGHA 1S85A 4CH8B 1N6YA 1GHWH 4IS5A 2KAIB 4GUXA 4WMFA 2BHGA 5DP9A 1O3IA 2P3UB 1F0RA 1Z8IB 1MQ5A 1F92A 3L6PA 1SGQE 3TLOA 2O8TA 2VGCC 1C5QA 1IHTH 1TONA 3GYLB 1FNIA 5EW1H 5FBEA 4BANB 4Q80A 3RLYH 1O5DH 2XYAA 3PROA 1CA0B 4BAMB 1OWHA 2FOAA 5AVDA 2GCTC 2W3IA 2ZHFH 3P70B 3GCHC 4NA7A 3U98H 4BXWA 4Q7YA 2J92A 4UDWH 2BX4A 1OP2A 3RXRA 2VIDA 1A46H 9ESTA 1PPCE 2TPIZ 4NWKA 1C2JA 4GVUA 4CRAA 4CBOA 3L33A 4CRDA 1RTFB 3AW1A 3LOXA 5TJXA 3NZIA 2AERH 1QR3E 4K60A 2BDBA 1B5GH 3RUOA 1J16A 4XOJA 3GISB 3QZQA 4K1EA 3EA9A 3A8AA 1AD8H 1G2MA 3E91A 1C9PA 5F8XA 1FY8E 4AB8A 1TNLA 2TGTA 4NSYA 1HAYB 4QT8C 2QXIA 1SFQB 4FUFA 2BY7X 1HBTH 3PLPA 1VGCC 4ZAEA 3HPTB 1O5FH 2Y5HA 2ZDMA 3UREA 1SLUB 6GCHG 1V2TT 4A5TS 5EQSA 5L2YH 2Y6TA 1HXEH 1YPEH 3M7TA 2HVXA 1Z71A 2FZZA 1G9IE 3A81A 1T8OA 2Z3EA 2SFAA 1FUJA 2OBQA 4WH6A 2QIQA 5EGMA 2WPLS 2XNIA 1AVXA 1F5KU 1A3EH 1SPJA 5CE1A 1LVBA 4U2WA 3TNSA 1O39A 1YCPK 1C5NH 1TMTH 1SGFA 3FANA 1G36A 1TGTA 2FYQA 2ZPQA 3OY6U 1UVSH 1SOTA 2PV9B 1G3CA 2WUBA 4OGYA 3U1JB 2B8OH 2FXRA 2VWNA 1HAVB 1SR5C 1F0TA 2BDHA 1L4ZA 3MWIU 4WVPE 2VIOA 4ZKOU 3TPIZ 4BAKB 1V2RT 2PGBB 4IMZA 1TX8A 1TBZH 4X8VH 1YPHE 1J17T 1C1WH 1HPGA 1GI4A 2IOTA 2FLBH 1NY22 2TGPZ 2J9NA 2EI6A 2ZA5A 4U30A 1C5ZB 1YPGH 1BQYA 1GJ9B 1C1RA 1FDPA 3LONA 4ABDA 3S7KB 3SV2H 2D8WA 1O2ZA 2VWLA 2A32A 3ZZBA 1TGSZ 2BY6X 5A8XA 1JRTA 5FX5A 3RXTA 1HNEE 3UR6A 2A7JA 5A8ZA 2BDAA 1F5LA 1CGIE 2C8WB 3VB4A 1O2XA 3PO1C 3EGKH 4OS2A 4J1YA 1AZ8A 1KY9A 2FOFA 2XW9A 1WBGB 1O30A 4WXIA 1MU6B 1AB9B 3RXUA 2XC0A 4BAOB 4JZIA 3HK3B 3ZZ9A 4JK5A 1GPZA 1HAIH 1V2QT 1NU9A 1TRNA 1GVZA 2O8MA 3Q77A 4IMQA 3RXCA 4K69A 8GCHF 4X2WA 3P8GA 5J4SA 2R2WU 1O3OA 4AFQA 3GYMA 2BXTH 5C20A 3LGWA 5HGGA 1CBWC 1C9TA 1K21H 4DCDA 3T29A 2GCHF 1GMCG 2ZFSA 3HKJB 1LPZB 2ILNA 5LPFA 5L30H 1PQ5A 3UUZA 4MG3A 1ETTH 4NIVA 4H42U 4KGAA 2PUQH 5T6GA 3RXBA 2QF0A 1TRMA 3KGPA 5DKMA 3KQBA 4MPWA 1OSSA 2P94A 1CHOG 2BLWA 2XBXA 2R9PA 1KDQA 2CHAB 4KKDA 4JK6A 4FUHA 1AE5A 1ARBA 1O5GH 5DP8A 2ZCLP 3SGQE 4DOQA 3CS7A 1Z1JA 1MH0A 2Y5GA 1RXPA 4GCHG 2ZFRH 1C4V2 2Q6GA 2VVVA 2ZFFH 4U32A 2PSXA 1LQDB 3RMNH 2ZGXH 3TK9A 3CP7A 1QQ4A 2R2MB 1O2WA 1MTVA 1V2OT 2A4OA 3GDSA 2I6SA 3UFAA 3AW0A 4DVAU 4X2XA 1O31A 2F9BH 2BQ7B 3TH4H 1QA0A 3R0FA 1C5RA 1UTJA 3VEQB 2FMJA 3SJIA 2J4IA 3RXSA 1ZMJA 1IQNA 3PMAB 4DURA 1GJ7B 1H8IH 1DICA 5T3HA 2ZTYA 4IBLH 1TB6H 3I77A 3ZZ3A 2V35A 5FXLA 1HUTH 4B74A 4B2BA 1DWEH 4Y7AA 5H4IB 1MBQA 1ELGA 1C5XB 2ZU4A 3LGTA 3PM3A 1YM0A 2ZC9H 4K2YA 1DWDH 1OYQA 1QL8A 1RTLA 1GMDG 5PTPA 1OWKA 3UNSA 1TOMH 3GY6A 1HIAB 1S5SA 2A2QH 1GI1A 1UTMA 3OX7U 2J34A 3Q3YA 1OWEA 1MAYA 2UUKB 1DLKB 1EUFA 1S6HA 2F9PA 1GHBG 4OS1A 2NU1E 1BCUH 1O3HA 2GV7A 4A6LA 2G8TA 4I31A 4BNRA 1ZR0A 3QDZB 3SV9A 2HPPH 2PHBA 3SNDA 1YPHC 2FO9A 4IC6A 4Y6DA 4B2AA 1ELBA 2H9TH 4BOHA 1B0EA 2BMGB 2H5CA 1GBKA 1GHYH 1GMHF 1QFKH 2VINA 4FUCA 5LH8A 4NFFA 1W14U 3U8RH 2SNVA 1AKSB 3M5MA 3A87A 1CO7E 2LNCA 1KLJH 3A86A 2FM2A 2GZ8A 4GSOA 4Y71A 3RC6A 1NFYA 3MNXA 1RIWC 1QNJA 2VU8E 2B5TB 4INKA 1GBHA 1AN1E 4A1XA 3GY4A 2A2XH 3A7VA 1TPOA 1A5IA 4B71A 3RXQA 3HGNA 2P3FH 1N6XA 2XC4A 1PYTC 2HALA 4CHAB 2GDEH 5C5NA 5LPRA 1XXFA 2FS8A 1GHAG 1O38A 3SU1A 3W95A 2AFQB 4Q7XA 2PFEA 1UTNA 1AHTH 1ZYOA 5FX6A 4FUDA 2ZTZA 4AX9H 3MU0A 2VVCA 3SJOA 3URCA 1DITH 1Y3YA 2BM2A 1BRBE 2ANWA 4Y0YE 1VCPA 1V2PT 3ZYEA 1Z6JH 4XBCA 4RN6A 1CU1A 1VITH 1GHVH 2ASUB 1BZXE 3GCNA 1MMJN 3TK6A 1PFXC 3BG4C 4NIWA 1LKBA 1ELFA 3KF2A 3LPRA 2W7SA 1MAXA 3T5FH 3FP8E 2VH0A 2WUCA 2XBWA 2QC2A 1ANBA 2FOHA 3SV6A 1ZOMA 5E8EH 4CRFA 2R0KA 1K1JA 1YC0A 2QA9E 3BF6H 1FAKH 4E7NA
chains in the Genus database with same CATH superfamily
1YCPM 2ZHWH 2FESH 3A8CA 1DXPA 3RU4D 2R0LA 1C1TA 4DIHH 1GI5A 2EI8A 3F9EA 1LHEH 2FPZA 2IJOB 1GBMA 3QGJA 2QYIA 1V2WT 1IOEA 2FOMB 3ZZ7A 1KDQB 2RFKC 1LQEA 3T2NA 2G55A 4DIIH 1GHXH 2F9UA 3VB6A 3GY7A 2HOBA 1G37A 5E2PA 3WWBA 3LH3A 2KR7A 1BHXF 1MBMA 1F5RA 1ANEA 1YPJH 1EPTC 3A88A 4ZXXH 4AGJA 5CMXH 4FUEA 1TE0A 3VB7A 5C3NA 5DN6D 1ABIH 3SNAA 3BTEE 1T8MA 4K5ZA 1GBCA 1HAHH 1BITA 1V2VT 1NO9H 4ABAA 1WQVH 4J2YB 5GWZA 2Y81A 1LPKB 2Y7ZA 4AORA 2FWWA 5C0UA 1Y8TA 4KTCA 1GJCB 1L4DA 1C1NA 1S83A 2UWPA 2J98B 1QL9A 4NGAH 2AGIX 2FDAA 2WV4A 3LGIA 4INLA 2UWOA 1C5PA 5FAHA 2PKAB 1TA6A 2FI4E 1D3QB 2CMYA 3D49H 4GCHF 1P09A 5E0HA 2VB0A 4MNYA 3A7YA 2VWMA 2H6MA 5HM9A 3RXLA 4Y8YA 3JZ1B 2PR3A 3QN7A 4B2CA 1C4Y2 3OTJE 2D2DA 1A0LA 2ULLA 4FU8A 1YY3A 5KECA 2TBSA 5DP5A 1TPSA 5CHAC 4ACBA 2V6NA 3OU0A 1ZPCA 1C5YB 1P57B 1XKBC 2WINI 2FX4A 1Y5UT 5KGOA 1IQGA 2ZPRA 3SJ8A 3TJNA 3SV7A 4XBDA 3N7OA 3Q00A 4MPXA 1ETRH 3DFLA 2RA0A 3H7TA 1C1SA 1QGFA 1ID5H 3SI3H 1ZGIA 2B0FA 1GGDB 1Y5AT 2V7QD 1AUTC 1MTWA 1UO6A 1CVWH 1KXEA 4OS5A 1GJ5H 4X2VA 1SGCA 2PWXA 4X1RU 2AH4X 3M3SA 4GLYA 5GXPA 1GMDF 1O35A 3SW2B 2Z3CA 2XXLA 3SZNA 2BY8X 5GNDA 5L2ZH 3IG6B 3PWCA 5EQQA 2G5VA 3ZV9A 5B6LA 2QAAA 1P9UA 1UK2A 1QB9A 4DT4A 1H9HE 3STIA 3F68H 3QLPH 3MH4A 1BB0B 4NA8A 3LC5A 4UFFH 2P95A 4YT6H 1EZUC 4X0WU 3D62A 1GI7B 4ZKRU 1S84A 4X8UH 4ZKSU 1BBRE 1BBRH 1JXPA 1P05A 1LMWB 4LZ4B 1GL0E 3MU4A 3U9AH 3MH5A 2OC8A 3SU5A 5JYIA 5JB8S 1IQMA 2C93B 5EODA 3W1EA 4AB9A 2RDLA 2G81E 1O3JA 1PPHE 4Z0KA 2KM0A 1DSUA 2ZECA 2BLOA 1SBWA 2HNTE 1TBQH 1FI8A 2JETC 3MHWU 1PYTD 2A4QA 1WOFA 5HXFA 1WV7H 2WV5A 1BTHH 1C2MA 3GICB 3Q3XA 1GBEA 2BVSH 4FETA 4WF8A 4FUIA 1KMHB 1HAPH 1CT0E 3PLBA 2OLGA 4ZCNA 1O3CA 1FAXA 3P17H 1GHAF 4HG6A 1T8LA 2FIRH 3U8OH 1FY5A 1BTWA 5JBCS 2DE9A 1BDAA 2ZQ2A 5GJ4B 1G3DA 2WV9A 4NSVA 2ZO3H 4A92A 1GCTC 5G4BA 3CENA 3SBKA 3RC5A 5A8YA 1HXFH 1AQ7A 1BMNH 4LZ1H 3WWFA 2HLDD 1ELVA 1DX5M 1ZRBA 1QB6A 3OYPA 4UFGH 2Z9LA 3KL6A 2M5TA 3UPEA 3SHCH 1EKBB 5JBAS 4ISLA 1KXFA 2STAE 1K1PA 2P59A 4WMDA 1OWIA 4BTUB 1G3BA 2ALPA 1A7SA 2SNWA 1YGCH 1QY6A 1CGJE 1T32A 4NG9H 2ZG0H 1KYNA 1VITF 1FV9A 1P11E 3ZVGA 2AEIH 2F3CE 3UOPA 4ZH8A 1MQ6A 4FU7A 4AFZA 4I86A 3E90B 3RXAA 1XVMA 4MDSA 2C90B 1UCYE 1EASA 1UCYH 1DS2E 4X2YA 3LC3A 1P02A 2F9VA 5EXLA 3RXOA 1DUAA 1E0FD 2Q1JA 3U28C 1COWD 1INCA 1TPPA 1E35B 1NFUA 5FBIA 2AGEX 2ZP0H 1DLEA 2YOLA 1Z6EA 1AY6H 2OD3B 2BZ6H 4MPUA 4K3JA 3TITA 1RS0A 4AGKA 5TCCA 4FVDA 4FUGA 1P12E 1QBOA 3KYFA 4ABEA 1DXWA 2GP9B 1SG8B 2FEQH 1JBUH 1ZJDA 2A5IA 7KMEH 1NC6A 3P95A 1K2I1 1LHGH 3CNRA 2EI7A 3RMOH 3ZVBA 4E05H 1A61H 1OYTH 4TWYA 1BRCE 1ELTA 3FP6E 2Z9KA 1H9IE 3M3VA 4X6OA 2AIPA 1LVMA 2YMSC 2M2AA 1GBIA 3CS0A 1EJMA 5DO4H 1RGQA 3SU2A 4GPGA 1O3NA 3TH2H 1EZXC 3O8CA 2K8IA 1CA0C 1QIXB 1P2MA 1PJPA 1QHRB 2L6OA 5C1XA 3EA7A 2A5AA 4ABBA 4BAQB 3NKKA 1QCPA 2ZPSA 5T6FA 3MH6A 6CHAB 1P2IA 1S0QA 1SGRE 2HGTH 4ISIH 4TPYA 1O36A 4NIXA 1Y3UA 2GVFA 1LHDH 1MKXK 2GMTB 3MO9A 3EA8A 1VCQA 3F2GA 3MO6A 1DPOA 1MD7A 1KXDA 4OGXA 2BYAX 2QF5A 3KNXA 2BZAA 5DP7A 4BTTB 4DT7B 2IPHA 2ZI2H 1SLXB 2FTMA 3PYHA 2B9LA 1S0RA 3PTBA 5FCKA 3NPSA 1D3PB 1MKWK 3SUFA 3K6YA 5HKKD 4DGJA 8LPRA 1UHBA 2HNTC 4AOQA 1C2FA 4NWLA 1NBMD 1JOUB 1HJ8A 4R8TB 2C8YB 2JJ1D 1K9OE 1EQ9A 4D9RA 3LKWA 1D9IA 3MNSA 5FCRA 2BQ6B 4YLQH 2BVXH 5E0GA 4YTAA 2ZFTA 3LDXH 1TGBA 3OTPA 4Q63A 4UEHH 4K1TA 5DK1A 3UWJH 1EPTA 1AMHA 5J4QA 2H5DA 3PWBA 1LHCH 3ATMA 3BIVH 3RU4T 1UVTH 1XUGA 1EJNA 3GY5A 4MLFB 1O3LA 1BJUA 1O2LA 1GJ8B 3LJOA 1QJ7B 5EPNA 1TRYA 2IJD1 5GCHG 1OKXA 3H7OA 1V3XA 2GDDA 1GJDB 2FOEA 2ALVA 3M5NA 2NWNA 1EAIA 3RXDA 3F9FA 1O2VA 3NUMA 3PB1E 4ABIA 3RXJA 1GG6B 5C1UA 3TU7H 5A09A 1NZQH 1P2OA 4YOIA 4M7GA 3ZVDA 2OK5A 3BTWE 1RTKA 1WDIA 3UR9A 2ZQ1A 3KQEA 1NM6A 1P06A 2HNTF 3SGBE 1V2JT 1E79D 4RT0A 1GI9B 3WW7A 1NESE 2AGGX 1YBWA 1AGJA 5AF9H 3RMMH 4IGDA 5GPIB 3V0XA 4CR5A 1SQRA 3SU0A 1GI6A 4YLUA 3BTHE 1KLTA 1AIXH 1ESTA 2ZGBH 5C2ZA 1EZQA 3KCGH 1WQSA 1A4WH 5CHBA 1O2HA 2ZKSA 3A8BA 1V2KT 1FN6A 2CGAA 3IWMA 1SVPA 1BOQA 4O97A 1O2PA 4ESTE 1YWUA 2PSYA 3SQEE 1AB9C 1T8NA 2WSSD 3RP2A 3BTDE 5C94A 1P3CA 2A4RA 5IDKA 3ITIA 1THRH 3DUXH 2F83A 1VR1H 3JZ2B 1MUEB 3UQOA 5JBBS 4ISHH 5A0AE 4YXWD 3LGVA 1P01A 1ANDA 2R3YA 3PMBB 1F2SE 2GD4B 3BEIB 5EW2H 5F6MA 5T6DA 3OY5U 4YOGA 4F4OC 3I78A 5CDFE 2ZCKP 1BJVA 3MU1A 4RT1A 2K0QA 4FU9A 3M7QA 1RD3B 3EDXB 1FONA 4Q2KA 2STBE 1TNGA 2J2UA 4PROA 1O3MA 3EE0B 1DUEA 2PTCE 3SUDA 1C2HA 3VGCB 2WPMS 4B76A 1OPHB 4JCNA 1XUFA 2PLXA 4BXSA 4ABFA 2HRVA 1UW7A 1IAUA 3VB5A 3M3TA 4JZFH 3GY2A 2J95A 2VIQA 4I8JA 1C2GA 5DP3A 4AFUA 3BTFE 1O2SA 4X6PA 1ZHPA 3RDZA 3SNCA 6GCHF 2CHAC 4TPIZ 2BDGA 2GX4A 4TWWA 2XC5A 3U69H 1HYLA 1DY8A 1O5BB 4M9FA 3SGAE 5DG6A 3RM2H 1EZSC 2ODQA 1HB0B 3W94A 1O3BA 3OFND 2BXUH 1CA8B 1C2DA 2ZU3A 3FP7E 1P3EA 4I33A 1EP5A 2O8LA 3RXMA 1SB1H 3A82A 1ORFA 3HATH 2CV3A 4DJZB 1SI5H 3GCTG 3K9XB 4Y79A 2ZF0H 2WPIS 5F8TA 3SN8A 1GBTA 1UTOA 2Q6DA 1P2NA 1EXFA 1D6WA 1FZZA 2CXVA 5EU8A 2FS9A 5B6OA 5DGJA 3UNQA 1N8OB 1MCTA 1WXRA 1F0UA 4TY6A 2QF4A 1C2LA 1E38B 1O2OA 2UUJB 2ZIQH 1BA8B 5I46H 1KXBA 3O8RA 4IN2A 5DSFA 2OINA 4CRCA 1GBJA 1QB1A 2ZU2A 4YESB 1TALA 3B9FH 3UY9A 1ZTJA 2VH6A 1C5OH 1YKTA 1KTTB 1O2KA 1PQ8A 5DP6A 1MZAA 4XE4A 2J97A 3ATIA 3VGCC 5HIZA 1VZQH 5EPYA 1KLIH 2BLQA 1IHSH 2XWBI 2DE8A 2C4FH 3G01A 2I6QA 1TQ7B 3F3BA 7GCHG 3B23B 4XDEA 2TIOA 3RMLH 1ZMLA 1WUNH 4KP0A 1S6LA 1K28D 2W26A 4B73A 3F6UH 2BY9X 2OXSA 1HLTH 3H5CB 1IQFA 1C5SA 1NT1A 1OP8A 4HI3A 1ZPBA 4Y10E 4YO9A 2SGQE 1FX0B 3NK8A 2GV6A 3C1KA 2YNAA 4E7RG 2CN0H 1XKAC 1HJAB 3KQ5A 1G2LA 2VNTA 1FY4A 1THSH 4WWYA 3ESTA 2VIPA 1SQTA 5ETXA 3MNBA 2A45B 4INHA 2EA3A 1NN6A 1CHGA 1NFXA 1MTNB 1K1IA 2R3UA 3LGUA 1PQAA 1SL3A 4WMEA 3KEEA 4JYUH 1K0HA 1GI0A 2KZ4A 4Y76A 3P8NA 3TJVA 3QK1A 1N8OC 1C1VH 1TOCB 5TCAA 4AC9A 1C2EA 1DOJA 4U01A 1GMCF 1O34A 1O5AB 4ZUHA 1V2LT 1LVOA 4CHAC 3O8BA 5E0JA 1UVOA 3ZZ5A 2FP7B 4CR9A 1CSOE 1TLDA 4I8LA 3A85A 3UQVA 5LGOA 3MNCA 4OM9A 1Y3WA 1TQ0B 1WSSH 1O3GA 1W7GH 3A84A 5JPMH 1MZDA 2ODYB 2ZDNA 2WYJA 1UK4A 5JBTA 3A83A 1W3CA 3AVZA 1CHOF 4A1TA 2VIWA 2GZ7A 4E06H 1UK3A 1LPGB 1DVAH 4MTBA 2F91A 4ZROA 1VCWA 5EJZA 3LGYA 3N7DA 2QXGA 1ZSJA 4P02A 3OEHD 1K1OA 1HDTH 2XBYA 5K7RA 1C5VA 1YP9A 1GJ4H 5FHTA 6LPRA 1NRSH 5HMAA 4TT3D 1TMUH 1SFIA 2BDIA 2ZDKA 3TJUA 3S0NA 2LPRA 2ZFPH 3PLKA 2BDCA 3P6ZB 3LJJA 3NXPA 3E16B 2XCNA 4ABGA 2H9HA 3VFEA 2K1QA 3DA9B 3VXEH 1D3TB 3I29A 3C27B 1EP6A 3EE7A 2QF3A 1O33A 1EAWA 1DSTA 2THFB 3TGKE 2C3SA 2XNDD 3Q76A 2FOGA 1ZHMA 4YM9A 1WYKA 1YPKH 1DT2A 3ZZAA 2NU2E 1W2KH 4Y11E 3VPKA 2V3OH 1Z8GA 1HJ9A 3MTYA 3STJA 3MYWA 1BMFD 3V7TA 1GHBF 1ZRKA 1LHFH 1TAWA 3QZRA 3E0NB 1XUIA 2IN2A 7LPRA 1V6DA 1HAVA 3WY8A 1C5UA 1ZJKA 3T28A 1GWAA 4D7FA 2SGDE 4Y0ZE 1C2IA 3P92A 2F9NA 1Z8JB 2A7CA 1ZLRA 4A1VA 2VGCB 1SGDE 1OX1A 3BTTE 4DY7B 1QRWA 1OWJA 2KFWA 1HAXB 4TY7A 3ZZ6A 4KELA 4I8KA 1T4UH 1ETSH 1NFWA 1ZTLA 3GCTF 4XBBA 1JWTA 2SGPE 5EXNA 1YCPH 2Z9JA 1BMAA 5E2OA 2TGDA 1GDQA 2YNBA 5SGAE 2GCTB 3BN9A 3M36A 1BRAA 1K1NA 2RA3A 4AG1A 3ODDA 4R0IA 4MNXA 2ODPA 1O0DH 1MCVA 4GHTA 2ZHEH 1OXGA 2FOCA 4X1NU 1M9UA 4ZMAH 1GGDC 8KME2 3MOCA 1SGIB 1W7XH 1O2QA 4I8HA 1BTUA 2OC0A 3T26A 4ASUD 1E34B 1UJ1A 3DFJA 4RKJB 4Q7ZA 1AFQB 2G4TA 2BD8A 1L1GA 3UWIA 4IN1A 3LIWA 4JMYA 3SI4H 4X8SH 1NPMA 2BQWB 1V2ST 4JZDH 1N1LA 1QURH 1X7AC 1O37A 5ESBA 1EAXA 3BTME 4KTSA 1VGCB 1XUKA 2ZDAH 3TVJB 1A0JA 1CT4E 1YPLH 4RKOB 1PQ7A 3BV9B 2GKVE 4NFEA 2QXHA 2BOHB 2GT8A 1L2EA 1G3EA 5C67A 2W6ID 2VVUA 4THNH 2UUFB 5A2MH 1OHHD 1FY3A 3O8DA 4GAWA 3NCLA 1VJ9U 3T25A 1BTXA 4ZHLU 3RU4E 1C4U2 3KN2A 1QJ1B 2GJGA 3MFJA 1ARCA 2G51A 1FLEE 1A5HA 5A0BA 1YF4A 1W0YH 2ANMH 1ZZZA 3M5LA 1TFXA 4AFSA 3QTOH 4DG4A 1E1QD 3BSQA 3A8DA 3ZZDA 1SGNE 1EJAA 3RXGA 1O2TA 3A89A 1EOJA 3PV4A 3P8OA 1VJAU 2WYGA 3SUEA 4BAHB 1HAZB 5K0HA 4LK4A 3TK5A 3BTQE 1P04A 3M7UA 1H9LB 1EATA 1MU8B 1W0ZU 2C8XB 2Z6BD 4UFDH 1W8BH 4AG2A 3SOSA 1SQOA 3SQHE 4NCYA 1ACBE 4FUJA 1U6QA 4ZHAA 1ESBA 1F0SA 5FPTA 1AFQC 2RCEA 2SGFE 1GCDA 2QE7D 2OTVA 3A7TA 4ISOA 1ZMNA 1XUHA 3FZZA 3SV8A 1DDJA 2ANKH 1FQ3A 2J38A 2ZTXA 2HWLB 3DT0H 3U1IB 3UIRA 1S82A 3GOVB 1GDNA 1Y3XA 4A7IB 2JH5D 1FMGA 1NRPH 4Y7BA 5ABWA 2Y80A 1J9CH 4CBNA 3ZZCA 1XXDA 2ZGJA 1TABE 4AYVB 1AI8H 3PV5A 4SGAE 1HRTH 4F49A 1P0SH 1EX3A 1BBRK 1C1QA 2OUAA 5L6NH 1AE8H 3E8LA 1JIRA 1O3FA 1XMNB 3ZZ4A 1SGYE 1D3DB 1TWXB 1DY9A 1JIMA 2PKSB 1AVWA 1AUJA 3PO1B 5EQRA 3Q3KA 1DWBH 1MTUA 2ZFQH 1HIAA 2HVYB 2QY0B 1C5MD 2AMQA 4TSFD 1GMHG 1OWDA 3E0PB 2TGAA 3QWCH 1L0ZA 3KYGA 1MTSA 3VB3A 1FPCH 2JH6D 1IQKA 1SOZA 2ZEBA 4Z6AH 1RFNA 1S81A 3SU4A 2BX3A 4D76A 1ZSKA 3M37A 1D6RA 3K2UA 2W3KA 1CBWB 3F0OA 1LDTT 2D26C 5DPAA 1LKAA 1P2JA 2OC1A 3D23A 4UD9H 2QN5T 1HFDA 4YZUA 3S9AA 7ESTE 1O2GH 2BD2A 2QCYA 2WPKS 3PV2A 1A1RA 1AKSA 1GBBA 2XOKD 3ATWA 4B75A 2Z94A 1W10U 4I7YH 3EAJA 4X1SU 4MVNA 3ZVAA 4F48B 1O32A 1P03A 3N99A 2F43B 1P8VC 1FY1A 3GY8A 1BTPA 4JZ1A 5EXMA 2PP6A 4Q4LA 1L1JA 3RM0H 3M35A 3M5OA 3TNTA 1PPEE 4JYTA 4ZXYH 4IW4E 2FI3E 4K1SA 1TA2A 2VJ1A 2KCAA 1HAGE 1NRRH 1SKYE 5BPEA 1Y59T 1C5WB 4O3TA 1P10A 1YLCA 2CF8H 2CK3D 1EFRD 1TX6A 3LT3A 3QUMP 2ZZUH 1P9SA 2TRMA 2XWAA 2OC7A 2PKSC 6CHAC 2GZ9A 2CJIA 3ZZ8A 2Y82A 1FPHH 3V3MA 1HAOH 3TJOA 1ZHRA 2PTNA 4GHQA 4AYYB 1ABJH 2FODA 2GMTC 1UCYK 4IC5A 3MO3A 3E6PH 3E1XB 5ESTE 1IQJA 4ASHA 2G5NA 5C1YA 4CH2B 5BRRE 2JJ2D 1T7CA 3EYDA 4SGBE 2SGAA 4ABHA 3EQ0H 1TNHA 1SQAA 2PUXB 2OQ5A 2HLCA 2W5EA 4ZKNU 3T27A 4D7GA 1ELEE 1QBNA 1FIZA 5C17A 2UUYA 2ZU1A 5HM2A 2WPJS 1Y5BT 4JYVH 4AZ2B 1SGFG 1C5LH 1EB2A 2C8ZB 2XCFA 1OP0A 1QA7A 3S69A 4XSKU 5AHGH 4H6TA 3TGJE 5F53A 2O8WA 3SNEA 2J94A 4KTUA 2JH0D 3ZYDA 1Y3VA 4D9QA 1QBVH 3KHVA 1V2NT 1DFPA 1O2YA 1GBAA 1H4WA 2P3TB 4XFQA 1S6FA 1KIGH 3HGPA 2JKHA 4FVBA 2UWLA 3KQDA 4WH8A 4X1PU 3BIUH 1QTFA 1TNIA 1O2UA 1O3EA 1E37B 1SMFE 1XM1A 4LOYH 1SGEE 2FX6A 2RG3A 9LPRA 4ABJA 1UTKA 2Y7XA 1TBRH 4JZEH 4MQAA 3F1SB 1GVLA 4UONA 1TNKA 1ELDE 3RC4A 2J98A 2JDID 5FPSA 1BTYA 1LVYA 1PPBH 3FZDA 4NZQA 3SORA 1RIWB 1O2NA 4OS7A 4ISNA 2PKAA 3FOAA 3URDA 1DE7H 1SHHB 4X6MA 1PPFE 1O2RA 1E36B 1NTPA 1YPMH 2GGVB 4VGCB 3RXHA 1H8ED 4OS4A 3DCLA 1T4VH 1GI8B 2KX4A 1GG6C 3TH3H 3E3TA 1SC8U 4YT7H 3A7ZA 2A4GA 3FO8D 4WXVA 3SHAH 4D8NA 1BHXB 2D1JA 2ANYA 2YMSD 3MU8A 3RXPA 4Z1MD 1ZSLA 2G4UA 2ZHDA 2ESTE 1WU1A 3AAUA 2EEKA 5IYTA 1LTOA 4MNWA 4HFPB 1O2JA 1KXCA 1OOKB 2IPQX 1WTHD 1CT2E 1NROH 1GBFA 3LH1A 2G52A 1UMAH 2W7UA 1SGTA 2OQUA 3HK6B 2OCVB 1TNJA 2GT7A 3UB0A 4O9VA 1HCGA 1FJSA 2Z9GA 1BRUP 3AASA 3OAAD 2XRCA 2ZDLA 3BG4B 1TMBH 3PTNA 1WCZA 3RLWH 2KCPA 1DWCH 4WJG2 1B7XB 1UVUH 2G00A 3ATLA 2P93A 2BB4A 1PPZA 3QO6A 1GBDA 2BVRH 4I8GA 2AMPA 2XTTB 3FVFB 4H6SB 1GJBB 3SJKA 5EG4A 1UHBB 3ZVEA 4O3UA 5DP4A 4X1QU 1XX9A 2BD9A 4HTCH 1Z8RA 1J14A 4F55A 2V3MA 2BD3A 1FN8A 2V0BA 3QGNB 1YYY1 1GI3A 1H8DH 3ZVFA 2ZDVH 1ZPZA 4FXGH 2NU0E 1V2UT 1A2CH 1UVPA 1GVKB 5C5OA 1ELAA 1A0HB 4VGCC 5EIYA 2P16A 3SU6A 1K22H 2NU4E 2Y5FA 4ACAA 3GDVA 5HYOA 1HV7A 1EPTB 3F9HA 1DM4B 1LCYA 2QXJA 1NBME 3KIDU 4HZHA 4I32A 2BOKA 4LXBH 4RI0A 1BTZA 3NWUA 1O2IA 5AFZH 5GIBA 4WY3A 3OEED 1K1MA 3SNBA 1AZZA 2XBVA 5JDUB 1AVGH 1O3PB 1UTLM 3S9BA 1PPGE 5LPEA 2O9QA 2VWOA 5GDSH 3R3GB 2AS9A 1P2KA 3ZV8A 1TYNA 1A3BH 1RJXB 1H1BA 1BUIA 1QRXA 1IQLA 1QRZA 4B1TA 1LO6A 4AN7A 4TYDA 1O2MA 1KTSB 1W0JD 2OP9A 2P8OB 2VIVA 1Q3XA 3KQCA 3FN8A 5EJ1A 3F0PA 3M61U 1IQEA 2ZU5A 1NRQH 2BD5A 3F2HA 5EOKA 2ZGCA 1UTPA 3UOUA 4NZLA 5CHAB 5GCHF 1O5EH 2KAIA 1TGNA 2BDYA 1VITG 4YOJA 3ZIAD 2KCOA 3UNRA 3LU9B 1ZGVA 4RSPA 4BTIB 2ZCHP 1AWFH 3TIUA 5A0CA 1ELCA 3B8JA 1SSXA 4Y8XA 3MU5A 4H4FA 1Z7KA 1O3KA 2WPHS 1SHYA 1XUJA 1WTGH 3ODFA 8ESTE 3PMHB 3MH7A 1P2QA 2OBOA 4MPVA 3IITA 4NIYA 4OS6A 1GL1A 2B7DH 2H9EH 3RXVA 1K1LA 2FLRH 1W13U 3A7WA 4HGCA 3U8TH 1C1PA 4ZHMU 2H1UA 2GTBA 2RDEA 4O03A 1OS8A 2Z9IA 3ELAH 1G32B 3MMGA 1IQHA 3A7XA 2A31A 1Q2WA 2BD7A 2CF9H 1YLDA 1L1NA 1BMMH 2ZHQH 1EOLA 4UFEH 3BEUA 2A7HA 3V12A 3P8FA 1GBLA 3BG8A 1ESAA 1DANH 1GJ6A 2PW8H 1HJAC 2FI5E 3K6ZA 5I25A 2ZNKH 2QV1A 1JRSA 1C1MA 1W12U 1O3AA 3DHKH 2ZWLH 3SZEA 2P8OC 1C1OA 3HKIB 1MTNC 1O3DA 3ENSB 4CREA 1W11U 1NRNH 3FAOA 2FYRA 1F7ZA 2EY4C 3AK5A 3SJ9A 3V13A 3AAVA 3F9GA 3ATKA 3DSOA 3OSYA 4X6NA 5F8ZA 1A5GH 1QZ8A 2JETB 1EB1H 1MD8A 3S7HB 1T31A 1FIWA 1D4PB 1QQUA 3SUGA 3GY3A 1GHZA 1V2MT 2AIQA 4Y8ZA 1XVOA 1G30B 4DW2U 1HGTH 1TGCA 4NA9H 1B0FA 1SLVB 1NU7B 3TGIE 3F2FA 1GCTB 1NS3A 2BTCE 1AWHB 1J15A 1TX7A 1WAYB 2SGEE 2DUCA 3ZVCA 2JIZD 1AU8A 1KSNA 2BY5X 4X8TH 2F9OA 4FUBA 1Z1IA 2BLVA 1EAUA 1BT7A 3A80A 2PGQB 3UTUH 1AO5A 1SGPE 1KXAA 3QTVH 1AFEH 1GDUA 5F03A 2A5KA 3DD2H 3RXIA 5HIYA 1BIOA 2QGRA 1CE5A 3GCOA 3GCHB 3K65B 3RXEA 1IQIA 3S9CA 2HPQH 5AFYH 3VXFH 5FPYA 5JB9S 1TIOA 3SO3A 2Z3DA 3FFGA 1J8AA 4K8BA 4UE7H 1Q31A 1QL7A 1C5TA 8GCHG 2NU3E 1GJAB 3T62A 1MKXH 1C1UH 2H2ZA 2V3HH 6ESTA 3BEFB 1C2KA 2A0QB 1JMOH 1RRKA 2A1DB 1FXYA 3PMJA 1O5CB 3RXFA 2FOBA 2GCHG 3GDUA 5DJ7A 1QJ6B 4CRBA 1TPAE 2KCYA 4MNVA 2BD4A 1ANCA 4K8YA 1THPB 2FTLE 3D65E 1MKWH 7GCHF 1CQQA 2AYWA 2Q6FA 1SLWB 1UTQA 2AHME 1GI2A 4CRGA 3MI4A 2EC9H 2O8UA 3RXKA 2AMDA 1BMLA 2Z7FE 2ZGHA 1ZTKA 3BTGE 3SU3A 3QX5H 3BTKE 3L3TA 1CGHA 1S85A 4CH8B 1N6YA 1GHWH 4IS5A 2KAIB 4GUXA 4WMFA 2BHGA 5DP9A 1O3IA 2P3UB 1F0RA 1Z8IB 1MQ5A 1F92A 3L6PA 1SGQE 3TLOA 2O8TA 2VGCC 2YMSB 1C5QA 1IHTH 1TONA 3GYLB 1FNIA 5EW1H 5FBEA 4XRNA 4BANB 4Q80A 3RLYH 1O5DH 2XYAA 3PROA 1CA0B 4BAMB 1OWHA 2FOAA 5AVDA 2GCTC 2W3IA 2ZHFH 3P70B 3GCHC 4NA7A 3U98H 4BXWA 4Q7YA 2J92A 4UDWH 2BX4A 2WZQA 1OP2A 3RXRA 2VIDA 1A46H 9ESTA 1PPCE 3VG8A 2TPIZ 4NWKA 1C2JA 4GVUA 4CRAA 4CBOA 3L33A 4CRDA 1RTFB 3AW1A 3LOXA 5TJXA 3NZIA 2AERH 1QR3E 4K60A 2BDBA 1B5GH 3RUOA 1J16A 2L74A 3GISB 4XOJA 3QZQA 4K1EA 3EA9A 3A8AA 1AD8H 1G2MA 3E91A 1C9PA 5F8XA 1FY8E 4AB8A 1TNLA 2TGTA 4NSYA 5KEDA 1HAYB 4QT8C 2QXIA 1SFQB 4FUFA 2BY7X 1HBTH 3DSGA 3PLPA 1VGCC 4ZAEA 3HPTB 2LELA 1O5FH 2Y5HA 2ZDMA 3UREA 1SLUB 6GCHG 1V2TT 4A5TS 5EQSA 5L2YH 2Y6TA 1HXEH 1YPEH 3M7TA 2HVXA 1Z71A 2FZZA 1G9IE 3A81A 3NRLA 1T8OA 2Z3EA 2SFAA 3N7EA 1FUJA 2OBQA 4WH6A 2QIQA 5EGMA 2WPLS 2XNIA 1AVXA 1F5KU 1A3EH 1SPJA 4XD7D 5CE1A 1LVBA 4U2WA 3TNSA 1O39A 1YCPK 1C5NH 1TMTH 1SGFA 3FANA 1G36A 1TGTA 2FYQA 2ZPQA 3OY6U 1UVSH 1SOTA 2PV9B 1G3CA 2WUBA 4OGYA 3U1JB 2B8OH 2FXRA 2VWNA 1HAVB 1SR5C 1F0TA 2BDHA 1L4ZA 3MWIU 4WVPE 2VIOA 4ZKOU 3TPIZ 4BAKB 1V2RT 2PGBB 4IMZA 1TX8A 1TBZH 4X8VH 1YPHE 1J17T 1C1WH 1HPGA 1GI4A 2IOTA 2FLBH 1NY22 2TGPZ 5FL7D 3GS9A 2J9NA 2EI6A 2ZA5A 4U30A 1C5ZB 1YPGH 1BQYA 1GJ9B 1C1RA 1FDPA 2F4LA 3LONA 4ABDA 3S7KB 3SV2H 2D8WA 1O2ZA 1VKYA 2VWLA 2A32A 3ZZBA 1TGSZ 2BY6X 5A8XA 1JRTA 5FX5A 3RXTA 3PRDA 1HNEE 3UR6A 2A7JA 5A8ZA 2BDAA 1MABB 1F5LA 1CGIE 2C8WB 3VB4A 1O2XA 3PO1C 3EGKH 4OS2A 4J1YA 1AZ8A 1KY9A 3H09A 2FOFA 2XW9A 1WBGB 1O30A 4WXIA 1MU6B 1AB9B 3RXUA 2XC0A 4BAOB 4JZIA 3HK3B 4FOUC 3ZZ9A 4JK5A 4B6FA 1GPZA 1HAIH 1V2QT 5EJLA 1NU9A 1TRNA 1GVZA 2O8MA 3Q77A 4IMQA 3RXCA 4K69A 8GCHF 4X2WA 3P8GA 5J4SA 2R2WU 1O3OA 4AFQA 3GYMA 2BXTH 3OE7D 5C20A 3LGWA 5HGGA 1CBWC 1C9TA 1K21H 4DCDA 3T29A 2GCHF 1GMCG 2ZFSA 3HKJB 1LPZB 2ILNA 5LPFA 5L30H 1PQ5A 3UUZA 4MG3A 1ETTH 4NIVA 4H42U 4KGAA 3SYJA 2PUQH 5T6GA 3RXBA 2QF0A 1TRMA 1YLNA 3KGPA 1H8HD 5DKMA 2LP6A 3KQBA 4MPWA 1OSSA 2P94A 1CHOG 2BLWA 2XBXA 2R9PA 1KDQA 2CHAB 4KKDA 4JK6A 4FUHA 1AE5A 4B6EA 1ARBA 1O5GH 5DP8A 2ZCLP 3SGQE 4DOQA 3CS7A 1Z1JA 1MH0A 2Y5GA 1RXPA 4GCHG 2ZFRH 1C4V2 2Q6GA 2VVVA 2ZFFH 4U32A 2PSXA 1LQDB 3RMNH 2ZGXH 3TK9A 3CP7A 1QQ4A 2R2MB 1O2WA 1MTVA 1V2OT 2A4OA 3GDSA 2I6SA 3UFAA 3AW0A 4DVAU 4X2XA 1O31A 2F9BH 2BQ7B 3TH4H 1QA0A 3R0FA 1C5RA 1UTJA 3VEQB 2FMJA 3SJIA 2J4IA 3RXSA 1ZMJA 1IQNA 3PMAB 4DURA 1GJ7B 1H8IH 1DICA 5T3HA 2ZTYA 4IBLH 1TB6H 3I77A 3ZZ3A 2V35A 5FXLA 1HUTH 4B74A 4B2BA 1DWEH 4Y7AA 5H4IB 1MBQA 3DSPA 3UAIC 1ELGA 1C5XB 2ZU4A 3LGTA 1W0KD 3PM3A 1YM0A 2ZC9H 4K2YA 1DWDH 1OYQA 1QL8A 1RTLA 1GMDG 5PTPA 1OWKA 3UNSA 1TOMH 3GY6A 1HIAB 1S5SA 2A2QH 1GI1A 1UTMA 3OX7U 2J34A 3Q3YA 1OWEA 1MAYA 2UUKB 1DLKB 1EUFA 1S6HA 2F9PA 1GHBG 4OS1A 2NU1E 1BCUH 1O3HA 2GV7A 4A6LA 2G8TA 4I31A 4BNRA 1ZR0A 3QDZB 3SV9A 2HPPH 2PHBA 3SNDA 1YPHC 5IK2D 2FO9A 4IC6A 4Y6DA 4B2AA 1ELBA 2H9TH 4BOHA 5T1VA 1B0EA 2BMGB 2H5CA 1GBKA 1GHYH 1GMHF 1QFKH 2VINA 4FUCA 5LH8A 3PRBA 4NFFA 1W14U 3U8RH 2VBCA 2SNVA 1AKSB 3M5MA 3A87A 1CO7E 2LNCA 1KLJH 3A86A 2FM2A 2GZ8A 4GSOA 4Y71A 3RC6A 1NFYA 3MNXA 1RIWC 1QNJA 2VU8E 1E1RD 2B5TB 4INKA 1GBHA 4P00A 1AN1E 4A1XA 3GY4A 2A2XH 3A7VA 1TPOA 1A5IA 4B71A 2WPDD 3RXQA 3HGNA 2P3FH 1N6XA 2XC4A 2WHXA 1PYTC 2HALA 4CHAB 2GDEH 5C5NA 5LPRA 1XXFA 2FS8A 1GHAG 1O38A 3SU1A 3W95A 2AFQB 4Q7XA 1UTNA 1ZYOA 1AHTH 2PFEA 5FX6A 4FUDA 2ZTZA 5C0TA 4AX9H 3MU0A 2VVCA 3SJOA 3URCA 1DITH 2BM2A 1Y3YA 1BRBE 2ANWA 4Y0YE 1VCPA 1V2PT 3ZYEA 1Z6JH 4XBCA 4RN6A 1CU1A 1VITH 3MQKC 1GHVH 2ASUB 1BZXE 3GCNA 1MMJN 3TK6A 1PFXC 3BG4C 4NIWA 2J5UA 3FKSD 1LKBA 1ELFA 3KF2A 3LPRA 2W7SA 1MAXA 3T5FH 3FP8E 2VH0A 2WUCA 2XBWA 2QC2A 1ANBA 2FOHA 3SV6A 1ZOMA 5E8EH 2EQNA 4CRFA 2R0KA 1K1JA 1YC0A 2W6JD 2QA9E 3BF6H 1FAKH 4E7NA
chains in the Genus database with same CATH topology
1YCPM 2ZHWH 2FESH 3A8CA 1DXPA 3RU4D 2R0LA 1C1TA 4DIHH 1GI5A 2EI8A 3F9EA 1LHEH 2FPZA 2IJOB 1GBMA 3QGJA 2QYIA 1V2WT 1IOEA 2FOMB 3ZZ7A 1KDQB 1LQEA 3T2NA 2G55A 4DIIH 1GHXH 2F9UA 3VB6A 3GY7A 2HOBA 1G37A 5E2PA 3LH3A 1BHXF 1MBMA 1F5RA 1ANEA 1YPJH 1EPTC 3A88A 4ZXXH 4AGJA 5CMXH 4FUEA 1TE0A 3VB7A 5C3NA 1ABIH 3SNAA 3BTEE 1T8MA 4K5ZA 1GBCA 1HAHH 1BITA 1V2VT 1NO9H 4ABAA 1WQVH 4J2YB 5GWZA 2Y81A 1LPKB 2Y7ZA 4AORA 2FWWA 1Y8TA 4KTCA 1GJCB 1L4DA 1C1NA 1S83A 2UWPA 1QL9A 4NGAH 2AGIX 2FDAA 2WV4A 3LGIA 4INLA 2UWOA 1C5PA 5FAHA 2PKAB 1TA6A 2FI4E 1D3QB 2CMYA 3D49H 4GCHF 1P09A 5E0HA 2VB0A 4MNYA 3A7YA 2VWMA 2H6MA 5HM9A 3RXLA 4Y8YA 3JZ1B 2PR3A 3QN7A 4B2CA 1C4Y2 3OTJE 2D2DA 1A0LA 2ULLA 4FU8A 2TBSA 5DP5A 1TPSA 5CHAC 2V6NA 3OU0A 1ZPCA 1C5YB 1P57B 1XKBC 2WINI 2FX4A 1Y5UT 1IQGA 2ZPRA 3SJ8A 3TJNA 3SV7A 4XBDA 3N7OA 3Q00A 4MPXA 1ETRH 3DFLA 2RA0A 3H7TA 1C1SA 1QGFA 1ID5H 3SI3H 1ZGIA 2B0FA 1GGDB 1Y5AT 1AUTC 1MTWA 1UO6A 1CVWH 1KXEA 4OS5A 1GJ5H 4X2VA 1SGCA 2PWXA 4X1RU 2AH4X 3M3SA 4GLYA 5GXPA 1GMDF 1O35A 3SW2B 2Z3CA 2XXLA 3SZNA 2BY8X 5L2ZH 3IG6B 3PWCA 5EQQA 2G5VA 3ZV9A 2QAAA 1P9UA 1UK2A 1QB9A 1H9HE 3STIA 3F68H 3QLPH 3MH4A 1BB0B 4NA8A 3LC5A 4UFFH 2P95A 4YT6H 1EZUC 4X0WU 3D62A 1GI7B 4ZKRU 1S84A 4X8UH 4ZKSU 1BBRE 1BBRH 1JXPA 1P05A 1LMWB 4LZ4B 1GL0E 3MU4A 3U9AH 3MH5A 2OC8A 3SU5A 5JYIA 5JB8S 1IQMA 2C93B 5EODA 4AB9A 2RDLA 2G81E 1O3JA 1PPHE 4Z0KA 2ZECA 1DSUA 2BLOA 1SBWA 2HNTE 1TBQH 1FI8A 2JETC 3MHWU 1PYTD 2A4QA 1WOFA 5HXFA 1WV7H 2WV5A 1BTHH 1C2MA 3GICB 3Q3XA 1GBEA 2BVSH 4WF8A 4FUIA 1HAPH 1CT0E 3PLBA 2OLGA 1O3CA 1FAXA 3P17H 1GHAF 1T8LA 2FIRH 3U8OH 1FY5A 1BTWA 5JBCS 2DE9A 1BDAA 2ZQ2A 5GJ4B 1G3DA 4NSVA 2ZO3H 4A92A 1GCTC 5G4BA 3CENA 3SBKA 3RC5A 5A8YA 1HXFH 1AQ7A 1BMNH 4LZ1H 1ELVA 1DX5M 1ZRBA 1QB6A 3OYPA 4UFGH 2Z9LA 3KL6A 2M5TA 3UPEA 3SHCH 1EKBB 5JBAS 4ISLA 1KXFA 2STAE 1K1PA 2P59A 4WMDA 1OWIA 4BTUB 1G3BA 2ALPA 1A7SA 2SNWA 1YGCH 1QY6A 1CGJE 1T32A 4NG9H 2ZG0H 1KYNA 1VITF 1FV9A 1P11E 3ZVGA 2AEIH 2F3CE 3UOPA 4ZH8A 1MQ6A 4FU7A 4AFZA 3E90B 3RXAA 1XVMA 4MDSA 2C90B 1UCYE 1EASA 1UCYH 1DS2E 4X2YA 3LC3A 1P02A 2F9VA 5EXLA 3RXOA 1DUAA 1E0FD 2Q1JA 1INCA 1TPPA 1E35B 1NFUA 5FBIA 2AGEX 2ZP0H 1DLEA 2YOLA 1Z6EA 1AY6H 2OD3B 2BZ6H 4MPUA 4K3JA 3TITA 1RS0A 4AGKA 5TCCA 4FVDA 4FUGA 1P12E 1QBOA 4ABEA 1DXWA 2GP9B 1SG8B 2FEQH 1JBUH 1ZJDA 2A5IA 7KMEH 1NC6A 3P95A 1K2I1 1LHGH 2EI7A 3RMOH 3ZVBA 4E05H 1A61H 1OYTH 4TWYA 1BRCE 1ELTA 3FP6E 2Z9KA 1H9IE 3M3VA 4X6OA 2AIPA 1LVMA 1GBIA 3CS0A 1EJMA 5DO4H 1RGQA 3SU2A 4GPGA 1O3NA 3TH2H 1EZXC 3O8CA 1CA0C 1QIXB 1P2MA 1PJPA 1QHRB 5C1XA 3EA7A 2A5AA 4ABBA 4BAQB 3NKKA 1QCPA 2ZPSA 5T6FA 3MH6A 6CHAB 1P2IA 1S0QA 1SGRE 2HGTH 4ISIH 4TPYA 1O36A 4NIXA 1Y3UA 2GVFA 1LHDH 1MKXK 2GMTB 3MO9A 3EA8A 1VCQA 3MO6A 1DPOA 1MD7A 1KXDA 4OGXA 2BYAX 3KNXA 2BZAA 5DP7A 4BTTB 4DT7B 2IPHA 2ZI2H 1SLXB 2FTMA 3PYHA 2B9LA 1S0RA 3PTBA 5FCKA 3NPSA 1D3PB 1MKWK 3SUFA 3K6YA 4DGJA 8LPRA 1UHBA 2HNTC 4AOQA 1C2FA 4NWLA 1JOUB 1HJ8A 4R8TB 2C8YB 1K9OE 1EQ9A 4D9RA 3LKWA 1D9IA 3MNSA 5FCRA 2BQ6B 4YLQH 2BVXH 5E0GA 4YTAA 2ZFTA 3LDXH 1TGBA 4UEHH 4K1TA 5DK1A 3UWJH 1EPTA 1AMHA 5J4QA 2H5DA 3PWBA 1LHCH 3ATMA 3BIVH 3RU4T 1UVTH 1XUGA 1EJNA 3GY5A 4MLFB 1O3LA 1BJUA 1O2LA 1GJ8B 3LJOA 1QJ7B 5EPNA 1TRYA 5GCHG 1OKXA 3H7OA 1V3XA 2GDDA 1GJDB 2FOEA 2ALVA 3M5NA 2NWNA 1EAIA 3RXDA 3F9FA 1O2VA 3NUMA 3PB1E 4ABIA 3RXJA 1GG6B 5C1UA 3TU7H 5A09A 1NZQH 1P2OA 4YOIA 4M7GA 3ZVDA 3BTWE 1RTKA 3UR9A 2ZQ1A 3KQEA 1NM6A 1P06A 2HNTF 3SGBE 1V2JT 1GI9B 1NESE 2AGGX 1YBWA 1AGJA 5AF9H 3RMMH 4IGDA 5GPIB 3V0XA 4CR5A 3SU0A 1GI6A 4YLUA 3BTHE 1KLTA 1AIXH 1ESTA 2ZGBH 5C2ZA 1EZQA 3KCGH 1WQSA 1A4WH 1O2HA 2ZKSA 3A8BA 1V2KT 1FN6A 2CGAA 3IWMA 1SVPA 1BOQA 4O97A 1O2PA 4ESTE 2PSYA 3SQEE 1AB9C 1T8NA 3RP2A 3BTDE 1P3CA 2A4RA 5IDKA 3ITIA 1THRH 3DUXH 2F83A 1VR1H 3JZ2B 1MUEB 3UQOA 5JBBS 4ISHH 5A0AE 3LGVA 1P01A 1ANDA 2R3YA 3PMBB 1F2SE 2GD4B 3BEIB 5EW2H 5F6MA 5T6DA 3OY5U 4YOGA 4F4OC 3I78A 2ZCKP 1BJVA 3MU1A 4FU9A 3M7QA 1RD3B 3EDXB 1FONA 4Q2KA 2STBE 1TNGA 2J2UA 4PROA 1O3MA 3EE0B 1DUEA 2PTCE 3SUDA 1C2HA 3VGCB 2WPMS 4B76A 1OPHB 4JCNA 1XUFA 2PLXA 4BXSA 4ABFA 2HRVA 1IAUA 3VB5A 3M3TA 4JZFH 3GY2A 2J95A 2VIQA 4I8JA 1C2GA 5DP3A 4AFUA 3BTFE 1O2SA 4X6PA 1ZHPA 3RDZA 3SNCA 6GCHF 2CHAC 4TPIZ 2BDGA 2GX4A 4TWWA 2XC5A 3U69H 1HYLA 1DY8A 1O5BB 3SGAE 5DG6A 3RM2H 1EZSC 2ODQA 1HB0B 3W94A 1O3BA 2BXUH 1CA8B 1C2DA 2ZU3A 3FP7E 1P3EA 4I33A 1EP5A 2O8LA 3RXMA 1SB1H 3A82A 1ORFA 3HATH 2CV3A 4DJZB 1SI5H 3GCTG 3K9XB 4Y79A 2ZF0H 2WPIS 5F8TA 3SN8A 1GBTA 1UTOA 2Q6DA 1P2NA 1EXFA 1D6WA 1FZZA 2CXVA 5EU8A 2FS9A 5B6OA 5DGJA 3UNQA 1N8OB 1MCTA 1F0UA 4TY6A 1C2LA 1E38B 1O2OA 2UUJB 2ZIQH 1BA8B 5I46H 1KXBA 3O8RA 4IN2A 2OINA 4CRCA 1GBJA 1QB1A 2ZU2A 4YESB 1TALA 3B9FH 3UY9A 1ZTJA 2VH6A 1C5OH 1YKTA 1KTTB 1O2KA 1PQ8A 5DP6A 1MZAA 4XE4A 3ATIA 3VGCC 1VZQH 5EPYA 1KLIH 2BLQA 1IHSH 2XWBI 2DE8A 2C4FH 3G01A 2I6QA 1TQ7B 7GCHG 3B23B 4XDEA 2TIOA 3RMLH 1ZMLA 1WUNH 4KP0A 4B73A 1K28D 2W26A 3F6UH 2BY9X 2OXSA 1HLTH 3H5CB 1IQFA 1C5SA 1NT1A 1OP8A 4HI3A 1ZPBA 4Y10E 4YO9A 2SGQE 3NK8A 2GV6A 3C1KA 2YNAA 4E7RG 2CN0H 1XKAC 1HJAB 1G2LA 2VNTA 1FY4A 1THSH 4WWYA 3ESTA 2VIPA 1SQTA 5ETXA 3MNBA 2A45B 4INHA 2EA3A 1NN6A 1CHGA 1NFXA 1MTNB 1K1IA 2R3UA 3LGUA 1PQAA 1SL3A 4WMEA 3KEEA 4JYUH 1GI0A 4Y76A 3P8NA 3TJVA 3QK1A 1N8OC 1C1VH 1TOCB 5TCAA 1C2EA 1DOJA 4U01A 1GMCF 1O34A 1O5AB 4ZUHA 1V2LT 1LVOA 4CHAC 3O8BA 5E0JA 1UVOA 3ZZ5A 2FP7B 4CR9A 1CSOE 1TLDA 4I8LA 3A85A 3UQVA 5LGOA 3MNCA 1Y3WA 1TQ0B 1WSSH 1O3GA 1W7GH 3A84A 5JPMH 1MZDA 2ODYB 2ZDNA 2WYJA 1UK4A 5JBTA 3A83A 1W3CA 3AVZA 1CHOF 4A1TA 2VIWA 2GZ7A 4E06H 1UK3A 1LPGB 1DVAH 4MTBA 2F91A 4ZROA 1VCWA 3LGYA 2QXGA 1ZSJA 1K1OA 1HDTH 2XBYA 5K7RA 1C5VA 1YP9A 1GJ4H 5FHTA 6LPRA 1NRSH 5HMAA 1TMUH 1SFIA 2BDIA 2ZDKA 3TJUA 3S0NA 2LPRA 2ZFPH 3PLKA 2BDCA 3P6ZB 3LJJA 3NXPA 3E16B 2XCNA 4ABGA 2H9HA 3VFEA 2K1QA 3DA9B 3VXEH 1D3TB 3I29A 3C27B 1EP6A 2QF3A 1O33A 1EAWA 1DSTA 2THFB 3TGKE 2C3SA 3Q76A 2FOGA 1ZHMA 4YM9A 1WYKA 1YPKH 1DT2A 3ZZAA 2NU2E 1W2KH 4Y11E 3VPKA 2V3OH 1Z8GA 1HJ9A 3MTYA 3STJA 3MYWA 3V7TA 1GHBF 1ZRKA 1LHFH 1TAWA 3QZRA 3E0NB 1XUIA 2IN2A 7LPRA 1V6DA 1HAVA 3WY8A 1C5UA 1ZJKA 3T28A 1GWAA 4D7FA 2SGDE 4Y0ZE 1C2IA 3P92A 2F9NA 1Z8JB 2A7CA 1ZLRA 4A1VA 2VGCB 1SGDE 1OX1A 3BTTE 4DY7B 1QRWA 1OWJA 3ZZ6A 1HAXB 4TY7A 4KELA 4I8KA 1T4UH 1ETSH 1NFWA 1ZTLA 3GCTF 4XBBA 1JWTA 2SGPE 5EXNA 1YCPH 2Z9JA 1BMAA 5E2OA 2TGDA 1GDQA 2YNBA 5SGAE 2GCTB 3BN9A 3M36A 1BRAA 1K1NA 2RA3A 4AG1A 3ODDA 4R0IA 4MNXA 2ODPA 1O0DH 1MCVA 4GHTA 2ZHEH 1OXGA 2FOCA 4X1NU 1M9UA 4ZMAH 1GGDC 8KME2 3MOCA 1SGIB 1W7XH 1O2QA 4I8HA 1BTUA 2OC0A 3T26A 1E34B 1UJ1A 3DFJA 4RKJB 4Q7ZA 1AFQB 2G4TA 2BD8A 1L1GA 3UWIA 4IN1A 3LIWA 4JMYA 3SI4H 4X8SH 1NPMA 2BQWB 1V2ST 4JZDH 1N1LA 1QURH 1X7AC 1O37A 5ESBA 1EAXA 3BTME 4KTSA 1VGCB 1XUKA 2ZDAH 3TVJB 1A0JA 1CT4E 1YPLH 4RKOB 1PQ7A 3BV9B 2GKVE 4NFEA 2QXHA 2BOHB 2GT8A 1L2EA 1G3EA 5C67A 2VVUA 4THNH 2UUFB 5A2MH 1FY3A 3O8DA 4GAWA 3NCLA 1VJ9U 3T25A 1BTXA 4ZHLU 3RU4E 1C4U2 3KN2A 1QJ1B 3MFJA 1ARCA 2G51A 1FLEE 1A5HA 5A0BA 1YF4A 1W0YH 2ANMH 1ZZZA 3M5LA 1TFXA 4AFSA 3QTOH 4DG4A 3BSQA 3A8DA 3ZZDA 1SGNE 1EJAA 3RXGA 1O2TA 3A89A 1EOJA 3PV4A 3P8OA 1VJAU 2WYGA 3SUEA 4BAHB 1HAZB 5K0HA 4LK4A 3TK5A 3BTQE 1P04A 3M7UA 1H9LB 1EATA 1MU8B 1W0ZU 2C8XB 2Z6BD 4UFDH 1W8BH 4AG2A 3SOSA 1SQOA 3SQHE 4NCYA 1ACBE 4FUJA 1U6QA 4ZHAA 1ESBA 1F0SA 5FPTA 1AFQC 2RCEA 2SGFE 1GCDA 2OTVA 3A7TA 4ISOA 1ZMNA 1XUHA 3FZZA 3SV8A 1DDJA 2ANKH 1FQ3A 2J38A 2ZTXA 2HWLB 3DT0H 3U1IB 3UIRA 1S82A 3GOVB 1GDNA 1Y3XA 4A7IB 2JH5D 1FMGA 1NRPH 4Y7BA 5ABWA 2Y80A 1J9CH 4CBNA 3ZZCA 1XXDA 2ZGJA 1TABE 4AYVB 1AI8H 4SGAE 1HRTH 4F49A 1P0SH 1EX3A 1BBRK 1C1QA 2OUAA 5L6NH 1AE8H 3E8LA 1JIRA 1O3FA 1XMNB 3ZZ4A 1SGYE 1D3DB 1TWXB 1DY9A 1JIMA 2PKSB 1AVWA 1AUJA 3PO1B 5EQRA 3Q3KA 1DWBH 1MTUA 2ZFQH 1HIAA 2QY0B 1C5MD 2AMQA 1GMHG 1OWDA 3E0PB 2TGAA 3QWCH 1L0ZA 1MTSA 3VB3A 1FPCH 2JH6D 1IQKA 1SOZA 2ZEBA 4Z6AH 1RFNA 1S81A 3SU4A 2BX3A 4D76A 1ZSKA 3M37A 1D6RA 3K2UA 2W3KA 1CBWB 1LDTT 2D26C