5ESTE

Crystallographic analysis of the inhibition of porcine pancreatic elastase by a peptidyl boronic acid: structure of a reaction intermediate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ELASTASE
publication title Crystallographic analysis of the inhibition of porcine pancreatic elastase by a peptidyl boronic acid: structure of a reaction intermediate.
pubmed doi rcsb
source organism Sus scrofa
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1989-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5estE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5estE01
2FI3E 1PPZA 1YPJH 3F9EA 4FU7A 4MQAA 3T25A 1AU8A 1P8VC 2OXSA 5GCHF 1C2KA 1O2VA 1H8DH 1PPHE 2C8XB 5E2OA 2BQ6B 3CENA 1N8OC 2BY5X 3P70B 2QCYA 5DP3A 1GL0E 3UTUH 5A8XA 2OLGA 2ZCHP 3P8NA 5JBAS 2XWAA 4YLQH 3SU6A 1FXYA 2A45B 3VEQB 2WYJA 3M37A 4AFUA 5E2PA 2H5CA 2TGPZ 1BITA 2G5NA 1GHWH 1GI5A 3KQBA 2BLWA 4QT8C 5DP4A 4I31A 1WU1A 2JETB 1SGDE 2ZHEH 3K2UA 1Q31A 3MO6A 1HCGA 4YO9A 3W95A 1C5UA 1TMUH 3BG4B 3UPEA 2F9NA 1IOEA 1C5SA 4H6SB 1RTLA 2IJOB 3KNXA 1DLEA 1Y8TA 3U9AH 3SUEA 3SUDA 3RMOH 3UNRA 2BVRH 2F3CE 4IC6A 4BTIB 1O5DH 1P03A 2ZGBH 1W0YH 1TNKA 4Q7ZA 1SLXB 9LPRA 2VH6A 1LTOA 1O2SA 3FFGA 2FXRA 1XUIA 1J16A 1DVAH 4X6NA 1GBDA 2BDBA 1L4ZA 2VWOA 1O2LA 1PYTC 3P8GA 4NSVA 1NRRH 2Y7XA 2ODYB 1GJ4H 1AO5A 5JB9S 4UDWH 1Z7KA 1RS0A 1H9HE 1NS3A 1GI8B 1ID5H 4HZHA 1N8OB 3VGCC 2TPIZ 1GBIA 3BTWE 3SV8A 1CE5A 3C27B 1BTUA 1VCQA 3IWMA 1MU8B 1DSUA 1VJ9U 1WYKA 5DP5A 2OUAA 4THNH 1O2WA 2WUCA 2WUBA 3A7ZA 2ZDMA 2BD3A 3GY5A 3OTJE 1V3XA 4NSYA 5L2ZH 3K6ZA 1D3DB 4XE4A 2VNTA 4Z0KA 2TGDA 3P8FA 5AF9H 1CT2E 3SO3A 1AE5A 1D6WA 5AFZH 1WQSA 2J34A 1HPGA 1BMLA 3M5OA 1Z1IA 1GJ8B 1HXFH 1PPBH 2FYRA 1XUGA 4BTTB 6ESTA 1XXDA 2OC1A 2JKHA 3A87A 4MNXA 1GBJA 4HGCA 4WVPE 4I33A 2ANYA 2QY0B 4K8YA 3VB3A 1O39A 5CMXH 3UNSA 3MFJA 1UTKA 5T3HA 4YZUA 1S82A 2Y81A 1O2XA 1GI7B 1FIWA 3BTTE 1C2GA 2GTBA 1NFXA 3G01A 5GWZA 4ABGA 3SJOA 2K1QA 3S7KB 2VH0A 1UCYH 3RXKA 2UUFB 1SB1H 1ZPCA 5CE1A 1XKBC 1B5GH 3VGCB 1GHAF 1A3BH 2O8WA 3M5MA 3BTDE 1CSOE 3LGVA 1RTFB 2Z6BD 3RXIA 3PTNA 1SHHB 1V2OT 4ZHLU 4I8HA 1ZTKA 3P17H 1MCVA 1UK3A 5F03A 3RXCA 3LH1A 3BG8A 1GBBA 1P57B 1QL7A 2VGCC 3ODFA 1C1NA 1OOKB 3PWBA 4AGJA 2FEQH 1L0ZA 3B9FH 5HMAA 2QXJA 4Q80A 1KTTB 3DD2H 3TK6A 5IDKA 3RDZA 1XMNB 1GJ7B 1W12U 2OCVB 2GX4A 2NWNA 1O32A 3SUFA 1UTJA 3ATIA 1EAIA 1C5OH 2P3TB 1GHVH 1EAWA 1MTVA 1O34A 3EA7A 2ZU4A 4UFEH 3F9FA 1HAOH 3SU1A 3R0FA 4ZKNU 5ETXA 4OS2A 1A4WH 1BMAA 1HAYB 1OWEA 1U6QA 3MNSA 5EODA 4AZ2B 1S6FA 1FIZA 1GWAA 3LGYA 4Y0ZE 1BB0B 4RSPA 2QF3A 5EQQA 1TX6A 3KIDU 1O38A 2AH4X 2GCHG 3FZZA 3ZYDA 2HPPH 1BJVA 2NU4E 3LC5A 1K22H 3TNTA 5F6MA 2A4QA 1UO6A 1GHZA 4I8LA 1O2MA 3RXLA 4YOJA 1W3CA 3ZZ3A 1W8BH 1IQFA 3SZNA 1SGNE 2W7UA 2WPMS 2D8WA 5GXPA 1ABIH 2G51A 1WTHD 2Z3EA 1EZSC 1MBQA 4AYVB 3STJA 2J94A 4SGAE 3MU8A 3LJJA 3ESTA 3B23B 1J17T 2ZDAH 3O8BA 2FODA 1ELEE 1O2YA 1MKXK 4UONA 1BQYA 4DGJA 3NXPA 1EXFA 1AE8H 2XBVA 3GDSA 2VGCB 1O3CA 1YKTA 4NWKA 1GL1A 1P10A 3GICB 2PTNA 4B73A 4CBOA 5TCCA 3T27A 5DO4H 1VCWA 1UMAH 4E06H 1K1JA 5PTPA 4YT7H 1H4WA 1UK4A 5F8ZA 5GPIB 3U1JB 1D4PB 1BT7A 3RXTA 3UY9A 4FUEA 3A7XA 1IAUA 1S85A 1FY1A 3Q3YA 2QN5T 1TGNA 1JOUB 3NZIA 3SOSA 1NPMA 1IQLA 1F0UA 2AS9A 2Q1JA 2BY8X 4MNYA 2A31A 1ZZZA 1Y3YA 3ZVEA 1TRYA 3OY6U 3RLYH 5FXLA 1EOJA 2BDYA 1FY3A 1F0TA 3PLBA 2Z3DA 2W7SA 4X1QU 3JZ2B 5ESBA 2DE9A 1CHGA 1BRBE 1O2OA 1TBZH 3KGPA 1EJMA 1WQVH 2AERH 2J9NA 1ZJDA 4DG4A 2GZ8A 1C2DA 1MQ5A 4CRGA 2FPZA 4RKOB 3A80A 3SQHE 1SQAA 1ZGIA 1GMHG 1O2UA 4A1XA 2ANMH 3SU2A 4BAHB 4GVUA 4AFSA 1FV9A 1FUJA 4CBNA 2BD7A 2HGTH 1E0FD 3VB7A 4RN6A 1F92A 1FMGA 1W11U 3NWUA 1P01A 1HLTH 4ZKRU 4BAMB 5A0BA 2GT8A 1AVGH 3OU0A 4X0WU 3GDVA 1TNLA 2EC9H 4F49A 1LHDH 1GPZA 3QGJA 1JMOH 3HKIB 3SBKA 2FZZA 4RKJB 1SGCA 1A5IA 1QBNA 2FS8A 2ZGHA 4X2WA 2BQWB 2NU0E 2ZTZA 4YLUA 3ZZAA 1GBAA 2ZPQA 1THSH 4INLA 4JYUH 1ZTJA 4AFZA 3PV4A 1O3MA 5LPEA 4B75A 4MG3A 1DY9A 3U98H 2Z7FE 1EP5A 2IOTA 1AHTH 1L1JA 3TITA 5EPNA 3BTHE 2G81E 4ZROA 4BXWA 3P95A 3QLPH 2A4GA 2VIVA 2HWLB 2V0BA 1C5XB 1BTZA 3ZVGA 1UTLM 4NA9H 3O8RA 2H1UA 4U32A 4BOHA 5HXFA 3TJVA 1LHCH 1GGDC 4B74A 5C5NA 2ULLA 1V2QT 3TH3H 2XNIA 3D49H 2R2MB 5AHGH 2EA3A 1GBLA 2BOKA 1SMFE 2BZ6H 1SVPA 5DP6A 1A5HA 3A89A 1V2RT 1BBRE 2ZFQH 1AUJA 1EJNA 4XBDA 1C5ZB 2Y5HA 1JRSA 5AVDA 3PMBB 3S69A 3A86A 3GY2A 3ZZ7A 1ESAA 1BTXA 2ODQA 4X1NU 1KXBA 3OYPA 5FAHA 8ESTE 2J38A 1V2KT 1FAXA 3E0PB 4HI3A 1LHGH 1HAXB 3QZRA 3ELAH 2A2QH 3ITIA 1HIAB 2TRMA 4IN2A 4NGAH 1NRNH 3VB4A 1D3QB 2GZ9A 1GJ9B 1BHXB 2W3KA 1IHTH 1XVOA 1JIRA 2ZFRH 1ZGVA 2GV6A 1ARBA 1Z8RA 1FN8A 1K21H 3DHKH 4R8TB 1DY8A 2F91A 1WSSH 5J4SA 4H42U 3UR6A 4F4OC 3URCA 1KXAA 4E7RG 1A5GH 1GMHF 4D9RA 1FDPA 2V35A 1C1SA 3ATWA 5JB8S 3ATKA 4GHQA 4TY6A 3MOCA 1NO9H 1T8NA 2ALPA 2WPHS 4O03A 1F0SA 1KTSB 2OBQA 1GGDB 1Q3XA 3RMMH 2THFB 4WXIA 3ATLA 1EAXA 1O30A 3QK1A 4H6TA 2PR3A 4Y0YE 1EUFA 1BTYA 5FBEA 1TPPA 2VB0A 4OS5A 2RA3A 1DICA 1C5YB 2GD4B 3PROA 5F8TA 1G3EA 3D62A 1EB2A 4B2AA 2NU2E 3TJUA 1LHEH 2CF8H 2FLBH 1GI3A 3T29A 1O3LA 1TPSA 3TU7H 4FUJA 1WAYB 2TGAA 1KDQB 2XTTB 4Q7YA 2PTCE 5C1UA 4FUGA 1QHRB 3TH4H 2GVFA 2FI4E 2OC7A 1AB9C 1CA8B 2SNVA 1TGCA 3BF6H 4Z6AH 1C5VA 1SSXA 3PLPA 5H4IB 4DW2U 5DKMA 3A8AA 1XVMA 3KQEA 3ZZCA 1Z6EA 1T4VH 4FUHA 3HK6B 1LPKB 3M7QA 4JMYA 4NIWA 1ACBE 4LXBH 1NY22 1S6HA 1P04A 1T7CA 4MNVA 4ISHH 2C8ZB 1BTHH 1HAGE 1MKXH 2OQ5A 1HIAA 3RU4E 4B1TA 2BM2A 3ODDA 3SU4A 4R0IA 1ARCA 2HNTC 3IG6B 1MZDA 3F1SB 2BYAX 5DK1A 2BLOA 2Q6DA 2JH0D 2CGAA 1LPGB 2LNCA 2ZGJA 3AAUA 1ZSLA 4FUCA 2PGQB 1EAUA 3Q76A 1BRCE 2GDDA 4XBBA 4Y76A 1QL8A 4XSKU 4I8GA 1C5NH 1PPEE 1MU6B 8LPRA 1C2LA 1MTWA 3FP7E 3GY8A 2P93A 4U2WA 4K3JA 2PKAB 1E34B 1ESTA 1V2PT 4FUIA 5DP8A 1C2MA 1BZXE 1J15A 1NFYA 1Z8GA 1FPCH 3FZDA 4B76A 2VIOA 1BBRK 1OYTH 3MH7A 3RXQA 4UFGH 1W7GH 1C1QA 4FU8A 4ZMAH 3TLOA 3HKJB 4XBCA 3OSYA 2UUYA 3RP2A 3SGBE 1AB9B 1CU1A 1F5RA 3BIUH 1P0SH 2VVUA 2C8YB 2QYIA 1CGHA 2AFQB 2BD8A 2CXVA 4DVAU 1ZTLA 1K1LA 1BHXF 1GVZA 1TOMH 4OS4A 3U1IB 3MNXA 4IS5A 1RFNA 5BRRE 1GHAG 1AN1E 2XC0A 1V2VT 4DCDA 3MNBA 1TGBA 1YPHE 2G8TA 3F68H 3UWIA 2BDIA 3P8OA 1TAWA 4WJG2 2VWLA 3FP8E 1DWCH 1LQEA 1W2KH 3SU5A 1HV7A 1ELBA 2J4IA 1GI2A 1AWFH 2BB4A 3RXPA 3UREA 1Y3UA 1SPJA 1SQTA 1H9IE 3LT3A 3PMJA 1GBTA 1TRNA 3T26A 2ZZUH 1ZMLA 2JH5D 1MKWK 1Y5BT 2HOBA 3PWCA 1O3HA 2WPLS 4ABBA 1W10U 4B71A 4DURA 1WOFA 1FAKH 1V2LT 1ANCA 2ODPA 1UTPA 2ZIQH 5JPMH 3SJ8A 1NRQH 1AGJA 2PUQH 3SV2H 2G5VA 4WXVA 8GCHF 1QQUA 1O3KA 2XBXA 3RXGA 2F83A 1MAXA 2O8MA 4GAWA 1Y3VA 4CHAC 3KN2A 4JK5A 5FPSA 1YLDA 4DJZB 2CHAC 1KXDA 3TK9A 3SNDA 5A09A 4OS6A 2FOGA 2P95A 4NA8A 3NKKA 1IQNA 2Y5GA 4X2YA 1KLIH 1GBFA 1KLJH 1P2QA 5GDSH 3RM2H 2AMPA 2G4UA 4MNWA 1DS2E 3S9CA 5HM2A 4X8TH 3LPRA 1LCYA 4LOYH 1V2MT 1MAYA 2FLRH 3TGIE 1SGYE 1QBOA 3U8TH 4DIIH 1A61H 1YM0A 5C1XA 1C5RA 1T32A 2H5DA 3ZZ5A 4FVDA 1G32B 2PSYA 2UWOA 1PQAA 2C4FH 2B7DH 4OS7A 4ABFA 1TFXA 4A92A 3LDXH 2QA9E 1GG6C 2PV9B 1NFWA 4K1EA 2ZI2H 3BEIB 1HRTH 3H7TA 1VCPA 1GBCA 3PMHB 1DM4B 3PLKA 1YYY1 1TGSZ 3GDUA 4YM9A 1BOQA 1CA0C 5TJXA 4AFQA 1O2JA 5K0HA 2HRVA 1KY9A 5L6NH 1O3IA 2V3HH 2ZHFH 4Y8ZA 4A1VA 1N6YA 4OGYA 4D7FA 4CHAB 4Q2KA 1DXWA 2IN2A 3SV6A 1GHXH 2CHAB 2KAIB 3V13A 1K1OA 1AI8H 3Q00A 2TIOA 1FPHH 2WPIS 4I7YH 1INCA 1MCTA 1ZHMA 3U8OH 3Q77A 1VITF 3AVZA 4A7IB 1PPFE 3MYWA 3SNCA 2OC8A 2VVVA 3F6UH 3NK8A 1MMJN 3ZZ4A 3T2NA 1C2JA 1QQ4A 1S5SA 1S0RA 3KQDA 1S0QA 1C4V2 1A1RA 1CGJE 1BIOA 1TNIA 3A7YA 1L1GA 2R9PA 2HNTF 3E6PH 4CR9A 5ABWA 3JZ1B 3BV9B 1JBUH 3HK3B 2QXGA 3L6PA 1G30B 1P2KA 1TIOA 3H7OA 1TALA 3RXSA 2Y5FA 1RJXB 1NRPH 2GMTC 5SGAE 4GUXA 1LVYA 1G2LA 1QCPA 4INKA 3VXEH 1UK2A 2BZAA 1C5TA 4AOQA 3SORA 4WWYA 3W94A 3ZVAA 1GG6B 1NU9A 2A4OA 1DXPA 4XFQA 1ANBA 2P59A 1A7SA 3BSQA 1NZQH 1Z71A 3DUXH 4KKDA 5DP7A 2G55A 1TLDA 5G4BA 1CA0B 4JYTA 1MTUA 4ZXYH 4UD9H 4TWWA 1LMWB 4SGBE 1PPGE 2ZCLP 1MTNC 1ZMNA 2V6NA 1HJ9A 1OKXA 4NZLA 4BTUB 4JK6A 3CS0A 3LH3A 4FUFA 3KF2A 1TX8A 2ZC9H 2CV3A 5JBTA 2PKSC 2BX4A 1CT0E 3OY5U 2SNWA 1A2CH 4Y7BA 4NFFA 4NIXA 1ZOMA 5C20A 6LPRA 3MHWU 3A83A 1OWHA 1LVOA 5L2YH 1Z8JB 5JDUB 1MZAA 1Z8IB 1P05A 5A0CA 1DPOA 1B0FA 4O3TA 2PSXA 3MU5A 1OSSA 5BPEA 1QRZA 3AAVA 2KAIA 2ZP0H 2ZU2A 3SUGA 8KME2 3RUOA 1FZZA 2ZGCA 4IMQA 2UWPA 3BN9A 4KGAA 3FAOA 5LPRA 1VITH 1BBRH 1K9OE 1J8AA 3KEEA 1THPB 3BTFE 1P3CA 5EU8A 3SV7A 1K1NA 2HVXA 2GMTB 4NCYA 1W14U 1OYQA 2A5AA 2H9EH 1C2IA 1P06A 1H9LB 3RXJA 1C1MA 2WV4A 1TGTA 3GYLB 3RC6A 1UVTH 2A4RA 2VIDA 3PTBA 1V2ST 1UVPA 4JYVH 4FUDA 1OP0A 1XXFA 1DFPA 1MTNB 1C1WH 3M5NA 3E1XB 3R3GB 1DSTA 2BDGA 1E37B 5GJ4B 1GJCB 3V0XA 1XUJA 1THRH 2Z3CA 2HPQH 2PKSB 3TNSA 1MQ6A 1C2EA 2A7HA 2DE8A 1AFQC 1X7AC 1NC6A 3SI4H 1ELGA 1ELDE 1VGCB 3MMGA 1ELTA 2ZO3H 1GDQA 4FU9A 3TGJE 1AZZA 1CGIE 1XUKA 1C2HA 1L4DA 3ZVDA 2SGQE 1MKWH 1D9IA 2UUKB 3LKWA 5FCRA 1O3GA 4X1PU 2ZEBA 4CH8B 5CHAC 3E16B 2J92A 1QNJA 3PB1E 2ANWA 4KP0A 1NFUA 1O2KA 1NU7B 1G3CA 4Y8YA 2PFEA 1GHBF 4ZH8A 1P2OA 3QO6A 3SJ9A 1O2ZA 2JH6D 4ABJA 1V2JT 1CBWC 3PM3A 3I78A 3LONA 1GJ6A 1DUEA 4YT6H 4IMZA 2ZDNA 3AW1A 1TRMA 2P16A 5DGJA 1DLKB 2NU3E 3GY4A 1C1RA 4KTUA 4Y71A 5TCAA 2GDEH 2ZWLH 2EI8A 2WYGA 1DWBH 3RU4D 2BMGB 3A84A 2A2XH 4ABHA 1QB6A 4HTCH 3GISB 2SFAA 1FY8E 2Y7ZA 5J4QA 3I77A 5HM9A 3UOUA 1NN6A 3EDXB 4WF8A 1JIMA 3BIVH 3HPTB 2PGBB 1AFQB 4J2YB 4IGDA 4D76A 2BHGA 1TA2A 3MWIU 3ZZBA 4ISNA 1HXEH 3MO3A 2QV1A 1V2WT 4MPUA 2XC4A 1UHBB 2W3IA 1K1IA 1C5QA 1CQQA 3AW0A 4MVNA 3RXMA 2FESH 3A85A 4PROA 1WV7H 4GCHF 4MTBA 5CHAB 3UR9A 4ABDA 4LZ1H 2ZF0H 2AEIH 4O3UA 2B9LA 1TA6A 4BANB 1HAVB 3UIRA 4CRAA 3F9HA 1D6RA 1DE7H 1OP2A 2ZGXH 4AORA 1CBWB 2Y6TA 1TMBH 3QUMP 1ZJKA 1BJUA 1EZXC 4WH6A 1C5LH 2W26A 1HAIH 4LK4A 2B5TB 1ORFA 3UFAA 1OWJA 1P2JA 1O37A 1O3PB 2C90B 3O8CA 3ZYEA 9ESTA 1Y59T 4MPXA 4YTAA 3QGNB 3T5FH 1HJ8A 3M7UA 3KL6A 3PO1C 1SLWB 2FOHA 1DWEH 5IYTA 1BA8B 2Z9JA 1MUEB 3GCTG 4X6PA 1C5WB 3GY3A 4O9VA 2ZU5A 3E91A 2FX6A 3QN7A 1P12E 4X6OA 5T6GA 1EOLA 1O2PA 1UTNA 3CS7A 1FJSA 1W13U 5DP9A 4O97A 2OBOA 1QR3E 1VZQH 3SV9A 1UCYK 1HUTH 3FVFB 2QXHA 2Z9GA 1V6DA 2QF0A 2VWNA 1E35B 2FWWA 4YOIA 1HBTH 2ILNA 1D3TB 3SNEA 1A46H 1QY6A 1KXFA 1AWHB 3GY7A 1XKAC 2FTMA 1C5PA 1GDNA 2XYAA 1C1TA 1O3DA 2F9PA 1NM6A 1LHFH 4ISLA 1W0ZU 2DUCA 1G36A 1O2TA 1UHBA 3NCLA 3SQEE 3D23A 4OS1A 4ASHA 3VB5A 3MH5A 3SHAH 5EQSA 3EGKH 1ZHPA 4OGXA 4AYYB 1C4U2 3QTOH 2CMYA 4ISOA 2Z9IA 3P6ZB 1GJBB 4K1SA 8GCHG 1Q2WA 2ZDVH 1UVSH 1HAVA 1EX3A 1SOTA 1T8MA 4I32A 3LC3A 1TBRH 2AIPA 2B0FA 2H9HA 3PO1B 3UOPA 2O8UA 1AD8H 3ZZDA 1QA7A 4BXSA 4Y7AA 4JZDH 4TPYA 3ZZ6A 1ELFA 2ZHWH 1NESE 2F9VA 2RDLA 2OINA 4NWLA 1GJ5H 2ZHDA 3S7HB 4IBLH 2BD9A 2VINA 4CH2B 1T8OA 2BY7X 1V2UT 1ZRBA 3LGWA 2ZKSA 1HAZB 1TPAE 2ZPRA 2GP9B 3RMLH 5AFYH 2VWMA 4FVBA 2G52A 1RTKA 3MO9A 1WCZA 5C67A 1UVOA 1C1VH 2SGFE 3RXHA 2PWXA 2EEKA 1XX9A 1EASA 4U30A 4A1TA 1SGFG 3LIWA 1V2TT 4WMFA 2SGEE 2CF9H 3M61U 5EXMA 1OP8A 1GI1A 1OS8A 5E0JA 3TPIZ 2FS9A 2AGGX 1FQ3A 1Y5AT 1L1NA 2ANKH 2ESTE 1ELVA 2ZG0H 1LQDB 1Z6JH 2RCEA 4K8BA 3GCTF 1BDAA 1YPGH 1WTGH 4WY3A 1KDQA 1NTPA 5EXLA 4AGKA 1ZPZA 3BTQE 2FP7B 3A8DA 1KSNA 2GT7A 3RU4T 6GCHF 1EZUC 2OC0A 3E8LA 3TGKE 1DT2A 1OWIA 4AN7A 1DANH 1PQ7A 1TB6H 2V3OH 4ABAA 3ZVBA 1YGCH 4GPGA 4KTCA 2YNBA 1LPZB 1SHYA 3MI4A 3VXFH 1VITG 4K69A 1O33A 1L2EA 1EQ9A 3FANA 1AQ7A 4BAQB 3M3SA 3PYHA 5A0AE 2XWBI 2ZDLA 1GJAB 1Y5UT 1TNJA 5FHTA 3SI3H 2ZQ2A 1SI5H 5T6DA 7ESTE 5T6FA 3QDZB 3TH2H 2VIQA 1CT4E 1F2SE 1EB1H 2FMJA 3FP6E 3TVJB 1GI0A 5B6OA 1TBQH 1DX5M 1O3JA 5L30H 4MPWA 1G37A 1NRSH 4GSOA 5C5OA 2D2DA 4Y79A 1UTQA 2ZECA 1SGFA 1FY5A 1IQKA 1QJ7B 2BD5A 1SGEE 4JZEH 1NT1A 3HGPA 2PKAA 2PW8H 4CR5A 3GYMA 4E05H 1YCPK 2ZPSA 2BXUH 2J95A 2A5KA 4TYDA 3SU3A 5LPFA 1QA0A 3RLWH 1GDUA 2XCFA 4CRFA 1A0JA 1OX1A 2QGRA 2XRCA 2QAAA 1CVWH 1GMDF 3P92A 1UVUH 2C8WB 1H1BA 1P2MA 1EATA 1P02A 3GCHC 2P3UB 1O3AA 1QJ1B 1SBWA 1GBHA 2FOBA 2PLXA 4K60A 1O2HA 3PMAB 1S84A 2R2WU 4UFDH 2STAE 5FPTA 2F9OA 1C9TA 1O2NA 2AYWA 1PFXC 4X8VH 1TOCB 3M35A 3QWCH 1QTFA 1P9UA 2ASUB 1G2MA 3E0NB 5JBCS 4BAKB 1O31A 1AVWA 2C3SA 2Z9KA 4CRDA 2FIRH 3I29A 3ZVCA 4AB8A 1O3EA 2BY9X 2BXTH 1ANEA 1YPHC 3QZQA 1LDTT 1A3EH 1TE0A 3Q3KA 1TYNA 4DY7B 3WY8A 3MTYA 1P3EA 1TX7A 2Y82A 2CN0H 1GMCG 1QFKH 2ZCKP 3E3TA 3BTKE 1ELAA 3UNQA 1KXEA 1AVXA 3S9BA 4NIVA 1YCPM 4YESB 3MNCA 1PQ5A 1EP6A 3EYDA 5FX5A 1TQ0B 2ALVA 3M5LA 4D9QA 4B2BA 2RA0A 5I46H 3EAJA 1HAPH 1O2GH 2WV5A 4XOJA 3A7WA 3ENSB 3BTGE 4BAOB 2ZU1A 1ETSH 1S81A 3DA9B 3EQ0H 1O5AB 1MD8A 2BD4A 2SGDE 1BTWA 2QIQA 1IQJA 1GHYH 4JCNA 3GCHB 3K9XB 2CJIA 2P94A 5C1YA 4I8JA 1F7ZA 1RD3B 4ISIH 3SW2B 3S0NA 2HLCA 1UJ1A 4E7NA 3UQVA 4ZKSU 2FDAA 1OWDA 1HYLA 3BTME 2WINI 1MTSA 1YF4A 2YNAA 2A7CA 3SGQE 1J9CH 1PQ8A 1QIXB 4TWYA 2PUXB 2VIWA 1K2I1 4X8UH 3QX5H 4Y8XA 1GHBG 1EKBB 1QRWA 4M7GA 1ABJH 1XUHA 3IITA 3RM0H 1H8IH 1PPCE 1RGQA 2ZFFH 4A6LA 3GOVB 2AIQA 4UEHH 1JXPA 1BCUH 3L33A 2FOFA 4CRBA 1SGQE 2WPKS 1O5BB 4AB9A 1SQOA 1K1PA 4I8KA 7KMEH 4LZ4B 3M36A 4NZQA 2WPJS 4WMEA 3KCGH 2TGTA 4ZUHA 1ELCA 1LO6A 3MU4A 1ETRH 3LJOA 1CHOG 5EQRA 2LPRA 3OX7U 5A2MH 1JRTA 1ZR0A 3NPSA 1ZPBA 1SLVB 1SC8U 1VGCC 3QTVH 1YPLH 2O9QA 1SFIA 2SGPE 1EPTC 2FOEA 5EOKA 7LPRA 2NU1E 4NIYA 1ZLRA 2BOHB 5E0HA 1O2QA 2XBWA 2ZFPH 2ZFTA 5A8YA 1FN6A 1Y3XA 1C1OA 1P2IA 2STBE 4GHTA 3KQCA 2FTLE 2R3UA 1XUFA 1P11E 4MLFB 2XXLA 4TPIZ 7GCHG 1BMNH 1W7XH 1BRAA 1AZ8A 4AX9H 1SGTA 2BD2A 3HATH 5EG4A 4ABIA 4NG9H 3DFLA 2ZTYA 3UQOA 3RXDA 1T31A 4JZFH 2OP9A 4IN1A 3RXVA 5LGOA 3TJOA 4GCHG 1YPKH 3RMNH 2EI6A 1GMCF 5DG6A 4D7GA 1HJAC 1GI9B 3MH4A 1AUTC 1YBWA 1P9SA 1NROH 1SGRE 2O8TA 2Z9LA 2ZNKH 1WUNH 3L3TA 1TONA 3RXBA 4U01A 3SGAE 3ZV9A 2UUJB 3TK5A 4KELA 5GIBA 1C1UH 1PJPA 3RXRA 2ZDKA 4MPVA 3HGNA 1E38B 4H4FA 1O5CB 5K7RA 1QB9A 1ETTH 1TQ7B 5E0GA 2BLQA 3EA8A 3RXAA 1IQIA 1O3FA 4XDEA 1BTPA 1O2IA 3SJIA 1XM1A 2HALA 3S9AA 3MH6A 1BRUP 2A1DB 1GI4A 3ATMA 1C2FA 2M5TA 1G9IE 1EPTB 1UCYE 2R3YA 1TNHA 4ESTE 3A7VA 2H9TH 3LGUA 5E8EH 1HB0B 2I6SA 2TBSA 3E90B 2VU8E 2BLVA 4UFFH 4YOGA 1B7XB 1E36B 5C2ZA 3NUMA 2FOCA 4ZHMU 1UTOA 3GY6A 2GKVE 3K6YA 1QJ6B 2AGEX 2R0KA 4NFEA 1GCDA 4Y6DA 3U69H 1TABE 2FX4A 4CRCA 2H6MA 1AMHA 2I6QA 5DJ7A 2Q6FA 4IC5A 3T62A 1Z1JA 3A8BA 2R0LA 1BMMH 2B8OH 2QXIA 3LGIA 4K1TA 1YCPH 2BVSH 3M7TA 1HJAB 1P09A 3CP7A 3C1KA 1QL9A 2OQUA 3O8DA 2QC2A 1YPEH 3DFJA 3URDA 1O3NA 4K2YA 1GBEA 1ZSJA 1CHOF 4ZHAA 4JZIA 3SHCH 1DOJA 3LGTA 1T8LA 3SNAA 4ABEA 1AIXH 2BDHA 1FNIA 3TIUA 3MU1A 1GI6A 1GVKB 1LKBA 1CO7E 1ZSKA 2GCHF 3A7TA 3A8CA 1O0DH 3SNBA 1O2RA 1HAHH 2FI5E 2AMDA 5FBIA 1EJAA 3A88A 1DDJA 1HFDA 2BQ7B 7GCHF 4TY7A 1QURH 4Q7XA 1IQHA 1LVBA 4X2XA 1IQGA 1RXPA 2BX3A 4Y11E 4WH8A 3STIA 2ZHQH 1PYTD 2ZQ1A 5EXNA 1GJDB 1TNGA 3VPKA 4K5ZA 2BY6X 1HDTH 1OPHB 2F9BH 2BVXH 5FCKA 5JYIA 1RIWC 1G3BA 1EPTA 4UE7H 3RXFA 4BNRA 1ZYOA 1KLTA 3EE0B 1J14A 1KIGH 1O35A 2BDAA 2H2ZA 5EPYA 1EZQA 1FONA 2Q6GA 4DIHH 1TPOA 2UWLA 2YOLA 1MH0A 1KYNA 1TWXB 2XCNA 4DT7B 4IW4E 4JZ1A 2ZFSA 1QGFA 1A0LA 1GBMA 1SFQB 3SN8A 5C3NA 1IHSH 1D3PB 3N7OA 3SU0A 1C4Y2 3U8RH 4HFPB 4ZAEA 3ZVFA 2XC5A 1ANDA 4ZKOU 5HGGA 3F9GA 1K28D 1OXGA 3D65E 2HNTE 3UUZA 2SGAA 2GCTC 1M9UA 4Y10E 3ZZ9A 2A32A 2F9UA 2Y80A 1ESBA 1RRKA 1YLCA 1ZHRA 2P8OC 4MDSA 2BTCE 1AFEH 2A0QB 5GCHG 2IPHA 2Z94A 1N1LA 6GCHG 1AKSB 3DT0H 3RC4A 1O5GH 2W5EA 2OTVA 1YP9A 1HNEE 1HGTH 4X8SH 3K65B 2FYQA 4AG1A 3B8JA 4CREA 1LKAA 2D26C 1VR1H 6CHAC 1FI8A 2RG3A 3ZV8A 1IQMA 1FLEE 1YC0A 1RIWB 4X2VA 2VVCA 3TJNA 2AGIX 3V7TA 3KHVA 4FUBA 4VGCC 4A5TS 1DUAA 1GCTC 1N6XA 2PHBA 4KTSA 1JWTA 2D1JA 1UTMA 1DITH 1F5KU 3MU0A 3ZZ8A 3RXEA 3A82A 1YPMH 3SJKA 3RXOA 3M3TA 1O5EH 3BTEE 5JBBS 1SLUB 1QB1A 1O3OA 2FO9A 3BEFB 1MBMA 1SG8B 5HYOA 1DWDH 5DPAA 2GGVB 1F0RA 2FM2A 4INHA 4B2CA 5A8ZA 1O3BA 1Y3WA 1C5MD 2P3FH 3UWJH 2XW9A 4AG2A 3A81A 4NA7A 1GBKA 2GCTB 4X6MA 2C93B 1FY4A 2OD3B 2ZTXA 4FXGH 1SL3A 3VB6A 3M3VA 2G00A 2VIPA 2XBYA 3V12A 3T28A 1C1PA 1GMDG 1MD7A 2P8OB 1S83A 2EI7A 3RXUA 2G4TA 3H5CB 1QBVH 2BDCA 1O5FH 2FOMB 1O36A 2AMQA 1B0EA 5FPYA 2VJ1A 4GLYA 3AASA 2A5IA 5EW1H 4D8NA 2JETC 1IQEA 1T4UH 1C9PA 1VJAU 2FOAA 1SR5C 1SGPE 1WBGB 1BUIA 1ZRKA 1AKSA 1LVMA 3BG4C 3RC5A 1K1MA 6CHAB 5ESTE 4WMDA 5LH8A 4X1RU 3GCOA 3VFEA 3BEUA 1G3DA 2ZA5A 1SGIB 2GZ7A 3Q3XA 1A0HB 5F8XA 2O8LA 1TMTH 1F5LA 2J2UA 4DOQA 4VGCB 1QRXA 4X1SU 1AY6H 1GCTB 1ZMJA 3V3MA 3LU9B 5FX6A 5I25A 5EW2H 2ZU3A 1P2NA 1KXCA 4ZXXH 3LOXA 3GCNA 2A7JA 3EA9A 4J1YA 1GVLA 2GV7A 5EGMA 1SOZA 1OWKA 1V2NT
chains in the Genus database with same CATH superfamily
2FI3E 1PPZA 1YPJH 3F9EA 4FU7A 4MQAA 3T25A 1AU8A 1P8VC 2OXSA 2KFWA 5GCHF 1C2KA 1O2VA 1H8DH 1PPHE 2C8XB 5E2OA 2BQ6B 3CENA 1N8OC 2BY5X 3P70B 2QCYA 5DP3A 1GL0E 2PP6A 3UTUH 5A8XA 2OLGA 2ZCHP 3P8NA 5JBAS 2XWAA 4YLQH 3SU6A 1FXYA 2A45B 3VEQB 5KEDA 2WYJA 5EIYA 3M37A 4AFUA 5E2PA 2H5CA 2TGPZ 1BITA 2G5NA 1GHWH 1GI5A 3KQBA 2BLWA 4QT8C 5DP4A 4I31A 1WU1A 2JETB 1SGDE 2ZHEH 3K2UA 1Q31A 3MO6A 1HCGA 4YO9A 3W95A 4DT4A 1C5UA 1TMUH 2F43B 3BG4B 3UPEA 2F9NA 1IOEA 1C5SA 4H6SB 1RTLA 2IJOB 3KNXA 1DLEA 1Y8TA 3U9AH 3SUEA 5DSFA 3SUDA 3RMOH 3UNRA 2BVRH 2F3CE 4IC6A 1KMHB 4BTIB 1O5DH 1P03A 2ZGBH 1W0YH 1TNKA 4Q7ZA 1SLXB 9LPRA 2VH6A 1LTOA 1O2SA 3FFGA 2FXRA 1COWD 1XUIA 1J16A 1DVAH 4X6NA 1GBDA 1BMFD 2BDBA 1L4ZA 2VWOA 1O2LA 1PYTC 3P8GA 4NSVA 1NRRH 2Y7XA 2ODYB 3CNRA 1GJ4H 1AO5A 5JB9S 4UDWH 5HKKD 1Z7KA 1RS0A 1H9HE 1NS3A 1GI8B 1ID5H 4HZHA 1N8OB 3VGCC 2TPIZ 1GBIA 3BTWE 3SV8A 1CE5A 3C27B 1BTUA 1VCQA 3IWMA 1MU8B 1DSUA 1VJ9U 1WYKA 5DP5A 2OUAA 4THNH 1O2WA 2WUCA 2WUBA 3A7ZA 2ZDMA 2BD3A 3GY5A 3OTJE 1V3XA 4NSYA 5L2ZH 3K6ZA 1D3DB 4XE4A 3F0OA 1NBME 2VNTA 4Z0KA 2TGDA 3P8FA 5AF9H 2WPDD 1CT2E 3SO3A 1AE5A 1D6WA 5AFZH 1WQSA 2J34A 1HPGA 1BMLA 3M5OA 3UB0A 1Z1IA 1GJ8B 1HXFH 1PPBH 2FYRA 1XUGA 4BTTB 6ESTA 1XXDA 1W0JD 2OC1A 2JKHA 3A87A 4FOUC 4MNXA 1GBJA 4HGCA 4WVPE 4I33A 5C94A 2ANYA 2QY0B 4K8YA 3VB3A 1O39A 5CMXH 3UNSA 3MFJA 4P02A 1UTKA 5T3HA 4YZUA 2HLDD 1S82A 2Y81A 1O2XA 1GI7B 1FIWA 3BTTE 1C2GA 2GTBA 1NFXA 2K0QA 3G01A 2AHME 5GWZA 4ABGA 3FO8D 3SJOA 2K1QA 3S7KB 2VH0A 1UCYH 3RXKA 2UUFB 1SB1H 1ZPCA 5CE1A 1XKBC 1B5GH 3VGCB 1GHAF 1A3BH 2O8WA 3M5MA 3BTDE 1CSOE 3LGVA 3KQ5A 1RTFB 5DN6D 2Z6BD 3RXIA 3PTNA 1SHHB 1V2OT 4ZHLU 4I8HA 1ZTKA 3P17H 1MCVA 1UK3A 1UW7A 5F03A 3RXCA 3LH1A 3BG8A 1GBBA 2KCPA 1P57B 1QL7A 2VGCC 3ODFA 1C1NA 1OOKB 3PWBA 4AGJA 2FEQH 1L0ZA 3B9FH 5HMAA 2QXJA 4Q80A 1KTTB 3DD2H 3TK6A 5IDKA 3RDZA 1XMNB 1GJ7B 1W12U 2OCVB 2GX4A 2NWNA 1O32A 3SUFA 4I86A 1UTJA 3ATIA 1EAIA 1C5OH 2P3TB 1GHVH 1EAWA 1MTVA 1O34A 3EA7A 2ZU4A 4UFEH 3F9FA 1HAOH 3SU1A 3R0FA 4ZKNU 5ETXA 4OS2A 1A4WH 1BMAA 1HAYB 1OWEA 1U6QA 3MNSA 5EODA 4AZ2B 1S6FA 1FIZA 1GWAA 3LGYA 4Y0ZE 1BB0B 4RSPA 2QF3A 5EQQA 1TX6A 3KIDU 5C0UA 1O38A 2AH4X 2GCHG 3FZZA 3ZYDA 1E1RD 1BJVA 2HPPH 2NU4E 3LC5A 1K22H 3TNTA 5F6MA 2A4QA 2GJGA 1UO6A 1GHZA 4I8LA 1O2MA 1K0HA 3RXLA 4YOJA 1W3CA 3ZZ3A 1W8BH 1IQFA 3SZNA 1SGNE 2W7UA 2WPMS 2D8WA 5GXPA 1ABIH 2G51A 1WTHD 2Z3EA 1EZSC 1MBQA 4AYVB 3STJA 2J94A 4SGAE 3MU8A 3LJJA 3ESTA 3B23B 1J17T 2ZDAH 3O8BA 2FODA 1ELEE 1O2YA 1MKXK 4UONA 1BQYA 4DGJA 2W6JD 3NXPA 2VBCA 1EXFA 1AE8H 2XBVA 3PRBA 3GDSA 2VGCB 1O3CA 1YKTA 4NWKA 1GL1A 1P10A 3GICB 2PTNA 4B73A 4CBOA 5TCCA 3T27A 2LELA 5DO4H 1VCWA 1UMAH 4E06H 1K1JA 5PTPA 4YT7H 1H4WA 1UK4A 5F8ZA 5GPIB 3U1JB 1D4PB 1BT7A 3RXTA 3UY9A 3F2HA 4FUEA 3A7XA 5KGOA 1IAUA 1S85A 1FY1A 3Q3YA 2QN5T 1TGNA 1JOUB 3NZIA 3SOSA 1NPMA 1IQLA 1F0UA 2AS9A 2Q1JA 2BY8X 4MNYA 2A31A 1ZZZA 1Y3YA 3ZVEA 1TRYA 4ASUD 3OY6U 3RLYH 5FXLA 1EOJA 2BDYA 1FY3A 1F0TA 3PLBA 2Z3DA 2W7SA 4X1QU 3JZ2B 5ESBA 1S6LA 2DE9A 1CHGA 1BRBE 1O2OA 1TBZH 3KGPA 1EJMA 2EY4C 1WQVH 2AERH 2J9NA 1ZJDA 4DG4A 2GZ8A 1C2DA 1MQ5A 1FX0B 2FPZA 4RKOB 4CRGA 3A80A 3SQHE 1SQAA 1ZGIA 1GMHG 1O2UA 4A1XA 2ANMH 3SU2A 4BAHB 4GVUA 4AFSA 1FV9A 1FUJA 4CBNA 2BD7A 2HGTH 1E0FD 3VB7A 4RN6A 1F92A 1FMGA 1W11U 3NWUA 1P01A 1HLTH 4ZKRU 4BAMB 5A0BA 2GT8A 1AVGH 3OU0A 4X0WU 3GDVA 1TNLA 2EC9H 4F49A 1LHDH 1GPZA 3QGJA 1JMOH 3HKIB 3SBKA 2FZZA 4RKJB 5IK2D 1SGCA 1A5IA 1QBNA 2FS8A 2ZGHA 4X2WA 2BQWB 2NU0E 2ZTZA 4YLUA 3ZZAA 1GBAA 2ZPQA 1THSH 4INLA 4JYUH 3UAIC 4XRNA 1ZTJA 4AFZA 3PV2A 3PV4A 2KCAA 1O3MA 5LPEA 4B75A 4MG3A 1DY9A 3U98H 2Z7FE 1EP5A 2IOTA 1AHTH 1L1JA 3TITA 5EPNA 3BTHE 2G81E 4ZROA 4BXWA 3P95A 3QLPH 2A4GA 2VIVA 2HWLB 2V0BA 1C5XB 1BTZA 3ZVGA 1UTLM 4NA9H 3O8RA 2H1UA 4U32A 4BOHA 5HXFA 3TJVA 1LHCH 1GGDC 4B74A 2EQNA 5C5NA 2ULLA 1V2QT 3TH3H 2XNIA 3D49H 2R2MB 5AHGH 2EA3A 1GBLA 2BOKA 1SMFE 2BZ6H 1SVPA 3OFND 5DP6A 1A5HA 3A89A 1V2RT 1BBRE 2ZFQH 1AUJA 1SKYE 1E79D 1EJNA 4XBDA 1C5ZB 2Y5HA 1JRSA 5AVDA 3PMBB 3S69A 3A86A 2WSSD 3GY2A 3ZZ7A 1ESAA 1BTXA 2ODQA 4X1NU 1KXBA 3OYPA 5FAHA 8ESTE 2J38A 1V2KT 1FAXA 3E0PB 4HI3A 1LHGH 1HAXB 3QZRA 3ELAH 2A2QH 3ITIA 1HIAB 2TRMA 4IN2A 4NGAH 1NRNH 3VB4A 1D3QB 2GZ9A 1GJ9B 1BHXB 2W3KA 1IHTH 1XVOA 1JIRA 2ZFRH 1ZGVA 2GV6A 1ARBA 1Z8RA 1FN8A 1K21H 3DHKH 4R8TB 1DY8A 2F91A 1WSSH 5J4SA 4H42U 3UR6A 4F4OC 3URCA 1KXAA 4E7RG 5CDFE 1A5GH 1GMHF 4D9RA 1FDPA 2V35A 1C1SA 3ATWA 5JB8S 3ATKA 4GHQA 4TY6A 3MOCA 1NO9H 1T8NA 2ALPA 2WPHS 4O03A 2JDID 1F0SA 1KTSB 2OBQA 4TSFD 1GGDB 1Q3XA 3RMMH 3DSOA 2THFB 4WXIA 3ATLA 1EAXA 1O30A 3QK1A 4H6TA 2PR3A 4Y0YE 1EUFA 1BTYA 5FBEA 1TPPA 2VB0A 4OS5A 2RA3A 1DICA 1C5YB 2GD4B 3PROA 5F8TA 1G3EA 3D62A 1EB2A 4B2AA 2NU2E 3TJUA 1LHEH 2CF8H 2FLBH 1GI3A 3T29A 1O3LA 1TPSA 2KM0A 3TU7H 4FUJA 1WAYB 2TGAA 1KDQB 2XTTB 4Q7YA 2PTCE 5C1UA 4FUGA 1QHRB 3TH4H 2GVFA 2FI4E 2OC7A 1AB9C 1CA8B 2SNVA 1TGCA 3BF6H 4Z6AH 1C5VA 1SSXA 3PLPA 5H4IB 4DW2U 5DKMA 3A8AA 1XVMA 3KQEA 3ZZCA 1Z6EA 1T4VH 4FUHA 3HK6B 1LPKB 3M7QA 4JMYA 4NIWA 1NBMD 1ACBE 4LXBH 1NY22 1S6HA 1P04A 1T7CA 4MNVA 4ISHH 2C8ZB 1BTHH 1HAGE 1MKXH 2OQ5A 1HIAA 3RU4E 4B1TA 2BM2A 3ODDA 3SU4A 4R0IA 1ARCA 2HNTC 3IG6B 1MZDA 3F1SB 2BYAX 5DK1A 2BLOA 2Q6DA 2JH0D 2CGAA 1LPGB 2LNCA 2ZGJA 3AAUA 1ZSLA 4FUCA 2PGQB 3WWBA 1EAUA 3Q76A 1BRCE 2GDDA 4XBBA 4Y76A 1QL8A 4XSKU 4I8GA 1WXRA 1C5NH 1PPEE 1MU6B 8LPRA 1C2LA 1MTWA 3FP7E 3GY8A 2P93A 4U2WA 4K3JA 2PKAB 1E34B 1ESTA 1V2PT 4FUIA 5DP8A 1C2MA 1BZXE 1J15A 1NFYA 1Z8GA 1FPCH 3FZDA 4B76A 2VIOA 1BBRK 1OYTH 3MH7A 3RXQA 4UFGH 1W7GH 1C1QA 4FU8A 4ZMAH 3TLOA 3HKJB 4XBCA 3OSYA 2UUYA 3RP2A 3SGBE 1AB9B 5EJ1A 1CU1A 1F5RA 3BIUH 1P0SH 2JJ1D 2VVUA 2C8YB 2QYIA 1CGHA 2AFQB 2BD8A 2CXVA 4DVAU 1ZTLA 1K1LA 1BHXF 1GVZA 1TOMH 4OS4A 3U1IB 3MNXA 4IS5A 1RFNA 3N7EA 5BRRE 1GHAG 1AN1E 2XC0A 1V2VT 4DCDA 3MNBA 1TGBA 4RI0A 1YPHE 2G8TA 3F68H 3UWIA 2BDIA 3P8OA 1TAWA 4WJG2 2VWLA 3FP8E 1DWCH 1LQEA 1W2KH 3SU5A 1HV7A 1ELBA 2J4IA 1GI2A 1AWFH 2BB4A 3RXPA 3UREA 1Y3UA 1SPJA 1SQTA 1H9IE 3LT3A 3PMJA 1GBTA 1TRNA 3T26A 2ZZUH 1ZMLA 2JH5D 1MKWK 1Y5BT 2HOBA 3PWCA 1O3HA 2WPLS 4ABBA 1W10U 3OE7D 4B71A 4DURA 1WOFA 1FAKH 1V2LT 1ANCA 2ODPA 1UTPA 2ZIQH 5JPMH 3SJ8A 1NRQH 1AGJA 2PUQH 3SV2H 2G5VA 4WXVA 8GCHF 1QQUA 1O3KA 2XBXA 3RXGA 2F83A 1MAXA 5F53A 2O8MA 4GAWA 1Y3VA 4CHAC 3KN2A 4JK5A 5FPSA 1YLDA 4DJZB 2CHAC 1KXDA 3TK9A 3SNDA 5A09A 4OS6A 2FOGA 2V7QD 2P95A 4NA8A 4OM9A 3NKKA 4Z1MD 1IQNA 2Y5GA 4X2YA 1KLIH 1GBFA 1KLJH 1P2QA 5GDSH 3RM2H 2AMPA 2G4UA 4MNWA 1DS2E 3S9CA 5HM2A 4X8TH 3LPRA 1LCYA 4LOYH 1V2MT 1MAYA 2FLRH 3TGIE 1SGYE 1QBOA 3U8TH 4DIIH 1A61H 1YM0A 5C1XA 1C5RA 1T32A 2H5DA 3ZZ5A 4FVDA 1G32B 2PSYA 2UWOA 5FL7D 1PQAA 2C4FH 2B7DH 4OS7A 4ABFA 1TFXA 4A92A 3LDXH 2QA9E 1YLNA 1GG6C 2PV9B 1H8ED 1NFWA 4K1EA 5C17A 2ZI2H 3BEIB 1HRTH 3H7TA 1OHHD 1GBCA 1VCPA 1DM4B 3PLKA 3PMHB 1YYY1 1TGSZ 3GDUA 4YM9A 1BOQA 1CA0C 3FOAA 5TJXA 4AFQA 1O2JA 5K0HA 2HRVA 1KY9A 5L6NH 1O3IA 2V3HH 4F48B 2ZHFH 4Y8ZA 1SQRA 4A1VA 1N6YA 4OGYA 4D7FA 4CHAB 4Q2KA 1DXWA 2IN2A 3SV6A 1GHXH 2CHAB 2KAIB 3V13A 1K1OA 1AI8H 3Q00A 2TIOA 1FPHH 2WPIS 4I7YH 1INCA 1MCTA 1ZHMA 3U8OH 3Q77A 1VITF 3AVZA 4A7IB 1PPFE 3MYWA 3SNCA 2OC8A 2VVVA 3F6UH 3W1EA 3MQKC 3NK8A 1MMJN 3ZZ4A 3T2NA 1C2JA 1QQ4A 1S5SA 1S0RA 3KQDA 1S0QA 1C4V2 1A1RA 1CGJE 1BIOA 1TNIA 3A7YA 1L1GA 2R9PA 2HNTF 3E6PH 4CR9A 5ABWA 3JZ1B 3BV9B 1JBUH 3HK3B 2QXGA 3L6PA 1G30B 1P2KA 1TIOA 3H7OA 1TALA 3RXSA 2Y5FA 1RJXB 4B6EA 1NRPH 2GMTC 5SGAE 4GUXA 1LVYA 1G2LA 1QCPA 4INKA 4XD7D 1UK2A 2BZAA 1C5TA 3VXEH 3SORA 4AOQA 4WWYA 3W94A 2KZ4A 3ZVAA 1GG6B 1NU9A 2A4OA 1DXPA 4XFQA 1ANBA 2P59A 1A7SA 3BSQA 1NZQH 1Z71A 3DUXH 4KKDA 5DP7A 2G55A 1TLDA 5G4BA 1CA0B 4JYTA 3KYFA 1MTUA 4ZXYH 4UD9H 4TWWA 1LMWB 4SGBE 1PPGE 2ZCLP 1MTNC 1ZMNA 2V6NA 1HJ9A 1OKXA 4NZLA 4BTUB 4JK6A 3CS0A 3LH3A 4FUFA 3KF2A 1TX8A 2ZC9H 2CV3A 5JBTA 2PKSC 2BX4A 1CT0E 2XOKD 2SNWA 3OY5U 1A2CH 4Y7BA 3WW7A 4NFFA 4NIXA 1ZOMA 5C20A 6LPRA 3MHWU 3A83A 1OWHA 1LVOA 5L2YH 1Z8JB 5JDUB 1MZAA 1Z8IB 1P05A 5A0CA 1DPOA 1B0FA 4O3TA 2PSXA 3MU5A 1OSSA 5BPEA 1QRZA 3AAVA 2KAIA 2WV9A 2ZP0H 2ZU2A 3SUGA 8KME2 1YY3A 3RUOA 1FZZA 2ZGCA 4IMQA 2UWPA 3BN9A 4KGAA 3FAOA 5LPRA 1VITH 2J97A 4AC9A 1BBRH 1K9OE 1J8AA 1QZ8A 3KEEA 1THPB 3BTFE 1P3CA 5EU8A 3SV7A 1K1NA 2HVXA 2GMTB 4NCYA 1W14U 1OYQA 2A5AA 2H9EH 1C2IA 1P06A 1H9LB 3RXJA 1C1MA 2QF5A 2WV4A 2YMSD 1TGTA 3GYLB 3RC6A 1UVTH 4RT0A 2A4RA 2VIDA 3PTBA 1V2ST 1UVPA 4JYVH 4FUDA 1OP0A 1XXFA 1DFPA 1MTNB 1C1WH 3M5NA 3E1XB 3R3GB 1DSTA 2BDGA 1E37B 5GJ4B 1GJCB 3V0XA 1XUJA 1THRH 2Z3CA 2HPQH 2PKSB 3TNSA 1MQ6A 1C2EA 2DE8A 2A7HA 1AFQC 1X7AC 1NC6A 2IJD1 3SI4H 1ELGA 1ELDE 1VGCB 3MMGA 1ELTA 2ZO3H 1GDQA 4FU9A 3TGJE 1AZZA 1CGIE 1XUKA 1C2HA 1L4DA 3ZVDA 2SGQE 1MKWH 1D9IA 2UUKB 3LKWA 3EE7A 5FCRA 1O3GA 4X1PU 2ZEBA 4CH8B 5CHAC 3E16B 3H09A 5C0TA 2J92A 1QNJA 3PB1E 2ANWA 4KP0A 1NFUA 1O2KA 1NU7B 1G3CA 4Y8YA 2PFEA 1GHBF 4ZH8A 4Q4LA 5CHBA 1P2OA 3QO6A 3SJ9A 1O2ZA 2JH6D 4ABJA 1V2JT 1CBWC 3PM3A 3I78A 3LONA 1GJ6A 1DUEA 4YT6H 4IMZA 2ZDNA 3AW1A 1TRMA 2P16A 5DGJA 1DLKB 2NU3E 3GY4A 1C1RA 4KTUA 4Y71A 5TCAA 2GDEH 2ZWLH 2EI8A 2WYGA 1DWBH 3RU4D 2BMGB 3VG8A 3A84A 4HG6A 2W6ID 2A2XH 4ABHA 1QB6A 4HTCH 3GISB 2SFAA 1FY8E 2Y7ZA 5J4QA 3I77A 5HM9A 3UOUA 1NN6A 3EDXB 4WF8A 2KCYA 1JIMA 3BIVH 3F2GA 3HPTB 2PGBB 1AFQB 4J2YB 4IGDA 4D76A 2BHGA 1TA2A 3MWIU 3ZZBA 4ISNA 1HXEH 3MO3A 2QV1A 1V2WT 4MPUA 1E1QD 2XC4A 1UHBB 2W3IA 1K1IA 1C5QA 1CQQA 3AW0A 4MVNA 3RXMA 2FESH 3A85A 3OEHD 4PROA 1WV7H 4GCHF 4MTBA 4Q63A 5CHAB 3UR9A 4ABDA 4LZ1H 2ZF0H 2AEIH 5B6LA 4O3UA 2B9LA 1TA6A 4BANB 1HAVB 3UIRA 4CRAA 3F9HA 1D6RA 1DE7H 1OP2A 2ZGXH 4AORA 1CBWB 2Y6TA 1TMBH 3QUMP 1ZJKA 1BJUA 1EZXC 4WH6A 1C5LH 2W26A 1HAIH 4LK4A 2B5TB 1ORFA 3UFAA 1OWJA 1P2JA 1O37A 1O3PB 2C90B 3O8CA 3ZYEA 9ESTA 1Y59T 2JJ2D 4MPXA 3U28C 4YTAA 3QGNB 3T5FH 3SZEA 1HJ8A 3M7UA 3KL6A 3PO1C 1SLWB 2FOHA 1DWEH 5IYTA 1BA8B 2Z9JA 1MUEB 3GCTG 4X6PA 1C5WB 3GY3A 2J98B 4O9VA 2ZU5A 3E91A 2FX6A 3QN7A 1P12E 4X6OA 5T6GA 1EOLA 1O2PA 1UTNA 3CS7A 1FJSA 1W13U 5DP9A 4O97A 1W0KD 2OBOA 1QR3E 1VZQH 4YXWD 3SV9A 1UCYK 1HUTH 3FVFB 2QXHA 2Z9GA 1V6DA 2QF0A 2VWNA 1E35B 2FWWA 4YOIA 1HBTH 2ILNA 1D3TB 3SNEA 1A46H 1QY6A 1KXFA 1AWHB 3SYJA 3GY7A 1XKAC 2FTMA 1C5PA 1GDNA 2XYAA 1C1TA 1O3DA 2F9PA 1NM6A 1LHFH 4ISLA 1W0ZU 2DUCA 1G36A 2XNDD 1O2TA 1UHBA 3NCLA 3SQEE 3D23A 4OS1A 4ASHA 3VB5A 3MH5A 3SHAH 5T1VA 5EQSA 3EGKH 1ZHPA 2KCOA 2J5UA 4OGXA 4AYYB 1C4U2 3QTOH 2CMYA 4ISOA 2Z9IA 3P6ZB 1GJBB 4K1SA 8GCHG 1Q2WA 2ZDVH 3OEED 1UVSH 1HAVA 1EX3A 1SOTA 1T8MA 4I32A 2HVYB 3LC3A 1TBRH 3KYGA 2AIPA 2B0FA 2H9HA 3PO1B 3UOPA 2O8UA 1AD8H 3ZZDA 1H8HD 1QA7A 4BXSA 2WHXA 4Y7AA 4JZDH 4TPYA 3ZZ6A 1ELFA 2ZHWH 1NESE 4ZCNA 2F9VA 2RDLA 2OINA 4NWLA 1GJ5H 2ZHDA 3S7HB 4IBLH 2BD9A 2YMSC 2VINA 4CH2B 1T8OA 1VKYA 2BY7X 3GS9A 1V2UT 1ZRBA 3LGWA 2ZKSA 1HAZB 1TPAE 2ZPRA 2J98A 2GP9B 3RMLH 5AFYH 2VWMA 4FVBA 2G52A 1RTKA 3MO9A 1WCZA 5C67A 1UVOA 1C1VH 2SGFE 3RXHA 2PWXA 2EEKA 1XX9A 1EASA 4U30A 4A1TA 1SGFG 3LIWA 1V2TT 4WMFA 2SGEE 2CF9H 3M61U 5EXMA 1OP8A 1GI1A 1OS8A 5E0JA 3TPIZ 2FS9A 2AGGX 1FQ3A 1Y5AT 1L1NA 2ANKH 2ESTE 1ELVA 2ZG0H 1LQDB 1Z6JH 2RCEA 4K8BA 3GCTF 1BDAA 1YPGH 1WTGH 4WY3A 1KDQA 1NTPA 5EXLA 4AGKA 1ZPZA 3BTQE 5EJLA 2FP7B 3A8DA 1KSNA 2RFKC 2GT7A 3RU4T 6GCHF 1EZUC 2OC0A 3E8LA 1EFRD 3TGKE 1DT2A 1OWIA 4AN7A 1DANH 1PQ7A 1TB6H 2V3OH 4ABAA 3ZVBA 1YGCH 4GPGA 4KTCA 2YNBA 1LPZB 1SHYA 3MI4A 3VXFH 1VITG 4K69A 1O33A 1L2EA 1EQ9A 3FANA 1AQ7A 4BAQB 3M3SA 3PYHA 5A0AE 2XWBI 2ZDLA 2YMSB 1GJAB 1Y5UT 1TNJA 5FHTA 3SI3H 2ZQ2A 2L74A 1SI5H 5T6DA 7ESTE 5T6FA 3QDZB 3TH2H 2VIQA 1CT4E 1F2SE 1EB1H 2FMJA 3FP6E 3TVJB 1GI0A 5B6OA 4ACBA 1TBQH 1DX5M 1O3JA 5L30H 4MPWA 1G37A 1NRSH 4GSOA 5C5OA 2D2DA 4Y79A 1UTQA 2ZECA 1SGFA 1FY5A 1IQKA 1QJ7B 2BD5A 1SGEE 4JZEH 1NT1A 3HGPA 2PKAA 2PW8H 4CR5A 3GYMA 4E05H 1YCPK 2ZPSA 2BXUH 2J95A 2A5KA 4TYDA 3SU3A 5LPFA 1QA0A 3RLWH 1GDUA 2XCFA 4CRFA 1A0JA 1OX1A 2QGRA 2XRCA 2QAAA 1CVWH 2QF4A 1GMDF 3P92A 1UVUH 2C8WB 1H1BA 1P2MA 1EATA 1P02A 3GCHC 2P3UB 1O3AA 1QJ1B 1SBWA 1GBHA 2FOBA 2PLXA 4K60A 1O2HA 3PMAB 1S84A 2R2WU 4UFDH 2STAE 5FPTA 2F9OA 1C9TA 1O2NA 2AYWA 1PFXC 3N7DA 4X8VH 1TOCB 3M35A 3QWCH 1QTFA 1P9UA 2ASUB 1G2MA 3E0NB 5JBCS 4BAKB 1O31A 1AVWA 2C3SA 2Z9KA 4CRDA 2FIRH 3I29A 3ZVCA 4AB8A 1O3EA 2RDEA 2V3MA 2BY9X 2BXTH 1ANEA 3DSGA 1YPHC 3QZQA 1LDTT 1A3EH 1TE0A 3Q3KA 1TYNA 4DY7B 3WY8A 3MTYA 1P3EA 1TX7A 2Y82A 2CN0H 1WDIA 1GMCG 1QFKH 2ZCKP 3E3TA 3BTKE 1ELAA 3UNQA 1KXEA 1AVXA 3S9BA 4NIVA 2QE7D 1YCPM 4YESB 3MNCA 1PQ5A 1EP6A 3EYDA 5FX5A 1TQ0B 2ALVA 3M5LA 4D9QA 4B2BA 2RA0A 5I46H 3EAJA 1HAPH 1O2GH 2WV5A 4XOJA 3A7WA 3ENSB 3BTGE 4BAOB 2ZU1A 1ETSH 1S81A 3DA9B 3EQ0H 1O5AB 5KECA 1MD8A 2BD4A 2SGDE 1BTWA 1MABB 2QIQA 3F0PA 1IQJA 1GHYH 4JCNA 3F2FA 3GCHB 3K9XB 4P00A 2CJIA 2P94A 5C1YA 4FETA 4I8JA 1F7ZA 1RD3B 4ISIH 3SW2B 3PRDA 3S0NA 2HLCA 1UJ1A 4E7NA 3UQVA 4ZKSU 2FDAA 3OAAD 1OWDA 1HYLA 3BTME 2WINI 1MTSA 1YF4A 2YNAA 2A7CA 3SGQE 1J9CH 1PQ8A 1QIXB 4TWYA 4TT3D 2K8IA 2PUXB 2VIWA 1K2I1 4X8UH 3QX5H 4Y8XA 1GHBG 1EKBB 1QRWA 4M7GA 1ABJH 1XUHA 3IITA 3RM0H 4ACAA 1H8IH 1PPCE 1RGQA 2IPQX 2ZFFH 4A6LA 3GOVB 2AIQA 4UEHH 1JXPA 1BCUH 3L33A 2FOFA 4CRBA 3N99A 1SGQE 2WPKS 1O5BB 4AB9A 1SQOA 1K1PA 4I8KA 7KMEH 4LZ4B 3M36A 4NZQA 2WPJS 4WMEA 3KCGH 2TGTA 4ZUHA 1ELCA 1LO6A 3MU4A 1ETRH 3LJOA 1CHOG 5EQRA 2LPRA 2WZQA 3OX7U 5A2MH 1JRTA 1ZR0A 3NPSA 1ZPBA 1SLVB 1SC8U 5HIYA 1VGCC 3QTVH 1YPLH 2O9QA 1SFIA 2SGPE 1EPTC 2FOEA 5EOKA 7LPRA 2NU1E 4NIYA 1ZLRA 2BOHB 1YWUA 1O2QA 2XBWA 2ZFPH 5E0HA 2ZFTA 5A8YA 1FN6A 1Y3XA 1C1OA 3PV5A 1P2IA 2STBE 4GHTA 3KQCA 2FTLE 2R3UA 1XUFA 1P11E 4MLFB 2XXLA 4TPIZ 7GCHG 1BMNH 1W7XH 1BRAA 1AZ8A 4AX9H 1SGTA 2BD2A 3HATH 5EG4A 4ABIA 4NG9H 3DFLA 2ZTYA 3UQOA 3RXDA 1T31A 4JZFH 3F3BA 2OP9A 4IN1A 3RXVA 5LGOA 3TJOA 4GCHG 1YPKH 3RMNH 2EI6A 1GMCF 5DG6A 4D7GA 1HJAC 1GI9B 3MH4A 1AUTC 1YBWA 1P9SA 1NROH 1SGRE 2O8TA 2Z9LA 2ZNKH 1WUNH 3L3TA 1TONA 3RXBA 4U01A 3SGAE 3ZV9A 2UUJB 3TK5A 4KELA 5GIBA 1C1UH 1PJPA 3RXRA 2ZDKA 4MPVA 3HGNA 1E38B 4H4FA 1O5CB 5K7RA 1QB9A 1ETTH 1TQ7B 5E0GA 2BLQA 3EA8A 3RXAA 1IQIA 1O3FA 4XDEA 1BTPA 1O2IA 3SJIA 1XM1A 2HALA 3S9AA 3MH6A 1BRUP 2A1DB 1GI4A 3ATMA 1C2FA 2M5TA 1G9IE 1EPTB 1UCYE 2R3YA 1TNHA 4ESTE 3A7VA 2H9TH 3LGUA 5E8EH 1HB0B 2I6SA 2TBSA 3E90B 2VU8E 2LP6A 2BLVA 4UFFH 4YOGA 1B7XB 1E36B 5C2ZA 3NUMA 3FN8A 2FOCA 4ZHMU 1UTOA 3GY6A 2GKVE 3K6YA 1QJ6B 4B6FA 2AGEX 2R0KA 4NFEA 1GCDA 4Y6DA 3U69H 1TABE 3AK5A 2FX4A 4CRCA 2H6MA 1AMHA 2I6QA 5DJ7A 2Q6FA 4IC5A 3T62A 1Z1JA 3A8BA 2R0LA 1BMMH 2B8OH 2QXIA 3LGIA 4K1TA 1YCPH 2BVSH 3M7TA 1HJAB 1P09A 3CP7A 3C1KA 1QL9A 2OQUA 3O8DA 2QC2A 1YPEH 3DFJA 3URDA 1O3NA 4K2YA 2KX4A 1GBEA 1ZSJA 1CHOF 4ZHAA 4JZIA 3SHCH 1DOJA 3LGTA 1T8LA 3SNAA 4ABEA 1AIXH 2BDHA 1FNIA 3TIUA 2OK5A 3MU1A 1GI6A 1GVKB 1LKBA 1CO7E 1ZSKA 2GCHF 3A7TA 5HIZA 3A8CA 1O0DH 3SNBA 1O2RA 1HAHH 2FI5E 2AMDA 5FBIA 1EJAA 3A88A 1DDJA 1HFDA 2BQ7B 7GCHF 4TY7A 4F55A 1QURH 4Q7XA 1IQHA 1LVBA 4X2XA 1IQGA 1RXPA 2BX3A 4Y11E 4WH8A 3STIA 2ZHQH 1PYTD 2ZQ1A 5EXNA 1GJDB 1TNGA 3VPKA 4K5ZA 2BY6X 3FKSD 1HDTH 1OPHB 2F9BH 2BVXH 3DCLA 5FCKA 5JYIA 1RIWC 1G3BA 1EPTA 4UE7H 3RXFA 4BNRA 1ZYOA 1KLTA 3EE0B 1J14A 1KIGH 1O35A 2BDAA 2H2ZA 5EPYA 1EZQA 1FONA 2Q6GA 4DIHH 1TPOA 2UWLA 2YOLA 1MH0A 1KYNA 1TWXB 3ZIAD 2XCNA 4DT7B 4IW4E 2M2AA 4JZ1A 2ZFSA 1QGFA 1A0LA 1GBMA 1SFQB 3SN8A 5C3NA 1IHSH 1D3PB 3N7OA 3SU0A 1C4Y2 3U8RH 4HFPB 4ZAEA 3ZVFA 4M9FA 2XC5A 1ANDA 4ZKOU 5HGGA 3F9GA 1K28D 1OXGA 3D65E 2HNTE 3UUZA 2SGAA 2GCTC 1M9UA 4Y10E 3ZZ9A 2A32A 2F9UA 2Y80A 1ESBA 1RRKA 1YLCA 1ZHRA 2P8OC 4MDSA 2BTCE 1AFEH 2A0QB 5GCHG 2IPHA 2Z94A 1N1LA 6GCHG 1AKSB 3DT0H 3RC4A 1O5GH 2W5EA 2OTVA 1YP9A 1HNEE 1HGTH 4RT1A 3K65B 2FYQA 4X8SH 4AG1A 3OTPA 3B8JA 4CREA 1LKAA 2D26C 1VR1H 6CHAC 1FI8A 2RG3A 3ZV8A 1IQMA 2CK3D 1FLEE 1YC0A 1RIWB 4X2VA 2VVCA 3TJNA 2AGIX 3V7TA 3KHVA 4FUBA 4VGCC 4A5TS 1DUAA 1GCTC 1N6XA 3NRLA 2PHBA 4KTSA 2JIZD 2KR7A 1JWTA 2D1JA 1UTMA 5GNDA 1DITH 1F5KU 3MU0A 3ZZ8A 3RXEA 2F4LA 3A82A 1YPMH 3SJKA 3RXOA 3M3TA 1O5EH 3BTEE 5JBBS 1SLUB 1QB1A 1O3OA 2FO9A 3BEFB 1MBMA 1SG8B 3DSPA 5HYOA 1DWDH 5DPAA 2GGVB 1F0RA 2FM2A 4INHA 4B2CA 5A8ZA 1O3BA 1Y3WA 1C5MD 2P3FH 3UWJH 2XW9A 4AG2A 3A81A 4NA7A 1GBKA 2GCTB 4X6MA 2C93B 1FY4A 2OD3B 2ZTXA 4FXGH 1SL3A 3VB6A 3M3VA 2G00A 2VIPA 2XBYA 3V12A 3T28A 1C1PA 1GMDG 1MD7A 2P8OB 1S83A 2EI7A 3RXUA 2L6OA 2G4TA 3H5CB 1QBVH 2BDCA 1O5FH 2FOMB 1O36A 2AMQA 1B0EA 5FPYA 2VJ1A 4GLYA 3AASA 2A5IA 5EW1H 4D8NA 2JETC 1IQEA 1T4UH 1C9PA 1VJAU 2FOAA 1SR5C 1SGPE 1WBGB 1BUIA 1ZRKA 1AKSA 1LVMA 3BG4C 3RC5A 1K1MA 6CHAB 5ESTE 4WMDA 5LH8A 4X1RU 3GCOA 3VFEA 3WWFA 3BEUA 1G3DA 2ZA5A 1SGIB 2GZ7A 3Q3XA 1A0HB 5F8XA 2O8LA 1TMTH 1F5LA 2J2UA 4DOQA 4VGCB 1QRXA 4X1SU 1AY6H 1GCTB 1ZMJA 3V3MA 3LU9B 5FX6A 5I25A 5EW2H 2ZU3A 1P2NA 1KXCA 4ZXXH 3LOXA 5EJZA 3GCNA 2A7JA 3EA9A 4J1YA 1GVLA 2GV7A 5EGMA 1SOZA 1OWKA 1V2NT
chains in the Genus database with same CATH topology
2FI3E 1PPZA 1YPJH 3F9EA 4FU7A 4MQAA 3T25A 1AU8A 1P8VC 2OXSA 5GCHF 1C2KA 1O2VA 1H8DH 1PPHE 2C8XB 5E2OA 2BQ6B 3CENA 1N8OC 2BY5X 3P70B 2QCYA 5DP3A 1GL0E 3UTUH 5A8XA 2OLGA 2ZCHP 3P8NA 5JBAS 2XWAA 4YLQH 3SU6A 1FXYA 2A45B 3VEQB 2WYJA 3M37A 4AFUA 5E2PA 2H5CA 2TGPZ 1BITA 2G5NA 1GHWH 1GI5A 3KQBA 2BLWA 4QT8C 5DP4A 4I31A 1WU1A 2JETB 1SGDE 2ZHEH 3K2UA 1Q31A 3MO6A 1HCGA 4YO9A 3W95A 1C5UA 1TMUH 3BG4B 3UPEA 2F9NA 1IOEA 1C5SA 4H6SB 1RTLA 2IJOB 3KNXA 1DLEA 1Y8TA 3U9AH 3SUEA 3SUDA 3RMOH 3UNRA 2BVRH 2F3CE 4IC6A 4BTIB 1O5DH 1P03A 2ZGBH 1W0YH 1TNKA 4Q7ZA 1SLXB 9LPRA 2VH6A 1LTOA 1O2SA 3FFGA 2FXRA 1XUIA 1J16A 1DVAH 4X6NA 1GBDA 2BDBA 1L4ZA 2VWOA 1O2LA 1PYTC 3P8GA 4NSVA 1NRRH 2Y7XA 2ODYB 1GJ4H 1AO5A 5JB9S 4UDWH 1Z7KA 1RS0A 1H9HE 1NS3A 1GI8B 1ID5H 4HZHA 1N8OB 3VGCC 2TPIZ 1GBIA 3BTWE 3SV8A 1CE5A 3C27B 1BTUA 1VCQA 3IWMA 1MU8B 1DSUA 1VJ9U 1WYKA 5DP5A 2OUAA 4THNH 1O2WA 2WUCA 2WUBA 3A7ZA 2ZDMA 2BD3A 3GY5A 3OTJE 1V3XA 4NSYA 5L2ZH 3K6ZA 1D3DB 4XE4A 2VNTA 4Z0KA 2TGDA 3P8FA 5AF9H 1CT2E 3SO3A 1AE5A 1D6WA 5AFZH 1WQSA 2J34A 1HPGA 1BMLA 3M5OA 1Z1IA 1GJ8B 1HXFH 1PPBH 2FYRA 1XUGA 4BTTB 6ESTA 1XXDA 2OC1A 2JKHA 3A87A 4MNXA 1GBJA 4HGCA 4WVPE 4I33A 2ANYA 2QY0B 4K8YA 3VB3A 1O39A 5CMXH 3UNSA 3MFJA 1UTKA 5T3HA 4YZUA 1S82A 2Y81A 1O2XA 1GI7B 1FIWA 3BTTE 1C2GA 2GTBA 1NFXA 3G01A 5GWZA 4ABGA 3SJOA 2K1QA 3S7KB 2VH0A 1UCYH 3RXKA 2UUFB 1SB1H 1ZPCA 5CE1A 1XKBC 1B5GH 3VGCB 1GHAF 1A3BH 2O8WA 3M5MA 3BTDE 1CSOE 3LGVA 1RTFB 2Z6BD 3RXIA 3PTNA 1SHHB 1V2OT 4ZHLU 4I8HA 1ZTKA 3P17H 1MCVA 1UK3A 5F03A 3RXCA 3LH1A 3BG8A 1GBBA 1P57B 1QL7A 2VGCC 3ODFA 1C1NA 1OOKB 3PWBA 4AGJA 2FEQH 1L0ZA 3B9FH 5HMAA 2QXJA 4Q80A 1KTTB 3DD2H 3TK6A 5IDKA 3RDZA 1XMNB 1GJ7B 1W12U 2OCVB 2GX4A 2NWNA 1O32A 3SUFA 1UTJA 3ATIA 1EAIA 1C5OH 2P3TB 1GHVH 1EAWA 1MTVA 1O34A 3EA7A 2ZU4A 4UFEH 3F9FA 1HAOH 3SU1A 3R0FA 4ZKNU 5ETXA 4OS2A 1A4WH 1BMAA 1HAYB 1OWEA 1U6QA 3MNSA 5EODA 4AZ2B 1S6FA 1FIZA 1GWAA 3LGYA 4Y0ZE 1BB0B 4RSPA 2QF3A 5EQQA 1TX6A 3KIDU 1O38A 2AH4X 2GCHG 3FZZA 3ZYDA 2HPPH 1BJVA 2NU4E 3LC5A 1K22H 3TNTA 5F6MA 2A4QA 1UO6A 1GHZA 4I8LA 1O2MA 3RXLA 4YOJA 1W3CA 3ZZ3A 1W8BH 1IQFA 3SZNA 1SGNE 2W7UA 2WPMS 2D8WA 5GXPA 1ABIH 2G51A 1WTHD 2Z3EA 1EZSC 1MBQA 4AYVB 3STJA 2J94A 4SGAE 3MU8A 3LJJA 3ESTA 3B23B 1J17T 2ZDAH 3O8BA 2FODA 1ELEE 1O2YA 1MKXK 4UONA 1BQYA 4DGJA 3NXPA 1EXFA 1AE8H 2XBVA 3GDSA 2VGCB 1O3CA 1YKTA 4NWKA 1GL1A 1P10A 3GICB 2PTNA 4B73A 4CBOA 5TCCA 3T27A 5DO4H 1VCWA 1UMAH 4E06H 1K1JA 5PTPA 4YT7H 1H4WA 1UK4A 5F8ZA 5GPIB 3U1JB 1D4PB 1BT7A 3RXTA 3UY9A 4FUEA 3A7XA 1IAUA 1S85A 1FY1A 3Q3YA 2QN5T 1TGNA 1JOUB 3NZIA 3SOSA 1NPMA 1IQLA 1F0UA 2AS9A 2Q1JA 2BY8X 4MNYA 2A31A 1ZZZA 1Y3YA 3ZVEA 1TRYA 3OY6U 3RLYH 5FXLA 1EOJA 2BDYA 1FY3A 1F0TA 3PLBA 2Z3DA 2W7SA 4X1QU 3JZ2B 5ESBA 2DE9A 1CHGA 1BRBE 1O2OA 1TBZH 3KGPA 1EJMA 1WQVH 2AERH 2J9NA 1ZJDA 4DG4A 2GZ8A 1C2DA 1MQ5A 4CRGA 2FPZA 4RKOB 3A80A 3SQHE 1SQAA 1ZGIA 1GMHG 1O2UA 4A1XA 2ANMH 3SU2A 4BAHB 4GVUA 4AFSA 1FV9A 1FUJA 4CBNA 2BD7A 2HGTH 1E0FD 3VB7A 4RN6A 1F92A 1FMGA 1W11U 3NWUA 1P01A 1HLTH 4ZKRU 4BAMB 5A0BA 2GT8A 1AVGH 3OU0A 4X0WU 3GDVA 1TNLA 2EC9H 4F49A 1LHDH 1GPZA 3QGJA 1JMOH 3HKIB 3SBKA 2FZZA 4RKJB 1SGCA 1A5IA 1QBNA 2FS8A 2ZGHA 4X2WA 2BQWB 2NU0E 2ZTZA 4YLUA 3ZZAA 1GBAA 2ZPQA 1THSH 4INLA 4JYUH 1ZTJA 4AFZA 3PV4A 1O3MA 5LPEA 4B75A 4MG3A 1DY9A 3U98H 2Z7FE 1EP5A 2IOTA 1AHTH 1L1JA 3TITA 5EPNA 3BTHE 2G81E 4ZROA 4BXWA 3P95A 3QLPH 2A4GA 2VIVA 2HWLB 2V0BA 1C5XB 1BTZA 3ZVGA 1UTLM 4NA9H 3O8RA 2H1UA 4U32A 4BOHA 5HXFA 3TJVA 1LHCH 1GGDC 4B74A 5C5NA 2ULLA 1V2QT 3TH3H 2XNIA 3D49H 2R2MB 5AHGH 2EA3A 1GBLA 2BOKA 1SMFE 2BZ6H 1SVPA 5DP6A 1A5HA 3A89A 1V2RT 1BBRE 2ZFQH 1AUJA 1EJNA 4XBDA 1C5ZB 2Y5HA 1JRSA 5AVDA 3PMBB 3S69A 3A86A 3GY2A 3ZZ7A 1ESAA 1BTXA 2ODQA 4X1NU 1KXBA 3OYPA 5FAHA 8ESTE 2J38A 1V2KT 1FAXA 3E0PB 4HI3A 1LHGH 1HAXB 3QZRA 3ELAH 2A2QH 3ITIA 1HIAB 2TRMA 4IN2A 4NGAH 1NRNH 3VB4A 1D3QB 2GZ9A 1GJ9B 1BHXB 2W3KA 1IHTH 1XVOA 1JIRA 2ZFRH 1ZGVA 2GV6A 1ARBA 1Z8RA 1FN8A 1K21H 3DHKH 4R8TB 1DY8A 2F91A 1WSSH 5J4SA 4H42U 3UR6A 4F4OC 3URCA 1KXAA 4E7RG 1A5GH 1GMHF 4D9RA 1FDPA 2V35A 1C1SA 3ATWA 5JB8S 3ATKA 4GHQA 4TY6A 3MOCA 1NO9H 1T8NA 2ALPA 2WPHS 4O03A 1F0SA 1KTSB 2OBQA 1GGDB 1Q3XA 3RMMH 2THFB 4WXIA 3ATLA 1EAXA 1O30A 3QK1A 4H6TA 2PR3A 4Y0YE 1EUFA 1BTYA 5FBEA 1TPPA 2VB0A 4OS5A 2RA3A 1DICA 1C5YB 2GD4B 3PROA 5F8TA 1G3EA 3D62A 1EB2A 4B2AA 2NU2E 3TJUA 1LHEH 2CF8H 2FLBH 1GI3A 3T29A 1O3LA 1TPSA 3TU7H 4FUJA 1WAYB 2TGAA 1KDQB 2XTTB 4Q7YA 2PTCE 5C1UA 4FUGA 1QHRB 3TH4H 2GVFA 2FI4E 2OC7A 1AB9C 1CA8B 2SNVA 1TGCA 3BF6H 4Z6AH 1C5VA 1SSXA 3PLPA 5H4IB 4DW2U 5DKMA 3A8AA 1XVMA 3KQEA 3ZZCA 1Z6EA 1T4VH 4FUHA 3HK6B 1LPKB 3M7QA 4JMYA 4NIWA 1ACBE 4LXBH 1NY22 1S6HA 1P04A 1T7CA 4MNVA 4ISHH 2C8ZB 1BTHH 1HAGE 1MKXH 2OQ5A 1HIAA 3RU4E 4B1TA 2BM2A 3ODDA 3SU4A 4R0IA 1ARCA 2HNTC 3IG6B 1MZDA 3F1SB 2BYAX 5DK1A 2BLOA 2Q6DA 2JH0D 2CGAA 1LPGB 2LNCA 2ZGJA 3AAUA 1ZSLA 4FUCA 2PGQB 1EAUA 3Q76A 1BRCE 2GDDA 4XBBA 4Y76A 1QL8A 4XSKU 4I8GA 1C5NH 1PPEE 1MU6B 8LPRA 1C2LA 1MTWA 3FP7E 3GY8A 2P93A 4U2WA 4K3JA 2PKAB 1E34B 1ESTA 1V2PT 4FUIA 5DP8A 1C2MA 1BZXE 1J15A 1NFYA 1Z8GA 1FPCH 3FZDA 4B76A 2VIOA 1BBRK 1OYTH 3MH7A 3RXQA 4UFGH 1W7GH 1C1QA 4FU8A 4ZMAH 3TLOA 3HKJB 4XBCA 3OSYA 2UUYA 3RP2A 3SGBE 1AB9B 1CU1A 1F5RA 3BIUH 1P0SH 2VVUA 2C8YB 2QYIA 1CGHA 2AFQB 2BD8A 2CXVA 4DVAU 1ZTLA 1K1LA 1BHXF 1GVZA 1TOMH 4OS4A 3U1IB 3MNXA 4IS5A 1RFNA 5BRRE 1GHAG 1AN1E 2XC0A 1V2VT 4DCDA 3MNBA 1TGBA 1YPHE 2G8TA 3F68H 3UWIA 2BDIA 3P8OA 1TAWA 4WJG2 2VWLA 3FP8E 1DWCH 1LQEA 1W2KH 3SU5A 1HV7A 1ELBA 2J4IA 1GI2A 1AWFH 2BB4A 3RXPA 3UREA 1Y3UA 1SPJA 1SQTA 1H9IE 3LT3A 3PMJA 1GBTA 1TRNA 3T26A 2ZZUH 1ZMLA 2JH5D 1MKWK 1Y5BT 2HOBA 3PWCA 1O3HA 2WPLS 4ABBA 1W10U 4B71A 4DURA 1WOFA 1FAKH 1V2LT 1ANCA 2ODPA 1UTPA 2ZIQH 5JPMH 3SJ8A 1NRQH 1AGJA 2PUQH 3SV2H 2G5VA 4WXVA 8GCHF 1QQUA 1O3KA 2XBXA 3RXGA 2F83A 1MAXA 2O8MA 4GAWA 1Y3VA 4CHAC 3KN2A 4JK5A 5FPSA 1YLDA 4DJZB 2CHAC 1KXDA 3TK9A 3SNDA 5A09A 4OS6A 2FOGA 2P95A 4NA8A 3NKKA 1IQNA 2Y5GA 4X2YA 1KLIH 1GBFA 1KLJH 1P2QA 5GDSH 3RM2H 2AMPA 2G4UA 4MNWA 1DS2E 3S9CA 5HM2A 4X8TH 3LPRA 1LCYA 4LOYH 1V2MT 1MAYA 2FLRH 3TGIE 1SGYE 1QBOA 3U8TH 4DIIH 1A61H 1YM0A 5C1XA 1C5RA 1T32A 2H5DA 3ZZ5A 4FVDA 1G32B 2PSYA 2UWOA 1PQAA 2C4FH 2B7DH 4OS7A 4ABFA 1TFXA 4A92A 3LDXH 2QA9E 1GG6C 2PV9B 1NFWA 4K1EA 2ZI2H 3BEIB 1HRTH 3H7TA 1VCPA 1GBCA 3PMHB 1DM4B 3PLKA 1YYY1 1TGSZ 3GDUA 4YM9A 1BOQA 1CA0C 5TJXA 4AFQA 1O2JA 5K0HA 2HRVA 1KY9A 5L6NH 1O3IA 2V3HH 2ZHFH 4Y8ZA 4A1VA 1N6YA 4OGYA 4D7FA 4CHAB 4Q2KA 1DXWA 2IN2A 3SV6A 1GHXH 2CHAB 2KAIB 3V13A 1K1OA 1AI8H 3Q00A 2TIOA 1FPHH 2WPIS 4I7YH 1INCA 1MCTA 1ZHMA 3U8OH 3Q77A 1VITF 3AVZA 4A7IB 1PPFE 3MYWA 3SNCA 2OC8A 2VVVA 3F6UH 3NK8A 1MMJN 3ZZ4A 3T2NA 1C2JA 1QQ4A 1S5SA 1S0RA 3KQDA 1S0QA 1C4V2 1A1RA 1CGJE 1BIOA 1TNIA 3A7YA 1L1GA 2R9PA 2HNTF 3E6PH 4CR9A 5ABWA 3JZ1B 3BV9B 1JBUH 3HK3B 2QXGA 3L6PA 1G30B 1P2KA 1TIOA 3H7OA 1TALA 3RXSA 2Y5FA 1RJXB 1NRPH 2GMTC 5SGAE 4GUXA 1LVYA 1G2LA 1QCPA 4INKA 3VXEH 1UK2A 2BZAA 1C5TA 4AOQA 3SORA 4WWYA 3W94A 3ZVAA 1GG6B 1NU9A 2A4OA 1DXPA 4XFQA 1ANBA 2P59A 1A7SA 3BSQA 1NZQH 1Z71A 3DUXH 4KKDA 5DP7A 2G55A 1TLDA 5G4BA 1CA0B 4JYTA 1MTUA 4ZXYH 4UD9H 4TWWA 1LMWB 4SGBE 1PPGE 2ZCLP 1MTNC 1ZMNA 2V6NA 1HJ9A 1OKXA 4NZLA 4BTUB 4JK6A 3CS0A 3LH3A 4FUFA 3KF2A 1TX8A 2ZC9H 2CV3A 5JBTA 2PKSC 2BX4A 1CT0E 3OY5U 2SNWA 1A2CH 4Y7BA 4NFFA 4NIXA 1ZOMA 5C20A 6LPRA 3MHWU 3A83A 1OWHA 1LVOA 5L2YH 1Z8JB 5JDUB 1MZAA 1Z8IB 1P05A 5A0CA 1DPOA 1B0FA 4O3TA 2PSXA 3MU5A 1OSSA 5BPEA 1QRZA 3AAVA 2KAIA 2ZP0H 2ZU2A 3SUGA 8KME2 3RUOA 1FZZA 2ZGCA 4IMQA 2UWPA 3BN9A 4KGAA 3FAOA 5LPRA 1VITH 1BBRH 1K9OE 1J8AA 3KEEA 1THPB 3BTFE 1P3CA 5EU8A 3SV7A 1K1NA 2HVXA 2GMTB 4NCYA 1W14U 1OYQA 2A5AA 2H9EH 1C2IA 1P06A 1H9LB 3RXJA 1C1MA 2WV4A 1TGTA 3GYLB 3RC6A 1UVTH 2A4RA 2VIDA 3PTBA 1V2ST 1UVPA 4JYVH 4FUDA 1OP0A 1XXFA 1DFPA 1MTNB 1C1WH 3M5NA 3E1XB 3R3GB 1DSTA 2BDGA 1E37B 5GJ4B 1GJCB 3V0XA 1XUJA 1THRH 2Z3CA 2HPQH 2PKSB 3TNSA 1MQ6A 1C2E