5ESTE

Crystallographic analysis of the inhibition of porcine pancreatic elastase by a peptidyl boronic acid: structure of a reaction intermediate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title Crystallographic analysis of the inhibition of porcine pancreatic elastase by a peptidyl boronic acid: structure of a reaction intermediate.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1989-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5estE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5estE01
3SN8A 4Y71A 1NS3A 2QA9E 3KQBA 4ZHLU 2QC2A 1DDJA 4X1RU 5HM9A 2FOAA 2JETC 3E3TA 2ZIQH 2F9BH 2ZFTA 1A5GH 4AFZA 4AB9A 1DLEA 2Y6TA 2A31A 1VJAU 1UCYH 3CS0A 1SSXA 1ELBA 1A4WH 2ZFRH 1DUEA 3DFJA 1GBBA 2H2ZA 2FOHA 1EX3A 4IC5A 3GCTG 1IQJA 2Y5GA 4YT6H 2TGDA 1ZR0A 4ABIA 1SGIB 1RRKA 3L33A 4CRBA 1JOUB 2ZPRA 1YYY1 2FOEA 3T27A 5A09A 4DCDA 1ABJH 2ZHQH 3RXJA 3LPRA 2ASUB 1YCPK 2FODA 3NXPA 3TVJB 3PMBB 4TPYA 3TH3H 2B9LA 1CHOF 3NWUA 1O2SA 1C2EA 1TPPA 1RTFB 1C5WB 1P03A 1V2PT 2VINA 2BD2A 2DE8A 3MU8A 1UO6A 5GPIB 2CHAB 1QB6A 1GGDC 1O2PA 2ZTXA 1BT7A 1ZTLA 5EW2H 1YCPM 1VCPA 1GBKA 1BTXA 1AKSB 4INKA 1YPHC 4KP0A 3SU1A 1N1LA 1GDNA 1BTYA 2ZECA 3KEEA 3KF2A 1SHYA 3VEQB 1VCQA 1S81A 1MU8B 1BMNH 1NTPA 8ESTE 2EA3A 3LC5A 1P9UA 2ZHFH 1THPB 1ZJDA 1BBRE 2ZG0H 3R0FA 3RXHA 3SBKA 1EQ9A 3GCTF 3ZVEA 1THRH 3P95A 2ZFPH 1K1LA 3ZVAA 4BXWA 2VH0A 1FNIA 4UD9H 4WMEA 1ZSJA 1EATA 2RA3A 1TBZH 3V3MA 3ZZ5A 1ELDE 2ZF0H 3ODFA 1XVOA 2ANMH 2UUFB 2BQ7B 1OWIA 4ABGA 4MTBA 1QBVH 1OXGA 5DP8A 3ZVGA 1NRSH 3SI3H 3ITIA 1TX8A 4WVPE 4BTUB 1EJMA 1JWTA 3VB3A 5IYTA 2ZPSA 1MQ5A 3H7OA 4Q80A 1C5VA 1ZGVA 5JPMH 1LKAA 3RLYH 1MKWH 9ESTA 4K69A 1EAIA 2FM2A 4KTUA 4ZXYH 3RU4T 3T28A 1GI0A 1FY3A 3KHVA 2GTBA 1CBWC 2THFB 3AW1A 4UDWH 4X8TH 4X2YA 1JMOH 3BEFB 4YZUA 2A7HA 5EPYA 2OC8A 3SNCA 1BUIA 3A8AA 5EXMA 5GDSH 1K1MA 3TJUA 5C20A 3A7YA 1Y3WA 4HI3A 2P93A 9LPRA 1WTHD 1RXPA 1C1MA 1TNJA 2Z3EA 3A8CA 4K3JA 1GPZA 3JZ2B 1KSNA 3LONA 3FP8E 1IQNA 1GMDF 1K9OE 1O5BB 3B8JA 4JZ1A 1OPHB 3PYHA 2I6QA 1MTSA 5L30H 3VB6A 5EGMA 4Y6DA 2ZHWH 1SC8U 6CHAB 5EG4A 5C5NA 1C4Y2 1C5SA 4B2BA 5C67A 1PQ7A 1H8IH 1MKXH 2BQ6B 4BAQB 7GCHG 1SQAA 2FP7B 3BTWE 3FVFB 1C5UA 3SU5A 1OYQA 3EGKH 3VB4A 1NT1A 1QB1A 2WV4A 4CR5A 4XFQA 3M7TA 2FXRA 1TPOA 1GI4A 2A2QH 1P57B 5F6MA 5IDKA 3LGYA 1Z8IB 4WY3A 1TWXB 3SU6A 1C1SA 2BXUH 1C1WH 3RM2H 3TK9A 1A5IA 1CQQA 5L2YH 1EJAA 1DXWA 1TE0A 2ZP0H 3RXEA 2A0QB 3SHAH 1LTOA 3LJOA 1P2IA 4K1EA 2FTMA 2Z9JA 3T29A 1ELFA 3RXCA 1MQ6A 1Z1JA 1ARCA 1NRNH 1QQ4A 2ZI2H 4I31A 1SGDE 3L3TA 3RXAA 1DT2A 2VVCA 3BTQE 3UR6A 1FN8A 1GCDA 1XKAC 1BRBE 1LHDH 1QBNA 1HNEE 1GG6C 3RXFA 4AZ2B 2BY5X 5J4QA 1BA8B 1C2KA 4ABFA 4X6OA 5DO4H 3S9CA 3OYPA 1L4ZA 3Q00A 1O5AB 2GX4A 1A0HB 4DIHH 1FUJA 4B73A 1FPCH 1DITH 5JBCS 2KAIB 1GDUA 1P11E 5C3NA 1HBTH 2AFQB 3E16B 3M3SA 2CV3A 5F8ZA 1MD7A 1C2FA 1UCYE 2VIPA 7GCHF 2PWXA 3MH7A 5GJ4B 1P04A 3TK5A 4B1TA 1MMJN 4KKDA 4E06H 2H9EH 3UNSA 1M9UA 3PTNA 6LPRA 2Z7FE 1H4WA 2C8XB 1FJSA 2RA0A 4DW2U 1O2HA 2XBXA 1SBWA 1E36B 1O2OA 1SHHB 2BLWA 1LQEA 1VITH 4SGAE 1SGYE 2ODYB 3UREA 1D4PB 4Z6AH 5AFYH 3SGQE 1KLTA 1DLKB 1GCTC 3ESTA 4X1SU 4XE4A 2ZCKP 3PM3A 3SU0A 3BTKE 2ODQA 1CO7E 4OS2A 3LT3A 4E7NA 1GJBB 2J95A 1EPTB 2W7SA 3LGIA 1YGCH 3GOVB 3MH4A 3SU4A 3ZZDA 4A5TS 4IW4E 1P09A 2OXSA 1IQIA 1LPGB 1LHCH 2A1DB 1GVLA 1CT2E 3RXLA 3A82A 3F68H 1T4UH 1OP0A 1V2LT 2CF9H 1KDQB 3ZVFA 1GHAG 3HKIB 3FANA 2WINI 5LPFA 3TJNA 3MI4A 3A81A 4NCYA 4ZHMU 5C1XA 1HAPH 1TPSA 5A8YA 1A5HA 4ZROA 4GHTA 4BAMB 3UUZA 1MBQA 3T62A 1GBJA 3KCGH 1T8LA 1TX7A 5EU8A 1NPMA 1K28D 1O2RA 2FLRH 1GI5A 1Y3XA 4JYVH 1KTSB 4K8YA 5DP4A 4YOGA 1W2KH 5JB8S 1NFWA 1V2RT 5GIBA 5FX6A 3K6YA 2ESTE 2VH6A 1DPOA 1HXFH 4CRFA 4FU9A 1QTFA 1QRWA 4ZXXH 1SFQB 4NIWA 4ISIH 2GCTB 2A7CA 3HK6B 4U32A 2HWLB 1KDQA 3HGPA 1BMAA 2ZGBH 3ZZ3A 1PYTC 3A84A 2G8TA 4JCNA 2BDAA 4AYVB 2NU1E 2FIRH 1AB9C 1FQ3A 1TGBA 2FI3E 4WXVA 5JB9S 1TRNA 3GCHC 2OC7A 3OY5U 2QGRA 3FAOA 4BAOB 1DY8A 5DJ7A 4BXSA 1UK3A 2P94A 1Y59T 3DD2H 2BDBA 4D76A 2ZDVH 5SGAE 1GHAF 3A7XA 2ZU4A 1GBCA 3W94A 1BIOA 2JKHA 3UNRA 1OYTH 1V3XA 1ORFA 7KMEH 2ZGHA 1S82A 4B2AA 1D6RA 2P95A 1FXYA 2PKAB 3UIRA 2NU2E 1F5RA 2A45B 1TOMH 1WQSA 4GSOA 1C5YB 1AUTC 1MU6B 4X0WU 4AB8A 1ARBA 2O8UA 1FDPA 3K2UA 1BJUA 3SNDA 5FCKA 1HIAA 1AWHB 1FIWA 1HAIH 4YLQH 1TX6A 3Q77A 5DP5A 1F2SE 3U8RH 1AFQB 1D3QB 3RC6A 4A92A 3QUMP 1UHBB 2ZU5A 4LZ4B 1GI1A 2FTLE 1YPGH 1P2NA 4CRCA 1NC6A 2HRVA 1WTGH 2QY0B 5LPEA 3GCOA 4LZ1H 3LGTA 1SGRE 1K22H 4CRDA 7LPRA 4H6SB 4NIXA 1GI9B 2WPLS 1QIXB 3SJOA 1O2UA 2ZDLA 1L0ZA 5CE1A 3SW2B 2A32A 2EI7A 1HAYB 3UWIA 1IQEA 3RXMA 4IC6A 3BEIB 3P8FA 1HPGA 3ZYEA 3MU1A 1LKBA 2YNAA 3B9FH 2IOTA 2LNCA 3E1XB 4UFEH 1P2KA 1T7CA 1SVPA 2ZDNA 2GKVE 3BTFE 4X2WA 3RMOH 2J92A 4GLYA 2ANYA 2TGAA 2J9NA 3BTGE 1O3DA 4ZUHA 1MTNB 2P16A 1ZRKA 1NN6A 1UHBA 2BVSH 2J38A 5C2ZA 1P10A 1AVGH 3RXRA 3UOUA 1A3BH 3D62A 2BDCA 4K60A 1DSUA 3SJ8A 4A1VA 3PWCA 8LPRA 4INHA 1BB0B 1BDAA 1SGCA 2VWOA 3DHKH 4ZAEA 4XBDA 4RKOB 1GI2A 1S6HA 2M5TA 6CHAC 5HGGA 4Y8YA 1IQKA 2H9TH 1A46H 1HB0B 1ELVA 1UTNA 1O2IA 2OD3B 2QIQA 3PO1C 2JH5D 1P05A 2CXVA 4I8GA 1AVXA 4CRGA 5GCHF 1TGNA 4NIVA 2C3SA 2NU0E 1MD8A 2Z6BD 1P2OA 1X7AC 1C2LA 3A87A 3V7TA 3E0NB 5A8ZA 1TRMA 4ISLA 1Y5BT 1YPLH 2G51A 5FXLA 2BZAA 1AZZA 4GHQA 1AMHA 5C5OA 1TB6H 4Y7AA 1AHTH 1GHWH 4AYYB 1F0SA 4E05H 3F9EA 2PUXB 2XBVA 3QO6A 1HV7A 2BD9A 2R2MB 3TLOA 2C90B 2FMJA 3UWJH 3SNAA 3UNQA 4WMFA 4ZKNU 1HJAC 2FDAA 1Y5UT 4BOHA 1FN6A 1HAHH 3ENSB 1UTJA 3BN9A 3RUOA 1JRSA 3SV9A 1DWDH 4NWLA 2J2UA 1KXEA 3P8NA 1KY9A 3TU7H 5DP9A 1EZQA 2XWBI 5DP7A 1QR3E 1ZMLA 5EXNA 1QJ7B 1K21H 1V2MT 1HUTH 1RIWC 3QGJA 3UTUH 2O8TA 3MNBA 1OKXA 2FESH 1L1GA 1Y3VA 3HK3B 2AS9A 2QCYA 5HXFA 1F0TA 5G4BA 2BTCE 1P12E 1EAWA 1QCPA 4TYDA 4Y10E 5A0BA 1RGQA 1HLTH 2BQWB 2YNBA 1XUIA 3SUFA 4DY7B 2WYJA 2BD4A 3IWMA 4AG1A 3MNCA 3RDZA 1EXFA 4NZLA 2GDDA 2P8OB 2VU8E 3LKWA 2XBYA 2OLGA 1XMNB 2V35A 4X2VA 1TMUH 1DM4B 4FVDA 1BZXE 1KXBA 1V2WT 5HM2A 4WMDA 4A1XA 2H6MA 1K1NA 2HNTE 4AGJA 2PFEA 4ISOA 2B8OH 3SOSA 4CHAC 4AFUA 1TIOA 1L1NA 1C4V2 3MFJA 1V6DA 5EQQA 3Q3KA 1FPHH 1UMAH 3ATWA 4B2CA 1XUFA 2BOKA 2VVVA 5JBAS 5LPRA 4MG3A 2BD7A 4WWYA 1XUGA 1AE5A 3AASA 1P02A 3SHCH 1RJXB 3MNXA 2BOHB 1PPZA 1J9CH 2UWLA 1A2CH 3LIWA 1AO5A 2BY7X 1P0SH 1BCUH 1O34A 1C9PA 1S6FA 5DKMA 3SV7A 1GJ4H 3STJA 1XM1A 4WJG2 2Z9GA 3TNSA 5DP3A 4B75A 2J34A 3MU5A 4KELA 2VVUA 3M37A 4FU7A 3RXPA 1GJCB 2NU3E 2XTTB 1AGJA 2A4OA 1XVMA 1ETSH 3ZYDA 3CS7A 1GDQA 3ATKA 2FWWA 5FPSA 1CGIE 1DX5M 3GDSA 1KYNA 2Q6FA 1DE7H 2GV6A 2A4RA 5JDUB 3ATLA 1PPHE 2UWPA 3BTHE 5B6OA 1OWKA 3E91A 1ELCA 1IQFA 1O30A 2VJ1A 2WPKS 1CGHA 1GHZA 3MO6A 1W14U 1QJ6B 2TRMA 1W12U 2LPRA 2HPPH 1JBUH 1NROH 3HPTB 4H4FA 2UUKB 2RDLA 1C2JA 1K1JA 1IQMA 1TNHA 2XCFA 2K1QA 2PV9B 2FOCA 1QQUA 3C27B 4X1QU 3UY9A 1ZHMA 1AKSA 1AUJA 1A1RA 2FPZA 1C1QA 1WYKA 3EA9A 2ZZUH 2SGEE 4OGYA 1HJ8A 2C8ZB 2ZFQH 3F9HA 1LMWB 4A6LA 4AORA 2FOBA 3SI4H 4FUIA 5TCAA 1K1PA 1FONA 1QHRB 3LOXA 5K7RA 1Z8GA 4Y11E 3A7TA 4U01A 1F5KU 5DPAA 3RMMH 1OWHA 4UFGH 2J94A 2IN2A 4HZHA 3A7VA 3MMGA 3MO9A 1CSOE 3RXQA 3ATMA 1RS0A 1G37A 2OBOA 5FAHA 1F5LA 1OWJA 1CHGA 2XC4A 1C5TA 4DG4A 3S7KB 2NWNA 4X1NU 1G30B 3VXFH 1C5NH 1GMHG 2ZU3A 4YLUA 1PPFE 1C5ZB 3RXSA 1KLJH 1UVUH 2ZDKA 3BTTE 3V13A 1IHSH 2Z9KA 2I6SA 1W0YH 1TALA 3QZQA 4OGXA 2WYGA 1Y3UA 5T3HA 1FY5A 2G00A 4HFPB 2JH0D 4WF8A 1YPMH 4D7FA 2TBSA 4GVUA 4UFDH 1U6QA 1VJ9U 2D8WA 4I8HA 5L2ZH 2VIVA 1GI8B 4DOQA 1QA7A 1ELGA 4AOQA 3DFLA 2BDHA 2ZGCA 2ZFSA 1VITG 1Z8JB 4MNXA 2GCHG 2ODPA 2Z9LA 2B7DH 3E8LA 1V2KT 1OP8A 1A61H 1AU8A 1HAZB 5E0GA 1XUKA 3ZVDA 3TNTA 4ABEA 2PKSC 3ZZ7A 4B76A 2ZA5A 1SLVB 4IN2A 2SGPE 1YCPH 2ZU2A 4I32A 1QJ1B 2P3UB 2CN0H 3P70B 2QF0A 1AD8H 1V2OT 3SNBA 3VGCC 2PW8H 2J4IA 2FLBH 2F83A 5J4SA 1D6WA 5EXLA 2AGIX 2AMPA 4MVNA 1GBFA 1UTOA 1VGCB 1QGFA 4CBOA 1DS2E 4OS1A 1GI6A 3RXUA 4FUEA 5DGJA 1GJAB 5EW1H 1BQYA 4O3UA 2FYRA 1SLWB 2PGBB 3OY6U 2BX3A 1G2MA 2QAAA 1ELTA 5FBIA 1GJDB 1P3CA 3FP6E 1A3EH 1O36A 1N8OC 4OS5A 2PSXA 1P01A 3ZZCA 1O3CA 1ZYOA 3D23A 1HXEH 3GICB 2FO9A 1GVKB 3BG4C 4VGCC 2A5IA 4PROA 4O03A 4AFSA 4INLA 4YOIA 1VITF 1HAXB 2GCHF 3TJVA 4ABJA 4JK6A 2VGCB 4BNRA 1W13U 3QGNB 1GWAA 2A4QA 1SLXB 4GCHG 1GJ5H 4JMYA 1BBRK 3SORA 3BTME 1S5SA 1D9IA 6GCHG 1NRPH 2C8WB 1O37A 4XDEA 1IAUA 1LHEH 3E0PB 3UR9A 1O2JA 2KAIA 1Z8RA 2C8YB 3MWIU 1DY9A 1PFXC 1PQ8A 2QYIA 1DUAA 2ILNA 2F9VA 2GMTC 2ZGJA 2EEKA 1HDTH 4GPGA 1HGTH 2P3TB 4X8VH 1KXAA 1N6YA 4HGCA 3SGAE 1ESAA 5A0AE 1CA0B 1B0FA 4ABAA 3KL6A 3RMLH 5EODA 1V2QT 2AIPA 1P8VC 3KN2A 2PUQH 1TQ0B 3P6ZB 3URCA 2F9NA 3DUXH 1O2MA 2PTNA 4I33A 4RSPA 3SV8A 3P8OA 2P8OC 1EOLA 2EI8A 1T8NA 3FZDA 2ZHEH 1E37B 1Y5AT 1GVZA 1W10U 1EPTA 1C5LH 3MOCA 1B7XB 3RM0H 1PJPA 2C4FH 3QLPH 3A7WA 3AVZA 1SB1H 1EUFA 2D26C 1NO9H 1RTKA 1LPZB 1UVPA 1WBGB 4F49A 4GCHF 1SQTA 3FP7E 1TFXA 2AMQA 1NFYA 3NPSA 2V6NA 3EA8A 3AAUA 4NA8A 2ALVA 2P59A 3PLKA 1PQ5A 3RXTA 3U1IB 1WU1A 3BSQA 3SUEA 2HNTF 2HALA 3Q3XA 3GY8A 3T5FH 1YPEH 3SU2A 1O2LA 3TH2H 1G3EA 1SGEE 1SGNE 1O2GH 5H4IB 2G5NA 3F9FA 2CHAC 1P06A 3PB1E 1NU9A 4IS5A 5JYIA 1GHXH 1BTZA 5FPTA 1TRYA 2BYAX 1MAYA 1GBIA 2BZ6H 3PLBA 2SGAA 1FMGA 1H9HE 1OP2A 3EAJA 3KQCA 2ZTZA 4XBCA 2P3FH 1DWEH 1O3IA 3I77A 1NU7B 1CT0E 4FUBA 2CJIA 3H5CB 2QV1A 3ZVBA 1B5GH 1BRUP 3MNSA 2GT8A 2RCEA 2FOGA 3ZVCA 6ESTA 2HVXA 3SUDA 1GBTA 1PPEE 1YBWA 2XNIA 4DT7B 4H6TA 4U2WA 1GBHA 4IMZA 2ZQ2A 1J8AA 5DP6A 2BHGA 4Q7YA 4D7GA 1C1NA 4Y79A 1K1OA 3TJOA 1QBOA 2FZZA 4YT7H 3LGWA 1LQDB 2GD4B 3PTBA 4GUXA 4MPUA 3BF6H 3K9XB 1S0RA 2ZNKH 3GY7A 3OSYA 1SPJA 2WPHS 3PMJA 1ACBE 1O2XA 1GBAA 2PKAA 1ZZZA 1UCYK 1YPJH 3O8RA 2GP9B 2WUBA 4FUFA 1VZQH 1IHTH 1C2DA 5A0CA 1DANH 1DWCH 1W8BH 1EKBB 5LGOA 1H9IE 1D3PB 2XXLA 5FPYA 2BB4A 1THSH 1F0RA 1BTUA 1NRRH 1FZZA 1OS8A 1YPHE 3KQEA 3TGIE 3A83A 5FX5A 1SGQE 1W7XH 3BG8A 3U69H 1LVBA 3PMAB 1GJ9B 3ZV8A 2AH4X 1UVSH 5CMXH 4J2YB 1ANDA 1AY6H 2BLOA 2BLVA 8GCHG 3GY3A 3OTJE 1HRTH 4B71A 4TY6A 1BHXB 2XWAA 1V2VT 5AFZH 4ZKOU 4H42U 2FEQH 1EAXA 2AMDA 2B5TB 2PHBA 1AFEH 1Z71A 2RG3A 4AN7A 3P17H 5BRRE 3O8DA 2FI4E 1RFNA 2ZCHP 1GL0E 4KGAA 3T26A 1Q3XA 5E0HA 4X8UH 1TGSZ 1SG8B 2Q6GA 1TBQH 4BTTB 1XKBC 2BVRH 2AIQA 3ODDA 3ZV9A 2F3CE 4NA9H 1DXPA 2HPQH 2VWNA 4ZKRU 4CH2B 4TWWA 3LGUA 3Q76A 3L6PA 3VXEH 4QT8C 2HGTH 5BPEA 3ZZ9A 3V12A 1ZGIA 1A0JA 1LDTT 3NZIA 1D3DB 2BDIA 5C1YA 4RKJB 1EZSC 1FLEE 4TPIZ 2V0BA 2HOBA 4Y7BA 5JBTA 4WH8A 2OINA 1C5OH 5TJXA 4K8BA 2STBE 3A8DA 8GCHF 1O5EH 3P92A 1G3DA 4JZDH 2ZPQA 1ZMNA 2BD5A 3EDXB 3AW0A 3RLWH 1MZDA 1MTWA 3ZZAA 3QWCH 7ESTE 1DFPA 1MKWK 2WPJS 2TGPZ 3NKKA 3M7UA 1C2HA 1XX9A 2W3IA 1GCTB 4R0IA 4ABDA 1MAXA 3BV9B 1H1BA 3QX5H 4K1TA 3UPEA 1GBMA 3RXVA 1PQAA 2BXTH 4TWYA 1BTHH 4NG9H 4O97A 1J16A 3S9AA 4F4OC 4YOJA 1S0QA 1YF4A 2W26A 2GZ9A 1YKTA 4MQAA 1QFKH 1C1VH 3QZRA 4Q2KA 4FUJA 1TAWA 1O2QA 1V2UT 1C5XB 1TMTH 2XBWA 4ZKSU 4NWKA 4XBBA 4I7YH 3IITA 4J1YA 4JZFH 3I78A 4FUHA 5DK1A 2IPHA 1ZOMA 5AHGH 1GBDA 1SL3A 2OC0A 2XYAA 1E38B 2ZC9H 1AZ8A 4OS4A 2ZCLP 1SQOA 1NFXA 2FI5E 2D1JA 1KXDA 3CENA 1NFUA 1J17T 1EPTC 1YPKH 1DOJA 1FV9A 2Y5HA 1ANEA 1BRAA 4UFFH 1MKXK 5K0HA 1ZSKA 1CT4E 3NCLA 1O3KA 1EZXC 3UOPA 4DVAU 1KLIH 4MNYA 1TNKA 3O8CA 3MHWU 5I46H 1EASA 4X6PA 1TYNA 3S0NA 5E2OA 1Z1IA 4YM9A 4ASHA 4JZEH 1MTVA 1O3GA 1CA0C 2O9QA 4FXGH 2OQ5A 3ZZBA 2A7JA 2JH6D 3U1JB 1SFIA 2AYWA 2DUCA 2H1UA 2W7UA 2VWLA 4IN1A 2AEIH 1O3NA 4HTCH 4AG2A 5L6NH 1DVAH 1AB9B 1J15A 1EZUC 1MUEB 2V3HH 2Z9IA 4ZH8A 1HCGA 2Y81A 5TCCA 2ZTYA 3GCHB 3LC3A 1A0LA 1WUNH 2ZO3H 1TNLA 1UTQA 5EQRA 1SGPE 1UTLM 4AFQA 3TK6A 4ZMAH 2R9PA 3TIUA 1GI3A 2H9HA 1OOKB 1AN1E 1EJNA 2PGQB 2GCTC 1P3EA 1P2JA 2R0LA 2WPIS 1V2JT 1T8OA 1TABE 4OS7A 2CGAA 4DGJA 2OC1A 3URDA 1ZPZA 2AGEX 3LH1A 2G52A 1XXFA 2AERH 3A89A 3GISB 4YO9A 1T8MA 2GVFA 3W95A 1LPKB 2VWMA 4MPVA 3M7QA 1N6XA 1UTMA 3KIDU 1WSSH 1LCYA 1MTUA 1WOFA 3RU4E 3HGNA 5AVDA 4AGKA 1GMDG 4D8NA 5E8EH 1O3MA 2Q1JA 4D9RA 1LVYA 1IQHA 1O35A 2GDEH 1AIXH 3EE0B 1JIRA 3UQVA 2IJOB 2BD8A 4I8JA 2G5VA 1ELEE 5T6DA 1BMMH 2ZFFH 1S83A 1QURH 1TA2A 1NM6A 1O2YA 3GDVA 4NZQA 1ZTKA 2VIWA 2ZU1A 2QXHA 3RXBA 3GYLB 3EQ0H 2O8WA 2FS9A 1O39A 1O5FH 1S85A 4DURA 3HATH 3M5OA 2CF8H 4NSYA 5PTPA 4DJZB 2PTCE 3A88A 1S84A 5ESTE 3T25A 3MU4A 3QK1A 3S7HB 1LO6A 3M61U 1TNIA 1LVOA 4TY7A 2BY8X 4MNVA 2TGTA 1A7SA 1MH0A 1EB2A 1BITA 4FUGA 2BDGA 3MO3A 1FY4A 4ZHAA 1B0EA 3PROA 1AFQC 3EA7A 4X6MA 1GL1A 2BVXH 5DG6A 2O8MA 3RXGA 4X8SH 2BLQA 1C1TA 4NIYA 4MPXA 1RD3B 5EOKA 3NK8A 1CVWH 1DWBH 1ABIH 4Y0YE 4LXBH 4Y8XA 3V0XA 3DA9B 4R8TB 1TQ7B 5T6FA 1HFDA 2A5AA 1C2GA 1ZHRA 4FUCA 4JZIA 1G3CA 2TIOA 1CGJE 1V2ST 3MU0A 4K5ZA 3LGVA 4A7IB 1O3EA 4BAKB 3SU3A 1IQGA 3A86A 4FUDA 1LHGH 5CHAB 3PLPA 2OTVA 3TPIZ 1O2KA 1QL8A 1SGTA 1TPAE 1G32B 1O3JA 2ULLA 1C1PA 2WUCA 3JZ1B 1C2MA 3PV4A 4ABBA 1PPCE 1F92A 1NZQH 1O3LA 1MTNC 3PO1B 4BTIB 1GBLA 2F9UA 2PLXA 1O3HA 1O2VA 5HYOA 1PPBH 3K6ZA 3S9BA 1ZRBA 2HLCA 2SNWA 3M35A 4YTAA 1OX1A 1O31A 2BM2A 2OQUA 2UWOA 2AGGX 4CREA 4NFEA 3RP2A 2ANKH 4LOYH 1Q2WA 1KTTB 2EC9H 1G9IE 4D9QA 1W7GH 3FZZA 1GMHF 3LU9B 3M5NA 4CR9A 1WV7H 3QTVH 3RU4D 3GYMA 1H8DH 4O9VA 4ESTE 2G4TA 2HNTC 2WPMS 1MCTA 2VB0A 1H9LB 2BDYA 1O2ZA 1JIMA 3AAVA 3A8BA 1HYLA 1HJAB 2R0KA 4Y0ZE 1TOCB 1SLUB 1KXCA 1O5CB 3CP7A 1FI8A 1E0FD 1JXPA 1GHYH 2YOLA 2FS8A 1EOJA 4GAWA 1K1IA 2F9OA 1O5DH 2PSYA 2UUYA 1P2QA 5E0JA 4CRAA 5AF9H 3BTEE 1BJVA 2DE9A 2SNVA 5ESBA 2STAE 1ANBA 1EB1H 3DT0H 1QRZA 2FOMB 2Z94A 1RIWB 2OCVB 1C5QA 2SGFE 4MPWA 1AI8H 2GZ7A 3U98H 2NU4E 3NUMA 4DIIH 1QB9A 2FX4A 3KNXA 2Z3CA 1FY8E 3OU0A 1W11U 2ZHDA 1ETTH 3RXIA 1GHBG 1WAYB 1WQVH 3MTYA 1PYTD 4BAHB 3H7TA 3KGPA 1IOEA 3T2NA 4B74A 4XOJA 1Z6JH 2ZDMA 2H5CA 2ZDAH 2JETB 4NSVA 1F7ZA 1HAOH 3LDXH 2Y80A 2VIDA 3D49H 4FU8A 3BIVH 2G55A 3BEUA 1SI5H 1K2I1 3OX7U 1DSTA 3O8BA 1C2IA 1TONA 4CHAB 3M5LA 1UK2A 2UUJB 5F8XA 1LHFH 4WXIA 2Y82A 1KXFA 3ZZ6A 1GMCG 2F91A 4NFFA 1ZMJA 4I8LA 2ANWA 1C5PA 4AX9H 3RC5A 1OSSA 2VIQA 3U9AH 1RTLA 2QF3A 2F9PA 1ELAA 3N7OA 3RC4A 3GY4A 5LH8A 3HKJB 3PMHB 3SO3A 1EAUA 1GBEA 3SJKA 1CU1A 1SGFG 1O3OA 2C93B 1O2WA 3RXKA 4UONA 1BHXF 3D65E 1GGDB 1VCWA 2A2XH 2R2WU 5C1UA 1DICA 2XC0A 1ESBA 1CE5A 3RXDA 2FYQA 1OWDA 3SUGA 2Q6DA 2XC5A 2D2DA 5E2PA 1TBRH 1GHBF 2PR3A 6GCHF 8KME2 1G36A 3GDUA 1NY22 2XRCA 1QY6A 3GY5A 1MBMA 2Y7XA 1PPGE 3BTDE 1MZAA 2TPIZ 1QA0A 1XUHA 1Y3YA 4IBLH 3WY8A 4M7GA 1ZJKA 1FIZA 1VR1H 1E35B 2ZKSA 2QN5T 3STIA 4UEHH 5ABWA 3EYDA 1HAVB 4SGBE 5FCRA 3SGBE 1E34B 1KIGH 1TGTA 4ISNA 1HIAB 2V3OH 4I8KA 1GMCF 3PWBA 1QRXA 1BRCE 2W5EA 1C4U2 2R3UA 2BMGB 4Y8ZA 3ELAH 5F03A 2G81E 1Z7KA 4IMQA 1GJ8B 3Q3YA 1UVTH 3SJ9A 2OUAA 4LK4A 1GHVH 4Y76A 2ZWLH 1QL9A 3QTOH 3TGJE 1ID5H 1L1JA 3M36A 1AQ7A 1O3BA 1LVMA 2FOFA 5A2MH 1Z6EA 1GI7B 1O2TA 1O3PB 4Q7ZA 1WCZA 2VIOA 3F1SB 5A8XA 3K65B 1AE8H 1T4VH 2A4GA 1O3AA 1ZSLA 1CBWB 1JRTA 3ZZ8A 1C5RA 1P2MA 4A1TA 2H5DA 2BY9X 3LH3A 1ZPBA 5EPNA 1HAVA 1GJ7B 1EP6A 3C1KA 2XCNA 3IG6B 5GXPA 3GY6A 5EQSA 3VB5A 2R3YA 3QN7A 4MLFB 1ESTA 3SJIA 1O2NA 4BANB 1NRQH 3MYWA 3U8TH 2SGDE 1IQLA 4THNH 1YM0A 1BTPA 1SMFE 1NESE 1W0ZU 1YLDA 3QDZB 1BBRH 3KQDA 4WH6A 4FVBA 4X6NA 3M3TA 2FX6A 2ZGXH 5GCHG 2Y7ZA 1CA8B 3SV6A 2CMYA 4CH8B 5HMAA 3TGKE 1Y8TA 1ETRH 1ZPCA 3VB7A 4NGAH 1J14A 1BTWA 3GCNA 4OS6A 1GJ6A 1L4DA 5T6GA 1T32A 3A7ZA 2ZEBA 3P8GA 1ANCA 1XXDA 2B0FA 4MDSA 1G3BA 1V2NT 3LJJA 1Q31A 2VNTA 1C1OA 3F9GA 1UK4A 2ZQ1A 4ABHA 3UQOA 5FBEA 2PKSB 3E90B 1HJ9A 1BMLA 1FAKH 4Q7XA 3F6UH 4Z0KA 3A80A 4NA7A 1TNGA 1V2TT 1YP9A 5JBBS 3VGCB 3BIUH 1AVWA 1UTKA 5FHTA 2GZ8A 4JYTA 3TH4H 5F8TA 1GG6B 3M3VA 5CHAC 3SQHE 2XW9A 4ISHH 4XSKU 1UJ1A 2GT7A 4KTSA 1TMBH 2GV7A 3VPKA 1O0DH 4U30A 3I29A 3MH6A 3B23B 1C5MD 1W3CA 2OBQA 3S69A 3SZNA 2G4UA 2OP9A 3R3GB 4K2YA 1P9SA 3FFGA 1ZTJA 2ALPA 1FY1A 4JK5A 5GWZA 3U8OH 3SV2H 1N8OB 3SQEE 2QXIA 2BD3A 1AWFH 1ZLRA 2QXJA 1HAGE 1VGCC 3BG4B 4VGCB 4K1SA 4MNWA 4UE7H 4YESB 3RMNH 1UTPA 1C1RA 2A5KA 4X1PU 1XUJA 1MCVA 3A85A 1UVOA 2WV5A 1O33A 1C9TA 1SOTA 1G2LA 3SNEA 4E7RG 2Y5FA 1QNJA 3TITA 3VFEA 2BY6X 5I25A 3GY2A 1EP5A 1TA6A 1TGCA 4KTCA 3G01A 3UFAA 2GGVB 4IGDA 1QL7A 1YC0A 3MH5A 1SOZA 4O3TA 2EI6A 3RXOA 1SR5C 1D3TB 4CBNA 4RN6A 2O8LA 3M5MA 1YLCA 1CHOG 1O38A 1T31A 1ZHPA 1O32A 2GMTB 2Z3DA 3ZZ4A 1O3FA 1SGFA 3E6PH 4JYUH 1TLDA 2VGCC 2W3KA 4X2XA 1FAXA 1OWEA 2BX4A 1O5GH 5ETXA 1BOQA 1INCA 1F0UA 1C1UH 2SGQE 1L2EA 2QXGA 2SFAA 3ATIA
chains in the Genus database with same CATH superfamily
3SN8A 4Y71A 1NS3A 2QA9E 3KQBA 4ZHLU 2QC2A 1DDJA 4X1RU 5HM9A 2FOAA 2JETC 3E3TA 2ZIQH 2F9BH 2ZFTA 1A5GH 4AFZA 4AB9A 4RI0A 1DLEA 2Y6TA 2A31A 1VJAU 1UCYH 3CS0A 1SSXA 1ELBA 2JJ2D 1A4WH 2ZFRH 1DUEA 3DFJA 1GBBA 2H2ZA 2FOHA 1EX3A 4IC5A 3GCTG 1IQJA 3F3BA 2Y5GA 4YT6H 2TGDA 1ZR0A 4ABIA 1SGIB 1RRKA 3L33A 4CRBA 1JOUB 2ZPRA 1YYY1 2FOEA 3T27A 5A09A 4DCDA 1ABJH 2ZHQH 3RXJA 3LPRA 2ASUB 1YCPK 2FODA 2QF4A 3NXPA 3TVJB 3PMBB 4TPYA 3TH3H 2B9LA 1CHOF 3NWUA 3N7DA 1O2SA 5C0TA 3F0OA 1C2EA 1TPPA 1RTFB 1C5WB 1P03A 1V2PT 2VINA 2BD2A 2DE8A 3MU8A 1UO6A 5GPIB 2CHAB 1QB6A 1GGDC 1O2PA 2ZTXA 1BT7A 1ZTLA 5EW2H 1YCPM 1VCPA 1GBKA 1VKYA 1BTXA 1AKSB 4INKA 1YPHC 4KP0A 3SU1A 1N1LA 1GDNA 1BTYA 2ZECA 3KEEA 3KF2A 1SHYA 3VEQB 1VCQA 1S81A 1MU8B 1BMNH 1NTPA 8ESTE 2EA3A 3LC5A 1P9UA 1S6LA 2ZHFH 1THPB 1ZJDA 1BBRE 2ZG0H 3R0FA 3RXHA 3SBKA 1EQ9A 3GCTF 3UAIC 3ZVEA 1THRH 3P95A 2ZFPH 1K1LA 3ZVAA 4BXWA 2VH0A 1FNIA 4UD9H 4WMEA 1ZSJA 1EATA 2RA3A 1TBZH 3V3MA 3ZZ5A 1ELDE 2ZF0H 3ODFA 1XVOA 2ANMH 2UUFB 2BQ7B 1OWIA 4ABGA 4MTBA 1QBVH 1OXGA 5DP8A 3ZVGA 1NRSH 3SI3H 3ITIA 1TX8A 4WVPE 4BTUB 1EJMA 1JWTA 3VB3A 5IYTA 2ZPSA 1MQ5A 3H7OA 4Q80A 1C5VA 1ZGVA 1EFRD 5JPMH 1LKAA 3RLYH 1MKWH 9ESTA 2J98B 4K69A 1EAIA 4Z1MD 2FM2A 4KTUA 4ZXYH 3RU4T 3T28A 1GI0A 1FY3A 3KHVA 2GTBA 1CBWC 2THFB 3AW1A 4UDWH 3FO8D 4X2YA 1JMOH 4X8TH 3BEFB 4YZUA 2A7HA 5EPYA 2OC8A 3SNCA 1BUIA 3A8AA 5EXMA 5GDSH 1K1MA 3TJUA 5C20A 3A7YA 1Y3WA 4HI3A 2P93A 9LPRA 1WTHD 1RXPA 1C1MA 1TNJA 2LP6A 2Z3EA 3A8CA 4K3JA 1GPZA 3JZ2B 1KSNA 3LONA 3FP8E 1IQNA 1GMDF 1K9OE 1O5BB 3B8JA 4JZ1A 1OPHB 3PYHA 2I6QA 1MTSA 5L30H 3VB6A 5EGMA 4Y6DA 2ZHWH 3OEED 1SC8U 6CHAB 5EG4A 5C5NA 1C4Y2 2EQNA 3ZIAD 1C5SA 4B2BA 2WZQA 5C67A 1PQ7A 1H8IH 1MKXH 2BQ6B 4BAQB 7GCHG 1SQAA 2FP7B 3BTWE 3FVFB 1C5UA 3SU5A 1OYQA 3EGKH 3VB4A 1NT1A 1QB1A 2WV4A 4CR5A 4XFQA 3M7TA 2FXRA 1TPOA 1GI4A 2A2QH 1P57B 5F6MA 5IDKA 3LGYA 1Z8IB 4WY3A 1TWXB 3SU6A 1C1SA 2BXUH 1C1WH 3RM2H 3TK9A 1A5IA 1CQQA 5L2YH 1EJAA 1DXWA 1TE0A 2ZP0H 3RXEA 2A0QB 3SHAH 1LTOA 3LJOA 1P2IA 4K1EA 2FTMA 2Z9JA 3T29A 1ELFA 3RXCA 1MQ6A 1Z1JA 1ARCA 1NRNH 1QQ4A 2ZI2H 4I31A 1SGDE 3L3TA 3RXAA 1DT2A 2VVCA 3BTQE 3UR6A 1FN8A 1GCDA 1XKAC 1BRBE 1LHDH 1QBNA 1HNEE 1GG6C 3RXFA 4AZ2B 2BY5X 3F2HA 5J4QA 1BA8B 1C2KA 4ABFA 4X6OA 5DO4H 3S9CA 3OYPA 1L4ZA 4M9FA 3Q00A 1O5AB 2GX4A 1A0HB 4DIHH 1FUJA 4B73A 1FPCH 1DITH 5JBCS 2KAIB 4ACAA 1GDUA 1P11E 5C3NA 1HBTH 2AFQB 3E16B 3M3SA 2CV3A 5F8ZA 1MD7A 1C2FA 1UCYE 2VIPA 7GCHF 2PWXA 3MH7A 3DSOA 5GJ4B 1P04A 3TK5A 4B1TA 1MMJN 4KKDA 4E06H 2H9EH 3UNSA 1M9UA 3PTNA 6LPRA 2Z7FE 1H4WA 2C8XB 1FJSA 2RA0A 4DW2U 1O2HA 2XBXA 1SBWA 1E36B 1O2OA 1SHHB 2BLWA 2WHXA 1LQEA 1VITH 2YMSB 4SGAE 1SGYE 2ODYB 3UREA 1D4PB 4Z6AH 5AFYH 3SGQE 1KLTA 1DLKB 1GCTC 3ESTA 4X1SU 4XE4A 2ZCKP 3PM3A 3SU0A 2AHME 3BTKE 2ODQA 1CO7E 4OS2A 3LT3A 4E7NA 1GJBB 2J95A 1EPTB 2W7SA 3LGIA 1YGCH 3GOVB 3UB0A 3MH4A 3SU4A 3ZZDA 4A5TS 4IW4E 1P09A 2OXSA 1IQIA 1LPGB 1LHCH 2A1DB 1GVLA 1CT2E 3RXLA 3A82A 3F68H 1T4UH 1OP0A 1V2LT 2CF9H 4HG6A 1KDQB 3ZVFA 1GHAG 3HKIB 3FANA 1W0JD 2WINI 5LPFA 3TJNA 3MI4A 3A81A 4NCYA 4ZHMU 5C1XA 1HAPH 1TPSA 5A8YA 1A5HA 4ZROA 4GHTA 1UW7A 4BAMB 3UUZA 1MBQA 3T62A 1GBJA 3KCGH 1T8LA 1OHHD 1TX7A 5EU8A 1NPMA 1K28D 1O2RA 2FLRH 1GI5A 1Y3XA 4JYVH 1KTSB 4K8YA 5DP4A 4YOGA 1W2KH 5JB8S 1NFWA 1V2RT 5GIBA 5FX6A 3KQ5A 3K6YA 2ESTE 2VH6A 1DPOA 1HXFH 4CRFA 4FU9A 1QTFA 1QRWA 4ZXXH 1SFQB 4NIWA 4ISIH 2GCTB 2A7CA 3HK6B 4U32A 2HWLB 1KDQA 3HGPA 1BMAA 2ZGBH 4DT4A 3ZZ3A 1PYTC 3A84A 2EY4C 2G8TA 2BDAA 4JCNA 4AYVB 2NU1E 2FIRH 2KR7A 1AB9C 1FQ3A 3OFND 1TGBA 2FI3E 4WXVA 5JB9S 1TRNA 3GCHC 2OC7A 3OY5U 2QGRA 3FAOA 4BAOB 1DY8A 5DJ7A 4BXSA 1UK3A 2P94A 1Y59T 3FKSD 3DD2H 2BDBA 4D76A 2ZDVH 5SGAE 1GHAF 3A7XA 2ZU4A 1GBCA 3W94A 1BIOA 2JKHA 3UNRA 1OYTH 1V3XA 1ORFA 7KMEH 2ZGHA 1S82A 4B2AA 1D6RA 2P95A 1FXYA 2PKAB 3UIRA 2NU2E 1F5RA 2A45B 1TOMH 1WQSA 4GSOA 1C5YB 1AUTC 1MU6B 4X0WU 4AB8A 1ARBA 3SZEA 2O8UA 1FDPA 2KZ4A 3K2UA 1BJUA 3SNDA 5FCKA 1HIAA 1AWHB 1FIWA 1HAIH 4YLQH 1TX6A 3Q77A 5DP5A 1F2SE 3U8RH 2CK3D 1AFQB 1D3QB 3RC6A 4A92A 3QUMP 1UHBB 2ZU5A 4LZ4B 1GI1A 2FTLE 1YPGH 1P2NA 4CRCA 1NC6A 2HRVA 1WTGH 2QY0B 5LPEA 3GCOA 4LZ1H 3LGTA 1SGRE 1K22H 4CRDA 7LPRA 4H6SB 4NIXA 1GI9B 2WPLS 1QIXB 3SJOA 2KX4A 1O2UA 2ZDLA 1L0ZA 5CE1A 3SW2B 2A32A 2EI7A 1HAYB 3UWIA 1IQEA 3RXMA 4IC6A 3BEIB 3P8FA 1HPGA 3ZYEA 3MU1A 1LKBA 2YNAA 3B9FH 2IOTA 2LNCA 3E1XB 4UFEH 1P2KA 1T7CA 1SVPA 1E79D 2ZDNA 2GKVE 3BTFE 4X2WA 3RMOH 2J92A 4GLYA 5HKKD 2ANYA 2TGAA 2J9NA 3BTGE 1O3DA 4ZUHA 1MTNB 2F4LA 2P16A 1ZRKA 1NN6A 1UHBA 2BVSH 2J38A 5C2ZA 1P10A 5HIZA 1AVGH 3RXRA 3UOUA 4RT0A 1A3BH 3D62A 2BDCA 4K60A 2W6JD 1DSUA 3SJ8A 4A1VA 3PWCA 8LPRA 4INHA 1BB0B 1BDAA 1SGCA 2VWOA 2M2AA 3DHKH 4ZAEA 4XBDA 4RKOB 1GI2A 1S6HA 2M5TA 6CHAC 5HGGA 1E1RD 4Y8YA 1H8HD 1IQKA 4FOUC 2YMSD 2H9TH 1A46H 1HB0B 1ELVA 1UTNA 1O2IA 2OD3B 2QIQA 3PO1C 2JH5D 2OK5A 4ACBA 1P05A 2KCOA 2CXVA 4I8GA 1AVXA 4CRGA 3AK5A 5GCHF 1TGNA 4NIVA 2C3SA 2NU0E 1MD8A 2Z6BD 1P2OA 1X7AC 1C2LA 3A87A 3V7TA 3E0NB 5A8ZA 1K0HA 1TRMA 4ISLA 1Y5BT 1YPLH 2G51A 5FXLA 2BZAA 1AZZA 4GHQA 1AMHA 5C5OA 1TB6H 4Y7AA 1AHTH 1GHWH 4AYYB 1F0SA 4E05H 3F9EA 2PUXB 2XBVA 3QO6A 1HV7A 2BD9A 2R2MB 3TLOA 2C90B 2FMJA 3UWJH 3SNAA 3UNQA 4WMFA 4ZKNU 1HJAC 2FDAA 1Y5UT 4BOHA 1FN6A 1HAHH 3ENSB 1UTJA 3BN9A 3RUOA 1JRSA 3SV9A 1DWDH 4NWLA 2J2UA 1KXEA 3P8NA 3KYFA 1KY9A 3TU7H 5DP9A 1EZQA 2XWBI 5DP7A 1QR3E 1ZMLA 5EXNA 1QJ7B 1K21H 1V2MT 1HUTH 1RIWC 3QGJA 1WXRA 4I86A 3UTUH 2O8TA 3MNBA 1OKXA 2FESH 1L1GA 1Y3VA 3HK3B 2AS9A 2QCYA 5HXFA 1F0TA 5G4BA 2BTCE 1P12E 1EAWA 1QCPA 5F53A 4TYDA 4Y10E 5A0BA 1RGQA 1HLTH 2BQWB 2YNBA 1XUIA 3SUFA 4DY7B 2WYJA 2BD4A 3IWMA 4AG1A 3MNCA 3RDZA 1EXFA 4NZLA 2GDDA 2P8OB 2VU8E 3LKWA 2XBYA 2OLGA 1XMNB 2V35A 4X2VA 1TMUH 1DM4B 4FVDA 1BZXE 1KXBA 1V2WT 5HM2A 4WMDA 4A1XA 2H6MA 1K1NA 2HNTE 4AGJA 2PFEA 4ISOA 2B8OH 3SOSA 4CHAC 4AFUA 1TIOA 1L1NA 1C4V2 3MFJA 1V6DA 5EQQA 3Q3KA 1FPHH 1UMAH 3ATWA 4B2CA 1XUFA 2BOKA 2VVVA 5JBAS 5LPRA 4MG3A 2BD7A 4WWYA 1XUGA 1AE5A 3AASA 1P02A 3SHCH 1RJXB 3MNXA 2BOHB 1PPZA 1J9CH 2UWLA 1A2CH 3LIWA 1AO5A 2BY7X 1COWD 1BCUH 1P0SH 1O34A 1C9PA 1S6FA 5DKMA 3SV7A 1GJ4H 3STJA 1XM1A 4WJG2 2Z9GA 3TNSA 5DP3A 4B75A 2J34A 3MU5A 4KELA 2VVUA 3M37A 4FU7A 3RXPA 1GJCB 2NU3E 2XTTB 1AGJA 2A4OA 1XVMA 1ETSH 3ZYDA 3CS7A 1GDQA 3ATKA 2FWWA 5FPSA 1CGIE 1DX5M 2IJD1 3GDSA 1KYNA 2Q6FA 1DE7H 2GV6A 2A4RA 5JDUB 3ATLA 1PPHE 2UWPA 3BTHE 5B6OA 1OWKA 3DSGA 3E91A 1ELCA 1IQFA 1O30A 2VJ1A 2WPKS 1CGHA 1GHZA 3MO6A 1W14U 1QJ6B 2TRMA 1W12U 2XNDD 2J97A 2LPRA 2HPPH 1JBUH 1NROH 3HPTB 2RFKC 4H4FA 2UUKB 2RDLA 1C2JA 1K1JA 1IQMA 1TNHA 2XCFA 2K1QA 2PV9B 2FOCA 1QQUA 3C27B 4X1QU 3UY9A 1ZHMA 1AKSA 1AUJA 1A1RA 2FPZA 1C1QA 1WYKA 3EA9A 2ZZUH 2SGEE 4OGYA 1HJ8A 2C8ZB 2ZFQH 3F9HA 3FN8A 1BMFD 1LMWB 4A6LA 4AORA 2FOBA 3SI4H 4FUIA 5TCAA 1K1PA 1FONA 1QHRB 3LOXA 5K7RA 1Z8GA 4Y11E 3A7TA 4U01A 1F5KU 5DPAA 3RMMH 1OWHA 4UFGH 2J94A 2IN2A 4HZHA 3A7VA 3MMGA 3MO9A 1CSOE 3RXQA 4F48B 3ATMA 1RS0A 1G37A 2OBOA 5FAHA 1F5LA 1OWJA 1CHGA 2XC4A 1C5TA 4DG4A 3S7KB 2NWNA 4X1NU 4XRNA 1G30B 3VXFH 1C5NH 1GMHG 2ZU3A 4YLUA 1PPFE 1C5ZB 3RXSA 1KLJH 1UVUH 2ZDKA 3BTTE 3V13A 1IHSH 2Z9KA 2I6SA 1W0YH 1TALA 3QZQA 4OGXA 2WYGA 1Y3UA 5T3HA 1FY5A 2G00A 4HFPB 2JH0D 2J98A 4WF8A 1YPMH 4D7FA 2TBSA 4GVUA 4UFDH 1U6QA 1VJ9U 3SYJA 2D8WA 4I8HA 5L2ZH 2VIVA 1GI8B 4DOQA 2W6ID 1QA7A 1ELGA 4AOQA 3DFLA 2BDHA 2ZGCA 2ZFSA 1VITG 1Z8JB 3PV2A 4MNXA 2GCHG 2ODPA 2Z9LA 2B7DH 3E8LA 1V2KT 1OP8A 1A61H 1AU8A 1HAZB 5E0GA 1XUKA 3ZVDA 2KM0A 3TNTA 4ABEA 2PKSC 3ZZ7A 4B76A 2ZA5A 1SLVB 4IN2A 2SGPE 1YCPH 2ZU2A 4I32A 1QJ1B 2P3UB 2CN0H 3P70B 2QF0A 1AD8H 1V2OT 3SNBA 3VGCC 2PW8H 2J4IA 2FLBH 2F83A 5J4SA 1D6WA 5EXLA 2AGIX 2AMPA 4MVNA 1GBFA 1UTOA 1VGCB 1QGFA 4CBOA 1DS2E 4OS1A 1GI6A 3RXUA 4FUEA 5DGJA 1GJAB 5EW1H 1BQYA 4O3UA 2FYRA 1SLWB 2PGBB 3OY6U 2BX3A 1G2MA 2QAAA 1ELTA 3PRBA 5FBIA 1GJDB 1P3CA 5DN6D 3FP6E 1A3EH 1O36A 1N8OC 4OS5A 2PSXA 1P01A 3ZZCA 1O3CA 1ZYOA 3D23A 1HXEH 3GICB 2FO9A 1GVKB 3VG8A 3BG4C 3EE7A 4VGCC 2A5IA 4PROA 4O03A 4AFSA 4INLA 4YOIA 1VITF 1HAXB 2GCHF 3TJVA 1W0KD 5EJZA 4ABJA 4JK6A 2VGCB 4BNRA 1W13U 3QGNB 1GWAA 2A4QA 1SLXB 4GCHG 1GJ5H 1WDIA 4JMYA 1BBRK 3SORA 3BTME 1S5SA 1D9IA 6GCHG 1NRPH 2C8WB 1O37A 4XDEA 1IAUA 1LHEH 3E0PB 3GS9A 3UR9A 1O2JA 2KAIA 1Z8RA 2C8YB 3MWIU 1DY9A 1PFXC 1PQ8A 2QYIA 1DUAA 2ILNA 2F9VA 2GMTC 4FETA 2ZGJA 2EEKA 1HDTH 4GPGA 2V3MA 1HGTH 2P3TB 4X8VH 1KXAA 1N6YA 4HGCA 3SGAE 1ESAA 5A0AE 1CA0B 4YXWD 1B0FA 4ABAA 3KL6A 3RMLH 5EODA 1V2QT 2AIPA 1P8VC 2KCYA 3KN2A 2PUQH 1TQ0B 3P6ZB 3URCA 2F9NA 3DUXH 1O2MA 2PTNA 4I33A 4RSPA 3SV8A 3P8OA 2P8OC 1EOLA 2EI8A 1T8NA 3FZDA 2ZHEH 1E37B 1Y5AT 1GVZA 1W10U 1EPTA 1C5LH 3MOCA 1B7XB 3RM0H 1PJPA 2C4FH 3QLPH 3A7WA 3AVZA 1SB1H 1EUFA 2D26C 1NO9H 1RTKA 1LPZB 1UVPA 1WBGB 4F49A 4GCHF 1SQTA 3FP7E 1TFXA 2AMQA 1NFYA 3NPSA 2V6NA 3EA8A 3WWFA 3AAUA 4NA8A 2ALVA 2P59A 3PLKA 1PQ5A 2F43B 3RXTA 3U1IB 1WU1A 3BSQA 5T1VA 3SUEA 2HNTF 2HALA 3Q3XA 3GY8A 3T5FH 1YPEH 3SU2A 1O2LA 3TH2H 1G3EA 1NBME 1SGEE 1SGNE 1O2GH 5H4IB 2G5NA 3F9FA 2CHAC 1P06A 3PB1E 1NU9A 3N99A 4IS5A 5JYIA 1GHXH 1BTZA 5FPTA 1TRYA 2BYAX 1MAYA 1GBIA 2BZ6H 4B6FA 3PLBA 4P02A 2SGAA 1FMGA 1H9HE 1OP2A 3EAJA 3KQCA 2ZTZA 4XBCA 2P3FH 1DWEH 1O3IA 3I77A 1NU7B 1CT0E 4FUBA 2CJIA 3H5CB 2QV1A 3ZVBA 1B5GH 1BRUP 1YWUA 3MNSA 2GT8A 2RCEA 2FOGA 3ZVCA 5C94A 6ESTA 2HVXA 3SUDA 1GBTA 1PPEE 1YBWA 2XNIA 3PV5A 4H6TA 4DT7B 4ZCNA 4U2WA 1GBHA 4IMZA 5DSFA 3NRLA 2ZQ2A 1J8AA 5DP6A 2BHGA 4Q7YA 4D7GA 1C1NA 4Y79A 1K1OA 3TJOA 1QBOA 2FZZA 4YT7H 3LGWA 1LQDB 2GD4B 3PTBA 4GUXA 4MPUA 3BF6H 3K9XB 1S0RA 2ZNKH 3GY7A 2HLDD 1SPJA 3OSYA 2WPHS 3PMJA 1ACBE 1O2XA 1GBAA 2PKAA 1ZZZA 1UCYK 1YPJH 5B6LA 3O8RA 2GP9B 2WUBA 4FUFA 1VZQH 1IHTH 1C2DA 5A0CA 1DANH 1DWCH 1W8BH 1EKBB 5LGOA 1H9IE 1D3PB 2XXLA 5FPYA 2BB4A 1THSH 5EJ1A 1F0RA 1BTUA 1NRRH 1FZZA 1OS8A 1YPHE 3KQEA 3TGIE 3A83A 5FX5A 1SGQE 1W7XH 3BG8A 3U69H 1LVBA 3PMAB 1GJ9B 3ZV8A 2AH4X 1UVSH 5CMXH 4J2YB 2L6OA 1ANDA 1AY6H 2BLOA 2BLVA 8GCHG 3GY3A 3OTJE 2V7QD 1HRTH 4B71A 4TY6A 1BHXB 2XWAA 1V2VT 5AFZH 4ZKOU 4H42U 2FEQH 1EAXA 2AMDA 2B5TB 2PHBA 1AFEH 1Z71A 2RG3A 4AN7A 3P17H 5BRRE 3O8DA 2FI4E 1RFNA 2ZCHP 1NBMD 5CHBA 1GL0E 4KGAA 3T26A 1Q3XA 5E0HA 4X8UH 1TGSZ 1SG8B 2Q6GA 1TBQH 4BTTB 1XKBC 2BVRH 2AIQA 3ODDA 3ZV9A 2F3CE 4NA9H 1DXPA 2HPQH 2VWNA 4ZKRU 4CH2B 4TWWA 3LGUA 3Q76A 3L6PA 3VXEH 4QT8C 2HGTH 5BPEA 1YY3A 4ASUD 3ZZ9A 3V12A 1ZGIA 1A0JA 1LDTT 3NZIA 1D3DB 2BDIA 5C1YA 4RKJB 5FL7D 1EZSC 1FLEE 4TPIZ 2V0BA 2HOBA 4Y7BA 5JBTA 4WH8A 2OINA 1C5OH 5TJXA 4K8BA 2STBE 3A8DA 8GCHF 1O5EH 2VBCA 3P92A 1G3DA 4JZDH 2ZPQA 1ZMNA 2KCPA 5KGOA 2BD5A 2KFWA 3EDXB 5C0UA 3AW0A 3RLWH 1MZDA 1MTWA 3ZZAA 3QWCH 7ESTE 1DFPA 1MKWK 2WPJS 2TGPZ 3NKKA 3M7UA 1C2HA 1XX9A 2W3IA 2WSSD 1GCTB 4R0IA 4ABDA 1MAXA 3BV9B 1H1BA 3QX5H 4K1TA 3UPEA 1GBMA 3RXVA 2J5UA 1PQAA 2BXTH 4TWYA 1BTHH 4NG9H 4O97A 1J16A 3S9AA 4F4OC 4YOJA 1S0QA 1YF4A 2W26A 2GZ9A 1YKTA 4MQAA 1QFKH 1C1VH 3QZRA 4Q2KA 4FUJA 1TAWA 1O2QA 2YMSC 1V2UT 1C5XB 1TMTH 2XBWA 4ZKSU 4NWKA 4XBBA 4I7YH 3IITA 4J1YA 4JZFH 3I78A 1FX0B 4FUHA 5DK1A 2IPHA 1ZOMA 5AHGH 1GBDA 1SL3A 2OC0A 2XYAA 1E38B 2ZC9H 3OE7D 1AZ8A 3OEHD 4OS4A 2ZCLP 1SQOA 1NFXA 2FI5E 2D1JA 1KXDA 3CENA 1NFUA 1J17T 1EPTC 1YPKH 1DOJA 1FV9A 2Y5HA 1ANEA 5KECA 1BRAA 4UFFH 1MKXK 5K0HA 1ZSKA 1CT4E 3NCLA 1O3KA 1EZXC 3FOAA 3UOPA 2RDEA 4DVAU 3OAAD 1KLIH 4MNYA 1TNKA 3O8CA 3MHWU 5I46H 1EASA 4X6PA 1TYNA 3S0NA 5E2OA 1Z1IA 4YM9A 4ASHA 4JZEH 1MTVA 1O3GA 1CA0C 2O9QA 4FXGH 2OQ5A 3ZZBA 2A7JA 2JH6D 3U1JB 1SFIA 2AYWA 2DUCA 2GJGA 2H1UA 2W7UA 2VWLA 4IN1A 2AEIH 1O3NA 4HTCH 4AG2A 5L6NH 1DVAH 1AB9B 1J15A 1EZUC 1MUEB 2V3HH 2Z9IA 4ZH8A 1HCGA 2Y81A 5TCCA 2ZTYA 3GCHB 3LC3A 1A0LA 1WUNH 2ZO3H 1TNLA 1UTQA 5EQRA 1SGPE 1UTLM 4AFQA 1MABB 3TK6A 4ZMAH 2R9PA 3TIUA 1GI3A 2H9HA 1OOKB 1AN1E 1EJNA 2PGQB 2GCTC 1P3EA 1P2JA 2R0LA 2WPIS 1V2JT 1T8OA 1TABE 4OS7A 2CGAA 4DGJA 2OC1A 3URDA 1ZPZA 2AGEX 3LH1A 2G52A 1XXFA 2AERH 3A89A 3GISB 4YO9A 1T8MA 2GVFA 3W95A 1LPKB 2VWMA 4MPVA 3M7QA 1N6XA 1UTMA 3KIDU 1WSSH 1LCYA 1MTUA 1WOFA 3RU4E 3HGNA 5AVDA 4AGKA 1GMDG 4D8NA 5E8EH 1O3MA 2Q1JA 4D9RA 1LVYA 1IQHA 1O35A 2GDEH 1AIXH 3EE0B 1JIRA 3UQVA 2IJOB 2BD8A 4I8JA 2G5VA 2K0QA 1ELEE 5T6DA 1BMMH 2ZFFH 1S83A 1QURH 2IPQX 1TA2A 1NM6A 1O2YA 3GDVA 4NZQA 1ZTKA 2VIWA 2ZU1A 2QXHA 3RXBA 3GYLB 1YLNA 3EQ0H 2JDID 2O8WA 2FS9A 1O39A 1O5FH 1S85A 4DURA 3HATH 3M5OA 2CF8H 4NSYA 5PTPA 4DJZB 2PTCE 3A88A 1S84A 5ESTE 3T25A 3MU4A 3KYGA 5GNDA 3QK1A 3S7HB 1LO6A 3M61U 1TNIA 1LVOA 4TY7A 2BY8X 4MNVA 2TGTA 1A7SA 1MH0A 1EB2A 1BITA 3DSPA 4FUGA 2BDGA 3MO3A 1FY4A 3WW7A 4ZHAA 1B0EA 3PROA 1AFQC 3EA7A 4X6MA 1GL1A 2BVXH 5DG6A 2O8MA 3RXGA 4X8SH 2BLQA 1C1TA 4NIYA 4MPXA 1RD3B 5EOKA 3NK8A 1CVWH 1DWBH 1ABIH 4Y0YE 4LXBH 4Y8XA 3V0XA 3DA9B 4B6EA 4R8TB 1TQ7B 5T6FA 1HFDA 2A5AA 3OTPA 1C2GA 1ZHRA 4FUCA 4JZIA 1G3CA 2TIOA 1CGJE 1V2ST 3MU0A 4K5ZA 3LGVA 4A7IB 1O3EA 2XOKD 4BAKB 3SU3A 1IQGA 3A86A 2JIZD 4FUDA 1LHGH 5CHAB 3PLPA 2PP6A 2OTVA 3TPIZ 1O2KA 1QL8A 1SGTA 1TPAE 1G32B 1O3JA 2ULLA 1C1PA 2WUCA 3JZ1B 1C2MA 3PV4A 4ABBA 1PPCE 1F92A 1NZQH 1O3LA 1MTNC 3PO1B 4BTIB 1GBLA 2F9UA 2PLXA 1O3HA 1O2VA 5HYOA 1PPBH 3K6ZA 3S9BA 1ZRBA 2HLCA 2SNWA 3M35A 4YTAA 1OX1A 1O31A 2BM2A 2OQUA 2UWOA 2AGGX 4CREA 4NFEA 3RP2A 5EIYA 2ANKH 4LOYH 1Q2WA 3W1EA 1KTTB 2EC9H 1G9IE 4D9QA 1W7GH 3FZZA 1GMHF 3LU9B 3M5NA 4CR9A 1WV7H 3QTVH 3RU4D 3GYMA 1H8DH 4O9VA 4ESTE 2G4TA 2HNTC 2JJ1D 2WPMS 5IK2D 1MCTA 2VB0A 1H9LB 5EJLA 4P00A 2BDYA 1O2ZA 4Q63A 1JIMA 3AAVA 3A8BA 1HYLA 1HJAB 2R0KA 4Y0ZE 1TOCB 1SLUB 1KXCA 1O5CB 3CP7A 1FI8A 1E0FD 1JXPA 1GHYH 2YOLA 2FS8A 1EOJA 4GAWA 1K1IA 2F9OA 1O5DH 2PSYA 2UUYA 4OM9A 1P2QA 5E0JA 3F0PA 4CRAA 3U28C 5AF9H 3BTEE 1BJVA 2DE9A 2SNVA 5ESBA 2STAE 1ANBA 1EB1H 3DT0H 1QRZA 2FOMB 2Z94A 1RIWB 2OCVB 1C5QA 2SGFE 4MPWA 1AI8H 2GZ7A 3U98H 2NU4E 2WPDD 3NUMA 4Q4LA 4DIIH 1QB9A 2FX4A 3KNXA 2Z3CA 1FY8E 3OU0A 1W11U 2ZHDA 1ETTH 3RXIA 1GHBG 1WAYB 1WQVH 3MTYA 1PYTD 4BAHB 3H7TA 3KGPA 1IOEA 3T2NA 4B74A 4XOJA 1E1QD 1Z6JH 2ZDMA 2H5CA 2ZDAH 2JETB 4XD7D 4NSVA 1F7ZA 1HAOH 3N7EA 3LDXH 2Y80A 2VIDA 3D49H 2L74A 4FU8A 3BIVH 2G55A 3BEUA 1SI5H 1K2I1 3OX7U 5KEDA 1H8ED 1DSTA 3O8BA 1C2IA 1TONA 4CHAB 3M5LA 1UK2A 2UUJB 5F8XA 1LHFH 4WXIA 2Y82A 1KXFA 3ZZ6A 1GMCG 2F91A 4NFFA 1ZMJA 4I8LA 2ANWA 2WV9A 1C5PA 4AX9H 3RC5A 1OSSA 2VIQA 3U9AH 3F2FA 1RTLA 2QF3A 2F9PA 1ELAA 3N7OA 3RC4A 3GY4A 2QE7D 3HKJB 5LH8A 3PMHB 3SO3A 1EAUA 1GBEA 3SJKA 1CU1A 1SGFG 1O3OA 2C93B 1O2WA 3RXKA 4UONA 1SQRA 1BHXF 3D65E 1GGDB 1VCWA 4F55A 2A2XH 2R2WU 5C1UA 1DICA 2XC0A 1ESBA 1CE5A 3RXDA 2FYQA 1OWDA 3SUGA 2Q6DA 2XC5A 2D2DA 5E2PA 1TBRH 1GHBF 2PR3A 6GCHF 8KME2 1G36A 3GDUA 1NY22 2XRCA 1QY6A 3GY5A 1MBMA 2Y7XA 1PPGE 3BTDE 1MZAA 2QF5A 2TPIZ 1QA0A 1XUHA 1Y3YA 4IBLH 3WY8A 4M7GA 1ZJKA 1FIZA 1VR1H 1E35B 2ZKSA 2QN5T 3STIA 4UEHH 5ABWA 3EYDA 1HAVB 4SGBE 5FCRA 3SGBE 1E34B 1KIGH 1TGTA 4ISNA 1HIAB 2V3OH 4I8KA 1GMCF 3PWBA 1QRXA 1BRCE 2W5EA 1C4U2 2R3UA 2BMGB 4Y8ZA 3ELAH 5F03A 2G81E 1Z7KA 4IMQA 1GJ8B 3Q3YA 1UVTH 3SJ9A 2OUAA 4LK4A 1GHVH 4Y76A 2ZWLH 1QL9A 3QTOH 3TGJE 1ID5H 1L1JA 3M36A 1AQ7A 1O3BA 1LVMA 2FOFA 5A2MH 1Z6EA 3H09A 1GI7B 1O2TA 1O3PB 4Q7ZA 1WCZA 2VIOA 3F1SB 5A8XA 3K65B 5HIYA 1AE8H 4TT3D 4AC9A 1T4VH 2A4GA 1O3AA 1ZSLA 1CBWB 1JRTA 3ZZ8A 1C5RA 1P2MA 4A1TA 2H5DA 1QZ8A 2BY9X 3DCLA 3LH3A 1ZPBA 5EPNA 1HAVA 1GJ7B 1EP6A 3C1KA 2XCNA 3IG6B 5GXPA 3GY6A 5EQSA 3VB5A 2R3YA 5C17A 3QN7A 4MLFB 1ESTA 3SJIA 1O2NA 4RT1A 4BANB 1NRQH 3MYWA 3U8TH 2K8IA 2SGDE 1IQLA 4THNH 1YM0A 1BTPA 1SMFE 1NESE 1W0ZU 1YLDA 2LELA 3QDZB 1BBRH 3KQDA 4WH6A 4FVBA 4X6NA 3M3TA 2FX6A 2ZGXH 1KMHB 5GCHG 2Y7ZA 1CA8B 3SV6A 2CMYA 4CH8B 5HMAA 3TGKE 1Y8TA 1ETRH 3F2GA 1ZPCA 3VB7A 4NGAH 1J14A 1BTWA 3GCNA 4OS6A 1GJ6A 1L4DA 5T6GA 1T32A 3A7ZA 2ZEBA 3P8GA 1ANCA 1XXDA 2B0FA 3WWBA 4MDSA 1G3BA 1V2NT 3LJJA 1Q31A 2VNTA 1C1OA 3F9GA 1UK4A 1SKYE 2ZQ1A 4ABHA 3UQOA 5FBEA 2PKSB 3E90B 1HJ9A 1BMLA 1FAKH 4Q7XA 3F6UH 4Z0KA 3A80A 4NA7A 1TNGA 1V2TT 1YP9A 5JBBS 3VGCB 3BIUH 1AVWA 1UTKA 5FHTA 2GZ8A 4JYTA 3TH4H 5F8TA 1GG6B 3M3VA 5CHAC 3SQHE 2XW9A 4ISHH 4XSKU 1UJ1A 2GT7A 4KTSA 1TMBH 2GV7A 3VPKA 1O0DH 4U30A 3I29A 3MH6A 3B23B 1C5MD 1W3CA 2OBQA 3S69A 3SZNA 2G4UA 2OP9A 3R3GB 4K2YA 3MQKC 2KCAA 1P9SA 3FFGA 1ZTJA 2ALPA 1FY1A 4JK5A 5GWZA 3U8OH 3SV2H 1N8OB 3SQEE 2QXIA 2BD3A 1AWFH 1ZLRA 2QXJA 1HAGE 1VGCC 3BG4B 4VGCB 4K1SA 4MNWA 4UE7H 4YESB 3RMNH 1UTPA 1C1RA 2A5KA 4X1PU 1XUJA 1MCVA 5CDFE 3A85A 1UVOA 2HVYB 2WV5A 1O33A 1C9TA 1SOTA 1G2LA 3SNEA 4E7RG 2Y5FA 1QNJA 3TITA 3VFEA 2BY6X 5I25A 3GY2A 1EP5A 1TA6A 1TGCA 4KTCA 3G01A 3UFAA 2GGVB 4IGDA 3PRDA 1QL7A 1YC0A 3MH5A 1SOZA 4O3TA 3CNRA 2EI6A 3RXOA 1SR5C 1D3TB 4CBNA 4RN6A 2O8LA 3M5MA 1YLCA 1CHOG 1O38A 1T31A 1ZHPA 4TSFD 1O32A 2GMTB 2Z3DA 3ZZ4A 1O3FA 1SGFA 3E6PH 4JYUH 1TLDA 2VGCC 2W3KA 4X2XA 1FAXA 1OWEA 2BX4A 1O5GH 5ETXA 1BOQA 1INCA 1F0UA 1C1UH 2SGQE 1L2EA 2QXGA 2SFAA 3ATIA
chains in the Genus database with same CATH topology
3SN8A 4Y71A 1NS3A 2QA9E 3KQBA 4ZHLU 2QC2A 1DDJA 4X1RU 5HM9A 2FOAA 2JETC 3E3TA 2ZIQH 2F9BH 2ZFTA 1A5GH 4AFZA 4AB9A 1DLEA 2Y6TA 2A31A 1VJAU 1UCYH 3CS0A 1SSXA 1ELBA 1A4WH 2ZFRH 1DUEA 3DFJA 1GBBA 2H2ZA 2FOHA 1EX3A 4IC5A 3GCTG 1IQJA 2Y5GA 4YT6H 2TGDA 1ZR0A 4ABIA 1SGIB 1RRKA 3L33A 4CRBA 1JOUB 2ZPRA 1YYY1 2FOEA 3T27A 5A09A 4DCDA 1ABJH 2ZHQH 3RXJA 3LPRA 2ASUB 1YCPK 2FODA 3NXPA 3TVJB 3PMBB 4TPYA 3TH3H 2B9LA 1CHOF 3NWUA 1O2SA 1C2EA 1TPPA 1RTFB 1C5WB 1P03A 1V2PT 2VINA 2BD2A 2DE8A 3MU8A 1UO6A 5GPIB 2CHAB 1QB6A 1GGDC 1O2PA 2ZTXA 1BT7A 1ZTLA 5EW2H 1YCPM 1VCPA 1GBKA 1BTXA 1AKSB 4INKA 1YPHC 4KP0A 3SU1A 1N1LA 1GDNA 1BTYA 2ZECA 3KEEA 3KF2A 1SHYA 3VEQB 1VCQA 1S81A 1MU8B 1BMNH 1NTPA 8ESTE 2EA3A 3LC5A 1P9UA 2ZHFH 1THPB 1ZJDA 1BBRE 2ZG0H 3R0FA 3RXHA 3SBKA 1EQ9A 3GCTF 3ZVEA 1THRH 3P95A 2ZFPH 1K1LA 3ZVAA 4BXWA 2VH0A 1FNIA 4UD9H 4WMEA 1ZSJA 1EATA 2RA3A 1TBZH 3V3MA 3ZZ5A 1ELDE 2ZF0H 3ODFA 1XVOA 2ANMH 2UUFB 2BQ7B 1OWIA 4ABGA 4MTBA 1QBVH 1OXGA 5DP8A 3ZVGA 1NRSH 3SI3H 3ITIA 1TX8A 4WVPE 4BTUB 1EJMA 1JWTA 3VB3A 5IYTA 2ZPSA 1MQ5A 3H7OA 4Q80A 1C5VA 1ZGVA 5JPMH 1LKAA 3RLYH 1MKWH 9ESTA 4K69A 1EAIA 2FM2A 4KTUA 4ZXYH 3RU4T 3T28A 1GI0A 1FY3A 3KHVA 2GTBA 1CBWC 2THFB 3AW1A 4UDWH 4X8TH 4X2YA 1JMOH 3BEFB 4YZUA 2A7HA 5EPYA 2OC8A 3SNCA 1BUIA 3A8AA 5EXMA 5GDSH 1K1MA 3TJUA 5C20A 3A7YA 1Y3WA 4HI3A 2P93A 9LPRA 1WTHD 1RXPA 1C1MA 1TNJA 2Z3EA 3A8CA 4K3JA 1GPZA 3JZ2B 1KSNA 3LONA 3FP8E 1IQNA 1GMDF 1K9OE 1O5BB 3B8JA 4JZ1A 1OPHB 3PYHA 2I6QA 1MTSA 5L30H 3VB6A 5EGMA 4Y6DA 2ZHWH 1SC8U 6CHAB 5EG4A 5C5NA 1C4Y2 1C5SA 4B2BA 5C67A 1PQ7A 1H8IH 1MKXH 2BQ6B 4BAQB 7GCHG 1SQAA 2FP7B 3BTWE 3FVFB 1C5UA 3SU5A 1OYQA 3EGKH 3VB4A 1NT1A 1QB1A 2WV4A 4CR5A 4XFQA 3M7TA 2FXRA 1TPOA 1GI4A 2A2QH 1P57B 5F6MA 5IDKA 3LGYA 1Z8IB 4WY3A 1TWXB 3SU6A 1C1SA 2BXUH 1C1WH 3RM2H 3TK9A 1A5IA 1CQQA 5L2YH 1EJAA 1DXWA 1TE0A 2ZP0H 3RXEA 2A0QB 3SHAH 1LTOA 3LJOA 1P2IA 4K1EA 2FTMA 2Z9JA 3T29A 1ELFA 3RXCA 1MQ6A 1Z1JA 1ARCA 1NRNH 1QQ4A 2ZI2H 4I31A 1SGDE 3L3TA 3RXAA 1DT2A 2VVCA 3BTQE 3UR6A 1FN8A 1GCDA 1XKAC 1BRBE 1LHDH 1QBNA 1HNEE 1GG6C 3RXFA 4AZ2B 2BY5X 5J4QA 1BA8B 1C2KA 4ABFA 4X6OA 5DO4H 3S9CA 3OYPA 1L4ZA 3Q00A 1O5AB 2GX4A 1A0HB 4DIHH 1FUJA 4B73A 1FPCH 1DITH 5JBCS 2KAIB 1GDUA 1P11E 5C3NA 1HBTH 2AFQB 3E16B 3M3SA 2CV3A 5F8ZA 1MD7A 1C2FA 1UCYE 2VIPA 7GCHF 2PWXA 3MH7A 5GJ4B 1P04A 3TK5A 4B1TA 1MMJN 4KKDA 4E06H 2H9EH 3UNSA 1M9UA 3PTNA 6LPRA 2Z7FE 1H4WA 2C8XB 1FJSA 2RA0A 4DW2U 1O2HA 2XBXA 1SBWA 1E36B 1O2OA 1SHHB 2BLWA 1LQEA 1VITH 4SGAE 1SGYE 2ODYB 3UREA 1D4PB 4Z6AH 5AFYH 3SGQE 1KLTA 1DLKB 1GCTC 3ESTA 4X1SU 4XE4A 2ZCKP 3PM3A 3SU0A 3BTKE 2ODQA 1CO7E 4OS2A 3LT3A 4E7NA 1GJBB 2J95A 1EPTB 2W7SA 3LGIA 1YGCH 3GOVB 3MH4A 3SU4A 3ZZDA 4A5TS 4IW4E 1P09A 2OXSA 1IQIA 1LPGB 1LHCH 2A1DB 1GVLA 1CT2E 3RXLA 3A82A 3F68H 1T4UH 1OP0A 1V2LT 2CF9H 1KDQB 3ZVFA 1GHAG 3HKIB 3FANA 2WINI 5LPFA 3TJNA 3MI4A 3A81A 4NCYA 4ZHMU 5C1XA 1HAPH 1TPSA 5A8YA 1A5HA 4ZROA 4GHTA 4BAMB 3UUZA 1MBQA 3T62A 1GBJA 3KCGH 1T8LA 1TX7A 5EU8A 1NPMA 1K28D 1O2RA 2FLRH 1GI5A 1Y3XA 4JYVH 1KTSB 4K8YA 5DP4A 4YOGA 1W2KH 5JB8S 1NFWA 1V2RT 5GIBA 5FX6A 3K6YA 2ESTE 2VH6A 1DPOA 1HXFH 4CRFA 4FU9A 1QTFA 1QRWA 4ZXXH 1SFQB 4NIWA 4ISIH 2GCTB 2A7CA 3HK6B 4U32A 2HWLB 1KDQA 3HGPA 1BMAA 2ZGBH 3ZZ3A 1PYTC 3A84A 2G8TA 4JCNA 2BDAA 4AYVB 2NU1E 2FIRH 1AB9C 1FQ3A 1TGBA 2FI3E 4WXVA 5JB9S 1TRNA 3GCHC 2OC7A 3OY5U 2QGRA 3FAOA 4BAOB 1DY8A 5DJ7A 4BXSA 1UK3A 2P94A 1Y59T 3DD2H 2BDBA 4D76A 2ZDVH 5SGAE 1GHAF 3A7XA 2ZU4A 1GBCA 3W94A 1BIOA 2JKHA 3UNRA 1OYTH 1V3XA 1ORFA 7KMEH 2ZGHA 1S82A 4B2AA 1D6RA 2P95A 1FXYA 2PKAB 3UIRA 2NU2E 1F5RA 2A45B 1TOMH 1WQSA 4GSOA 1C5YB 1AUTC 1MU6B 4X0WU 4AB8A 1ARBA 2O8UA 1FDPA 3K2UA 1BJUA 3SNDA 5FCKA 1HIAA 1AWHB 1FIWA 1HAIH 4YLQH 1TX6A 3Q77A 5DP5A 1F2SE 3U8RH 1AFQB 1D3QB 3RC6A 4A92A 3QUMP 1UHBB 2ZU5A 4LZ4B 1GI1A 2FTLE 1YPGH 1P2NA 4CRCA 1NC6A 2HRVA 1WTGH 2QY0B 5LPEA 3GCOA 4LZ1H 3LGTA 1SGRE 1K22H 4CRDA 7LPRA 4H6SB 4NIXA 1GI9B 2WPLS 1QIXB 3SJOA 1O2UA 2ZDLA 1L0ZA 5CE1A 3SW2B 2A32A 2EI7A 1HAYB 3UWIA 1IQEA 3RXMA 4IC6A 3BEIB 3P8FA 1HPGA 3ZYEA 3MU1A 1LKBA 2YNAA 3B9FH 2IOTA 2LNCA 3E1XB 4UFEH 1P2KA 1T7CA 1SVPA 2ZDNA 2GKVE 3BTFE 4X2WA 3RMOH 2J92A 4GLYA 2ANYA 2TGAA 2J9NA 3BTGE 1O3DA 4ZUHA 1MTNB 2P16A 1ZRKA 1NN6A 1UHBA 2BVSH 2J38A 5C2ZA 1P10A 1AVGH 3RXRA 3UOUA 1A3BH 3D62A 2BDCA 4K60A 1DSUA 3SJ8A 4A1VA 3PWCA 8LPRA 4INHA 1BB0B 1BDAA 1SGCA 2VWOA 3DHKH 4ZAEA 4XBDA 4RKOB 1GI2A 1S6HA 2M5TA 6CHAC 5HGGA 4Y8YA 1IQKA 2H9TH 1A46H 1HB0B 1ELVA 1UTNA 1O2IA 2OD3B 2QIQA 3PO1C 2JH5D 1P05A 2CXVA 4I8GA 1AVXA 4CRGA 5GCHF 1TGNA 4NIVA 2C3SA 2NU0E 1MD8A 2Z6BD 1P2OA 1X7AC 1C2LA 3A87A 3V7TA 3E0NB 5A8ZA 1TRMA 4ISLA 1Y5BT 1YPLH 2G51A 5FXLA 2BZAA 1AZZA 4GHQA 1AMHA 5C5OA 1TB6H 4Y7AA 1AHTH 1GHWH 4AYYB 1F0SA 4E05H 3F9EA 2PUXB 2XBVA 3QO6A 1HV7A 2BD9A 2R2MB 3TLOA 2C90B 2FMJA 3UWJH 3SNAA 3UNQA 4WMFA 4ZKNU 1HJAC 2FDAA 1Y5UT 4BOHA 1FN6A 1HAHH 3ENSB 1UTJA 3BN9A 3RUOA 1JRSA 3SV9A 1DWDH 4NWLA 2J2UA 1KXEA 3P8NA 1KY9A 3TU7H 5DP9A 1EZQA 2XWBI 5DP7A 1QR3E 1ZMLA 5EXNA 1QJ7B 1K21H 1V2MT 1HUTH 1RIWC 3QGJA 3UTUH 2O8TA 3MNBA 1OKXA 2FESH 1L1GA 1Y3VA 3HK3B 2AS9A 2QCYA 5HXFA 1F0TA 5G4BA 2BTCE 1P12E 1EAWA 1QCPA 4TYDA 4Y10E 5A0BA 1RGQA 1HLTH 2BQWB 2YNBA 1XUIA 3SUFA 4DY7B 2WYJA 2BD4A 3IWMA 4AG1A 3MNCA 3RDZA 1EXFA 4NZLA 2GDDA 2P8OB 2VU8E 3LKWA 2XBYA 2OLGA 1XMNB 2V35A 4X2VA 1TMUH 1DM4B 4FVDA 1BZXE 1KXBA 1V2WT 5HM2A 4WMDA 4A1XA 2H6MA 1K1NA 2HNTE 4AGJA 2PFEA 4ISOA 2B8OH 3SOSA 4CHAC 4AFUA 1TIOA 1L1NA 1C4V2 3MFJA 1V6DA 5EQQA 3Q3KA 1FPHH 1UMAH 3ATWA 4B2CA 1XUFA 2BOKA 2VVVA 5JBAS 5LPRA 4MG3A 2BD7A 4WWYA 1XUGA 1AE5A 3AASA 1P02A 3SHCH 1RJXB 3MNXA 2BOHB 1PPZA 1J9CH 2UWLA 1A2CH 3LIWA 1AO5A 2BY7X 1P0SH 1BCUH 1O34A 1C9PA 1S6FA 5DKMA 3SV7A 1GJ4H 3STJA 1XM1A 4WJG2 2Z9GA 3TNSA 5DP3A 4B75A 2J34A 3MU5A 4KELA 2VVUA 3M37A 4FU7A 3RXPA 1GJCB 2NU3E 2XTTB 1AGJA 2A4OA 1XVMA 1ETSH 3ZYDA 3CS7A 1GDQA 3ATKA 2FWWA 5FPSA 1CGIE 1DX5M 3GDSA 1KYNA 2Q6FA 1DE7H 2GV6A 2A4RA 5JDUB 3ATLA 1PPHE 2UWPA 3BTHE 5B6OA 1OWKA 3E91A 1ELCA 1IQFA 1O30A 2VJ1A 2WPKS 1CGHA 1GHZA 3MO6A 1W14U 1QJ6B 2TRMA 1W12U 2LPRA 2HPPH 1JBUH 1NROH 3HPTB 4H4FA 2UUKB 2RDLA 1C2JA 1K1JA 1IQMA 1TNHA 2XCFA 2K1QA 2PV9B 2FOCA 1QQUA 3C27B 4X1QU 3UY9A 1ZHMA 1AKSA 1AUJA 1A1RA 2FPZA 1C1QA 1WYKA 3EA9A 2ZZUH 2SGEE 4OGYA 1HJ8A 2C8ZB 2ZFQH 3F9HA 1LMWB 4A6LA 4AORA 2FOBA 3SI4H 4FUIA 5TCAA 1K1PA 1FONA 1QHRB 3LOXA 5K7RA 1Z8GA 4Y11E 3A7TA 4U01A 1F5KU 5DPAA 3RMMH 1OWHA 4UFGH 2J94A 2IN2A 4HZHA 3A7VA 3MMGA 3MO9A 1CSOE 3RXQA 3ATMA 1RS0A 1G37A 2OBOA 5FAHA 1F5LA 1OWJA 1CHGA 2XC4A 1C5TA 4DG4A 3S7KB 2NWNA 4X1NU 1G30B 3VXFH 1C5NH 1GMHG 2ZU3A 4YLUA 1PPFE 1C5ZB 3RXSA 1KLJH 1UVUH 2ZDKA 3BTTE 3V13A 1IHSH 2Z9KA 2I6SA 1W0YH 1TALA 3QZQA 4OGXA 2WYGA 1Y3UA 5T3HA 1FY5A 2G00A 4HFPB 2JH0D 4WF8A 1YPMH 4D7FA 2TBSA 4GVUA 4UFDH 1U6QA 1VJ9U 2D8WA 4I8HA 5L2ZH 2VIVA 1GI8B 4DOQA 1QA7A 1ELGA 4AOQA 3DFLA 2BDHA 2ZGCA 2ZFSA 1VITG 1Z8JB 4MNXA 2GCHG 2ODPA 2Z9LA 2B7DH 3E8LA 1V2KT 1OP8A 1A61H 1AU8A 1HAZB 5E0GA 1XUKA 3ZVDA 3TNTA 4ABEA 2PKSC 3ZZ7A 4B76A 2ZA5A 1SLVB 4IN2A 2SGPE 1YCPH 2ZU2A 4I32A 1QJ1B 2P3UB 2CN0H 3P70B 2QF0A 1AD8H 1V2OT 3SNBA 3VGCC 2PW8H 2J4IA 2FLBH 2F83A 5J4SA 1D6WA 5EXLA 2AGIX 2AMPA 4MVNA 1GBFA 1UTOA 1VGCB 1QGFA 4CBOA 1DS2E 4OS1A 1GI6A 3RXUA 4FUEA 5DGJA 1GJAB 5EW1H 1BQYA 4O3UA 2FYRA 1SLWB 2PGBB 3OY6U 2BX3A 1G2MA 2QAAA 1ELTA 5FBIA 1GJDB 1P3CA 3FP6E 1A3EH 1O36A 1N8OC 4OS5A 2PSXA 1P01A 3ZZCA 1O3CA 1ZYOA 3D23A 1HXEH 3GICB 2FO9A 1GVKB 3BG4C 4VGCC 2A5IA 4PROA 4O03A 4AFSA 4INLA 4YOIA 1VITF 1HAXB 2GCHF 3TJVA 4ABJA 4JK6A 2VGCB 4BNRA 1W13U 3QGNB 1GWAA 2A4QA 1SLXB 4GCHG 1GJ5H 4JMYA 1BBRK 3SORA 3BTME 1S5SA 1D9IA 6GCHG 1NRPH 2C8WB 1O37A 4XDEA 1IAUA 1LHEH 3E0PB 3UR9A 1O2JA 2KAIA 1Z8RA 2C8YB 3MWIU 1DY9A 1PFXC 1PQ8A 2QYIA 1DUAA 2ILNA 2F9VA 2GMTC 2ZGJA 2EEKA 1HDTH 4GPGA 1HGTH 2P3TB 4X8VH 1KXAA 1N6YA 4HGCA 3SGAE 1ESAA 5A0AE 1CA0B 1B0FA 4ABAA 3KL6A 3RMLH 5EODA 1V2QT 2AIPA 1P8VC 3KN2A 2PUQH 1TQ0B 3P6ZB 3URCA 2F9NA