5ESTE

Crystallographic analysis of the inhibition of porcine pancreatic elastase by a peptidyl boronic acid: structure of a reaction intermediate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of the inhibition of porcine pancreatic elastase by a peptidyl boronic acid: structure of a reaction intermediate.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ELASTASE
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1989-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5estE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5estE01
2SGFE 1UK3A 4WXVA 2FEQH 1E36B 1Y3UA 1HAXB 1VJ9U 1IQKA 4AYVB 2F9NA 4YZUA 4ISNA 1EKBB 4X8TH 1QBVH 3MU4A 1W12U 3M3VA 3N7OA 1CU1A 4WWYA 2F83A 5IDKA 1V2UT 1NTPA 4JYTA 4ESTE 1C2LA 4KKDA 1TGSZ 1YPHC 1QA0A 2VVCA 2W26A 2Y5HA 3KQBA 2EI8A 3UFAA 1VCQA 1T8OA 4DURA 3LJJA 1DE7H 3PB1E 5EQRA 3RDZA 4ISHH 1GJ8B 2ZCHP 1PFXC 1TNHA 5AFZH 1F0UA 2PHBA 5TCAA 2FODA 4DCDA 3TH2H 3C1KA 1C9TA 1D6RA 3OTJE 2ZI2H 1DX5M 1IQEA 1DWDH 4FUGA 3LKWA 3PO1C 1P03A 2PR3A 4BTIB 1WTGH 1OKXA 2XBXA 2O9QA 3TVJB 4NZLA 3QTVH 1N8OB 3FFGA 3ZV9A 2ZGBH 2QC2A 1E38B 1KXCA 1C2EA 1HGTH 1P2IA 3SBKA 1LKAA 2Q1JA 5A0CA 3I29A 2HVXA 2EA3A 1EPTB 5J4QA 1P02A 1BRBE 2P94A 3P70B 1TQ0B 2PLXA 4XBCA 1BHXF 3O8BA 1BA8B 1KLJH 1QTFA 2GMTB 5ESTE 1H8DH 3EQ0H 3ZZDA 1K1PA 4JZIA 3WY8A 3RMLH 1ETTH 1BTZA 3M7QA 2VIDA 2ZCLP 4NA9H 2GP9B 3F9GA 4RSPA 1GMCG 4X2XA 4XDEA 1GBMA 5IYTA 3U69H 3M35A 1RTLA 3LT3A 3M61U 4JMYA 2VGCB 1FY8E 3SQHE 2PTNA 4UFFH 3R0FA 4AX9H 4TY7A 1EB1H 3A8DA 1S85A 1K9OE 1FQ3A 3ENSB 1MAXA 8GCHF 4JK6A 3UNSA 3CS7A 2UWPA 1AHTH 1BQYA 1O3IA 1YLDA 1RFNA 5EXMA 4CR9A 4Z6AH 4Y8YA 2A32A 1DANH 3MNCA 3PMBB 2ZP0H 3ZVBA 4CRGA 1NZQH 1T8LA 5F8ZA 1YPMH 2P93A 1V6DA 3TGIE 1EX3A 3MU5A 2YNAA 4JZFH 1GGDC 1QGFA 1NFUA 5A2MH 4AFZA 1QCPA 1UK4A 3RXEA 1AZZA 3VXFH 1YPKH 1O2VA 1BTXA 2AMDA 1YCPK 3LOXA 6LPRA 1AY6H 2VWNA 1S5SA 3PMHB 2A7CA 1GHZA 1K21H 5A8YA 4ZROA 5JBAS 4UFDH 1BBRH 1SFQB 1EOJA 4U30A 4NG9H 4AB8A 1LVBA 5BRRE 3HK6B 3TJUA 2IPHA 1O2QA 6GCHF 2OC8A 2ZU5A 4XE4A 5LH8A 1F0TA 3PYHA 4MLFB 1A3BH 1LMWB 4AFQA 3LGUA 3UWIA 4QT8C 2DUCA 1AKSA 2QIQA 1BBRK 2PKSB 2B0FA 3EA7A 1V2PT 1AB9C 5BPEA 2ZDVH 1OYQA 4NWKA 2Z3DA 2RA3A 1XMNB 2IN2A 3ZZ8A 2BQWB 1Z6EA 1L4DA 2GX4A 1V2VT 4Y6DA 1QL9A 3KIDU 5C3NA 5DP7A 1T7CA 4O3TA 2FX6A 4UFGH 3GY8A 5DK1A 1P3EA 1PQ7A 2ZEBA 1W11U 3ELAH 4Q2KA 3ZZ6A 2XCFA 1FDPA 4DW2U 1VITG 4B75A 2D1JA 1XXDA 2ZQ2A 2CF9H 1IQMA 1C1MA 2FI4E 2G55A 3QGJA 1ZPCA 3SHCH 3UNQA 1PQ5A 3S9BA 3MTYA 1AKSB 5TCCA 1F5LA 5CHAB 1A2CH 3H7OA 4ZHAA 1LQEA 2QN5T 2WV4A 4I8HA 4KTUA 1GJ5H 3TITA 5C20A 3RXFA 4AB9A 1AFEH 1MQ5A 3M5MA 3Q3YA 3QZQA 1TOMH 2Q6FA 1GVLA 1RJXB 1C1NA 1KXBA 2BX4A 4FVDA 1XXFA 1OWDA 2H9EH 6CHAB 2VB0A 1J16A 2CMYA 4X2VA 5GIBA 1TFXA 4E7NA 1INCA 2NWNA 4M7GA 2W5EA 2Y5FA 1NRRH 1UTMA 2GCHG 1MBMA 2QA9E 3VB6A 4JZEH 1O2YA 4CRAA 4TPIZ 1O2HA 4ZUHA 2O8WA 3ZZ4A 2XYAA 3UREA 1UTOA 2ANWA 3QUMP 1T32A 1Z7KA 1FONA 4J2YB 3RXGA 3RM2H 1LQDB 2BD8A 5DP6A 3RU4E 1AMHA 5JB8S 2FTMA 1MBQA 1K28D 4A1XA 1DWBH 3ATKA 3U8OH 1CHOF 3ZYDA 2GCHF 2C8ZB 5F8XA 1CT2E 1D3QB 3AASA 1ETSH 1GJ4H 1C1SA 3Q3XA 2FI5E 4BAKB 1OPHB 1A0LA 2B7DH 3BEUA 1A0JA 1O5AB 4H6TA 1FXYA 1W13U 4O9VA 4OGXA 2R2MB 1W14U 5T6FA 2FX4A 1F7ZA 1LPGB 2A5AA 4CREA 2OBQA 5A8ZA 3EA8A 1AUJA 1C2MA 1MZDA 1G2LA 4WMFA 1QB6A 5HM9A 1TE0A 1C5VA 3MWIU 3BG4C 2W3IA 3URCA 1LTOA 5J4SA 1GI7B 4FU8A 3GDSA 3IWMA 1HAPH 1QURH 1TB6H 1UVPA 1ZSJA 3A8AA 5EXNA 3EYDA 1P04A 3D49H 4CRBA 2J2UA 4OS4A 5JPMH 1PPEE 2WPJS 1XX9A 4JK5A 1K1JA 1PYTD 4IGDA 4IC5A 4WF8A 3F68H 5FPTA 2Z9JA 2FI3E 6GCHG 1GMCF 3A7ZA 1PQ8A 1D3DB 2GCTC 1WTHD 4MPUA 1K1LA 1BMMH 1PPHE 2I6SA 1MKWH 1ZRKA 1YF4A 5JBCS 4IN1A 2A7HA 1A3EH 1SGTA 1QL8A 1W10U 1P2MA 3VB4A 1TA2A 1V2LT 3M3SA 1GMHG 3UR6A 3T26A 2QV1A 1L2EA 3SU0A 2Y82A 2FYQA 1VR1H 2UWLA 1EZXC 3QWCH 2SGQE 3FZZA 3MH5A 3PM3A 4BTUB 3EA9A 1GMDG 2PKAA 1JBUH 4FUBA 5FHTA 3RM0H 1BJVA 3PROA 2P16A 1ZJDA 5FCKA 2BHGA 3UWJH 3UOPA 1SHHB 1VITH 2BYAX 2C90B 3RXQA 4CHAB 1FPCH 2BOHB 2ZFRH 5DP3A 4ABEA 1AI8H 4K60A 3S9AA 3SJIA 1EAUA 1O34A 2BDYA 2ZDAH 4O97A 3MO3A 1QR3E 1NFWA 1PYTC 5E8EH 4GVUA 3Q3KA 5LPEA 2H2ZA 2OQ5A 1O3AA 4DIIH 2QXGA 1BMLA 3ZYEA 1MU6B 3NPSA 2C8YB 2G52A 2P8OC 5FPYA 4K8YA 3E3TA 4DY7B 1HRTH 2ZA5A 3NKKA 4D9RA 3FP6E 1YM0A 3F9HA 3BTDE 4NFFA 3M5OA 2BY6X 1GI6A 1ZHPA 3KGPA 2A4GA 3PMAB 1O31A 1GJCB 1GDQA 4I32A 1TALA 1NU9A 4FUFA 3D62A 2SGPE 4MNXA 1GDNA 4X0WU 1FJSA 1A1RA 1Y59T 3A8CA 1ZMNA 4HI3A 2F9VA 2P3UB 2ULLA 3P95A 2Q6GA 5I46H 1O2RA 1GBTA 3ZZAA 2AMPA 2ODPA 4NSYA 1XUFA 2GGVB 1AZ8A 4Z0KA 1C5YB 1XUKA 4WH6A 1O2XA 3OY6U 1SVPA 2BDAA 4MPVA 1W0ZU 1P12E 1WSSH 4INLA 5EQQA 5LGOA 3CP7A 3GY5A 1Y3WA 3RLWH 1PPGE 4IW4E 4Y8ZA 5GCHG 1C5QA 3P8GA 3HPTB 1BIOA 3S7KB 2ZO3H 4ZKOU 1AUTC 1RXPA 1AE5A 1V2OT 2STAE 2C93B 2BQ7B 2ZG0H 1G3DA 2BDCA 4SGBE 1E35B 2BLOA 4TYDA 4BXWA 2ZHFH 1SFIA 2UWOA 1O3HA 2RA0A 2WPLS 5GCHF 2BXTH 4ABFA 5FPSA 1DSUA 3VPKA 1HAYB 4AOQA 3LH1A 2ZHWH 1EJAA 1O3OA 1Y8TA 2G4TA 1A5IA 3PTNA 1AU8A 2YNBA 2SGEE 2G00A 5B6OA 2D8WA 1GBKA 3RXJA 2Y7ZA 3MU0A 5DG6A 3RXIA 4U01A 1UCYK 3TNTA 3DFJA 1JIRA 2WPMS 1G37A 1E0FD 3KL6A 2VINA 5T6DA 1RTKA 3ZVGA 3E16B 1P2OA 4LZ4B 2VWLA 2C8XB 2WUCA 2ZHDA 2EEKA 5DP5A 1O2ZA 1UTNA 1RS0A 8ESTE 1THRH 1YLCA 1ZOMA 1TNJA 3TH4H 3D23A 4ISOA 1V2QT 2F9OA 1PPZA 1QQ4A 1DWCH 5EPYA 1ELBA 2R9PA 3VB5A 2OP9A 1WV7H 1RIWB 1D6WA 2WPIS 3NWUA 2BZAA 5EPNA 2PSYA 3M37A 2PKAB 5GXPA 1ANDA 1Z1IA 3STJA 1GGDB 1O2GH 1EJMA 3P8NA 3G01A 4UE7H 1GJ9B 2F3CE 2FOAA 4A7IB 3UUZA 5K7RA 1GVZA 1XM1A 2G5NA 3HGNA 4K5ZA 3O8RA 3ATWA 3SV7A 4X8UH 3MNSA 1HJ8A 1NT1A 1K1OA 2QYIA 2Z3CA 1ETRH 3ZVFA 3LJOA 1TNIA 3SUGA 1JIMA 3L6PA 1F0RA 3M5LA 3ODFA 3QLPH 2V3OH 3SJ9A 3T28A 3RXOA 4Y7AA 4D7FA 1O32A 1FLEE 1GHYH 1TAWA 2ZFTA 1XUJA 4DT7B 2ZU2A 4NA7A 3NXPA 3RC4A 1THPB 3STIA 1GL0E 1J17T 2QXHA 2FOFA 5SGAE 3F9FA 2AGGX 2R0KA 2WUBA 4BXSA 1SQTA 4I8KA 1LHGH 3H5CB 5JDUB 2XC4A 1YC0A 3A82A 1O3GA 2GMTC 1OWKA 1CA8B 1AN1E 3TLOA 2AIQA 1HAVA 1TIOA 1O5FH 2D26C 5EU8A 3V7TA 5DP4A 5A0AE 1CBWB 1K22H 1TA6A 1ZHMA 2XWAA 5GJ4B 1K1IA 3DFLA 2A5IA 1C1OA 4U2WA 4PROA 1HJ9A 1QRZA 1DT2A 3RXPA 1BOQA 1ZTJA 3HGPA 4KTSA 3SNCA 1CA0C 3PWCA 1UTKA 1BDAA 4NCYA 2JETB 5EQSA 3RXMA 2XW9A 1NRPH 1AIXH 2NU3E 3QDZB 1Y5AT 4WH8A 2P59A 3PLKA 1TX6A 2AIPA 5CHAC 3SI4H 1C5NH 3SUDA 1N6XA 1DITH 3A7YA 1TPAE 1Q31A 3L33A 3P8FA 3SNDA 2VWMA 1G2MA 1NPMA 1ESBA 4YOJA 1Z71A 1EZUC 1TRNA 4BANB 1TBZH 2Y81A 1J9CH 4X1RU 1IQNA 3GY6A 1BMNH 4F4OC 1SGDE 4B74A 1CE5A 4NGAH 3RU4T 1O5EH 1TWXB 1O5GH 3IG6B 1ZR0A 4KTCA 5EW2H 1WUNH 1HXFH 1SGNE 5JB9S 1O0DH 1G3EA 1NRNH 2UUFB 1O3LA 1OWEA 1FMGA 5T3HA 1PPFE 2CV3A 5AHGH 1UK2A 1HNEE 2OC7A 2ZTXA 3BTME 1P2NA 5H4IB 4WMEA 1HAZB 1MD8A 2TBSA 3GCNA 3FP8E 4Q80A 3LGIA 1SGRE 2R3UA 2H6MA 3T62A 2JH0D 1DWEH 2A45B 1KXEA 2J92A 4FU9A 2EI7A 1OWIA 4AG1A 1GVKB 1CGHA 2GKVE 1C2GA 1G32B 1TBRH 3I77A 4B2AA 3HK3B 3KF2A 1XUHA 1UCYH 3SGBE 2PUXB 2CJIA 1YPJH 3EGKH 1ESAA 1GBHA 1TPPA 3ZVCA 2V35A 3A80A 1N6YA 1QRXA 1J8AA 1L1GA 4OS1A 1SLUB 1W8BH 1QBNA 2FLBH 5T6GA 1QY6A 3VB7A 2ANKH 7GCHG 3SZNA 1ZJKA 1GWAA 1UO6A 1GBAA 4OGYA 1O3FA 1JRSA 4K2YA 5E0JA 1LKBA 1HAHH 1JMOH 2ZGXH 1G3BA 2PGBB 1UHBA 2AH4X 1ARBA 1AVWA 3BG8A 4WJG2 1ZLRA 3V0XA 5HGGA 2W7UA 4TWYA 3TU7H 4B76A 2G81E 2BLVA 1MKXH 3OX7U 4AYYB 5CE1A 3BTHE 1HIAA 4GUXA 2VGCC 1UVOA 1C2JA 2FOMB 2CHAC 1P0SH 2G51A 2Z3EA 1XUGA 2GV7A 3QGNB 1HXEH 6ESTA 1IHSH 2XBVA 1GHXH 3BIVH 3RXLA 1HB0B 4GHQA 1FPHH 3TPIZ 1TONA 5HMAA 1S81A 1BTUA 2UUYA 4Y8XA 2QXIA 1HJAC 1UTPA 3SQEE 2BZ6H 3SUEA 4X8SH 1C1PA 2Z7FE 2OD3B 2HLCA 2NU4E 2DE8A 5E0HA 1WOFA 5C1XA 2ZWLH 3RU4D 1BMAA 2UUJB 3LC3A 1BHXB 4INKA 4B2CA 1PPBH 2Z9LA 4FUHA 1BT7A 1LVMA 4IN2A 4I7YH 3GY7A 1C5LH 2BLWA 4AFUA 2A7JA 4Y11E 3KNXA 2O8TA 3HKIB 3PTBA 1GI1A 4I31A 1SLXB 2M5TA 3SOSA 4YESB 1GG6C 3VGCC 1Z8IB 1GBDA 4RN6A 2OC0A 1O2KA 1C5SA 4CH8B 4THNH 3GDUA 3ZVAA 1S6FA 3KQEA 1KSNA 1V2TT 1C5TA 3A7VA 4GSOA 2BY5X 4X8VH 1SL3A 4DJZB 1MKXK 2VVUA 3SV2H 1DUEA 2OC1A 5DP9A 1P05A 1D9IA 3MO6A 1OWJA 2AGEX 1GHAF 2FIRH 4Y71A 4YO9A 3VEQB 4Y0YE 1ELVA 2ANMH 1O5CB 1GI8B 3GY3A 4CRDA 2XWBI 3SHAH 5C2ZA 1O38A 1TNKA 1TMBH 2OXSA 4MDSA 1TNGA 3F6UH 3SV9A 2TRMA 2BDIA 2PGQB 4XOJA 3KCGH 2PSXA 1GBIA 1IQIA 4FUIA 2C8WB 2BY9X 5DP8A 1GHAG 2XBWA 2ZQ1A 1Q3XA 4NIYA 1OX1A 1DXWA 4VGCC 1JOUB 2B8OH 1UTJA 1MZAA 3RC5A 1DS2E 2WPKS 4K3JA 1QJ1B 4ISLA 2QXJA 1EAIA 1IQJA 2BDGA 1HAGE 4D8NA 2ALVA 4NWLA 3GDVA 1JWTA 1EP5A 2ZU1A 5FAHA 1KDQB 1GI5A 1SQAA 3LGTA 1C5PA 4MVNA 1P10A 1SGEE 4MNVA 3RXSA 2VU8E 4I33A 1KXFA 3BSQA 1WBGB 1ZTKA 2OCVB 3NUMA 2K1QA 1MTWA 1HDTH 3SO3A 1B0EA 1KTSB 2BXUH 2JH5D 3BF6H 1HFDA 2ZKSA 3GCTG 2XC0A 1HPGA 4WXIA 1BTPA 1H1BA 1YPGH 5FX5A 1SHYA 5DPAA 1MCVA 2HNTE 1E34B 8GCHG 1BTYA 1G30B 1T8MA 1V3XA 1O3CA 6CHAC 4ZAEA 1DY8A 3SU3A 2SNWA 4YTAA 4B1TA 4Y0ZE 1BRCE 2Z6BD 2VVVA 1CQQA 1QBOA 1TLDA 1Q2WA 4OS6A 5C1UA 1DOJA 4XBDA 1BRAA 1D4PB 3K9XB 1GJDB 2WINI 3E0NB 3E90B 1O37A 2QAAA 4X6NA 3SJ8A 5TJXA 1P3CA 1EPTC 4MPXA 1UJ1A 1KXDA 3ESTA 3CENA 1DFPA 2P3TB 3A84A 3DA9B 2VIWA 2WYGA 1GHBF 4HTCH 1O3MA 1ZTLA 3RP2A 3RXVA 1ELEE 4FUCA 2BOKA 4X1PU 4AZ2B 4OS7A 3RXRA 1GI4A 5E2OA 4X6PA 1TGTA 3LC5A 1DSTA 2CN0H 2F9PA 1LPKB 1FY3A 2HGTH 2YOLA 1CO7E 2HRVA 2Y7XA 1GDUA 1L1JA 1UTQA 1A5HA 1EZSC 2ESTE 3V13A 1A5GH 4AFSA 2HALA 2ZFQH 1NROH 3RMOH 5L2ZH 1MH0A 2A4OA 2A4QA 2HWLB 4ABAA 1C2IA 3MOCA 4Y79A 3GCOA 3SV6A 2JKHA 2ANYA 2ZDLA 3BG4B 2A31A 3LGWA 4R8TB 2ZC9H 1C2DA 1V2NT 1EJNA 1ANEA 1ZRBA 1BCUH 2ZNKH 4RKOB 4YT7H 2Y6TA 4YT6H 3FVFB 1C1QA 1GI2A 1EZQA 1C9PA 2XXLA 3VB3A 1BITA 3L3TA 1Y3YA 2SFAA 2ZHQH 4CBOA 3HATH 3MU1A 4X6OA 2PUQH 1V2KT 2VIPA 3ZZCA 1PJPA 1AWHB 1C1WH 2OLGA 2P3FH 2B5TB 1ZSKA 3VFEA 1U6QA 2BDHA 5L30H 1QRWA 1V2ST 3A8BA 2BD9A 3BEFB 4X6MA 1YPHE 4WVPE 3BN9A 3LH3A 1SGCA 1C5RA 2ZFPH 1S0RA 4MQAA 2OQUA 2F9BH 3TH3H 8LPRA 1AGJA 2GD4B 2QY0B 2ZDKA 2C4FH 2FO9A 1W3CA 1EOLA 1OYTH 2TGAA 1HYLA 2V0BA 1FY1A 1T4UH 2HPPH 3MNBA 2BVXH 2ZZUH 3DD2H 1ANCA 5HYOA 4ZMAH 2ZU4A 3MFJA 3SV8A 2ILNA 4I8GA 5C67A 1B0FA 3ZV8A 2PW8H 2VIOA 5FBIA 1OWHA 3NCLA 2EI6A 1FIZA 1TMTH 3TK9A 1TNLA 3MI4A 9ESTA 2VNTA 1KLTA 3FZDA 1C1RA 1FY4A 1H9IE 2Y5GA 1FAXA 5DJ7A 2VH0A 2FPZA 1CGIE 2Q6DA 1A4WH 2Z9IA 1C2KA 3RXHA 3SGAE 2ZFFH 1SB1H 3MNXA 1GJ6A 1P8VC 3KQDA 5L2YH 4NSVA 3QK1A 1IOEA 1P9UA 3AAUA 3IITA 4BAOB 1C1UH 4D9QA 1VGCC 2BVRH 1NFXA 1C4U2 1MD7A 3M7UA 1LHDH 3SU2A 1C5OH 1TPSA 1UVSH 3SU6A 3DT0H 1E37B 3GCTF 4TY6A 4GPGA 3S9CA 1GBCA 1ZGIA 4NFEA 1TRMA 5EOKA 3GISB 2GV6A 3SU4A 2I6QA 2ZGJA 1SGPE 1GCTB 1SMFE 1P57B 2JH6D 4IMQA 1O3NA 2W7SA 1L0ZA 2HPQH 4YLQH 1D3TB 2FP7B 1EB2A 3LU9B 3AW0A 1GI3A 4K1TA 3TK5A 3TJNA 1BJUA 2A1DB 1DVAH 4Y7BA 3A89A 4FVBA 3RUOA 1UVUH 5LPFA 2BM2A 2WPHS 4E06H 3RXUA 1G9IE 2WV5A 1V2WT 3A81A 1C5ZB 1C5WB 1KYNA 1NRSH 4NIVA 1HAVB 3FAOA 1CT0E 3O8DA 2GDDA 2ZPRA 1X7AC 1TX8A 5DO4H 1CBWC 1SGFA 1HAOH 3RXBA 4X1SU 1A61H 3ATLA 2FS8A 2FTLE 4X1NU 3PO1B 1AE8H 2FDAA 2HNTF 2QF0A 1BRUP 3Q77A 1CGJE 1QNJA 1ELAA 3B23B 3U1IB 4GLYA 1TQ7B 4CH2B 3U8RH 2GT8A 3A7XA 1KXAA 4YOIA 1DLEA 4Q7XA 2C3SA 3KHVA 3UIRA 4DIHH 1OSSA 4UONA 3SUFA 1QB9A 1O2SA 4E7RG 1MTNC 3E1XB 3E8LA 2WYJA 3URDA 1EP6A 1C2HA 1MTUA 3PMJA 5JBTA 3ATIA 3UR9A 1NU7B 3BTEE 4JZ1A 4K1EA 2QGRA 2O8UA 1V2MT 3A7TA 5ABWA 1BZXE 1QFKH 3T2NA 3MH4A 1ZPZA 1O3JA 1AVXA 1C2FA 1YPEH 1Z8RA 2ODYB 1QA7A 2F9UA 1S6HA 1T4VH 3TIUA 3U9AH 3M5NA 1NESE 1N1LA 1O2NA 4NZQA 3BTQE 4AORA 1GMDF 5JYIA 1DXPA 2FWWA 5A0BA 2AS9A 3SGQE 3RMMH 1WQSA 2FMJA 3MYWA 1ZZZA 1P2JA 4ZKRU 3RXKA 2FOBA 4ABIA 1P06A 3A85A 4MNYA 3RXTA 1DPOA 3SJOA 1L4ZA 3MHWU 3B9FH 3GCHB 3RXDA 3MO9A 4FUDA 7GCHF 2VIVA 3U1JB 1J14A 2EC9H 1SPJA 1YP9A 2R2WU 5DKMA 2HOBA 2A2QH 2TGTA 4H4FA 3GCHC 2QF3A 3QN7A 3V12A 1O2TA 3P6ZB 4K8BA 1TMUH 3QO6A 1L1NA 4ZKSU 5AVDA 2V3HH 5E0GA 1RGQA 1DDJA 1O5DH 4K69A 2QCYA 5E2PA 3KEEA 4NA8A 1C4Y2 1ZYOA 1NC6A 2P8OB 1O2JA 1RRKA 2ZU3A 1GJBB 4FUEA 2BY7X 1KLIH 4VGCB 1UTLM 2RDLA 3OSYA 2XCNA 1GBBA 1P9SA 2J38A 4TWWA 1NRQH 4Y10E 2A0QB 1ELDE 1EATA 2P95A 3QZRA 1MUEB 1MAYA 4GCHF 4A1VA 4WY3A 1AVGH 1TABE 2ZF0H 5C5NA 1AD8H 2CXVA 4F49A 1O2PA 1ZGVA 5FXLA 3T25A 1YKTA 1MKWK 1QJ6B 4Y76A 2FS9A 4XBBA 4BAMB 1LVOA 4HZHA 4LZ1H 3AW1A 3W94A 1LDTT 1O35A 4BNRA 3BTWE 3RC6A 1ELCA 3GYLB 1K1MA 3ZVEA 4O3UA 2ASUB 3KN2A 4IS5A 1KDQA 1ZHRA 1O2OA 4FUJA 5ESBA 2XTTB 1WU1A 5C5OA 1S83A 1C5MD 1SGQE 4SGAE 1OXGA 2KAIB 4KP0A 2J95A 5F03A 1BTWA 4UDWH 3GY2A 2ODQA 4IC6A 2STBE 3HKJB 3A83A 1PQAA 1FUJA 2CGAA 1GI9B 5PTPA 1NY22 3ZZ3A 3S69A 2PFEA 1O33A 1ELGA 2ZTYA 1SBWA 1AQ7A 3LDXH 4OS2A 2BX3A 1KIGH 1OOKB 1Z8GA 1IQGA 1EAXA 2R3YA 1O30A 4FU7A 4LOYH 1O5BB 4X2WA 1C5UA 2XNIA 1Z1JA 4JYVH 1EUFA 1GBFA 2BY8X 1VITF 3UY9A 2OINA 1OS8A 1GCTC 2BDBA 1HBTH 2G5VA 2V6NA 3W95A 1HIAB 2HNTC 2AMQA 2H5CA 3A88A 3TNSA 3ATMA 1TGCA 4YLUA 3ITIA 5CMXH 3BTGE 3TJVA 2A5KA 2TGPZ 3MH7A 5A09A 2KAIA 3SNEA 1VZQH 1O3BA 3LPRA 2ZPSA 4IMZA 3LGYA 2D2DA 2O8MA 2R0LA 3BTFE 4LK4A 2IJOB 2W3KA 1LHCH 2VIQA 1GBLA 1S82A 2LPRA 1TGNA 4A6LA 3Q00A 4ZXXH 1FN8A 3P92A 2RCEA 1C1TA 2AEIH 2VJ1A 3B8JA 3E6PH 1SOZA 1LCYA 2OUAA 1B5GH 4H6SB 5GWZA 1SLWB 4FXGH 5FBEA 3EAJA 4CBNA 2OBOA 3KQCA 4YOGA 4GAWA 1MU8B 3K65B 3SNBA 2ZECA 1WAYB 4B73A 1DICA 1IQHA 3QTOH 3SU5A 5C1YA 1XUIA 3FANA 1SC8U 5GDSH 1LO6A 1VJAU 1FAKH 4AGJA 3M36A 1ELFA 1FI8A 5HM2A 2BD4A 1N8OC 2BMGB 5GPIB 1W7GH 4K1SA 3S0NA 1P2QA 3AAVA 1GHVH 1SG8B 1QB1A 5AFYH 3RMNH 2DE9A 1TX7A 2NU2E 1BBRE 2PKSC 4GHTA 3F1SB 4ZXYH 5I25A 1C5XB 1S0QA 3AVZA 4J1YA 2XRCA 4AG2A 1O2UA 5DGJA 1GCDA 1CVWH 1FZZA 4JYUH 4LXBH 1T31A 2NU1E 1SGYE 4ZKNU 3SI3H 3M7TA 4A1TA 4AN7A 2J94A 2FOEA 1RIWC 2BB4A 1YPLH 1Z8JB 5EODA 3JZ1B 1IAUA 1HV7A 1O3EA 3H7TA 1KY9A 3K6ZA 4XSKU 3T27A 1HJAB 4ZHLU 1HLTH 2BD3A 1CA0B 3FP7E 1GMHF 2AFQB 1V2JT 5FCRA 2F91A 1SQOA 4O03A 3SORA 3ZZ5A 2FESH 3CS0A 1FN6A 1ZMLA 2PWXA 3O8CA 1VGCB 5K0HA 1O2MA 2GZ7A 3OYPA 1AO5A 4BOHA 1W7XH 3A86A 4WMDA 4BAQB 1MTSA 2BLQA 2Y80A 3A7WA 1IQFA 4H42U 1HAIH 1LPZB 4D76A 1GG6B 2ZHEH 3VGCB 1EXFA 1ABIH 2GTBA 1P11E 4DOQA 1OP8A 2AYWA 1RD3B 1TYNA 2BTCE 3BV9B 4ABHA 4A5TS 1GI0A 1MTVA 1HCGA 4NIXA 1S84A 3RXCA 2FOCA 5G4BA 3TGKE 3D65E 1XVMA 2G4UA 2SGDE 7ESTE 3C27B 4UEHH 3GOVB 2GDEH 1OP2A 3ZZ7A 3RXAA 3T29A 4DG4A 5ETXA 2IOTA 1YYY1 1O3DA 4HGCA 2VH6A 4MNWA 3SN8A 4IBLH 1O2IA 3E91A 1YGCH 2UUKB 1DM4B 2H1UA 5LPRA 1EQ9A 1F5KU 2RG3A 1Z6JH 3RLYH 1MCTA 1THSH 1ABJH 1ID5H 1K1NA 2ZPQA 3BIUH 4RKJB 1SI5H 1SGIB 1XKBC 4ABGA 7LPRA 3U98H 1XVOA 1B7XB 1FY5A 1DUAA 1QQUA 1ESTA 4Q7YA 3MMGA 5HXFA 1CHGA 1F92A 1DY9A 4I8JA 4CRCA 2GT7A 1IHTH 1SSXA 2JETC 1H9HE 3ODDA 4U32A 1CHOG 2FOGA 5EW1H 4A92A 1AB9B 1ARCA 3GY4A 1O3KA 1TGBA 3PV4A 8KME2 2H9TH 2H9HA 5F6MA 1ZSLA 1FNIA 4CR5A 1GJAB 3EE0B 1NO9H 4ABBA 2FM2A 4CHAC 1IQLA 2ZFSA 2TIOA 2A2XH 1JRTA 1H8IH 1UCYE 1G3CA 4HFPB 4KELA 2GZ8A 2BD7A 1F5RA 1GBJA 5F8TA 1TBQH 2H5DA 5EGMA 4X1QU 2CF8H 2THFB 1O36A 2ZGHA 1CT4E 1FIWA 2ZCKP 1F2SE 1H9LB 1TOCB 4ABJA 2PTCE 3LONA 3ZZ9A 1UMAH 3UQVA 4MG3A 3SW2B 3ZZBA 1EPTA 4ABDA 1T8NA 2ZTZA 4BTTB 1BB0B 3EDXB 3GICB 3PLBA 1LHFH 3BTTE 1NS3A 1AWFH 2AGIX 1TPOA 1GBEA 1SOTA 1GHWH 1LHEH 2CHAB 2GZ9A 2Z94A 3LGVA 4X2YA 4ZH8A 3NK8A 4ISIH 1PPCE 1SLVB 2J9NA 3I78A 3Q76A 1GHBG 1O3PB 3S7HB 1NN6A 4JZDH 4TPYA 2J4IA 2A4RA 4CRFA 1Y3VA 3MU8A 1P09A 1ACBE 1K2I1 3U8TH 3DUXH 1LVYA 3TK6A 1QHRB 3SNAA 2FLRH 2Z9GA 2NU0E 4R0IA 1O2WA 1W0YH 1YCPH 4E05H 1CSOE 2B9LA 2BD2A 1ZMJA 1C1VH 4BAHB 5L6NH 2O8LA 2FYRA 1WQVH 2TPIZ 1NFYA 3P8OA 1DLKB 1RTFB 2BVSH 3GYMA 3PLPA 1ELTA 1Y5BT 5JBBS 1GL1A 1H4WA 4ASHA 2TGDA 3UPEA 1GPZA 4JCNA 1SR5C 1ORFA 1VCWA 3OU0A 4B71A 1D3PB 9LPRA 1EASA 3M3TA 3PWBA 3LIWA 2PV9B 4DGJA 1WCZA 1YCPM 4UFEH 1MMJN 1XKAC 1J15A 1GJ7B 1QIXB 3V3MA 4ZHMU 1A0HB 2FOHA 1W2KH 3P17H 3UNRA 1ZPBA 1A46H 4AGKA 5AF9H 2Z9KA 3TJOA 1ANBA 1JXPA 2GCTB 3DHKH 2FXRA 4D7GA 1EAWA 1QL7A 1A7SA 3SU1A 2LNCA 1BTHH 3K2UA 1UHBB 2ZDNA 4INHA 2ZIQH 3T5FH 1O39A 2G8TA 1Y5UT 2ZGCA 4UD9H 4KGAA 1OP0A 4XFQA 7KMEH 2ALPA 3VXEH 2SNVA 3E0PB 4B2BA 1C4V2 1MQ6A 1VCPA 3UOUA 3NZIA 1Y3XA 1TRYA 3BTKE 3K6YA 2ZDMA 1O2LA 1UVTH 5EXLA 2XBYA 1WYKA 3TGJE 3A87A 3QX5H 1F0SA 1P01A 1M9UA 4I8LA 3UTUH 3JZ2B 5A8XA 3MH6A 2FZZA 2BD5A 3R3GB 1QJ7B 3F9EA 3UQOA 3ZVDA 1AFQC 1MTNB 4Q7ZA 5EG4A 3SJKA 2J34A 1G36A 1SGFG 1HUTH 2OTVA 2XC5A 4YM9A 4MPWA 3BEIB 1NM6A 4GCHG 4MTBA 1YBWA 2GVFA 1FV9A 4NIWA 4OS5A 1P2KA 2SGAA 1BUIA 1AFQB 2AERH 5FX6A 3OY5U 1KTTB 4DVAU 1V2RT 2BQ6B 2VWOA
chains in the Genus database with same CATH superfamily
2SGFE 1UK3A 4WXVA 2FEQH 1E36B 1Y3UA 1HAXB 1VJ9U 1IQKA 4AYVB 2F9NA 2IPQX 4YZUA 4ISNA 1EKBB 4X8TH 1QBVH 3MU4A 1W12U 3M3VA 3N7OA 1CU1A 4WWYA 2F83A 5IDKA 1V2UT 1NTPA 4JYTA 4ESTE 1C2LA 4KKDA 1TGSZ 1YPHC 1QA0A 3MQKC 2V7QD 2VVCA 2W26A 2Y5HA 3KQBA 2EI8A 3UFAA 1VCQA 1T8OA 4DURA 3LJJA 1DE7H 3PB1E 5EQRA 3RDZA 4ISHH 1GJ8B 2ZCHP 1PFXC 4DT4A 1TNHA 5AFZH 1F0UA 2PHBA 5TCAA 2FODA 4DCDA 3TH2H 3C1KA 1C9TA 1D6RA 3OTJE 2ZI2H 1DX5M 1IQEA 1DWDH 4FUGA 5KGOA 3LKWA 3PO1C 1P03A 2PR3A 4BTIB 2HLDD 1WTGH 1OKXA 2XBXA 2O9QA 3TVJB 4NZLA 3QTVH 1N8OB 3FFGA 3ZV9A 2ZGBH 2QC2A 1E38B 1KXCA 1C2EA 1HGTH 1P2IA 3SBKA 2LP6A 1LKAA 2Q1JA 5A0CA 3I29A 2HVXA 2EA3A 1EPTB 5J4QA 1P02A 1BRBE 2P94A 3P70B 1TQ0B 2PLXA 4XBCA 1BHXF 3O8BA 4ZCNA 1BA8B 1KLJH 1QTFA 2GMTB 5ESTE 1H8DH 3EQ0H 3ZZDA 1K1PA 4JZIA 3WY8A 3RMLH 1ETTH 1BTZA 3M7QA 2VIDA 2ZCLP 4NA9H 2GP9B 3F9GA 4RSPA 1GMCG 4X2XA 4XDEA 1GBMA 5IYTA 3U69H 3M35A 1RTLA 3LT3A 3M61U 4JMYA 2VGCB 1FY8E 3SQHE 2PTNA 4UFFH 3R0FA 4AX9H 4TY7A 1EB1H 3A8DA 1S85A 1K9OE 1FQ3A 3ENSB 4Q63A 1MAXA 3SZEA 8GCHF 4JK6A 3UNSA 3CS7A 2UWPA 1AHTH 1BQYA 1O3IA 1YLDA 1RFNA 5EXMA 4CR9A 4Z6AH 4Y8YA 2A32A 1DANH 3MNCA 3PMBB 2ZP0H 3ZVBA 4CRGA 1NZQH 1T8LA 5F8ZA 1YPMH 2P93A 1V6DA 3TGIE 1EX3A 3MU5A 2YNAA 4JZFH 1GGDC 1QGFA 1NFUA 5A2MH 4AFZA 1QCPA 1UK4A 3RXEA 1AZZA 2RDEA 3VXFH 1YPKH 1O2VA 1BTXA 2AMDA 1YCPK 3LOXA 6LPRA 2KM0A 1AY6H 2VWNA 1S5SA 3PMHB 2A7CA 1GHZA 1K21H 5A8YA 4ZROA 5JBAS 4UFDH 1BBRH 1SFQB 1EOJA 4U30A 4NG9H 4AB8A 1LVBA 5BRRE 3HK6B 3F0PA 3TJUA 2IPHA 1O2QA 6GCHF 2OC8A 1NBME 2ZU5A 3H09A 4XE4A 5LH8A 4TSFD 1F0TA 3PYHA 4MLFB 1A3BH 1LMWB 4AFQA 3LGUA 3UWIA 4QT8C 2DUCA 1AKSA 2QIQA 1BBRK 2PKSB 2B0FA 3EA7A 1V2PT 1AB9C 5BPEA 2EY4C 2ZDVH 1OYQA 4NWKA 2Z3DA 2RA3A 2IN2A 1XMNB 3ZZ8A 2BQWB 1Z6EA 1L4DA 2GX4A 1V2VT 4Y6DA 1QL9A 3KIDU 5C3NA 5DP7A 1T7CA 1SKYE 4O3TA 2FX6A 4UFGH 3GY8A 5DK1A 1P3EA 1PQ7A 2ZEBA 1W11U 3N99A 3ELAH 4Q2KA 2YMSB 3ZZ6A 2XCFA 1FDPA 4DW2U 1VITG 4B75A 2D1JA 1XXDA 2ZQ2A 2CF9H 1IQMA 1C1MA 2FI4E 2G55A 3QGJA 1ZPCA 3SHCH 3UNQA 1PQ5A 3S9BA 3MTYA 1AKSB 5TCCA 1F5LA 5CHAB 4YXWD 1A2CH 3H7OA 4ZHAA 1LQEA 2QN5T 2WV4A 2WV9A 4I8HA 1GJ5H 4KTUA 3TITA 2VBCA 5C20A 3RXFA 4AB9A 1AFEH 1MQ5A 3M5MA 3Q3YA 3QZQA 1TOMH 2Q6FA 1GVLA 1RJXB 1C1NA 1KXBA 2BX4A 4FVDA 1XXFA 1OWDA 2H9EH 6CHAB 2VB0A 1J16A 2CMYA 4X2VA 5GIBA 5C0UA 1TFXA 4E7NA 1INCA 2NWNA 4M7GA 4F55A 2W5EA 2Y5FA 5GNDA 1NRRH 1UTMA 2GCHG 1MBMA 2QA9E 3VB6A 4JZEH 1O2YA 4CRAA 4TPIZ 1O2HA 4ZUHA 2O8WA 3ZZ4A 2XYAA 3UREA 1UTOA 2ANWA 3QUMP 1T32A 1Z7KA 1FONA 4J2YB 3RXGA 4B6FA 3RM2H 1LQDB 2BD8A 5DP6A 3RU4E 1AMHA 5JB8S 2FTMA 1MBQA 1K28D 4A1XA 1DWBH 3ATKA 3U8OH 1CHOF 3ZYDA 2GCHF 2C8ZB 5F8XA 1CT2E 1D3QB 3AASA 1ETSH 1GJ4H 1C1SA 3Q3XA 5IK2D 2FI5E 4BAKB 1OPHB 1A0LA 2B7DH 3BEUA 1A0JA 1O5AB 4H6TA 1FXYA 3PRDA 1W13U 4O9VA 4OGXA 2R2MB 1W14U 5T6FA 2FX4A 1F7ZA 1LPGB 2A5AA 4CREA 2OBQA 5A8ZA 3EA8A 1AUJA 2KCOA 1C2MA 1MZDA 1G2LA 4WMFA 1QB6A 5HM9A 2JIZD 1TE0A 3CNRA 1C5VA 3MWIU 3BG4C 2W3IA 3URCA 1LTOA 5J4SA 1GI7B 4FU8A 3GDSA 3IWMA 1HAPH 1QURH 1TB6H 1UVPA 1ZSJA 3A8AA 5EXNA 3EYDA 1P04A 2QF5A 3D49H 5C0TA 4CRBA 2J2UA 4OS4A 5JPMH 1PPEE 2WPJS 1XX9A 4JK5A 1K1JA 1PYTD 4IGDA 4IC5A 4WF8A 3F68H 5FPTA 2Z9JA 2FI3E 6GCHG 1GMCF 3A7ZA 1PQ8A 1D3DB 2GCTC 1WTHD 4MPUA 1K1LA 1BMMH 2XOKD 1PPHE 2I6SA 1MKWH 1ZRKA 1YF4A 5JBCS 2M2AA 4IN1A 2A7HA 1A3EH 1SGTA 1QL8A 1W10U 1P2MA 3VB4A 1TA2A 1V2LT 3M3SA 1GMHG 3UR6A 3T26A 2QV1A 1L2EA 3SU0A 2Y82A 2FYQA 1VR1H 2UWLA 1EZXC 3QWCH 2SGQE 3FZZA 4I86A 3MH5A 3PM3A 4BTUB 3EA9A 1GMDG 2PKAA 1JBUH 4FUBA 5FHTA 3RM0H 1BJVA 3PROA 2P16A 1ZJDA 5FCKA 2BHGA 5T1VA 3UWJH 3UOPA 1SHHB 1VITH 2BYAX 2C90B 3RXQA 4CHAB 1FPCH 2BOHB 2ZFRH 5DP3A 4ABEA 1AI8H 4K60A 3S9AA 3SJIA 1EAUA 1O34A 2BDYA 2ZDAH 4O97A 3MO3A 1QR3E 1NFWA 1PYTC 5E8EH 4GVUA 3Q3KA 5LPEA 2H2ZA 2OQ5A 1O3AA 4DIIH 2QXGA 1BMLA 3ZYEA 1MU6B 3NPSA 4RT1A 2C8YB 2G52A 2P8OC 5FPYA 4K8YA 3E3TA 4DY7B 1HRTH 2ZA5A 3NKKA 4D9RA 3FP6E 1YM0A 3F9HA 3BTDE 4NFFA 3M5OA 2BY6X 1GI6A 1ZHPA 3KGPA 2A4GA 3PMAB 1O31A 1GJCB 1GDQA 4I32A 1TALA 1NU9A 4FUFA 3D62A 2SGPE 2JDID 4MNXA 1GDNA 4X0WU 1FJSA 1A1RA 1Y59T 3AK5A 3A8CA 1ZMNA 4HI3A 2F9VA 2P3UB 2ULLA 3U28C 3P95A 2Q6GA 5I46H 2IJD1 1O2RA 1GBTA 1WXRA 3OAAD 3ZZAA 2AMPA 2ODPA 4NSYA 1XUFA 2GGVB 1AZ8A 4Z0KA 1C5YB 1XUKA 4WH6A 1O2XA 3OY6U 1SVPA 5KEDA 2BDAA 4MPVA 1W0ZU 1P12E 1WSSH 4INLA 5EQQA 5LGOA 3CP7A 1W0JD 3GY5A 1Y3WA 3RLWH 1PPGE 4IW4E 4Y8ZA 5GCHG 1C5QA 3P8GA 3HPTB 1BIOA 3WW7A 3S7KB 2ZO3H 4ZKOU 1AUTC 1RXPA 1AE5A 1V2OT 2STAE 2C93B 2BQ7B 2ZG0H 1G3DA 2BDCA 4SGBE 1E35B 2BLOA 4TYDA 4BXWA 2ZHFH 1SFIA 2UWOA 1O3HA 2RA0A 2WPLS 5GCHF 2BXTH 2L74A 4ABFA 5FPSA 1DSUA 3VPKA 1HAYB 4AOQA 3LH1A 2ZHWH 1EJAA 1O3OA 1Y8TA 2G4TA 1A5IA 3PTNA 1AU8A 2YNBA 2SGEE 2G00A 5B6OA 2D8WA 1GBKA 3RXJA 2Y7ZA 3MU0A 5DG6A 3RXIA 4U01A 1H8HD 1UCYK 3TNTA 3DFJA 1JIRA 2WPMS 1G37A 1E0FD 3KL6A 2VINA 5T6DA 1RTKA 3ZVGA 3E16B 1P2OA 4LZ4B 2VWLA 2C8XB 2WUCA 2ZHDA 2EEKA 5DP5A 1O2ZA 1UTNA 1RS0A 8ESTE 1THRH 1YLCA 1ZOMA 1TNJA 3TH4H 3D23A 4ISOA 1V2QT 2F9OA 1PPZA 1QQ4A 1DWCH 5EPYA 1ELBA 2R9PA 2KX4A 3VB5A 2OP9A 1WV7H 1RIWB 1D6WA 2WPIS 3NWUA 2BZAA 5EPNA 2PSYA 3M37A 2PKAB 5GXPA 1ANDA 1Z1IA 3STJA 3DSPA 1GGDB 1O2GH 1EJMA 3P8NA 3G01A 4UE7H 1GJ9B 2F3CE 1WDIA 2FOAA 4A7IB 3UUZA 5K7RA 1GVZA 1XM1A 2G5NA 3HGNA 4K5ZA 3O8RA 3ATWA 3SV7A 4X8UH 3MNSA 1HJ8A 1NT1A 1K1OA 2QYIA 2Z3CA 1ETRH 3ZVFA 3LJOA 1TNIA 3SUGA 1JIMA 3L6PA 1F0RA 3M5LA 3ODFA 3QLPH 2J97A 2V3OH 3SJ9A 3T28A 3RXOA 4Y7AA 4D7FA 1O32A 1FLEE 1GHYH 1TAWA 1YLNA 2ZFTA 1XUJA 4DT7B 2ZU2A 4NA7A 3NXPA 3RC4A 1THPB 3STIA 1GL0E 1J17T 2QXHA 2FOFA 5SGAE 3F9FA 2AGGX 2R0KA 2WUBA 4BXSA 1SQTA 4I8KA 1LHGH 3H5CB 5JDUB 2XC4A 1YC0A 3A82A 1O3GA 2GMTC 1OWKA 1CA8B 1AN1E 3TLOA 2AIQA 1HAVA 1TIOA 1O5FH 2D26C 5EU8A 3V7TA 5DP4A 5A0AE 1CBWB 1K22H 1TA6A 1ZHMA 2XWAA 5GJ4B 1K1IA 3DFLA 2A5IA 1C1OA 4U2WA 4PROA 1HJ9A 1QRZA 1DT2A 3RXPA 1BOQA 1ZTJA 3HGPA 4KTSA 3SNCA 1QZ8A 1CA0C 3PWCA 1UTKA 1BDAA 4NCYA 2JETB 5EQSA 3RXMA 2XW9A 1NRPH 1AIXH 2NU3E 3QDZB 3F3BA 1Y5AT 4WH8A 2P59A 3PLKA 1TX6A 2AIPA 5CHAC 3SI4H 1C5NH 4AC9A 3SUDA 1N6XA 1DITH 3A7YA 1TPAE 1Q31A 3L33A 3P8FA 3SNDA 2VWMA 1G2MA 1NPMA 1ESBA 4YOJA 1Z71A 1EZUC 1TRNA 4BANB 1TBZH 2Y81A 1J9CH 4X1RU 1IQNA 3GY6A 1BMNH 4F4OC 1SGDE 4B74A 1CE5A 4NGAH 3RU4T 3F2GA 1O5EH 1TWXB 1O5GH 3IG6B 1ZR0A 4KTCA 5EW2H 1WUNH 1HXFH 1SGNE 5JB9S 1O0DH 5DN6D 1G3EA 1NRNH 2UUFB 1O3LA 1OWEA 1FMGA 5T3HA 1PPFE 2KCPA 2CV3A 5AHGH 1UK2A 1HNEE 2OC7A 2ZTXA 3BTME 1P2NA 5H4IB 2J5UA 4WMEA 1HAZB 1MD8A 2TBSA 3GCNA 3FP8E 4Q80A 3LGIA 2V3MA 1SGRE 2R3UA 2H6MA 3T62A 2JH0D 1DWEH 2A45B 1KXEA 3GS9A 2J92A 4FU9A 2EI7A 1OWIA 4AG1A 2K8IA 1GVKB 1CGHA 2GKVE 1C2GA 1G32B 1TBRH 3I77A 4B2AA 3HK3B 2J98A 3KF2A 1XUHA 1UCYH 3SGBE 2PUXB 2CJIA 1YPJH 3EGKH 1ESAA 1GBHA 1TPPA 1SQRA 3ZVCA 2V35A 3A80A 1N6YA 1QRXA 1J8AA 1L1GA 4OS1A 1SLUB 3PV2A 1W8BH 1QBNA 2FLBH 5T6GA 1QY6A 2KCYA 2ANKH 1UW7A 3VB7A 7GCHG 3SZNA 1ZJKA 3F0OA 1GWAA 1UO6A 4ACAA 1GBAA 4OGYA 1O3FA 1JRSA 4K2YA 5E0JA 1LKBA 1HAHH 1JMOH 2ZGXH 1G3BA 2PGBB 1UHBA 2AH4X 1ARBA 1AVWA 3BG8A 4WJG2 1ZLRA 3VG8A 3V0XA 5HGGA 2W7UA 4TWYA 3TU7H 4B76A 3W1EA 2G81E 2BLVA 1MKXH 3OX7U 4AYYB 5CE1A 3BTHE 2OK5A 1HIAA 4GUXA 2VGCC 1UVOA 1C2JA 2FOMB 2CHAC 1P0SH 2G51A 2Z3EA 1XUGA 2GV7A 3QGNB 1HXEH 6ESTA 1IHSH 2XBVA 1GHXH 3BIVH 3RXLA 2F43B 1HB0B 4GHQA 1FPHH 3TPIZ 1TONA 5HMAA 1S81A 1BTUA 2UUYA 4Y8XA 2QXIA 1HJAC 1UTPA 3SQEE 2BZ6H 3SUEA 4X8SH 1C1PA 2Z7FE 2OD3B 2HLCA 2NU4E 2DE8A 5E0HA 1WOFA 5C1XA 2ZWLH 3RU4D 1BMAA 2UUJB 3LC3A 1BHXB 4INKA 4B2CA 1PPBH 2Z9LA 4FUHA 1BT7A 1LVMA 4IN2A 5CDFE 4I7YH 3GY7A 1C5LH 2BLWA 4AFUA 2A7JA 4Y11E 3KNXA 2O8TA 3HKIB 3PTBA 1GI1A 4I31A 1SLXB 2M5TA 3SOSA 4YESB 1GG6C 3VGCC 1Z8IB 1GBDA 4RN6A 2OC0A 1O2KA 1C5SA 4P00A 4CH8B 4THNH 3GDUA 3ZVAA 1S6FA 3KQEA 1KSNA 2JJ1D 1C5TA 1V2TT 3A7VA 2BY5X 4GSOA 4X8VH 1SL3A 4DJZB 1MKXK 2VVUA 3SV2H 1DUEA 2OC1A 5DP9A 1P05A 1D9IA 3MO6A 1OWJA 2AGEX 1GHAF 2FIRH 4Y71A 4YO9A 3VEQB 4Y0YE 1ELVA 2ANMH 1O5CB 1GI8B 3GY3A 4CRDA 2XWBI 3SHAH 5C2ZA 1O38A 1TNKA 1TMBH 2OXSA 4MDSA 1TNGA 3F6UH 3SV9A 2QE7D 2TRMA 2BDIA 2PGQB 4XOJA 3KCGH 2PSXA 1GBIA 1IQIA 4FUIA 2C8WB 2BY9X 5DP8A 1GHAG 2XBWA 2ZQ1A 1Q3XA 4NIYA 1OX1A 1DXWA 4VGCC 1JOUB 2B8OH 1UTJA 1MZAA 3RC5A 1DS2E 2WPKS 4K3JA 1QJ1B 3F2FA 4ISLA 2QXJA 1EAIA 1IQJA 2BDGA 1HAGE 4D8NA 2ALVA 4NWLA 2HVYB 3GDVA 1JWTA 1EP5A 2ZU1A 3FO8D 5FAHA 1KDQB 1GI5A 1SQAA 3LGTA 3KYGA 1C5PA 4MVNA 4ACBA 1P10A 1SGEE 4MNVA 3RXSA 2VU8E 4I33A 1KXFA 3BSQA 1WBGB 1ZTKA 2OCVB 3NUMA 2K1QA 1MTWA 1HDTH 3SO3A 1B0EA 1KTSB 2BXUH 2JH5D 3BF6H 1HFDA 2ZKSA 3GCTG 2XC0A 1HPGA 4WXIA 1BTPA 1H1BA 1YPGH 5FX5A 1SHYA 5DPAA 1MCVA 2HNTE 1E34B 8GCHG 1BTYA 1G30B 1T8MA 1V3XA 1O3CA 6CHAC 4ZAEA 1DY8A 2W6ID 2SNWA 4YTAA 3SU3A 4Y0ZE 4B1TA 1BRCE 4XRNA 2Z6BD 2VVVA 1CQQA 1QBOA 1TLDA 1Q2WA 4OS6A 5C1UA 1DOJA 4XBDA 1BRAA 1D4PB 3K9XB 1GJDB 5B6LA 2WINI 3E0NB 3E90B 1O37A 2QAAA 4X6NA 3SJ8A 5TJXA 1P3CA 1EPTC 4MPXA 1UJ1A 1KXDA 3ESTA 3CENA 1DFPA 2P3TB 3A84A 3DA9B 2VIWA 2WYGA 1GHBF 4HTCH 1O3MA 1ZTLA 3RP2A 3RXVA 1ELEE 4FUCA 2BOKA 4X1PU 4AZ2B 4OS7A 3RXRA 1GI4A 5E2OA 4X6PA 1TGTA 3LC5A 1DSTA 2CN0H 2F9PA 1LPKB 1FY3A 2HGTH 2YOLA 1CO7E 2HRVA 1S6LA 2Y7XA 1GDUA 1COWD 1L1JA 1UTQA 5DSFA 1A5HA 1EZSC 5EJLA 2ESTE 3V13A 1A5GH 4AFSA 2HALA 2ZFQH 1NROH 3RMOH 5L2ZH 3NRLA 1MH0A 2A4OA 2A4QA 2HWLB 4ABAA 1C2IA 3KYFA 3MOCA 4Y79A 1NBMD 3GCOA 3SV6A 2JKHA 2ANYA 2ZDLA 3BG4B 2A31A 3LGWA 4R8TB 1K0HA 2ZC9H 1C2DA 1V2NT 1EJNA 2QF4A 1ANEA 1ZRBA 1BCUH 2ZNKH 4RKOB 4YT7H 2Y6TA 4YT6H 3FVFB 1C1QA 1GI2A 1EZQA 1C9PA 2XXLA 3VB3A 1BITA 3L3TA 1Y3YA 2SFAA 2ZHQH 4CBOA 5HKKD 3HATH 3MU1A 4X6OA 3N7DA 2PUQH 1V2KT 2VIPA 3ZZCA 1PJPA 1AWHB 1C1WH 3DSOA 2OLGA 2P3FH 2B5TB 1ZSKA 3VFEA 1U6QA 2BDHA 5L30H 1QRWA 1V2ST 3A8BA 2BD9A 3BEFB 3OTPA 4X6MA 1YPHE 4WVPE 3BN9A 3LH3A 1SGCA 1C5RA 2ZFPH 1S0RA 4MQAA 2OQUA 2F9BH 3TH3H 8LPRA 1AGJA 2GD4B 2QY0B 2ZDKA 2C4FH 2FO9A 1W3CA 1EOLA 1OYTH 2TGAA 1HYLA 2V0BA 1FY1A 1T4UH 2HPPH 3MNBA 2BVXH 2ZZUH 3DD2H 1ANCA 5HYOA 4ZMAH 2ZU4A 3MFJA 3SV8A 2ILNA 4I8GA 5C67A 1B0FA 3ZV8A 2PW8H 2VIOA 5FBIA 1OWHA 3NCLA 2EI6A 1FIZA 1TMTH 3TK9A 1TNLA 3MI4A 9ESTA 2VNTA 1KLTA 3FZDA 4RT0A 1C1RA 1FY4A 1H9IE 2Y5GA 1FAXA 5DJ7A 2VH0A 2FPZA 1CGIE 2Q6DA 1A4WH 2Z9IA 1C2KA 3RXHA 3SGAE 2ZFFH 1SB1H 3MNXA 1GJ6A 1P8VC 3KQDA 5L2YH 4NSVA 3QK1A 1IOEA 1P9UA 3AAUA 3IITA 4BAOB 1C1UH 4D9QA 1VGCC 2BVRH 1H8ED 1NFXA 1C4U2 1MD7A 3M7UA 1LHDH 3SU2A 1C5OH 1TPSA 2WZQA 1UVSH 3SU6A 3DT0H 1E37B 3GCTF 4TY6A 4GPGA 3S9CA 1GBCA 1ZGIA 4NFEA 2CK3D 1TRMA 5EOKA 3GISB 2GV6A 3SU4A 2I6QA 1OHHD 2ZGJA 1SGPE 1GCTB 1SMFE 1P57B 2JH6D 4IMQA 1O3NA 2W7SA 5C17A 1L0ZA 2HPQH 4YLQH 1D3TB 2FP7B 1EB2A 3LU9B 3AW0A 1GI3A 4K1TA 3TK5A 3TJNA 1BJUA 2A1DB 1DVAH 4Y7BA 5C94A 3A89A 4FVBA 3RUOA 1UVUH 5LPFA 2BM2A 2WPHS 4E06H 3RXUA 1G9IE 2WV5A 1V2WT 3A81A 1C5ZB 1C5WB 1KYNA 1NRSH 3OEED 4NIVA 1HAVB 3FAOA 1CT0E 3O8DA 2GDDA 2ZPRA 1X7AC 1TX8A 5DO4H 1CBWC 1SGFA 1HAOH 3RXBA 4X1SU 1A61H 3ATLA 2FS8A 2FTLE 4X1NU 3PO1B 1AE8H 2FDAA 2HNTF 2QF0A 1BRUP 3Q77A 4TT3D 1CGJE 1QNJA 1ELAA 3B23B 3SYJA 3U1IB 4GLYA 1TQ7B 4CH2B 3U8RH 2GT8A 3A7XA 1MABB 1KXAA 4YOIA 1DLEA 4Q7XA 3WWFA 2C3SA 3KHVA 3UIRA 4DIHH 1OSSA 4UONA 3SUFA 1QB9A 1O2SA 4E7RG 1MTNC 3E1XB 3E8LA 2WYJA 3URDA 1EP6A 1C2HA 1MTUA 3PMJA 5JBTA 3ATIA 3UR9A 1NU7B 2RFKC 3BTEE 4JZ1A 4K1EA 2QGRA 2O8UA 1V2MT 3A7TA 5ABWA 1BZXE 3OEHD 1QFKH 3T2NA 3MH4A 1ZPZA 1O3JA 1AVXA 1C2FA 1YPEH 1Z8RA 2ODYB 1QA7A 2F9UA 5FL7D 1S6HA 1T4VH 3TIUA 3U9AH 3M5NA 1NESE 1N1LA 1O2NA 4NZQA 3BTQE 4AORA 1GMDF 3OFND 5JYIA 1DXPA 2FWWA 5A0BA 2AS9A 3SGQE 3RMMH 1WQSA 2FMJA 3MYWA 1ZZZA 1P2JA 4ZKRU 3RXKA 5CHBA 2FOBA 4ABIA 1P06A 3A85A 4MNYA 3RXTA 1DPOA 3SJOA 1L4ZA 3MHWU 2EQNA 3B9FH 3GCHB 3RXDA 3MO9A 4FUDA 7GCHF 2WHXA 2VIVA 3U1JB 1J14A 3WWBA 2EC9H 1SPJA 1YP9A 2R2WU 5DKMA 2HOBA 2A2QH 2TGTA 4H4FA 3GCHC 2QF3A 3QN7A 3V12A 1O2TA 3P6ZB 4K8BA 1TMUH 3QO6A 1L1NA 4ZKSU 5AVDA 2V3HH 5E0GA 1RGQA 1DDJA 3FOAA 1O5DH 4K69A 2QCYA 5E2PA 3OE7D 3KEEA 4NA8A 1C4Y2 1ZYOA 1NC6A 2P8OB 1O2JA 1RRKA 2ZU3A 4Z1MD 1GJBB 4FUEA 2BY7X 1KLIH 4VGCB 1UTLM 2RDLA 3OSYA 2XCNA 1GBBA 1P9SA 1EFRD 2J38A 4TWWA 1NRQH 4Y10E 2A0QB 1ELDE 1EATA 2P95A 3QZRA 4RI0A 1MUEB 1MAYA 4GCHF 4A1VA 4WY3A 1AVGH 1TABE 2ZF0H 5C5NA 5HIZA 1AD8H 2YMSC 2CXVA 4F49A 1O2PA 1ZGVA 5FXLA 3T25A 1YKTA 1MKWK 1QJ6B 4Y76A 2FS9A 5EIYA 4XBBA 4BAMB 1LVOA 4HZHA 4LZ1H 3AW1A 3W94A 1LDTT 1O35A 4BNRA 3BTWE 4HG6A 3RC6A 1ELCA 3GYLB 1K1MA 3ZVEA 4O3UA 2ASUB 3KN2A 4IS5A 1KDQA 5F53A 1ZHRA 1O2OA 4FUJA 4ASUD 5ESBA 2XTTB 1WU1A 5C5OA 1S83A 1C5MD 2LELA 3DSGA 3UAIC 1SGQE 2W6JD 4SGAE 1OXGA 2KAIB 4KP0A 2J95A 5F03A 1BTWA 4UDWH 3GY2A 2ODQA 3FKSD 4IC6A 2STBE 3HKJB 3A83A 1PQAA 1FUJA 2KCAA 2CGAA 1GI9B 2XNDD 5PTPA 1NY22 3ZZ3A 3S69A 2PFEA 1O33A 1ELGA 5KECA 2ZTYA 1SBWA 3EE7A 1AQ7A 3DCLA 3LDXH 4OS2A 2BX3A 1KIGH 1OOKB 1Z8GA 1IQGA 1EAXA 2R3YA 1O30A 4FU7A 4LOYH 1O5BB 4X2WA 1C5UA 2XNIA 1Z1JA 4JYVH 1EUFA 1GBFA 2BY8X 1VITF 3UY9A 2OINA 1OS8A 1GCTC 2BDBA 1HBTH 2G5VA 2V6NA 3W95A 1HIAB 2HNTC 2AMQA 2H5CA 3A88A 3TNSA 3ATMA 1TGCA 4YLUA 3ITIA 5CMXH 3BTGE 3TJVA 2A5KA 2TGPZ 3MH7A 5A09A 2KAIA 3SNEA 1VZQH 1O3BA 3LPRA 2ZPSA 4IMZA 3LGYA 2D2DA 2O8MA 2R0LA 3BTFE 4LK4A 4Q4LA 2IJOB 2W3KA 1LHCH 2VIQA 1GBLA 1S82A 2LPRA 1TGNA 4A6LA 3Q00A 4ZXXH 1FN8A 3P92A 2RCEA 1C1TA 2AEIH 2VJ1A 3B8JA 3E6PH 1SOZA 1LCYA 2OUAA 1B5GH 1E1QD 4H6SB 5GWZA 1SLWB 4FXGH 5FBEA 3EAJA 4CBNA 2OBOA 3KQCA 4YOGA 4GAWA 1MU8B 3K65B 3SNBA 5EJ1A 2ZECA 1WAYB 4B73A 1DICA 1IQHA 3QTOH 3SU5A 5C1YA 1XUIA 3FANA 1SC8U 5GDSH 1LO6A 1VJAU 1FAKH 4AGJA 3M36A 1ELFA 1FI8A 5HM2A 2BD4A 1N8OC 2BMGB 5GPIB 1W7GH 4K1SA 3S0NA 1P2QA 3AAVA 1GHVH 1SG8B 1QB1A 5AFYH 3RMNH 2DE9A 1TX7A 2NU2E 2WSSD 1BBRE 2PKSC 4GHTA 3F1SB 4ZXYH 5I25A 1C5XB 1S0QA 3AVZA 4J1YA 2XRCA 4AG2A 1O2UA 5DGJA 1GCDA 1CVWH 1FZZA 4JYUH 4LXBH 1T31A 2NU1E 1SGYE 4ZKNU 3SI3H 3M7TA 4A1TA 4AN7A 2J94A 2FOEA 1RIWC 2BB4A 1YPLH 1Z8JB 5EODA 3JZ1B 1IAUA 1HV7A 1O3EA 3H7TA 1KY9A 3K6ZA 4XSKU 3T27A 1HJAB 4ZHLU 1HLTH 2BD3A 1CA0B 3FP7E 1GMHF 2AFQB 1V2JT 5FCRA 3F2HA 2F91A 1SQOA 4O03A 3SORA 3ZZ5A 2FESH 3CS0A 1FN6A 1ZMLA 2PWXA 3O8CA 1VGCB 5K0HA 1E79D 1O2MA 2J98B 2GZ7A 3OYPA 1AO5A 4BOHA 5EJZA 3ZIAD 2JJ2D 1W7XH 3A86A 4WMDA 4BAQB 1MTSA 2BLQA 2Y80A 2K0QA 1IQFA 3A7WA 4H42U 1HAIH 1LPZB 4D76A 1GG6B 2ZHEH 3VGCB 1EXFA 1ABIH 2GTBA 1P11E 4DOQA 1OP8A 2AYWA 1RD3B 1TYNA 2BTCE 3BV9B 4ABHA 4A5TS 1GI0A 1MTVA 1HCGA 3PV5A 4NIXA 1S84A 3RXCA 2FOCA 5G4BA 3TGKE 3D65E 1XVMA 2G4UA 2SGDE 7ESTE 3C27B 4UEHH 3GOVB 2PP6A 2GDEH 3KQ5A 1OP2A 2F4LA 3ZZ7A 3RXAA 3T29A 4DG4A 5ETXA 2IOTA 1YYY1 1O3DA 4HGCA 2VH6A 4MNWA 3SN8A 4IBLH 1O2IA 3E91A 1YGCH 2UUKB 1DM4B 2H1UA 5LPRA 1EQ9A 1F5KU 2RG3A 1Z6JH 3RLYH 1MCTA 1THSH 1ABJH 1ID5H 1K1NA 2ZPQA 3BIUH 4RKJB 1SI5H 4OM9A 1SGIB 1XKBC 3FN8A 4ABGA 7LPRA 3U98H 1XVOA 1B7XB 1FY5A 1DUAA 1QQUA 1ESTA 4Q7YA 3MMGA 5HXFA 1W0KD 1CHGA 4P02A 1F92A 1DY9A 4I8JA 4CRCA 2GT7A 1IHTH 1SSXA 2JETC 1H9HE 3ODDA 4U32A 1CHOG 2FOGA 5EW1H 4A92A 1AB9B 1ARCA 3GY4A 1O3KA 1TGBA 3PV4A 8KME2 2H9TH 2H9HA 1FX0B 5F6MA 1ZSLA 1FNIA 4CR5A 1GJAB 3EE0B 1NO9H 4ABBA 2FM2A 1E1RD 2GJGA 4CHAC 4M9FA 3UB0A 1IQLA 2ZFSA 2TIOA 2A2XH 1JRTA 1H8IH 1UCYE 1G3CA 4HFPB 4KELA 2GZ8A 2BD7A 1F5RA 1GBJA 5F8TA 1TBQH 2H5DA 5EGMA 4X1QU 2CF8H 2THFB 1O36A 2ZGHA 1CT4E 1FIWA 2ZCKP 1F2SE 1H9LB 1TOCB 4ABJA 2PTCE 3LONA 3ZZ9A 1UMAH 2KFWA 3UQVA 4MG3A 3SW2B 3ZZBA 1EPTA 4ABDA 4FETA 1T8NA 2ZTZA 4BTTB 1BB0B 3EDXB 3GICB 3PLBA 1LHFH 3BTTE 1NS3A 1AWFH 2AGIX 1TPOA 1GBEA 1SOTA 1GHWH 1LHEH 2CHAB 2GZ9A 2Z94A 3LGVA 4X2YA 4ZH8A 3NK8A 2WPDD 2YMSD 4ISIH 1PPCE 1SLVB 2J9NA 3I78A 3Q76A 1GHBG 1O3PB 3S7HB 1NN6A 4JZDH 4TPYA 2J4IA 2A4RA 4CRFA 1Y3VA 3MU8A 1P09A 1ACBE 1K2I1 3U8TH 3DUXH 1LVYA 3TK6A 1QHRB 3SNAA 3N7EA 4F48B 2FLRH 2Z9GA 1VKYA 2NU0E 4R0IA 1O2WA 1W0YH 1YCPH 4E05H 1CSOE 2B9LA 2BD2A 1ZMJA 1C1VH 4BAHB 5L6NH 2O8LA 1YWUA 2FYRA 1WQVH 2TPIZ 1NFYA 3P8OA 1DLKB 1RTFB 2BVSH 3GYMA 3PLPA 1ELTA 1Y5BT 5JBBS 1GL1A 1H4WA 4ASHA 2TGDA 3UPEA 1GPZA 4JCNA 1SR5C 3PRBA 1ORFA 1VCWA 3OU0A 4B6EA 4B71A 1D3PB 9LPRA 1EASA 3M3TA 3PWBA 3LIWA 2PV9B 4DGJA 1WCZA 1YCPM 4UFEH 1MMJN 5HIYA 1XKAC 1J15A 1GJ7B 1QIXB 3V3MA 4ZHMU 1A0HB 2FOHA 1W2KH 3P17H 3UNRA 1ZPBA 1A46H 4AGKA 5AF9H 2Z9KA 3TJOA 1ANBA 1JXPA 2GCTB 3DHKH 2FXRA 4D7GA 1KMHB 1EAWA 1QL7A 1A7SA 3SU1A 2LNCA 1BTHH 3K2UA 1UHBB 1BMFD 2AHME 2ZDNA 4INHA 2ZIQH 2L6OA 1O39A 3T5FH 2G8TA 1Y5UT 2ZGCA 4UD9H 4KGAA 1OP0A 4XFQA 7KMEH 2ALPA 3VXEH 2SNVA 3E0PB 4B2BA 1C4V2 1MQ6A 1VCPA 3UOUA 3NZIA 1Y3XA 1TRYA 3BTKE 3K6YA 2ZDMA 4XD7D 1O2LA 1UVTH 5EXLA 2XBYA 1WYKA 3TGJE 3A87A 3QX5H 1F0SA 1P01A 1M9UA 4I8LA 3UTUH 3JZ2B 5A8XA 3MH6A 2FZZA 2BD5A 3R3GB 4FOUC 1YY3A 2KZ4A 1QJ7B 3F9EA 3UQOA 3ZVDA 1AFQC 1MTNB 4Q7ZA 5EG4A 3SJKA 2J34A 1G36A 1SGFG 1HUTH 2OTVA 2XC5A 4YM9A 4MPWA 3BEIB 1NM6A 2KR7A 4GCHG 4MTBA 1YBWA 2GVFA 1FV9A 4NIWA 4OS5A 1P2KA 2SGAA 1BUIA 1AFQB 2AERH 5FX6A 3OY5U 1KTTB 4DVAU 1V2RT 2BQ6B 2VWOA
chains in the Genus database with same CATH topology
2SGFE 1UK3A 4WXVA 2FEQH 1E36B 1Y3UA 1HAXB 1VJ9U 1IQKA 4AYVB 2F9NA 4YZUA 4ISNA 1EKBB 4X8TH 1QBVH 3MU4A 1W12U 3M3VA 3N7OA 1CU1A 4WWYA 2F83A 5IDKA 1V2UT 1NTPA 4JYTA 4ESTE 1C2LA 4KKDA 1TGSZ 1YPHC 1QA0A 2VVCA 2W26A 2Y5HA 3KQBA 2EI8A 3UFAA 1VCQA 1T8OA 4DURA 3LJJA 1DE7H 3PB1E 5EQRA 3RDZA 4ISHH 1GJ8B 2ZCHP 1PFXC 1TNHA 5AFZH 1F0UA 2PHBA 5TCAA 2FODA 4DCDA 3TH2H 3C1KA 1C9TA 1D6RA 3OTJE 2ZI2H 1DX5M 1IQEA 1DWDH 4FUGA 3LKWA 3PO1C 1P03A 2PR3A 4BTIB 1WTGH 1OKXA 2XBXA 2O9QA 3TVJB 4NZLA 3QTVH 1N8OB 3FFGA 3ZV9A 2ZGBH 2QC2A 1E38B 1KXCA 1C2EA 1HGTH 1P2IA 3SBKA 1LKAA 2Q1JA 5A0CA 3I29A 2HVXA 2EA3A 1EPTB 5J4QA 1P02A 1BRBE 2P94A 3P70B 1TQ0B 2PLXA 4XBCA 1BHXF 3O8BA 1BA8B 1KLJH 1QTFA 2GMTB 5ESTE 1H8DH 3EQ0H 3ZZDA 1K1PA 4JZIA 3WY8A 3RMLH 1ETTH 1BTZA 3M7QA 2VIDA 2ZCLP 4NA9H 2GP9B 3F9GA 4RSPA 1GMCG 4X2XA 4XDEA 1GBMA 5IYTA 3U69H 3M35A 1RTLA 3LT3A 3M61U 4JMYA 2VGCB 1FY8E 3SQHE 2PTNA 4UFFH 3R0FA 4AX9H 4TY7A 1EB1H 3A8DA 1S85A 1K9OE 1FQ3A 3ENSB 1MAXA 8GCHF 4JK6A 3UNSA 3CS7A 2UWPA 1AHTH 1BQYA 1O3IA 1YLDA 1RFNA 5EXMA 4CR9A 4Z6AH 4Y8YA 2A32A 1DANH 3MNCA 3PMBB 2ZP0H 3ZVBA 4CRGA 1NZQH 1T8LA 5F8ZA 1YPMH 2P93A 1V6DA 3TGIE 1EX3A 3MU5A 2YNAA 4JZFH 1GGDC 1QGFA 1NFUA 5A2MH 4AFZA 1QCPA 1UK4A 3RXEA 1AZZA 3VXFH 1YPKH 1O2VA 1BTXA 2AMDA 1YCPK 3LOXA 6LPRA 1AY6H 2VWNA 1S5SA 3PMHB 2A7CA 1GHZA 1K21H 5A8YA 4ZROA 5JBAS 4UFDH 1BBRH 1SFQB 1EOJA 4U30A 4NG9H 4AB8A 1LVBA 5BRRE 3HK6B 3TJUA 2IPHA 1O2QA 6GCHF 2OC8A 2ZU5A 4XE4A 5LH8A 1F0TA 3PYHA 4MLFB 1A3BH 1LMWB 4AFQA 3LGUA 3UWIA 4QT8C 2DUCA 1AKSA 2QIQA 1BBRK 2PKSB 2B0FA 3EA7A 1V2PT 1AB9C 5BPEA 2ZDVH 1OYQA 4NWKA 2Z3DA 2RA3A 1XMNB 2IN2A 3ZZ8A 2BQWB 1Z6EA 1L4DA 2GX4A 1V2VT 4Y6DA 1QL9A 3KIDU 5C3NA 5DP7A 1T7CA 4O3TA 2FX6A 4UFGH 3GY8A 5DK1A 1P3EA 1PQ7A 2ZEBA 1W11U 3ELAH 4Q2KA 3ZZ6A 2XCFA 1FDPA 4DW2U 1VITG 4B75A 2D1JA 1XXDA 2ZQ2A 2CF9H 1IQMA 1C1MA 2FI4E 2G55A 3QGJA 1ZPCA 3SHCH 3UNQA 1PQ5A 3S9BA 3MTYA 1AKSB 5TCCA 1F5LA 5CHAB 1A2CH 3H7OA 4ZHAA 1LQEA 2QN5T 2WV4A 4I8HA 4KTUA 1GJ5H 3TITA 5C20A 3RXFA 4AB9A 1AFEH 1MQ5A 3M5MA 3Q3YA 3QZQA 1TOMH 2Q6FA 1GVLA 1RJXB 1C1NA 1KXBA 2BX4A 4FVDA 1XXFA 1OWDA 2H9EH 6CHAB 2VB0A 1J16A 2CMYA 4X2VA 5GIBA 1TFXA 4E7NA 1INCA 2NWNA 4M7GA 2W5EA 2Y5FA 1NRRH 1UTMA 2GCHG 1MBMA 2QA9E 3VB6A 4JZEH 1O2YA 4CRAA 4TPIZ 1O2HA 4ZUHA 2O8WA 3ZZ4A 2XYAA 3UREA 1UTOA 2ANWA 3QUMP 1T32A 1Z7KA 1FONA 4J2YB 3RXGA 3RM2H 1LQDB 2BD8A 5DP6A 3RU4E 1AMHA 5JB8S 2FTMA 1MBQA 1K28D 4A1XA 1DWBH 3ATKA 3U8OH 1CHOF 3ZYDA 2GCHF 2C8ZB 5F8XA 1CT2E 1D3QB 3AASA 1ETSH 1GJ4H 1C1SA 3Q3XA 2FI5E 4BAKB 1OPHB 1A0LA 2B7DH 3BEUA 1A0JA 1O5AB 4H6TA 1FXYA 1W13U 4O9VA 4OGXA 2R2MB 1W14U 5T6FA 2FX4A 1F7ZA 1LPGB 2A5AA 4CREA 2OBQA 5A8ZA 3EA8A 1AUJA 1C2MA 1MZDA 1G2LA 4WMFA 1QB6A 5HM9A 1TE0A 1C5VA 3MWIU 3BG4C 2W3IA 3URCA 1LTOA 5J4SA 1GI7B 4FU8A 3GDSA 3IWMA 1HAPH 1QURH 1TB6H 1UVPA 1ZSJA 3A8AA 5EXNA 3EYDA 1P04A 3D49H 4CRBA 2J2UA 4OS4A 5JPMH 1PPEE 2WPJS 1XX9A 4JK5A 1K1JA 1PYTD 4IGDA 4IC5A 4WF8A 3F68H 5FPTA 2Z9JA 2FI3E 6GCHG 1GMCF 3A7ZA 1PQ8A 1D3DB 2GCTC 1WTHD 4MPUA 1K1LA 1BMMH 1PPHE 2I6SA 1MKWH 1ZRKA 1YF4A 5JBCS 4IN1A 2A7HA 1A3EH 1SGTA 1QL8A 1W10U 1P2MA 3VB4A 1TA2A 1V2LT 3M3SA 1GMHG 3UR6A 3T26A 2QV1A 1L2EA 3SU0A 2Y82A 2FYQA 1VR1H 2UWLA 1EZXC 3QWCH 2SGQE 3FZZA 3MH5A 3PM3A 4BTUB 3EA9A 1GMDG 2PKAA 1JBUH 4FUBA 5FHTA 3RM0H 1BJVA 3PROA 2P16A 1ZJDA 5FCKA 2BHGA 3UWJH 3UOPA 1SHHB 1VITH 2BYAX 2C90B 3RXQA 4CHAB 1FPCH 2BOHB 2ZFRH 5DP3A 4ABEA 1AI8H 4K60A 3S9AA 3SJIA 1EAUA 1O34A 2BDYA 2ZDAH 4O97A 3MO3A 1QR3E 1NFWA 1PYTC 5E8EH 4GVUA 3Q3KA 5LPEA 2H2ZA 2OQ5A 1O3AA 4DIIH 2QXGA 1BMLA 3ZYEA 1MU6B 3NPSA 2C8YB 2G52A 2P8OC 5FPYA 4K8YA 3E3TA 4DY7B 1HRTH 2ZA5A 3NKKA 4D9RA 3FP6E 1YM0A 3F9HA 3BTDE 4NFFA 3M5OA 2BY6X 1GI6A 1ZHPA 3KGPA 2A4GA 3PMAB 1O31A 1GJCB 1GDQA 4I32A 1TALA 1NU9A 4FUFA 3D62A 2SGPE 4MNXA 1GDNA 4X0WU 1FJSA 1A1RA 1Y59T 3A8CA 1ZMNA 4HI3A 2F9VA 2P3UB 2ULLA 3P95A 2Q6GA 5I46H 1O2RA 1GBTA 3ZZAA 2AMPA 2ODPA 4NSYA 1XUFA 2GGVB 1AZ8A 4Z0KA 1C5YB 1XUKA 4WH6A 1O2XA 3OY6U 1SVPA 2BDAA 4MPVA 1W0ZU 1P12E 1WSSH 4INLA 5EQQA 5LGOA 3CP7A 3GY5A 1Y3WA 3RLWH 1PPGE 4IW4E 4Y8ZA 5GCHG 1C5QA 3P8GA 3HPTB 1BIOA 3S7KB 2ZO3H 4ZKOU 1AUTC 1RXPA 1AE5A 1V2OT 2STAE 2C93B 2BQ7B 2ZG0H 1G3DA 2BDCA 4SGBE 1E35B 2BLOA 4TYDA 4BXWA 2ZHFH 1SFIA 2UWOA 1O3HA 2RA0A 2WPLS 5GCHF 2BXTH 4ABFA 5FPSA 1DSUA 3VPKA 1HAYB 4AOQA 3LH1A 2ZHWH 1EJAA 1O3OA 1Y8TA 2G4TA 1A5IA 3PTNA 1AU8A 2YNBA 2SGEE 2G00A 5B6OA 2D8WA 1GBKA 3RXJA 2Y7ZA 3MU0A 5DG6A 3RXIA 4U01A 1UCYK 3TNTA 3DFJA 1JIRA 2WPMS 1G37A 1E0FD 3KL6A 2VINA 5T6DA 1RTKA 3ZVGA 3E16B 1P2OA 4LZ4B 2VWLA 2C8XB 2WUCA 2ZHDA 2EEKA 5DP5A 1O2ZA 1UTNA 1RS0A 8ESTE 1THRH 1YLCA 1ZOMA 1TNJA 3TH4H 3D23A 4ISOA 1V2QT 2F9OA 1PPZA 1QQ4A 1DWCH 5EPYA 1ELBA 2R9PA 3VB5A 2OP9A 1WV7H 1RIWB 1D6WA 2WPIS 3NWUA 2BZAA 5EPNA 2PSYA 3M37A 2PKAB 5GXPA 1ANDA 1Z1IA 3STJA 1GGDB 1O2GH 1EJMA 3P8NA 3G01A 4UE7H 1GJ9B 2F3CE 2FOAA 4A7IB 3UUZA 5K7RA 1GVZA 1XM1A 2G5NA 3HGNA 4K5ZA 3O8RA 3ATWA 3SV7A 4X8UH 3MNSA 1HJ8A 1NT1A 1K1OA 2QYIA 2Z3CA 1ETRH 3ZVFA 3LJOA 1TNIA 3SUGA 1JIMA 3L6PA 1F0RA 3M5LA 3ODFA 3QLPH 2V3OH 3SJ9A 3T28A 3RXOA 4Y7AA 4D7FA 1O32A 1FLEE 1GHYH 1TAWA 2ZFTA 1XUJA 4DT7B 2ZU2A 4NA7A 3NXPA 3RC4A 1THPB 3STIA 1GL0E 1J17T 2QXHA 2FOFA 5SGAE 3F9FA 2AGGX 2R0KA 2WUBA 4BXSA 1SQTA 4I8KA 1LHGH 3H5CB 5JDUB 2XC4A 1YC0A 3A82A 1O3GA 2GMTC 1OWKA 1CA8B 1AN1E 3TLOA 2AIQA 1HAVA 1TIOA 1O5FH 2D26C 5EU8A 3V7TA 5DP4A 5A0AE 1CBWB 1K22H 1TA6A 1ZHMA 2XWAA 5GJ4B 1K1IA 3DFLA 2A5IA 1C1OA 4U2WA 4PROA 1HJ9A 1QRZA 1DT2A 3RXPA 1BOQA 1ZTJA 3HGPA 4KTSA 3SNCA 1CA0C 3PWCA 1UTKA 1BDAA 4NCYA 2JETB 5EQSA 3RXMA 2XW9A 1NRPH 1AIXH 2NU3E 3QDZB 1Y5AT 4WH8A 2P59A 3PLKA 1TX6A 2AIPA 5CHAC 3SI4H 1C5NH 3SUDA 1N6XA 1DITH 3A7YA 1TPAE 1Q31A 3L33A 3P8FA 3SNDA 2VWMA 1G2MA 1NPMA 1ESBA 4YOJA 1Z71A 1EZUC 1TRNA 4BANB 1TBZH 2Y81A 1J9CH 4X1RU 1IQNA 3GY6A 1BMNH 4F4OC 1SGDE 4B74A 1CE5A 4NGAH 3RU4T 1O5EH 1TWXB 1O5GH 3IG6B 1ZR0A 4KTCA 5EW2H 1WUNH 1HXFH 1SGNE 5JB9S 1O0DH 1G3EA 1NRNH 2UUFB 1O3LA 1OWEA 1FMGA 5T3HA 1PPFE 2CV3A 5AHGH 1UK2A 1HNEE 2OC7A 2ZTXA 3BTME 1P2NA 5H4IB 4WMEA 1HAZB 1MD8A 2TBSA 3GCNA 3FP8E 4Q80A 3LGIA 1SGRE 2R3UA 2H6MA 3T62A 2JH0D 1DWEH 2A45B 1KXEA 2J92A 4FU9A 2EI7A 1OWIA 4AG1A 1GVKB 1CGHA 2GKVE 1C2GA 1G32B 1TBRH 3I77A 4B2AA 3HK3B 3KF2A 1XUHA 1UCYH 3SGBE 2PUXB 2CJIA 1YPJH 3EGKH 1ESAA 1GBHA 1TPPA 3ZVCA 2V35A 3A80A 1N6YA 1QRXA 1J8AA 1L1GA 4OS1A 1SLUB 1W8BH 1QBNA 2FLBH 5T6GA 1QY6A 3VB7A 2ANKH 7GCHG 3SZNA 1ZJKA 1GWAA 1UO6A 1GBAA 4OGYA 1O3FA 1JRSA 4K2YA 5E0JA 1LKBA 1HAHH 1JMOH 2ZGXH 1G3BA 2PGBB 1UHBA 2AH4X 1ARBA 1AVWA 3BG8A 4WJG2 1ZLRA 3V0XA 5HGGA 2W7UA 4TWYA 3TU7H 4B76A 2G81E 2BLVA 1MKXH 3OX7U 4AYYB 5CE1A 3BTHE 1HIAA 4GUXA 2VGCC 1UVOA 1C2JA 2FOMB 2CHAC 1P0SH 2G51A 2Z3EA 1XUGA 2GV7A 3QGNB 1HXEH 6ESTA 1IHSH 2XBVA 1GHXH 3BIVH 3RXLA 1HB0B 4GHQA 1FPHH 3TPIZ 1TONA 5HMAA 1S81A 1BTUA 2UUYA 4Y8XA 2QXIA 1HJAC 1UTPA 3SQEE 2BZ6H 3SUEA 4X8SH 1C1PA 2Z7FE 2OD3B 2HLCA 2NU4E 2DE8A 5E0HA 1WOFA 5C1XA 2ZWLH 3RU4D 1BMAA 2UUJB 3LC3A 1BHXB 4INKA 4B2CA 1PPBH 2Z9LA 4FUHA 1BT7A 1LVMA 4IN2A 4I7YH 3GY7A 1C5LH 2BLWA 4AFUA 2A7JA 4Y11E 3KNXA 2O8TA 3HKIB 3PTBA 1GI1A 4I31A 1SLXB 2M5TA 3SOSA 4YESB 1GG6C 3VGCC 1Z8IB 1GBDA 4RN6A 2OC0A 1O2KA 1C5SA 4CH8B 4THNH 3GDUA 3ZVAA 1S6FA 3KQEA 1KSNA 1V2TT 1C5TA 3A7VA 4GSOA 2BY5X 4X8VH 1SL3A 4DJZB 1MKXK 2VVUA 3SV2H 1DUEA 2OC1A 5DP9A 1P05A 1D9IA 3MO6A 1OWJA 2AGEX 1GHAF 2FIRH 4Y71A 4YO9A 3VEQB 4Y0YE 1ELVA 2ANMH 1O5CB 1GI8B 3GY3A 4CRDA 2XWBI 3SHAH 5C2ZA 1O38A 1TNKA 1TMBH 2OXSA 4MDSA 1TNGA 3F6UH 3SV9A 2TRMA 2BDIA 2PGQB 4XOJA 3KCGH 2PSXA 1GBIA 1IQIA 4FUIA 2C8WB 2BY9X 5DP8A 1GHAG 2XBWA 2ZQ1A 1Q3XA 4NIYA 1OX1A 1DXWA 4VGCC 1JOUB 2B8OH 1UTJA 1MZAA 3RC5A 1DS2E 2WPKS 4K3JA 1QJ1B 4ISLA 2QXJA 1EAIA 1IQJA 2BDGA 1HAGE 4D8NA 2ALVA 4NWLA 3GDVA 1JWTA 1EP5A 2ZU1A 5FAHA 1KDQB 1GI5A 1SQAA 3LGTA 1C5PA 4MVNA 1P10A 1SGEE 4MNVA 3RXSA 2VU8E 4I33A 1KXFA 3BSQA 1WBGB 1ZTKA 2OCVB 3NUMA 2K1QA 1MTWA 1HDTH 3SO3A 1B0EA 1KTSB 2BXUH 2JH5D 3BF6H 1HFDA <