5E0GA

1.20 a resolution structure of norovirus 3cl protease in complex with a triazole-based macrocyclic (17-mer) inhibitor
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
173
Chain Sequence
b'HHAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTGANAKGLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Norovirus 3C-like protease
molecule tags Protease/protease inhibitor
source organism Norwalk virus
publication title Structure-based design and synthesis of triazole-based macrocyclic inhibitors of norovirus protease: Structural, biochemical, spectroscopic, and antiviral studies.
pubmed doi rcsb
total genus 40
structure length 173
sequence length 175
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5e0gA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5e0gA01
3SJKA 3SU2A 3MU4A 2GZ9A 1OWEA 4ABDA 3ZZDA 1G2MA 2B0FA 1CT4E 1UHBA 1LDTT 2ZTZA 4WWYA 3BG4B 3M3SA 3M36A 1JBUH 3D65E 1ZPBA 1IQIA 1SGFG 1FIWA 2ZI2H 1DUEA 1O34A 3H7OA 2A4OA 3P95A 2OBQA 3TJUA 4K8YA 1HAZB 1C1RA 1UTQA 1DX5M 1MTNC 1KDQA 1MBMA 4YZUA 3GYMA 3ZZ6A 1YC0A 1WV7H 3LH1A 3QZRA 4U01A 4GHQA 1KLIH 3A8BA 1YPKH 9ESTA 1ANBA 1OWIA 1VCQA 1O3KA 1HIAB 2BB4A 1GBAA 3S9BA 3MNCA 1FY3A 1GCTC 4AG1A 2XRCA 3UOUA 1W13U 3BIUH 1IQEA 1PPHE 2W7UA 1BMMH 1T4UH 2V0BA 4VGCC 4ABAA 1C5TA 1O3FA 2FIRH 1TAWA 4K1EA 2G55A 2PR3A 4PROA 1THPB 3LGWA 2Z9IA 1MTSA 5FCRA 1NU9A 9LPRA 3MH4A 3PMHB 1CA0C 2PGQB 4U32A 3T29A 1ELVA 2CGAA 2WYJA 1OWDA 1A5GH 3QUMP 4TPIZ 1HJAC 1N6XA 4K2YA 1P03A 2C90B 1YLCA 1GMCG 1K9OE 1VGCB 2PGBB 1O3NA 1MTWA 1Z6EA 5CHAB 1L1GA 2QXGA 5GJ4B 3GDUA 2OUAA 1UMAH 2AGGX 3MNBA 1QA7A 3F6UH 1AE5A 2JKHA 3QTOH 4IN1A 1BMAA 1XKBC 3SZNA 5HXFA 2ZHWH 1VITG 3SQEE 3TNSA 1INCA 2QXJA 1TMUH 2BOKA 2QYIA 4MG3A 4Y71A 2SFAA 1J16A 1G36A 3OSYA 3LPRA 1E36B 1W8BH 3LJOA 4R8TB 3BTHE 3MH7A 1VJ9U 1P01A 1CHGA 1BRBE 1NROH 2FX4A 1C2IA 2XBXA 2FOCA 3RXTA 1XUGA 2XC0A 3SV6A 1ZPCA 4JZEH 1P57B 1BZXE 3SORA 1O3EA 3SW2B 1GJBB 2ODYB 3LIWA 3SU0A 1PPZA 5DP8A 3S0NA 2OXSA 3B8JA 1RTFB 1GMHG 2J94A 1GJ6A 3R3GB 3U8OH 5FPYA 3SU1A 1QTFA 4M7GA 2QCYA 1P3CA 2BD3A 2CMYA 1H1BA 2ANMH 2KAIB 2Y7XA 8LPRA 5AVDA 1Y5AT 1GJ4H 1HAIH 4LK4A 2G5VA 2D26C 1C2FA 4AN7A 3M7QA 2A5AA 4X6PA 1DWBH 2GVFA 2GZ8A 2ZFTA 1EASA 1CGHA 2XXLA 4B2AA 1Y3WA 4NG9H 1SHYA 4TYDA 4CHAC 3RMNH 1C9PA 1FLEE 2A4RA 1C5ZB 4NWKA 2ILNA 3LGYA 3IITA 3RXIA 3RC5A 2BDGA 2PUXB 1BTXA 1YF4A 4MDSA 3CP7A 1UTNA 2Y82A 2BDAA 4JZFH 4YESB 4X2VA 3ZZ4A 1K1NA 1D6WA 4I8GA 8GCHG 1BOQA 4INLA 1TNIA 4DCDA 2W3IA 1HDTH 1ESTA 5EQRA 1FMGA 1SGCA 1K1IA 4AZ2B 1S5SA 1RTKA 2H2ZA 3LDXH 3V12A 1ID5H 3PROA 1DE7H 2C8WB 1AY6H 3M5NA 1SQTA 2BQ6B 5T6GA 4Y0ZE 1GHBF 1NFWA 3ZVGA 3SHCH 4MNWA 1AD8H 3W94A 2BLOA 1RD3B 5E2OA 3WY8A 2JETC 1WQSA 1O2WA 1W10U 3K6ZA 1P2KA 2XYAA 1CGIE 1EB1H 2WPKS 3PWBA 4E05H 2IPHA 1HAVB 3UREA 3D62A 1HAGE 2A2QH 2RG3A 5AFZH 3QGNB 4HGCA 4A5TS 3SV8A 1D9IA 2TGAA 2QXHA 1FY8E 1IQJA 2FEQH 1UVPA 1T32A 1HIAA 2GZ7A 4AFSA 3AAUA 5EQQA 1VITH 3M5OA 1C5NH 5FX6A 5C3NA 4AOQA 2CF8H 4UFFH 2Z3DA 1UK3A 1GJAB 1A0HB 2J95A 1NTPA 2ZDMA 1UK2A 1BJUA 4ISHH 3VGCB 3T28A 1HLTH 1NPMA 2HNTE 2P59A 1F5KU 1GJ5H 1WTHD 1T31A 5GCHF 8ESTE 2TBSA 2F9VA 1K2I1 2JH6D 4X1PU 2PW8H 1S85A 1ZHMA 1MBQA 2KAIA 4Q80A 3BTKE 2PKSB 2Y6TA 4I8LA 1QHRB 2VH6A 5C2ZA 1PPCE 1ARBA 2A7HA 1GBJA 1TPPA 1P3EA 5GCHG 2J4IA 2GX4A 1C1SA 1Z7KA 2TGDA 1BTUA 6GCHG 1QBNA 2A7JA 1EZUC 1TIOA 4I31A 1O5GH 4BTTB 2BD2A 1AB9C 4BANB 2GKVE 1BJVA 5J4SA 4CH2B 1CA8B 3LGUA 3MWIU 3BIVH 4AGKA 1MZDA 1C5VA 2ZDVH 1PPGE 1NZQH 1YPEH 2Z3CA 1FONA 2GCTB 3TITA 4UFEH 1O2HA 3MI4A 3Q3KA 1OP8A 3ITIA 4J2YB 1UTLM 3EAJA 2R2MB 4ZKNU 2H1UA 2ZDKA 2VJ1A 4XE4A 2ANYA 3A88A 1W12U 2V3HH 1LVMA 2Y5HA 5FBEA 1S83A 1TABE 3GYLB 1S6HA 1DFPA 1LPKB 1O2QA 4H6TA 3EDXB 1G30B 4XBDA 3RU4D 1AQ7A 3SU5A 4MLFB 1AB9B 3QDZB 2GV6A 1Z8RA 4ABFA 4CRAA 2O8LA 5C1YA 1AKSB 1WSSH 2BD7A 1W11U 2ODPA 4ABJA 2WPMS 3VB5A 2ZDLA 3K65B 2VIWA 1OPHB 3RXMA 4AORA 4FUHA 1QFKH 2AMPA 1WCZA 2F9PA 2FM2A 5JB8S 2RA0A 1O35A 2QF3A 2FOEA 3KQEA 1TWXB 4ZXYH 2C8ZB 1HYLA 1EB2A 2VIOA 2HGTH 2PV9B 1XX9A 4WY3A 5HMAA 1V2ST 1LHEH 4WH6A 4ABBA 3ODFA 4RN6A 1HB0B 3PLPA 4AGJA 1C5LH 3ZZCA 2ZQ1A 2P8OB 3S7HB 4NGAH 2ZA5A 1XXFA 1C1TA 1SHHB 2BY6X 1BBRH 4DJZB 1O2IA 8KME2 3O8DA 1C5RA 2SGFE 1AHTH 2XNIA 3RXQA 3VXEH 3ZV8A 1ZSLA 2FOMB 2AIQA 2ZECA 4JK5A 2BY9X 7ESTE 2C8XB 1ZHRA 2ZF0H 5DP5A 4K1SA 2ZG0H 1EP6A 1TONA 3MMGA 1PQ7A 1GI7B 3ATKA 4GPGA 2Z6BD 4IW4E 3RP2A 1THSH 1IOEA 1V2VT 3B23B 4HTCH 1G3DA 3U69H 1LVOA 3SGQE 3P92A 3VB7A 2IJOB 5L2YH 2BY7X 1LCYA 2H5CA 1QB6A 1PYTD 1KXBA 3A80A 1QRWA 1X7AC 4WVPE 1O5FH 2ZU5A 1B0FA 3TVJB 2UUFB 1UCYH 1SGRE 2WUBA 3DFJA 3QTVH 3B9FH 2HOBA 1ZZZA 1L1NA 3BTEE 1A0LA 4B74A 1WOFA 2PHBA 1HBTH 2VU8E 5TJXA 5EXMA 2OD3B 2R2WU 2ODQA 2FESH 4FU9A 5T6DA 3M35A 3SU4A 1FY5A 3FVFB 4D7GA 4FUEA 4BAHB 4OGYA 1GMDF 2HALA 4DURA 5A2MH 1O31A 2QXIA 4X0WU 1HRTH 2XC4A 2Q6FA 4FUBA 2GTBA 1SB1H 5AHGH 2FOHA 3UOPA 2QGRA 2STAE 1DUAA 1N6YA 1TMTH 1C5SA 1W14U 2GD4B 1BBRK 2XCNA 4OS1A 2NU2E 1A1RA 2SGEE 1TOCB 1TFXA 4KP0A 1UTOA 3SNEA 3UFAA 1C1MA 1FZZA 2OCVB 1F2SE 2ZU1A 3GICB 3UNQA 1O36A 4VGCB 3OTJE 4MPVA 2PKAB 3RXBA 1HXFH 3A7TA 4TWWA 2HPQH 2FI4E 4X2XA 1TLDA 3A81A 3RU4E 1O5CB 3D49H 2PTNA 3T25A 4X8VH 1MQ6A 1RIWC 1GBDA 1FUJA 5JBCS 3TNTA 1BBRE 3AW1A 1FAKH 2O8WA 3LKWA 4RKOB 4BOHA 3TK6A 3SGBE 3E1XB 4LXBH 3TU7H 1G9IE 3DUXH 1ZMNA 3PTNA 1BQYA 3LOXA 1O3DA 3C27B 2AFQB 4B2BA 1GI0A 3BTFE 1SR5C 1ELTA 3UNRA 1MCVA 1F0UA 4GLYA 2BQ7B 4NSVA 2BQWB 4IMQA 3KNXA 3RXDA 4X2WA 1XUHA 1DY8A 2PFEA 1P0SH 5GXPA 1LPGB 3BV9B 1MTNB 1C2LA 4WF8A 4ZHAA 1YGCH 1LVBA 4B71A 1LMWB 1AWFH 4I8JA 1ANEA 1O30A 2H5DA 3F9FA 4MPUA 1BMLA 2ZHDA 1ZJDA 1RFNA 2W7SA 1MQ5A 3Q77A 1Z71A 4JK6A 3TGKE 1GCTB 1Y3YA 1GBHA 3SNAA 1D3QB 2V35A 1SMFE 3Q3YA 4CRGA 3AVZA 1WUNH 1A61H 2NU1E 1CBWB 1LHGH 2AH4X 4E06H 4Z0KA 2RDLA 2XWBI 2BX4A 1A5HA 3BG4C 1P09A 1L4ZA 4IBLH 4K5ZA 4UE7H 2R0LA 5JDUB 3PTBA 2P8OC 1KDQB 1RJXB 2QC2A 3RC6A 1QGFA 3SJIA 1P2OA 2SGQE 2VIPA 2A2XH 2Z9KA 1SVPA 3MNSA 1MKXK 4A7IB 1S6FA 1YPJH 1ZR0A 4BTUB 2WPIS 5PTPA 4O3UA 2ZFRH 3FP6E 2LPRA 5A8XA 5AF9H 3O8RA 3EA8A 1TBZH 1TX8A 1AWHB 1QBVH 1TNLA 1XKAC 2WUCA 4B76A 1UVUH 5I25A 3OY5U 1QJ6B 1Y3UA 3SI3H 1JOUB 1MU8B 4AB8A 5IYTA 3RXCA 4NCYA 1ESAA 1T8OA 1CBWC 2VWMA 4DY7B 3KCGH 1PJPA 1GL0E 5C1UA 3MYWA 2ZFPH 3A82A 1KTTB 4KELA 1K22H 1C5PA 5EPNA 4AX9H 5FCKA 1BIOA 4DVAU 4RSPA 1UTKA 1UTPA 4NIXA 1UTMA 1NRQH 2W5EA 1TMBH 5EPYA 4MVNA 1AGJA 2UWOA 4TY7A 4O97A 1BRAA 4FUFA 4CREA 3N7OA 1PPBH 4UDWH 2STBE 3AW0A 1BHXB 4FVBA 3MHWU 2QF0A 2ZCKP 2XBYA 3ZZ5A 5TCAA 2F9BH 1V2TT 2BDHA 4OS4A 3OY6U 1P2JA 4XFQA 1HAXB 1OWKA 1ZLRA 1HXEH 3JZ2B 1GG6C 4ZMAH 2FOFA 3OU0A 2BD4A 1W7GH 2ZCLP 3TK5A 2GCHG 1GBCA 2ZU3A 3FZZA 1F0TA 4GCHF 1UJ1A 3F9HA 4ABGA 2EEKA 1EJAA 1KSNA 3PO1B 5DJ7A 5EGMA 2FOBA 1JXPA 1KXCA 4DT7B 1ETSH 1E34B 4IGDA 1S0RA 3E91A 4K69A 5LPFA 2OBOA 4B73A 2SGAA 1GHXH 1NRRH 1AVGH 1KTSB 3RM0H 1HUTH 5FXLA 1DICA 2ASUB 2PLXA 2G8TA 5T6FA 1QCPA 3K2UA 2BYAX 2ZFFH 4KGAA 1VJAU 4D8NA 1V2NT 2BOHB 3SNCA 3ZZ7A 2BVXH 2F83A 1O2MA 3ZV9A 1O33A 5HGGA 1ETRH 1NFXA 4AYVB 3A7VA 1C9TA 1SGIB 1JRSA 5EU8A 3TLOA 1L2EA 1O3HA 4NSYA 4OS2A 1GBTA 1SLWB 1NO9H 4O9VA 4Q7YA 3SJ8A 1GBMA 2VGCC 3MU8A 1YP9A 4D9QA 2PSXA 1NY22 4JYUH 2Z94A 5JB9S 5E0GA 1ZSJA 4Q7XA 3M61U 1OYQA 5DP4A 1RGQA 3SJOA 1QQUA 3GY8A 2HVXA 1NC6A 2P93A 3T27A 1LTOA 3H5CB 1FPCH 1C5YB 1QRZA 1FNIA 4FU8A 2BHGA 4ZAEA 1EOLA 1C5WB 4DIIH 1RTLA 1PQAA 3F1SB 3RU4T 4E7NA 1TA6A 1HJ9A 1KY9A 1XUJA 4Y10E 1DXWA 3RXUA 2LNCA 1GI1A 1WYKA 1GHAF 2TPIZ 2R9PA 4ABEA 1J15A 1FJSA 3FFGA 1IQFA 1SGQE 2AEIH 1TB6H 1CU1A 2ZKSA 2I6QA 1EATA 4XBCA 4YLQH 2G4UA 2VWNA 3ATLA 2AMDA 2NWNA 1IQGA 3NK8A 4Y7AA 3P6ZB 1G2LA 2F9OA 2ZGCA 1H9IE 2IOTA 2AGIX 2VNTA 3A7WA 1LHCH 1TQ0B 4IC6A 3RXSA 5JPMH 1EZQA 2A0QB 4WH8A 1YBWA 3STJA 1BTPA 5HM2A 1EQ9A 3UIRA 3E8LA 2WPLS 4ZH8A 1HAYB 2C4FH 5DP3A 2UWLA 1Z6JH 2ZC9H 3S9AA 5J4QA 2G4TA 2QAAA 3KIDU 4U30A 1O3GA 5FX5A 6CHAC 2OQ5A 5LPRA 1G3CA 4OS7A 1BITA 5ESTE 4ZHMU 1PPEE 2O8UA 4YOJA 3T26A 1SGPE 2W26A 4IN2A 1AFQC 2HNTF 4NZQA 4MNXA 1UO6A 1MAYA 1V2OT 1LKAA 2AGEX 2A5KA 3BF6H 3KL6A 1OKXA 4ISNA 2J92A 1GHWH 4IS5A 5E0HA 2A31A 1ZRBA 2XBWA 1EUFA 4LZ1H 2P16A 3D23A 3PMJA 1JWTA 5CE1A 2D1JA 3GCTG 4XOJA 4HZHA 4WJG2 3ATIA 1JIMA 2G51A 1FN6A 1MZAA 4FUJA 1HJAB 2A7CA 1RXPA 1GBBA 5B6OA 3ZYEA 2Q6GA 3TK9A 1TE0A 2FS8A 3SV2H 5C67A 1SOTA 1GI8B 1C1NA 1Z1JA 2CF9H 2A4GA 3P70B 1KIGH 3BG8A 5GIBA 3LGVA 5C20A 3EA9A 1J17T 1YPGH 3SGAE 1P2IA 1W2KH 4FU7A 1OXGA 1C5XB 1O3CA 4NIWA 3BTQE 3HKIB 3A84A 2ZGBH 1O2LA 1AKSA 1IHSH 5EODA 1O2GH 2XC5A 2VWLA 3ATMA 2Y5GA 2O9QA 2WPHS 1EP5A 4OS5A 3SO3A 1C2HA 1W0YH 3V13A 1UVOA 2J2UA 2P94A 4UFGH 1EZSC 1RRKA 1C5QA 3BTGE 4H6SB 2GP9B 1H4WA 1IQMA 1SQOA 2ULLA 3RXPA 5CMXH 4CBOA 3SHAH 1DSUA 1O3BA 3I29A 4ZKSU 1EPTB 3RXEA 1VITF 2FP7B 1DLKB 4MQAA 1A2CH 2NU4E 2BLVA 4MTBA 1YYY1 1FPHH 3M5MA 2YOLA 2ZIQH 2P3FH 4CH8B 3T5FH 3FP7E 2FI3E 2ZQ2A 1SGNE 1SQAA 2FTLE 1IQHA 1NRNH 1MAXA 2UUKB 4WMFA 3SV7A 4I33A 3F9GA 1FXYA 1XUIA 2GMTC 1ZTKA 1O2KA 4INKA 4DG4A 5AFYH 3A8DA 3M7TA 2BLQA 3I78A 3LJJA 1ZHPA 4CHAB 1AVWA 2Y81A 4FVDA 1AFEH 3H7TA 4I8HA 1Y3XA 2VWOA 4TWYA 6LPRA 2PWXA 2EA3A 4JYVH 3QGJA 2GDDA 2BVSH 1BB0B 2ZDNA 2FZZA 1WAYB 2ALPA 1K21H 1TGCA 3BTME 3NXPA 2XW9A 4I8KA 3GCNA 3MH6A 5JBTA 1ANDA 1Y59T 1TRMA 1ELGA 3RXAA 4CRBA 1KLJH 2B8OH 1WU1A 2GMTB 5EW1H 1GI4A 3V0XA 4K3JA 2H9EH 3TH2H 2ANKH 2ESTE 1D3DB 2EC9H 5A0CA 4MNVA 4BAQB 1GJDB 2TGTA 3C1KA 2OC1A 1L4DA 1YM0A 1V2WT 1ETTH 3BTWE 1A0JA 3MFJA 1YCPM 1QRXA 5A09A 1C1WH 6ESTA 1C2JA 4QT8C 3TH4H 3MTYA 3TPIZ 2G5NA 3DD2H 2GT8A 1MUEB 1K1MA 1QY6A 2FTMA 4ZKOU 3SI4H 1O2ZA 5F03A 3PWCA 1GMHF 4CR9A 3SUEA 3VEQB 1T8LA 2THFB 2HPPH 5L2ZH 2NU3E 1GDQA 4ZHLU 1CA0B 5DP6A 1VCPA 4UFDH 7KMEH 3UQVA 4ISOA 1TOMH 2SNVA 1U6QA 3BN9A 5A0AE 1UK4A 3GCTF 1CE5A 3CENA 1OOKB 3RXFA 1ELAA 4YOIA 2BXUH 4BAMB 1TRYA 2ZPQA 3L6PA 1O32A 4H42U 1CHOG 1DY9A 4OGXA 3LC5A 5FBIA 1GVKB 4AFQA 3BSQA 1GDUA 2VH0A 2ZHQH 1C1UH 4IC5A 3SU6A 2ZO3H 1A4WH 3DFLA 1MKXH 5K0HA 3OYPA 1MCTA 1AN1E 3PB1E 3PMBB 4CBNA 4UEHH 3A87A 2TRMA 3ZVBA 1GVZA 3L33A 1IHTH 5DG6A 2VINA 3KQBA 1ELDE 1DSTA 1G3EA 3HK6B 1GMCF 2DE9A 1SFQB 2A32A 3SUGA 4BAOB 5T3HA 1N8OB 1LHDH 2ZFQH 3KQCA 4KKDA 3KEEA 3MO3A 1XVOA 2XWAA 2Y80A 3M7UA 5K7RA 4Y8XA 5DK1A 5BRRE 1C5OH 3FANA 3IG6B 3QZQA 1Y5BT 1Z8JB 4XSKU 4IMZA 4H4FA 1OS8A 1V2PT 5FPTA 2AS9A 2F91A 2Q6DA 2ZWLH 4FUIA 4ESTE 1WTGH 3UNSA 2VIQA 1J14A 1PYTC 2XCFA 1OSSA 2Q1JA 2Z9LA 3EYDA 4GUXA 1AE8H 4Y79A 2ZPSA 2ZEBA 2ZGJA 4YM9A 1G3BA 2BDIA 1NS3A 1QB9A 1CO7E 1TX7A 4KTCA 2VVCA 1C4U2 1KXFA 3DHKH 1C2KA 1ZGIA 1AI8H 1F0RA 5HM9A 1SG8B 1O3PB 4AFZA 1DITH 4X6NA 2BD8A 1N8OC 1D6RA 1W7XH 3O8BA 3M3TA 3RMMH 1MD8A 1V6DA 1MTUA 7GCHF 1O5AB 2ZNKH 2ZCHP 2GCTC 2G00A 1ZPZA 1P12E 4Y8YA 4FUCA 1LVYA 2BZAA 2OINA 3UTUH 4DGJA 5ETXA 1TYNA 3KF2A 1LQEA 2A1DB 1ZSKA 1P9SA 3E3TA 1EAXA 1DANH 3ZZ3A 1BHXF 1YPLH 1TALA 5F6MA 3ESTA 3GY6A 3SUDA 2W3KA 4TY6A 1LO6A 1ANCA 2QN5T 5F8TA 1O3JA 1SLUB 2V3OH 1GPZA 1NRSH 1ESBA 4NIVA 1W0ZU 1DM4B 1UCYE 2OC7A 3R0FA 1L0ZA 1O2RA 5IDKA 3MO9A 5DKMA 1Z1IA 2CJIA 2YNAA 3QWCH 4GAWA 4X8SH 4CR5A 2FLRH 1H9LB 1O3LA 2DE8A 1SPJA 3F68H 1AMHA 1JRTA 4DIHH 4DOQA 3A8AA 3LGTA 2TIOA 5SGAE 2R3YA 3M5LA 4A1TA 3KHVA 2AYWA 1BDAA 3TIUA 1GI6A 3P8NA 4UD9H 3P8FA 1S81A 1QNJA 3HGPA 4Y7BA 3RUOA 1GHZA 5HYOA 2RA3A 3ODDA 4R0IA 2OLGA 2ZTXA 4NFFA 3ZVCA 5DO4H 2CXVA 1OX1A 2OC8A 4K1TA 1EZXC 1KXAA 3BTTE 1K28D 4YT7H 4D76A 1C4Y2 1Y5UT 1ORFA 4B1TA 1OP2A 3E6PH 1YCPK 1YKTA 1GCDA 1QR3E 1V2MT 2G52A 1O2UA 2XBVA 2GCHF 2ANWA 1LPZB 1XM1A 1QB1A 3VPKA 4X1NU 2FMJA 2H9HA 1FIZA 4FUGA 1SGDE 3RXGA 1GJ8B 3URCA 1F5LA 1P04A 2Z3EA 1ZMLA 1GJCB 1T8NA 2UUJB 1C5UA 3QK1A 3HPTB 2O8MA 1ZTLA 1C5MD 3TJVA 1BMNH 3PMAB 2FDAA 3DT0H 3IWMA 3EGKH 2CHAC 1OWHA 5C5OA 1Y3VA 1FQ3A 1PFXC 4X1SU 1VCWA 1ZRKA 1O37A 1G32B 2FLBH 3OX7U 6GCHF 3LT3A 1GHAG 3PO1C 3QO6A 1V2QT 2EI6A 3RM2H 1O5EH 3F9EA 4BAKB 1S82A 3CS7A 1TGBA 1VGCC 1P9UA 3MU0A 3VB3A 1EOJA 1E37B 5CHAC 3UUZA 1ELFA 1BTHH 3W95A 3LONA 1J9CH 1JIRA 1O2TA 4ZXXH 5I46H 3O8CA 4LZ4B 1AFQB 1H9HE 3KQDA 1BUIA 2V6NA 3MNXA 1UCYK 1FY1A 3S9CA 3U1JB 1RIWB 3NPSA 3VB6A 3A7ZA 1O3MA 4JZDH 3LU9B 1HAOH 2FO9A 1IAUA 2D8WA 1P06A 1P05A 1L1JA 1OP0A 1HPGA 2BDCA 4ZKRU 5ESBA 4U2WA 1GBKA 1GGDC 1UHBB 1M9UA 2WINI 1P8VC 1V2JT 3U8RH 1GI5A 3TGIE 1EPTA 1E0FD 1SOZA 2BTCE 2BY5X 4X8TH 5LPEA 1BTWA 2GT7A 5H4IB 3PLBA 1P2NA 2FI5E 5FAHA 3SJ9A 1FDPA 2GDEH 2A5IA 1DWDH 3DA9B 2NU0E 3PYHA 5TCCA 1TQ7B 1XMNB 1XXDA 5LH8A 2Z9GA 5DP9A 1ABJH 3AAVA 4JZ1A 1IQKA 3RXJA 5A8YA 3RLYH 2ZFSA 1DPOA 3EQ0H 3Q76A 2H9TH 1H8DH 3GCHB 1MTVA 2BDYA 1DWCH 3A86A 1TNKA 2C93B 4INHA 2BX3A 3T62A 4Y8ZA 1Q3XA 1A5IA 3ZZ8A 1MH0A 1ELEE 1GBEA 1O38A 4ISLA 4OS6A 5G4BA 4J1YA 3KGPA 1GI9B 2QY0B 4AFUA 3U8TH 1HNEE 2FX6A 1HFDA 1NU7B 3GCOA 1SFIA 1NT1A 1GI2A 1KYNA 1ARCA 4A1XA 1FN8A 1QJ7B 1AU8A 4TPYA 2JH5D 3V7TA 1W3CA 3GOVB 1QIXB 1CVWH 2QIQA 2FYQA 4NA7A 1ELBA 1EX3A 2B9LA 1N1LA 2FYRA 3QN7A 2Y5FA 5EXLA 1BT7A 4WXVA 3EE0B 2PSYA 1E35B 4X6MA 3GCHC 1D3TB 1SGFA 5EQSA 1OWJA 2DUCA 1EAWA 3VXFH 3NKKA 1ZOMA 2GGVB 2P95A 1QBOA 4WXIA 1QL9A 2F3CE 1ZGVA 5GDSH 3PM3A 1A46H 3QX5H 6CHAB 2ZP0H 1AVXA 3U1IB 3NUMA 2AERH 3GY3A 5EXNA 3RLWH 2QA9E 4NIYA 1HGTH 4Y0YE 4KTSA 1UTJA 4YOGA 1P10A 2QV1A 2R3UA 4B75A 3I77A 4JMYA 1EJMA 3RDZA 3RXOA 1CT0E 2ALVA 4FXGH 1EXFA 3Q00A 2D2DA 5EG4A 1XUFA 1QL8A 1AIXH 2PUQH 2IN2A 5F8ZA 5ABWA 4ZROA 4WMDA 1C2GA 1NRPH 2CHAB 2ZHEH 1NESE 2C3SA 2B7DH 1PQ8A 1SL3A 4Q7ZA 1CGJE 1F5RA 4Y11E 1SBWA 3RXRA 4MPWA 4BXWA 2BMGB 2A4QA 4LOYH 3A7YA 2Z9JA 3UR6A 4SGAE 4YT6H 1HV7A 4D9RA 1WQVH 2B5TB 1QA0A 2BVRH 2I6SA 3HK3B 3L3TA 5GWZA 4WMEA 5A0BA 3BEUA 3UWJH 4FUDA 4YLUA 1EAIA 4ISIH 1TNJA 1NFYA 3BEFB 2ZDAH 5C1XA 1GG6B 1C1OA 3SN8A 4JZIA 1EJNA 1MMJN 2AMQA 3GDVA 2WV5A 5JBAS 2P3UB 4UONA 2ZTYA 3ZZAA 3HGNA 5JBBS 4NWLA 1KLTA 3FP8E 1YPHC 1RS0A 3E0PB 4NA8A 1TBRH 1A3EH 4DW2U 3A8CA 3VGCC 3E0NB 1HAPH 3SUFA 2TGPZ 3A85A 2ZZUH 4THNH 4A1VA 1VZQH 4E7RG 1TA2A 2UUYA 3NZIA 3RXVA 1D4PB 3A83A 1Z8GA 2VB0A 2WPJS 4CRDA 2Y7ZA 5EW2H 1GBLA 4JCNA 1VR1H 1DT2A 2BDBA 2BM2A 1BTZA 3MO6A 1TX6A 3PV4A 1J8AA 2H6MA 1FY4A 1AZ8A 2VIDA 3KN2A 3M37A 4GSOA 3LC3A 2ZU2A 1O2VA 1DS2E 2Z7FE 1TGTA 2PKAA 5C5NA 5E8EH 1HAVA 3RMOH 2ZGXH 3ZZBA 1ABIH 2BZ6H 1QL7A 1GGDB 1A7SA 4ABIA 1Q2WA 7LPRA 4GHTA 2VVVA 3ZZ9A 1TGNA 1K1OA 2VGCB 2OQUA 5L6NH 4MNYA 4D7FA 1B7XB 4I7YH 2WV4A 3UPEA 1C2DA 1GDNA 1TBQH 5DPAA 3G01A 1THRH 1P2QA 1TPOA 1MD7A 2ZU4A 3JZ1B 1GBIA 1UVTH 2FPZA 2HRVA 1ACBE 3FZDA 4NFEA 3ZYDA 2J34A 4ZUHA 3ATWA 1TNHA 1HAHH 1O2OA 3CS0A 2F9NA 4YTAA 1Z8IB 4AYYB 2GV7A 4I32A 3U9AH 1XVMA 2YNBA 1S0QA 3BEIB 3SV9A 1V2RT 2SGPE 5FPSA 1O3OA 1P2MA 1SC8U 3S7KB 1BRUP 3FAOA 1GBFA 3SNDA 4ASHA 1O2JA 4X1QU 1H8IH 2ZHFH 5LGOA 4SGBE 3GY4A 4ABHA 2FS9A 1NFUA 2CV3A 1PPFE 1EAUA 2F9UA 3ELAH 3NCLA 4NA9H 2BXTH 4AG2A 5EOKA 1DXPA 2PKSC 1F0SA 2XTTB 1GL1A 1YPMH 1BCUH 2M5TA 5E0JA 1SLVB 2VIVA 3A89A 2EI8A 5E2PA 5F8XA 1D3PB 3EA7A 7GCHG 1AO5A 1ZJKA 3ZVFA 1A3BH 3K6YA 1YPHE 1TGSZ 4XBBA 2A45B 1CQQA 5JYIA 5A8ZA 1C1VH 1O0DH 1O5BB 1GI3A 4O03A 4GVUA 2BD5A 3LH3A 4A92A 1GJ9B 3BTDE 1K1PA 1F92A 1O2XA 2P3TB 4Y6DA 1FI8A 4F49A 1Y8TA 1V3XA 1O5DH 3STIA 2VVUA 4Y76A 1ZMJA 1UVSH 2J38A 2OC0A 3SBKA 3MH5A 1BA8B 3A7XA 3S69A 2RCEA 2FOGA 1ZYOA 2ZPRA 4XDEA 3ENSB 4BXSA 1CT2E 1O2SA 3T2NA 1GMDG 2BLWA 3VFEA 1ELCA 1KXDA 1FV9A 4X1RU 3HKJB 1V2LT 4HFPB 3RXKA 1AUJA 4YO9A 3RC4A 1HCGA 2JH0D 4NZLA 1DDJA 1DLEA 1B5GH 1ZTJA 1S84A 3ZVEA 5DGJA 1HJ8A 2CN0H 1AZZA 1V2UT 2FOAA 4RKJB 1CSOE 2SNWA 4X2YA 5BPEA 1BRCE 2C8YB 2BD9A 4MPXA 1TPAE 2FXRA 3LGIA 3TGJE 3P8GA 1AUTC 1WBGB 4K8BA 3TH3H 1NN6A 1SGYE 3MOCA 2O8TA 1C4V2 3GY7A 3P8OA 3VB4A 1DWEH 1O2NA 1SSXA 4Z6AH 1XUKA 2FODA 1NM6A 1EKBB 4JYTA 3P17H 3MU1A 4AB9A 1FAXA 3UR9A 4KTUA 1B0EA 1DVAH 3V3MA 1QQ4A 5GPIB 1GJ7B 1MKWK 1YCPH 3PLKA 2HWLB 2SGDE 3U98H 1DOJA 1V2KT 1BTYA 1O2YA 3UQOA 4BNRA 1O3AA 3GISB 3QLPH 1MKWH 3E16B 1C1QA 2PTCE 5FHTA 4BTIB 3TJNA 4CRCA 2HLCA 1GHBG 2UWPA 2WYGA 3TJOA 5L30H 1EPTC 3SNBA 1YLDA 2OTVA 1TRNA 3AASA 3GY5A 3RXHA 3E90B 1IQLA 1LQDB 3ZVDA 1SI5H 4Q2KA 3SU3A 3GY2A 1F7ZA 1K1LA 4K60A 1TNGA 1GHVH 2BY8X 5DP7A 3RMLH 2AIPA 2G81E 2R0KA 1TPSA 1IQNA 1OYTH 8GCHF 2OP9A 3URDA 4GCHG 1JMOH 3RXLA 1P11E 2FWWA 1CHOF 3M3VA 2HNTC 1E38B 1LHFH 3SQHE 1QURH 3ZVAA 4O3TA 1T8MA 1O39A 3HATH 4A6LA 1PQ5A 4HI3A 1C1PA 3MU5A 2JETB 1T7CA 1SGTA 1T4VH 1O3IA 3K9XB 4B2CA 1P02A 1QJ1B 3UWIA 3SOSA 1KXEA 1G37A 1C2EA 1C2MA 2EI7A 2K1QA 2J9NA 3NWUA 1GHYH 3UY9A 4CRFA 1Q31A 4F4OC 3GDSA 1SGEE 1K1JA 1LKBA 1GWAA 1GVLA 1O2PA 1SLXB 1MU6B 3Q3XA 4X8UH 2ZGHA 4X6OA
chains in the Genus database with same CATH superfamily
2YMSB 3SJKA 3SU2A 3MU4A 2GZ9A 1OWEA 4ABDA 3ZZDA 1G2MA 2B0FA 5DN6D 1CT4E 1UHBA 1LDTT 2ZTZA 4WWYA 3BG4B 3M3SA 2AHME 3M36A 1JBUH 3D65E 1ZPBA 1IQIA 1SGFG 1FIWA 2ZI2H 1DUEA 1O34A 3H7OA 2A4OA 4Q63A 3P95A 2OBQA 3TJUA 4K8YA 1HAZB 1C1RA 1UTQA 1DX5M 1MTNC 1KDQA 1MBMA 4YZUA 3GYMA 3ZZ6A 1YC0A 1WV7H 3LH1A 3PV2A 3QZRA 4U01A 4GHQA 1KLIH 3A8BA 1YPKH 9ESTA 1ANBA 1OWIA 1VCQA 1O3KA 1HIAB 2BB4A 1GBAA 3S9BA 3MNCA 1FY3A 1GCTC 4AG1A 2XRCA 3UOUA 1W13U 3BIUH 1IQEA 1PPHE 2W7UA 1BMMH 1T4UH 2V0BA 4VGCC 4ABAA 1C5TA 1O3FA 2FIRH 1TAWA 4K1EA 2G55A 2PR3A 4PROA 1THPB 3LGWA 2Z9IA 1MTSA 5FCRA 1NU9A 9LPRA 3MH4A 3PMHB 3FKSD 1CA0C 2PGQB 4U32A 3T29A 1ELVA 2CGAA 2WYJA 1OWDA 1A5GH 3QUMP 2QE7D 4TPIZ 1HJAC 1N6XA 4K2YA 1P03A 2C90B 1YLCA 1GMCG 1K9OE 1VGCB 2PGBB 5HIZA 1O3NA 1MTWA 1Z6EA 5CHAB 1L1GA 2QXGA 5GJ4B 3GDUA 2OUAA 1UMAH 2AGGX 3MNBA 1QA7A 3F6UH 1AE5A 2JKHA 3QTOH 4IN1A 1BMAA 2QF5A 1XKBC 4F48B 3SZNA 5HXFA 2ZHWH 1VITG 2F43B 3SQEE 3TNSA 1INCA 2QXJA 1TMUH 2BOKA 4RT0A 2QYIA 4MG3A 4Y71A 2SFAA 1J16A 1G36A 3OSYA 3LPRA 1E36B 1W8BH 3LJOA 4R8TB 3BTHE 3MH7A 1VJ9U 1P01A 1CHGA 1BRBE 1NROH 2FX4A 1C2IA 2XBXA 2FOCA 3RXTA 1XUGA 2XC0A 3SV6A 1ZPCA 2WV9A 4JZEH 1P57B 1BZXE 3SORA 1O3EA 3SW2B 1GJBB 2ODYB 3LIWA 3SU0A 4P00A 1PPZA 5DP8A 3S0NA 2OXSA 3B8JA 1RTFB 1GMHG 2J94A 1GJ6A 3R3GB 3U8OH 5FPYA 3SU1A 1QTFA 4M7GA 2QCYA 1P3CA 2BD3A 2CMYA 1H1BA 3F3BA 2ANMH 2KAIB 2Y7XA 8LPRA 5AVDA 1Y5AT 1GJ4H 2K0QA 1HAIH 4LK4A 2G5VA 2D26C 1C2FA 4AN7A 3M7QA 2A5AA 4X6PA 1DWBH 2GVFA 2GZ8A 2ZFTA 1EASA 1CGHA 2XXLA 4B2AA 1Y3WA 4NG9H 1SHYA 4TYDA 4CHAC 3RMNH 1C9PA 2J97A 1FLEE 2A4RA 1C5ZB 4NWKA 2ILNA 3LGYA 3IITA 3RXIA 3RC5A 2V7QD 2BDGA 2PUXB 1BTXA 1YF4A 4MDSA 3CP7A 1UTNA 2Y82A 2BDAA 4JZFH 4YESB 4X2VA 3ZZ4A 1K1NA 1D6WA 4I8GA 8GCHG 1BOQA 4INLA 1TNIA 4DCDA 2W3IA 1HDTH 1ESTA 5EQRA 1FMGA 1SGCA 1K1IA 4AZ2B 1S5SA 1RTKA 2H2ZA 3LDXH 3V12A 1ID5H 3PROA 1DE7H 4ZCNA 2C8WB 1AY6H 3M5NA 1SQTA 2BQ6B 5T6GA 4Y0ZE 1GHBF 1NFWA 3ZVGA 3SHCH 4MNWA 1AD8H 3W94A 2BLOA 1RD3B 5KGOA 5E2OA 3WY8A 2JETC 1WQSA 3F2GA 1O2WA 1W10U 3K6ZA 1P2KA 2XYAA 1CGIE 1EB1H 2WPKS 3PWBA 4E05H 2IPHA 1HAVB 3KYFA 3UREA 3D62A 1HAGE 2A2QH 2RG3A 5AFZH 3QGNB 4HGCA 4A5TS 3SV8A 1D9IA 2TGAA 2QXHA 1FY8E 1IQJA 2FEQH 1UVPA 1T32A 1HIAA 2GZ7A 4AFSA 3AAUA 5EQQA 1VITH 3M5OA 1C5NH 1E1RD 5FX6A 5C3NA 4AOQA 2CF8H 4UFFH 2Z3DA 3U28C 5FL7D 1UK3A 1GJAB 1A0HB 2J95A 1NTPA 2ZDMA 1UK2A 1BJUA 4ISHH 3VGCB 3T28A 1HLTH 1NPMA 2HNTE 2P59A 1F5KU 1GJ5H 1WTHD 1T31A 2W6JD 5GCHF 8ESTE 2QF4A 2TBSA 2F9VA 1K2I1 2JH6D 4X1PU 4DT4A 2PW8H 1S85A 1ZHMA 1MBQA 2KAIA 4Q80A 3BTKE 2PKSB 2Y6TA 4I8LA 1QHRB 2VH6A 5C2ZA 1PPCE 1ARBA 2A7HA 1GBJA 1TPPA 1P3EA 5GCHG 2J4IA 2GX4A 1C1SA 1Z7KA 2TGDA 1BTUA 6GCHG 1QBNA 2A7JA 1EZUC 3F0PA 1TIOA 4I31A 2JJ2D 1O5GH 4BTTB 2BD2A 1AB9C 4BANB 2GKVE 1BJVA 5J4SA 4CH2B 1CA8B 3LGUA 3MWIU 3BIVH 4AGKA 1MZDA 1YWUA 1C5VA 2ZDVH 1PPGE 1NZQH 1YPEH 2Z3CA 1FONA 2GCTB 3KYGA 3TITA 4UFEH 1O2HA 3MI4A 3Q3KA 1OP8A 3ITIA 4J2YB 1UTLM 3EAJA 2R2MB 4ZKNU 2H1UA 2ZDKA 2VJ1A 4XE4A 2ANYA 3A88A 1W12U 2V3HH 1LVMA 2Y5HA 5FBEA 1S83A 4I86A 1TABE 1YY3A 3GYLB 1S6HA 1DFPA 1LPKB 1O2QA 4H6TA 3EDXB 1G30B 4XBDA 3RU4D 1AQ7A 3SU5A 4MLFB 1AB9B 3QDZB 2GV6A 1Z8RA 4ABFA 4CRAA 2O8LA 5C1YA 1AKSB 1WSSH 1VKYA 2BD7A 1W11U 2ODPA 4ABJA 2WPMS 3VB5A 2ZDLA 3K65B 2VIWA 1OPHB 3RXMA 4AORA 1EFRD 4FUHA 1QFKH 2AMPA 1WCZA 2F9PA 2FM2A 5JB8S 2RA0A 1O35A 2QF3A 2FOEA 3KQEA 1TWXB 4ZXYH 2C8ZB 1HYLA 1EB2A 2VIOA 2HGTH 2PV9B 1XX9A 4WY3A 5HMAA 1V2ST 1KMHB 1LHEH 4WH6A 4ABBA 3ODFA 4RN6A 1HB0B 3PLPA 4AGJA 1C5LH 3ZZCA 2ZQ1A 2P8OB 3S7HB 4NGAH 2ZA5A 1E1QD 1XXFA 1C1TA 1SHHB 2GJGA 2BY6X 1BBRH 4DJZB 1BMFD 1O2IA 2WPDD 8KME2 3O8DA 1C5RA 2SGFE 4P02A 1AHTH 2XNIA 3RXQA 3VXEH 3ZV8A 5C0TA 1ZSLA 2FOMB 2AIQA 2ZECA 4JK5A 2BY9X 7ESTE 2C8XB 1ZHRA 2ZF0H 5DP5A 4K1SA 2ZG0H 1EP6A 1TONA 3MMGA 1PQ7A 1GI7B 3ATKA 4GPGA 2Z6BD 4IW4E 3RP2A 1THSH 1IOEA 1V2VT 3B23B 1WXRA 4HTCH 1G3DA 3DSGA 1LVOA 3SGQE 3P92A 3U69H 2IJOB 3VB7A 5L2YH 2BY7X 1LCYA 2H5CA 1QB6A 1PYTD 1KXBA 3A80A 1QRWA 1X7AC 4WVPE 1O5FH 2ZU5A 1B0FA 4XD7D 3TVJB 3VG8A 2UUFB 1UCYH 1SGRE 2WUBA 3DFJA 3QTVH 2JJ1D 3PRBA 3B9FH 2HOBA 1ZZZA 1L1NA 3BTEE 1A0LA 4B74A 1WOFA 2PHBA 1HBTH 2VU8E 5TJXA 5EXMA 2OD3B 2R2WU 1E79D 2ODQA 2FESH 4FU9A 5T6DA 3M35A 3SU4A 1FY5A 3FVFB 4D7GA 4FUEA 4YXWD 4BAHB 5HIYA 4OGYA 1GMDF 3EE7A 2HALA 4DURA 5A2MH 1O31A 2QXIA 4X0WU 1HRTH 2XC4A 2Q6FA 4FUBA 2GTBA 1SB1H 5AHGH 2FOHA 3UOPA 2QGRA 2STAE 1DUAA 1N6YA 1TMTH 5DSFA 1C5SA 3H09A 1W14U 2GD4B 1BBRK 2XCNA 1YLNA 3WWFA 4OS1A 2KFWA 5B6LA 5CDFE 5KEDA 2NU2E 1A1RA 2SGEE 1TOCB 1TFXA 4KP0A 1UTOA 3SNEA 3UFAA 1C1MA 3PRDA 1FZZA 2J98A 2OCVB 2KM0A 1F2SE 2ZU1A 3GICB 3UNQA 1O36A 4VGCB 3OTJE 4MPVA 2PKAB 2KCYA 1HXFH 3A7TA 4TWWA 3RXBA 2HPQH 2FI4E 4X2XA 1TLDA 3A81A 3RU4E 1O5CB 3D49H 2PTNA 3T25A 4X8VH 1MQ6A 1RIWC 1GBDA 1FUJA 5JBCS 3TNTA 1BBRE 3AW1A 1FAKH 2O8WA 3LKWA 4RKOB 4BOHA 3TK6A 3SGBE 3E1XB 4LXBH 3TU7H 1G9IE 3DUXH 1ZMNA 3PTNA 1BQYA 3LOXA 1O3DA 3C27B 2AFQB 4B2BA 1GI0A 3BTFE 2WHXA 1SR5C 1ELTA 3UNRA 1MCVA 1F0UA 4GLYA 2BQ7B 4NSVA 2BQWB 4IMQA 3KNXA 3RXDA 4X2WA 1XUHA 1DY8A 2PFEA 1P0SH 5GXPA 1LPGB 3BV9B 1MTNB 1C2LA 4WF8A 4ZHAA 3OTPA 1YGCH 1LVBA 4B71A 1LMWB 1AWFH 5CHBA 4I8JA 1ANEA 1O30A 2H5DA 3F9FA 4MPUA 1BMLA 2ZHDA 1ZJDA 1RFNA 2W7SA 1MQ5A 3Q77A 1Z71A 4JK6A 3TGKE 1GCTB 1Y3YA 1GBHA 3SNAA 1D3QB 3OFND 2V35A 1SMFE 3Q3YA 4CRGA 3AVZA 1WUNH 1A61H 2NU1E 1CBWB 1LHGH 2AH4X 4E06H 4Z0KA 2RDLA 2XWBI 2BX4A 1A5HA 3BG4C 1P09A 1L4ZA 4IBLH 4K5ZA 4UE7H 2R0LA 5JDUB 3PTBA 2LELA 1WDIA 2P8OC 1KDQB 1RJXB 2QC2A 3RC6A 1QGFA 3SJIA 1P2OA 2SGQE 2VIPA 2A2XH 2Z9KA 1SVPA 3MNSA 1MKXK 4A7IB 1S6FA 1YPJH 1ZR0A 4BTUB 2WPIS 5PTPA 4O3UA 2ZFRH 3FP6E 2LPRA 5A8XA 5AF9H 3O8RA 3EA8A 1TBZH 1TX8A 1AWHB 1QBVH 1TNLA 1XKAC 2WUCA 4B76A 1UVUH 5I25A 3OY5U 1QJ6B 1Y3UA 3SI3H 1JOUB 1MU8B 4AB8A 5IYTA 3RXCA 4NCYA 1ESAA 1T8OA 1CBWC 2VWMA 4DY7B 3KCGH 1PJPA 3W1EA 1GL0E 5C1UA 3MYWA 2ZFPH 3A82A 1KTTB 5EIYA 4KELA 1K22H 1C5PA 5EPNA 4AX9H 5FCKA 3ZIAD 1BIOA 4DVAU 2KZ4A 4RSPA 1UTKA 1UTPA 4NIXA 1UTMA 1NRQH 2W5EA 1TMBH 5EPYA 4MVNA 1AGJA 2UWOA 4TY7A 4O97A 1BRAA 4FUFA 4CREA 3N7OA 1PPBH 4UDWH 2KCOA 2STBE 3AW0A 1BHXB 4FVBA 3MHWU 2QF0A 2ZCKP 2XBYA 3ZZ5A 5TCAA 2F9BH 1V2TT 2BDHA 4OS4A 3OY6U 1P2JA 4XFQA 4TSFD 1HAXB 1OWKA 1ZLRA 1HXEH 3JZ2B 1GG6C 4ZMAH 2FOFA 3OU0A 2BD4A 1W7GH 2ZCLP 3TK5A 2GCHG 1GBCA 2ZU3A 3FZZA 1F0TA 4GCHF 1UJ1A 3F9HA 4ABGA 2EEKA 1EJAA 1KSNA 3PO1B 5DJ7A 5EGMA 2FOBA 2L74A 1JXPA 1KXCA 4DT7B 1ETSH 1E34B 4IGDA 1S0RA 3E91A 4K69A 5LPFA 2OBOA 4B73A 2SGAA 1GHXH 2W6ID 4RI0A 1NRRH 2IPQX 1AVGH 1KTSB 5KECA 3RM0H 1HUTH 5FXLA 2KR7A 1DICA 2ASUB 2PLXA 2G8TA 5T6FA 1QCPA 3K2UA 2BYAX 2ZFFH 3WWBA 3N7DA 4KGAA 1VJAU 2HLDD 4D8NA 1V2NT 2BOHB 3SNCA 3ZZ7A 2BVXH 2F83A 1O2MA 3ZV9A 1O33A 5HGGA 1ETRH 1NFXA 4AYVB 3A7VA 1C9TA 1SGIB 1JRSA 5EU8A 5F53A 3TLOA 5C94A 1L2EA 1O3HA 4NSYA 4OS2A 1GBTA 1SLWB 1NO9H 4O9VA 4Q7YA 3SJ8A 1GBMA 2VGCC 3MU8A 1YP9A 4D9QA 2PSXA 1NY22 4JYUH 2Z94A 5JB9S 5E0GA 1ZSJA 4Q7XA 3M61U 3OE7D 1OYQA 2RFKC 5DP4A 1RGQA 3SJOA 1QQUA 3GY8A 2VBCA 2HVXA 1NC6A 2M2AA 2P93A 3T27A 1LTOA 3H5CB 1FPCH 1C5YB 1QRZA 1FNIA 4FU8A 2BHGA 4ZAEA 1EOLA 1C5WB 4DIIH 1RTLA 1PQAA 3F1SB 3RU4T 4E7NA 1TA6A 1HJ9A 1KY9A 1XUJA 4Y10E 1DXWA 3RXUA 2LNCA 1GI1A 1WYKA 1GHAF 3SYJA 2TPIZ 2R9PA 4ABEA 3OEHD 1J15A 2WSSD 1FJSA 3FFGA 1IQFA 1SGQE 2AEIH 1TB6H 1CU1A 2ZKSA 2I6QA 1EATA 4XBCA 4YLQH 2G4UA 1COWD 2VWNA 3ATLA 2AMDA 2NWNA 1IQGA 3NK8A 4Y7AA 3P6ZB 1G2LA 2F9OA 3PV5A 2ZGCA 1H9IE 2IOTA 2AGIX 2VNTA 3A7WA 1LHCH 1TQ0B 2L6OA 4IC6A 3RXSA 5JPMH 1EZQA 2A0QB 4WH8A 1YBWA 3STJA 1BTPA 5HM2A 1EQ9A 3UIRA 3E8LA 2WPLS 4ZH8A 1HAYB 2C4FH 5DP3A 2UWLA 1Z6JH 2ZC9H 3S9AA 5J4QA 2G4TA 2QAAA 3KIDU 4U30A 1O3GA 5FX5A 6CHAC 2OQ5A 5LPRA 1G3CA 4OS7A 1BITA 5ESTE 4ZHMU 1PPEE 2O8UA 3F0OA 4YOJA 3T26A 1SGPE 2W26A 4IN2A 1AFQC 2HNTF 4NZQA 1H8HD 4MNXA 1UO6A 1MAYA 1V2OT 1LKAA 2AGEX 3F2FA 2A5KA 3BF6H 3KL6A 1OKXA 4ISNA 2J92A 1GHWH 4IS5A 5E0HA 2A31A 2EY4C 3N99A 1ZRBA 2XBWA 1EUFA 4LZ1H 2P16A 3D23A 3PMJA 1JWTA 5CE1A 2D1JA 3GCTG 4XOJA 4HZHA 4WJG2 3ATIA 1JIMA 2G51A 4HG6A 1FN6A 1MZAA 4FUJA 1HJAB 4TT3D 1NBME 2A7CA 1RXPA 1GBBA 5B6OA 3ZYEA 2Q6GA 3TK9A 1TE0A 2FS8A 3SV2H 5C67A 1SOTA 1GI8B 1C1NA 1Z1JA 2CF9H 2A4GA 3P70B 1KIGH 3BG8A 5GIBA 3LGVA 5C20A 3EA9A 1J17T 1YPGH 3SGAE 1P2IA 1W2KH 4FU7A 1OXGA 1C5XB 1O3CA 4NIWA 3BTQE 3HKIB 3OAAD 3A84A 2ZGBH 1O2LA 1AKSA 1IHSH 5EODA 1O2GH 2XC5A 2VWLA 3ATMA 2Y5GA 4OM9A 2O9QA 2WPHS 1EP5A 4OS5A 3SO3A 1C2HA 1W0YH 3V13A 1UVOA 2J2UA 2P94A 4UFGH 1EZSC 1RRKA 1SQRA 1C5QA 3BTGE 4H6SB 2GP9B 1H4WA 1IQMA 1SQOA 3OEED 2ULLA 3RXPA 1OHHD 5CMXH 4CBOA 3SHAH 1DSUA 1O3BA 3I29A 4ZKSU 1EPTB 3RXEA 1VITF 2FP7B 1DLKB 4MQAA 1A2CH 2NU4E 2BLVA 4MTBA 5IK2D 1YYY1 1FPHH 3M5MA 3FN8A 2YOLA 2ZIQH 2P3FH 4CH8B 3T5FH 3FP7E 2FI3E 2ZQ2A 1SGNE 1SQAA 2CK3D 2FTLE 1IQHA 1NRNH 1MAXA 2UUKB 1QZ8A 4WMFA 3SV7A 4I33A 3F9GA 2F4LA 1FXYA 1XUIA 2GMTC 1ZTKA 1O2KA 4INKA 4DG4A 5AFYH 3A8DA 3M7TA 2BLQA 3I78A 3LJJA 1ZHPA 4CHAB 1AVWA 2Y81A 4FVDA 1AFEH 3H7TA 4I8HA 1Y3XA 2VWOA 4TWYA 6LPRA 2PWXA 2EA3A 4JYVH 3QGJA 2GDDA 2BVSH 1BB0B 2ZDNA 1MABB 2FZZA 1WAYB 2ALPA 1K21H 1TGCA 3BTME 3NXPA 2XW9A 4I8KA 3GCNA 3MH6A 5JBTA 1ANDA 1Y59T 1TRMA 1ELGA 3RXAA 4CRBA 1KLJH 4ACBA 2B8OH 1WU1A 2GMTB 5EW1H 1GI4A 3V0XA 4K3JA 2H9EH 3TH2H 2ANKH 2ESTE 1D3DB 2V3MA 2EC9H 2J98B 5A0CA 4MNVA 4BAQB 1GJDB 1W0JD 2TGTA 3C1KA 2OC1A 1L4DA 1YM0A 1V2WT 1ETTH 3BTWE 1A0JA 3MFJA 1YCPM 1QRXA 5A09A 1C1WH 6ESTA 1C2JA 4QT8C 3TH4H 3MTYA 3TPIZ 2G5NA 3DD2H 2GT8A 1MUEB 1K1MA 1QY6A 2FTMA 4ZKOU 3SI4H 1O2ZA 5F03A 3PWCA 1GMHF 4CR9A 3SUEA 3VEQB 1T8LA 2THFB 2HPPH 5L2ZH 2NU3E 1GDQA 4ZHLU 1CA0B 5DP6A 1VCPA 4UFDH 7KMEH 3UQVA 4ISOA 1TOMH 2SNVA 1U6QA 3BN9A 5A0AE 1UK4A 3GCTF 1CE5A 3CENA 1OOKB 3RXFA 1ELAA 4YOIA 2BXUH 4BAMB 1TRYA 2ZPQA 3L6PA 4Q4LA 1O32A 4H42U 1CHOG 1DY9A 4OGXA 3LC5A 5FBIA 1GVKB 4AFQA 3BSQA 1GDUA 2VH0A 2ZHQH 1C1UH 4IC5A 3SU6A 2EQNA 2ZO3H 1A4WH 3DFLA 1MKXH 5K0HA 3OYPA 1MCTA 1AN1E 3PB1E 3PMBB 4CBNA 4UEHH 3A87A 2TRMA 3ZVBA 1GVZA 3L33A 1IHTH 5DG6A 2VINA 3KQBA 1ELDE 1DSTA 1G3EA 3HK6B 4RT1A 3F2HA 1GMCF 2DE9A 1SFQB 2A32A 3SUGA 4BAOB 5T3HA 1N8OB 1LHDH 2ZFQH 3KQCA 4KKDA 3KEEA 3MO3A 1XVOA 2XWAA 2Y80A 3M7UA 5K7RA 4Y8XA 5DK1A 5BRRE 1C5OH 3FANA 3IG6B 3QZQA 1Y5BT 1Z8JB 4XSKU 4IMZA 4H4FA 1OS8A 2KCAA 1V2PT 2KCPA 5FPTA 2AS9A 2F91A 2Q6DA 2ZWLH 4FUIA 4ESTE 1WTGH 3UNSA 2VIQA 1J14A 1PYTC 2XCFA 1OSSA 2Q1JA 2Z9LA 3EYDA 4GUXA 1AE8H 4Y79A 2ZPSA 2ZEBA 2ZGJA 4YM9A 1G3BA 2BDIA 1NS3A 1QB9A 1CO7E 1TX7A 4KTCA 2VVCA 1C4U2 1KXFA 3DHKH 1C2KA 1ZGIA 1AI8H 1F0RA 5HM9A 1SG8B 1O3PB 4AFZA 1DITH 1NBMD 4X6NA 2BD8A 1N8OC 1D6RA 1W7XH 3O8BA 3M3TA 3RMMH 1MD8A 1V6DA 1MTUA 7GCHF 1O5AB 2ZNKH 2ZCHP 2GCTC 2G00A 1ZPZA 1P12E 4Y8YA 4FUCA 1LVYA 2BZAA 2OINA 3UTUH 4DGJA 5ETXA 1TYNA 3KF2A 1LQEA 2A1DB 1ZSKA 1P9SA 3E3TA 5C0UA 1EAXA 1DANH 3ZZ3A 1BHXF 1YPLH 1TALA 5F6MA 3ESTA 3GY6A 3SUDA 2W3KA 4TY6A 1LO6A 1ANCA 2QN5T 5F8TA 1O3JA 1SLUB 1GPZA 2V3OH 1NRSH 1ESBA 4NIVA 1W0ZU 1DM4B 1UCYE 2OC7A 3R0FA 1L0ZA 1O2RA 5IDKA 3MO9A 5DKMA 1Z1IA 2CJIA 2YNAA 3QWCH 4GAWA 4X8SH 3UAIC 4CR5A 2FLRH 3SZEA 2JIZD 2K8IA 1H9LB 1O3LA 3DSOA 2DE8A 1SPJA 3F68H 1AMHA 1JRTA 4DIHH 4DOQA 3A8AA 2XOKD 3LGTA 2TIOA 5SGAE 2R3YA 3M5LA 4A1TA 3KHVA 2AYWA 1BDAA 3TIUA 1GI6A 3P8NA 4UD9H 3P8FA 1S81A 1QNJA 3HGPA 4Y7BA 3RUOA 1GHZA 5HYOA 2RA3A 3ODDA 4R0IA 2OLGA 2ZTXA 4NFFA 3ZVCA 5DO4H 2CXVA 1OX1A 2OC8A 4K1TA 1EZXC 1KXAA 3BTTE 1K28D 4YT7H 4D76A 1C4Y2 1Y5UT 4B6FA 1ORFA 4B1TA 1OP2A 3E6PH 1YCPK 1YKTA 1GCDA 1QR3E 1V2MT 2G52A 1O2UA 2RDEA 2GCHF 2XBVA 2ANWA 2PP6A 1LPZB 1XM1A 1QB1A 3VPKA 4X1NU 2FMJA 2H9HA 4FOUC 1FIZA 4FUGA 1SGDE 3RXGA 1GJ8B 3URCA 1F5LA 1P04A 2Z3EA 1ZMLA 1GJCB 1T8NA 2UUJB 2YMSC 1C5UA 3QK1A 3HPTB 2O8MA 1ZTLA 1C5MD 3TJVA 1BMNH 3PMAB 2FDAA 3DT0H 3IWMA 3EGKH 2CHAC 1OWHA 5C5OA 1Y3VA 1FQ3A 1PFXC 4X1SU 1VCWA 1ZRKA 1O37A 1G32B 2FLBH 3OX7U 6GCHF 3LT3A 1GHAG 3PO1C 3QO6A 1V2QT 2EI6A 3RM2H 1O5EH 3F9EA 4BAKB 1S82A 3CS7A 1TGBA 1VGCC 1P9UA 3MU0A 3VB3A 1EOJA 1E37B 5CHAC 3UUZA 1ELFA 1BTHH 3W95A 3LONA 1J9CH 1JIRA 2KX4A 1O2TA 4ZXXH 5I46H 3O8CA 4LZ4B 1AFQB 1H9HE 3KQDA 2J5UA 1BUIA 2V6NA 3MNXA 1UCYK 1FY1A 1SKYE 3S9CA 3U1JB 1RIWB 3NPSA 3VB6A 3A7ZA 1O3MA 4JZDH 3LU9B 1HAOH 2FO9A 1IAUA 2D8WA 1P06A 1P05A 4ASUD 1L1JA 1OP0A 1HPGA 2BDCA 4ZKRU 5ESBA 4U2WA 1GBKA 1GGDC 1UHBB 1M9UA 2WINI 1P8VC 1V2JT 3U8RH 1GI5A 3TGIE 1EPTA 1E0FD 1SOZA 2BTCE 5EJ1A 2BY5X 4X8TH 5LPEA 1BTWA 2GT7A 5H4IB 3PLBA 1P2NA 2FI5E 5FAHA 3SJ9A 1FDPA 2GDEH 2A5IA 3CNRA 1W0KD 1DWDH 3DA9B 2NU0E 3PYHA 5TCCA 1TQ7B 1XMNB 1XXDA 3N7EA 5LH8A 2Z9GA 5DP9A 1ABJH 2IJD1 3AAVA 4JZ1A 1IQKA 3RXJA 5A8YA 3RLYH 2ZFSA 1DPOA 3EQ0H 3Q76A 2H9TH 1H8DH 3GCHB 1MTVA 2BDYA 1DWCH 3A86A 1TNKA 2C93B 3FO8D 4INHA 2BX3A 3T62A 4Y8ZA 1Q3XA 1A5IA 3ZZ8A 1MH0A 1ELEE 1GBEA 1O38A 4ISLA 4OS6A 5G4BA 4J1YA 3KGPA 1GI9B 2QY0B 4AFUA 3U8TH 1HNEE 2FX6A 1HFDA 1NU7B 3GCOA 1SFIA 1S6LA 1NT1A 1GI2A 1UW7A 1KYNA 1ARCA 3FOAA 4A1XA 1FN8A 1QJ7B 1AU8A 4TPYA 2JH5D 3V7TA 1W3CA 3GOVB 1QIXB 1CVWH 3KQ5A 2QIQA 2FYQA 4NA7A 1ELBA 1EX3A 2B9LA 1N1LA 2FYRA 3QN7A 2Y5FA 5EXLA 1BT7A 4WXVA 3EE0B 2PSYA 1E35B 4X6MA 3GCHC 1D3TB 1SGFA 2JDID 1OWJA 5EQSA 2DUCA 1EAWA 3VXFH 3NKKA 1ZOMA 2GGVB 2P95A 1QBOA 4WXIA 1QL9A 2F3CE 1ZGVA 5GDSH 3PM3A 1A46H 3QX5H 6CHAB 2ZP0H 1AVXA 3U1IB 3NUMA 2AERH 3GY3A 5EXNA 3RLWH 2QA9E 4NIYA 1HGTH 4Y0YE 4KTSA 1UTJA 4YOGA 1P10A 2QV1A 2R3UA 4B75A 3I77A 4JMYA 1EJMA 3RDZA 3RXOA 1CT0E 2ALVA 2XNDD 1EXFA 3Q00A 2D2DA 4FXGH 1XUFA 5EG4A 1QL8A 1AIXH 2PUQH 2IN2A 5F8ZA 5ABWA 4ZROA 2WZQA 4WMDA 1C2GA 1NRPH 2CHAB 2ZHEH 1NESE 2C3SA 2B7DH 1PQ8A 1SL3A 4Q7ZA 1CGJE 1F5RA 4Y11E 1SBWA 3RXRA 4MPWA 4BXWA 2BMGB 2A4QA 4LOYH 3A7YA 2Z9JA 3UR6A 4SGAE 4YT6H 1HV7A 4D9RA 1WQVH 2B5TB 1QA0A 2BVRH 2I6SA 3HK3B 4FETA 3L3TA 5GWZA 4WMEA 5A0BA 3BEUA 3UWJH 4FUDA 4YLUA 1EAIA 4ISIH 1TNJA 1NFYA 3BEFB 2ZDAH 5C1XA 1GG6B 1C1OA 3SN8A 4JZIA 1EJNA 3UB0A 1MMJN 2AMQA 3GDVA 2WV5A 5JBAS 2P3UB 4UONA 2ZTYA 3ZZAA 3HGNA 5JBBS 4NWLA 1KLTA 3FP8E 1YPHC 1RS0A 3E0PB 4NA8A 3DCLA 1TBRH 5EJLA 1A3EH 4DW2U 3A8CA 3VGCC 3E0NB 1HAPH 3SUFA 2HVYB 2TGPZ 3A85A 2ZZUH 4THNH 4A1VA 1VZQH 4E7RG 1TA2A 2UUYA 3NZIA 3RXVA 1D4PB 3A83A 1Z8GA 2VB0A 2WPJS 4CRDA 2Y7ZA 5EW2H 1GBLA 4JCNA 1VR1H 5T1VA 1DT2A 2BDBA 2BM2A 1BTZA 3MO6A 1TX6A 3PV4A 1J8AA 2H6MA 1FY4A 1AZ8A 2VIDA 3KN2A 3M37A 4GSOA 3LC3A 2ZU2A 1O2VA 3MQKC 4Z1MD 1DS2E 2Z7FE 1TGTA 2PKAA 5C5NA 5E8EH 1HAVA 4AC9A 3RMOH 2ZGXH 3ZZBA 1ABIH 2BZ6H 1QL7A 1GGDB 1A7SA 4ABIA 1Q2WA 7LPRA 4GHTA 2VVVA 3ZZ9A 1TGNA 1K1OA 2VGCB 2OQUA 5L6NH 4MNYA 4D7FA 1B7XB 4I7YH 2WV4A 3UPEA 1C2DA 1GDNA 1TBQH 5DPAA 3G01A 1THRH 1P2QA 1TPOA 1MD7A 2ZU4A 3JZ1B 1GBIA 1UVTH 2FPZA 2HRVA 1ACBE 3FZDA 4NFEA 3ZYDA 2J34A 4ZUHA 3ATWA 1TNHA 1HAHH 1O2OA 3CS0A 2F9NA 4YTAA 1Z8IB 4AYYB 2GV7A 4I32A 3U9AH 1XVMA 2YNBA 1S0QA 3BEIB 3SV9A 1V2RT 2SGPE 5FPSA 1O3OA 1P2MA 1SC8U 3S7KB 1BRUP 3FAOA 1GBFA 3SNDA 3DSPA 4ASHA 1O2JA 4X1QU 1H8IH 2OK5A 2ZHFH 5LGOA 1H8ED 4SGBE 3GY4A 4ABHA 2FS9A 1NFUA 2CV3A 1PPFE 1EAUA 2F9UA 3ELAH 3NCLA 4NA9H 2BXTH 4AG2A 5EOKA 1DXPA 2PKSC 1F0SA 2XTTB 1GL1A 4M9FA 1YPMH 1BCUH 4XRNA 2M5TA 5E0JA 1SLVB 2VIVA 3A89A 2EI8A 5E2PA 5F8XA 1D3PB 3EA7A 7GCHG 1AO5A 1ZJKA 3ZVFA 1A3BH 3K6YA 1YPHE 1TGSZ 4XBBA 3AK5A 2A45B 1CQQA 5JYIA 5A8ZA 1C1VH 1O0DH 1O5BB 1GI3A 4O03A 4GVUA 2BD5A 3LH3A 4B6EA 4A92A 1GJ9B 3BTDE 1K1PA 1F92A 1O2XA 2P3TB 4Y6DA 1FI8A 4F49A 1Y8TA 3GS9A 1V3XA 1O5DH 3STIA 1K0HA 3WW7A 2VVUA 4Y76A 1ZMJA 1UVSH 2J38A 2OC0A 3SBKA 3MH5A 1BA8B 3A7XA 3S69A 2RCEA 2LP6A 2FOGA 1ZYOA 2ZPRA 4XDEA 3ENSB 4BXSA 1CT2E 1O2SA 3T2NA 1GMDG 2BLWA 3VFEA 1ELCA 1KXDA 1FV9A 4X1RU 3HKJB 1V2LT 4HFPB 3RXKA 1AUJA 4YO9A 3RC4A 1HCGA 2JH0D 4NZLA 1DDJA 1DLEA 5EJZA 1B5GH 1ZTJA 1S84A 3ZVEA 5DGJA 1HJ8A 2CN0H 1AZZA 1V2UT 2FOAA 4RKJB 1CSOE 2SNWA 4X2YA 5BPEA 1BRCE 2C8YB 2BD9A 4MPXA 1TPAE 2FXRA 3LGIA 3TGJE 3P8GA 1AUTC 1WBGB 4K8BA 3TH3H 4F55A 1NN6A 1SGYE 3MOCA 2O8TA 1C4V2 3GY7A 3NRLA 3P8OA 3VB4A 1DWEH 1O2NA 1SSXA 4Z6AH 1XUKA 2FODA 1NM6A 1EKBB 4JYTA 3P17H 3MU1A 4AB9A 1FAXA 3UR9A 4KTUA 1B0EA 1DVAH 3V3MA 1QQ4A 5GPIB 1GJ7B 5GNDA 1MKWK 1YCPH 3PLKA 2HWLB 2SGDE 3U98H 1DOJA 2YMSD 1V2KT 1BTYA 1O2YA 3UQOA 4BNRA 1O3AA 3GISB 5C17A 3QLPH 1MKWH 3E16B 1C1QA 2PTCE 5FHTA 4ACAA 4BTIB 3TJNA 4CRCA 2HLCA 1GHBG 2UWPA 2WYGA 3TJOA 5L30H 1EPTC 3SNBA 1YLDA 2OTVA 1TRNA 3AASA 3GY5A 3RXHA 3E90B 1IQLA 1LQDB 3ZVDA 1SI5H 4Q2KA 1FX0B 3SU3A 3GY2A 1F7ZA 1K1LA 4K60A 1TNGA 1GHVH 2BY8X 5DP7A 3RMLH 2AIPA 2G81E 2R0KA 1TPSA 1IQNA 1OYTH 8GCHF 2OP9A 3URDA 4GCHG 1JMOH 3RXLA 1P11E 2FWWA 1CHOF 3M3VA 2HNTC 1E38B 1LHFH 3SQHE 1QURH 3ZVAA 4O3TA 1T8MA 1O39A 3HATH 4A6LA 1PQ5A 4HI3A 1C1PA 3MU5A 2JETB 1T7CA 1SGTA 1T4VH 1O3IA 5HKKD 3K9XB 4B2CA 1P02A 1QJ1B 3UWIA 3SOSA 1KXEA 1G37A 1C2EA 1C2MA 2EI7A 2K1QA 2J9NA 3NWUA 1GHYH 3UY9A 4CRFA 1Q31A 4F4OC 3GDSA 1SGEE 1K1JA 1LKBA 1GWAA 1GVLA 1O2PA 1SLXB 1MU6B 3Q3XA 4X8UH 2ZGHA 4X6OA
chains in the Genus database with same CATH topology
3SJKA 3SU2A 3MU4A 2GZ9A 1OWEA 4ABDA 3ZZDA 1G2MA 2B0FA 1CT4E 1UHBA 1LDTT 2ZTZA 4WWYA 3BG4B 3M3SA 3M36A 1JBUH 3D65E 1ZPBA 1IQIA 1SGFG 1FIWA 2ZI2H 1DUEA 1O34A 3H7OA 2A4OA 3P95A 2OBQA 3TJUA 4K8YA 1HAZB 1C1RA 1UTQA 1DX5M 1MTNC 1KDQA 1MBMA 4YZUA 3GYMA 3ZZ6A 1YC0A 1WV7H 3LH1A 3QZRA 4U01A 4GHQA 1KLIH 3A8BA 1YPKH 9ESTA 1ANBA 1OWIA 1VCQA 1O3KA 1HIAB 2BB4A 1GBAA 3S9BA 3MNCA 1FY3A 1GCTC 4AG1A 2XRCA 3UOUA 1W13U 3BIUH 1IQEA 1PPHE 2W7UA 1BMMH 1T4UH 2V0BA 4VGCC 4ABAA 1C5TA 1O3FA 2FIRH 1TAWA 4K1EA 2G55A 2PR3A 4PROA 1THPB 3LGWA 2Z9IA 1MTSA 5FCRA 1NU9A 9LPRA 3MH4A 3PMHB 1CA0C 2PGQB 4U32A 3T29A 1ELVA 2CGAA 2WYJA 1OWDA 1A5GH 3QUMP 4TPIZ 1HJAC 1N6XA 4K2YA 1P03A 2C90B 1YLCA 1GMCG 1K9OE 1VGCB 2PGBB 1O3NA 1MTWA 1Z6EA 5CHAB 1L1GA 2QXGA 5GJ4B 3GDUA 2OUAA 1UMAH 2AGGX 3MNBA 1QA7A 3F6UH 1AE5A 2JKHA 3QTOH 4IN1A 1BMAA 1XKBC 3SZNA 5HXFA 2ZHWH 1VITG 3SQEE 3TNSA 1INCA 2QXJA 1TMUH 2BOKA 2QYIA 4MG3A 4Y71A 2SFAA 1J16A 1G36A 3OSYA 3LPRA 1E36B 1W8BH 3LJOA 4R8TB 3BTHE 3MH7A 1VJ9U 1P01A 1CHGA 1BRBE 1NROH 2FX4A 1C2IA 2XBXA 2FOCA 3RXTA 1XUGA 2XC0A 3SV6A 1ZPCA 4JZEH 1P57B 1BZXE 3SORA 1O3EA 3SW2B 1GJBB 2ODYB 3LIWA 3SU0A 1PPZA 5DP8A 3S0NA 2OXSA 3B8JA 1RTFB 1GMHG 2J94A 1GJ6A 3R3GB 3U8OH 5FPYA 3SU1A 1QTFA 4M7GA 2QCYA 1P3CA 2BD3A 2CMYA 1H1BA 2ANMH 2KAIB 2Y7XA 8LPRA 5AVDA 1Y5AT 1GJ4H 1HAIH 4LK4A 2G5VA 2D26C 1C2FA 4AN7A 3M7QA 2A5AA 4X6PA 1DWBH 2GVFA 2GZ8A 2ZFTA 1EASA 1CGHA 2XXLA 4B2AA 1Y3WA 4NG9H 1SHYA 4TYDA 4CHAC 3RMNH 1C9PA 1FLEE 2A4RA 1C5ZB 4NWKA 2ILNA 3LGYA 3IITA 3RXIA 3RC5A 2BDGA 2PUXB 1BTXA 1YF4A 4MDSA 3CP7A 1UTNA 2Y82A 2BDAA 4JZFH 4YESB 4X2VA 3ZZ4A 1K1NA 1D6WA 4I8GA 8GCHG 1BOQA 4INLA 1TNIA 4DCDA 2W3IA 1HDTH 1ESTA 5EQRA 1FMGA 1SGCA 1K1IA 4AZ2B 1S5SA 1RTKA 2H2ZA 3LDXH 3V12A 1ID5H 3PROA 1DE7H 2C8WB 1AY6H 3M5NA 1SQTA 2BQ6B 5T6GA 4Y0ZE 1GHBF 1NFWA 3ZVGA 3SHCH 4MNWA 1AD8H 3W94A 2BLOA 1RD3B 5E2OA 3WY8A 2JETC 1WQSA 1O2WA 1W10U 3K6ZA 1P2KA 2XYAA 1CGIE 1EB1H 2WPKS 3PWBA 4E05H 2IPHA 1HAVB 3UREA 3D62A 1HAGE 2A2QH 2RG3A 5AFZH 3QGNB 4HGCA 4A5TS 3SV8A 1D9IA 2TGAA 2QXHA 1FY8E 1IQJA 2FEQH 1UVPA 1T32A 1HIAA 2GZ7A 4AFSA 3AAUA 5EQQA 1VITH 3M5OA 1C5NH 5FX6A 5C3NA 4AOQA 2CF8H 4UFFH 2Z3DA 1UK3A 1GJAB 1A0HB 2J95A 1NTPA 2ZDMA 1UK2A 1BJUA 4ISHH 3VGCB 3T28A 1HLTH 1NPMA 2HNTE 2P59A 1F5KU 1GJ5H 1WTHD 1T31A 5GCHF 8ESTE 2TBSA 2F9VA 1K2I1 2JH6D 4X1PU 2PW8H 1S85A 1ZHMA 1MBQA 2KAIA 4Q80A 3BTKE 2PKSB 2Y6TA 4I8LA 1QHRB 2VH6A 5C2ZA 1PPCE 1ARBA 2A7HA 1GBJA 1TPPA 1P3EA 5GCHG 2J4IA 2GX4A 1C1SA 1Z7KA 2TGDA 1BTUA 6GCHG 1QBNA 2A7JA 1EZUC 1TIOA 4I31A 1O5GH 4BTTB 2BD2A 1AB9C 4BANB 2GKVE 1BJVA 5J4SA 4CH2B 1CA8B 3LGUA 3MWIU 3BIVH 4AGKA 1MZDA 1C5VA 2ZDVH 1PPGE 1NZQH 1YPEH 2Z3CA 1FONA 2GCTB 3TITA 4UFEH 1O2HA 3MI4A 3Q3KA 1OP8A 3ITIA 4J2YB 1UTLM 3EAJA 2R2MB 4ZKNU 2H1UA 2ZDKA 2VJ1A 4XE4A 2ANYA 3A88A 1W12U 2V3HH 1LVMA 2Y5HA 5FBEA 1S83A 1TABE 3GYLB 1S6HA 1DFPA 1LPKB 1O2QA 4H6TA 3EDXB 1G30B 4XBDA 3RU4D 1AQ7A 3SU5A 4MLFB 1AB9B 3QDZB 2GV6A 1Z8RA 4ABFA 4CRAA 2O8LA 5C1YA 1AKSB 1WSSH 2BD7A 1W11U 2ODPA 4ABJA 2WPMS 3VB5A 2ZDLA 3K65B 2VIWA 1OPHB 3RXMA 4AORA 4FUHA 1QFKH 2AMPA 1WCZA 2F9PA 2FM2A 5JB8S 2RA0A 1O35A 2QF3A 2FOEA 3KQEA 1TWXB 4ZXYH 2C8ZB 1HYLA 1EB2A 2VIOA 2HGTH 2PV9B 1XX9A 4WY3A 5HMAA 1V2ST 1LHEH 4WH6A 4ABBA 3ODFA 4RN6A 1HB0B 3PLPA 4AGJA 1C5LH 3ZZCA 2ZQ1A 2P8OB 3S7HB 4NGAH 2ZA5A 1XXFA 1C1TA 1SHHB 2BY6X 1BBRH 4DJZB 1O2IA 8KME2 3O8DA 1C5RA 2SGFE 1AHTH 2XNIA 3RXQA 3VXEH 3ZV8A 1ZSLA 2FOMB 2AIQA 2ZECA 4JK5A 2BY9X 7ESTE 2C8XB 1ZHRA 2ZF0H 5DP5A 4K1SA 2ZG0H 1EP6A 1TONA 3MMGA 1PQ7A 1GI7B 3ATKA 4GPGA 2Z6BD 4IW4E 3RP2A 1THSH 1IOEA 1V2VT 3B23B 4HTCH 1G3DA 3U69H 1LVOA 3SGQE 3P92A 3VB7A 2IJOB 5L2YH 2BY7X 1LCYA 2H5CA 1QB6A 1PYTD 1KXBA 3A80A 1QRWA 1X7AC 4WVPE 1O5FH 2ZU5A 1B0FA 3TVJB 2UUFB 1UCYH 1SGRE 2WUBA 3DFJA 3QTVH 3B9FH 2HOBA 1ZZZA 1L1NA 3BTEE 1A0LA 4B74A 1WOFA 2PHBA 1HBTH 2VU8E 5TJXA 5EXMA 2OD3B 2R2WU 2ODQA 2FESH 4FU9A 5T6DA 3M35A 3SU4A 1FY5A 3FVFB 4D7GA 4FUEA 4BAHB 4OGYA 1GMDF 2HALA 4DURA 5A2MH 1O31A 2QXIA 4X0WU 1HRTH 2XC4A 2Q6FA 4FUBA 2GTBA 1SB1H 5AHGH 2FOHA 3UOPA 2QGRA 2STAE 1DUAA 1N6YA 1TMTH 1C5SA 1W14U 2GD4B 1BBRK 2XCNA 4OS1A 2NU2E 1A1RA 2SGEE 1TOCB 1TFXA 4KP0A 1UTOA 3SNEA 3UFAA 1C1MA 1FZZA 2OCVB 1F2SE 2ZU1A 3GICB 3UNQA 1O36A 4VGCB 3OTJE 4MPVA 2PKAB 3RXBA 1HXFH 3A7TA 4TWWA 2HPQH 2FI4E 4X2XA 1TLDA 3A81A 3RU4E 1O5CB 3D49H 2PTNA 3T25A 4X8VH 1MQ6A 1RIWC 1GBDA 1FUJA 5JBCS 3TNTA 1BBRE 3AW1A 1FAKH 2O8WA 3LKWA 4RKOB 4BOHA 3TK6A 3SGBE 3E1XB 4LXBH 3TU7H 1G9IE 3DUXH 1ZMNA 3PTNA 1BQYA 3LOXA 1O3DA 3C27B 2AFQB 4B2BA 1GI0A 3BTFE 1SR5C 1ELTA 3UNRA 1MCVA 1F0UA 4GLYA 2BQ7B 4NSVA 2BQWB 4IMQA 3KNXA 3RXDA 4X2WA 1XUHA 1DY8A 2PFEA 1P0SH 5GXPA 1LPGB 3BV9B 1MTNB 1C2LA 4WF8A 4ZHAA 1YGCH 1LVBA 4B71A 1LMWB 1AWFH 4I8JA 1ANEA 1O30A 2H5DA 3F9FA 4MPUA 1BMLA 2ZHDA 1ZJDA 1RFNA 2W7SA 1MQ5A 3Q77A 1Z71A 4JK6A 3TGKE 1GCTB 1Y3YA 1GBHA 3SNAA 1D3QB 2V35A 1SMFE 3Q3YA 4CRGA 3AVZA 1WUNH 1A61H 2NU1E 1CBWB 1LHGH 2AH4X 4E06H 4Z0KA 2RDLA 2XWBI 2BX4A 1A5HA 3BG4C 1P09A 1L4ZA 4IBLH 4K5ZA 4UE7H 2R0LA 5JDUB 3PTBA 2P8OC 1KDQB 1RJXB 2QC2A 3RC6A 1QGFA 3SJIA 1P2OA 2SGQE 2VIPA 2A2XH 2Z9KA 1SVPA 3MNSA 1MKXK 4A7IB 1S6FA 1YPJH 1ZR0A 4BTUB 2WPIS 5PTPA 4O3UA 2ZFRH 3FP6E 2LPRA 5A8XA 5AF9H 3O8RA 3EA8A 1TBZH 1TX8A 1AWHB 1QBVH 1TNLA 1XKAC 2WUCA 4B76A 1UVUH 5I25A 3OY5U 1QJ6B 1Y3UA 3SI3H 1JOUB 1MU8B 4AB8A 5IYTA 3RXCA 4NCYA 1ESAA 1T8OA 1CBWC 2VWMA 4DY7B 3KCGH 1PJPA 1GL0E 5C1UA 3MYWA 2ZFPH 3A82A 1KTTB 4KELA 1K22H 1C5PA 5EPNA 4AX9H 5FCKA 1BIOA 4DVAU 4RSPA 1UTKA 1UTPA 4NIXA 1UTMA 1NRQH 2W5EA 1TMBH 5EPYA 4MVNA 1AGJA 2UWOA 4TY7A 4O97A 1BRAA 4FUFA 4CREA 3N7OA 1PPBH 4UDWH 2STBE 3AW0A 1BHXB 4FVBA 3MHWU 2QF0A 2ZCKP 2XBYA 3ZZ5A 5TCAA 2F9BH 1V2TT 2BDHA 4OS4A 3OY6U 1P2JA 4XFQA 1HAXB 1OWKA 1ZLRA 1HXEH 3JZ2B 1GG6C 4ZMAH 2FOFA 3OU0A 2BD4A 1W7GH 2ZCLP 3TK5A 2GCHG 1GBCA 2ZU3A 3FZZA 1F0TA 4GCHF 1UJ1A 3F9HA 4ABGA 2EEKA 1EJAA 1KSNA 3PO1B 5DJ7A 5EGMA 2FOBA 1JXPA 1KXCA 4DT7B 1ETSH 1E34B 4IGDA 1S0RA 3E91A 4K69A 5LPFA 2OBOA 4B73A 2SGAA 1GHXH 1NRRH 1AVGH 1KTSB 3RM0H 1HUTH 5FXLA 1DICA 2ASUB 2PLXA 2G8TA 5T6FA 1QCPA 3K2UA 2BYAX 2ZFFH 4KGAA 1VJAU 4D8NA 1V2NT 2BOHB 3SNCA 3ZZ7A 2BVXH 2F83A 1O2MA 3ZV9A 1O33A 5HGGA 1ETRH 1NFXA 4AYVB 3A7VA 1C9TA 1SGIB 1JRSA 5EU8A 3TLOA 1L2EA 1O3HA 4NSYA 4OS2A 1GBTA 1SLWB 1NO9H 4O9VA 4Q7YA 3SJ8A 1GBMA 2VGCC 3MU8A 1YP9A 4D9QA 2PSXA 1NY22 4JYUH 2Z94A 5JB9S 5E0GA 1ZSJA 4Q7XA 3M61U 1OYQA 5DP4A 1RGQA 3SJOA 1QQUA 3GY8A 2HVXA 1NC6A 2P93A 3T27A 1LTOA 3H5CB 1FPCH 1C5YB 1QRZA 1FNIA 4FU8A 2BHGA 4ZAEA 1EOLA 1C5WB 4DIIH 1RTLA 1PQAA 3F1SB 3RU4T 4E7NA 1TA6A 1HJ9A 1KY9A 1XUJA 4Y10E 1DXWA 3RXUA 2LNCA 1GI1A 1WYKA 1GHAF 2TPIZ 2R9PA 4ABEA 1J15A 1FJSA 3FFGA 1IQFA 1SGQE 2AEIH 1TB6H 1CU1A 2ZKSA 2I6QA 1EATA 4XBCA 4YLQH 2G4UA 2VWNA 3ATLA 2AMDA 2NWNA 1IQGA 3NK8A 4Y7AA 3P6ZB 1G2LA 2F9OA 2ZGCA 1H9IE 2IOTA 2AGIX 2VNTA 3A7WA 1LHCH 1TQ0B 4IC6A 3RXSA 5JPMH 1EZQA 2A0QB 4WH8A 1YBWA 3STJA 1BTPA 5HM2A 1EQ9A 3UIRA 3E8LA 2WPLS 4ZH8A 1HAYB 2C4FH 5DP3A 2UWLA 1Z6JH 2ZC9H 3S9AA 5J4QA 2G4TA 2QAAA 3KIDU 4U30A 1O3GA 5FX5A 6CHAC 2OQ5A 5LPRA 1G3CA 4OS7A 1BITA 5ESTE 4ZHMU 1PPEE 2O8UA 4YOJA 3T26A 1SGPE 2W26A 4IN2A 1AFQC 2HNTF 4NZQA 4MNXA 1UO6A 1MAYA 1V2OT 1LKAA 2AGEX 2A5KA 3BF6H 3KL6A 1OKXA 4ISNA 2J92A 1GHWH 4IS5A 5E0HA 2A31A 1ZRBA 2XBWA 1EUFA 4LZ1H 2P16A 3D23A 3PMJA 1JWTA 5CE1A 2D1JA 3GCTG 4XOJA 4HZHA 4WJG2 3ATIA 1JIMA 2G51A 1FN6A 1MZAA 4FUJA 1HJAB 2A7CA 1RXPA 1GBBA 5B6OA 3ZYEA 2Q6GA 3TK9A 1TE0A 2FS8A 3SV2H 5C67A 1SOTA 1GI8B 1C1NA 1Z1JA 2CF9H 2A4GA 3P70B 1KIGH 3BG8A 5GIBA 3LGVA 5C20A 3EA9A 1J17T 1YPGH 3SGAE 1P2IA 1W2KH 4FU7A 1OXGA 1C5XB 1O3CA 4NIWA 3BTQE 3HKIB 3A84A 2ZGBH 1O2LA 1AKSA 1IHSH 5EODA 1O2GH 2XC5A 2VWLA 3ATMA 2Y5GA 2O9QA 2WPHS 1EP5A 4OS5A 3SO3A 1C2HA 1W0YH 3V13A 1UVOA 2J2UA 2P94A 4UFGH 1EZSC 1RRKA 1C5QA 3BTGE 4H6SB 2GP9B 1H4WA 1IQMA 1SQOA 2ULLA 3RXPA 5CMXH 4CBOA 3SHAH 1DSUA 1O3BA 3I29A 4ZKSU 1EPTB 3RXEA 1VITF 2FP7B 1DLKB 4MQAA 1A2CH 2NU4E 2BLVA 4MTBA 1YYY1 1FPHH 3M5MA 2YOLA 2ZIQH 2P3FH