5E0GA

1.20 a resolution structure of norovirus 3cl protease in complex with a triazole-based macrocyclic (17-mer) inhibitor
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
173
Chain Sequence
HHAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTGANAKGLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protease/protease inhibitor
molecule keywords Norovirus 3C-like protease
publication title Structure-based design and synthesis of triazole-based macrocyclic inhibitors of norovirus protease: Structural, biochemical, spectroscopic, and antiviral studies.
pubmed doi rcsb
source organism Norwalk virus
total genus 40
structure length 173
sequence length 175
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5e0gA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5e0gA01
1A7SA 1LDTT 4XBCA 3QX5H 2GMTB 4ABAA 1BRUP 1RD3B 2BY6X 1E36B 2R2MB 3BTDE 1F2SE 4X2WA 1AMHA 4YESB 3N7OA 2P93A 1GJ6A 3M7QA 4AFZA 3O8DA 1ETRH 1O3KA 3IITA 2BMGB 3TH3H 1K1OA 1T4UH 5AF9H 4MPVA 1XUFA 5F8ZA 2FOGA 4FUCA 4E05H 2QV1A 3KHVA 1G32B 2ALVA 2UUKB 3U98H 1ARCA 1GCTB 2Y6TA 1BHXF 1FZZA 3SV2H 1DANH 3QTVH 1H8DH 3QWCH 1OYQA 4BAHB 1SOTA 2GKVE 1VCWA 5T6GA 1QCPA 1DS2E 2UWLA 4AGJA 1O3PB 1P05A 4FUIA 4NCYA 3FP7E 3PMAB 3ATKA 5PTPA 3GY6A 3VB7A 4YT7H 3STIA 3BSQA 3LU9B 1AUJA 3P95A 5F03A 3RXVA 1WTGH 3SI3H 4E7NA 5A8ZA 4CR9A 1KLIH 1SLXB 2OCVB 2NU1E 1P9SA 1SQTA 3GDVA 3RXTA 2B7DH 1DY9A 1ZJDA 2TPIZ 1VCQA 1DSUA 4MNVA 1V2VT 2JH5D 2FXRA 1BA8B 2XYAA 4Y0ZE 1Z8JB 3F9FA 1QRXA 2A32A 3PMBB 1H8IH 1O5FH 4YZUA 3BTWE 1A2CH 1NO9H 3V12A 3RXUA 8KME2 2ODYB 2GP9B 3PLKA 1UVOA 4IMQA 3ZZ8A 3M5MA 2G52A 4HZHA 2VWMA 2P95A 1GI7B 3RC5A 9LPRA 2BVXH 3TJUA 1E38B 1CO7E 2XC4A 4ZKNU 3A82A 3NZIA 2UUYA 1T8OA 1EOLA 3ZVFA 1MZAA 1OWIA 4FUHA 4FUGA 2QF3A 1QTFA 5HM9A 4A7IB 4VGCB 1UHBA 1GJ7B 4X6NA 3PTBA 3RC4A 1B0EA 5JB9S 1BOQA 4ZKRU 3R0FA 5LPFA 2GZ7A 1ELVA 3BEIB 1DE7H 1K1NA 3SJ9A 4CHAB 3QN7A 4YT6H 1FAKH 1PYTC 4ZKOU 2VJ1A 1OWEA 2LNCA 3LDXH 1QFKH 3BTEE 1PPHE 2PR3A 5FBIA 6GCHG 3MO3A 1O2HA 2Z9LA 2G4TA 3A7TA 2BDAA 1S85A 1O5CB 1ZSLA 2VWNA 3T26A 5G4BA 4K1SA 2GZ8A 3UIRA 3RXMA 1D3PB 1BTXA 5DP8A 3GCHB 5E0GA 1H4WA 1D6RA 1RRKA 1Y3WA 2ZQ2A 1KXDA 1TNKA 5I25A 5ESBA 1GVZA 1WQSA 2FOHA 2ZDLA 1ZMNA 4BAOB 3FFGA 4BOHA 1UJ1A 4AN7A 2BZ6H 1AY6H 3KIDU 1Y59T 1ZPBA 1G3DA 4I8KA 2CJIA 4Y8YA 3U8TH 1Y5AT 4GHTA 1AU8A 4NA9H 2J9NA 3D65E 1TGTA 1ELGA 3U8OH 4KKDA 1AKSB 4IN2A 3UPEA 1P12E 1KSNA 3GCOA 2ZHDA 1K1PA 2O9QA 1PQ7A 1Z6JH 4BTTB 3LGYA 1BBRE 1MMJN 2ZPRA 5T3HA 4NG9H 4JK6A 1B0FA 2FDAA 1WTHD 2Z94A 1KXFA 2ZCKP 1E34B 1N1LA 1AWHB 4XE4A 2FI3E 3DFLA 1YLCA 3BTHE 4NA7A 1FDPA 2BXUH 1O2QA 1BMMH 1S6HA 1FN6A 1HJ8A 3I78A 1HGTH 1QRWA 5EPNA 3S9CA 1C2MA 3FANA 1FONA 1O2JA 1QQUA 3OY5U 4D7GA 1PPBH 2BXTH 3JZ1B 5CHAB 1ELDE 1NFWA 1TPOA 1LQEA 3Q76A 3ZVCA 5BRRE 3SUFA 1IHSH 4Y10E 4CBNA 2WV5A 1FMGA 2XCFA 6CHAB 3BEUA 1SGCA 1F0UA 2W5EA 2PGQB 1W14U 1A5IA 2F9VA 4RN6A 3VEQB 3CENA 1GBJA 1WBGB 2G55A 1P3EA 2H9HA 3RC6A 1GJBB 3E0NB 1AE5A 1OKXA 1GBHA 1ZSJA 1V2QT 2ZFTA 1FJSA 4Y7BA 1QBNA 1BITA 7GCHG 1EJMA 1GJ4H 1UVTH 5ETXA 2UUJB 3MNCA 3RXKA 4VGCC 1IHTH 2C3SA 5A8YA 1IQMA 1WU1A 3PO1B 3MU1A 2BTCE 4NWLA 2THFB 1Y5UT 2AIQA 4K2YA 2XXLA 3LPRA 1O2PA 2PGBB 1C1MA 4CHAC 3BG4B 2V0BA 4AYVB 3K65B 1AO5A 1GHBF 4UD9H 1MTUA 3T28A 5JBAS 1NM6A 1GL1A 1O3JA 1LCYA 1V2UT 1AI8H 1WCZA 1C2KA 3IG6B 2BD8A 4MVNA 4FUDA 3PMJA 2C8WB 2ZGCA 4DURA 1SGTA 1O2KA 3GCHC 1BTYA 4BANB 9ESTA 1BZXE 3S69A 3SGQE 3A7ZA 4Y76A 1SSXA 2VVUA 1O3BA 1IQNA 1HAVB 2UUFB 5E2OA 4YOIA 2A4OA 2W3IA 2Z6BD 1IQEA 4INKA 3SJKA 1S82A 3SQEE 3BIVH 2G5NA 1YLDA 1OOKB 4FXGH 1C1PA 1L1NA 1LHDH 2FOEA 1CSOE 1HRTH 1HAOH 3QZQA 3C1KA 2BVRH 2M5TA 2CGAA 1MCTA 4K60A 3KGPA 1GI2A 3CP7A 4KELA 3SNEA 3RXAA 2PLXA 3GCTF 4MPXA 4MG3A 3ZVGA 3EA8A 5CMXH 3PM3A 2V3HH 1BMLA 3DHKH 1AVWA 1TNGA 2RCEA 4OS5A 5ESTE 2BLQA 3A83A 3VB4A 1W8BH 1BB0B 1W12U 1SFIA 2GZ9A 1GBAA 1PQ5A 3E6PH 2UWPA 1V2WT 2QCYA 1EAUA 1RTFB 3K6YA 4GUXA 2NU4E 2Y81A 4HI3A 2F9UA 1UVSH 1Y3XA 1HAPH 2WINI 1O2LA 4UFGH 1A5GH 2Y5GA 1LVOA 3BN9A 4FVBA 4IBLH 2QF0A 1AZZA 1S83A 3U9AH 5DGJA 1EUFA 5CHAC 1NU7B 4CRGA 1K1IA 1VITF 2ZU2A 4B73A 3P8GA 4ZHAA 1O34A 3SU1A 1ZMJA 4H6SB 1C4V2 1F0SA 5C1YA 1B7XB 3SNDA 6CHAC 3UWIA 4WXVA 2OD3B 3A84A 5TCCA 5CE1A 4CBOA 1OYTH 1LVBA 1ZGVA 3QUMP 3A89A 4WMEA 2ZO3H 3F9HA 1C2EA 2H9EH 4ZXYH 1PQ8A 3SV6A 1KIGH 3MTYA 1EKBB 3RXOA 1GHYH 1GI1A 4KTCA 2ZDVH 1GHZA 3NK8A 3UWJH 1TPAE 4LZ4B 2O8WA 2PWXA 1U6QA 2TIOA 4KTUA 1P06A 2ILNA 3FZZA 4YOJA 3PO1C 3TPIZ 1AGJA 1EPTB 1IQJA 5DP9A 5FX6A 1V3XA 2R3UA 3TNTA 1TA2A 1ZR0A 1EOJA 2FMJA 2BDYA 1XM1A 3BG4C 1GHAF 1NPMA 1Y3YA 4I8HA 4Y11E 3SOSA 3TJOA 4Y79A 3B9FH 1H1BA 4A1TA 2W26A 4GAWA 4A92A 2TBSA 1TBRH 4I8JA 1TBZH 1GJDB 1C9TA 3RXBA 4AX9H 1TPSA 1IOEA 1NRRH 1UTNA 3LONA 1RXPA 1O2WA 1SGPE 4NIXA 5C3NA 4Q7ZA 3O8RA 3UR9A 4SGAE 2NWNA 3SGAE 3ZZ6A 4THNH 1HPGA 3TH4H 1L1JA 3DA9B 1P01A 2ODQA 2C8ZB 2A5AA 4Q7YA 1V2ST 1GBBA 3LGVA 4JYVH 3F68H 1AFEH 1E35B 3Q3XA 4XBDA 1JMOH 1O3AA 3MU8A 1RTLA 3SNAA 3F6UH 1TNLA 2ALPA 5F6MA 5I46H 1C5RA 5A09A 3PYHA 3KN2A 1MCVA 2G5VA 2ZGBH 5EQQA 1EATA 2FOCA 2W3KA 1ZRBA 3PROA 2AGGX 3TVJB 2EI8A 4O3TA 4R0IA 2IOTA 2AYWA 2YOLA 2CHAB 1NY22 4MNWA 1QHRB 1A0HB 2TGDA 1EZUC 2BX4A 2V35A 1PPZA 2XC5A 1CGIE 1MH0A 1JIRA 1EX3A 4ZAEA 3GOVB 4I7YH 3TGIE 2G81E 5IYTA 1TX6A 2C8XB 1PPCE 2D26C 4YO9A 3VGCB 5FX5A 1F7ZA 3S0NA 1CE5A 4ZHMU 1ESTA 2PSXA 3S9BA 1W2KH 1ZYOA 1VITH 1DWDH 1K9OE 4JZDH 1GJ9B 2PTNA 3FP8E 5J4QA 3MU0A 3RXGA 3RU4T 1P09A 2ZNKH 2JKHA 1RJXB 1OWHA 2OC0A 3VB6A 1ELEE 4I8LA 1TYNA 4Q80A 1Y3UA 2WPMS 4FVDA 1C2FA 2BDGA 1SG8B 1TFXA 2PKAB 1JRTA 3OX7U 1EAWA 3O8BA 1ID5H 4TWYA 2XBYA 3RXJA 1V2JT 3IWMA 3D62A 5J4SA 2HGTH 5EXLA 5EW1H 1QGFA 1HAYB 5JDUB 5EXNA 1V2NT 1ZPCA 2VH0A 3BIUH 5FXLA 1P11E 1P2MA 2Q6FA 1P02A 3RDZA 1VCPA 2ZKSA 1VJAU 3LOXA 1DVAH 1ZJKA 4LZ1H 4BXSA 1FPHH 1QR3E 2BQWB 4MQAA 4FUBA 1C5PA 3HK3B 4NIYA 1K1MA 1HUTH 1DLKB 2QY0B 1G30B 1J14A 1EPTC 4WH6A 3M35A 3BTME 1VGCB 2ZA5A 4Y8ZA 6GCHF 1BRBE 4B76A 1OP8A 4JYTA 2DUCA 2ZEBA 3M5NA 2FODA 2BOHB 2BB4A 1SVPA 2BDHA 1HV7A 2J4IA 2BLOA 1AVXA 2F9OA 2ZIQH 4R8TB 3RXEA 3U8RH 1ARBA 3M3VA 1XKAC 3ZZ9A 1C4Y2 1MU6B 1FQ3A 1C5MD 3PLPA 4X8VH 2BD7A 5HGGA 1O5GH 1A0JA 1YPHC 1AN1E 1EZXC 3GICB 1C1WH 1UVPA 2HVXA 4FU8A 2PW8H 2ZECA 1QB9A 2VU8E 4I8GA 4ISIH 2HNTF 1C1RA 2R0LA 1LMWB 5A0BA 3PB1E 1P2KA 3SJOA 1O2RA 1KXEA 2FIRH 2OUAA 1TALA 3BG8A 1KLTA 1YPKH 1V2LT 1TIOA 2KAIA 1AKSA 1AVGH 2BZAA 3NKKA 2ZU3A 5FPSA 1BTZA 1HAGE 1GG6C 1TNHA 1BQYA 1AZ8A 1C5LH 1CA0B 3BTGE 4CRCA 2B9LA 1QBVH 1C5XB 3A7WA 3SHCH 2FPZA 1SGYE 3TGJE 3RXSA 4K8YA 3V7TA 2H5DA 3PMHB 5K7RA 1CGJE 2BVSH 5ABWA 1SB1H 2OC7A 2ZQ1A 3KCGH 3F9EA 4FUFA 3TNSA 1EB2A 2CHAC 3A88A 5TJXA 3LH3A 1UCYK 2NU2E 2BQ6B 1IQFA 1TWXB 3LIWA 2ZHEH 2G4UA 5IDKA 2Z3EA 4D8NA 2VIDA 3S7KB 6ESTA 2I6QA 1ZLRA 1KTSB 1UTOA 4AORA 2FLRH 4B75A 3VXEH 1T8LA 3ODDA 3RXCA 3VGCC 4OGYA 1BCUH 2ZFQH 1WV7H 2EEKA 1HXFH 4CH8B 4NSYA 3LKWA 5LGOA 3FAOA 1L2EA 1MAYA 1UTLM 2A5IA 4DW2U 1GGDB 4IN1A 1L0ZA 2OLGA 1V2RT 1NS3A 7KMEH 3T62A 1GBMA 4JCNA 1GBIA 1YYY1 3MU4A 3TU7H 2Z7FE 5DG6A 2AFQB 1TOCB 2HALA 5H4IB 1TGNA 1GI5A 2ZPSA 3EGKH 4X1PU 1EZQA 1GHVH 1MKXK 1E37B 7GCHF 1OS8A 1BIOA 3GCNA 1AFQB 1MKWK 1FI8A 3KEEA 4ABFA 2ZHQH 1NT1A 2IPHA 1L4DA 1QRZA 3ZZAA 2WPIS 1XXDA 4MNYA 4O9VA 1HAHH 2O8UA 3M5OA 2FWWA 3SJ8A 4D9RA 5A0CA 3RLWH 1DOJA 1MZDA 2WPKS 1Z1IA 1LVMA 2BY7X 1FPCH 5A8XA 1T7CA 2D8WA 1VGCC 3F9GA 3UREA 1EQ9A 2FOBA 4H4FA 3ZZDA 2QGRA 1ABJH 1P03A 2BYAX 1SGDE 1XVMA 2CN0H 1CHOG 3MU5A 1ORFA 4X8TH 2FI5E 3MI4A 4NGAH 4TY6A 4J2YB 3MYWA 3GDSA 3FVFB 2VH6A 3GY7A 1QY6A 1TLDA 1GBFA 3G01A 5EU8A 4FU9A 1P04A 2QXHA 1A4WH 1MU8B 3H5CB 3UNQA 2A4QA 2BD9A 3ESTA 1HFDA 4DVAU 2IJOB 2Y7ZA 3RXPA 4UDWH 4ZKSU 1HAVA 2ZDAH 3R3GB 5EOKA 2HRVA 1C9PA 1C2JA 3GYLB 5JB8S 2XC0A 1C1UH 2Z3CA 3ZVDA 3ZZ5A 1C1NA 4TPYA 1GBKA 1CVWH 4CR5A 2FX6A 4Y8XA 1ELTA 1JOUB 4XDEA 4INHA 4ABDA 4ABBA 1UTPA 3LGUA 3PWBA 4IMZA 1S84A 4CRDA 1BJVA 1CGHA 2ODPA 1THRH 2PSYA 2BDIA 1CA0C 3RMMH 2P16A 2GCTB 1GBDA 1C1VH 2P3UB 1GJCB 1SLWB 3SBKA 1HJAB 1ESBA 4Y7AA 3GDUA 3QLPH 5HM2A 1S6FA 2Y5HA 3LT3A 5LPRA 1W10U 1HAXB 1O3EA 1TX7A 3TGKE 4F4OC 4LXBH 1XUKA 3TH2H 1O2YA 1ELCA 4JZFH 2ZDKA 1C2LA 1YCPK 2ZPQA 1UK2A 1C2HA 1BT7A 1SGIB 3RU4D 2V3OH 1UHBB 5GJ4B 4IW4E 1YM0A 3V0XA 5T6FA 5SGAE 3MH5A 2GGVB 2XCNA 1GBCA 2R3YA 3TIUA 1O2ZA 1GGDC 4I33A 1OSSA 1ZZZA 2OQ5A 1EB1H 3RM2H 1F92A 1TPPA 1EJAA 1Q2WA 4TYDA 3URCA 1ZOMA 1GBEA 1WUNH 2NU0E 1L4ZA 1ELAA 3GYMA 5DPAA 2STAE 1UCYH 2EC9H 2SGDE 5GXPA 1K21H 3EYDA 4ZROA 1AFQC 5C20A 1TAWA 3QGJA 1KXBA 2LPRA 1H9IE 1DM4B 3RU4E 1O0DH 3BTTE 3JZ2B 4WY3A 4ZH8A 1M9UA 2XWBI 1V2MT 5FAHA 2F9BH 4JZIA 2O8TA 4GLYA 2R2WU 2QIQA 2ZI2H 1SGFG 3D23A 5E2PA 2W7UA 4ABHA 3A87A 1DDJA 2ZTYA 4ABEA 1L1GA 2RA0A 1YCPM 1G2MA 1F5RA 4FUJA 5F8XA 4BTUB 2EI7A 1FY8E 1HJ9A 4MTBA 3RM0H 1YP9A 1HIAA 1IQLA 5AVDA 1K1LA 4IGDA 1MKXH 2ANKH 1KDQB 1O2SA 1C5QA 1MUEB 3EAJA 5DK1A 3ZV9A 3U1JB 2BY9X 1RS0A 2ZGJA 4DT7B 2FP7B 1BRAA 1F0RA 2XBVA 3STJA 3GISB 4ABGA 4DOQA 5T6DA 1FNIA 1D3QB 2FTLE 1MTNB 3SU0A 1EASA 2JETB 4X1QU 4JYUH 2OBQA 2TGPZ 3BEFB 1X7AC 3GY4A 4ZUHA 4D9QA 3I29A 1D3DB 2FTMA 3U1IB 1BHXB 3SQHE 2TRMA 1CT2E 4TY7A 1GI0A 5FCRA 1WOFA 3HKJB 2VWLA 4A1XA 5L6NH 2VGCB 1GBTA 1SGRE 1O3MA 1AIXH 8GCHG 3CS7A 2GCTC 2PFEA 4B2BA 3W95A 4AB9A 1HJAC 1BTUA 2A2XH 1ESAA 2TGAA 2AEIH 5LH8A 1YC0A 2RDLA 2FO9A 3UTUH 1KLJH 1EXFA 1XXFA 4F49A 1CQQA 2CF8H 3DT0H 2HNTE 3RP2A 3EE0B 1BMAA 5EW2H 1T32A 1MD7A 1DLEA 1C5OH 5E0HA 4MPWA 3UFAA 2VVCA 2D1JA 1MQ6A 4K69A 1RFNA 3EA9A 3URDA 1Z8IB 3T5FH 2PKAA 2GX4A 3M5LA 3ZYEA 1TGSZ 1IAUA 3UOPA 5DJ7A 2BDCA 4GCHG 1A46H 1GMCG 2P3TB 2VIQA 1C5VA 4HGCA 4JK5A 1C5NH 4DG4A 1IQGA 1AWFH 3ITIA 3HATH 3PLBA 3SNCA 4LOYH 1FY1A 1O3CA 2FEQH 1C2IA 1ZPZA 5FPYA 3SO3A 1LKAA 3U69H 1Z71A 1NRNH 1KXCA 1OPHB 1ZMLA 4NIVA 1O3OA 1P57B 3P17H 1FY5A 4CRBA 1UTQA 1K22H 1LO6A 2QYIA 4U01A 2PKSC 4ABIA 1DITH 1J8AA 1GWAA 1A5HA 5EODA 1TQ0B 1FN8A 4ZHLU 1HLTH 3SI4H 3UQVA 3KNXA 1YPJH 4JMYA 1C1QA 1EP5A 4JZEH 5DP4A 3RXFA 4RKJB 2GCHG 1SMFE 2H9TH 1XMNB 1THPB 1O5BB 3ZZCA 1C5UA 4HFPB 3M36A 4K1EA 1QL8A 3QTOH 3SJIA 1MAXA 1NESE 1ETSH 1GG6B 1O31A 4X8UH 1YPEH 4K1TA 1RTKA 1LVYA 4X6OA 4UONA 3CS0A 2AMQA 4U2WA 1DUEA 5DKMA 3MMGA 2ZFSA 2ZDNA 1SC8U 1S5SA 1OWDA 2BD3A 1Y8TA 1VZQH 4OS6A 2ZFFH 4ASHA 2F91A 3HGNA 1T8MA 1NFYA 3HKIB 3H7OA 2XWAA 2GVFA 1UCYE 4UE7H 1Z8RA 1MTNC 2UWOA 1ZSKA 3RXRA 2JETC 5L30H 3T29A 1GDNA 1LHCH 1QA0A 3E8LA 3K6ZA 1GI4A 3EQ0H 3PTNA 1MTWA 1ANBA 2ZTXA 1GBLA 2VIVA 1J15A 1ZHRA 1DXPA 1N6XA 1MTVA 5DP3A 2XNIA 2BD2A 2VGCC 5AFZH 1O2XA 1T31A 3FP6E 1OXGA 5EPYA 3UNRA 2AMDA 4NZLA 1CT4E 1Z6EA 2G00A 1GJ5H 1HXEH 3S9AA 2FOFA 1QIXB 3M3SA 4NIWA 5A2MH 4D76A 5JPMH 4WVPE 3ZVEA 1O33A 1NROH 1A0LA 2C90B 2FOAA 2VIWA 4KP0A 2Z9GA 1BTHH 4X1RU 3RMNH 2DE9A 3UOUA 2SNWA 1BRCE 1O3HA 2ZDMA 1BTPA 2ZHFH 1PQAA 7ESTE 2P94A 4INLA 1VJ9U 1ZGIA 2GTBA 1O3NA 5C5NA 1XUHA 3BTQE 2A5KA 3Q00A 1LTOA 2ANYA 1ELFA 1P2QA 1OWKA 1THSH 3SHAH 3KQCA 1SLVB 1QBOA 2RA3A 2J94A 3MWIU 1O2IA 1NZQH 4BAQB 1MD8A 1DWBH 4GSOA 1O5EH 3E91A 1UMAH 4A5TS 4H42U 1SL3A 2OBOA 5GCHG 3ZVAA 4D7FA 2R9PA 3SU5A 1QNJA 2AERH 2FS8A 2ZU4A 1BMNH 3LGWA 4IS5A 1O5AB 1ANCA 4AFQA 1O3GA 2XBWA 3RMOH 4I32A 7LPRA 2EI6A 5AFYH 2AIPA 3RXDA 2V6NA 3PWCA 4Y0YE 1FV9A 3VB5A 3ATMA 1ANDA 1F5LA 3L6PA 3BTFE 4Z0KA 1CHOF 4J1YA 4GVUA 1A3EH 3QZRA 5E8EH 2P8OB 1G3BA 2A1DB 4UFDH 1GI8B 4AZ2B 4CH2B 1ZRKA 2ESTE 3MFJA 2QAAA 2BD4A 2OXSA 4E7RG 3A7YA 1O2OA 3RXHA 1FY4A 3UY9A 1NU9A 1EAIA 1D6WA 5C1XA 4X2YA 1O2UA 4ISLA 5FCKA 1G37A 1SOZA 4BTIB 4X6PA 1NC6A 1DWCH 1LHEH 4LK4A 4GHQA 1FXYA 4GPGA 3SUEA 5GWZA 2ZCLP 3DUXH 2C8YB 1Y3VA 4B1TA 2TGTA 1N6YA 1TABE 3KQEA 1SHYA 1CBWB 1HAIH 1YKTA 2HLCA 4B74A 1XVOA 1UK3A 1O3DA 3A81A 1DFPA 2AH4X 4O03A 4ISOA 2HWLB 3AAVA 1C5WB 1O36A 4DIIH 2O8MA 1KYNA 1SI5H 1Y5BT 2NU3E 1V2KT 4WMFA 3EDXB 5F8TA 1BJUA 1O2GH 2A7CA 4OGXA 1GL0E 2BM2A 3PV4A 4NZQA 5GIBA 8LPRA 5C67A 3E0PB 3ODFA 1TGBA 1GMDG 1TNIA 3LC3A 3SV8A 2WUCA 3ZZ3A 1ACBE 4MDSA 1OX1A 1DX5M 3MNBA 4XFQA 1GVKB 2SNVA 1G9IE 1GI3A 4CRAA 1W13U 2VB0A 1TGCA 2J92A 2ZFPH 1DSTA 3DFJA 1O39A 3VFEA 2Y5FA 1PJPA 1BUIA 3LGIA 3MO6A 2OC8A 5EG4A 3SORA 2GV7A 2FM2A 1GMHG 3KF2A 1DUAA 1XUGA 2XW9A 1O2NA 2VWOA 1Z8GA 2VIOA 3ATWA 4NA8A 2FS9A 1S0RA 2HPQH 1T4VH 2RG3A 1ZTLA 1TOMH 2H5CA 4BAKB 2ZGHA 1VR1H 1C1SA 3TK9A 2VVVA 3MH7A 1TB6H 1AQ7A 4AGKA 1ANEA 2XBXA 4NFEA 1UK4A 1GVLA 4ISNA 2YNBA 1OP0A 3SW2B 3SU6A 3A85A 1G3CA 3B23B 1TBQH 2F3CE 4B71A 1GI6A 1GHXH 4AG1A 1AHTH 1QJ7B 2F9NA 2Q6DA 2BDBA 3P8FA 1G2LA 1P0SH 4WXIA 1AD8H 1RIWB 1P3CA 1DWEH 1EP6A 4U30A 2GMTC 4YOGA 2VNTA 1JXPA 1QJ1B 3GY8A 3D49H 5HXFA 3QDZB 2STBE 3A7XA 4K3JA 1HAZB 3SGBE 4U32A 4WJG2 4X1SU 3GY2A 1MBQA 3ENSB 4OS1A 1GHWH 2F83A 3HPTB 2HPPH 2KAIB 4XSKU 1O37A 2GDDA 3ELAH 1LQDB 2P8OC 1W3CA 2BLVA 1F5KU 2VINA 1JBUH 2F9PA 1SQOA 1W11U 1IQHA 1KDQA 3VXFH 2QXGA 1LKBA 1GCTC 2FX4A 3A86A 3SV9A 4UFFH 1XUIA 1P2JA 3RLYH 3UR6A 4RSPA 2I6SA 3AW0A 4MPUA 1QURH 3MNSA 4NSVA 3TJVA 3P70B 2A31A 1UTKA 1Q31A 2A45B 3A8AA 1DY8A 3QK1A 1AE8H 2Z3DA 1CBWC 2O8LA 2ZTZA 2ZHWH 2P3FH 1TRYA 2BY5X 3GY3A 1GJAB 3Q3YA 4ISHH 1AB9B 1C1TA 2CMYA 4KTSA 8GCHF 1FLEE 1D3TB 1O3FA 5JYIA 1QJ6B 1W0YH 2JH6D 4CREA 1JRSA 1WQVH 4TPIZ 1J16A 3MOCA 2A2QH 1QL9A 5FPTA 1TNJA 4MLFB 1ZHPA 1EJNA 2EA3A 1FY3A 3K9XB 1O2MA 1SGQE 4O3UA 4A1VA 4AOQA 5EXMA 3FZDA 4JZ1A 2H6MA 1IQIA 5FHTA 1O38A 3T25A 3KL6A 1O2TA 1C1OA 4K8BA 1YBWA 3C27B 3SU4A 3SUGA 1CHGA 4NFFA 2A7JA 4I31A 1NRPH 3SZNA 5EQRA 1DXWA 1C2DA 1GCDA 1TMTH 4AG2A 3F1SB 3LJOA 2QXIA 4B2AA 4DGJA 1UTMA 5JBCS 1W0ZU 4KGAA 3A7VA 1KXAA 1EPTA 2PKSB 4NWKA 4CRFA 4DJZB 2J2UA 5TCAA 2C93B 2FYQA 1B5GH 2Y7XA 3M7UA 4WWYA 3OU0A 1DICA 1SPJA 3SU2A 5EQSA 4GCHF 1GMCF 5DP5A 4OS2A 1GI9B 6LPRA 1HCGA 1MBMA 5B6OA 2A7HA 3NWUA 1OP2A 1QB6A 5BPEA 2ZF0H 1O3LA 3ATIA 3P92A 1W7GH 1YPMH 2OQUA 3E16B 3UUZA 1SLUB 1HB0B 5AHGH 1INCA 4DCDA 4X6MA 2WYJA 2BLWA 2BX3A 3MH6A 3OTJE 1JWTA 3ZZ7A 4BXWA 1SGEE 1N8OB 1Z1JA 2AMPA 2OC1A 1XX9A 4ESTE 3L3TA 2FESH 2J95A 2QC2A 1TX8A 2YNAA 3ZVBA 1O30A 2QA9E 1RIWC 4ZXXH 1MKWH 3SU3A 4Q7XA 3MNXA 3B8JA 2GCHF 5JBTA 1ETTH 4OS4A 4K5ZA 4WH8A 2G8TA 2R0KA 1FUJA 1DPOA 3H7TA 2BHGA 1NN6A 2A4GA 3Q77A 2ZP0H 2GDEH 3M61U 4XBBA 4IC5A 1HDTH 4YLUA 3RMLH 1YPGH 2J38A 1SGNE 4RKOB 4XOJA 4X2XA 2Z9KA 1D9IA 2ZZUH 4Z6AH 2JH0D 1NRSH 1SGFA 4B2CA 2SFAA 1BBRK 3V3MA 1P10A 1LPKB 3BF6H 1SR5C 2SGAA 1IQKA 1G3EA 4X8SH 1LHFH 3ZZ4A 3LC5A 1XUJA 2Z9IA 1GDQA 4E06H 2ZWLH 1C5YB 3ZV8A 3VPKA 1PPEE 1A1RA 1NTPA 1TONA 2XTTB 1P8VC 3MHWU 1PFXC 1A3BH 1ZTKA 1F0TA 3AVZA 3DD2H 1V6DA 4PROA 1NFUA 3E3TA 1E0FD 3V13A 1OWJA 2GT8A 1FAXA 1PPFE 3LGTA 4OS7A 4DY7B 3ATLA 3WY8A 2AS9A 3NCLA 1UVUH 1SQAA 1TE0A 1AB9C 2GT7A 1TRMA 2WPHS 2SGFE 3MH4A 2ZG0H 1KY9A 1FIZA 2ZU5A 3A8CA 3P8NA 1RGQA 2HOBA 2VIPA 2WPJS 1MTSA 2PUXB 1FIWA 1QB1A 1YGCH 2FI4E 3SV7A 2B8OH 3VB3A 1P2OA 2FOMB 2ZC9H 4FU7A 1EAXA 4YTAA 1CA8B 1KTTB 5DO4H 1GHBG 3SUDA 1WYKA 1MQ5A 2PV9B 3AASA 2BD5A 1V2TT 5L2YH 1QL7A 4AB8A 1LHGH 2ZU1A 2PUQH 1TMBH 2B5TB 3NPSA 1YCPH 1Z7KA 2Q6GA 5C2ZA 1ABIH 3O8CA 3KQDA 4TWWA 2CV3A 1WSSH 3OY6U 3UQOA 1A61H 2A0QB 3QGNB 4YLQH 1NFXA 4IC6A 3BV9B 4Y71A 2Q1JA 1YPLH 5GCHF 2J34A 4AFSA 2SGQE 3W94A 1S81A 4AFUA 1W7XH 1C4U2 1SHHB 1UO6A 1LPGB 1GJ8B 3L33A 2DE8A 2QXJA 3TK6A 1HIAB 3GY5A 4YM9A 4BAMB 2GV6A 1QQ4A 1TQ7B 4FUEA 1N8OC 5EGMA 1P2NA 3P8OA 1O35A 1V2OT 3MO9A 3M3TA 2WUBA 1O32A 1T8NA 3E90B 3Q3KA 1UTJA 4WMDA 4M7GA 3GCTG 3K2UA 2GD4B 5K0HA 1EZSC 2PTCE 1P2IA 2QN5T 2C4FH 3RXIA 3A8DA 4MNXA 4ZMAH 4AYYB 4HTCH 1QA7A 3OYPA 3NUMA 1ELBA 1G36A 1PPGE 3LJJA 3RXQA 1YPHE 1ZHMA 5FBEA 2XRCA 4Q2KA 4UFEH 3T2NA 2BOKA 2WYGA 2AGEX 2Z9JA 1C2GA 1J9CH 2Y82A 4H6TA 1K2I1 1P9UA 1C5ZB 1ZTJA 3HGPA 5L2ZH 2HNTC 3ZZBA 2CXVA 3AW1A 1JIMA 3P6ZB 5JBBS 3M37A 3TLOA 1HBTH 1O3IA 3EA7A 3LH1A 3NXPA 4X0WU 2FYRA 1K28D 1VITG 5LPEA 1O5DH 1BTWA 2W7SA 4BNRA 3QO6A 3SNBA 3RXLA 2ANMH 4O97A 3TJNA 3KQBA 4Y6DA 1O2VA 4WF8A 5HMAA 4ABJA 1DT2A 4A6LA 1D4PB 1TMUH 4UEHH 2H1UA 1HNEE 5GPIB 4X1NU 2ANWA 1PYTD 2OP9A 2OTVA 1GMDF 2ZCHP 1AUTC 2BY8X 5C1UA 2FLBH 2ULLA 1CT0E 4SGBE 1BDAA 2OINA 1H9LB 1HYLA 8ESTE 3S7HB 3TITA 1K1JA 1YF4A 3I77A 2ZFRH 2IN2A 3T27A 1BBRH 1C5SA 2P59A 3RUOA 5HYOA 5E0JA 3AAUA 3ZYDA 5A0AE 1CU1A 4QT8C 2K1QA 3M7TA 3TK5A 1GPZA 1NRQH 3SN8A 2ZGXH 2WPLS 2G51A 2ASUB 2Y80A 3UNSA 1V2PT 1GHAG 5GDSH 2PHBA 2B0FA 2SGPE 1LPZB 2H2ZA 4DIHH 1Q3XA 1TRNA 2WV4A 3A80A 4X2VA 1SBWA 2A4RA 3HK6B 2AGIX 1J17T 1GDUA 1SFQB 3BTKE 3A8BA 1C5TA 1GMHF 1XKBC 5DP7A 5DP6A 3OSYA 2FZZA 1S0QA 1H9HE 1WAYB 2CF9H 3E1XB 5C5OA 1TA6A 2BQ7B 2SGEE 2D2DA
chains in the Genus database with same CATH superfamily
1A7SA 1LDTT 4XBCA 3QX5H 2GMTB 4ABAA 1BRUP 1RD3B 2BY6X 1E36B 2R2MB 3BTDE 1F2SE 4X2WA 1AMHA 4YESB 3N7OA 2P93A 1GJ6A 3M7QA 4AFZA 3O8DA 1ETRH 1O3KA 3IITA 2BMGB 3TH3H 1K1OA 1T4UH 5AF9H 4MPVA 1XUFA 5F8ZA 2FOGA 4FUCA 4E05H 2QV1A 3KHVA 1G32B 2ALVA 2UUKB 3U98H 1ARCA 1GCTB 2Y6TA 1BHXF 1FZZA 3SV2H 1DANH 3QTVH 4HG6A 1H8DH 3QWCH 1OYQA 4BAHB 1SOTA 2GKVE 1VCWA 5T6GA 1QCPA 1DS2E 2UWLA 4AGJA 1O3PB 1P05A 4FUIA 4NCYA 3FP7E 3PMAB 3ATKA 5EJ1A 5PTPA 3GY6A 3VB7A 4YT7H 3STIA 3BSQA 3LU9B 1AUJA 3P95A 5F03A 3RXVA 1WTGH 3SI3H 4E7NA 5A8ZA 4CR9A 1KLIH 1SLXB 2OCVB 2NU1E 1P9SA 1SQTA 3GDVA 3RXTA 2B7DH 1DY9A 1ZJDA 2TPIZ 1VCQA 1DSUA 4MNVA 1V2VT 2JH5D 2FXRA 1BA8B 3KYFA 2XYAA 4Y0ZE 1Z8JB 3F9FA 1QRXA 2A32A 3PMBB 1H8IH 1O5FH 4YZUA 3BTWE 1A2CH 1NO9H 3V12A 3RXUA 8KME2 2ODYB 2GP9B 3PLKA 1UVOA 4IMQA 3ZZ8A 3M5MA 2G52A 4HZHA 2VWMA 2P95A 3U28C 1GI7B 3RC5A 9LPRA 2BVXH 3TJUA 1E38B 1CO7E 2KCOA 2XC4A 4TT3D 4ZKNU 3A82A 3NZIA 2RFKC 2UUYA 1T8OA 1EOLA 3VG8A 3ZVFA 1MZAA 1OWIA 4FUHA 4FUGA 2QF3A 1QTFA 5HM9A 4A7IB 4VGCB 1UHBA 1GJ7B 4X6NA 3PTBA 3RC4A 1B0EA 5JB9S 1BOQA 4ZKRU 3R0FA 5LPFA 2GZ7A 1ELVA 3BEIB 1DE7H 1K1NA 1SQRA 3SJ9A 4CHAB 3QN7A 4YT6H 1FAKH 1PYTC 4ZKOU 2VJ1A 1OWEA 2LNCA 3LDXH 1QFKH 3BTEE 1PPHE 2PR3A 3OEED 5FBIA 6GCHG 3MO3A 1O2HA 2Z9LA 4Q4LA 2G4TA 3A7TA 2BDAA 3PRBA 1S85A 1O5CB 1ZSLA 2VWNA 1NBMD 4RT1A 2KX4A 3T26A 5G4BA 4K1SA 2GZ8A 3UIRA 3RXMA 1D3PB 1BTXA 5DP8A 3GCHB 5E0GA 1H4WA 1D6RA 1RRKA 1Y3WA 2ZQ2A 1KXDA 1TNKA 5I25A 5ESBA 1GVZA 1WQSA 2FOHA 2ZDLA 1ZMNA 4BAOB 3FFGA 4BOHA 2OK5A 1UJ1A 4AN7A 2BZ6H 1AY6H 3KIDU 1Y59T 1ZPBA 1G3DA 4I8KA 2CJIA 4Y8YA 3U8TH 1Y5AT 1MABB 4GHTA 1AU8A 4NA9H 2J9NA 3D65E 1TGTA 1ELGA 3U8OH 4KKDA 1AKSB 4IN2A 3UPEA 1P12E 1KSNA 3GCOA 2ZHDA 1K1PA 2O9QA 1PQ7A 1Z6JH 1NBME 4BTTB 3LGYA 1YY3A 1BBRE 1MMJN 2ZPRA 5T3HA 4NG9H 4JK6A 1B0FA 2AHME 1WTHD 2FDAA 2Z94A 1KXFA 2ZCKP 1E34B 1N1LA 1AWHB 4XE4A 2FI3E 3DFLA 1YLCA 3BTHE 4NA7A 1FDPA 2BXUH 1O2QA 1BMMH 1S6HA 1FN6A 1HJ8A 3I78A 1HGTH 1QRWA 5EPNA 3S9CA 1C2MA 3FANA 1FONA 1O2JA 1QQUA 5IK2D 3OY5U 4D7GA 1PPBH 2BXTH 3JZ1B 5CHAB 1ELDE 1NFWA 1TPOA 1LQEA 3Q76A 3ZVCA 5BRRE 3SUFA 1IHSH 4Y10E 4CBNA 3PRDA 2WV5A 1FMGA 2XCFA 6CHAB 3BEUA 1SGCA 1F0UA 2W5EA 2PGQB 1W14U 1A5IA 2F9VA 4RN6A 3VEQB 3CENA 1GBJA 1WBGB 2G55A 1P3EA 2H9HA 3RC6A 1GJBB 3E0NB 1AE5A 1OKXA 1GBHA 1ZSJA 1V2QT 2ZFTA 1FJSA 4Y7BA 1QBNA 1BITA 7GCHG 1EJMA 1GJ4H 1UVTH 5ETXA 2UUJB 3MNCA 3RXKA 4VGCC 1IHTH 2C3SA 5A8YA 1IQMA 1WU1A 3PO1B 3MU1A 2BTCE 4NWLA 2THFB 1Y5UT 2AIQA 4K2YA 2XXLA 3LPRA 1O2PA 2PGBB 1C1MA 4CHAC 3BG4B 2V0BA 4AYVB 3K65B 1AO5A 1GHBF 4UD9H 1MTUA 3T28A 5JBAS 1NM6A 2J97A 1GL1A 1O3JA 1LCYA 1V2UT 1AI8H 1WCZA 1C2KA 3IG6B 2BD8A 4MVNA 4FUDA 3PMJA 2C8WB 2ZGCA 4DURA 1SGTA 1O2KA 3GCHC 1BTYA 4BANB 9ESTA 1BZXE 3S69A 3SGQE 3A7ZA 4Y76A 1SSXA 2VVUA 1O3BA 1IQNA 1HAVB 2UUFB 5E2OA 4YOIA 5C0TA 2A4OA 5CHBA 2W3IA 2Z6BD 3AK5A 1IQEA 4INKA 3SJKA 1S82A 3SQEE 3BIVH 3F2GA 2G5NA 1YLDA 1OOKB 4FXGH 1C1PA 1L1NA 1LHDH 4P02A 2FOEA 1CSOE 1HRTH 1HAOH 3QZQA 3C1KA 2BVRH 2M5TA 2CGAA 1MCTA 4K60A 3KGPA 1GI2A 5KECA 5T1VA 3CP7A 4KELA 3SNEA 3RXAA 2PLXA 3GCTF 4MPXA 4MG3A 3ZVGA 3EA8A 5CMXH 3PM3A 2V3HH 1BMLA 3DHKH 1AVWA 1TNGA 3OE7D 2RCEA 4OS5A 5ESTE 2BLQA 3A83A 3VB4A 1W8BH 1BB0B 1W12U 1SFIA 2GZ9A 1GBAA 1PQ5A 3E6PH 3UAIC 2UWPA 3SZEA 1V2WT 2QCYA 1EAUA 1RTFB 3K6YA 4GUXA 2NU4E 2Y81A 4HI3A 2F9UA 1UVSH 3GS9A 1Y3XA 2LELA 2WINI 1HAPH 1O2LA 4UFGH 1A5GH 2Y5GA 1LVOA 1W0JD 3BN9A 4FVBA 2QF0A 4IBLH 1AZZA 1S83A 3U9AH 5DGJA 1EUFA 5CHAC 1NU7B 4CRGA 1K1IA 1VITF 2ZU2A 4B73A 3P8GA 4ZHAA 1O34A 3SU1A 1ZMJA 4H6SB 1C4V2 1F0SA 5C1YA 1B7XB 3SNDA 6CHAC 3UWIA 4WXVA 2OD3B 3A84A 1E1RD 5TCCA 5CE1A 4CBOA 1OYTH 1LVBA 1ZGVA 3QUMP 3A89A 4WMEA 2ZO3H 3F9HA 1C2EA 2H9EH 4ZXYH 1PQ8A 3SV6A 1KIGH 3MTYA 1EKBB 3RXOA 1GHYH 1GI1A 4KTCA 2ZDVH 1GHZA 3NK8A 3UWJH 1TPAE 4XD7D 4LZ4B 2O8WA 2PWXA 1U6QA 2TIOA 4KTUA 1P06A 2ILNA 3FZZA 4YOJA 3PO1C 3TPIZ 5DN6D 1AGJA 1EPTB 1IQJA 5DP9A 5FX6A 3F0OA 1V3XA 2R3UA 3TNTA 1TA2A 1ZR0A 1EOJA 2FMJA 2BDYA 1XM1A 3BG4C 1GHAF 1NPMA 1Y3YA 4I8HA 4Y11E 2JDID 3SOSA 3TJOA 4Y79A 3B9FH 1H1BA 1FX0B 1H8ED 4A1TA 2W26A 4GAWA 4A92A 3EE7A 2TBSA 4F55A 1TBRH 4I8JA 1TBZH 1GJDB 1C9TA 3RXBA 4AX9H 1TPSA 1IOEA 1NRRH 1UTNA 3LONA 1RXPA 1O2WA 1SGPE 4NIXA 5C3NA 1OHHD 1K0HA 4Q7ZA 3O8RA 3UR9A 4SGAE 2NWNA 3SGAE 3ZZ6A 4THNH 1HPGA 3TH4H 1L1JA 3DA9B 1P01A 2ODQA 2C8ZB 2A5AA 4Q7YA 1V2ST 1GBBA 3LGVA 4JYVH 3F68H 1AFEH 1E35B 3Q3XA 2HLDD 4XBDA 1JMOH 1O3AA 2EY4C 3F0PA 3MU8A 1RTLA 3SNAA 3F6UH 1TNLA 2ALPA 5F6MA 5I46H 1C5RA 1VKYA 5A09A 3PYHA 3KN2A 1MCVA 2G5VA 2ZGBH 5EQQA 1EATA 2FOCA 2W3KA 1ZRBA 3PROA 2AGGX 3TVJB 2EI8A 4O3TA 4R0IA 2IOTA 2AYWA 2YOLA 2CHAB 1NY22 4MNWA 1QHRB 1A0HB 2TGDA 1EZUC 2BX4A 2V35A 1PPZA 2XC5A 1CGIE 1MH0A 1JIRA 1EX3A 4ZAEA 3GOVB 4I7YH 3TGIE 2G81E 5IYTA 1TX6A 2C8XB 1PPCE 2D26C 4YO9A 3VGCB 5FX5A 1F7ZA 3S0NA 1CE5A 4ZHMU 1ESTA 2PSXA 3S9BA 1W2KH 4M9FA 1ZYOA 4ZCNA 1VITH 1DWDH 1K9OE 4JZDH 1GJ9B 2PTNA 3FP8E 5J4QA 3MU0A 3RXGA 3RU4T 1P09A 2ZNKH 2JKHA 1RJXB 1OWHA 2OC0A 1KMHB 1ELEE 3VB6A 4I8LA 2K8IA 1TYNA 4Q80A 1Y3UA 2WPMS 4FVDA 1C2FA 2BDGA 1SG8B 1TFXA 2PKAB 1JRTA 3OX7U 1EAWA 3O8BA 1ID5H 4TWYA 2XBYA 3RXJA 1V2JT 3KQ5A 3IWMA 3D62A 5J4SA 2HGTH 5EXLA 5EW1H 1QGFA 1HAYB 5JDUB 5EXNA 1V2NT 1ZPCA 2VH0A 3BIUH 5FXLA 1P11E 1P2MA 2Q6FA 1P02A 3RDZA 1VCPA 2ZKSA 2KZ4A 1VJAU 3LOXA 2RDEA 1DVAH 1ZJKA 3WWFA 4LZ1H 4BXSA 1FPHH 1QR3E 2BQWB 4MQAA 4FUBA 1C5PA 3HK3B 4NIYA 1K1MA 1HUTH 1W0KD 1DLKB 2QY0B 1G30B 1J14A 1EPTC 4WH6A 3M35A 3BTME 1VGCB 2ZA5A 4Y8ZA 6GCHF 1BRBE 4B76A 1OP8A 4JYTA 2DUCA 2ZEBA 3M5NA 2FODA 2BOHB 2BB4A 1SVPA 2BDHA 1HV7A 2J4IA 2BLOA 1AVXA 2F9OA 2ZIQH 4R8TB 3RXEA 3U8RH 1ARBA 3M3VA 1XKAC 3ZZ9A 1C4Y2 1MU6B 1FQ3A 1C5MD 3PLPA 4X8VH 2BD7A 5HGGA 1O5GH 1A0JA 1YPHC 1AN1E 1EZXC 3GICB 1C1WH 1UVPA 2HVXA 4FU8A 2PW8H 2ZECA 1QB9A 2VU8E 4I8GA 4ISIH 2HNTF 1C1RA 2R0LA 1LMWB 5A0BA 2KCYA 3PB1E 1P2KA 3SJOA 1O2RA 1KXEA 2FIRH 2OUAA 1TALA 3BG8A 1KLTA 1YPKH 1V2LT 1TIOA 3FN8A 2KAIA 1AKSA 1AVGH 2BZAA 3NKKA 2ZU3A 5FPSA 1BTZA 1HAGE 3PV2A 1GG6C 3WW7A 3SYJA 1TNHA 1BQYA 1AZ8A 1C5LH 1CA0B 3BTGE 4CRCA 2B9LA 1QBVH 1C5XB 2K0QA 3A7WA 3SHCH 2FPZA 1SGYE 3FKSD 3TGJE 3RXSA 4K8YA 3V7TA 2H5DA 3PMHB 5K7RA 1CGJE 2BVSH 5ABWA 1SB1H 2OC7A 2ZQ1A 3KCGH 3F9EA 4FUFA 3TNSA 1EB2A 2CHAC 3A88A 5TJXA 3LH3A 1UCYK 2NU2E 2BQ6B 1IQFA 1TWXB 3LIWA 2QF5A 2G4UA 2ZHEH 2Z3EA 4D8NA 5IDKA 2VIDA 2QE7D 3S7KB 6ESTA 2I6QA 1ZLRA 1KTSB 1UTOA 4AORA 2FLRH 4XRNA 4B75A 3VXEH 1T8LA 3ODDA 3RXCA 3VGCC 4OGYA 1BCUH 2ZFQH 1WV7H 2EEKA 1HXFH 4CH8B 4NSYA 3LKWA 5LGOA 3FAOA 1L2EA 1MAYA 1UTLM 2GJGA 2A5IA 4DW2U 1GGDB 4IN1A 1L0ZA 2OLGA 1V2RT 1NS3A 4B6FA 3T62A 7KMEH 1GBMA 4JCNA 1GBIA 1YYY1 3MU4A 3TU7H 2Z7FE 5DG6A 2AFQB 1TOCB 2HALA 5H4IB 1TGNA 1GI5A 2ZPSA 3EGKH 4X1PU 1EZQA 1GHVH 1MKXK 1E37B 7GCHF 1OS8A 1BIOA 3GCNA 1AFQB 1MKWK 4FETA 1FI8A 3KEEA 4ABFA 2ZHQH 1NT1A 2IPHA 1L4DA 1QRZA 3ZZAA 2WPIS 1XXDA 4MNYA 4O9VA 4Z1MD 1HAHH 2O8UA 3M5OA 2FWWA 3SJ8A 4D9RA 5A0CA 3RLWH 1DOJA 1MZDA 2WPKS 1Z1IA 1LVMA 2BY7X 1FPCH 5A8XA 1T7CA 2D8WA 1VGCC 3F9GA 3UREA 1EQ9A 4FOUC 2FOBA 4H4FA 4YXWD 3ZZDA 2QGRA 1ABJH 1P03A 2BYAX 1SGDE 1XVMA 2CN0H 1CHOG 3MU5A 1ORFA 4X8TH 2FI5E 2W6JD 3MI4A 4NGAH 4TY6A 4J2YB 3MYWA 3GDSA 3FVFB 2VH6A 3GY7A 1QY6A 5HKKD 1TLDA 1GBFA 3G01A 5EU8A 4FU9A 1P04A 2QXHA 4RT0A 1A4WH 1MU8B 3H5CB 3UNQA 2A4QA 2BD9A 3ESTA 1HFDA 4DVAU 2IJOB 2Y7ZA 3RXPA 4UDWH 4ZKSU 1HAVA 2ZDAH 3R3GB 5EOKA 2HRVA 1C9PA 1C2JA 3GYLB 5JB8S 2XC0A 1C1UH 2Z3CA 3ZVDA 3ZZ5A 1C1NA 4TPYA 1GBKA 1CVWH 4CR5A 2FX6A 4Y8XA 1ELTA 1JOUB 3N7EA 4XDEA 4INHA 4ABDA 4ABBA 1UTPA 3LGUA 3PWBA 4IMZA 1S84A 4CRDA 1BJVA 1CGHA 2ODPA 1THRH 2PSYA 1UW7A 2BDIA 1CA0C 3RMMH 2P16A 2GCTB 1GBDA 1C1VH 2P3UB 1GJCB 1SLWB 3SBKA 1HJAB 1ESBA 4Y7AA 3GDUA 3QLPH 2KR7A 5HM2A 1S6FA 2Y5HA 3LT3A 5LPRA 1W10U 1HAXB 1O3EA 1TX7A 3TGKE 4F4OC 4LXBH 1XUKA 3DCLA 3TH2H 1O2YA 2IPQX 1ELCA 4JZFH 2ZDKA 2W6ID 1C2LA 1YCPK 2ZPQA 1UK2A 1C2HA 3DSPA 5C94A 1BT7A 1SGIB 2WZQA 3RU4D 4ACAA 2V3OH 5FL7D 1UHBB 3OTPA 5GJ4B 4IW4E 1YM0A 3V0XA 5T6FA 5SGAE 3MH5A 2GGVB 2XCNA 1GBCA 3F2FA 2R3YA 3TIUA 1O2ZA 1GGDC 4I33A 1OSSA 1ZZZA 2OQ5A 1EB1H 3RM2H 1F92A 1TPPA 1EJAA 1Q2WA 4TYDA 3URCA 1ZOMA 1GBEA 1WUNH 2NU0E 1L4ZA 1ELAA 3GYMA 4F48B 5DPAA 2STAE 1UCYH 2EC9H 2SGDE 5GXPA 1K21H 3EYDA 4ZROA 1AFQC 5C20A 2WSSD 1TAWA 3QGJA 1KXBA 2LPRA 1H9IE 1DM4B 3RU4E 1O0DH 3BTTE 3JZ2B 3F2HA 4WY3A 4ZH8A 1M9UA 2XWBI 1WDIA 1V2MT 5FAHA 2F9BH 4JZIA 2O8TA 4GLYA 3FOAA 2R2WU 2QIQA 2ZI2H 1SGFG 4P00A 3D23A 5E2PA 2W7UA 4ABHA 3A87A 1DDJA 2ZTYA 4ABEA 1L1GA 2RA0A 1YCPM 1G2MA 1F5RA 4FUJA 5F8XA 4BTUB 2EI7A 1FY8E 2EQNA 2L6OA 1HJ9A 4MTBA 3RM0H 1YP9A 1HIAA 1IQLA 5AVDA 1K1LA 4IGDA 1MKXH 2PP6A 2ANKH 1KDQB 1O2SA 1C5QA 1MUEB 3EAJA 5DK1A 3ZV9A 3U1JB 2BY9X 1RS0A 2ZGJA 4DT7B 2FP7B 1BRAA 1F0RA 2XBVA 3STJA 3GISB 4ABGA 4DOQA 5T6DA 1FNIA 1D3QB 2FTLE 1MTNB 3SU0A 1EASA 2JETB 1H8HD 4X1QU 4JYUH 2OBQA 2TGPZ 3BEFB 1X7AC 3GY4A 4ZUHA 4D9QA 3I29A 1D3DB 3KYGA 2FTMA 3U1IB 1BHXB 3SQHE 2TRMA 1CT2E 4TY7A 1GI0A 5FCRA 1WOFA 3HKJB 2VWLA 4A1XA 5L6NH 2VGCB 1GBTA 1SGRE 1O3MA 1AIXH 8GCHG 3CS7A 2GCTC 2PFEA 4ACBA 4B2BA 3W95A 4AB9A 1HJAC 1BTUA 2A2XH 1ESAA 2TGAA 2AEIH 5LH8A 1YC0A 2JJ1D 2RDLA 2FO9A 3UTUH 1KLJH 1EXFA 1XXFA 4F49A 1CQQA 2CF8H 3DT0H 2HNTE 3RP2A 3EE0B 1BMAA 3N7DA 5EW2H 1T32A 1MD7A 1DLEA 1C5OH 5E0HA 5C17A 4MPWA 3UFAA 2VVCA 2D1JA 1MQ6A 4B6EA 4K69A 1RFNA 3EA9A 3URDA 1Z8IB 3T5FH 2PKAA 2GX4A 3M5LA 3ZYEA 1TGSZ 1IAUA 3UOPA 5DJ7A 2BDCA 4GCHG 1A46H 1GMCG 2P3TB 2VIQA 2YMSD 1C5VA 4HGCA 4JK5A 1C5NH 4DG4A 1IQGA 5GNDA 1AWFH 3ITIA 3HATH 3PLBA 3SNCA 4LOYH 1FY1A 1O3CA 2FEQH 1C2IA 1ZPZA 5FPYA 3SO3A 1LKAA 3U69H 1Z71A 1NRNH 1KXCA 1OPHB 1ZMLA 4NIVA 1O3OA 1P57B 3P17H 2YMSB 1FY5A 4CRBA 1UTQA 1K22H 1LO6A 2QYIA 4U01A 2PKSC 4ABIA 1DITH 1J8AA 1GWAA 1A5HA 5EODA 1TQ0B 1FN8A 4ZHLU 1HLTH 3SI4H 3UQVA 3KNXA 5F53A 1YPJH 4JMYA 2J98B 1C1QA 1EP5A 4JZEH 5DP4A 3RXFA 4RKJB 2GCHG 1SMFE 2H9TH 1XMNB 1THPB 1O5BB 3ZZCA 1C5UA 4HFPB 3M36A 4K1EA 1QL8A 3QTOH 3SJIA 1MAXA 1NESE 1ETSH 1GG6B 1O31A 3MQKC 4X8UH 1YPEH 4K1TA 1RTKA 5HIYA 1LVYA 4X6OA 4UONA 3CS0A 2AMQA 4U2WA 1DUEA 5DKMA 3MMGA 5DSFA 2ZFSA 2ZDNA 1SC8U 1S5SA 1OWDA 2BD3A 1Y8TA 1VZQH 4OS6A 2ZFFH 4ASHA 2F91A 3HGNA 1T8MA 1NFYA 3HKIB 3H7OA 2J5UA 2XWAA 2GVFA 1UCYE 4UE7H 1Z8RA 1MTNC 2UWOA 1ZSKA 3RXRA 2JETC 5L30H 3T29A 1GDNA 1LHCH 1QA0A 3E8LA 3K6ZA 3W1EA 1GI4A 3EQ0H 1EFRD 3PTNA 1MTWA 1ANBA 2ZTXA 1GBLA 2VIVA 1J15A 1ZHRA 1DXPA 1N6XA 1MTVA 5DP3A 2XNIA 2BD2A 2VGCC 5AFZH 1O2XA 1T31A 3FP6E 1OXGA 5EPYA 3UNRA 2AMDA 4NZLA 1CT4E 1Z6EA 2G00A 1GJ5H 1HXEH 3S9AA 2FOFA 1QIXB 2CK3D 3M3SA 4NIWA 5A2MH 4D76A 5JPMH 3UB0A 4WVPE 3ZVEA 1O33A 1NROH 1A0LA 2C90B 2FOAA 2VIWA 4KP0A 2Z9GA 1BTHH 3OFND 4X1RU 3RMNH 2DE9A 3UOUA 2SNWA 1BRCE 1O3HA 2ZDMA 1BTPA 4ASUD 2ZHFH 1PQAA 7ESTE 2P94A 4INLA 1VJ9U 1ZGIA 2GTBA 1O3NA 5C5NA 1XUHA 3BTQE 2A5KA 3Q00A 1LTOA 2ANYA 1ELFA 1P2QA 1OWKA 1THSH 2JIZD 2KCPA 3KQCA 3SHAH 1SLVB 1QBOA 2RA3A 2J94A 3MWIU 1O2IA 1NZQH 4BAQB 1MD8A 1DWBH 4GSOA 1O5EH 3E91A 1UMAH 4A5TS 4H42U 1SL3A 2OBOA 5GCHG 3ZVAA 2KCAA 4D7FA 3ZIAD 2R9PA 3SU5A 1QNJA 2AERH 2FS8A 2ZU4A 4AC9A 1BMNH 3LGWA 4IS5A 1O5AB 1ANCA 4AFQA 2YMSC 1O3GA 2XBWA 3RMOH 4I32A 7LPRA 2EI6A 5AFYH 2AIPA 3RXDA 2V6NA 3PWCA 4Y0YE 1FV9A 3VB5A 3ATMA 1ANDA 1F5LA 3L6PA 3BTFE 4Z0KA 1CHOF 3CNRA 4J1YA 4GVUA 1A3EH 3QZRA 5E8EH 2P8OB 1G3BA 2A1DB 2M2AA 4UFDH 1GI8B 4AZ2B 4CH2B 1ZRKA 2ESTE 5EIYA 3MFJA 2QAAA 1QZ8A 2BD4A 2OXSA 4E7RG 3A7YA 1O2OA 3RXHA 1FY4A 3UY9A 1NU9A 1EAIA 1D6WA 5C1XA 4X2YA 1O2UA 5KEDA 4ISLA 5FCKA 1G37A 1SOZA 4BTIB 4X6PA 1NC6A 1DWCH 1LHEH 4LK4A 4GHQA 1FXYA 4GPGA 3SUEA 5GWZA 2ZCLP 3DUXH 2F43B 2C8YB 1Y3VA 4B1TA 2TGTA 1N6YA 1TABE 3KQEA 1SHYA 1CBWB 1HAIH 1YKTA 2HLCA 4B74A 1XVOA 1UK3A 1O3DA 3A81A 1DFPA 2AH4X 4O03A 4ISOA 2HWLB 1SKYE 1C5WB 1O36A 3AAVA 2O8MA 4DIIH 1KYNA 1SI5H 1Y5BT 2NU3E 1V2KT 4WMFA 3DSOA 3EDXB 5F8TA 1BJUA 1O2GH 2A7CA 4OGXA 1GL0E 2BM2A 3PV4A 4NZQA 5GIBA 8LPRA 5C67A 3E0PB 3ODFA 1WXRA 1TGBA 1GMDG 1TNIA 1YWUA 3LC3A 3SV8A 2WUCA 3ZZ3A 1ACBE 4MDSA 1OX1A 1DX5M 3MNBA 4XFQA 1GVKB 4Q63A 2SNVA 4OM9A 1G9IE 1GI3A 4CRAA 1W13U 2VB0A 1TGCA 2J92A 2ZFPH 1DSTA 3DFJA 1O39A 3VFEA 2Y5FA 1PJPA 1YLNA 1BUIA 3LGIA 5CDFE 2IJD1 3MO6A 2OC8A 5EG4A 3SORA 2GV7A 2FM2A 1GMHG 3KF2A 1DUAA 1XUGA 2XW9A 1O2NA 2VWOA 1Z8GA 2VIOA 3ATWA 4NA8A 2FS9A 1S0RA 2VBCA 2HPQH 1T4VH 2RG3A 1ZTLA 1TOMH 2H5CA 4BAKB 2ZGHA 1VR1H 1C1SA 3TK9A 2VVVA 3MH7A 1TB6H 1AQ7A 4AGKA 1ANEA 2XBXA 4NFEA 1UK4A 1GVLA 4ISNA 2YNBA 1OP0A 3SW2B 3SU6A 3A85A 1G3CA 3B23B 1TBQH 2F3CE 4B71A 3N99A 1GI6A 1GHXH 4AG1A 1AHTH 1QJ7B 2F9NA 2Q6DA 3OEHD 2BDBA 3P8FA 1G2LA 1P0SH 4WXIA 1AD8H 1RIWB 1P3CA 1DWEH 1EP6A 4U30A 2GMTC 4YOGA 2VNTA 1JXPA 1QJ1B 1S6LA 3GY8A 3D49H 5HXFA 3QDZB 2STBE 3A7XA 4K3JA 2QF4A 1HAZB 3SGBE 4U32A 2V7QD 4WJG2 4X1SU 3GY2A 1MBQA 2LP6A 3ENSB 4OS1A 1GHWH 2F83A 3HPTB 2HPPH 2KAIB 4XSKU 1O37A 2GDDA 3ELAH 1LQDB 2P8OC 1W3CA 2BLVA 1F5KU 2VINA 1JBUH 2F9PA 1SQOA 1W11U 1IQHA 1KDQA 3VXFH 2QXGA 1LKBA 1GCTC 2FX4A 3A86A 3SV9A 4UFFH 1XUIA 1P2JA 3RLYH 3UR6A 4RSPA 2I6SA 3AW0A 3FO8D 4MPUA 2WV9A 1QURH 3MNSA 4NSVA 3TJVA 3P70B 2A31A 1UTKA 1Q31A 2A45B 3A8AA 1DY8A 3QK1A 1AE8H 2Z3DA 1CBWC 2O8LA 2ZTZA 2ZHWH 2P3FH 1TRYA 2BY5X 3GY3A 1GJAB 3Q3YA 2JJ2D 4ISHH 1AB9B 1C1TA 2CMYA 5KGOA 4KTSA 8GCHF 1FLEE 1D3TB 1O3FA 5JYIA 1QJ6B 1W0YH 2JH6D 4CREA 1JRSA 1WQVH 4TPIZ 1J16A 3MOCA 2A2QH 3WWBA 1QL9A 5FPTA 1TNJA 4MLFB 1ZHPA 1EJNA 2EA3A 1FY3A 3K9XB 1O2MA 1SGQE 4O3UA 4A1VA 4AOQA 5EXMA 3FZDA 4JZ1A 2H6MA 1IQIA 5FHTA 2WHXA 1E79D 1O38A 3T25A 3KL6A 1O2TA 1C1OA 4K8BA 1YBWA 3C27B 3SU4A 3SUGA 1CHGA 4NFFA 2A7JA 4I31A 1NRPH 3SZNA 5EQRA 1DXWA 1C2DA 1GCDA 1TMTH 4AG2A 3F1SB 3LJOA 2QXIA 4B2AA 4DGJA 1UTMA 5JBCS 1W0ZU 4KGAA 3A7VA 1KXAA 1EPTA 2PKSB 4NWKA 4CRFA 4DJZB 2J2UA 2HVYB 5TCAA 2C93B 2FYQA 1B5GH 2Y7XA 3M7UA 4WWYA 3OU0A 1DICA 1SPJA 3SU2A 5EQSA 4GCHF 1GMCF 5DP5A 4OS2A 1GI9B 6LPRA 1HCGA 1MBMA 5B6OA 2A7HA 3NWUA 1OP2A 1QB6A 5BPEA 2ZF0H 1O3LA 3ATIA 3H09A 3P92A 1W7GH 1YPMH 2OQUA 3E16B 3UUZA 1SLUB 1HB0B 5AHGH 1INCA 4DCDA 4X6MA 2WYJA 2BLWA 2BX3A 3MH6A 3OTJE 1JWTA 3ZZ7A 4BXWA 1SGEE 1N8OB 1Z1JA 2AMPA 2OC1A 1XX9A 4ESTE 3L3TA 2FESH 2J95A 2QC2A 1TX8A 2YNAA 3OAAD 3ZVBA 1O30A 2QA9E 1RIWC 4ZXXH 1MKWH 2J98A 3SU3A 4Q7XA 3MNXA 3B8JA 2GCHF 4DT4A 5JBTA 1ETTH 2L74A 4OS4A 4K5ZA 4RI0A 4WH8A 2G8TA 2R0KA 1FUJA 1DPOA 3H7TA 2BHGA 1NN6A 2A4GA 3Q77A 2ZP0H 2GDEH 3M61U 4XBBA 4IC5A 1HDTH 4YLUA 3RMLH 1YPGH 4TSFD 2J38A 1SGNE 4RKOB 4XOJA 4X2XA 3PV5A 2Z9KA 1D9IA 2ZZUH 4Z6AH 2JH0D 1NRSH 1SGFA 4B2CA 2SFAA 1BBRK 3V3MA 1P10A 1LPKB 3BF6H 1SR5C 2SGAA 1IQKA 1G3EA 4X8SH 1LHFH 3ZZ4A 3LC5A 1XUJA 2Z9IA 1GDQA 4E06H 2ZWLH 1C5YB 3ZV8A 3VPKA 1PPEE 1A1RA 1NTPA 1TONA 2XTTB 2KFWA 1P8VC 3MHWU 1PFXC 1A3BH 1ZTKA 1F0TA 3AVZA 3DD2H 1V6DA 4PROA 1NFUA 3E3TA 1E0FD 3V13A 1OWJA 2GT8A 1FAXA 1PPFE 3LGTA 4OS7A 2KM0A 4DY7B 3ATLA 3WY8A 2AS9A 3NCLA 1UVUH 1SQAA 1TE0A 1AB9C 1E1QD 2GT7A 1TRMA 2WPHS 2SGFE 3MH4A 2ZG0H 1KY9A 4I86A 1FIZA 2ZU5A 3A8CA 3P8NA 1RGQA 2HOBA 2VIPA 2WPJS 1MTSA 2PUXB 1FIWA 1QB1A 1YGCH 2FI4E 3SV7A 2B8OH 3VB3A 1P2OA 2FOMB 2ZC9H 4FU7A 1EAXA 4YTAA 5B6LA 1CA8B 1KTTB 5DO4H 1GHBG 3DSGA 3SUDA 1WYKA 1MQ5A 2PV9B 3AASA 2BD5A 1V2TT 5L2YH 1QL7A 4AB8A 1LHGH 2ZU1A 2PUQH 1TMBH 2B5TB 3NPSA 1YCPH 1Z7KA 2Q6GA 5C2ZA 1ABIH 3O8CA 3KQDA 4TWWA 2CV3A 1WSSH 3OY6U 3UQOA 1A61H 2A0QB 3QGNB 4YLQH 1NFXA 4IC6A 3BV9B 4Y71A 2Q1JA 1YPLH 5GCHF 2J34A 4AFSA 2SGQE 3W94A 1S81A 2XNDD 4AFUA 1W7XH 1C4U2 1SHHB 1UO6A 1LPGB 1GJ8B 3L33A 2DE8A 2QXJA 3TK6A 1HIAB 3GY5A 4YM9A 4BAMB 2GV6A 1QQ4A 1TQ7B 4FUEA 1N8OC 5EGMA 1P2NA 3P8OA 1O35A 1V2OT 3F3BA 3MO9A 3M3TA 2WUBA 1BMFD 1O32A 1T8NA 3E90B 3Q3KA 1UTJA 4WMDA 4M7GA 3GCTG 2V3MA 3K2UA 2GD4B 5K0HA 1EZSC 2PTCE 1P2IA 2QN5T 2C4FH 3RXIA 3A8DA 4MNXA 4ZMAH 4AYYB 4HTCH 1QA7A 3OYPA 3NUMA 1ELBA 1G36A 1PPGE 3LJJA 3RXQA 1YPHE 1ZHMA 5FBEA 2XRCA 4Q2KA 4UFEH 3T2NA 2BOKA 2WYGA 2AGEX 2Z9JA 1C2GA 1J9CH 2Y82A 4H6TA 2F4LA 1K2I1 1P9UA 1C5ZB 1ZTJA 3HGPA 5L2ZH 2HNTC 3ZZBA 2CXVA 3AW1A 1JIMA 3P6ZB 5JBBS 3M37A 3TLOA 1HBTH 1O3IA 3EA7A 3LH1A 3NXPA 4X0WU 2FYRA 1K28D 1VITG 5LPEA 1O5DH 1BTWA 2W7SA 4BNRA 3QO6A 3SNBA 3RXLA 1COWD 5C0UA 2ANMH 4O97A 3TJNA 3KQBA 4Y6DA 1O2VA 4WF8A 5HMAA 4ABJA 3NRLA 1DT2A 4A6LA 1D4PB 1TMUH 4UEHH 2H1UA 1HNEE 5GPIB 4X1NU 2ANWA 1PYTD 2OP9A 2OTVA 1GMDF 2ZCHP 1AUTC 2BY8X 5C1UA 2FLBH 2ULLA 1CT0E 4SGBE 1BDAA 2WPDD 2OINA 5EJLA 1H9LB 1HYLA 8ESTE 3S7HB 3TITA 1K1JA 1YF4A 3I77A 2ZFRH 2IN2A 3T27A 1BBRH 1C5SA 2P59A 3RUOA 5HYOA 5E0JA 3AAUA 3ZYDA 5A0AE 1CU1A 4QT8C 2K1QA 3M7TA 3TK5A 1GPZA 1NRQH 3SN8A 2ZGXH 2WPLS 2G51A 2ASUB 2Y80A 3UNSA 1V2PT 1GHAG 5GDSH 2PHBA 2B0FA 2SGPE 1LPZB 2H2ZA 4DIHH 1Q3XA 1TRNA 2WV4A 3A80A 4X2VA 5EJZA 1SBWA 2A4RA 3HK6B 2AGIX 1J17T 1GDUA 1SFQB 5HIZA 3BTKE 3A8BA 2XOKD 1C5TA 1GMHF 1XKBC 5DP7A 5DP6A 3OSYA 2FZZA 1S0QA 1H9HE 1WAYB 2CF9H 3E1XB 5C5OA 1TA6A 2BQ7B 2SGEE 2D2DA
chains in the Genus database with same CATH topology
1A7SA 1LDTT 4XBCA 3QX5H 2GMTB 4ABAA 1BRUP 1RD3B 2BY6X 1E36B 2R2MB 3BTDE 1F2SE 4X2WA 1AMHA 4YESB 3N7OA 2P93A 1GJ6A 3M7QA 4AFZA 3O8DA 1ETRH 1O3KA 3IITA 2BMGB 3TH3H 1K1OA 1T4UH 5AF9H 4MPVA 1XUFA 5F8ZA 2FOGA 4FUCA 4E05H 2QV1A 3KHVA 1G32B 2ALVA 2UUKB 3U98H 1ARCA 1GCTB 2Y6TA 1BHXF 1FZZA 3SV2H 1DANH 3QTVH 1H8DH 3QWCH 1OYQA 4BAHB 1SOTA 2GKVE 1VCWA 5T6GA 1QCPA 1DS2E 2UWLA 4AGJA 1O3PB 1P05A 4FUIA 4NCYA 3FP7E 3PMAB 3ATKA 5PTPA 3GY6A 3VB7A 4YT7H 3STIA 3BSQA 3LU9B 1AUJA 3P95A 5F03A 3RXVA 1WTGH 3SI3H 4E7NA 5A8ZA 4CR9A 1KLIH 1SLXB 2OCVB 2NU1E 1P9SA 1SQTA 3GDVA 3RXTA 2B7DH 1DY9A 1ZJDA 2TPIZ 1VCQA 1DSUA 4MNVA 1V2VT 2JH5D 2FXRA 1BA8B 2XYAA 4Y0ZE 1Z8JB 3F9FA 1QRXA 2A32A 3PMBB 1H8IH 1O5FH 4YZUA 3BTWE 1A2CH 1NO9H 3V12A 3RXUA 8KME2 2ODYB 2GP9B 3PLKA 1UVOA 4IMQA 3ZZ8A 3M5MA 2G52A 4HZHA 2VWMA 2P95A 1GI7B 3RC5A 9LPRA 2BVXH 3TJUA 1E38B 1CO7E 2XC4A 4ZKNU 3A82A 3NZIA 2UUYA 1T8OA 1EOLA 3ZVFA 1MZAA 1OWIA 4FUHA 4FUGA 2QF3A 1QTFA 5HM9A 4A7IB 4VGCB 1UHBA 1GJ7B 4X6NA 3PTBA 3RC4A 1B0EA 5JB9S 1BOQA 4ZKRU 3R0FA 5LPFA 2GZ7A 1ELVA 3BEIB 1DE7H 1K1NA 3SJ9A 4CHAB 3QN7A 4YT6H 1FAKH 1PYTC 4ZKOU 2VJ1A 1OWEA 2LNCA 3LDXH 1QFKH 3BTEE 1PPHE 2PR3A 5FBIA 6GCHG 3MO3A 1O2HA 2Z9LA 2G4TA 3A7TA 2BDAA 1S85A 1O5CB 1ZSLA 2VWNA 3T26A 5G4BA 4K1SA 2GZ8A 3UIRA 3RXMA 1D3PB 1BTXA 5DP8A 3GCHB 5E0GA 1H4WA 1D6RA 1RRKA 1Y3WA 2ZQ2A 1KXDA 1TNKA 5I25A 5ESBA 1GVZA 1WQSA 2FOHA 2ZDLA 1ZMNA 4BAOB 3FFGA 4BOHA 1UJ1A 4AN7A 2BZ6H 1AY6H 3KIDU 1Y59T 1ZPBA 1G3DA 4I8KA 2CJIA 4Y8YA 3U8TH 1Y5AT 4GHTA 1AU8A 4NA9H 2J9NA 3D65E 1TGTA 1ELGA 3U8OH 4KKDA 1AKSB 4IN2A 3UPEA 1P12E 1KSNA 3GCOA 2ZHDA 1K1PA 2O9QA 1PQ7A 1Z6JH 4BTTB 3LGYA 1BBRE 1MMJN 2ZPRA 5T3HA 4NG9H 4JK6A 1B0FA 2FDAA 1WTHD 2Z94A 1KXFA 2ZCKP 1E34B 1N1LA 1AWHB 4XE4A 2FI3E 3DFLA 1YLCA 3BTHE 4NA7A 1FDPA 2BXUH 1O2QA 1BMMH 1S6HA 1FN6A 1HJ8A 3I78A 1HGTH 1QRWA 5EPNA 3S9CA 1C2MA 3FANA 1FONA 1O2JA 1QQUA 3OY5U 4D7GA 1PPBH 2BXTH 3JZ1B 5CHAB 1ELDE 1NFWA 1TPOA 1LQEA 3Q76A 3ZVCA 5BRRE 3SUFA 1IHSH 4Y10E 4CBNA 2WV5A 1FMGA 2XCFA 6CHAB 3BEUA 1SGCA 1F0UA 2W5EA 2PGQB 1W14U 1A5IA 2F9VA 4RN6A 3VEQB 3CENA 1GBJA 1WBGB 2G55A 1P3EA 2H9HA 3RC6A 1GJBB 3E0NB 1AE5A 1OKXA 1GBHA 1ZSJA 1V2QT 2ZFTA 1FJSA 4Y7BA 1QBNA 1BITA 7GCHG 1EJMA 1GJ4H 1UVTH 5ETXA 2UUJB 3MNCA 3RXKA 4VGCC 1IHTH 2C3SA 5A8YA 1IQMA 1WU1A 3PO1B 3MU1A 2BTCE 4NWLA 2THFB 1Y5UT 2AIQA 4K2YA 2XXLA 3LPRA 1O2PA 2PGBB 1C1MA 4CHAC 3BG4B 2V0BA 4AYVB 3K65B 1AO5A 1GHBF 4UD9H 1MTUA 3T28A 5JBAS 1NM6A 1GL1A 1O3JA 1LCYA 1V2UT 1AI8H 1WCZA 1C2KA 3IG6B 2BD8A 4MVNA 4FUDA 3PMJA 2C8WB 2ZGCA 4DURA 1SGTA 1O2KA 3GCHC 1BTYA 4BANB 9ESTA 1BZXE 3S69A 3SGQE 3A7ZA 4Y76A 1SSXA 2VVUA 1O3BA 1IQNA 1HAVB 2UUFB 5E2OA 4YOIA 2A4OA 2W3IA 2Z6BD 1IQEA 4INKA 3SJKA 1S82A 3SQEE 3BIVH 2G5NA 1YLDA 1OOKB 4FXGH 1C1PA 1L1NA 1LHDH 2FOEA 1CSOE 1HRTH 1HAOH 3QZQA 3C1KA 2BVRH 2M5TA 2CGAA 1MCTA 4K60A 3KGPA 1GI2A 3CP7A 4KELA 3SNEA 3RXAA 2PLXA 3GCTF 4MPXA 4MG3A 3ZVGA 3EA8A 5CMXH 3PM3A 2V3HH 1BMLA 3DHKH 1AVWA 1TNGA 2RCEA 4OS5A 5ESTE 2BLQA 3A83A 3VB4A 1W8BH 1BB0B 1W12U 1SFIA 2GZ9A 1GBAA 1PQ5A 3E6PH 2UWPA 1V2WT 2QCYA 1EAUA 1RTFB 3K6YA 4GUXA 2NU4E 2Y81A 4HI3A 2F9UA 1UVSH 1Y3XA 1HAPH 2WINI 1O2LA 4UFGH 1A5GH 2Y5GA 1LVOA 3BN9A 4FVBA 4IBLH 2QF0A 1AZZA 1S83A 3U9AH 5DGJA 1EUFA 5CHAC 1NU7B 4CRGA 1K1IA 1VITF 2ZU2A 4B73A 3P8GA 4ZHAA 1O34A 3SU1A 1ZMJA 4H6SB 1C4V2 1F0SA 5C1YA 1B7XB 3SNDA 6CHAC 3UWIA 4WXVA 2OD3B 3A84A 5TCCA 5CE1A 4CBOA 1OYTH 1LVBA 1ZGVA 3QUMP 3A89A 4WMEA 2ZO3H 3F9HA 1C2EA 2H9EH 4ZXYH 1PQ8A 3SV6A 1KIGH 3MTYA 1EKBB 3RXOA 1GHYH 1GI1A 4KTCA 2ZDVH 1GHZA 3NK8A 3UWJH 1TPAE 4LZ4B 2O8WA 2PWXA 1U6QA 2TIOA 4KTUA 1P06A 2ILNA 3FZZA 4YOJA 3PO1C 3TPIZ 1AGJA 1EPTB 1IQJA 5DP9A 5FX6A 1V3XA 2R3UA 3TNTA 1TA2A 1ZR0A 1EOJA 2FMJA 2BDYA 1XM1A 3BG4C 1GHAF 1NPMA 1Y3YA 4I8HA 4Y11E 3SOSA 3TJOA 4Y79A 3B9FH 1H1BA 4A1TA 2W26A 4GAWA 4A92A 2TBSA 1TBRH 4I8JA 1TBZH 1GJDB 1C9TA 3RXBA 4AX9H 1TPSA 1IOEA 1NRRH 1UTNA 3LONA 1RXPA 1O2WA 1SGPE 4NIXA 5C3NA 4Q7ZA 3O8RA 3UR9A 4SGAE 2NWNA 3SGAE 3ZZ6A 4THNH 1HPGA 3TH4H 1L1JA 3DA9B 1P01A 2ODQA 2C8ZB 2A5AA 4Q7YA 1V2ST 1GBBA 3LGVA 4JYVH 3F68H 1AFEH 1E35B 3Q3XA 4XBDA 1JMOH 1O3AA 3MU8A 1RTLA 3SNAA 3F6UH 1TNLA 2ALPA 5F6MA 5I46H 1C5RA 5A09A 3PYHA 3KN2A 1MCVA 2G5VA 2ZGBH 5EQQA 1EATA 2FOCA 2W3KA 1ZRBA 3PROA 2AGGX 3TVJB 2EI8A 4O3TA 4R0IA 2IOTA 2AYWA 2YOLA 2CHAB 1NY22 4MNWA 1QHRB 1A0HB 2TGDA 1EZUC 2BX4A 2V35A 1PPZA 2XC5A 1CGIE 1MH0A 1JIRA 1EX3A 4ZAEA 3GOVB 4I7YH 3TGIE 2G81E 5IYTA 1TX6A 2C8XB 1PPCE 2D26C 4YO9A 3VGCB 5FX5A 1F7ZA 3S0NA 1CE5A 4ZHMU 1ESTA 2PSXA 3S9BA 1W2KH 1ZYOA 1VITH 1DWDH 1K9OE 4JZDH 1GJ9B 2PTNA 3FP8E 5J4QA 3MU0A 3RXGA 3RU4T 1P09A 2ZNKH 2JKHA 1RJXB 1OWHA 2OC0A 3VB6A 1ELEE 4I8LA 1TYNA 4Q80A 1Y3UA 2WPMS 4FVDA 1C2FA 2BDGA 1SG8B 1TFXA 2PKAB 1JRTA 3OX7U 1EAWA 3O8BA 1ID5H 4TWYA 2XBYA 3RXJA 1V2JT 3IWMA 3D62A 5J4SA 2HGTH 5EXLA 5EW1H 1QGFA 1HAYB 5JDUB 5EXNA 1V2NT 1ZPCA 2VH0A 3BIUH 5FXLA 1P11E 1P2MA 2Q6FA 1P02A 3RDZA 1VCPA 2ZKSA 1VJAU 3LOXA 1DVAH 1ZJKA 4LZ1H 4BXSA 1FPHH 1QR3E 2BQWB 4MQAA 4FUBA 1C5PA 3HK3B 4NIYA 1K1MA 1HUTH 1DLKB 2QY0B 1G30B 1J14A 1EPTC 4WH6A 3M35A 3BTME 1VGCB 2ZA5A 4Y8ZA 6GCHF 1BRBE 4B76A 1OP8A 4JYTA 2DUCA 2ZEBA 3M5NA 2FODA 2BOHB 2BB4A 1SVPA 2BDHA 1HV7A 2J4IA 2BLOA 1AVXA 2F9OA 2ZIQH 4R8TB 3RXEA 3U8RH 1ARBA 3M3VA 1XKAC 3ZZ9A 1C4Y2 1MU6B 1FQ3A 1C5MD 3PLPA 4X8VH 2BD7A 5HGGA 1O5GH 1A0JA 1YPHC 1AN1E 1EZXC 3GICB 1C1WH 1UVPA 2HVXA 4FU8A 2PW8H 2ZECA 1QB9A 2VU8E 4I8GA 4ISIH 2HNTF 1C1RA 2R0LA 1LMWB 5A0BA 3PB1E 1P2KA 3SJOA 1O2RA 1KXEA 2FIRH 2OUAA 1TALA 3BG8A 1KLTA 1YPKH 1V2LT 1TIOA 2KAIA 1AKSA 1AVGH 2BZAA 3NKKA 2ZU3A 5FPSA 1BTZA 1HAGE 1GG6C 1TNHA 1BQYA 1AZ8A 1C5LH 1CA0B 3BTGE 4CRCA 2B9LA 1QBVH 1C5XB 3A7WA 3SHCH 2FPZA 1SGYE 3TGJE 3RXSA 4K8YA 3V7TA 2H5DA 3PMHB 5K7RA 1CGJE 2BVSH 5ABWA 1SB1H 2OC7A 2ZQ1A 3KCGH 3F9EA 4FUFA 3TNSA 1EB2A 2CHAC 3A88A 5TJXA 3LH3A 1UCYK 2NU2E 2BQ6B 1IQFA 1TWXB 3LIWA 2ZHEH 2G4UA 5IDKA 2Z3EA 4D8NA 2VIDA 3S7KB 6ESTA 2I6QA 1ZLRA 1KTSB 1UTOA 4AORA 2FLRH 4B75A 3VXEH 1T8LA 3ODDA 3RXCA 3VGCC 4OGYA 1BCUH 2ZFQH 1WV7H 2EEKA 1HXFH 4CH8B 4NSYA 3LKWA 5LGOA 3FAOA 1L2EA 1MAYA 1UTLM 2A5IA 4DW2U 1GGDB 4IN1A 1L0ZA 2OLGA 1V2RT 1NS3A 7KMEH 3T62A 1GBMA 4JCNA 1GBIA 1YYY1 3MU4A 3TU7H 2Z7FE 5DG6A 2AFQB 1TOCB 2HALA 5H4IB 1TGNA 1GI5A 2ZPSA 3EGKH 4X1PU 1EZQA 1GHVH 1MKXK 1E37B 7GCHF 1OS8A 1BIOA 3GCNA 1AFQB 1MKWK 1FI8A 3KEEA 4ABFA 2ZHQH 1NT1A 2IPHA 1L4DA 1QRZA 3ZZAA 2WPIS 1XXDA 4MNYA 4O9VA 1HAHH 2O8UA 3M5OA 2FWWA 3SJ8A 4D9RA 5A0CA 3RLWH 1DOJA 1MZDA 2WPKS 1Z1IA 1LVMA 2BY7X 1FPCH 5A8XA 1T7CA 2D8WA 1VGCC 3F9GA 3UREA 1EQ9A 2FOBA 4H4FA 3ZZDA 2QGRA 1ABJH 1P03A 2BYAX 1SGDE 1XVMA 2CN0H 1CHOG 3MU5A 1ORFA 4X8TH 2FI5E 3MI4A 4NGAH 4TY6A 4J2YB 3MYWA 3GDSA 3FVFB 2VH6A 3GY7A 1QY6A 1TLDA 1GBFA 3G01A 5EU8A 4FU9A 1P04A 2QXHA 1A4WH 1MU8B 3H5CB 3UNQA 2A4QA 2BD9A 3ESTA 1HFDA 4DVAU 2IJOB 2Y7ZA 3RXPA 4UDWH 4ZKSU 1HAVA 2ZDAH 3R3GB 5EOKA 2HRVA 1C9PA 1C2JA 3GYLB 5JB8S 2XC0A 1C1UH 2Z3CA 3ZVDA 3ZZ5A 1C1NA 4TPYA 1GBKA 1CVWH 4CR5A 2FX6A 4Y8XA 1ELTA 1JOUB 4XDEA 4INHA 4ABDA 4ABBA 1UTPA 3LGUA 3PWBA 4IMZA 1S84A 4CRDA 1BJVA 1CGHA 2ODPA 1THRH 2PSYA 2BDIA 1CA0C 3RMMH 2P16A 2GCTB 1GBDA 1C1VH 2P3UB 1GJCB 1SLWB 3SBKA 1HJAB 1ESBA 4Y7AA 3GDUA 3QLPH 5HM2A 1S6FA 2Y5HA 3LT3A 5LPRA 1W10U 1HAXB 1O3EA 1TX7A 3TGKE 4F4OC 4LXBH 1XUKA 3TH2H 1O2YA 1ELCA 4JZFH 2ZDKA 1C2LA 1YCPK 2ZPQA 1UK2A 1C2HA 1BT7A 1SGIB 3RU4D 2V3OH 1UHBB 5GJ4B 4IW4E 1YM0A 3V0XA 5T6FA 5SGAE 3MH5A 2GGVB 2XCNA 1GBCA 2R3YA 3TIUA 1O2ZA 1GGDC 4I33A 1OSSA 1ZZZA 2OQ5A 1EB1H 3RM2H 1F92A 1TPPA 1EJAA 1Q2WA 4TYDA 3URCA 1ZOMA 1GBEA 1WUNH 2NU0E 1L4ZA 1ELAA 3GYMA 5DPAA 2STAE 1UCYH 2EC9H 2SGDE 5GXPA 1K21H 3EYDA 4ZROA 1AFQC 5C20A 1TAWA 3QGJA 1KXBA 2LPRA 1H9IE 1DM4B 3RU4E 1O0DH 3BTTE 3JZ2B 4WY3A 4ZH8A 1M9UA 2XWBI 1V2MT 5FAHA 2F9BH 4JZIA 2O8TA 4GLYA 2R2WU 2QIQA 2ZI2H 1SGFG 3D23A 5E2PA 2W7UA 4ABHA 3A87A 1DDJA 2ZTYA 4ABEA 1L1GA 2RA0A 1YCPM 1G2MA 1F5RA 4FUJA 5F8XA 4BTUB 2EI7A 1FY8E 1HJ9A 4MTBA 3RM0H 1YP9A 1HIAA 1IQLA 5AVDA 1K1LA 4IGDA 1MKX