5E0GA

1.20 a resolution structure of norovirus 3cl protease in complex with a triazole-based macrocyclic (17-mer) inhibitor
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
173
Chain Sequence
HHAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTGANAKGLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Norovirus 3C-like protease
publication title Structure-based design and synthesis of triazole-based macrocyclic inhibitors of norovirus protease: Structural, biochemical, spectroscopic, and antiviral studies.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Protease/protease inhibitor
total genus 40
structure length 173
sequence length 175
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5e0gA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5e0gA01
3PYHA 3AW1A 1C5LH 4UE7H 1O0DH 1TA6A 3PV4A 3RU4D 1BRAA 9LPRA 4AFUA 1O35A 3RXMA 1P2IA 3TK6A 1OP8A 5IDKA 2OBQA 2PGBB 3A88A 1CHGA 3TVJB 1TPOA 2GDEH 2FLRH 1GHBF 4I31A 3U1JB 2PTCE 2FOCA 1WQVH 1C5YB 1W13U 4I32A 1CT2E 4RKOB 1XKAC 4CR5A 4JZ1A 4ZKSU 2NU2E 1AMHA 4YM9A 2Q1JA 3GOVB 1GPZA 1UO6A 3FP6E 4UONA 1GMHF 3OY6U 3LGWA 1Y3XA 2GCHF 2HNTE 3GY3A 4Q7ZA 5CMXH 1TNLA 3OY5U 5AFYH 1FV9A 2PUQH 4NGAH 2Q6FA 3T2NA 2KAIB 1ZMLA 3SORA 2D8WA 4YOGA 3P92A 3A7VA 1MZDA 1SVPA 3LGTA 4SGAE 4Y0ZE 3RXUA 1CBWB 2PFEA 1J15A 2UWLA 1TAWA 2BD5A 2TGAA 3P8NA 1LMWB 1O2SA 2G5VA 1DLKB 1WSSH 1ZHRA 2H5CA 4K60A 8LPRA 1O30A 4K1EA 1SC8U 2ANYA 1ZPZA 1Z6EA 5FXLA 4NIYA 3T27A 3UUZA 2O8UA 3MMGA 1BITA 1TGSZ 2PHBA 1YYY1 4A1XA 2Y80A 1Z6JH 4ISNA 1O5FH 1YCPH 1S85A 1MTVA 1T8LA 3URCA 3IITA 2J92A 5HM9A 1C5QA 1C2JA 1CU1A 2H6MA 1NU7B 1SGYE 4NIXA 3M36A 2RA3A 4FUEA 3H5CB 5JDUB 1O3OA 1WCZA 1V6DA 1SOTA 2FLBH 1ZPBA 3PMHB 1ANEA 2VH6A 4DY7B 1VGCC 2P3FH 3PROA 1LPZB 2QY0B 9ESTA 3RC4A 2J4IA 1D3QB 1SPJA 1IQEA 3UY9A 4ISOA 3O8BA 2ZO3H 1TNGA 4A6LA 3GY7A 3GCTG 1O3DA 4A7IB 4CH2B 4F49A 2XWAA 3GY6A 4YOJA 1LPGB 4AZ2B 1EAXA 3ZZ4A 1SBWA 3NXPA 4AFQA 4DGJA 3B9FH 1ANDA 1FN6A 1O5GH 3QWCH 1DPOA 3MFJA 4CHAB 1GMCF 2F9UA 2GGVB 4MG3A 3STIA 4OS2A 3TU7H 1O3HA 4NA8A 2WV4A 3SHAH 5JB8S 1HUTH 2QCYA 4XBBA 1BRUP 1MTWA 2OC1A 4YO9A 4XFQA 1QL8A 3SU5A 1MMJN 5GDSH 4BNRA 3M35A 2W7UA 3ATKA 1O39A 2SGQE 5LPRA 4A1TA 4KKDA 1O2VA 1GBAA 3RXKA 2WUBA 1Y5AT 1OWDA 2VVCA 2BQWB 1MZAA 1O2LA 2TGTA 3KCGH 3HATH 2P95A 1GI2A 1BBRK 4Y76A 1CGIE 3B8JA 3BV9B 1SMFE 2Z3EA 1GJAB 1IQNA 4BTTB 4IGDA 2A4OA 2ZHQH 3SJ8A 1SQOA 4X6OA 1K1NA 2AYWA 4INKA 2FYQA 1LHEH 1G3CA 1AZ8A 1UVUH 1DOJA 2ZA5A 4B75A 1B0EA 2Z9LA 2ZFPH 2HVXA 1ZHMA 2G4UA 1BJUA 1P8VC 3SJOA 3S7KB 1HJ8A 2A4GA 2ZGCA 2XC5A 1TRYA 1L2EA 5DK1A 1BQYA 1KY9A 1P2KA 2BZ6H 3LH3A 1AFQB 5F03A 1EZXC 1JRTA 1ZMNA 5A09A 4ZH8A 3SO3A 4MPWA 1UTOA 1NTPA 4UDWH 3ZZ6A 4X8UH 2F9PA 1GHXH 2G00A 1BHXB 4GLYA 4IMZA 3V7TA 5PTPA 1RIWB 1Z8IB 2C8XB 1MBMA 4IS5A 2ZFTA 2FX4A 2CHAC 3TLOA 3KEEA 2WPHS 3SV8A 4GVUA 5DP7A 4MQAA 2W3IA 1SLXB 4HI3A 3QLPH 4TY6A 4AB9A 6ESTA 4RSPA 1MU6B 1VR1H 2Y81A 4JZEH 1WBGB 3SV2H 1F7ZA 1DXPA 1OPHB 2ZU1A 4LZ4B 1FUJA 2SGEE 1VCWA 1HB0B 1ANBA 1G30B 1EXFA 2QIQA 1F0SA 3MH6A 4JYUH 4AG2A 1TPPA 1C4V2 1C9PA 2WYGA 2A7JA 4FUCA 1TFXA 1Z1JA 4JCNA 1OWJA 1P0SH 1O38A 3T62A 1NFUA 1PPHE 2FESH 2BDHA 2BOKA 4WMEA 2AMPA 4B76A 3BTQE 1IQIA 1ETRH 1G2MA 3ATLA 1UVSH 1GI1A 5CHAC 2V3OH 1HFDA 1QR3E 2BD3A 1ABJH 4FU9A 3LPRA 2VVUA 3LIWA 1ANCA 2ZP0H 3D65E 3ZVEA 1JOUB 3UR9A 2ZHFH 5ESTE 4ZKOU 3V13A 2YOLA 4Y7BA 4I8KA 1LKAA 4X6PA 5EG4A 3PLPA 1BMNH 1AU8A 3A8BA 1KLTA 3RM0H 3ZZ3A 3U9AH 1QIXB 2BDIA 3SU3A 1ELEE 3B23B 1PJPA 2BQ7B 5DP3A 4ZKRU 1MKWH 2BDAA 3GYLB 2C90B 3EAJA 1WTGH 5FPSA 2VB0A 4Y7AA 2ZIQH 1G3EA 1PFXC 2FTMA 4MPVA 1RTFB 4X1NU 5EQQA 1CA0B 2BLVA 1CA8B 1AVWA 4CRFA 5GXPA 3O8RA 3SUGA 3RC5A 1XM1A 3MU1A 2FOHA 1P06A 4I8JA 2B8OH 1GJ9B 1QQ4A 2OC8A 1S83A 1GJ8B 4Y79A 2ZC9H 1KXCA 4CRCA 2W26A 3P17H 5AF9H 1O2ZA 4XOJA 1A46H 1A5HA 4AN7A 2CMYA 3I78A 3ZZ9A 1FZZA 1BRBE 1C5SA 1NT1A 2R0LA 1TA2A 2UUJB 3SNCA 1SGIB 1KIGH 3HGNA 5EPYA 2ZGJA 1ZGVA 5JYIA 1SGFG 3KN2A 1G3DA 2ZDKA 1QRXA 2BDGA 1HJAB 1ZJDA 3Q77A 1GVKB 2P94A 2Z6BD 4JZDH 4OS4A 1VJ9U 1DX5M 3M5OA 1KDQB 2OINA 3MH7A 1F92A 1FY4A 1TNKA 1V2UT 3PMAB 1SGEE 1GI5A 4OS7A 1O3JA 1LCYA 3ZZDA 1EOJA 3PWBA 3HKIB 2A4QA 1OX1A 3N7OA 2FOBA 1NRNH 1GBLA 2EA3A 4D7FA 4I33A 1AUTC 4XBDA 3HPTB 1FY8E 2FOMB 2XBWA 1IHTH 1YBWA 2CGAA 3A81A 4THNH 1GI6A 1TX8A 4NFEA 1O3CA 1IQHA 4YLQH 4H4FA 1PQAA 1V2LT 1DANH 1OWEA 1L1GA 4R8TB 1TMTH 2AGEX 1D3TB 1BHXF 5LH8A 2VIOA 2QXGA 2CN0H 1GHVH 1O5EH 1JXPA 3E8LA 4TPIZ 3Q00A 5GIBA 1MCVA 1OWHA 5A0AE 1AVGH 2GX4A 3O8DA 1HPGA 3S9AA 1EZQA 2PKAA 3R3GB 1FDPA 4BTUB 3EDXB 4WJG2 3RUOA 1NS3A 1P05A 4E7RG 4VGCC 1X7AC 1G2LA 1HV7A 4AYYB 3A8AA 1P9UA 1TALA 4JYVH 2AERH 1ELAA 3OX7U 3LOXA 2B5TB 4YT7H 1A2CH 2H9TH 4JMYA 2FI3E 2GV7A 1KXFA 3BG4C 5EW2H 1C5TA 1ID5H 2OP9A 1P01A 3UOPA 1EPTB 2ZHWH 3K9XB 4M7GA 2FP7B 1O5AB 1J16A 3ZVFA 3KHVA 3RXTA 1TMUH 1GBTA 2J38A 2XRCA 4NWLA 3M61U 1NC6A 1J17T 1UTQA 1N6XA 1C2FA 4I7YH 4CRDA 3RMLH 1V3XA 1T32A 4YOIA 1Z1IA 1RTKA 1FONA 3T29A 1ARCA 1T8OA 4A92A 2GMTC 4X8TH 1EP6A 2Y6TA 1ORFA 5DKMA 1QNJA 3SGBE 1TX6A 1A0JA 1C5NH 1BBRE 3PO1C 4YTAA 1SB1H 4R0IA 5HMAA 1GWAA 3T25A 2EI8A 4AYVB 2OTVA 2GVFA 3ODFA 1O2MA 5J4SA 2Y5HA 2J9NA 3KQDA 4JZIA 2UWOA 1H9LB 1RGQA 4OGXA 1T31A 1UCYH 4PROA 2Q6GA 1E36B 1EASA 1MH0A 2PUXB 5EPNA 2AS9A 4J1YA 4K1TA 3RMMH 1NN6A 3CP7A 3BG8A 4KGAA 1SGRE 3GCHC 2THFB 1P2OA 1XMNB 1ZGIA 2KAIA 5FCKA 2SGFE 2VIQA 2IOTA 1OKXA 2FIRH 4GHTA 1LVBA 3SU4A 1UVOA 2W3KA 1KXBA 2OXSA 2LNCA 1INCA 1W3CA 4XE4A 2FTLE 2VGCB 2WUCA 3K6YA 5EW1H 3F6UH 4FVBA 3RLWH 1QBNA 1C1NA 1H8IH 1JRSA 1FIWA 3UPEA 7GCHG 5FBIA 5HXFA 2GKVE 4BAOB 3DT0H 3OU0A 3RU4E 1J14A 2O8MA 1FI8A 5TJXA 1GCTC 1YPLH 2FOEA 1QL7A 1BIOA 2F9VA 3DD2H 4WVPE 2ZU2A 1GI3A 1OP0A 2VWOA 4AGKA 2XBVA 1N1LA 1VZQH 4HZHA 4RKJB 1V2RT 3A7ZA 3HK6B 2C8ZB 5EXLA 1BA8B 2ZDMA 1C1TA 1F5KU 4ASHA 4DIIH 2A7HA 1IQJA 5T6DA 3MWIU 3EGKH 1P09A 1VGCB 4FUFA 1W0YH 2ILNA 2NU4E 3MTYA 1K1PA 3FAOA 1EJNA 1KXAA 1EB1H 1TOMH 1IQLA 1XXDA 3VB3A 5HM2A 1N8OC 1UK2A 3HKJB 1RTLA 3RXQA 1QFKH 2FPZA 4GPGA 3M5NA 2RG3A 4CRBA 1C5ZB 1TRMA 2WV5A 1WUNH 1GMDG 1TNHA 4X2WA 4ZHMU 3VPKA 3ODDA 4J2YB 3MNSA 1GHAG 1SGNE 4MDSA 1DUEA 4ABGA 1FXYA 3D23A 2TRMA 3T28A 1TOCB 1UK4A 3BTKE 1ELDE 5ESBA 5FBEA 2XC4A 6GCHG 1KTSB 2Z9GA 2ZTZA 4KELA 1UTLM 1YPEH 1KSNA 3VGCB 2BD8A 3WY8A 3KF2A 2V3HH 4JK6A 1D9IA 1ZOMA 1MAXA 1Y59T 1L4DA 3SUFA 2BM2A 2FYRA 3P6ZB 1HAVB 4JK5A 1CHOG 1ETTH 6CHAB 1DFPA 1BUIA 2GDDA 4K3JA 4ZMAH 2CF9H 4BTIB 5AHGH 2HNTF 1J9CH 1UTPA 1ZSLA 2P3UB 3SU2A 1RD3B 4CBOA 2A0QB 1O2NA 3A83A 3IWMA 5DO4H 3CS7A 5GCHG 2ANWA 5C67A 1YPHE 4HGCA 1NZQH 1TIOA 4NA7A 1QB6A 3S9BA 1S81A 1SSXA 1H9HE 2H9EH 3QUMP 4X6MA 2PKSC 1SGTA 1GCDA 2SGAA 3UQVA 1GG6B 1LKBA 1OOKB 2O8WA 3AW0A 3ATMA 2VJ1A 1LHDH 5SGAE 1THRH 5JBTA 3UIRA 4FU7A 2BOHB 1W8BH 2OC0A 1TQ7B 5FPYA 5L6NH 2C93B 1E38B 1BTZA 2ZQ1A 1OP2A 5ETXA 4BAMB 1EX3A 1W11U 1B0FA 1C2MA 2A31A 4X8VH 1UTMA 1BT7A 3KNXA 4Y8XA 2VIVA 2UUYA 1THPB 4Z6AH 5A8YA 1C2DA 3G01A 1F5LA 3GDSA 1P2MA 1AZZA 2FI5E 3AAUA 3MNXA 4WH6A 3P8GA 4BAHB 3C27B 2BD4A 3Q76A 1A3BH 2OC7A 1P02A 3EA9A 1GDNA 1AN1E 2BLWA 3DUXH 1AWFH 1O2GH 2K1QA 1O2QA 1SLUB 1UVPA 2ZHEH 1A3EH 3ZZAA 4K8YA 1O3IA 4U32A 2G5NA 2ULLA 1H9IE 4OS6A 1BRCE 2O9QA 2G8TA 1VCPA 1C9TA 1WU1A 3A7XA 5ABWA 1FPCH 1QBOA 1GVLA 2VINA 3RP2A 2M5TA 3OTJE 1GI8B 3GYMA 2BY5X 2FEQH 4ABJA 1ZJKA 3TNSA 1MTNB 4I8HA 1GBJA 3TIUA 4Q7XA 2CJIA 3RXEA 2ZTXA 2BXUH 3VEQB 4AORA 5IYTA 1DITH 1GBMA 3MU4A 3SHCH 1GBEA 1PQ5A 2QXJA 2BD9A 1H1BA 1A4WH 3AAVA 1CBWC 3KQEA 4O97A 1DWBH 1FAXA 1DWCH 3PB1E 2HPQH 2A5IA 4WMDA 5E8EH 5LPEA 1AI8H 2PWXA 1DDJA 3PMJA 5GJ4B 4B74A 2XBYA 2OCVB 3TGIE 1U6QA 1Y3WA 2A2XH 3D62A 3ITIA 3M5MA 4X1PU 4BAQB 7GCHF 1DICA 1FNIA 3MH4A 3GY8A 3DA9B 2GV6A 1LQEA 1MTSA 1D4PB 5DP9A 1CVWH 1ELFA 4B2CA 3PLBA 3P95A 1NROH 2QXHA 1BDAA 1FIZA 1TNJA 3E6PH 1OYTH 2QN5T 4MTBA 2GCTC 3NKKA 1QRZA 3ZVCA 1SGDE 1BCUH 3LGVA 4UEHH 5DP4A 4ZHAA 1W2KH 1PPBH 1BTYA 3BTFE 3VB7A 3A8DA 4NIVA 4BAKB 2V6NA 1ELGA 1UCYK 1V2TT 1C1UH 3LC3A 3NWUA 1GGDB 2Z7FE 4X1QU 2WPJS 1UTJA 4ZAEA 1QHRB 1P10A 1IOEA 1K28D 4TY7A 2WPIS 3F9EA 4WXIA 3KQCA 3ZVDA 3GISB 1GMDF 2ZU3A 1TABE 1YLCA 4CHAC 1MKXK 2BX4A 1HIAA 1GHAF 2EI6A 1W10U 2BB4A 2SNWA 1RS0A 1YCPM 1EZSC 1O37A 4E7NA 2B0FA 5TCAA 5A0BA 1V2MT 2Y5GA 1CT4E 2AIQA 3MHWU 8ESTE 1DM4B 4GCHG 1DLEA 1ZRBA 1CSOE 2GT7A 3A7YA 3EA8A 4MVNA 1SGQE 3SJIA 2R3UA 5L2YH 2TPIZ 5JBCS 4ZROA 4UFEH 2BVRH 1HXFH 1L4ZA 1WV7H 2XCNA 3FANA 8GCHG 1V2ST 2JH5D 1GBDA 3IG6B 3I77A 1XX9A 5EQSA 5I46H 2ZG0H 3SGQE 3TK9A 2ZHDA 1D3DB 3GDUA 1O2KA 1O3BA 2VWNA 2ZF0H 4RN6A 4X8SH 3ZYDA 3M3TA 4FUBA 2V0BA 3BF6H 5HYOA 1GI4A 2C4FH 5BRRE 1FPHH 4XSKU 2F9NA 3M7UA 2CV3A 4DT7B 4CBNA 3S7HB 1AFQC 2ZGXH 1VITG 1TGCA 4H6TA 1PPZA 1IQMA 5EOKA 4ZHLU 2GD4B 1A0LA 2ASUB 3OSYA 4Y8ZA 1DWDH 1RIWC 1EPTA 1HDTH 3BG4B 1NFYA 4ISHH 2D2DA 3MO6A 2ZCHP 2FM2A 2FZZA 4SGBE 4ABAA 4Y10E 2HWLB 1O5CB 3GDVA 3W94A 2XNIA 5E0HA 3E16B 3TJNA 3A89A 1FJSA 2R2WU 2D26C 2P16A 4U2WA 1LHFH 2P93A 1ELVA 1S0RA 3QGJA 1RXPA 2BLQA 2W7SA 3CENA 3H7OA 1NM6A 1VCQA 5AVDA 3GCTF 3SNBA 5JBAS 1GBCA 1UHBB 3MU0A 3OYPA 1HGTH 4O3UA 1J8AA 2SNVA 1Q2WA 1QA0A 2A7CA 3FVFB 3LH1A 3LJOA 3PO1B 2VWMA 1O5DH 5FX6A 1ELTA 4X2YA 1H8DH 1YPKH 1K9OE 1GHBG 5B6OA 4LZ1H 1S6HA 1Z8GA 4H6SB 2ZPQA 1OS8A 1CGJE 1HJ9A 7LPRA 4I8LA 3A7TA 1TYNA 1TMBH 4Q80A 1NRQH 1IQKA 4WWYA 1O32A 2G4TA 2IN2A 5AFZH 3SNAA 4GAWA 3I29A 3ZVBA 1MCTA 1QJ7B 1W14U 1WQSA 1ZTKA 5EGMA 3ZV9A 1PPEE 3D49H 4D9QA 1NPMA 2NU1E 3RXOA 1GL1A 5FAHA 5A2MH 1YCPK 1XUIA 2R3YA 3UWIA 1O2HA 4KTUA 1O2UA 1P04A 2J94A 2TGDA 4O3TA 4YLUA 4IW4E 1O2YA 4FVDA 1C1QA 3ZZ7A 3SNEA 4Y6DA 3U8TH 1V2PT 3MH5A 3TPIZ 1GHYH 3SU6A 1AGJA 2FS8A 4IN1A 1ETSH 4DIHH 1YPMH 4MLFB 3BTEE 3STJA 1MAYA 2PW8H 1NESE 1KLIH 2Q6DA 1CA0C 4YZUA 2QYIA 2JETC 1Z7KA 4HFPB 3SW2B 3E1XB 1SHYA 2RA0A 5BPEA 1AO5A 1C1WH 4IN2A 2Z3DA 5T3HA 1P12E 3PMBB 1P9SA 2B9LA 1BTXA 1NFWA 3M37A 2BY7X 2P8OC 4D76A 3K65B 2WPKS 1MUEB 4U30A 5EXNA 4ABFA 5A0CA 3MI4A 3U69H 1PYTD 1B5GH 1V2KT 3RU4T 2FXRA 1V2VT 3BSQA 3LJJA 4WF8A 3RXGA 2AFQB 3Q3KA 4B1TA 1HJAC 1C1PA 1DT2A 3LC5A 3A86A 5F8XA 1P11E 4FUJA 1GBHA 1Z71A 3QX5H 5I25A 3M3SA 1AB9C 1N8OB 1W0ZU 1D6WA 2BY6X 2FODA 1XUJA 5E0GA 2XC0A 1OWIA 1EAWA 5A8XA 2HRVA 2OD3B 4Y0YE 1DVAH 2GZ8A 3TH4H 2WYJA 1JIMA 1QA7A 1O3GA 2TBSA 1AQ7A 2D1JA 3ZYEA 2BMGB 1HCGA 1SI5H 2SFAA 3SV6A 4XBCA 1BOQA 1TBZH 1CE5A 1FAKH 1BZXE 1O2OA 2A5KA 3RXRA 2ESTE 5DPAA 1SQTA 3ZVAA 1GBBA 3QZRA 1JMOH 3RLYH 2HLCA 1V2WT 3K6ZA 3NPSA 1TONA 1O3NA 2F3CE 5F6MA 1H4WA 3MU5A 2ZZUH 1THSH 2OUAA 2O8TA 1IQFA 4ISIH 1FMGA 2AGIX 1RRKA 1AKSB 1YC0A 2A5AA 2O8LA 4NZLA 1SQAA 3ELAH 1P2QA 1P2JA 5CE1A 2VIDA 5C1XA 1HLTH 1E37B 5G4BA 2ZFQH 2QXIA 2ZI2H 2GZ7A 1LTOA 1RFNA 1LPKB 3BIVH 5C1YA 1OWKA 2B7DH 4WY3A 1NRRH 3QGNB 3MNCA 4YT6H 1XUFA 2I6SA 2J95A 2PKAB 2ZU4A 4F4OC 2PKSB 1P57B 1IAUA 3QK1A 3GCNA 4DJZB 3RXDA 1C2LA 1GI0A 2R9PA 2FMJA 1UCYE 2HNTC 1VITF 2DE9A 5C5OA 3SNDA 2Z3CA 4Q7YA 3QO6A 1EPTC 2AIPA 1GJCB 1C2HA 4K8BA 5E0JA 4BXWA 2AGGX 3PM3A 1C5UA 5C1UA 3MNBA 5C5NA 2OLGA 3A7WA 1PQ8A 4AFSA 1O2IA 3URDA 3UTUH 5FPTA 3HK3B 4NSVA 1S84A 1TGNA 1YF4A 4ZXYH 3M3VA 1DSTA 5FCRA 1AE8H 1FN8A 2ANMH 3SV7A 4TWWA 1PPFE 1C1OA 2OQUA 1XKBC 3FFGA 1EATA 1EJMA 2BDBA 1AUJA 4K69A 4B71A 3KGPA 3U8OH 1MKWK 2JKHA 4BXSA 1TB6H 1TE0A 3KL6A 3UQOA 1BTUA 1UTKA 1HAXB 3GCOA 3RXSA 1GDQA 1Q3XA 3V3MA 1Y5UT 1O2RA 3VXEH 1QB9A 2ZDLA 3RMNH 2Z9IA 1F5RA 2BDCA 1OXGA 4JZFH 1CGHA 1C2GA 4WMFA 2BZAA 3BTDE 4NCYA 4Z0KA 3TITA 2AEIH 2EC9H 2G81E 2QGRA 4IBLH 2H2ZA 4IC5A 1N6YA 4QT8C 1K1MA 3GICB 1O3KA 2ZGHA 1GBFA 3LKWA 1O3LA 1CO7E 1O2JA 3UWJH 2YNBA 4KP0A 1C5OH 4K2YA 1T7CA 2VIPA 4A5TS 2VH0A 3ZZCA 7KMEH 2WPLS 1HAYB 3RXAA 1KYNA 1C1VH 3R0FA 3ENSB 1QTFA 2VGCC 3QN7A 1W7XH 4AG1A 4ABDA 3E0NB 1O3AA 3SUEA 4UFGH 4ISLA 2XW9A 2ZU5A 3UREA 1SG8B 1G9IE 2G55A 3EQ0H 1G3BA 3V0XA 3RXBA 2HALA 2JH0D 3VB5A 5LGOA 4FXGH 2Z9KA 1ZPCA 1HBTH 2CHAB 3V12A 4DOQA 4DW2U 4Y8YA 3DFLA 2FX6A 1GI9B 1EJAA 1LHGH 1O2TA 1FY3A 2GCTB 2ZPSA 4INLA 1EOLA 1EAIA 2ZECA 2ZFFH 1E35B 4H42U 3EYDA 3RC6A 1ZMJA 3LGUA 4MPXA 2H5DA 2C8WB 4UD9H 1TGTA 1D3PB 2Z9JA 2FI4E 2AH4X 3GY5A 2F9BH 3RXIA 2F9OA 3H7TA 4INHA 1YGCH 1SGPE 1QJ1B 3MO9A 3TNTA 2STBE 3BTME 3M7TA 1V2QT 2BX3A 2V35A 4U01A 4UFFH 1ZSJA 2JH6D 3S69A 3LDXH 1L0ZA 4GUXA 3BN9A 4BOHA 1C5XB 2BQ6B 1NRPH 3UNQA 3SI3H 1O2PA 2RCEA 5CHAB 5FX5A 1LDTT 3RMOH 5K7RA 3TJVA 1ZTJA 1A1RA 2TIOA 1HAOH 2ZFRH 5E2OA 2I6QA 2BVSH 1OSSA 3VGCC 1F0TA 3T5FH 3SUDA 3SI4H 4X6NA 2ZCLP 5DGJA 3TJOA 1MD8A 1XVOA 1DY9A 3F9HA 1ZRKA 2DE8A 2FS9A 2F91A 2QF0A 1NO9H 4TYDA 1JIRA 4NSYA 6CHAC 1NRSH 1KLJH 3PWCA 2AMQA 5JBBS 1O33A 1TQ0B 5DP5A 1C5PA 4FUIA 3UOUA 1AVXA 1QRWA 1XXFA 4FUGA 2PV9B 1P03A 1JBUH 3RXJA 4OS1A 4DG4A 5EXMA 2ZKSA 1AD8H 3JZ2B 3RDZA 1UVTH 2FO9A 3SU0A 3S0NA 2WINI 1P2NA 1E0FD 3F1SB 3L6PA 3C1KA 1A5GH 1KXDA 2R2MB 1SLVB 3RXCA 1S82A 1O31A 2Y7XA 5C2ZA 1ZHPA 1DE7H 1TWXB 1GG6C 2VNTA 1GJ7B 5EQRA 1XUHA 2OBOA 3LGIA 3VB6A 5EU8A 2PSXA 4CRGA 3ZV8A 4LOYH 4AX9H 3NK8A 1G37A 2SGPE 2YNAA 1MQ5A 4AGJA 1S0QA 3NZIA 2ZWLH 2SGDE 4E05H 1XVMA 4KTCA 2EI7A 4AB8A 4FUDA 1RJXB 1T4UH 4TWYA 1BMMH 1O3EA 1TLDA 2P3TB 1LVMA 3KQBA 1K2I1 3O8CA 2CF8H 4GSOA 5TCCA 1FY1A 1LO6A 1KDQA 4K5ZA 2PLXA 1UHBA 2BDYA 4ZXXH 3SGAE 2QAAA 3NUMA 3FP7E 2IJOB 1UK3A 8KME2 1QGFA 5DG6A 4UFDH 4B73A 2BD7A 2BVXH 1C5RA 1SHHB 4X2VA 2NU0E 4Q2KA 3U98H 6GCHF 1C2EA 1ARBA 1ZSKA 4MNYA 4NWKA 2VIWA 1SGFA 2VU8E 3BEUA 1KTTB 2FOAA 4DURA 3FZDA 4KTSA 1XUGA 1HAZB 4ZUHA 1K22H 2ANKH 3E0PB 1S5SA 1YP9A 2UUKB 4Y11E 1CHOF 3QTVH 1MTNC 3E3TA 1O3MA 3FZZA 1ESBA 2TGPZ 3F9GA 3S9CA 2FDAA 5DJ7A 5C20A 5E2PA 3K2UA 4DCDA 3BEIB 1BB0B 2PTNA 2W5EA 2ZQ2A 2HPPH 2C8YB 3ATWA 4FUHA 3TGKE 2UUFB 2BD2A 4MNWA 1ABIH 1M9UA 4O03A 2EEKA 4I8GA 5GCHF 4D8NA 1GJDB 4DVAU 1EB2A 1O34A 5DP8A 4VGCB 3SQHE 2A45B 2ZTYA 1HAPH 2GP9B 1BMAA 1MQ6A 1MD7A 3VXFH 3E91A 1O2WA 3P8OA 1SFQB 1BJVA 4O9VA 2JETB 3SJKA 5C3NA 1GL0E 1F2SE 1EQ9A 1TBRH 2VWLA 3BTTE 3TH3H 4BANB 3TH2H 1GJBB 1QQUA 1GHZA 3SQEE 3ZVGA 3F68H 1SL3A 3EE0B 1C1SA 4JYTA 4ABBA 3U8RH 1K1IA 2ZDVH 1D6RA 1SR5C 4X1SU 1CQQA 2STAE 1AY6H 2P8OB 3TGJE 3RM2H 2NU3E 1VJAU 2H1UA 1TRNA 2FOGA 6LPRA 4X1RU 5T6GA 3M5LA 5H4IB 5GWZA 1HAIH 2FWWA 2Y7ZA 1LQDB 1AFEH 1PYTC 2XTTB 2ZGBH 2XXLA 2ZCKP 2GMTB 1K21H 2BYAX 3A85A 3MU8A 2ZNKH 1LHCH 1MTUA 1F0UA 1V2JT 3TK5A 2HGTH 1C2IA 4IMQA 2GT8A 2VVVA 2ODPA 5DP6A 2ALVA 1TPSA 4B2BA 1ZYOA 5L2ZH 1GGDC 3BTWE 1AB9B 2BLOA 2IPHA 4AOQA 1WTHD 7ESTE 1YPGH 2CXVA 3ZZ8A 4D7GA 1NY22 2QC2A 1TX7A 1V2OT 1TNIA 2ZPRA 1LVYA 1GMHG 2GCHG 2ODYB 3F9FA 3CS0A 1GVZA 1HIAB 2C3SA 1GI7B 2H9HA 2GZ9A 1T4VH 1GBIA 2G51A 1E34B 1QURH 3QZQA 4K1SA 3DHKH 1YLDA 1IQGA 1SGCA 1OYQA 2Y5FA 3GCHB 3EA7A 1FLEE 2QA9E 1C5MD 1A7SA 3PTBA 1L1JA 3KIDU 5JB9S 2Z94A 3NCLA 1C5VA 3BIUH 2BY9X 3GY4A 1HAHH 1AKSA 1GJ5H 1C4U2 1DY8A 1DXWA 4IC6A 1Z8JB 2A4RA 3RXPA 3A87A 3RXLA 4ABEA 4NIWA 3Q3YA 1SOZA 4FU8A 1FY5A 2WPMS 1UTNA 2R0KA 4GHQA 4XDEA 2LPRA 3W95A 3L33A 1T8NA 1C5WB 2QV1A 2PGQB 4CR9A 1HXEH 3UNSA 3A84A 1ZR0A 3SBKA 1Q31A 2FOFA 5F8ZA 5FHTA 1BBRH 4Y71A 1C1RA 1EKBB 3ESTA 2PR3A 2HOBA 1Y8TA 1A61H 4X2XA 1C1MA 3MO3A 1EP5A 4NFFA 1TPAE 2XBXA 3ZZBA 2ODQA 1GCTB 3VB4A 1Z8RA 2A1DB 1A0HB 5L30H 4NZQA 1XUKA 1Y5BT 3M7QA 1GJ6A 1NFXA 1MBQA 4CH8B 1B7XB 2Y82A 1DS2E 1AWHB 1IHSH 3SV9A 2GTBA 3SOSA 1YPJH 4A1VA 1F0RA 3P70B 3ATIA 1YKTA 1HRTH 5HGGA 3BEFB 2A2QH 1QY6A 1W12U 3QDZB 1L1NA 1O36A 1HYLA 1P3EA 2ALPA 1K1LA 1K1OA 1QJ6B 1BTPA 4X0WU 5K0HA 4D9RA 4OS5A 1Y3UA 3RXVA 2NWNA 1T8MA 2XCFA 1GMCG 1G36A 1GBKA 4WH8A 2F83A 1BTWA 1TBQH 1O3PB 1GHWH 1PPGE 2AMDA 3MOCA 3TJUA 1BMLA 2ZDAH 2A32A 4MPUA 5J4QA 3JZ1B 4ABIA 1O5BB 1G32B 1P3CA 3DFJA 2J34A 1VITH 1DWEH 2QF3A 2PSYA 4MNXA 5JPMH 3QTOH 5A8ZA 4AFZA 1ESAA 1HAVA 1PQ7A 2DUCA 1GJ4H 2G52A 4GCHF 2BHGA 3L3TA 3A8CA 1SLWB 1ZLRA 3T26A 4LXBH 1Y3YA 1KXEA 1TGBA 3Q3XA 1AHTH 3UNRA 4ZKNU 1FQ3A 1HAGE 2ZDNA 2BXTH 1UMAH 4NG9H 2XWBI 1EUFA 3AASA 3HGPA 3AVZA 1EZUC 1DUAA 8GCHF 4ABHA 1A5IA 1AE5A 1S6FA 1MKXH 2P59A 3LT3A 1QBVH 5F8TA 1HNEE 3LU9B 4ESTE 3E90B 3SZNA 3ZZ5A 1EAUA 1ACBE 2J2UA 3GY2A 2ZFSA 3UR6A 5EODA 2BY8X 1AIXH 5GPIB 1UJ1A 1V2NT 1QL9A 1WAYB 2UWPA 3BTHE 4B2AA 4CRAA 1ELCA 4NA9H 1ELBA 1JWTA 4OGYA 2OQ5A 1MU8B 3FP8E 4MNVA 1O3FA 1PPCE 1CT0E 1DSUA 1SFIA 3P8FA 3LONA 3U1IB 1Y3VA 4TPYA 5T6FA 1O2XA 5LPFA 1GDUA 3BTGE 1W7GH 1ZZZA 1QB1A 3PTNA 3A82A 2RDLA 1WOFA 1BTHH 1C2KA 1NU9A 3RXFA 2BTCE 1LVOA 1WYKA 1QCPA 1K1JA 3A80A 3SJ9A 1ESTA 1C4Y2 3MYWA 2XYAA 3SU1A 2ZEBA 3LGYA 4YESB 4HTCH 1YM0A 3PLKA 4LK4A 3UFAA 1YPHC 3SN8A 3RXHA 4WXVA 3VFEA 4CREA 4E06H 1ZTLA
chains in the Genus database with same CATH superfamily
3PYHA 5HKKD 3AW1A 1C5LH 4UE7H 1O0DH 1TA6A 3PV4A 3RU4D 1BRAA 9LPRA 4AFUA 1O35A 3RXMA 1P2IA 3TK6A 1OP8A 5IDKA 2OBQA 2PGBB 3A88A 1CHGA 3TVJB 1TPOA 2GDEH 2FLRH 1GHBF 4I31A 3U1JB 2PTCE 2FOCA 1WQVH 1C5YB 1W13U 4I32A 1CT2E 4RKOB 1XKAC 4CR5A 4JZ1A 4ZKSU 2NU2E 1AMHA 4YM9A 2Q1JA 3GOVB 1GPZA 1UO6A 3FP6E 4UONA 1GMHF 3OY6U 3LGWA 1Y3XA 2GCHF 2HNTE 4RI0A 3GY3A 4Q7ZA 5CMXH 1TNLA 2KM0A 3OY5U 5AFYH 1FV9A 2PUQH 4NGAH 2Q6FA 2RFKC 3T2NA 2KAIB 1ZMLA 3SORA 2D8WA 4YOGA 3P92A 3A7VA 1MZDA 1SVPA 3LGTA 4SGAE 4Y0ZE 3RXUA 1CBWB 2PFEA 4RT1A 1J15A 2UWLA 1TAWA 2BD5A 2TGAA 3P8NA 1LMWB 4FETA 1O2SA 2G5VA 1DLKB 4XRNA 1WSSH 1ZHRA 2H5CA 4K60A 8LPRA 1O30A 4K1EA 1SC8U 2ANYA 1ZPZA 2WHXA 1Z6EA 5FXLA 5EJ1A 4NIYA 3T27A 3UUZA 2O8UA 3MMGA 1BITA 1TGSZ 2PHBA 1YYY1 2EY4C 4A1XA 2Y80A 1Z6JH 4ISNA 1O5FH 1WDIA 1YCPH 1S85A 1MTVA 1T8LA 3URCA 3IITA 2J92A 5HM9A 2KCAA 3WW7A 1C5QA 1C2JA 1CU1A 2H6MA 1NU7B 1SGYE 4NIXA 2L6OA 3M36A 2RA3A 4FUEA 3H5CB 5JDUB 1O3OA 1WCZA 1V6DA 1SOTA 2FLBH 1ZPBA 3PMHB 1ANEA 2VH6A 4DY7B 1VGCC 2P3FH 3PROA 1LPZB 2QY0B 9ESTA 5IK2D 3RC4A 2J4IA 1D3QB 1SPJA 1IQEA 3UY9A 4ISOA 3O8BA 2ZO3H 1TNGA 4A6LA 3GY7A 3GCTG 1O3DA 4A7IB 4CH2B 4F49A 2XWAA 3GY6A 4YOJA 1LPGB 4AZ2B 1EAXA 3ZZ4A 1SBWA 3NXPA 4AFQA 4DGJA 3B9FH 1ANDA 2JJ1D 1FN6A 1O5GH 3QWCH 1DPOA 2QF5A 3MFJA 4CHAB 1GMCF 2F9UA 2GGVB 4MG3A 3STIA 4OS2A 3TU7H 1O3HA 4NA8A 2WV4A 3SHAH 5JB8S 4ACAA 1HUTH 2QCYA 4XBBA 1BRUP 1MTWA 2OC1A 4YO9A 4XFQA 1QL8A 3N7DA 3SU5A 1MMJN 5GDSH 4BNRA 3M35A 2W7UA 3ATKA 1O39A 2SGQE 5LPRA 4A1TA 4KKDA 1O2VA 1GBAA 3RXKA 2WUBA 1Y5AT 1OWDA 2VVCA 2BQWB 1MZAA 1O2LA 2TGTA 3KCGH 3HATH 2P95A 1GI2A 1BBRK 4Y76A 1CGIE 3B8JA 3BV9B 1SMFE 2Z3EA 1GJAB 1IQNA 4BTTB 4IGDA 2A4OA 2ZHQH 3SJ8A 1SQOA 4X6OA 1K1NA 2AYWA 4INKA 2FYQA 1LHEH 1G3CA 1AZ8A 3OAAD 1UVUH 1DOJA 2ZA5A 4B75A 1B0EA 1QZ8A 2Z9LA 2ZFPH 2HVXA 1ZHMA 2G4UA 1BJUA 1P8VC 3SJOA 3S7KB 2V3MA 1HJ8A 2F4LA 2A4GA 2ZGCA 2XC5A 1TRYA 1L2EA 5DK1A 1BQYA 1KY9A 1P2KA 2BZ6H 3LH3A 1AFQB 5F03A 1EZXC 1JRTA 1ZMNA 5A09A 4ZH8A 3SO3A 4MPWA 1UTOA 1NTPA 4UDWH 3ZZ6A 4X8UH 2F9PA 1GHXH 2G00A 3OE7D 1BHXB 4GLYA 2LP6A 4IMZA 3V7TA 5PTPA 1RIWB 5EJLA 1Z8IB 2C8XB 1MBMA 4IS5A 2ZFTA 2FX4A 2CHAC 3TLOA 3KEEA 2WPHS 3SV8A 4GVUA 5DP7A 4MQAA 2W3IA 1SLXB 4HI3A 3QLPH 4TY6A 4AB9A 6ESTA 4RSPA 1MU6B 1VR1H 2Y81A 4JZEH 1WBGB 3SV2H 1F7ZA 1DXPA 1OPHB 2ZU1A 4LZ4B 1FUJA 2SGEE 1VCWA 1HB0B 1ANBA 1G30B 1EXFA 2QIQA 1F0SA 3MH6A 4JYUH 4AG2A 1TPPA 1C4V2 1C9PA 2WYGA 2A7JA 4FUCA 1TFXA 1Z1JA 3VG8A 4JCNA 1OWJA 1P0SH 1O38A 3T62A 1H8HD 1NFUA 1PPHE 2FESH 2BDHA 2BOKA 4WMEA 2AMPA 4B76A 3BTQE 1IQIA 1ETRH 1G2MA 3ATLA 1UVSH 1GI1A 5CHAC 2V3OH 1HFDA 1QR3E 2BD3A 1ABJH 4FU9A 3LPRA 2VVUA 3SYJA 3LIWA 1ANCA 2ZP0H 3D65E 2J5UA 1JOUB 3ZVEA 3UR9A 2ZHFH 5ESTE 4ZKOU 3F2GA 4AC9A 3V13A 2YOLA 4Y7BA 5HIYA 4I8KA 1LKAA 4X6PA 5EG4A 3PLPA 1BMNH 1AU8A 3A8BA 1KLTA 3RM0H 3ZZ3A 3U9AH 1QIXB 2BDIA 3SU3A 1ELEE 3B23B 1WXRA 1PJPA 3OFND 2BQ7B 5DP3A 4ZKRU 1MKWH 2BDAA 3GYLB 2C90B 3EAJA 5KECA 1WTGH 5FPSA 2VB0A 4Y7AA 2ZIQH 1G3EA 1NBME 1PFXC 2FTMA 4MPVA 1RTFB 4X1NU 5EQQA 1CA0B 2BLVA 1CA8B 1AVWA 4CRFA 5GXPA 3O8RA 3SUGA 3RC5A 1XM1A 3MU1A 2FOHA 4ASUD 1P06A 4I8JA 2B8OH 1GJ9B 1QQ4A 2OC8A 1S83A 1GJ8B 4Y79A 2ZC9H 1KXCA 4CRCA 2W26A 3P17H 5AF9H 2VBCA 1O2ZA 3MQKC 4XOJA 1A46H 1A5HA 4AN7A 2CMYA 3I78A 2XOKD 4YXWD 3ZZ9A 3SZEA 1FZZA 1BRBE 1C5SA 1NT1A 2R0LA 1TA2A 2UUJB 3SNCA 1SGIB 1KIGH 3HGNA 5EPYA 2WSSD 2ZGJA 1ZGVA 5JYIA 1SGFG 3KN2A 1G3DA 2ZDKA 1QRXA 2BDGA 1HJAB 1ZJDA 2W6ID 3Q77A 1GVKB 2P94A 2Z6BD 4JZDH 4OS4A 1VJ9U 1DX5M 3M5OA 4P00A 1KDQB 2OINA 3MH7A 1F92A 1FY4A 1TNKA 1V2UT 3PMAB 1MABB 1SGEE 1GI5A 4OS7A 1O3JA 1LCYA 3ZZDA 1EOJA 3PWBA 3HKIB 2A4QA 1OX1A 3N7OA 2FOBA 1NRNH 1GBLA 2EA3A 4D7FA 4I33A 1AUTC 4XBDA 3HPTB 1FY8E 2FOMB 2XBWA 1IHTH 1YBWA 2CGAA 3A81A 4F48B 4THNH 1GI6A 1TX8A 4NFEA 1O3CA 1IQHA 4YLQH 4H4FA 1PQAA 1V2LT 1DANH 3DSPA 1OWEA 1L1GA 1SQRA 4R8TB 1TMTH 2CK3D 2AGEX 1D3TB 1BHXF 5LH8A 2VIOA 2QXGA 2CN0H 1GHVH 1O5EH 1JXPA 3E8LA 4TPIZ 3Q00A 5GIBA 1MCVA 1OWHA 5A0AE 1AVGH 2GX4A 3O8DA 1HPGA 3S9AA 1EZQA 2PKAA 3R3GB 1FDPA 4BTUB 3EDXB 4WJG2 3RUOA 1NS3A 1P05A 4E7RG 4VGCC 1X7AC 1G2LA 1HV7A 4AYYB 3A8AA 1P9UA 1TALA 4JYVH 2AERH 1ELAA 3OX7U 3LOXA 2B5TB 4YT7H 1A2CH 2H9TH 4JMYA 2FI3E 2GV7A 1KXFA 3BG4C 5EW2H 1C5TA 5F53A 1ID5H 2OP9A 1P01A 3UOPA 1EPTB 2ZHWH 3K9XB 4M7GA 2FP7B 1O5AB 1J16A 3ZVFA 3KHVA 3RXTA 1TMUH 1GBTA 2J38A 2XRCA 4NWLA 3M61U 1NC6A 1J17T 1UTQA 1N6XA 1C2FA 4I7YH 4CRDA 3RMLH 1V3XA 1T32A 4YOIA 1Z1IA 4I86A 1RTKA 1FONA 3T29A 1ARCA 1T8OA 4A92A 4B6EA 2GMTC 4X8TH 3DCLA 1EP6A 2Y6TA 1ORFA 5DKMA 1QNJA 3SGBE 1TX6A 1A0JA 1C5NH 1BBRE 3PO1C 4YTAA 1SB1H 2GJGA 4R0IA 1GWAA 5HMAA 3T25A 2EI8A 4AYVB 2OTVA 2GVFA 3ODFA 1O2MA 5J4SA 2Y5HA 2J9NA 3KQDA 4JZIA 2UWOA 3WWFA 1H9LB 1RGQA 4OGXA 1T31A 1UCYH 3FOAA 4PROA 2Q6GA 1E36B 1EASA 1MH0A 2PUXB 5EPNA 3FO8D 2AS9A 4J1YA 4K1TA 3RMMH 1NN6A 3CP7A 3BG8A 4KGAA 1SGRE 3GCHC 2THFB 1P2OA 1XMNB 1ZGIA 2KAIA 5FCKA 2SGFE 2VIQA 2IOTA 1OKXA 2FIRH 4GHTA 1LVBA 3SU4A 1UVOA 2AHME 2W3KA 1KXBA 2OXSA 2LNCA 1INCA 1W3CA 4XE4A 2FTLE 2VGCB 2WUCA 3K6YA 5EW1H 3F6UH 4FVBA 3RLWH 1QBNA 1C1NA 1H8IH 1JRSA 2KFWA 1FIWA 3UPEA 7GCHG 5FBIA 5HXFA 3PRDA 2GKVE 4BAOB 3DT0H 1E79D 5C0TA 3OU0A 3RU4E 1J14A 2O8MA 1FI8A 5TJXA 1GCTC 1YPLH 1OHHD 2FOEA 1QL7A 1BIOA 2F9VA 3DD2H 4WVPE 2ZU2A 1GI3A 1OP0A 2VWOA 3EE7A 4AGKA 2XBVA 1N1LA 1VZQH 4HZHA 4RKJB 1V2RT 3A7ZA 3HK6B 2C8ZB 5EXLA 1BA8B 2ZDMA 1C1TA 1F5KU 4ASHA 4DIIH 2A7HA 1IQJA 3FKSD 5T6DA 5HIZA 3MWIU 3EGKH 1P09A 1VGCB 4FUFA 1W0YH 2ILNA 2NU4E 3MTYA 1K1PA 5FL7D 3FAOA 1EJNA 1KXAA 1EB1H 1TOMH 1IQLA 1XXDA 3VB3A 5HM2A 1N8OC 1UK2A 3HKJB 1RTLA 3RXQA 1QFKH 2FPZA 4GPGA 3M5NA 2RG3A 4CRBA 1C5ZB 1TRMA 2WV5A 1WUNH 1GMDG 1TNHA 4X2WA 4ZHMU 3VPKA 3ODDA 4J2YB 5KEDA 3MNSA 1GHAG 1UW7A 1SGNE 4MDSA 3UB0A 1DUEA 2J98B 4ABGA 1FXYA 3D23A 2TRMA 3T28A 1TOCB 1UK4A 3BTKE 1ELDE 5ESBA 5FBEA 2XC4A 6GCHG 1KTSB 2Z9GA 2ZTZA 4KELA 1UTLM 1YPEH 1KSNA 3VGCB 2BD8A 3WY8A 5CDFE 3KF2A 2V3HH 4JK6A 1D9IA 1ZOMA 1MAXA 1Y59T 1L4DA 3SUFA 2BM2A 2FYRA 3P6ZB 1HAVB 4JK5A 1CHOG 1ETTH 6CHAB 1DFPA 1BUIA 2GDDA 4K3JA 4ZMAH 2CF9H 4BTIB 5AHGH 2HNTF 1J9CH 1UTPA 1ZSLA 2P3UB 2YMSB 3SU2A 1RD3B 4CBOA 2A0QB 1O2NA 3A83A 3IWMA 5C94A 5DO4H 3CS7A 5GCHG 4FOUC 2ANWA 5C67A 1YPHE 4HGCA 1NZQH 1TIOA 4NA7A 1QB6A 3S9BA 1S81A 1SSXA 1H9HE 2H9EH 3QUMP 4X6MA 2PKSC 1SGTA 1GCDA 2SGAA 3AK5A 1GG6B 3UQVA 1LKBA 1OOKB 2O8WA 3AW0A 3ATMA 2VJ1A 1LHDH 5SGAE 1THRH 5JBTA 3UIRA 1VKYA 4FU7A 2BOHB 1W8BH 2OC0A 1TQ7B 2K8IA 5FPYA 5L6NH 2C93B 1E38B 1BTZA 2ZQ1A 1OP2A 5ETXA 4BAMB 1EX3A 1W11U 1B0FA 1C2MA 2A31A 4X8VH 1UTMA 1BT7A 3KNXA 4Y8XA 2VIVA 2UUYA 1THPB 4Z6AH 5A8YA 1C2DA 3G01A 1F5LA 2WZQA 3GDSA 1P2MA 1AZZA 2FI5E 3AAUA 3MNXA 4WH6A 3OEHD 3NRLA 3P8GA 4BAHB 3C27B 2BD4A 3Q76A 1A3BH 2OC7A 1P02A 3EA9A 1GDNA 1AN1E 2BLWA 3DUXH 1AWFH 1O2GH 2K1QA 1O2QA 1SLUB 1UVPA 2ZHEH 1A3EH 3ZZAA 4K8YA 1O3IA 4U32A 2G5NA 2ULLA 1H9IE 4OS6A 1BRCE 2O9QA 2G8TA 1VCPA 1C9TA 1WU1A 3A7XA 5ABWA 1FPCH 1QBOA 1COWD 1GVLA 2VINA 3RP2A 2M5TA 3OTJE 1GI8B 3GYMA 2BY5X 3F0OA 2FEQH 4ABJA 1ZJKA 3TNSA 1MTNB 1YY3A 4I8HA 1GBJA 3TIUA 4Q7XA 2CJIA 3RXEA 2ZTXA 2BXUH 3VEQB 4AORA 5IYTA 1DITH 1GBMA 5DSFA 3MU4A 3SHCH 1GBEA 1PQ5A 2QXJA 2BD9A 1H1BA 1A4WH 3AAVA 1CBWC 3KQEA 4O97A 1DWBH 1FAXA 1DWCH 3PB1E 2HPQH 2A5IA 4WMDA 5E8EH 5LPEA 1AI8H 2PWXA 1DDJA 3PMJA 5GJ4B 4B74A 2XBYA 2OCVB 3TGIE 1U6QA 1Y3WA 2A2XH 3D62A 3ITIA 3M5MA 4X1PU 4BAQB 7GCHF 1DICA 1FNIA 3MH4A 3GY8A 3DA9B 2GV6A 1LQEA 1MTSA 1D4PB 5DP9A 2IPQX 1CVWH 1ELFA 4B2CA 3PLBA 3P95A 1NROH 2QXHA 1BDAA 1FIZA 1TNJA 3E6PH 1OYTH 2QN5T 4MTBA 2GCTC 3NKKA 1QRZA 3ZVCA 1SGDE 1BCUH 3LGVA 4UEHH 5DP4A 4ZHAA 1W2KH 1PPBH 1BTYA 3BTFE 3VB7A 3A8DA 4NIVA 4BAKB 2V6NA 1ELGA 1UCYK 1V2TT 1C1UH 3LC3A 3NWUA 1GGDB 2Z7FE 4X1QU 2WPJS 1UTJA 4ZAEA 3KQ5A 1QHRB 1P10A 1IOEA 1K28D 4TY7A 2WPIS 3F9EA 1SKYE 4WXIA 3KQCA 3ZVDA 3GISB 1GMDF 2ZU3A 1TABE 1YLCA 4Q4LA 4CHAC 1MKXK 2BX4A 1S6LA 1HIAA 1GHAF 2EI6A 1W10U 2BB4A 2SNWA 1RS0A 1YCPM 5EIYA 1EZSC 1O37A 4E7NA 2B0FA 5TCAA 3U28C 5A0BA 1V2MT 2Y5GA 1CT4E 2AIQA 3MHWU 8ESTE 1DM4B 4GCHG 1DLEA 1ZRBA 1CSOE 2GT7A 3A7YA 3EA8A 4MVNA 1SGQE 1E1QD 3SJIA 2R3UA 3GS9A 5L2YH 2TPIZ 5JBCS 4ZROA 4TSFD 4UFEH 2BVRH 1HXFH 1L4ZA 1WV7H 2XCNA 3FANA 8GCHG 1V2ST 2JH5D 1GBDA 3IG6B 3I77A 1XX9A 5EQSA 5I46H 2ZG0H 3SGQE 3TK9A 2ZHDA 1D3DB 3GDUA 1YWUA 1O2KA 1O3BA 2VWNA 2ZF0H 4RN6A 4X8SH 3ZYDA 3ZIAD 1W0KD 3M3TA 4FUBA 2V0BA 3BF6H 5HYOA 1GI4A 3F2FA 2C4FH 5BRRE 1FPHH 4XSKU 2F9NA 3M7UA 2CV3A 4DT7B 4CBNA 3S7HB 1AFQC 2ZGXH 1VITG 1TGCA 4H6TA 1PPZA 1IQMA 5EOKA 4ZHLU 2GD4B 1A0LA 2ASUB 3OSYA 4Y8ZA 1DWDH 1RIWC 1EPTA 1HDTH 3BG4B 1NFYA 4ISHH 2D2DA 3MO6A 2ZCHP 2FM2A 2FZZA 4SGBE 4ABAA 4Y10E 2HWLB 1O5CB 3GDVA 3W94A 2XNIA 5E0HA 3E16B 3TJNA 3A89A 1FJSA 2R2WU 2D26C 2P16A 3OTPA 4U2WA 1LHFH 2P93A 1ELVA 1S0RA 3QGJA 1RXPA 2BLQA 2W7SA 3CENA 3H7OA 1NM6A 1VCQA 5AVDA 3GCTF 3SNBA 5JBAS 2JDID 1GBCA 1UHBB 2F43B 3MU0A 2K0QA 3OYPA 1HGTH 4O3UA 1J8AA 3KYFA 2SNVA 2IJD1 1Q2WA 1QA0A 2A7CA 3FVFB 3LH1A 3LJOA 3PO1B 2VWMA 1O5DH 5FX6A 1ELTA 4X2YA 1H8DH 1W0JD 1YPKH 1K9OE 1GHBG 5B6OA 4LZ1H 1S6HA 1Z8GA 4H6SB 2ZPQA 1OS8A 1CGJE 1HJ9A 7LPRA 4I8LA 3A7TA 1TYNA 2KZ4A 1TMBH 4Q80A 1NRQH 1IQKA 4WWYA 1O32A 2G4TA 2IN2A 5AFZH 3SNAA 4GAWA 3I29A 3ZVBA 1MCTA 1QJ7B 1W14U 1WQSA 1ZTKA 5EGMA 3ZV9A 1PPEE 3D49H 4D9QA 3F3BA 1NPMA 2NU1E 3RXOA 1GL1A 5FAHA 5A2MH 1YCPK 3OEED 1XUIA 2R3YA 3UWIA 1O2HA 4KTUA 1O2UA 1P04A 2J94A 2TGDA 4O3TA 4YLUA 4IW4E 1O2YA 4FVDA 1C1QA 3ZZ7A 3SNEA 4Y6DA 3U8TH 1V2PT 3MH5A 3TPIZ 1GHYH 3SU6A 1AGJA 2FS8A 4IN1A 1ETSH 4DIHH 1YPMH 4MLFB 3BTEE 3STJA 1MAYA 2L74A 2PW8H 1NESE 1KLIH 2Q6DA 1CA0C 4YZUA 2QYIA 2JETC 1Z7KA 4HFPB 3SW2B 3E1XB 1SHYA 2RA0A 5BPEA 1AO5A 1C1WH 4IN2A 2Z3DA 5T3HA 1P12E 3PMBB 1P9SA 4B6FA 2B9LA 1BTXA 1KMHB 1NFWA 3M37A 2BY7X 2P8OC 4D76A 3K65B 3UAIC 2WPKS 1MUEB 4U30A 5EXNA 4ABFA 5A0CA 4P02A 5B6LA 3MI4A 3U69H 1PYTD 1B5GH 1V2KT 3RU4T 2FXRA 1V2VT 3BSQA 3LJJA 4WF8A 3RXGA 2AFQB 3Q3KA 4B1TA 1HJAC 1C1PA 1DT2A 3LC5A 3A86A 5F8XA 1P11E 4FUJA 1GBHA 1Z71A 3QX5H 5I25A 3M3SA 1AB9C 1N8OB 1W0ZU 1D6WA 2BY6X 2FODA 1XUJA 5E0GA 2XC0A 1OWIA 3F0PA 1EAWA 5A8XA 2HRVA 2OD3B 4Y0YE 1BMFD 1DVAH 2GZ8A 3TH4H 2WYJA 1JIMA 1QA7A 1O3GA 2TBSA 1AQ7A 2D1JA 3ZYEA 2BMGB 1HCGA 1SI5H 2SFAA 3SV6A 4XBCA 1BOQA 1TBZH 1CE5A 1FAKH 1BZXE 1O2OA 2A5KA 3RXRA 2ESTE 2HLDD 5DPAA 1SQTA 3KYGA 1GBBA 3QZRA 1JMOH 3RLYH 3ZVAA 2HLCA 1V2WT 3K6ZA 3NPSA 1TONA 1O3NA 2F3CE 2EQNA 5F6MA 1H4WA 3MU5A 2ZZUH 1THSH 2OUAA 2O8TA 2WV9A 1IQFA 4ISIH 1FMGA 2AGIX 1RRKA 1AKSB 1YC0A 2A5AA 2O8LA 4NZLA 1SQAA 3ELAH 1P2QA 1P2JA 4TT3D 5CE1A 1YLNA 2VIDA 5C1XA 1HLTH 1E37B 5G4BA 2ZFQH 2QXIA 2ZI2H 2GZ7A 1LTOA 1RFNA 1LPKB 3BIVH 5C1YA 1OWKA 2B7DH 4WY3A 1NRRH 3QGNB 3MNCA 4YT6H 1XUFA 2I6SA 2J95A 2PKAB 2ZU4A 4F4OC 2PKSB 1P57B 1IAUA 3QK1A 3GCNA 4DJZB 3RXDA 1C2LA 4RT0A 1GI0A 2R9PA 2FMJA 1UCYE 2RDEA 2HNTC 1VITF 2DE9A 5C5OA 3SNDA 2Z3CA 4Q7YA 2QE7D 3N7EA 3QO6A 1EPTC 2AIPA 1GJCB 1C2HA 4K8BA 5E0JA 4BXWA 2AGGX 3PM3A 1C5UA 5C1UA 3MNBA 5C5NA 2OLGA 3A7WA 1PQ8A 4AFSA 1O2IA 3URDA 3UTUH 5FPTA 3HK3B 4NSVA 1S84A 3FN8A 1TGNA 1YF4A 4ZXYH 3M3VA 1DSTA 5FCRA 1AE8H 1FN8A 2ANMH 3SV7A 4TWWA 1PPFE 1C1OA 2OQUA 1XKBC 4DT4A 3FFGA 1EATA 1EJMA 2BDBA 1AUJA 4K69A 4B71A 3KGPA 3U8OH 1MKWK 2JKHA 4BXSA 1TB6H 1TE0A 3KL6A 3UQOA 1BTUA 1H8ED 1UTKA 1HAXB 3GCOA 3RXSA 1GDQA 1Q3XA 3V3MA 1Y5UT 1O2RA 3VXEH 1QB9A 3N99A 2ZDLA 3PV2A 3RMNH 2Z9IA 1F5RA 2BDCA 1OXGA 4JZFH 1CGHA 1C2GA 4WMFA 2BZAA 3BTDE 4NCYA 4Z0KA 3TITA 2AEIH 2EC9H 2G81E 1EFRD 2QGRA 4IBLH 2H2ZA 4IC5A 1N6YA 4QT8C 2KX4A 1K1MA 3GICB 1O3KA 2ZGHA 1GBFA 3LKWA 1O3LA 1CO7E 1O2JA 3UWJH 2YNBA 4KP0A 1C5OH 3F2HA 4K2YA 1T7CA 2VIPA 4A5TS 2VH0A 3ZZCA 7KMEH 2WPLS 1HAYB 3RXAA 1KYNA 4M9FA 1C1VH 3R0FA 3ENSB 1QTFA 2VGCC 3QN7A 1W7XH 4AG1A 4ABDA 3E0NB 1O3AA 3SUEA 4UFGH 4ISLA 2XW9A 2ZU5A 3UREA 1SG8B 1G9IE 2G55A 3EQ0H 1G3BA 3V0XA 3RXBA 2HALA 2JH0D 3VB5A 5LGOA 4FXGH 5GNDA 2Z9KA 1ZPCA 1HBTH 2CHAB 3V12A 4DOQA 4DW2U 4Y8YA 3DFLA 2FX6A 1GI9B 1EJAA 5EJZA 1LHGH 1O2TA 1FY3A 2GCTB 2ZPSA 4INLA 1EOLA 1EAIA 2ZECA 2ZFFH 1E35B 4H42U 3EYDA 3RC6A 1ZMJA 3LGUA 4MPXA 2H5DA 2C8WB 4UD9H 1TGTA 1D3PB 2Z9JA 2FI4E 2AH4X 3GY5A 2F9BH 3RXIA 2F9OA 3H7TA 4INHA 3WWBA 1YGCH 1SGPE 1QJ1B 3MO9A 3TNTA 2STBE 3BTME 3M7TA 5C17A 1V2QT 2BX3A 2J97A 2V35A 4U01A 4UFFH 1ZSJA 2JH6D 3S69A 3LDXH 1L0ZA 4GUXA 3BN9A 4BOHA 1C5XB 2BQ6B 1NRPH 3UNQA 3SI3H 1O2PA 2RCEA 5CHAB 5FX5A 1LDTT 3RMOH 5K7RA 3TJVA 1ZTJA 1A1RA 2TIOA 1HAOH 2ZFRH 5E2OA 2I6QA 2BVSH 1OSSA 3VGCC 1F0TA 3T5FH 2W6JD 3SUDA 3SI4H 4X6NA 2ZCLP 5DGJA 3TJOA 1MD8A 1XVOA 1DY9A 3F9HA 1ZRKA 2KCOA 2DE8A 2FS9A 2F91A 2QF0A 1NO9H 4TYDA 1JIRA 4NSYA 6CHAC 1NRSH 1KLJH 3PWCA 2AMQA 5JBBS 1O33A 1TQ0B 5DP5A 1C5PA 4FUIA 3UOUA 1AVXA 1QRWA 1XXFA 2M2AA 4FUGA 2PV9B 1P03A 1JBUH 3RXJA 4OS1A 2YMSC 4DG4A 5EXMA 2ZKSA 1AD8H 3JZ2B 3RDZA 1UVTH 2FO9A 3SU0A 3S0NA 2WINI 1P2NA 3DSGA 3H09A 1E0FD 3F1SB 3L6PA 3C1KA 1A5GH 1KXDA 2R2MB 1SLVB 3RXCA 1S82A 1O31A 2Y7XA 5C2ZA 1ZHPA 1DE7H 1TWXB 1GG6C 2VNTA 1GJ7B 5EQRA 1XUHA 2OBOA 3LGIA 3VB6A 5EU8A 2PSXA 3PRBA 4XD7D 4CRGA 3ZV8A 4LOYH 1E1RD 4AX9H 3NK8A 1G37A 2SGPE 2YNAA 1MQ5A 4AGJA 1S0QA 3NZIA 2ZWLH 2SGDE 4E05H 1XVMA 4KTCA 2EI7A 4AB8A 4FUDA 1RJXB 1T4UH 4F55A 4TWYA 1BMMH 1O3EA 1TLDA 2P3TB 1LVMA 3KQBA 1K2I1 3O8CA 5DN6D 2CF8H 4GSOA 5TCCA 1FY1A 1LO6A 1KDQA 4K5ZA 2PLXA 1UHBA 2BDYA 4ZXXH 3SGAE 2QAAA 3NUMA 3FP7E 2LELA 2IJOB 1UK3A 8KME2 4HG6A 1QGFA 1K0HA 5DG6A 4UFDH 4B73A 2BD7A 2BVXH 1C5RA 1SHHB 4X2VA 2NU0E 4Q2KA 3U98H 6GCHF 1C2EA 1ARBA 1ZSKA 4MNYA 4NWKA 2VIWA 1SGFA 2VU8E 3BEUA 1KTTB 2FOAA 4DURA 3FZDA 4KTSA 1XUGA 1HAZB 4ZUHA 1K22H 2JJ2D 2ANKH 3E0PB 1S5SA 1YP9A 2UUKB 4Y11E 1CHOF 3QTVH 1MTNC 3E3TA 1O3MA 3FZZA 1ESBA 2TGPZ 3F9GA 3S9CA 2FDAA 5DJ7A 5C20A 5E2PA 3K2UA 4DCDA 3BEIB 2YMSD 1BB0B 2PTNA 2W5EA 2ZQ2A 2HPPH 2C8YB 3ATWA 4FUHA 5KGOA 3TGKE 2UUFB 2BD2A 4MNWA 1ABIH 1M9UA 4O03A 2EEKA 4I8GA 5GCHF 4D8NA 1GJDB 4DVAU 1EB2A 1O34A 5DP8A 4VGCB 3SQHE 2A45B 2ZTYA 1HAPH 2GP9B 1BMAA 1MQ6A 1MD7A 5C0UA 3VXFH 3E91A 1O2WA 3P8OA 1SFQB 1BJVA 4O9VA 2JETB 3SJKA 5C3NA 1GL0E 1F2SE 1EQ9A 1TBRH 2VWLA 3BTTE 3TH3H 4BANB 3TH2H 1GJBB 1QQUA 1GHZA 3SQEE 3ZVGA 3F68H 1SL3A 3EE0B 1C1SA 4JYTA 4ABBA 3U8RH 1K1IA 2ZDVH 1D6RA 4ACBA 1SR5C 4X1SU 1CQQA 2STAE 1AY6H 2P8OB 3W1EA 3TGJE 3RM2H 1NBMD 1VJAU 2H1UA 1TRNA 2NU3E 2FOGA 6LPRA 4X1RU 5T6GA 3M5LA 5H4IB 5GWZA 1HAIH 2FWWA 2Y7ZA 1LQDB 1AFEH 1PYTC 2XTTB 2ZGBH 2XXLA 2ZCKP 2GMTB 1K21H 2BYAX 3A85A 3MU8A 2ZNKH 1LHCH 1MTUA 1F0UA 1V2JT 3TK5A 2HGTH 1C2IA 4IMQA 2GT8A 2VVVA 2ODPA 5DP6A 2ALVA 1TPSA 4B2BA 1ZYOA 2OK5A 5L2ZH 1GGDC 3BTWE 1AB9B 2BLOA 2IPHA 4AOQA 1WTHD 7ESTE 1YPGH 2CXVA 3ZZ8A 4D7GA 1NY22 2QC2A 1TX7A 1V2OT 1TNIA 2ZPRA 1LVYA 1GMHG 4OM9A 2GCHG 2ODYB 3F9FA 3CS0A 1GVZA 1HIAB 2C3SA 1GI7B 2H9HA 2GZ9A 1T4VH 1GBIA 2G51A 1E34B 1QURH 3QZQA 4K1SA 3DHKH 1YLDA 1IQGA 1SGCA 1OYQA 2KR7A 2Y5FA 3GCHB 2QF4A 1FLEE 2QA9E 3EA7A 1C5MD 1A7SA 3PTBA 1L1JA 3KIDU 5JB9S 2Z94A 3NCLA 1C5VA 3BIUH 2BY9X 3GY4A 1HAHH 1AKSA 1GJ5H 1C4U2 1DY8A 1DXWA 4IC6A 1Z8JB 2A4RA 3RXPA 3A87A 3RXLA 4ABEA 4NIWA 3Q3YA 1SOZA 4FU8A 1FY5A 2WPMS 1UTNA 2R0KA 4GHQA 4XDEA 2LPRA 3W95A 3L33A 1T8NA 1C5WB 2QV1A 2PGQB 4CR9A 1HXEH 3UNSA 3A84A 1ZR0A 3DSOA 3SBKA 1Q31A 2FOFA 5F8ZA 5FHTA 1BBRH 4Y71A 1C1RA 1EKBB 3ESTA 2PR3A 2HOBA 1Y8TA 1A61H 4X2XA 1C1MA 3MO3A 1EP5A 4NFFA 1TPAE 2XBXA 3ZZBA 2ODQA 1GCTB 3VB4A 1Z8RA 2A1DB 1A0HB 5CHBA 5L30H 2PP6A 4NZQA 1XUKA 1Y5BT 3M7QA 1GJ6A 3PV5A 1NFXA 1MBQA 4CH8B 1B7XB 2Y82A 1DS2E 1AWHB 1IHSH 3SV9A 2GTBA 3SOSA 1YPJH 4A1VA 1F0RA 3P70B 3ATIA 1YKTA 1HRTH 5HGGA 3BEFB 2A2QH 1QY6A 1W12U 3QDZB 1L1NA 1O36A 1HYLA 1P3EA 2ALPA 1K1LA 1K1OA 1QJ6B 1BTPA 4X0WU 5K0HA 4D9RA 4OS5A 1Y3UA 3RXVA 2NWNA 1T8MA 2XCFA 2J98A 1GMCG 1G36A 1GBKA 4WH8A 2F83A 1BTWA 1TBQH 1O3PB 1GHWH 1PPGE 2AMDA 3MOCA 3TJUA 1BMLA 2ZDAH 2A32A 4MPUA 5J4QA 3JZ1B 4ABIA 1O5BB 1FX0B 1G32B 1P3CA 3DFJA 2J34A 4ZCNA 1VITH 1DWEH 2QF3A 2PSYA 4MNXA 5JPMH 3QTOH 5A8ZA 4AFZA 1ESAA 1HAVA 1PQ7A 2DUCA 1GJ4H 2KCPA 2G52A 4GCHF 2BHGA 3L3TA 3A8CA 3CNRA 1SLWB 1ZLRA 3T26A 4LXBH 1Y3YA 1KXEA 1TGBA 3Q3XA 1AHTH 5T1VA 3UNRA 4ZKNU 1FQ3A 1HAGE 2ZDNA 2BXTH 1UMAH 4NG9H 2XWBI 1EUFA 3AASA 3HGPA 3AVZA 1EZUC 1DUAA 8GCHF 4ABHA 1A5IA 1AE5A 1S6FA 1MKXH 2P59A 3LT3A 1QBVH 5F8TA 1HNEE 3LU9B 4ESTE 3E90B 3SZNA 3ZZ5A 1EAUA 1ACBE 2J2UA 3GY2A 2ZFSA 3UR6A 5EODA 2BY8X 1AIXH 5GPIB 1UJ1A 1V2NT 1QL9A 4Z1MD 1WAYB 2UWPA 3BTHE 4B2AA 4CRAA 1ELCA 2WPDD 4NA9H 2JIZD 1ELBA 1JWTA 4OGYA 2OQ5A 1MU8B 3FP8E 4MNVA 1O3FA 1PPCE 1CT0E 1DSUA 1SFIA 3P8FA 2XNDD 3LONA 3U1IB 1Y3VA 4TPYA 5T6FA 1O2XA 5LPFA 1GDUA 3BTGE 1W7GH 1ZZZA 1QB1A 3PTNA 3A82A 2RDLA 2KCYA 1WOFA 1BTHH 1C2KA 1NU9A 3RXFA 2HVYB 2BTCE 1LVOA 1WYKA 1QCPA 1K1JA 3A80A 3SJ9A 1ESTA 1C4Y2 3MYWA 2XYAA 3SU1A 2ZEBA 3LGYA 4Q63A 4YESB 4HTCH 1YM0A 3PLKA 4LK4A 3UFAA 1YPHC 3SN8A 3RXHA 4WXVA 3VFEA 2V7QD 4CREA 4E06H 1ZTLA
chains in the Genus database with same CATH topology
3PYHA 3AW1A 1C5LH 4UE7H 1O0DH 1TA6A 3PV4A 3RU4D 1BRAA 9LPRA 4AFUA 1O35A 3RXMA 1P2IA 3TK6A 1OP8A 5IDKA 2OBQA 2PGBB 3A88A 1CHGA 3TVJB 1TPOA 2GDEH 2FLRH 1GHBF 4I31A 3U1JB 2PTCE 2FOCA 1WQVH 1C5YB 1W13U 4I32A 1CT2E 4RKOB 1XKAC 4CR5A 4JZ1A 4ZKSU 2NU2E 1AMHA 4YM9A 2Q1JA 3GOVB 1GPZA 1UO6A 3FP6E 4UONA 1GMHF 3OY6U 3LGWA 1Y3XA 2GCHF 2HNTE 3GY3A 4Q7ZA 5CMXH 1TNLA 3OY5U 5AFYH 1FV9A 2PUQH 4NGAH 2Q6FA 3T2NA 2KAIB 1ZMLA 3SORA 2D8WA 4YOGA 3P92A 3A7VA 1MZDA 1SVPA 3LGTA 4SGAE 4Y0ZE 3RXUA 1CBWB 2PFEA 1J15A 2UWLA 1TAWA 2BD5A 2TGAA 3P8NA 1LMWB 1O2SA 2G5VA 1DLKB 1WSSH 1ZHRA 2H5CA 4K60A 8LPRA 1O30A 4K1EA 1SC8U 2ANYA 1ZPZA 1Z6EA 5FXLA 4NIYA 3T27A 3UUZA 2O8UA 3MMGA 1BITA 1TGSZ 2PHBA 1YYY1 4A1XA 2Y80A 1Z6JH 4ISNA 1O5FH 1YCPH 1S85A 1MTVA 1T8LA 3URCA 3IITA 2J92A 5HM9A 1C5QA 1C2JA 1CU1A 2H6MA 1NU7B 1SGYE 4NIXA 3M36A 2RA3A 4FUEA 3H5CB 5JDUB 1O3OA 1WCZA 1V6DA 1SOTA 2FLBH 1ZPBA 3PMHB 1ANEA 2VH6A 4DY7B 1VGCC 2P3FH 3PROA 1LPZB 2QY0B 9ESTA 3RC4A 2J4IA 1D3QB 1SPJA 1IQEA 3UY9A 4ISOA 3O8BA 2ZO3H 1TNGA 4A6LA 3GY7A 3GCTG 1O3DA 4A7IB 4CH2B 4F49A 2XWAA 3GY6A 4YOJA 1LPGB 4AZ2B 1EAXA 3ZZ4A 1SBWA 3NXPA 4AFQA 4DGJA 3B9FH 1ANDA 1FN6A 1O5GH 3QWCH 1DPOA 3MFJA 4CHAB 1GMCF 2F9UA 2GGVB 4MG3A 3STIA 4OS2A 3TU7H 1O3HA 4NA8A 2WV4A 3SHAH 5JB8S 1HUTH 2QCYA 4XBBA 1BRUP 1MTWA 2OC1A 4YO9A 4XFQA 1QL8A 3SU5A 1MMJN 5GDSH 4BNRA 3M35A 2W7UA 3ATKA 1O39A 2SGQE 5LPRA 4A1TA 4KKDA 1O2VA 1GBAA 3RXKA 2WUBA 1Y5AT 1OWDA 2VVCA 2BQWB 1MZAA 1O2LA 2TGTA 3KCGH 3HATH 2P95A 1GI2A 1BBRK 4Y76A 1CGIE 3B8JA 3BV9B 1SMFE 2Z3EA 1GJAB 1IQNA 4BTTB 4IGDA 2A4OA 2ZHQH 3SJ8A 1SQOA 4X6OA 1K1NA 2AYWA 4INKA 2FYQA 1LHEH 1G3CA 1AZ8A 1UVUH 1DOJA 2ZA5A 4B75A 1B0EA 2Z9LA 2ZFPH 2HVXA 1ZHMA 2G4UA 1BJUA 1P8VC 3SJOA 3S7KB 1HJ8A 2A4GA 2ZGCA 2XC5A 1TRYA 1L2EA 5DK1A 1BQYA 1KY9A 1P2KA 2BZ6H 3LH3A 1AFQB 5F03A 1EZXC 1JRTA 1ZMNA 5A09A 4ZH8A 3SO3A 4MPWA 1UTOA 1NTPA 4UDWH 3ZZ6A 4X8UH 2F9PA 1GHXH 2G00A 1BHXB 4GLYA 4IMZA 3V7TA 5PTPA 1RIWB 1Z8IB 2C8XB 1MBMA 4IS5A 2ZFTA 2FX4A 2CHAC 3TLOA 3KEEA 2WPHS 3SV8A 4GVUA 5DP7A 4MQAA 2W3IA 1SLXB 4HI3A 3QLPH 4TY6A 4AB9A 6ESTA 4RSPA 1MU6B 1VR1H 2Y81A 4JZEH 1WBGB 3SV2H 1F7ZA 1DXPA 1OPHB 2ZU1A 4LZ4B 1FUJA 2SGEE 1VCWA 1HB0B 1ANBA 1G30B 1EXFA 2QIQA 1F0SA 3MH6A 4JYUH 4AG2A 1TPPA 1C4V2 1C9PA 2WYGA 2A7JA 4FUCA 1TFXA 1Z1JA 4JCNA 1OWJA 1P0SH 1O38A 3T62A 1NFUA 1PPHE 2FESH 2BDHA 2BOKA 4WMEA 2AMPA 4B76A 3BTQE 1IQIA 1ETRH 1G2MA 3ATLA 1UVSH 1GI1A 5CHAC 2V3OH 1HFDA 1QR3E 2BD3A 1ABJH 4FU9A 3LPRA 2VVUA 3LIWA 1ANCA 2ZP0H 3D65E 3ZVEA 1JOUB 3UR9A 2ZHFH 5ESTE 4ZKOU 3V13A 2YOLA 4Y7BA 4I8KA 1LKAA 4X6PA 5EG4A 3PLPA 1BMNH 1AU8A 3A8BA 1KLTA 3RM0H 3ZZ3A 3U9AH 1QIXB 2BDIA 3SU3A 1ELEE 3B23B 1PJPA 2BQ7B 5DP3A 4ZKRU 1MKWH 2BDAA 3GYLB 2C90B 3EAJA 1WTGH 5FPSA 2VB0A 4Y7AA 2ZIQH 1G3EA 1PFXC 2FTMA 4MPVA 1RTFB 4X1NU 5EQQA 1CA0B 2BLVA 1CA8B 1AVWA 4CRFA 5GXPA 3O8RA 3SUGA 3RC5A 1XM1A 3MU1A 2FOHA 1P06A 4I8JA 2B8OH 1GJ9B 1QQ4A 2OC8A 1S83A 1GJ8B 4Y79A 2ZC9H 1KXCA 4CRCA 2W26A 3P17H 5AF9H 1O2ZA 4XOJA 1A46H 1A5HA 4AN7A 2CMYA 3I78A 3ZZ9A 1FZZA 1BRBE 1C5SA 1NT1A 2R0LA 1TA2A 2UUJB 3SNCA 1SGIB 1KIGH 3HGNA 5EPYA 2ZGJA 1ZGVA 5JYIA 1SGFG 3KN2A 1G3DA 2ZDKA 1QRXA 2BDGA 1HJAB 1ZJDA 3Q77A 1GVKB 2P94A 2Z6BD 4JZDH 4OS4A 1VJ9U 1DX5M 3M5OA 1KDQB 2OINA 3MH7A 1F92A 1FY4A 1TNKA 1V2UT 3PMAB 1SGEE 1GI5A 4OS7A 1O3JA 1LCYA 3ZZDA 1EOJA 3PWBA 3HKIB 2A4QA 1OX1A 3N7OA 2FOBA 1NRNH 1GBLA 2EA3A 4D7FA 4I33A 1AUTC 4XBDA 3HPTB 1FY8E 2FOMB 2XBWA 1IHTH 1YBWA 2CGAA 3A81A 4THNH 1GI6A 1TX8A 4NFEA 1O3CA 1IQHA 4YLQH 4H4FA 1PQAA 1V2LT 1DANH 1OWEA 1L1GA 4R8TB 1TMTH 2AGEX 1D3TB 1BHXF 5LH8A 2VIOA 2QXGA 2CN0H 1GHVH 1O5EH 1JXPA 3E8LA 4TPIZ 3Q00A 5GIBA 1MCVA 1OWHA 5A0AE 1AVGH 2GX4A 3O8DA 1HPGA 3S9AA 1EZQA 2PKAA 3R3GB 1FDPA 4BTUB 3EDXB 4WJG2 3RUOA 1NS3A 1P05A 4E7RG 4VGCC 1X7AC 1G2LA 1HV7A 4AYYB 3A8AA 1P9UA 1TALA 4JYVH 2AERH 1ELAA 3OX7U 3LOXA 2B5TB 4YT7H 1A2CH 2H9TH 4JMYA 2FI3E 2GV7A 1KXFA 3BG4C 5EW2H 1C5TA 1ID5H 2OP9A 1P01A 3UOPA 1EPTB 2ZHWH 3K9XB 4M7GA 2FP7B 1O5AB 1J16A 3ZVFA 3KHVA 3RXTA 1TMUH 1GBTA 2J38A 2XRCA 4NWLA 3M61U 1NC6A 1J17T 1UTQA 1N6XA 1C2FA 4I7YH 4CRDA 3RMLH 1V3XA 1T32A 4YOIA 1Z1IA 1RTKA 1FONA 3T29A 1ARCA 1T8OA 4A92A 2GMTC 4X8TH 1EP6A 2Y6TA 1ORFA 5DKMA 1QNJA 3SGBE 1TX6A 1A0JA 1C5NH 1BBRE 3PO1C 4YTAA 1SB1H 4R0IA 5HMAA 1GWAA 3T25A 2EI8A 4AYVB 2OTVA 2GVFA 3ODFA 1O2MA 5J4SA 2Y5HA 2J9NA 3KQDA 4JZIA 2UWOA 1H9LB 1RGQA 4OGXA 1T31A 1UCYH 4PROA 2Q6GA 1E36B 1EASA 1MH0A 2PUXB 5EPNA 2AS9A 4J1YA 4K1TA 3RMMH 1NN6A 3CP7A 3BG8A 4KGAA 1SGRE 3GCHC 2THFB 1P2OA 1XMNB 1ZGIA 2KAIA 5FCKA 2SGFE 2VIQA 2IOTA 1OKXA 2FIRH 4GHTA 1LVBA 3SU4A 1UVOA 2W3KA 1KXBA 2OXSA 2LNCA 1INCA 1W3CA 4XE4A 2FTLE 2VGCB 2WUCA 3K6YA 5EW1H 3F6UH 4FVBA 3RLWH 1QBNA 1C1NA 1H8IH 1JRSA 1FIWA 3UPEA 7GCHG 5FBIA 5HXFA 2GKVE 4BAOB 3DT0H 3OU0A 3RU4E 1J14A 2O8MA 1FI8A 5TJXA 1GCTC 1YPLH 2FOEA 1QL7A 1BIOA 2F9VA 3DD2H 4WVPE 2ZU2A 1GI3A 1OP0A 2VWOA 4AGKA 2XBVA 1N1LA 1VZQH 4HZHA 4RKJB 1V2RT 3A7ZA 3HK6B 2C8ZB 5EXLA 1BA8B 2ZDMA 1C1TA 1F5KU 4ASHA 4DIIH 2A7HA 1IQJA 5T6DA 3MWIU 3EGKH 1P09A 1VGCB 4FUFA 1W0YH 2ILNA 2NU4E 3MTYA 1K1PA 3FAOA 1EJNA 1KXAA 1EB1H 1TOMH 1IQLA 1XXDA 3VB3A 5HM2A 1N8OC 1UK2A 3HKJB 1RTLA 3RXQA 1QFKH 2FPZA 4GPGA 3M5NA 2RG3A 4CRBA 1C5ZB 1TRMA 2WV5A 1WUNH 1GMDG 1TNHA 4X2WA 4ZHMU 3VPKA 3ODDA 4J2YB 3MNSA 1GHAG 1SGNE 4MDSA 1DUEA 4ABGA 1FXYA 3D23A 2TRMA 3T28A 1TOCB 1UK4A 3BTKE 1ELDE 5ESBA 5FBEA 2XC4A 6GCHG 1KTSB 2Z9GA 2ZTZA 4KELA 1UTLM 1YPEH 1KSNA 3VGCB 2BD8A 3WY8A 3KF2A 2V3HH 4JK6A 1D9IA 1ZOMA 1MAXA 1Y59T 1L4DA 3SUFA 2BM2A 2FYRA 3P6ZB 1HAVB 4JK5A 1CHOG 1ETTH 6CHAB 1DFPA 1BUIA 2GDDA 4K3JA 4ZMAH 2CF9H 4BTIB 5AHGH 2HNTF 1J9CH 1UTPA 1ZSLA 2P3UB 3SU2A 1RD3B 4CBOA 2A0QB 1O2NA 3A83A 3IWMA 5DO4H 3CS7A 5GCHG 2ANWA 5C67A 1YPHE 4HGCA 1NZQH 1TIOA 4NA7A 1QB6A 3S9BA 1S81A 1SSXA 1H9HE 2H9EH 3QUMP 4X6MA 2PKSC 1SGTA 1GCDA 2SGAA 3UQVA 1GG6B 1LKBA 1OOKB 2O8WA 3AW0A 3ATMA 2VJ1A 1LHDH 5SGAE 1THRH 5JBTA 3UIRA 4FU7A 2BOHB 1W8BH 2OC0A 1TQ7B 5FPYA 5L6NH 2C93B 1E38B 1BTZA 2ZQ1A 1OP2A 5ETXA 4BAMB 1EX3A 1W11U 1B0FA 1C2MA 2A31A 4X8VH 1UTMA 1BT7A 3KNXA 4Y8XA 2VIVA 2UUYA 1THPB 4Z6AH 5A8YA 1C2DA 3G01A 1F5LA 3GDSA 1P2MA 1AZZA 2FI5E 3AAUA 3MNXA 4WH6A 3P8GA 4BAHB 3C27B 2BD4A 3Q76A 1A3BH 2OC7A 1P02A 3EA9A 1GDNA 1AN1E 2BLWA 3DUXH 1AWFH 1O2GH 2K1QA 1O2QA 1SLUB 1UVPA 2ZHEH 1A3EH 3ZZAA 4K8YA 1O3IA 4U32A 2G5NA 2ULLA 1H9IE 4OS6A 1BRCE 2O9QA 2G8TA 1VCPA 1C9TA 1WU1A 3A7XA 5ABWA 1FPCH 1QBOA 1GVLA 2VINA 3RP2A 2M5TA 3OTJE 1GI8B 3GYMA 2BY5X 2FEQH 4ABJA 1ZJKA 3TNSA 1MTNB 4I8HA 1GBJA 3TIUA 4Q7XA 2CJIA 3RXEA 2ZTXA 2BXUH 3VEQB 4AORA 5IYTA 1DITH 1GBMA 3MU4A 3SHCH 1GBEA 1PQ5A 2QXJA 2BD9A 1H1BA 1A4WH 3AAVA 1CBWC 3KQEA 4O97A 1DWBH 1FAXA 1DWCH 3PB1E 2HPQH 2A5IA 4WMDA 5E8EH 5LPEA 1AI8H 2PWXA 1DDJA 3PMJA 5GJ4B 4B74A 2XBYA 2OCVB 3TGIE 1U6QA 1Y3WA 2A2XH 3D62A 3ITIA 3M5MA 4X1PU 4BAQB 7GCHF 1DICA 1FNIA 3MH4A 3GY8A 3DA9B 2GV6A 1LQEA 1MTSA 1D4PB 5DP9A 1CVWH 1ELFA 4B2CA 3PLBA 3P95A 1NROH 2QXHA 1BDAA 1FIZA 1TNJA 3E6PH 1OYTH 2QN5T 4MTBA 2GCTC 3NKKA 1QRZA 3ZVCA 1SGDE 1BCUH 3LGVA 4UEHH 5DP4A 4ZHAA 1W2KH 1PPBH 1BTYA 3BTFE 3VB7A 3A8DA 4NIVA 4BAKB 2V6NA 1ELGA 1UCYK 1V2TT 1C1UH 3LC3A 3NWUA 1GGDB 2Z7FE 4X1QU 2WPJS 1UTJA 4ZAEA 1QHRB 1P10A 1IOEA 1K28D 4TY7A 2WPIS 3F9EA 4WXIA 3KQCA 3ZVDA 3GISB 1GMDF 2ZU3A 1TABE 1YLCA 4CHAC 1MKXK 2BX4A 1HIAA 1GHAF 2EI6A 1W10U 2BB4A 2SNWA 1RS0A 1YCPM 1EZSC 1O37A 4E7NA 2B0FA 5TCAA 5A0BA 1V2MT 2Y5GA 1CT4E 2AIQA 3MHWU 8ESTE 1DM4B 4GCHG 1DLEA 1ZRBA 1CSOE 2GT7A 3A7YA 3EA8A 4MVNA 1SGQE 3SJIA 2R3UA 5L2YH 2TPIZ 5JBCS 4ZROA 4UFEH 2BVRH 1HXFH 1L4ZA 1WV7H 2XCNA 3FANA 8GCHG 1V2ST 2JH5D 1GBDA 3IG6B 3I77A 1XX9A 5EQSA 5I46H 2ZG0H 3SGQE 3TK9A 2ZHDA 1D3DB 3GDUA 1O2KA 1O3BA 2VWNA 2ZF0H 4RN6A 4X8SH 3ZYDA 3M3TA 4FUBA 2V0BA 3BF6H 5HYOA 1GI4A 2C4FH 5BRRE 1FPHH 4XSKU 2F9NA 3M7UA 2CV3A 4DT7B 4CBNA 3S7HB 1AFQC 2ZGXH 1VITG 1TGCA 4H6TA 1PPZA 1IQMA 5EOKA 4ZHLU 2GD4B 1A0LA 2ASUB 3OSYA 4Y8ZA 1DWDH 1RIWC 1EPTA 1HDTH 3BG4B 1NFYA 4ISHH 2D2DA 3MO6A 2ZCHP 2FM2A 2FZZA 4SGBE