1XUGA

Trypsin-babim-zn+2, ph 8.2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xugA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xugA02
4D8NA 4I32A 7GCHF 3VB5A 4DG4A 1KXAA 2D8WA 4BAOB 2ALPA 1Z1JA 2BB4A 1BITA 3MNBA 1HIAA 2VVUA 1C5QA 3PMAB 2VNTA 3SJOA 2GT8A 2VIDA 4B75A 3SHCH 3KQDA 2A0QB 3B23B 3RXMA 5FPYA 1BRBE 4X8TH 1VCWA 1GCTB 1LKAA 1P01A 4ABIA 3K6YA 1O2GH 4K69A 1UJ1A 2P8OB 3U8RH 3U98H 4BAMB 3VGCB 4MDSA 2FX6A 1GMCG 2QF3A 1BB0B 4X1PU 1TGSZ 1PYTC 1C1OA 1O3AA 2HLCA 3TITA 3A87A 1AZZA 3NCLA 2YNBA 4K1SA 4D9RA 1K1PA 4AG2A 3ATWA 1MMJN 1G3BA 1YF4A 2OC7A 1GI5A 1QRWA 2OD3B 1FAKH 1A7SA 3KL6A 3A7ZA 3PMJA 1QA0A 2WV4A 5B6OA 1XVMA 1A61H 2XCFA 1C2KA 1ELVA 3PO1C 1N8OC 1QBVH 1P05A 1PPEE 2P3TB 1O2QA 2AIQA 5AFYH 5FX6A 2WYJA 1TFXA 3P6ZB 1ETSH 1S0QA 3E90B 4Q7YA 1TNKA 1TX8A 1K22H 3SQHE 4DW2U 9LPRA 3K9XB 2BVXH 3BF6H 4AYVB 2ZU5A 2F9UA 1NFXA 1LQDB 4GUXA 1OP2A 5C1UA 3QDZB 1DLKB 4MNVA 4F4OC 2Z7FE 1JBUH 5DP7A 3SOSA 4RKOB 2BZ6H 1C1MA 3QTOH 1GBAA 3GDUA 1NZQH 2HNTF 3QO6A 1PFXC 1DDJA 4ZXXH 1SGCA 3QN7A 1P2NA 3U9AH 3FAOA 1LKBA 1P2KA 3HK6B 3PB1E 4I8JA 1B7XB 1KYNA 1G3CA 1AMHA 3ZVEA 4ABGA 3F1SB 3ZYDA 2STAE 3ZZCA 4GLYA 1GMDF 2AMDA 5TCAA 2PSXA 2A7CA 1BTPA 4ZKNU 3ATKA 4ISOA 3SO3A 2A31A 1GBBA 1DM4B 2A2QH 3ZV9A 5JPMH 4B2BA 2AMPA 2ZO3H 2Z9JA 1WUNH 4AG1A 5HYOA 1EKBB 4WH6A 4DOQA 1C5XB 2B0FA 3MH6A 5DO4H 5I46H 3QZQA 1G2LA 3MTYA 1JXPA 1T8MA 1TGBA 4Y76A 1AY6H 1O2XA 2AMQA 1QJ7B 3K65B 1HFDA 3T26A 5CMXH 1KXFA 1GI7B 2CF9H 5DGJA 1QQUA 4HI3A 1RJXB 4WXVA 1JOUB 2CF8H 2PR3A 3RXFA 1DE7H 1KLIH 2Y5GA 1C5SA 2ZU1A 3IG6B 4TPYA 3RMLH 1WBGB 2WV5A 3VB4A 4D9QA 1ANCA 2ZFPH 4J2YB 3SGQE 1H9HE 1DOJA 1K9OE 1TQ0B 2SGDE 2HVXA 2VGCB 3A7VA 3STIA 3KIDU 8GCHG 5IDKA 4MPXA 2GV7A 2OC0A 1TALA 3ITIA 4J1YA 2FOFA 3HKJB 3RMNH 1D6RA 1O5BB 4BAQB 4NZQA 1GBJA 3HKIB 4JCNA 2VH6A 3TU7H 2VH0A 1C1PA 3P17H 1ANEA 1T8LA 2RA0A 2PGBB 1QBOA 3MMGA 3URCA 2BLOA 1RTKA 1HRTH 2OCVB 4XBBA 4GAWA 1GL1A 2FO9A 2VWNA 4MPVA 1BTUA 2ZKSA 2QXHA 1TRNA 1Y59T 2BZAA 3MU1A 8LPRA 4MG3A 1FJSA 2ZGJA 4ZKOU 1P12E 1C2GA 2G00A 1O3FA 1P03A 4I33A 4HTCH 5AFZH 3W95A 3ZV8A 1QY6A 4NA7A 4FUHA 1A5HA 1SGTA 1SGFA 5HGGA 4BANB 4CH2B 2UUKB 3AAUA 3M61U 2Q6GA 2GMTB 1KDQB 1O2UA 1SHHB 3RU4D 1TABE 4OS6A 1A3EH 1C2HA 1HXEH 4ABJA 3SU6A 3M7UA 1GJ6A 1NN6A 3E3TA 4U2WA 4XE4A 1QL9A 4BXSA 3S69A 3RU4E 1F0TA 2GD4B 2FOEA 4UFEH 4YT6H 3SV7A 5GJ4B 5FCRA 2ZU3A 3JZ2B 1C1TA 2QIQA 1B5GH 2FMJA 4DURA 1U6QA 1W13U 3LC5A 1ETTH 2TBSA 2H2ZA 2FM2A 4WXIA 5HMAA 3RLWH 4MNXA 1O38A 1WQSA 1IQNA 4B2CA 4X6NA 4DIIH 4CREA 4FUJA 3LU9B 1DT2A 4CRDA 3EQ0H 1LPKB 1ZHMA 3NPSA 4K3JA 1OP8A 2VJ1A 4MNYA 4X8VH 4Z0KA 1KDQA 1L1NA 1C9TA 1Y3YA 2WPJS 2ALVA 3RLYH 1Y5BT 3GISB 1BHXB 1MUEB 1BMLA 4E7RG 4X2VA 1SI5H 2PHBA 3BTDE 4VGCC 1BJVA 1YC0A 3OX7U 2OXSA 3PLKA 2A2XH 1AUTC 3S7KB 1TYNA 1CO7E 1V2ST 3QZRA 4JZFH 4H42U 1HBTH 3LOXA 2FP7B 1A2CH 1INCA 4NG9H 1KXEA 2QF0A 2XC5A 1S82A 1WCZA 6CHAB 3O8CA 2W5EA 1QJ1B 4AGKA 1UVSH 1QIXB 1QNJA 3MO3A 1O2ZA 2SNWA 2TGAA 3RXGA 1CA0B 4K2YA 3MNSA 3BEUA 1MCVA 1FDPA 2BD3A 3S0NA 1VCQA 4YZUA 3GDVA 3RMOH 1SLUB 4Y8ZA 2SGPE 3ZZ8A 1DY9A 4CH8B 2FLRH 1V2LT 1AI8H 1FIZA 3HGPA 2I6SA 1H1BA 1O5DH 3S9CA 3LGUA 5GWZA 2SGQE 5GDSH 3E8LA 4UD9H 1V3XA 3A84A 5AHGH 1Z8JB 3UREA 3Q3KA 1GHAF 1SOTA 1UMAH 2FOHA 3BTME 2GZ9A 1C2FA 3MNXA 1SQOA 1HXFH 1UTOA 3H5CB 3CS0A 3ODDA 1EZSC 5HXFA 3U1JB 1V2WT 3TVJB 1A0HB 3F68H 1JMOH 4FXGH 4M7GA 2HPQH 3A7WA 1HJ9A 4INHA 1GG6B 1GJ9B 2FIRH 5GXPA 1P06A 4OGXA 2FESH 1S83A 2V3HH 3AW0A 1TRYA 1T4VH 1LCYA 1YM0A 3E0NB 2ANKH 2FDAA 2C90B 1EXFA 1C2JA 3R3GB 2JETC 1OOKB 3PMBB 4UE7H 1O35A 1MAYA 2QYIA 1HAIH 1ZSLA 4X1RU 4YLQH 1UTMA 4X6PA 1SLVB 2ZGCA 1RGQA 5EG4A 1VCPA 3VB6A 3UWJH 2H5DA 1FMGA 1S84A 1GBFA 1FPHH 1SLWB 1XM1A 3T62A 1XUHA 1MTVA 2BLQA 4NSYA 2ODQA 3ATMA 4LK4A 9ESTA 2SGAA 5IYTA 1ANDA 1J17T 3C1KA 2ODYB 2V0BA 3QWCH 1ELGA 3D23A 1BHXF 4XOJA 1QL8A 1S85A 1SGRE 2TPIZ 1GJAB 1D3DB 2P59A 1C5MD 2RG3A 3RXTA 3U1IB 4Y8YA 1O34A 1THRH 1FQ3A 2D26C 2RA3A 4U01A 4IMZA 4KTUA 5JBBS 1C1WH 1UO6A 2QAAA 2Z3DA 5E8EH 1QBNA 3V0XA 1TBRH 5LGOA 2B9LA 1A5IA 1BTYA 3A8DA 3E91A 2HGTH 1S6FA 3URDA 5A09A 3ENSB 2XBVA 4CRBA 1EP5A 4Q2KA 1GHBG 2BD4A 4WH8A 3HK3B 1VJAU 1ZTLA 1B0FA 1K1NA 2V3OH 3LJOA 1KLTA 1PPFE 2G55A 1EAIA 3GY8A 1ZLRA 1ELEE 3DFLA 3RXUA 1S81A 1B0EA 3LDXH 3A82A 1HAHH 1N6XA 3SNAA 3V7TA 1J15A 1HAZB 1SQAA 5C5NA 2GCHG 4A5TS 3FFGA 1SGQE 1QB6A 5GCHF 1O3EA 1YPGH 1J16A 3QTVH 1HAPH 5FBEA 1ZJKA 2SGFE 2UWPA 4K60A 2QCYA 1NRPH 5C20A 1WU1A 2DE9A 5J4SA 4MQAA 3I78A 3P8FA 2BOKA 1MD8A 5AF9H 4BOHA 1HNEE 3FZDA 2A7HA 1E38B 1TBQH 4FVBA 3S9BA 4NIWA 1O2SA 2A4RA 1IQHA 3PWBA 1G3EA 1CVWH 1Z8IB 2OC1A 4X6OA 3T2NA 2Z94A 2BY6X 4NWLA 1IAUA 2D1JA 3A88A 5PTPA 3UOPA 5C2ZA 3SJKA 1D9IA 5LPRA 3LGIA 3MWIU 4PROA 1EUFA 2ESTE 1LVMA 1Z6EA 4TY7A 2FEQH 1V2RT 4KP0A 3NKKA 4X6MA 2OTVA 4NIXA 2F9VA 1V2JT 1FY8E 1QJ6B 1LHFH 1IHSH 4Y10E 1ZHRA 4AGJA 1NC6A 1O2LA 1PPGE 2HNTE 1ZYOA 4O9VA 1E0FD 2BXTH 1F5KU 3GYMA 1XXFA 3BTKE 1GI9B 3VPKA 3P8GA 4X2WA 2BD9A 5T3HA 4AOQA 2C93B 4CR5A 1C1VH 1NFWA 1NRSH 5G4BA 3BG4C 4TYDA 3BTQE 3SGBE 1CA0C 5ESBA 4WWYA 3V12A 2ZCHP 3FP7E 2RDLA 1BBRK 2CGAA 1C1QA 3RP2A 2XRCA 4JK6A 2Y7ZA 1C2MA 1NU7B 2FOGA 4NIYA 2A5KA 1DXPA 5EGMA 3KNXA 2OBQA 3CS7A 3O8DA 1UTJA 1YPHE 2TGPZ 3SNDA 1P2QA 1MTSA 3F6UH 2XCNA 2AYWA 1CT2E 1GJDB 2AFQB 1GJ4H 2ZHQH 1C1NA 3A80A 3EA9A 5C1YA 1UK4A 2GZ7A 3SI3H 1A3BH 2HWLB 4HFPB 2AH4X 2ZCKP 1H8IH 1MBQA 1BMMH 4FVDA 1ZJDA 1IQGA 3MO9A 3UQVA 1V2MT 4FUFA 1XKBC 3P8NA 3RXBA 3SV8A 2GZ8A 2H6MA 1Q3XA 3RXAA 1ZPCA 3SGAE 1VITG 2CMYA 1TMBH 1O5GH 3GY3A 4ABFA 1GG6C 2C8WB 2HRVA 2VWOA 1FONA 3EA8A 1C1SA 3SHAH 1NS3A 3FP6E 3QK1A 1GBKA 4FUBA 2BX4A 1SFIA 1NFUA 2IPHA 1MTWA 1J14A 4FUDA 5JBTA 3G01A 4NZLA 2PKAB 2A5AA 1TPPA 2P93A 3R0FA 3PTBA 5FCKA 4VGCB 5EW2H 2PKSC 1L1GA 3PV4A 2Y81A 2ZA5A 1GJ5H 1TPSA 1O2NA 2VVVA 3Q3YA 3BSQA 1Y3WA 1AWFH 2ZFTA 5F8XA 1SMFE 3ZZDA 4U32A 1KTSB 1IQEA 2BQ6B 1NY22 4YOIA 1ESBA 1FIWA 4A1VA 3HGNA 1V2QT 4XSKU 1RTFB 2A45B 4Z6AH 4X8SH 1ARBA 1GBHA 2BDAA 1HPGA 1EAWA 2J92A 2PGQB 2EA3A 2ZECA 1GMHG 1O37A 3ATIA 1WSSH 1TIOA 2EI6A 1XUJA 1TWXB 2F9OA 1NTPA 1WTGH 3LKWA 1DFPA 1ELTA 2PKAA 3RXHA 2PV9B 1P2MA 5T6DA 4DJZB 4AFZA 4A92A 3KQBA 4RN6A 2KAIB 2FTLE 2WUCA 2JH6D 3ZZ6A 1O3MA 1KXCA 3RMMH 3EAJA 1IHTH 3I29A 2O8TA 1UTKA 2XC4A 2BD2A 1D4PB 1O2JA 3RXCA 3O8BA 3EGKH 3OTJE 1EATA 1GDNA 1NPMA 3M3TA 4ZKSU 2Z3EA 4TWYA 3P70B 2BX3A 5DK1A 1C9PA 1OKXA 4MPUA 3AVZA 1QA7A 4I8GA 2ZPRA 3LGTA 1IQIA 2ZWLH 1W7GH 1ZGVA 1THSH 1GCDA 1SG8B 1YPLH 1ELDE 1WYKA 1H8DH 1THPB 2JETB 1FZZA 5SGAE 3ZVBA 1GBLA 2KAIA 3MO6A 1GVZA 1UVUH 1HJ8A 3UR9A 5TCCA 4A1TA 2XWBI 2ZU4A 4Y6DA 2J94A 1CHGA 2PW8H 3DFJA 1HLTH 3FANA 1XUFA 1RRKA 2LPRA 3M7TA 3LIWA 4JZ1A 2F9PA 1FY1A 2OBOA 2BY9X 1NM6A 4DCDA 1XUKA 1KY9A 2FS8A 1AVGH 3UOUA 4CRGA 5T6GA 3MU5A 1O3JA 2GGVB 3OYPA 5JDUB 3JZ1B 1O5AB 3E6PH 2OC8A 1ID5H 5K7RA 1AVWA 2UUYA 2OUAA 3VB3A 5F8ZA 5EQRA 3A7TA 1DWEH 1GBTA 1QQ4A 3GCTF 1DSTA 1TLDA 2PSYA 2J38A 3N7OA 1GWAA 1AWHB 1MBMA 2NU3E 2ZP0H 2ILNA 3VXFH 2OLGA 1EOJA 1C4U2 4MPWA 4WY3A 3TK5A 2ZDNA 1O2OA 1AE5A 2BDYA 1EP6A 7ESTE 2FI4E 1MU8B 4NCYA 2R2WU 1F0RA 1BOQA 3A86A 5LPEA 1A1RA 1WQVH 2BQWB 1DWCH 2ZFFH 1Y5AT 2IOTA 1S0RA 4FU8A 3RXOA 4GHQA 1GHZA 1W0ZU 2F9BH 3TGJE 4Y8XA 1SL3A 3RM0H 4CRCA 1FI8A 1GJ7B 4ABEA 1GHYH 1GPZA 2AGEX 3EDXB 4YT7H 3S7HB 1ETRH 1ABJH 1KXDA 2FLBH 4ASHA 1C5UA 2PTNA 1O36A 4YESB 2W3KA 3RM2H 1BMNH 1D6WA 1TPAE 2CJIA 1HCGA 3DD2H 2VIWA 1TGCA 3BTEE 2Z9LA 1H9IE 3B9FH 3RXRA 3KQCA 1SR5C 3PROA 1O3IA 1ESAA 1GI3A 1L1JA 4I8HA 1MTUA 1FLEE 1SQTA 4LXBH 1V2KT 2J9NA 6GCHG 3NZIA 2P3FH 2G51A 1CHOG 5FAHA 7KMEH 3FZZA 4A7IB 2F3CE 2QXGA 4LZ1H 4OS1A 4XBDA 3GY5A 1AZ8A 4HZHA 5CE1A 5DKMA 1LVOA 1Z6JH 3SQEE 2ZFQH 1FPCH 4GVUA 2BDCA 1UTPA 2Q6FA 2STBE 4ZHAA 2O9QA 4JMYA 1L2EA 4H4FA 1TONA 1EB2A 1CT0E 3AW1A 4X2YA 1ABIH 4JYVH 3SJ9A 2BOHB 1AKSB 3F9GA 3ZZAA 1AE8H 4GCHG 1PPHE 4R0IA 1F0UA 1LHDH 2OP9A 4X2XA 1O3BA 3SUDA 1V2UT 3GOVB 2ZDLA 5DP9A 4I8KA 1RIWB 1X7AC 3F9FA 1S5SA 3KQEA 1WTHD 3M3VA 5GIBA 2J34A 3A85A 2ZHEH 1GBCA 1PQ5A 1XKAC 1ZR0A 3LJJA 1YCPH 1HB0B 1Y3VA 3BG4B 4ZHLU 3MH5A 1F0SA 3RXPA 3UIRA 4X1NU 5E2PA 2ZHFH 3NK8A 1O3GA 2R3YA 2H1UA 1TNGA 1XMNB 5FPSA 3UUZA 4K8BA 2THFB 4CHAC 1YLCA 4GHTA 3UPEA 4O03A 3FP8E 2FYRA 2ULLA 2BTCE 2PUXB 2FZZA 1C5ZB 5A8XA 2AGGX 1GHVH 1AKSA 5DG6A 4ZMAH 2FODA 2BLVA 5JB8S 1GHWH 2GDDA 2OQUA 1FV9A 1BTWA 1QB1A 2EI7A 4IC5A 1CSOE 1OS8A 2DE8A 2FTMA 3DA9B 2FXRA 1GGDC 2FOMB 4KTSA 1CU1A 1ZMJA 1BT7A 2UUJB 3TIUA 2Y6TA 1GMCF 2Z9IA 4RSPA 1Y5UT 2Z9KA 4MNWA 1A5GH 1P9SA 4KTCA 1OWIA 4AYYB 3GYLB 1BQYA 2Y5HA 1PYTD 4AFUA 1P02A 1LHCH 3V13A 3U8OH 3SNEA 4H6TA 4KGAA 1G2MA 3LH3A 3KN2A 5T6FA 4F49A 4NA8A 2GCTB 1P2IA 1FN6A 4ISNA 1N1LA 3GCNA 4FUCA 1EAXA 4JYTA 3T28A 3QLPH 1ZZZA 2P16A 1SGYE 2EEKA 2PFEA 1IQFA 3SUFA 2J95A 2PKSB 3RU4T 4ABHA 4YOGA 1UCYE 4ISIH 1E36B 3VFEA 3ZZBA 4NA9H 4NIVA 3ODFA 1TOCB 2QXIA 7LPRA 1TQ7B 1UTNA 1ZMNA 1C5TA 1O39A 2BMGB 3GICB 2BD5A 1BTHH 2FYQA 4HGCA 3ZVAA 2ZTXA 1RXPA 1O30A 3K2UA 3SV9A 1ACBE 4Y79A 3KGPA 2VVCA 2AIPA 4ZUHA 1P3CA 1BA8B 1O5CB 4XFQA 1SBWA 1E37B 2BY5X 2BY7X 3TH2H 3MH7A 2ZFRH 1ORFA 2BD8A 2PLXA 1P11E 3PMHB 2ZQ2A 3TH4H 1PQ8A 1FY4A 1AUJA 4RKJB 3K6ZA 1A0LA 1UVPA 4MLFB 1C1RA 2FWWA 3SU5A 1ZGIA 1DY8A 2J4IA 4Y7BA 2V6NA 1PJPA 2VU8E 3SI4H 2QN5T 3F9HA 1QB9A 4CBNA 3B8JA 2CHAB 1TNIA 1UCYH 1SOZA 2Y82A 1D3TB 3A8CA 3A8BA 1AU8A 3NWUA 1O3CA 4ZAEA 2OQ5A 1Z8GA 3DHKH 4FUGA 3ZVDA 1Y3UA 1SB1H 2GP9B 1MKXH 2B8OH 3S9AA 3UNSA 3ATLA 4D76A 3PLBA 2QV1A 3MI4A 1UHBB 1P10A 1BZXE 5C5OA 3SU0A 3UY9A 1GI1A 4IMQA 4BNRA 1EPTB 2Q1JA 3RXQA 1V2TT 4NSVA 2B7DH 1HAOH 1DX5M 3KCGH 2NU1E 5E0GA 1VJ9U 1T7CA 2ZPQA 2G81E 1FAXA 1JRTA 1ZOMA 1MTNC 8GCHF 2R2MB 1TPOA 4UDWH 4YTAA 1XX9A 4TY6A 2JKHA 1K2I1 1O2TA 3Q00A 1O3LA 2P95A 5DPAA 3STJA 2ZDAH 3E16B 1ZPBA 5CHAC 2ZFSA 4WJG2 4R8TB 2YOLA 4ABBA 1GVKB 1OWEA 1TMUH 2ODPA 3GY2A 4ABDA 5DP5A 2LNCA 1OWHA 1RFNA 2ZCLP 4IBLH 4CR9A 3BIUH 3D49H 3MHWU 4CBOA 1UHBA 1MQ6A 3EYDA 1EZQA 3ZZ9A 2XXLA 1K28D 1ZSJA 1YPEH 2UWLA 2VIPA 5EXMA 4WMEA 3T5FH 1RTLA 1DSUA 4E7NA 1IQKA 1PPZA 1QRZA 4B74A 1RIWC 2FOAA 2BVRH 1OWDA 1K1IA 2G5VA 1F92A 5HM2A 1HAVB 1G3DA 1O2YA 3BIVH 1FXYA 5A8YA 1EASA 5C1XA 1CT4E 1GI8B 1BBRE 2NU2E 2ANWA 1YYY1 2W3IA 3Q76A 1BRCE 2BVSH 1GDUA 2GX4A 5FXLA 3BTHE 5JYIA 1TGNA 3PLPA 3TJUA 6LPRA 2BHGA 3DUXH 1Y3XA 3O8RA 4Y0YE 1CHOF 3L3TA 5DP6A 1A0JA 2V35A 8ESTE 4DY7B 5EPYA 3TJOA 2ZGHA 1GBDA 5AVDA 1O2PA 1BJUA 1RS0A 2AGIX 1LVYA 1ZTKA 2Z9GA 1AIXH 1GJCB 3A7YA 3SUEA 5ABWA 1CBWB 1OWJA 1P04A 3ZZ4A 1L4ZA 1KSNA 4X1QU 1HAVA 3GDSA 5FPTA 3TNSA 2BDBA 4UEHH 5FX5A 1T31A 5EPNA 1LHGH 3SU4A 1AFQC 1AO5A 1WV7H 1G30B 3RDZA 4AFQA 3LH1A 1T32A 1O31A 1W0YH 4GCHF 1UVTH 1AB9B 1TA2A 1OPHB 4H6SB 5F03A 2QGRA 1DPOA 1C4Y2 1YKTA 1LTOA 1YPKH 4DGJA 4YOJA 1DLEA 1BBRH 2GCTC 2GVFA 1ZHPA 1AFEH 1CGHA 1GI4A 2RCEA 2XC0A 1W3CA 1MKWH 4OS7A 4XBCA 2FPZA 5EXLA 2W7UA 1TOMH 4FU9A 1GHAG 2WPKS 4YO9A 3UTUH 1Q31A 1VGCB 1BMAA 5DP8A 3OU0A 5EOKA 1ELBA 1BIOA 4IC6A 1Y8TA 2HPPH 3D65E 1EZXC 1UK2A 2ZTZA 1TNHA 1BCUH 1SLXB 4YLUA 2UUFB 5DP3A 2A32A 2OINA 5H4IB 1O3DA 2FS9A 2ZEBA 1C2DA 2XWAA 5K0HA 1C5NH 4MVNA 3TGIE 1GL0E 2XW9A 5EQQA 4IN2A 4CHAB 3TPIZ 1F2SE 3SBKA 3CENA 3OSYA 4A6LA 4D7FA 3LGVA 1KTTB 3Q3XA 4X8UH 1TAWA 5FBIA 1GBMA 1SGDE 1ELFA 1QL7A 1P8VC 1P57B 4FU7A 5LH8A 1C2EA 1XXDA 1GJ8B 1GI2A 2BLWA 5JB9S 3M5LA 1GGDB 1MZAA 4B1TA 4O97A 2CHAC 3M5OA 3F9EA 2XBYA 1L0ZA 1EJAA 1HJAB 2O8WA 4NGAH 2ZDVH 4ESTE 1VR1H 1OX1A 1W8BH 2ZIQH 3GCHC 4FUIA 1UTLM 3TJNA 1V2PT 3AASA 5EU8A 1TBZH 3RXIA 4Y71A 1LO6A 1O3PB 4O3TA 2VB0A 5DP4A 1EPTC 3TK6A 4AB9A 1QFKH 1A4WH 2ZG0H 1IQLA 1XUIA 4BTIB 3DT0H 1Z1IA 4O3UA 4CRAA 4ZKRU 1AD8H 2G4TA 1QR3E 3TNTA 1G36A 1IQMA 3A89A 1NRNH 3UWIA 2NU0E 1QGFA 5EXNA 1ZRKA 5EW1H 2A7JA 3SW2B 1TA6A 2G8TA 1DICA 1FY3A 1SC8U 3TGKE 1CQQA 1H9LB 2G4UA 2ANYA 1FUJA 4ABAA 3RC6A 1P0SH 4JZDH 2ASUB 1HV7A 1O2IA 1DWBH 1MU6B 1QHRB 1AN1E 1D3QB 2PTCE 1CGJE 1RD3B 4E05H 5GCHG 1GI0A 4NFEA 4I7YH 1SGPE 2B5TB 3MFJA 2UWOA 1GHBF 3RC4A 1EJNA 1W2KH 4I31A 1P2JA 1EOLA 2FX4A 2SNVA 2A1DB 3U8TH 5HM9A 1DUEA 4OS2A 1DS2E 1YLDA 2Q6DA 3VB7A 5EQSA 1QRXA 3AAVA 3W94A 1IOEA 3UNRA 1OSSA 1HYLA 1ZSKA 1O5FH 1UK3A 1C5PA 2P94A 2ZTYA 5A0BA 1V6DA 2G5NA 1W7XH 1W14U 1SVPA 1HAXB 2VINA 1O2MA 3T27A 2GCHF 1WAYB 3UQOA 2FOBA 3BEFB 3TK9A 8KME2 1F5RA 3TJVA 2R0KA 5DJ7A 3E1XB 2WPIS 2A4QA 4U30A 1W11U 2HNTC 1C5YB 4BTTB 2TRMA 1DWDH 3OY5U 1ANBA 4DVAU 1C5RA 4SGBE 5BPEA 3OY6U 1AVXA 1BDAA 1K1JA 4AN7A 2ZDKA 1MZDA 2EI8A 3ELAH 3QGJA 3IITA 1LVBA 4BTUB 2TGDA 1O2RA 1QCPA 3GY4A 1BTZA 3SNCA 3LT3A 2GV6A 3A8AA 3A83A 1DVAH 1HUTH 1CBWC 1MTNB 4FUEA 2IN2A 2PUQH 1P2OA 4GSOA 3M5NA 1KIGH 3MU0A 5E0HA 1C2IA 3BTGE 1LDTT 5L2ZH 1YPHC 2QC2A 4B71A 4MTBA 3RXEA 5CHAB 2R3UA 5LPFA 2VWMA 3I77A 1OP0A 1O0DH 4ZHMU 1EJMA 2WYGA 1KXBA 3V3MA 1XUGA 3BTWE 3SV6A 1SGNE 1AB9C 4SGAE 1VITH 4INKA 4Y7AA 1QURH 5E0JA 1YCPK 1YPJH 1K1MA 3RXDA 2BQ7B 2ZHWH 3LPRA 1G37A 1JWTA 1FY5A 3A81A 4ZXYH 1C4V2 1Q2WA 1TRMA 2FOCA 1UVOA 7GCHG 2K1QA 3ESTA 2TIOA 1PQ7A 3T29A 1GCTC 1SHYA 2JH5D 2O8MA 2I6QA 2AEIH 1NO9H 2XYAA 2P8OC 4K1TA 1VGCC 1TX7A 4NWKA 4ZH8A 3VGCC 1GJBB 4LZ4B 2SGEE 3C27B 4THNH 2VWLA 3BTTE 2F91A 3CP7A 3ZZ3A 1ZRBA 1K1OA 4IGDA 4UFDH 1LHEH 1O2WA 1MQ5A 3L6PA 1Z8RA 1HDTH 4A1XA 3SV2H 1S6HA 1TB6H 2PWXA 3LONA 5F6MA 1O33A 1E35B 1BRAA 3M3SA 3WY8A 4B2AA 1GVLA 1TX6A 1YBWA 3SU2A 1O5EH 5A8ZA 2VIVA 1J8AA 1JRSA 2FI5E 1O32A 3SU3A 3SJ8A 2GTBA 3M5MA 1LPZB 1YCPM 3QX5H 3HATH 1L4DA 1VITF 3NUMA 3MH4A 4X0WU 1CGIE 1Z7KA 1EZUC 1JIMA 1KLJH 2VIQA 1V2VT 1MD7A 1TE0A 1OYQA 1TMTH 5L2YH 1BRUP 1BUIA 2ANMH 2R9PA 1O2VA 2EC9H 3M7QA 1LMWB 3SORA 3M36A 1CE5A 4Y0ZE 1N6YA 1MAXA 1NFYA 2O8UA 3MYWA 3E0PB 1AFQB 1F7ZA 3A7XA 3SUGA 3UR6A 2WPLS 3SN8A 2QXJA 4TWWA 1LQEA 1A46H 1HJAC 1TNLA 2CXVA 3SJIA 4IS5A 2F83A 2H9TH 3RXSA 2ZPSA 4Q7XA 4IN1A 1J9CH 3PYHA 1O3NA 5C67A 4BXWA 1C2LA 1AQ7A 1O2HA 3RXVA 4I8LA 2WINI 1F5LA 2QY0B 3HPTB 3KEEA 4OGYA 2BXUH 1DITH 1O3OA 1HAYB 2C8YB 2TGTA 4AORA 1DUAA 3ZZ5A 1DXWA 2XBXA 1P9UA 4B76A 2J2UA 1K1LA 4ISHH 2BY8X 3BG8A 2ZHDA 1GMDG 2ZF0H 1SSXA 3D62A 1O3HA 1UTQA 1ZMLA 3KF2A 1JIRA 1GMHF 1W12U 4DIHH 2P3UB 4Y11E 3RXKA 4GPGA 2IJOB 2Y80A 1NROH 2DUCA 2WUBA 4K1EA 1WOFA 2F9NA 1GDQA 1ARCA 1C5VA 3RXLA 1UCYK 1PPBH 4IW4E 3PWCA 3KHVA 4DT7B 2A4GA 5F8TA 1PQAA 1YP9A 3U69H 2HOBA 3PO1B 2BDHA 2C8ZB 2VGCC 1N8OB 5BRRE 2C8XB 3SNBA 3RUOA 1MKXK 5C3NA 4AB8A 5JBAS 1GBEA 1T4UH 2CV3A 3ZVGA 1NU9A 3VEQB 2GKVE 2W7SA 1IQJA 3MOCA 2GDEH 4JK5A 3MU4A 3BEIB 4AZ2B 3FVFB 3GCOA 1W10U 4ISLA 1GI6A 1H4WA 1HAGE 2JH0D 4INLA 1DANH 3QGNB 1EQ9A 4UONA 2H5CA 1AHTH 4YM9A 1G9IE 1GHXH 6ESTA 3RC5A 4X1SU 1AGJA 3GCTG 4JZEH 3ZZ7A 2C4FH 2O8LA 3SZNA 5EODA 3ZVCA 5TJXA 2A5IA 2G52A 2R0LA 3P8OA 1TGTA 3GCHB 4K5ZA 1ZPZA 1LPGB 1D3PB 2H9HA 1OWKA 2WPHS 3UNQA 1T8NA 2ZGXH 3GY7A 4K8YA 3MNCA 2GMTC 2BYAX 3M35A 1P09A 2WPMS 1PPCE 2XTTB 1OYTH 3PTNA 5FHTA 1NT1A 5J4QA 2C3SA 2ZDMA 4NFFA 3L33A 5L30H 1OXGA 1NRQH 1YPMH 2ZNKH 2ZU2A 3ZVFA 1SPJA 2Z3CA 4CRFA 1EX3A 1O2KA 2D2DA 2QA9E 4WMFA 1ELAA 1MCTA 1FN8A 1P3EA 3TLOA 5E2OA 1HGTH 4KELA 5I25A 1ELCA 3LGYA 2XNIA 1C5OH 3EE0B 2VIOA 3BV9B 1SGIB 3IWMA 3P92A 5A0AE 2Y5FA 2GT7A 4WMDA 1QTFA 3SU1A 1V2OT 4D7GA 2A4OA 1EPTA 5GPIB 4Q80A 1GBIA 4BAHB 1MH0A 3GY6A 3QUMP 3VXEH 2CN0H 2BDIA 4JYUH 2SFAA 1NRRH 3RXJA 3MU8A 2AS9A 1FNIA 4ZROA 2NWNA 1M9UA 3T25A 2BDGA 1G32B 1XVOA 4XDEA 4KKDA 2XBWA 3TH3H 2Z6BD 1CA8B 5L6NH 3H7OA 1SFQB 4AFSA 3LC3A 3Q77A 1Z71A 3H7TA 2ZGBH 4WF8A 3P95A 2M5TA 3PM3A 4JZIA 5A2MH 3M37A 4LOYH 1YGCH 1HIAB 6CHAC 1EB1H 4OS5A 2BD7A 2ZQ1A 1ESTA 5ESTE 6GCHF 2BM2A 1VZQH 3NXPA 1C5WB 3ZYEA 1EAUA 1K21H 3BN9A 2H9EH 4WVPE 5JBCS 4BAKB 4E06H 1V2NT 3LGWA 1T8OA 2ZZUH 3BTFE 4B73A 1BTXA 4TPIZ 3EA7A 1ZTJA 2W26A 4Q7ZA 1SGFG 2ZC9H 2YNAA 1TNJA 1SGEE 3UFAA 1MKWK 4OS4A 2FI3E 2NU4E 4UFFH 4QT8C 4UFGH 4AX9H 1C5LH 1NESE 1O3KA 2ZI2H 1E34B 5ETXA 2HALA 5A0CA 1C1UH 2Y7XA 2AERH
chains in the Genus database with same CATH superfamily
3KYFA 4D8NA 4I32A 7GCHF 3VB5A 4DG4A 1KXAA 2D8WA 4BAOB 2ALPA 1Z1JA 2BB4A 2EY4C 1H8ED 1BITA 3MNBA 1HIAA 2VVUA 1C5QA 3PMAB 2VNTA 3SJOA 2GT8A 2VIDA 4B75A 5KECA 3SHCH 3KQDA 2A0QB 3B23B 3EE7A 3RXMA 5FPYA 1BRBE 4X8TH 1VCWA 1GCTB 2LELA 1LKAA 1P01A 4ABIA 3K6YA 1O2GH 4K69A 1UJ1A 2P8OB 3U8RH 3U98H 4BAMB 3VGCB 4MDSA 2FX6A 1GMCG 2QF3A 1BB0B 4X1PU 1TGSZ 1PYTC 1C1OA 1O3AA 2HLCA 3TITA 3A87A 1AZZA 3NCLA 2YNBA 4K1SA 4D9RA 1K1PA 3N7EA 4AG2A 3ATWA 1MMJN 5CHBA 1G3BA 1YF4A 2OC7A 1GI5A 1QRWA 2WZQA 2OD3B 1FAKH 1A7SA 3KL6A 3A7ZA 3PMJA 1QA0A 2WV4A 5B6OA 1XVMA 3DCLA 1A61H 2XCFA 1C2KA 1ELVA 3PO1C 1N8OC 1QBVH 1P05A 1PPEE 2P3TB 1O2QA 2AIQA 5AFYH 5FX6A 2WYJA 1TFXA 3P6ZB 1ETSH 1S0QA 3E90B 4Q7YA 1TNKA 1TX8A 1K22H 3SQHE 4DW2U 4B6FA 3K9XB 9LPRA 5DN6D 2BVXH 3BF6H 4AYVB 2ZU5A 2F9UA 1NFXA 1LQDB 4GUXA 1OP2A 5C1UA 3QDZB 1DLKB 4MNVA 4F4OC 2Z7FE 1JBUH 5DP7A 3SOSA 4RKOB 2BZ6H 1C1MA 3QTOH 1GBAA 3GDUA 1NZQH 2HNTF 3QO6A 1PFXC 1DDJA 4ZXXH 1SGCA 3QN7A 1P2NA 3U9AH 3FAOA 1LKBA 1P2KA 3HK6B 3PB1E 4I8JA 1B7XB 1KYNA 1G3CA 1AMHA 3ZVEA 4ABGA 3F1SB 3ZYDA 2STAE 3ZZCA 4GLYA 1GMDF 2AMDA 5TCAA 3VG8A 2PSXA 2A7CA 1BTPA 4ZKNU 3ATKA 4ISOA 3SO3A 2A31A 1GBBA 1DM4B 2A2QH 3ZV9A 5JPMH 4B2BA 2AMPA 2ZO3H 2Z9JA 1WUNH 4AG1A 5HYOA 1EKBB 4WH6A 2F43B 4DOQA 1C5XB 2B0FA 3MH6A 1E1RD 5DO4H 5I46H 3QZQA 1G2LA 3MTYA 1JXPA 1T8MA 1TGBA 4Y76A 1AY6H 1O2XA 2AMQA 1QJ7B 3K65B 1HFDA 3T26A 5CMXH 1KXFA 1GI7B 2CF9H 5DGJA 1QQUA 4HI3A 1RJXB 4WXVA 1JOUB 2CF8H 2PR3A 3RXFA 1DE7H 1KLIH 2Y5GA 1C5SA 2ZU1A 3IG6B 4TPYA 5GNDA 3RMLH 1WBGB 2WV5A 3VB4A 4D9QA 1ANCA 2ZFPH 4J2YB 3SGQE 1WDIA 1H9HE 4TSFD 3MQKC 1DOJA 1K9OE 1TQ0B 2SGDE 2HVXA 2VGCB 3A7VA 3STIA 3KIDU 8GCHG 5IDKA 4MPXA 3GS9A 2GV7A 2YMSD 2OC0A 1TALA 3ITIA 4J1YA 2FOFA 3HKJB 3RMNH 1D6RA 1O5BB 4BAQB 4NZQA 1GBJA 3F3BA 3HKIB 4JCNA 2VH6A 3TU7H 2VH0A 1C1PA 3P17H 1ANEA 1T8LA 2RA0A 2PGBB 1EFRD 1QBOA 3MMGA 3URCA 2BLOA 4AC9A 1RTKA 1HRTH 2OCVB 4XBBA 4GAWA 1GL1A 2FO9A 2VWNA 4MPVA 1BTUA 2ZKSA 2QXHA 1TRNA 1Y59T 2BZAA 3MU1A 8LPRA 4MG3A 1FJSA 2ZGJA 4ZKOU 1P12E 1C2GA 2G00A 3N7DA 1O3FA 1P03A 4I33A 4HTCH 5AFZH 3W95A 3ZV8A 1QY6A 4NA7A 4FUHA 1A5HA 1SGTA 1SGFA 5EIYA 5HGGA 4BANB 4CH2B 2UUKB 3AAUA 3M61U 2Q6GA 2GMTB 1KDQB 1O2UA 1SHHB 3RU4D 1TABE 4OS6A 1A3EH 1C2HA 1HXEH 4ABJA 3SU6A 3M7UA 1GJ6A 1NN6A 3E3TA 4U2WA 4XE4A 1COWD 1QL9A 4BXSA 3S69A 3RU4E 1F0TA 2GD4B 5HIZA 2FOEA 4UFEH 4F55A 4YT6H 3SV7A 5GJ4B 5FCRA 2ZU3A 3JZ2B 1C1TA 2QIQA 1B5GH 2FMJA 4DURA 1U6QA 1W13U 3LC5A 1ETTH 2TBSA 2H2ZA 2FM2A 4WXIA 5HMAA 3RLWH 4MNXA 1O38A 1WQSA 1IQNA 4B2CA 4X6NA 4DIIH 1YLNA 3KYGA 4CREA 2IPQX 4FUJA 3LU9B 1DT2A 4CRDA 3EQ0H 1LPKB 1ZHMA 3NPSA 4K3JA 1OP8A 2VJ1A 4MNYA 4X8VH 4Z0KA 1KDQA 1L1NA 1C9TA 1Y3YA 2WPJS 2ALVA 3RLYH 1Y5BT 3GISB 1BHXB 1MUEB 1BMLA 4E7RG 4X2VA 2JDID 1SI5H 2PHBA 3BTDE 4VGCC 1BJVA 1YC0A 3OX7U 2OXSA 3PLKA 2A2XH 3F0PA 1AUTC 3S7KB 1TYNA 1CO7E 1V2ST 3QZRA 4JZFH 4H42U 1HBTH 3LOXA 2FP7B 1A2CH 1INCA 4NG9H 3N99A 1KXEA 2QF0A 2XC5A 1S82A 1WCZA 6CHAB 3O8CA 2W5EA 1QJ1B 4AGKA 1UVSH 1QIXB 1QNJA 3MO3A 1O2ZA 2SNWA 2V3MA 2TGAA 5KGOA 3RXGA 1CA0B 4K2YA 3MNSA 3BEUA 1MCVA 1FDPA 2BD3A 3S0NA 1VCQA 4YZUA 3GDVA 3RMOH 1SLUB 4Y8ZA 2SGPE 3ZZ8A 1DY9A 4CH8B 2FLRH 1V2LT 1AI8H 1FIZA 3HGPA 2I6SA 1H1BA 1O5DH 3S9CA 3LGUA 5GWZA 2SGQE 5GDSH 2RFKC 3E8LA 4UD9H 1V3XA 3A84A 5AHGH 1Z8JB 3UREA 3Q3KA 1GHAF 1SOTA 1UMAH 1WXRA 2FOHA 3BTME 2GZ9A 1C2FA 3MNXA 1SQOA 1HXFH 1UTOA 3H5CB 3CS0A 3ODDA 1EZSC 5HXFA 3U1JB 1V2WT 4P00A 3TVJB 1A0HB 3F68H 1JMOH 4FXGH 4M7GA 2HPQH 3A7WA 1HJ9A 4INHA 1GG6B 1GJ9B 2FIRH 5GXPA 1P06A 2AHME 4OGXA 5EJZA 2FESH 1S83A 2V3HH 3AW0A 1TRYA 1T4VH 1LCYA 1YM0A 3E0NB 2ANKH 2FDAA 2C90B 1EXFA 4ASUD 1C2JA 3R3GB 2JETC 1OOKB 3PMBB 4UE7H 1O35A 1MAYA 2QYIA 1HAIH 1ZSLA 4X1RU 4YLQH 1UTMA 4X6PA 1SLVB 2ZGCA 1RGQA 5EG4A 1VCPA 3VB6A 3UWJH 2H5DA 1FMGA 1S84A 1GBFA 1FPHH 1SLWB 1XM1A 3T62A 1XUHA 1MTVA 2BLQA 4NSYA 2ODQA 3ATMA 4LK4A 9ESTA 2SGAA 5IYTA 1ANDA 1J17T 3C1KA 2ODYB 2V0BA 3QWCH 1ELGA 3D23A 1BHXF 4XOJA 1QL8A 1S85A 1SGRE 2TPIZ 1GJAB 1D3DB 2P59A 1C5MD 2RG3A 3RXTA 3U1IB 4Y8YA 1O34A 1THRH 1FQ3A 2D26C 2HLDD 4B6EA 2RA3A 4U01A 4IMZA 4KTUA 5JBBS 1C1WH 2XOKD 1UO6A 2QAAA 4RT0A 2Z3DA 5E8EH 1QBNA 3V0XA 1TBRH 5LGOA 2B9LA 1A5IA 1BTYA 3A8DA 3E91A 2HGTH 1S6FA 3URDA 5A09A 3ENSB 2XBVA 4CRBA 1EP5A 4Q2KA 1GHBG 2BD4A 4WH8A 3HK3B 1VJAU 1ZTLA 1B0FA 1K1NA 2V3OH 3LJOA 3UB0A 1KLTA 1PPFE 2G55A 1EAIA 3GY8A 1ZLRA 1ELEE 3DFLA 3RXUA 1S81A 1B0EA 3LDXH 3A82A 1HAHH 1N6XA 3SNAA 3V7TA 1J15A 1KMHB 1HAZB 1SQAA 5C5NA 2GCHG 4A5TS 3FFGA 1SGQE 1QB6A 5GCHF 1O3EA 1YPGH 1J16A 3QTVH 1HAPH 5FBEA 1E1QD 5F53A 1ZJKA 2SGFE 2UWPA 4K60A 2QCYA 1NRPH 5C20A 1WU1A 2DE9A 5J4SA 4MQAA 3I78A 3P8FA 2BOKA 1MD8A 5AF9H 4BOHA 1HNEE 3FZDA 2A7HA 1E38B 1TBQH 4DT4A 4FVBA 3S9BA 4NIWA 1O2SA 5EJLA 2A4RA 1IQHA 3PWBA 1G3EA 1CVWH 1Z8IB 2OC1A 4X6OA 3T2NA 2Z94A 2BY6X 4NWLA 1IAUA 2D1JA 3A88A 5PTPA 3UOPA 5C2ZA 3SJKA 1D9IA 5LPRA 5C94A 3LGIA 3MWIU 4PROA 1YY3A 1EUFA 2ESTE 1LVMA 1Z6EA 4TY7A 2FEQH 1V2RT 4KP0A 3NKKA 4X6MA 2OTVA 4NIXA 2F9VA 1V2JT 1FY8E 1QJ6B 1LHFH 5CDFE 1IHSH 4Y10E 1ZHRA 4AGJA 1NC6A 1O2LA 1PPGE 2HNTE 1ZYOA 4O9VA 1E0FD 2BXTH 1F5KU 3GYMA 1XXFA 3BTKE 1GI9B 3VPKA 3P8GA 4X2WA 2BD9A 5T3HA 4AOQA 2C93B 4CR5A 1C1VH 2K8IA 1NFWA 1NRSH 5G4BA 3BG4C 4TYDA 3BTQE 3SGBE 2KCAA 1CA0C 3OEED 4WWYA 5ESBA 3V12A 2ZCHP 3FP7E 2RDLA 1BBRK 2CGAA 1C1QA 3RP2A 2XRCA 4JK6A 2Y7ZA 1C2MA 1NU7B 3SZEA 2FOGA 4NIYA 2A5KA 3WW7A 1DXPA 5EGMA 3KNXA 2OBQA 3CS7A 3O8DA 1UTJA 1YPHE 2TGPZ 3SNDA 1P2QA 1MTSA 3F6UH 2XCNA 2AYWA 1CT2E 1GJDB 4P02A 2AFQB 1GJ4H 2ZHQH 1C1NA 3A80A 3EA9A 5C1YA 1UK4A 2GZ7A 3SI3H 1A3BH 2HWLB 4HFPB 2AH4X 2ZCKP 1H8IH 1MBQA 1BMMH 3F2GA 2EQNA 4FVDA 1ZJDA 1IQGA 3MO9A 3UQVA 1V2MT 4FUFA 1XKBC 3P8NA 3RXBA 3SV8A 2GZ8A 2H6MA 1Q3XA 3RXAA 1ZPCA 3SGAE 1VITG 2CMYA 1TMBH 1O5GH 3GY3A 4ABFA 1GG6C 2C8WB 2HRVA 2VWOA 1FONA 2L6OA 3EA8A 1C1SA 3SHAH 1NS3A 3FP6E 3QK1A 1GBKA 4FUBA 2BX4A 1SFIA 1NFUA 2KX4A 2IPHA 1MTWA 1J14A 4FUDA 5JBTA 3G01A 4NZLA 2PKAB 2A5AA 1TPPA 2P93A 3R0FA 3PTBA 5FCKA 4XD7D 4ZCNA 4VGCB 5EW2H 2PKSC 1L1GA 3PV4A 2Y81A 2ZA5A 1GJ5H 1TPSA 3DSGA 1O2NA 4XRNA 2VVVA 3Q3YA 3BSQA 1Y3WA 1AWFH 2ZFTA 5F8XA 1SMFE 3ZZDA 4U32A 1KTSB 1IQEA 2BQ6B 3DSPA 1NY22 4YOIA 1ESBA 1FIWA 4A1VA 3HGNA 1V2QT 4XSKU 1RTFB 2A45B 4Z6AH 4X8SH 1ARBA 1GBHA 2BDAA 1HPGA 1EAWA 2J92A 2PGQB 2EA3A 2ZECA 1GMHG 1O37A 3ATIA 1WSSH 1TIOA 2EI6A 1XUJA 1TWXB 2F9OA 1NTPA 1WTGH 3LKWA 1DFPA 1ELTA 2PKAA 3RXHA 2PV9B 1P2MA 5T6DA 5DSFA 4FOUC 4DJZB 4AFZA 4A92A 3KQBA 3F2FA 2KAIB 4RN6A 2FTLE 2WUCA 2JH6D 3ZZ6A 1O3MA 1KXCA 3RMMH 3EAJA 1IHTH 3I29A 2O8TA 1UTKA 2XC4A 2BD2A 1D4PB 1O2JA 3RXCA 3O8BA 3EGKH 3OTJE 1EATA 1GDNA 1NPMA 3M3TA 4ZKSU 2Z3EA 4TWYA 3P70B 2BX3A 5DK1A 1C9PA 3CNRA 1OKXA 1YWUA 3AVZA 4MPUA 1QA7A 4I8GA 2ZPRA 3LGTA 1IQIA 2ZWLH 1W7GH 1ZGVA 1THSH 1GCDA 1SG8B 1YPLH 1ELDE 1WYKA 4Q4LA 1H8DH 1THPB 2JETB 1FZZA 5SGAE 3ZVBA 1GBLA 2KAIA 3MO6A 1GVZA 1UVUH 1HJ8A 3UR9A 5TCCA 4A1TA 2XWBI 2ZU4A 4Y6DA 2J94A 1CHGA 2PW8H 3DFJA 1HLTH 3FANA 1XUFA 1RRKA 2LPRA 3M7TA 3LIWA 4JZ1A 2F9PA 1FY1A 2OBOA 2BY9X 1NM6A 2WV9A 4DCDA 1XUKA 1KY9A 2FS8A 1AVGH 3UOUA 4CRGA 5T6GA 3MU5A 1O3JA 2GGVB 2QF5A 3OYPA 5JDUB 3JZ1B 1O5AB 3E6PH 2OC8A 1ID5H 4ACAA 5K7RA 1AVWA 2UUYA 2OUAA 3VB3A 5F8ZA 5EQRA 3A7TA 1DWEH 1GBTA 1QQ4A 3GCTF 1DSTA 1TLDA 2PSYA 2J38A 3N7OA 1GWAA 1NBME 1AWHB 1MBMA 2NU3E 2ZP0H 2ILNA 3VXFH 2OLGA 1EOJA 1C4U2 4MPWA 4WY3A 3TK5A 2ZDNA 1O2OA 5C0UA 1AE5A 2BDYA 1EP6A 4M9FA 7ESTE 2FI4E 1MU8B 4NCYA 2R2WU 1F0RA 1BOQA 2W6JD 3A86A 5LPEA 1A1RA 1WQVH 2BQWB 1DWCH 2ZFFH 1Y5AT 2IOTA 1S0RA 4FU8A 3RXOA 4GHQA 1GHZA 1W0ZU 2F9BH 3TGJE 4Y8XA 1SL3A 3RM0H 4CRCA 1FI8A 1GJ7B 4ABEA 4I86A 1W0KD 1GHYH 1GPZA 2AGEX 3EDXB 4YT7H 3S7HB 1ETRH 1ABJH 1KXDA 2FLBH 4ASHA 1C5UA 2PTNA 1O36A 4YESB 2W3KA 3RM2H 1BMNH 1D6WA 1TPAE 2CJIA 1HCGA 3DD2H 2VIWA 1TGCA 3BTEE 2Z9LA 1H9IE 3B9FH 3RXRA 3KQCA 1SR5C 3PROA 1O3IA 1ESAA 1GI3A 1L1JA 4I8HA 1MTUA 1FLEE 1SQTA 4LXBH 1V2KT 2J9NA 6GCHG 3NZIA 2P3FH 2G51A 1CHOG 2JJ2D 5FAHA 1BMFD 7KMEH 3FZZA 4A7IB 4ACBA 2F3CE 2QXGA 4LZ1H 4OS1A 4XBDA 3GY5A 5HIYA 1AZ8A 4HZHA 5CE1A 5DKMA 1LVOA 1Z6JH 3SQEE 2ZFQH 1FPCH 4GVUA 2BDCA 1UTPA 2Q6FA 2STBE 4ZHAA 2O9QA 4JMYA 2RDEA 1L2EA 4H4FA 1TONA 1EB2A 1CT0E 3AW1A 4X2YA 1ABIH 4JYVH 3SJ9A 2BOHB 1AKSB 3F9GA 3ZZAA 1AE8H 4GCHG 1PPHE 4R0IA 1F0UA 1LHDH 2OP9A 4X2XA 1O3BA 3SUDA 1V2UT 1W0JD 3GOVB 2ZDLA 5DP9A 4I8KA 1RIWB 1X7AC 3F9FA 1S5SA 3KQEA 1WTHD 3M3VA 5GIBA 2J34A 3A85A 2ZHEH 1GBCA 1PQ5A 1XKAC 1ZR0A 3LJJA 1YCPH 1HB0B 2LP6A 1Y3VA 3BG4B 3PRBA 4ZHLU 3MH5A 1F0SA 3RXPA 3UIRA 4X1NU 5E2PA 2ZHFH 3NK8A 1O3GA 2R3YA 2H1UA 1TNGA 1XMNB 5FPSA 3UUZA 4K8BA 2THFB 4CHAC 1YLCA 4GHTA 3UPEA 4O03A 3FP8E 2FYRA 2ULLA 2BTCE 2PUXB 2FZZA 1C5ZB 5A8XA 2AGGX 1GHVH 1AKSA 5DG6A 4ZMAH 2FODA 2BLVA 5JB8S 1GHWH 2GDDA 5HKKD 2OQUA 1FV9A 1BTWA 1QB1A 2EI7A 4IC5A 1CSOE 1OS8A 2DE8A 2FTMA 3DA9B 2FXRA 1GGDC 2FOMB 4KTSA 1CU1A 1ZMJA 1BT7A 2UUJB 2KM0A 3TIUA 2Y6TA 1GMCF 2Z9IA 4RSPA 1Y5UT 2Z9KA 4MNWA 1A5GH 1P9SA 4KTCA 1OWIA 4AYYB 3GYLB 1BQYA 2Y5HA 1PYTD 4RI0A 4AFUA 1P02A 1LHCH 3V13A 3U8OH 3SNEA 4H6TA 4KGAA 1G2MA 3LH3A 3KN2A 5T6FA 4F49A 4NA8A 2GCTB 1P2IA 1FN6A 4ISNA 1N1LA 3GCNA 4FUCA 1EAXA 4JYTA 3T28A 1SKYE 3QLPH 1ZZZA 2P16A 1SGYE 2EEKA 2PFEA 1IQFA 3SUFA 2J95A 2PKSB 3RU4T 4ABHA 4YOGA 1UCYE 4ISIH 2KZ4A 1E36B 3VFEA 3ZZBA 4NA9H 4NIVA 3ODFA 1TOCB 2QXIA 7LPRA 1TQ7B 1UTNA 1ZMNA 1C5TA 3F2HA 1O39A 2BMGB 3GICB 5FL7D 2BD5A 1BTHH 2FYQA 4HGCA 3ZVAA 2ZTXA 1RXPA 1O30A 3K2UA 3SV9A 1ACBE 4Y79A 3KGPA 2VVCA 2AIPA 4ZUHA 1P3CA 1BA8B 1O5CB 4XFQA 1SBWA 1E37B 2BY5X 2BY7X 3TH2H 3MH7A 2ZFRH 1ORFA 2BD8A 2PLXA 1P11E 3PMHB 2ZQ2A 1VKYA 3TH4H 1PQ8A 1FY4A 1AUJA 4RKJB 3K6ZA 1A0LA 1UVPA 4MLFB 1C1RA 3PRDA 2FWWA 2J97A 3SU5A 1ZGIA 1DY8A 2J4IA 4Y7BA 2V6NA 1PJPA 2VU8E 5T1VA 3SI4H 2QN5T 3F9HA 1QB9A 4CBNA 2YMSC 3B8JA 2CHAB 1TNIA 1UCYH 1SOZA 2Y82A 1D3TB 3A8CA 3A8BA 1AU8A 3NWUA 1O3CA 4ZAEA 2OQ5A 1Z8GA 3DHKH 4FUGA 3ZVDA 3WWFA 1Y3UA 1SB1H 2VBCA 2GP9B 1MKXH 2B8OH 3S9AA 3UNSA 3ATLA 4D76A 3PLBA 2QV1A 3MI4A 1UHBB 1P10A 2OK5A 1BZXE 5C5OA 3SU0A 3UY9A 1GI1A 4IMQA 4BNRA 2KR7A 1EPTB 2Q1JA 3RXQA 1V2TT 4NSVA 2B7DH 1HAOH 1DX5M 3KCGH 2NU1E 5E0GA 1VJ9U 1T7CA 2ZPQA 2G81E 2GJGA 1FAXA 1JRTA 1ZOMA 1MTNC 8GCHF 2R2MB 1TPOA 4UDWH 4YTAA 1XX9A 4TY6A 2JKHA 1K2I1 1O2TA 3Q00A 1O3LA 2P95A 5DPAA 3STJA 2ZDAH 3E16B 1ZPBA 5CHAC 2ZFSA 4WJG2 4R8TB 2YOLA 4ABBA 1GVKB 1OWEA 1TMUH 2ODPA 3GY2A 4ABDA 5DP5A 2LNCA 1OWHA 1RFNA 2ZCLP 4IBLH 4CR9A 3BIUH 3D49H 3MHWU 4CBOA 1UHBA 1MQ6A 3EYDA 1EZQA 3ZZ9A 2XXLA 1K28D 1ZSJA 1FX0B 1YPEH 2UWLA 2VIPA 5EXMA 4WMEA 3T5FH 1RTLA 1DSUA 4E7NA 1IQKA 1PPZA 1QRZA 4B74A 1RIWC 2FOAA 5IK2D 2BVRH 1OWDA 1K1IA 2G5VA 1F92A 2QF4A 5HM2A 1HAVB 1G3DA 1O2YA 4YXWD 3BIVH 1FXYA 5A8YA 5C0TA 4RT1A 1EASA 2WPDD 5C1XA 2M2AA 1CT4E 1GI8B 1BBRE 2NU2E 2ANWA 1YYY1 2W3IA 3Q76A 1BRCE 2BVSH 1GDUA 2GX4A 5FXLA 3BTHE 5JYIA 2KCOA 1TGNA 3PLPA 3TJUA 6LPRA 2BHGA 3DUXH 2WHXA 1Y3XA 3O8RA 4Q63A 4Y0YE 1CHOF 3L3TA 5DP6A 1A0JA 2V35A 8ESTE 4DY7B 5EPYA 3TJOA 2ZGHA 1GBDA 5AVDA 1O2PA 4HG6A 1BJUA 1RS0A 2AGIX 1LVYA 1ZTKA 2Z9GA 1AIXH 1GJCB 3A7YA 3SUEA 5ABWA 1CBWB 1OWJA 1P04A 3ZZ4A 1L4ZA 1KSNA 3DSOA 4X1QU 1HAVA 3GDSA 5FPTA 3TNSA 2BDBA 4UEHH 5FX5A 1T31A 2CK3D 5EPNA 1LHGH 3SU4A 1AFQC 1AO5A 1WV7H 1G30B 3RDZA 4AFQA 3LH1A 3ZIAD 1T32A 1O31A 1W0YH 4GCHF 1UVTH 1AB9B 1TA2A 1OPHB 4H6SB 5F03A 2QGRA 1DPOA 1C4Y2 1YKTA 1LTOA 1YPKH 4DGJA 4YOJA 1DLEA 1BBRH 2GCTC 2GVFA 1ZHPA 1AFEH 1CGHA 1GI4A 2RCEA 2K0QA 2XC0A 1W3CA 3UAIC 1MKWH 4OS7A 4XBCA 2FPZA 5EXLA 2W7UA 1TOMH 4FU9A 1GHAG 2WPKS 4YO9A 3UTUH 3FN8A 1Q31A 1VGCB 1SQRA 1BMAA 5DP8A 3OU0A 5EOKA 3FKSD 1ELBA 1BIOA 4IC6A 1Y8TA 2HPPH 3FOAA 3D65E 1EZXC 1UK2A 2ZTZA 1TNHA 1BCUH 1SLXB 4YLUA 2UUFB 5DP3A 2A32A 2OINA 5H4IB 1O3DA 2FS9A 2ZEBA 1C2DA 2XWAA 5K0HA 1C5NH 4MVNA 3TGIE 1GL0E 2XW9A 5EQQA 4IN2A 2J98B 4CHAB 3TPIZ 2L74A 1F2SE 3SBKA 3CENA 3OSYA 4A6LA 4D7FA 3LGVA 1KTTB 3Q3XA 4X8UH 1TAWA 5FBIA 1GBMA 1SGDE 1ELFA 1QL7A 1P8VC 1P57B 4FU7A 5LH8A 1C2EA 1XXDA 1GJ8B 1GI2A 2BLWA 5JB9S 3M5LA 1GGDB 1MZAA 4B1TA 4O97A 1QZ8A 2CHAC 3M5OA 2JJ1D 3F9EA 2XBYA 1L0ZA 1EJAA 1HJAB 2O8WA 4NGAH 2ZDVH 4ESTE 1VR1H 1OX1A 1W8BH 1MABB 2ZIQH 3GCHC 4FUIA 1UTLM 3TJNA 1V2PT 3AASA 5EU8A 1TBZH 3RXIA 4Y71A 1LO6A 1O3PB 5EJ1A 2XNDD 2J98A 4O3TA 2VB0A 3OEHD 5DP4A 1EPTC 3W1EA 3TK6A 4AB9A 1QFKH 1A4WH 2ZG0H 1IQLA 1XUIA 4BTIB 3DT0H 1Z1IA 4O3UA 4CRAA 4ZKRU 1AD8H 2G4TA 1QR3E 3TNTA 1G36A 1IQMA 3A89A 1NRNH 3UWIA 2NU0E 1QGFA 5EXNA 1ZRKA 5EW1H 2A7JA 3SW2B 1TA6A 2G8TA 1DICA 1FY3A 1SC8U 3TGKE 1CQQA 1H9LB 2G4UA 2ANYA 1FUJA 3NRLA 4ABAA 3RC6A 1P0SH 4JZDH 2ASUB 1HV7A 1NBMD 1O2IA 1DWBH 1MU6B 1QHRB 1AN1E 1D3QB 2PTCE 1CGJE 1RD3B 3H09A 4E05H 5GCHG 1GI0A 4NFEA 4I7YH 1SGPE 2B5TB 3MFJA 2UWOA 1GHBF 3RC4A 1EJNA 1W2KH 4I31A 1P2JA 1EOLA 2FX4A 2SNVA 2A1DB 3U8TH 5HM9A 1DUEA 4OS2A 1DS2E 1YLDA 2Q6DA 3VB7A 5EQSA 1QRXA 3AAVA 3W94A 1IOEA 3UNRA 1OSSA 1HYLA 1ZSKA 1O5FH 1UK3A 1C5PA 2P94A 2ZTYA 5A0BA 1V6DA 2G5NA 1W7XH 1W14U 1SVPA 1HAXB 2VINA 1O2MA 3T27A 2GCHF 1WAYB 2F4LA 3OFND 3UQOA 2FOBA 3BEFB 3TK9A 8KME2 1F5RA 5C17A 3TJVA 2R0KA 2YMSB 5DJ7A 3E1XB 2WPIS 2A4QA 4U30A 1W11U 2HNTC 1C5YB 4BTTB 2TRMA 1DWDH 3OY5U 2J5UA 1ANBA 4DVAU 1C5RA 4SGBE 2V7QD 5BPEA 3OTPA 3OY6U 1AVXA 1BDAA 1K1JA 4AN7A 2ZDKA 1MZDA 2EI8A 3ELAH 3QGJA 3IITA 1LVBA 4BTUB 2TGDA 1O2RA 1QCPA 3GY4A 1BTZA 3SNCA 3LT3A 2GV6A 1K0HA 3A8AA 3A83A 1DVAH 1HUTH 1CBWC 1MTNB 4FUEA 2IN2A 3FO8D 2PUQH 1P2OA 4GSOA 3M5NA 1KIGH 3MU0A 5E0HA 1C2IA 3BTGE 1LDTT 5L2ZH 1E79D 1YPHC 2QC2A 4B71A 4MTBA 3RXEA 5CHAB 2R3UA 5LPFA 2VWMA 3I77A 1OP0A 1O0DH 4ZHMU 1EJMA 2WYGA 1KXBA 3V3MA 1XUGA 3BTWE 3SV6A 1SGNE 1AB9C 4SGAE 1VITH 4INKA 4Y7AA 1QURH 5E0JA 1YCPK 2WSSD 1YPJH 1K1MA 3RXDA 2BQ7B 2ZHWH 3LPRA 1G37A 1JWTA 1FY5A 3A81A 4ZXYH 1C4V2 1Q2WA 1TRMA 2FOCA 1UVOA 7GCHG 2K1QA 3ESTA 2TIOA 1PQ7A 3T29A 1GCTC 4F48B 1SHYA 2JH5D 2O8MA 2I6QA 2AEIH 1NO9H 2XYAA 2P8OC 4K1TA 1VGCC 1TX7A 4NWKA 4ZH8A 3VGCC 1GJBB 4LZ4B 2SGEE 3C27B 4THNH 3OAAD 2VWLA 2W6ID 3BTTE 2F91A 3CP7A 3ZZ3A 1ZRBA 1K1OA 4IGDA 4UFDH 1LHEH 1O2WA 1MQ5A 3L6PA 1Z8RA 2KCPA 1HDTH 4A1XA 4FETA 3SV2H 1S6HA 1TB6H 2PWXA 3LONA 5F6MA 1O33A 1E35B 1BRAA 3M3SA 3WY8A 4B2AA 1GVLA 1TX6A 1YBWA 3SU2A 1O5EH 5A8ZA 2VIVA 3PV2A 1J8AA 1JRSA 2FI5E 1O32A 3SU3A 3SJ8A 2GTBA 3M5MA 1LPZB 1YCPM 3QX5H 3HATH 1L4DA 1VITF 3NUMA 3MH4A 4X0WU 1CGIE 1Z7KA 1EZUC 1JIMA 1KLJH 2VIQA 1V2VT 1MD7A 4TT3D 1TE0A 1OYQA 1TMTH 5L2YH 1BRUP 1BUIA 2ANMH 2R9PA 1O2VA 2EC9H 3M7QA 1LMWB 3SORA 3M36A 3OE7D 3KQ5A 1CE5A 4Y0ZE 1UW7A 1N6YA 1MAXA 1NFYA 2O8UA 3MYWA 3E0PB 1AFQB 1F7ZA 3A7XA 3SUGA 3UR6A 2WPLS 3SN8A 2QXJA 4TWWA 1LQEA 1A46H 1HJAC 1TNLA 2CXVA 3SJIA 4IS5A 2F83A 2H9TH 3RXSA 2ZPSA 4Q7XA 4IN1A 1J9CH 3PYHA 1O3NA 2PP6A 5C67A 4BXWA 1C2LA 1AQ7A 1O2HA 3RXVA 5KEDA 4I8LA 2WINI 1F5LA 2QY0B 3HPTB 3KEEA 4OGYA 1H8HD 2QE7D 2BXUH 1DITH 1O3OA 1HAYB 2C8YB 2TGTA 4AORA 1DUAA 3ZZ5A 1DXWA 2XBXA 1P9UA 4B76A 2J2UA 1K1LA 4ISHH 2BY8X 3BG8A 2ZHDA 2JIZD 1GMDG 2ZF0H 1SSXA 3D62A 1O3HA 1UTQA 1OHHD 1ZMLA 3KF2A 1JIRA 1GMHF 1W12U 4DIHH 2P3UB 4Y11E 3RXKA 4GPGA 2IJOB 2Y80A 1NROH 2DUCA 2WUBA 4K1EA 1WOFA 2F9NA 1GDQA 1ARCA 1C5VA 3RXLA 1S6LA 1UCYK 1PPBH 4IW4E 3PWCA 3KHVA 4DT7B 2A4GA 5F8TA 1PQAA 1YP9A 3U69H 2HOBA 3PO1B 2BDHA 2C8ZB 2VGCC 1N8OB 5BRRE 2C8XB 3SNBA 3RUOA 1MKXK 5C3NA 3SYJA 4AB8A 5JBAS 1GBEA 1T4UH 2CV3A 3ZVGA 1NU9A 3VEQB 3U28C 2GKVE 2W7SA 1IQJA 2HVYB 3MOCA 2GDEH 4JK5A 3MU4A 3BEIB 4AZ2B 3FVFB 3GCOA 1W10U 4ISLA 1GI6A 1H4WA 1HAGE 2JH0D 4INLA 1DANH 3QGNB 1EQ9A 4UONA 3PV5A 2H5CA 1AHTH 4YM9A 1G9IE 1GHXH 6ESTA 3RC5A 4X1SU 1AGJA 3GCTG 4JZEH 3ZZ7A 2C4FH 2O8LA 3SZNA 5EODA 3ZVCA 5TJXA 2A5IA 2G52A 5B6LA 2R0LA 2KCYA 3P8OA 1TGTA 3GCHB 4K5ZA 1ZPZA 1LPGB 1D3PB 2H9HA 1OWKA 2WPHS 3UNQA 1T8NA 2ZGXH 3GY7A 4K8YA 3MNCA 2GMTC 2BYAX 3M35A 1P09A 2WPMS 1PPCE 2XTTB 1OYTH 3PTNA 5FHTA 3WWBA 1NT1A 5J4QA 2C3SA 2ZDMA 4NFFA 3L33A 5L30H 1OXGA 1NRQH 1YPMH 2ZNKH 2ZU2A 3ZVFA 1SPJA 2Z3CA 4CRFA 1EX3A 1O2KA 2D2DA 2QA9E 4WMFA 1ELAA 1MCTA 1FN8A 1P3EA 3TLOA 2IJD1 5E2OA 1HGTH 4KELA 4Z1MD 5I25A 1ELCA 3LGYA 2XNIA 1C5OH 3EE0B 2VIOA 3BV9B 1SGIB 3IWMA 3P92A 5A0AE 2Y5FA 2GT7A 4WMDA 1QTFA 3SU1A 1V2OT 4D7GA 2A4OA 1EPTA 5GPIB 4Q80A 1GBIA 4BAHB 1MH0A 3GY6A 3QUMP 3VXEH 2CN0H 2BDIA 4JYUH 2SFAA 1NRRH 3RXJA 3MU8A 2AS9A 1FNIA 4ZROA 2NWNA 1M9UA 3T25A 2BDGA 1G32B 1XVOA 4XDEA 4KKDA 2XBWA 3TH3H 2Z6BD 1CA8B 5L6NH 3H7OA 1SFQB 4AFSA 3LC3A 3Q77A 1Z71A 3H7TA 2ZGBH 4WF8A 3P95A 2M5TA 3PM3A 4JZIA 5A2MH 3M37A 4LOYH 1YGCH 1HIAB 6CHAC 1EB1H 4OS5A 2BD7A 2ZQ1A 1ESTA 5ESTE 6GCHF 2BM2A 1VZQH 3NXPA 1C5WB 3ZYEA 1EAUA 1K21H 3BN9A 2H9EH 4WVPE 5JBCS 4BAKB 4E06H 1V2NT 3LGWA 1T8OA 2ZZUH 3BTFE 4B73A 1BTXA 4TPIZ 3EA7A 1ZTJA 2W26A 4Q7ZA 1SGFG 2ZC9H 3F0OA 2YNAA 1TNJA 1SGEE 3UFAA 1MKWK 4OS4A 2FI3E 2NU4E 4UFFH 4QT8C 4UFGH 2KFWA 4AX9H 1C5LH 1NESE 1O3KA 2ZI2H 4OM9A 1E34B 5ETXA 2HALA 5A0CA 3AK5A 1C1UH 2Y7XA 2AERH
chains in the Genus database with same CATH topology
4D8NA 4I32A 7GCHF 3VB5A 4DG4A 1KXAA 2D8WA 4BAOB 2ALPA 1Z1JA 2BB4A 1BITA 3MNBA 1HIAA 2VVUA 1C5QA 3PMAB 2VNTA 3SJOA 2GT8A 2VIDA 4B75A 3SHCH 3KQDA 2A0QB 3B23B 3RXMA 5FPYA 1BRBE 4X8TH 1VCWA 1GCTB 1LKAA 1P01A 4ABIA 3K6YA 1O2GH 4K69A 1UJ1A 2P8OB 3U8RH 3U98H 4BAMB 3VGCB 4MDSA 2FX6A 1GMCG 2QF3A 1BB0B 4X1PU 1TGSZ 1PYTC 1C1OA 1O3AA 2HLCA 3TITA 3A87A 1AZZA 3NCLA 2YNBA 4K1SA 4D9RA 1K1PA 4AG2A 3ATWA 1MMJN 1G3BA 1YF4A 2OC7A 1GI5A 1QRWA 2OD3B 1FAKH 1A7SA 3KL6A 3A7ZA 3PMJA 1QA0A 2WV4A 5B6OA 1XVMA 1A61H 2XCFA 1C2KA 1ELVA 3PO1C 1N8OC 1QBVH 1P05A 1PPEE 2P3TB 1O2QA 2AIQA 5AFYH 5FX6A 2WYJA 1TFXA 3P6ZB 1ETSH 1S0QA 3E90B 4Q7YA 1TNKA 1TX8A 1K22H 3SQHE 4DW2U 9LPRA 3K9XB 2BVXH 3BF6H 4AYVB 2ZU5A 2F9UA 1NFXA 1LQDB 4GUXA 1OP2A 5C1UA 3QDZB 1DLKB 4MNVA 4F4OC 2Z7FE 1JBUH 5DP7A 3SOSA 4RKOB 2BZ6H 1C1MA 3QTOH 1GBAA 3GDUA 1NZQH 2HNTF 3QO6A 1PFXC 1DDJA 4ZXXH 1SGCA 3QN7A 1P2NA 3U9AH 3FAOA 1LKBA 1P2KA 3HK6B 3PB1E 4I8JA 1B7XB 1KYNA 1G3CA 1AMHA 3ZVEA 4ABGA 3F1SB 3ZYDA 2STAE 3ZZCA 4GLYA 1GMDF 2AMDA 5TCAA 2PSXA 2A7CA 1BTPA 4ZKNU 3ATKA 4ISOA 3SO3A 2A31A 1GBBA 1DM4B 2A2QH 3ZV9A 5JPMH 4B2BA 2AMPA 2ZO3H 2Z9JA 1WUNH 4AG1A 5HYOA 1EKBB 4WH6A 4DOQA 1C5XB 2B0FA 3MH6A 5DO4H 5I46H 3QZQA 1G2LA 3MTYA 1JXPA 1T8MA 1TGBA 4Y76A 1AY6H 1O2XA 2AMQA 1QJ7B 3K65B 1HFDA 3T26A 5CMXH 1KXFA 1GI7B 2CF9H 5DGJA 1QQUA 4HI3A 1RJXB 4WXVA 1JOUB 2CF8H 2PR3A 3RXFA 1DE7H 1KLIH 2Y5GA 1C5SA 2ZU1A 3IG6B 4TPYA 3RMLH 1WBGB 2WV5A 3VB4A 4D9QA 1ANCA 2ZFPH 4J2YB 3SGQE 1H9HE 1DOJA 1K9OE 1TQ0B 2SGDE 2HVXA 2VGCB 3A7VA 3STIA 3KIDU 8GCHG 5IDKA 4MPXA 2GV7A 2OC0A 1TALA 3ITIA 4J1YA 2FOFA 3HKJB 3RMNH 1D6RA 1O5BB 4BAQB 4NZQA 1GBJA 3HKIB 4JCNA 2VH6A 3TU7H 2VH0A 1C1PA 3P17H 1ANEA 1T8LA 2RA0A 2PGBB 1QBOA 3MMGA 3URCA 2BLOA 1RTKA 1HRTH 2OCVB 4XBBA 4GAWA 1GL1A 2FO9A 2VWNA 4MPVA 1BTUA 2ZKSA 2QXHA 1TRNA 1Y59T 2BZAA 3MU1A 8LPRA 4MG3A 1FJSA 2ZGJA 4ZKOU 1P12E 1C2GA 2G00A 1O3FA 1P03A 4I33A 4HTCH 5AFZH 3W95A 3ZV8A 1QY6A 4NA7A 4FUHA 1A5HA 1SGTA 1SGFA 5HGGA 4BANB 4CH2B 2UUKB 3AAUA 3M61U 2Q6GA 2GMTB 1KDQB 1O2UA 1SHHB 3RU4D 1TABE 4OS6A 1A3EH 1C2HA 1HXEH 4ABJA 3SU6A 3M7UA 1GJ6A 1NN6A 3E3TA 4U2WA 4XE4A 1QL9A 4BXSA 3S69A 3RU4E 1F0TA 2GD4B 2FOEA 4UFEH 4YT6H 3SV7A 5GJ4B 5FCRA 2ZU3A 3JZ2B 1C1TA 2QIQA 1B5GH 2FMJA 4DURA 1U6QA 1W13U 3LC5A 1ETTH 2TBSA 2H2ZA 2FM2A 4WXIA 5HMAA 3RLWH 4MNXA 1O38A 1WQSA 1IQNA 4B2CA 4X6NA 4DIIH 4CREA 4FUJA 3LU9B 1DT2A 4CRDA 3EQ0H 1LPKB 1ZHMA 3NPSA 4K3JA 1OP8A 2VJ1A 4MNYA 4X8VH 4Z0KA 1KDQA 1L1NA 1C9TA 1Y3YA 2WPJS 2ALVA 3RLYH 1Y5BT 3GISB 1BHXB 1MUEB 1BMLA 4E7RG 4X2VA 1SI5H 2PHBA 3BTDE 4VGCC 1BJVA 1YC0A 3OX7U 2OXSA 3PLKA 2A2XH 1AUTC 3S7KB 1TYNA 1CO7E 1V2ST 3QZRA 4JZFH 4H42U 1HBTH 3LOXA 2FP7B 1A2CH 1INCA 4NG9H 1KXEA 2QF0A 2XC5A 1S82A 1WCZA 6CHAB 3O8CA 2W5EA 1QJ1B 4AGKA 1UVSH 1QIXB 1QNJA 3MO3A 1O2ZA 2SNWA 2TGAA 3RXGA 1CA0B 4K2YA 3MNSA 3BEUA 1MCVA 1FDPA 2BD3A 3S0NA 1VCQA 4YZUA 3GDVA 3RMOH 1SLUB 4Y8ZA 2SGPE 3ZZ8A 1DY9A 4CH8B 2FLRH 1V2LT 1AI8H 1FIZA 3HGPA 2I6SA 1H1BA 1O5DH 3S9CA 3LGUA 5GWZA 2SGQE 5GDSH 3E8LA 4UD9H 1V3XA 3A84A 5AHGH 1Z8JB 3UREA 3Q3KA 1GHAF 1SOTA 1UMAH 2FOHA 3BTME 2GZ9A 1C2FA 3MNXA 1SQOA 1HXFH 1UTOA 3H5CB 3CS0A 3ODDA 1EZSC 5HXFA 3U1JB 1V2WT 3TVJB 1A0HB 3F68H 1JMOH 4FXGH 4M7GA 2HPQH 3A7WA 1HJ9A 4INHA 1GG6B 1GJ9B 2FIRH 5GXPA 1P06A 4OGXA 2FESH 1S83A 2V3HH 3AW0A 1TRYA 1T4VH 1LCYA 1YM0A 3E0NB 2ANKH 2FDAA 2C90B 1EXFA 1C2JA 3R3GB 2JETC 1OOKB 3PMBB 4UE7H 1O35A 1MAYA 2QYIA 1HAIH 1ZSLA 4X1RU 4YLQH 1UTMA 4X6PA 1SLVB 2ZGCA 1RGQA 5EG4A 1VCPA 3VB6A 3UWJH 2H5DA 1FMGA 1S84A 1GBFA 1FPHH 1SLWB 1XM1A 3T62A 1XUHA 1MTVA 2BLQA 4NSYA 2ODQA 3ATMA 4LK4A 9ESTA 2SGAA 5IYTA 1ANDA 1J17T 3C1KA 2ODYB 2V0BA 3QWCH 1ELGA 3D23A 1BHXF 4XOJA 1QL8A 1S85A 1SGRE 2TPIZ 1GJAB 1D3DB 2P59A 1C5MD 2RG3A 3RXTA 3U1IB 4Y8YA 1O34A 1THRH 1FQ3A 2D26C 2RA3A 4U01A 4IMZA 4KTUA 5JBBS 1C1WH 1UO6A 2QAAA 2Z3DA 5E8EH 1QBNA 3V0XA 1TBRH 5LGOA 2B9LA 1A5IA 1BTYA 3A8DA 3E91A 2HGTH 1S6FA 3URDA 5A09A 3ENSB 2XBVA 4CRBA 1EP5A 4Q2KA 1GHBG 2BD4A 4WH8A 3HK3B 1VJAU 1ZTLA 1B0FA 1K1NA 2V3OH 3LJOA 1KLTA 1PPFE 2G55A 1EAIA 3GY8A 1ZLRA 1ELEE 3DFLA 3RXUA 1S81A 1B0EA 3LDXH 3A82A 1HAHH 1N6XA 3SNAA 3V7TA 1J15A 1HAZB 1SQAA 5C5NA 2GCHG 4A5TS 3FFGA 1SGQE 1QB6A 5GCHF 1O3EA 1YPGH 1J16A 3QTVH 1HAPH 5FBEA 1ZJKA 2SGFE 2UWPA 4K60A 2QCYA 1NRPH 5C20A 1WU1A 2DE9A 5J4SA 4MQAA 3I78A 3P8FA 2BOKA 1MD8A 5AF9H 4BOHA 1HNEE 3FZDA 2A7HA 1E38B 1TBQH 4FVBA 3S9BA 4NIWA 1O2SA 2A4RA 1IQHA 3PWBA 1G3EA 1CVWH 1Z8IB 2OC1A 4X6OA 3T2NA 2Z94A 2BY6X 4NWLA 1IAUA 2D1JA 3A88A 5PTPA 3UOPA 5C2ZA 3SJKA 1D9IA 5LPRA 3LGIA 3MWIU 4PROA 1EUFA 2ESTE 1LVMA 1Z6EA 4TY7A 2FEQH 1V2RT 4KP0A 3NKKA 4X6MA 2OTVA 4NIXA 2F9VA 1V2JT 1FY8E 1QJ6B 1LHFH 1IHSH 4Y10E 1ZHRA 4AGJA 1NC6A 1O2LA 1PPGE 2HNTE 1ZYOA 4O9VA 1E0FD 2BXTH 1F5KU 3GYMA 1XXFA 3BTKE 1GI9B 3VPKA 3P8GA 4X2WA 2BD9A 5T3HA 4AOQA 2C93B 4CR5A 1C1VH 1NFWA 1NRSH 5G4BA 3BG4C 4TYDA 3BTQE 3SGBE 1CA0C 5ESBA 4WWYA 3V12A 2ZCHP 3FP7E 2RDLA 1BBRK 2CGAA 1C1QA 3RP2A 2XRCA 4JK6A 2Y7ZA 1C2MA 1NU7B 2FOGA 4NIYA 2A5KA 1DXPA 5EGMA 3KNXA 2OBQA 3CS7A 3O8DA 1UTJA 1YPHE 2TGPZ 3SNDA 1P2QA 1MTSA 3F6UH 2XCNA 2AYWA 1CT2E 1GJDB 2AFQB 1GJ4H 2ZHQH 1C1NA 3A80A 3EA9A 5C1YA 1UK4A 2GZ7A 3SI3H 1A3BH 2HWLB 4HFPB 2AH4X 2ZCKP 1H8IH 1MBQA 1BMMH 4FVDA 1ZJDA 1IQGA 3MO9A 3UQVA 1V2MT 4FUFA 1XKBC 3P8NA 3RXBA 3SV8A 2GZ8A 2H6MA 1Q3XA 3RXAA 1ZPCA 3SGAE 1VITG 2CMYA 1TMBH 1O5GH 3GY3A 4ABFA 1GG6C 2C8WB 2HRVA 2VWOA 1FONA 3EA8A 1C1SA 3SHAH 1NS3A 3FP6E 3QK1A 1GBKA 4FUBA 2BX4A 1SFIA 1NFUA 2IPHA 1MTWA 1J14A 4FUDA 5JBTA 3G01A 4NZLA 2PKAB 2A5AA 1TPPA 2P93A 3R0FA 3PTBA 5FCKA 4VGCB 5EW2H 2PKSC 1L1GA 3PV4A 2Y81A 2ZA5A 1GJ5H 1TPSA 1O2NA 2VVVA 3Q3YA 3BSQA 1Y3WA 1AWFH 2ZFTA 5F8XA 1SMFE 3ZZDA 4U32A 1KTSB 1IQEA 2BQ6B 1NY22 4YOIA 1ESBA 1FIWA 4A1VA 3HGNA 1V2QT 4XSKU 1RTFB 2A45B 4Z6AH 4X8SH 1ARBA 1GBHA 2BDAA 1HPGA 1EAWA 2J92A 2PGQB 2EA3A 2ZECA 1GMHG 1O37A 3ATIA 1WSSH 1TIOA 2EI6A 1XUJA 1TWXB 2F9OA 1NTPA 1WTGH 3LKWA 1DFPA 1ELTA 2PKAA 3RXHA 2PV9B 1P2MA 5T6DA 4DJZB 4AFZA 4A92A 3KQBA 4RN6A 2KAIB 2FTLE 2WUCA 2JH6D 3ZZ6A 1O3MA 1KXCA 3RMMH 3EAJA 1IHTH 3I29A 2O8TA 1UTKA 2XC4A 2BD2A 1D4PB 1O2JA 3RXCA 3O8BA 3EGKH 3OTJE 1EATA 1GDNA 1NPMA 3M3TA 4ZKSU 2Z3EA 4TWYA 3P70B 2BX3A 5DK1A 1C9PA 1OKXA 4MPUA 3AVZA 1QA7A 4I8GA 2ZPRA 3LGTA 1IQIA 2ZWLH 1W7GH 1ZGVA 1THSH 1GCDA 1SG8B 1YPLH 1ELDE 1WYKA 1H8DH 1THPB 2JETB 1FZZA 5SGAE 3ZVBA 1GBLA 2KAIA 3MO6A 1GVZA 1UVUH 1HJ8A 3UR9A 5TCCA 4A1TA 2XWBI 2ZU4A 4Y6DA 2J94A 1CHGA 2PW8H 3DFJA 1HLTH 3FANA 1XUFA 1RRKA 2LPRA 3M7TA 3LIWA 4JZ1A 2F9PA 1FY1A 2OBOA 2BY9X 1NM6A 4DCDA 1XUKA 1KY9A 2FS8A 1AVGH 3UOUA 4CRGA 5T6GA 3MU5A 1O3JA 2GGVB 3OYPA 5JDUB 3JZ1B 1O5AB 3E6PH 2OC8A 1ID5H 5K7RA 1AVWA 2UUYA 2OUAA 3VB3A 5F8ZA 5EQRA 3A7TA 1DWEH 1GBTA 1QQ4A 3GCTF 1DSTA 1TLDA 2PSYA 2J38A 3N7OA 1GWAA 1AWHB 1MBMA 2NU3E 2ZP0H 2ILNA 3VXFH 2OLGA 1EOJA 1C4U2 4MPWA 4WY3A 3TK5A 2ZDNA 1O2OA 1AE5A 2BDYA 1EP6A 7ESTE 2FI4E 1MU8B 4NCYA 2R2WU 1F0RA 1BOQA 3A86A 5LPEA 1A1RA 1WQVH 2BQWB 1DWCH 2ZFFH 1Y5AT 2IOTA 1S0RA 4FU8A 3RXOA 4GHQA 1GHZA 1W0ZU 2F9BH 3TGJE 4Y8XA 1SL3A 3RM0H 4CRCA 1FI8A 1GJ7B 4ABEA 1GHYH 1GPZA 2AGEX 3EDXB 4YT7H 3S7HB 1ETRH 1ABJH 1KXDA 2FLBH 4ASHA 1C5UA 2PTNA 1O36A 4YESB 2W3KA 3RM2H 1BMNH 1D6WA 1TPAE 2CJIA 1HCGA 3DD2H 2VIWA 1TGCA 3BTEE 2Z9LA 1H9IE 3B9FH 3RXRA 3KQCA 1SR5C 3PROA 1O3IA 1ESAA 1GI3A 1L1JA 4I8HA 1MTUA 1FLEE 1SQTA 4LXBH 1V2KT 2J9NA 6GCHG 3NZIA 2P3FH 2G51A 1CHOG 5FAHA 7KMEH 3FZZA 4A7IB 2F3CE 2QXGA 4LZ1H 4OS1A 4XBDA 3GY5A 1AZ8A 4HZHA 5CE1A 5DKMA 1LVOA 1Z6JH 3SQEE 2ZFQH 1FPCH 4GVUA 2BDCA 1UTPA 2Q6FA 2STBE 4ZHAA 2O9QA 4JMYA 1L2EA 4H4FA 1TONA 1EB2A 1CT0E 3AW1A 4X2YA 1ABIH 4JYVH 3SJ9A 2BOHB 1AKSB 3F9GA 3ZZAA 1AE8H 4GCHG 1PPHE 4R0IA 1F0UA 1LHDH 2OP9A 4X2XA 1O3BA 3SUDA 1V2UT 3GOVB 2ZDLA 5DP9A 4I8KA 1RIWB 1X7AC 3F9FA 1S5SA 3KQEA 1WTHD 3M3VA 5GIBA 2J34A 3A85A 2ZHEH 1GBCA 1PQ5A 1XKAC 1ZR0A 3LJJA 1YCPH 1HB0B 1Y3VA 3BG4B 4ZHLU 3MH5A 1F0SA 3RXPA 3UIRA 4X1NU 5E2PA 2ZHFH 3NK8A 1O3GA 2R3YA 2H1UA 1TNGA 1XMNB 5FPSA 3UUZA 4K8BA</