3M35A

Trypsin in complex with the inhibitor 1-[3-(aminomethyl)phenyl]-n-[3-fluoro-2'-(methylsulfonyl)biphenyl-4-yl]-3-(trifluoromethyl)-1h-pyrazole-5-carboxamide (dpc423)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title Discovery of 1-(2-Aminomethylphenyl)-3-trifluoromethyl-N-[3-fluoro-2'-(aminosulfonyl)[1,1'-biphenyl)]-1H-pyrazole-5-carboxyamide (DPC602), a Potent, Selective, and Orally Bioavailable Factor Xa Inhibitor
pubmed rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m35A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m35A02
5EW2H 1DY9A 1EPTB 4IMZA 1D4PB 1AI8H 2BDHA 3EA7A 1VJ9U 3TIUA 1T8LA 5C3NA 4Y11E 2A7CA 2AERH 3SUFA 4ZMAH 1O3PB 3ZZ9A 4B71A 1AN1E 2FOCA 1IQIA 2ALPA 4AGKA 3FP8E 2FYQA 3EAJA 1BZXE 2B0FA 2R3YA 1UTJA 3JZ2B 1EZSC 4Z0KA 5T6DA 1NRQH 2ZP0H 3MNSA 4TWWA 4DT7B 5EQSA 1PYTD 3A87A 1GBHA 2GZ7A 3SV6A 1PPBH 1DWBH 4YESB 3GY5A 1H4WA 5DP6A 3U8RH 1O3JA 1S6FA 2HALA 1O2JA 4YM9A 2FI5E 1D3DB 5LPFA 4CRFA 1IHSH 1CA0B 1O5AB 1T31A 4Y8XA 1W0ZU 2C90B 4NSYA 3RXAA 2PKAB 1QURH 2FOHA 2BQ6B 4UD9H 1MU8B 1GI0A 2Q6GA 1Q2WA 2K1QA 2BD4A 3ATWA 1ESAA 2BHGA 2GV6A 1O5CB 3RXEA 1EQ9A 1VZQH 1P57B 1BDAA 3PB1E 1P2JA 1ZTJA 3BTTE 4UONA 3V13A 1VITH 1NT1A 1RIWC 5JB8S 1M9UA 1ANCA 2BZ6H 4WMFA 2M5TA 3RC5A 3A8DA 2VIVA 1DT2A 3R3GB 1VGCC 1GHAF 1TA2A 1PPCE 3T25A 2HRVA 1FDPA 3TGJE 3M37A 1HXFH 2AIPA 2QYIA 3FVFB 4WJG2 3QN7A 3UFAA 2PLXA 2TIOA 4B76A 3M7UA 1T8MA 1PYTC 5E2OA 4I7YH 1AUTC 1SI5H 1CHGA 6CHAB 1GHVH 3M5NA 4UFGH 3NUMA 3MNBA 4X6OA 3GDSA 4NWKA 3GY6A 5C1UA 1TB6H 4SGAE 3TH4H 4NA8A 3KIDU 2Y5HA 1O3HA 2A32A 3RM0H 2FOBA 1MKXK 1E34B 1FZZA 3UUZA 1AU8A 1JBUH 1SL3A 4U01A 1GI2A 1L0ZA 1VITF 1GHAG 1XUJA 2BOHB 4JZDH 1TNHA 1CVWH 1MZAA 4Y0ZE 1GHXH 4CHAB 3SU6A 3ITIA 1FI8A 1ABJH 1UVOA 2GZ9A 2ZU4A 4LOYH 2LPRA 4ISOA 5IYTA 3LONA 2ZTYA 1GCTC 1AWHB 2HVXA 1NN6A 1TRMA 2AGGX 4X6MA 3LGUA 1FJSA 3RXCA 4FU9A 5AVDA 2JETC 1ELBA 1XMNB 1UTQA 1A5GH 2J4IA 3S69A 1O2WA 2HPPH 3GCHC 3RP2A 4Y6DA 2ILNA 2EA3A 4JZFH 1LDTT 3RXOA 1TGNA 1VITG 2GGVB 2V3OH 2WPHS 1CBWC 5FPSA 2VJ1A 2A7HA 1O5EH 1P04A 1P2IA 1QGFA 3AW0A 1GBTA 1UCYH 2A1DB 1BHXB 1FIWA 1MQ6A 3ZZ3A 1AE8H 2ZDLA 1S82A 1DWCH 4GHTA 2F83A 2J9NA 5DP7A 3ELAH 1O3KA 2QGRA 1ZSJA 1O2SA 1TBRH 2GZ8A 3P6ZB 3VB4A 2BVSH 3TJNA 5DO4H 5I25A 4KELA 3SU0A 1TNGA 1XUFA 1GJCB 1O30A 1FXYA 4X1SU 1C1QA 3D23A 4KP0A 2WUBA 1IQHA 4ESTE 1GBIA 3KQBA 1IAUA 3E1XB 1V2TT 3A7ZA 3LKWA 5TCCA 8GCHF 4AOQA 1PQ7A 3EYDA 1C5YB 1C2LA 2BLOA 4ISNA 1SGPE 2J2UA 3LH3A 4IGDA 3S9CA 1HJ9A 4IW4E 1UTOA 5ETXA 1TE0A 4NIVA 4WY3A 3ZZCA 2A4QA 3ZZ6A 5E0GA 2ZDAH 1N1LA 2WPLS 5HYOA 1ZHMA 4FVDA 1GHYH 3KN2A 1VCQA 5A8XA 2HOBA 1PFXC 1PQAA 1O2IA 1BBRE 1C1NA 3VXFH 2BVRH 4B75A 2OTVA 5A0AE 1Z6EA 2ALVA 8GCHG 1UHBA 2BDGA 3BEUA 1GJBB 2AS9A 4AYVB 1NFYA 5DJ7A 1XUKA 2A2XH 1SQTA 2GCTB 2ZHEH 4H42U 1AO5A 3SUDA 1OYQA 1CO7E 1WCZA 1ESTA 2TRMA 1UJ1A 1K21H 2W5EA 4X2XA 1FQ3A 3FZZA 1VJAU 3Q3KA 3UOPA 4DVAU 1YPLH 1W12U 1NY22 2SGFE 3PROA 5GXPA 3L3TA 1C1TA 1HB0B 1O2OA 1Z1IA 1C5PA 2VINA 3U8TH 1FMGA 3K6YA 3MO6A 3VGCB 3ZVFA 3RUOA 3MU8A 1HAIH 1NTPA 4WWYA 1Y3UA 2C8ZB 2F9PA 1EB2A 1ELFA 3UNQA 6GCHF 4E05H 1F0SA 4I31A 2ZWLH 4I32A 1NRNH 4H4FA 1SGRE 1GDUA 3VXEH 2ZHQH 1P3EA 5FX6A 1Q31A 3UIRA 1Z6JH 3CENA 4I8LA 1Q3XA 3TK9A 5GJ4B 1JXPA 1YPHE 1GI8B 3CS0A 3SV8A 3T2NA 3B9FH 1KXFA 1TGBA 4GAWA 3SGBE 3SORA 1NFXA 2Q1JA 3M7QA 1C4V2 1ELCA 3RM2H 1UTMA 1KXCA 1WQSA 3QUMP 1V2WT 3KQCA 3SQEE 3HATH 4F49A 1C2HA 1P3CA 5GPIB 3ZVGA 1XVMA 2VWOA 2HPQH 1C2EA 1F5LA 1MTNC 4O9VA 1QTFA 4YOJA 1XUHA 1ELDE 1RJXB 2ZGXH 3R0FA 1IQGA 6GCHG 1PPZA 5E0HA 1L1JA 5HMAA 6CHAC 2OUAA 2IOTA 1A7SA 2OP9A 4OS4A 4IMQA 1UTKA 2PSXA 2FODA 2O8UA 2P8OB 3SU2A 1TPOA 2WINI 4E7RG 2I6QA 2G4TA 3SJIA 1TIOA 1V2JT 2BOKA 5G4BA 1E35B 1KXBA 2A4GA 5HXFA 4X8UH 5H4IB 4I8JA 3UY9A 5F03A 1TNJA 1V2MT 4NIWA 1KXEA 3VB5A 1C1RA 2XXLA 3C1KA 1ELAA 3AW1A 4D7FA 1P9UA 2GCHF 1UCYE 4CHAC 1GHWH 4FUHA 4WVPE 2P3TB 2VVCA 4Q2KA 2AEIH 1MTWA 1YPHC 3BG4C 3GICB 5EW1H 2OCVB 1TA6A 1ZPCA 4FUGA 1KY9A 3S7KB 5EXNA 5GIBA 1C5SA 1QB9A 1C2DA 4MPUA 1HAXB 4PROA 1GI7B 4Y7AA 3U1JB 5LPEA 1P10A 1AZ8A 3GY7A 1H9LB 4CRAA 1QJ1B 3MI4A 2Z7FE 3Q00A 1NU9A 1SC8U 1F0RA 3QK1A 4JZ1A 1MKWK 1IHTH 4LXBH 2BLWA 1XXFA 3PYHA 3ODDA 2ZQ2A 4ABAA 1BT7A 2GCHG 3M3TA 4Y0YE 4X1PU 1CQQA 1EP5A 2AMPA 1HJAB 1QY6A 1SR5C 4O97A 1SPJA 1GI5A 1ZPZA 3W95A 1OOKB 2QV1A 5T6GA 2AGIX 2Y7XA 5FBEA 2B7DH 1O3DA 1DXPA 2CF9H 5FCKA 4WF8A 2ZFTA 3GISB 1TRNA 3UQVA 1LHFH 2ZCHP 1P06A 4K8YA 7ESTE 1C2GA 1ABIH 1YM0A 1EJAA 2O9QA 1QJ6B 4KKDA 1WUNH 1BRAA 2UWOA 2R3UA 1K1OA 2WV4A 1SQAA 4JK5A 4E06H 3M5MA 1GMHF 1FN8A 4MPWA 2Z6BD 2XW9A 3TNSA 4ISHH 3SNAA 3LGYA 2VU8E 1QIXB 2W3IA 4MPVA 5T3HA 3U69H 1BTUA 2A5KA 3P8NA 3EA9A 1GGDB 3TJUA 3VFEA 1SVPA 3QWCH 5E8EH 2RDLA 2SGPE 1NO9H 4FU7A 1WAYB 2VWNA 2BXTH 1KTTB 1V2ST 1MH0A 2QN5T 1EUFA 1D3PB 1ZHRA 2GCTC 1GMHG 2XBVA 2XCNA 4FUBA 4HI3A 4NA7A 1O38A 2P3FH 2TPIZ 1UO6A 1QL7A 3D49H 1C1PA 1E38B 1THRH 2RCEA 1DSTA 2QAAA 3MWIU 1EZQA 1LPKB 4GHQA 1O2ZA 3I77A 1AWFH 3O8RA 2AFQB 1BTYA 4TPYA 3P8OA 4AGJA 1AVWA 4TY7A 1Y3WA 3A7WA 2FYRA 2ANWA 1FLEE 1OWDA 2ZFSA 3TK6A 1B0EA 3K6ZA 3ZZ7A 2F9UA 5FBIA 5EG4A 1FY1A 2QC2A 1KYNA 3KEEA 5TJXA 3BTFE 3QGNB 9LPRA 2D26C 1HYLA 4FUFA 1S81A 2FOEA 4A92A 3ZVDA 1JMOH 1MTSA 2XC5A 1BTHH 4ISIH 1ETRH 1GBAA 3MNCA 3UTUH 3CP7A 3GOVB 3OSYA 1ANEA 2XC4A 3A85A 2RG3A 4D9RA 5JBBS 3M35A 8ESTE 4ZKNU 1K2I1 3ZZDA 1J15A 3TLOA 4AORA 2BX3A 1AFQB 1KIGH 3NZIA 4K1EA 1SGEE 2GMTB 2SNWA 1WQVH 4INHA 4AB9A 4ZAEA 1XUIA 1CGIE 1DLKB 2QXGA 4Y71A 1UHBB 1HRTH 2P8OC 5A2MH 2P95A 1TX7A 2JKHA 3HKJB 3Q3YA 1ORFA 5EQRA 2NWNA 3OY6U 2G52A 1VCPA 3ZZBA 1TBQH 2WPIS 4X6NA 1ZRKA 3E0PB 3HPTB 1THSH 4AG2A 1C5UA 3MU1A 2ZGJA 2J38A 1C5RA 3SGAE 1LHCH 2R2MB 4YO9A 1P11E 3EE0B 1GBMA 1GPZA 1P02A 2VB0A 3ZZ4A 3ATIA 3A8BA 1ZMNA 1T7CA 4K2YA 1QRXA 1AFEH 5IDKA 1TFXA 5CHAB 2XCFA 4VGCB 1HAGE 2ZFQH 1ZOMA 2OC1A 2P3UB 1W2KH 2OD3B 2STAE 5C5NA 4JMYA 4NFEA 3AASA 1EXFA 1Y5BT 3EDXB 4K1SA 5DGJA 1S6HA 2GTBA 2KAIB 3RXPA 1FY3A 2BMGB 1SGDE 1YYY1 5JBAS 1C2MA 4MTBA 5DK1A 4AB8A 1T32A 3QLPH 1S0RA 2VVUA 1BJVA 1ARCA 1O35A 3PMAB 3M5OA 1UVUH 1F0UA 4JZIA 2Z9JA 5DP5A 1TRYA 4NWLA 1TNIA 2NU1E 2BD2A 2XRCA 2VNTA 2ZHFH 1MBMA 2A4RA 1HJAC 2VWLA 2FOFA 1KXAA 5BPEA 1G32B 1TONA 2CJIA 3PV4A 2J34A 4ZUHA 5JPMH 1W11U 2ZO3H 1TALA 3PMBB 1AMHA 2P59A 1Y59T 4CREA 1BRBE 1WOFA 3O8BA 2C8WB 1SOTA 2WUCA 1GVLA 3O8CA 2GD4B 2A5IA 4RSPA 2XBWA 3KL6A 3FP6E 1IQEA 3V12A 1RD3B 2NU4E 2DE9A 4OS5A 1BBRH 4WXVA 2QXIA 1MAXA 5EQQA 3MH7A 1BTPA 2ZDVH 3SZNA 3V0XA 1BTZA 1QL8A 5FXLA 3RXFA 1A4WH 1XUGA 1OXGA 1UK4A 1K1PA 1V2OT 2ZFRH 1C5LH 5DP9A 2FS9A 1C2FA 2BD5A 3EQ0H 1GGDC 2EI8A 4YT7H 1IQLA 1U6QA 2VIDA 1CT0E 1TGCA 1MCVA 1HAPH 1O3EA 1HAVA 1ZSKA 3F9HA 1A5IA 4TY6A 3RXMA 3QGJA 4MVNA 3MMGA 1C5TA 3FANA 2NU0E 1FUJA 4YTAA 4JYUH 2W7UA 1GBLA 2Y82A 3PO1B 2ZDKA 3RXGA 5ESBA 4B1TA 1LHEH 1HXEH 3F9EA 2SGAA 1MU6B 2HNTE 3SQHE 1QBVH 1QA7A 1GI3A 5C20A 1MBQA 3ATMA 3C27B 2FEQH 1GL0E 2FWWA 2ZI2H 2D1JA 1DX5M 2BY9X 1ETSH 1CSOE 1N8OB 2PW8H 1P9SA 1KDQB 3A88A 1SOZA 3DD2H 4R0IA 4F4OC 2FI3E 3RXVA 1ANBA 1WYKA 2AGEX 3IWMA 1OP0A 3STIA 3D62A 1BIOA 4GUXA 1GVZA 4K69A 2FI4E 4A1TA 1CT4E 3O8DA 2D8WA 1L2EA 8KME2 1UCYK 1TNKA 4K3JA 4IN2A 1H1BA 4Z6AH 2PKSC 5EODA 3NKKA 1AFQC 1TMBH 1BITA 2Y81A 4X8TH 4B73A 1YC0A 2HNTC 1CU1A 1Z8JB 5L2ZH 1DSUA 1MQ5A 4YZUA 1QJ7B 1F5RA 3TGKE 2UWLA 1CA8B 4I8KA 1B5GH 1O2UA 1F0TA 1AKSA 4A7IB 3MU4A 4BXSA 3PLBA 2ANYA 4RKJB 1GJ5H 4BNRA 2AYWA 1YPMH 1O2GH 1NU7B 1PPGE 1BB0B 1O3LA 1ZHPA 2YNBA 1BHXF 1GMDF 2CV3A 1A5HA 3P70B 1HAOH 3A7YA 5BRRE 1S85A 5A8ZA 5F6MA 4VGCC 2BY5X 2PTNA 2SGDE 3A86A 3RXRA 1P09A 3RXIA 1SLWB 5T6FA 1SFIA 3A81A 2C4FH 6ESTA 4R8TB 1LHGH 1LVYA 4BXWA 1HIAB 1P2MA 1EPTC 1H8IH 3BV9B 2CF8H 1V3XA 1OKXA 1UTNA 1YCPH 2ZF0H 3E91A 4DCDA 3SI4H 1IQNA 1P2QA 3FZDA 2EC9H 3TK5A 8LPRA 2G55A 5K7RA 1YKTA 3E6PH 4U2WA 4X2YA 2ZG0H 2FMJA 2BDYA 3LGIA 2ZDMA 1J16A 4JYTA 1SGFA 1GMDG 3ODFA 3UPEA 2BQWB 3LIWA 1Y3VA 2FX6A 2BDIA 1UK3A 4YT6H 1P01A 2ZA5A 1XXDA 1GJ6A 1DUEA 4NG9H 2QIQA 5A8YA 4NZLA 1A0HB 5B6OA 1FONA 1C1VH 1GJ8B 4DIHH 3OU0A 1GMCF 2XBYA 4ABDA 2BD7A 4YOGA 3RMNH 1YLDA 4MG3A 2A4OA 5GCHF 1HUTH 2BZAA 2BDCA 1CA0C 2Z9IA 2Z94A 4RN6A 1DDJA 1C5NH 1MD7A 2JH5D 4MNXA 3F9GA 1IQMA 4LK4A 4J2YB 4UFEH 2FM2A 4DIIH 4X6PA 5CE1A 4CBNA 1ELVA 2SGEE 1GL1A 3ZZAA 2XNIA 1OP2A 2G81E 1GI9B 2F3CE 1Z1JA 3UR6A 4CBOA 3SHCH 1GMCG 1EAUA 2BYAX 5GCHG 2XC0A 1NESE 3U98H 1HPGA 3P17H 1O2MA 1A46H 4NIYA 2G8TA 4HFPB 1K1LA 4B74A 2TGTA 1L1NA 3I29A 1OYTH 4CRGA 2FXRA 5EPNA 1YCPM 4CRBA 3LGVA 5HM2A 4XDEA 5EU8A 3K2UA 1KXDA 2STBE 1YGCH 3SI3H 2FESH 3TVJB 3M5LA 1G37A 4KTSA 4FUDA 1WTHD 4BTTB 2CXVA 2Z9KA 3BTGE 2ASUB 1GCDA 1P03A 3T27A 2GT8A 3ZVEA 3URCA 4OGYA 4BAHB 2SFAA 5TCAA 1ELGA 3DHKH 4GSOA 4UE7H 3L33A 1FAXA 2H9EH 2FDAA 2WPKS 1EJNA 3BN9A 2ZGBH 1O3GA 1AUJA 1LKAA 3JZ1B 1TGTA 1LVOA 4FU8A 3RLYH 1C9PA 1DITH 2BLVA 4XSKU 1AY6H 1BQYA 4XE4A 4K5ZA 2TGDA 1T8NA 1C4Y2 1ZRBA 2A5AA 4GVUA 4BANB 2WYGA 1YPJH 2NU2E 2BTCE 4DURA 4Y7BA 4NSVA 1AVGH 1EAIA 4OS1A 3M3VA 4AYYB 1HAVB 2LNCA 5AFYH 1F7ZA 4BTUB 3TNTA 3A7XA 4JK6A 3S7HB 3OX7U 4ZROA 3EA8A 3Q76A 3UREA 3SV9A 3M3SA 1EOLA 1F5KU 2ZU2A 2AMQA 1GI4A 1O5BB 2ZU3A 4X1RU 4J1YA 1D6RA 2ODYB 3HK3B 5J4SA 2OC8A 1ESBA 2V0BA 2G5NA 2H9TH 3RDZA 2Z3DA 1P0SH 4Y8YA 1B0FA 2ZCLP 3SW2B 4HZHA 1F2SE 1O3OA 4ZKOU 5HM9A 3BIUH 2FTMA 2GVFA 1N6YA 3A83A 3RXSA 4YLUA 1AB9B 3TH3H 1DUAA 3VPKA 4H6SB 2ANKH 1C1SA 3FAOA 4NFFA 1DANH 3SBKA 4ABGA 3G01A 3QX5H 2P16A 1TWXB 5DP8A 3GY3A 2J95A 3LGWA 3BTME 4O03A 3UWIA 1T4UH 4KGAA 3SNCA 2Y80A 1KLJH 2G4UA 1Y5UT 5EOKA 5LPRA 1FNIA 4UFFH 1GJAB 1GDNA 2O8LA 3SV2H 4D7GA 1HNEE 1OP8A 1PQ8A 4ABJA 4X1QU 3BTEE 1KLIH 2W26A 2W7SA 1K22H 1W7XH 1OWEA 2RA0A 3D65E 3SOSA 1LQEA 1GBBA 2CMYA 2ZQ1A 1VR1H 3MTYA 2R2WU 4XFQA 1HAYB 1VGCB 1ZJDA 3VGCC 3MYWA 2VGCB 3LJJA 3NPSA 4ABEA 1EP6A 1GI1A 1X7AC 1C5VA 1RTLA 1O36A 1EB1H 1S5SA 1UK2A 3VB3A 3A8CA 4CR9A 1HFDA 3HK6B 3SJKA 2F91A 4DW2U 2FOAA 1FAKH 3LC5A 4X2WA 5I46H 1BUIA 2OC7A 3UNRA 5C67A 1OPHB 1RFNA 3PLPA 3HGNA 3PTBA 3TGIE 1O3AA 1OWJA 1C5MD 3SJ8A 3A7TA 3A84A 3S9AA 2RA3A 2ZU5A 3BTWE 1TAWA 5F8XA 2QXHA 4INKA 1G3EA 1EOJA 1GBJA 4YOIA 5C1XA 1TQ7B 2OQUA 1JRTA 9ESTA 1C2IA 4UEHH 2TGAA 1SFQB 1C1UH 2ZFFH 3M36A 1Y5AT 4CH8B 1C5OH 1G2MA 1P2OA 1W8BH 4XOJA 2THFB 1AZZA 1TX6A 1GI6A 1L1GA 2VIWA 2YOLA 4MLFB 1J17T 4B2AA 2PTCE 3MOCA 1DS2E 3BEFB 2FO9A 1C5ZB 2VWMA 1JRSA 1FN6A 3VB6A 2FLBH 1PQ5A 3GDVA 2G00A 1LVMA 2H5DA 2BD3A 1CBWB 1AGJA 4X0WU 2HNTF 3ATKA 1H9HE 2FLRH 2XWAA 1A2CH 1HCGA 1G3BA 5AHGH 5ABWA 1SSXA 1B7XB 1EAWA 2ZKSA 4U30A 3DT0H 1PPFE 1DM4B 1MCTA 3RLWH 1LO6A 2P94A 4ZXXH 3V7TA 3H7TA 3KF2A 1N6XA 5FAHA 5F8TA 1DWDH 1XM1A 3H5CB 2F9NA 1L4DA 1Y3YA 3PMHB 1FV9A 1HGTH 2ZPRA 2V3HH 5JB9S 2VVVA 1O3CA 1D9IA 3SN8A 2HGTH 3MH4A 4CRCA 2P93A 1O0DH 4RKOB 1DFPA 3KHVA 1BTWA 1A1RA 1G36A 1E36B 1TOMH 4AZ2B 1W14U 1OSSA 1TMTH 2GKVE 4ZKSU 3VB7A 2O8WA 3RXBA 5C2ZA 2W3KA 3A7VA 3U9AH 3GCOA 1S83A 1S0QA 1EATA 3K9XB 1T4VH 2ESTE 2PGQB 3RXJA 3ZV9A 1UVTH 3B8JA 4DOQA 1GWAA 1P2KA 3IITA 1YBWA 3LPRA 1ZZZA 1O32A 1ZGVA 3UR9A 5EXMA 3GCNA 3MNXA 2TGPZ 2OQ5A 1BRUP 2C8XB 5JBCS 2IJOB 3DUXH 1FIZA 3RC6A 1QRWA 1BBRK 1ZJKA 3NCLA 2F9VA 4AFZA 2BY8X 1IQJA 3PM3A 4LZ4B 1PJPA 2BDBA 1MD8A 4JYVH 4MNWA 5EXLA 1BMLA 3RXDA 1EKBB 4AFUA 1KTSB 2UUKB 3K65B 1AB9C 2ZC9H 1CHOF 5E2PA 4IC6A 5DPAA 2ZDNA 1O37A 2R0KA 2ZHDA 3T29A 1INCA 2YNAA 1O2NA 2Z9GA 5DP4A 5PTPA 4A1XA 3AVZA 2H2ZA 5LH8A 2ZIQH 3TJVA 1LHDH 2BQ7B 1QNJA 3BIVH 2OXSA 3E8LA 4XBDA 4AG1A 4BAQB 2ZZUH 3E3TA 2CHAB 4D76A 1YP9A 4BAOB 1GBKA 2BDAA 5GDSH 4HTCH 1PPEE 1JIMA 2CN0H 2QF0A 1SGIB 2HWLB 3LGTA 1CHOG 3BEIB 3BTQE 4X1NU 1ZLRA 3LOXA 2OC0A 1QA0A 2Q6DA 1TBZH 5FCRA 3E16B 4HGCA 2GT7A 5FPTA 1NS3A 1O3FA 2ZPQA 1NC6A 4OS2A 3VEQB 2SGQE 4ZKRU 3ZVCA 4BAKB 2BY7X 1J8AA 4TYDA 3A80A 1O3MA 5L2YH 1MUEB 1LVBA 4O3TA 4FUJA 1ETTH 4TPIZ 3RU4T 3UWJH 4DGJA 2VGCC 1Z8RA 4Y76A 3SNBA 1EJMA 1MTNB 3MO3A 4Q7XA 1ZGIA 2ZEBA 1ZTLA 3UQOA 1IQFA 1GBCA 3GCTF 3EGKH 3L6PA 3PMJA 3W94A 4KTUA 2ODPA 3SU5A 1RTFB 1GBEA 3SUEA 2BLQA 1TPPA 3QTVH 1LTOA 2A31A 1OWIA 2ZU1A 2R9PA 1FY5A 2A2QH 1LQDB 1F92A 3RXUA 3QDZB 4BTIB 4A1VA 2Y5FA 2GDEH 1XKAC 1C2KA 3M61U 4FVBA 4MNYA 1QBOA 1EX3A 1AVXA 1WBGB 3BSQA 2BY6X 1G30B 3E90B 2PR3A 1TQ0B 3T62A 1O2QA 2F9BH 3GCTG 7GCHF 3BG4B 2GMTC 3FFGA 1SQOA 1MMJN 1MKXH 1V2LT 5AFZH 1C5WB 1O34A 1AIXH 2J92A 2PGBB 3F6UH 2FPZA 2G51A 4Q80A 3MH5A 1SBWA 5HGGA 1NFWA 1THPB 1WTGH 1QCPA 4O3UA 3SNDA 6LPRA 3MU5A 1HAZB 3V3MA 2UWPA 2TBSA 1Z7KA 1WV7H 1K28D 3B23B 1BOQA 1YCPK 2UUYA 5EGMA 4ZXYH 1QL9A 1SLXB 3RXQA 3SU3A 1ZTKA 3LH1A 4X8VH 4AFQA 7GCHG 2BD9A 1ARBA 3KNXA 1D3QB 5CHAC 1SHYA 2PHBA 2BVXH 1Z71A 2B9LA 4NIXA 4K8BA 1A3BH 1C1OA 2PUXB 1QRZA 1O2HA 1BMNH 2PUQH 3KQEA 4ABBA 3DA9B 2VIPA 1P05A 2R0LA 3KQDA 4NA9H 3BTKE 1BA8B 3BTHE 5AF9H 2Y6TA 4OS7A 1OWKA 1NZQH 4WH8A 1W0YH 4MQAA 2XBXA 2JH0D 1SGYE 5GWZA 3QZQA 3GYMA 4K1TA 1AE5A 3DFLA 1O3BA 2DUCA 2AH4X 2H1UA 2JH6D 4Q7YA 4BOHA 1V2UT 2C93B 2VH6A 1SGTA 1SGNE 4TWYA 1BRCE 3CS7A 4IS5A 3RMMH 1P8VC 1SMFE 3LU9B 3ZVBA 1K9OE 3KGPA 4AFSA 5L6NH 2GDDA 1P12E 1GG6B 1V2KT 2A7JA 2D2DA 3F9FA 3RXLA 3T5FH 3ESTA 1HBTH 3SHAH 1CT2E 3ZZ5A 4IC5A 3ZYEA 1Z8GA 4GLYA 4YLQH 3ZVAA 1IQKA 2QF3A 1J14A 3MHWU 2WPJS 1A0JA 2O8MA 4KTCA 4WH6A 4GCHF 1NRRH 1BTXA 4FUEA 1GHZA 4MDSA 3TITA 3ZV8A 2ODQA 1SLUB 1GJ4H 4OGXA 3UOUA 2XYAA 3GY2A 1O39A 1AHTH 1W13U 2EI6A 4LZ1H 4FUIA 4XBCA 2CHAC 2BM2A 3A82A 1C1MA 1C4U2 3SV7A 1NROH 2I6SA 1JIRA 3SJOA 2FZZA 1DWEH 1O5FH 4D9QA 2C8YB 3PWBA 4QT8C 2Y7ZA 2BB4A 1TGSZ 3RC4A 3SO3A 5ESTE 1EPTA 1RTKA 4X8SH 5K0HA 1ZR0A 7KMEH 1A61H 1O2TA 4ABHA 1O31A 1HJ8A 4K60A 3KCGH 4CRDA 2KAIA 1C9TA 4FXGH 1LCYA 3PO1C 4GCHG 3OTJE 3U1IB 3Q3XA 2PSYA 4A5TS 2XTTB 1ZPBA 1E0FD 1V2QT 3A8AA 1SLVB 3PTNA 1KLTA 3TPIZ 1O3IA 4INLA 1H8DH 2PV9B 3MO9A 3RXTA 5A0CA 1QB6A 2VIOA 1ZYOA 2WYJA 1H9IE 4ZH8A 1VCWA 3GY4A 3LC3A 1S84A 3SU4A 1N8OC 2G5VA 4SGBE 1NRPH 1O3NA 2WPMS 1NRSH 2O8TA 1TNLA 2GP9B 1C5XB 1YPEH 1ZMLA 2A0QB 1SG8B 2GX4A 3ATLA 3PWCA 1BMMH 1YF4A 3NXPA 3Q77A 1NM6A 1XX9A 4DY7B 1DVAH 1K1MA 1RS0A 1LMWB 1TX8A 1MZDA 3RXHA 2GV7A 3MU0A 1YPKH 1G3DA 5L30H 2PKAA 2BXUH 4CR5A 1JOUB 1NFUA 3F68H 3QO6A 1O33A 1OWHA 1GBFA 2FOGA 3LDXH 1FY8E 1O2VA 1RRKA 3T26A 3S0NA 1C2JA 1P2NA 1G3CA 1UTPA 1SGQE 5A0BA 3ZYDA 1EASA 1SGCA 1ZMJA 2ZCKP 1ELTA 2VIQA 4UFDH 4IBLH 4BAMB 1UVPA 1WU1A 1XVOA 2V35A 4U32A 2Y5GA 1T8OA 3BF6H 2FIRH 5A09A 3F1SB 2A45B 4B2CA 1FPCH 1W7GH 4ZHAA 2OINA 1DICA 5SGAE 2FS8A 1MTVA 2ZFPH 4Y79A 1HV7A 1PPHE 1G9IE 3RXKA 5F8ZA 1K1NA 3BG8A 5JYIA 2HLCA 1MTUA 1QR3E 4ISLA 1GJ9B 1EZUC 1HDTH 2ZTXA 2Z3CA 3MFJA 1GVKB 1TYNA 1W3CA 1DPOA 1MKWH 1YPGH 2EEKA 4WMDA 4MPXA 2DE8A 1O2RA 3WY8A 1O5GH 2SNVA 4MNVA 4I8GA 2ULLA 2FOMB 2ZHWH 1MAYA 1QQUA 4AN7A 1Y8TA 1EAXA 4H6TA 2H5CA 1KDQA 1V2RT 2ZPSA 4JZEH 4NZQA 1DE7H 3GYLB 1TPAE 3QZRA 2FX4A 4AX9H 1HLTH 4I33A 1ANDA 4B2BA 4CH2B 4THNH 5FHTA 1CGJE 1IOEA 3SU1A 4M7GA 3FP7E 1A0LA 1C1WH 1BJUA 1HAHH 3I78A 5DG6A 1SHHB 4NCYA 4Y10E 2OBQA 1D6WA 1GHBF 3N7OA 1DY8A 4ABIA 3TJOA 1EZXC 3SJ9A 4E7NA 1BMAA 7LPRA 5EPYA 1O2LA 5DP3A 1GG6C 3H7OA 2UUJB 2AMDA 1O2XA 5C1YA 2C3SA 5JBTA 1C5QA 1O2YA 1RIWB 1GDQA 2VH0A 3P8FA 3RMLH 1AKSB 4FUCA 1V2VT 1TMUH 1KSNA 2BD8A 1CGHA 3ZZ8A 2Z3EA 1QBNA 1UVSH 2F9OA 3SUGA 1GBDA 2IN2A 4A6LA 2OBOA 3T28A 2NU3E 3HGPA 3DFJA 1GHBG 1NPMA 1YLCA 2ZTZA 1ID5H 4WXIA 5J4QA 2OLGA 2Q6FA 2B8OH 2Z9LA 3AAVA 3P92A 4Q7ZA 4ZHLU 2BX4A 1OS8A 5LGOA 4I8HA 1LKBA 2V6NA 3IG6B 2XWBI 1TLDA 1DXWA 1D3TB 3OYPA 2PWXA 4IN1A 1ACBE 5FX5A 3U8OH 1HIAA 1QHRB 1QQ4A 1TOCB 3TU7H 2IPHA 1BCUH 1GJDB 2ZGHA 4ABFA 4X2VA 1WSSH 3SNEA 3OY5U 3LJOA 1AQ7A 1ELEE 2B5TB 1K1IA 5JDUB 1OX1A 5FPYA 1V2NT 2ZNKH 4GPGA 1G2LA 1O2PA 4ZHMU 3PLKA 4DG4A 1J9CH 1RGQA 3ENSB 5DKMA 1GCTB 1ZSLA 1RXPA 3AAUA 1E37B 1A3EH 2ZECA 3GDUA 1W10U 2CGAA 3STJA 3P95A 3HKIB 2UUFB 1UMAH 2JETB 1FY4A 3URDA 4D8NA 2AIQA 2PKSB 3GCHB 3P8GA 3M7TA 3RU4D 2H6MA 2FTLE 2QY0B 3RMOH 4DJZB 1JWTA 1GJ7B 1O2KA 4ASHA 5C5OA 3TH2H 2QA9E 1LPZB 1QB1A 2ZGCA 3RU4E 3LT3A 4XBBA 1DOJA 4Y8ZA 2QXJA 3QTOH 1FPHH 1V6DA 2FP7B 1O5DH 1SB1H 1AD8H 1TPSA 4UDWH 1L4ZA 3NK8A 1TABE 1V2PT 1LPGB 3BTDE 3UNSA 1Y3XA 2PFEA 5CMXH 4JCNA 3GY8A 5E0JA 2EI7A 1UTLM 1Z8IB 4OS6A 4NGAH 1SGFG 3MH6A 1QFKH 3E0NB 1DLEA 2WV5A 1K1JA 2QCYA 3A89A 4WMEA 2H9HA 1XKBC 2ANMH 1CE5A 3SGQE 3S9BA 2J94A 3NWUA
chains in the Genus database with same CATH superfamily
5EW2H 1DY9A 1EPTB 4IMZA 1D4PB 5C94A 1AI8H 2BDHA 3EA7A 1VJ9U 3TIUA 1T8LA 5C3NA 3FKSD 4Y11E 2A7CA 2AERH 3SUFA 4ZMAH 1O3PB 3ZZ9A 4TT3D 4B71A 1AN1E 2FOCA 1IQIA 2ALPA 4AGKA 3FP8E 2FYQA 3EAJA 1BZXE 2B0FA 2R3YA 1UTJA 3JZ2B 1EZSC 4Z0KA 5T6DA 1NRQH 2ZP0H 5KECA 3MNSA 4TWWA 4DT7B 5EQSA 1PYTD 5EJ1A 3A87A 1GBHA 2GZ7A 3SV6A 1PPBH 1DWBH 4YESB 3GY5A 1H4WA 5DP6A 3U8RH 1O3JA 1S6FA 2HALA 1O2JA 4YM9A 2FI5E 1D3DB 5LPFA 4CRFA 1IHSH 1CA0B 1O5AB 1T31A 4Y8XA 1W0ZU 2C90B 4NSYA 3RXAA 2J98B 2PKAB 1QURH 2FOHA 2BQ6B 4P02A 4UD9H 1MU8B 1GI0A 2Q6GA 1Q2WA 2K1QA 2BD4A 3ATWA 1ESAA 2BHGA 2GV6A 1O5CB 3RXEA 2IPQX 1EQ9A 1VZQH 3PV5A 1P57B 1BDAA 3FN8A 3PB1E 1P2JA 1ZTJA 3BTTE 4UONA 3V13A 3OTPA 1VITH 1NT1A 1RIWC 5JB8S 1M9UA 1ANCA 2BZ6H 4WMFA 2M5TA 3RC5A 3A8DA 2VIVA 1DT2A 3R3GB 1VGCC 1GHAF 1TA2A 1PPCE 2GJGA 3T25A 4DT4A 2HRVA 1FDPA 3TGJE 3M37A 1HXFH 2AIPA 2QYIA 3FVFB 4WJG2 3QN7A 3UFAA 2PLXA 2TIOA 4B76A 3M7UA 1T8MA 1PYTC 5E2OA 4I7YH 1AUTC 1SI5H 1CHGA 6CHAB 1GHVH 2XOKD 3M5NA 4UFGH 2KZ4A 3NUMA 3MNBA 4X6OA 1UW7A 3GDSA 4NWKA 3GY6A 5C1UA 1TB6H 4SGAE 3TH4H 4NA8A 3KIDU 2Y5HA 1O3HA 2A32A 3RM0H 2FOBA 1MKXK 1E34B 1FZZA 3UUZA 1AU8A 1JBUH 1SL3A 4U01A 1GI2A 1L0ZA 1VITF 1GHAG 1XUJA 2BOHB 4JZDH 4OM9A 1TNHA 1CVWH 1MZAA 4Y0ZE 1GHXH 2K0QA 2WZQA 4CHAB 3SU6A 1COWD 3ITIA 1FI8A 1ABJH 2YMSB 1UVOA 2GZ9A 2ZU4A 4LOYH 2LPRA 4ISOA 5IYTA 3LONA 2ZTYA 1GCTC 1AWHB 2HVXA 1NN6A 1TRMA 2AGGX 4X6MA 3LGUA 1FJSA 3RXCA 4FU9A 5AVDA 2JETC 1ELBA 1XMNB 1UTQA 1A5GH 2J4IA 3S69A 1O2WA 2HPPH 3GCHC 3RP2A 4Y6DA 2ILNA 2EA3A 4JZFH 1LDTT 3RXOA 1TGNA 3EE7A 1VITG 2GGVB 2V3OH 2WPHS 1CBWC 5FPSA 2VJ1A 2A7HA 1O5EH 1P04A 1P2IA 1QGFA 3AW0A 1GBTA 2WHXA 1UCYH 2A1DB 1BHXB 1FIWA 1MQ6A 3ZZ3A 1AE8H 2ZDLA 1S82A 1DWCH 4GHTA 2PP6A 2F83A 2J9NA 3OEHD 5DP7A 3ELAH 1O3KA 2QGRA 1ZSJA 1O2SA 1TBRH 2GZ8A 3P6ZB 3VB4A 2BVSH 3TJNA 5DO4H 5I25A 4KELA 3SU0A 1TNGA 3KYFA 1XUFA 1GJCB 1O30A 1FXYA 4X1SU 1C1QA 3D23A 4KP0A 2WUBA 1IQHA 4ESTE 4RT0A 1GBIA 3KQBA 1IAUA 3E1XB 1V2TT 3A7ZA 3LKWA 5TCCA 8GCHF 4AOQA 1PQ7A 3EYDA 1C5YB 2WSSD 1C2LA 2BLOA 4ISNA 1SGPE 2J2UA 3LH3A 4IGDA 3S9CA 1HJ9A 4IW4E 1UTOA 4FETA 5ETXA 1TE0A 4NIVA 4WY3A 3ZZCA 2A4QA 3ZZ6A 5E0GA 2ZDAH 1N1LA 2WPLS 5HYOA 1ZHMA 4FVDA 1GHYH 3KN2A 1VCQA 5A8XA 2HOBA 1PFXC 1PQAA 1O2IA 1BBRE 1C1NA 3VXFH 2BVRH 4B75A 2OTVA 5A0AE 1VKYA 1Z6EA 2ALVA 8GCHG 1UHBA 2BDGA 3BEUA 1GJBB 3DSPA 2AS9A 4AYVB 1NFYA 5DJ7A 1XUKA 2A2XH 1SQTA 2GCTB 2ZHEH 4H42U 1AO5A 5HKKD 3SUDA 1OYQA 1CO7E 1WCZA 1ESTA 2TRMA 1UJ1A 1K21H 1QZ8A 2W5EA 4X2XA 1FQ3A 3FZZA 1VJAU 3Q3KA 3UOPA 4DVAU 1YPLH 1W12U 1NY22 2SGFE 3PROA 5GXPA 3L3TA 1C1TA 1HB0B 1O2OA 1Z1IA 1C5PA 2JJ1D 2VINA 3U8TH 1FMGA 3K6YA 3MO6A 3VGCB 3ZVFA 3RUOA 3MU8A 1HAIH 1NTPA 4WWYA 1Y3UA 2C8ZB 2F9PA 2YMSD 1EB2A 1ELFA 3UNQA 6GCHF 4E05H 1F0SA 4I31A 2ZWLH 4I32A 1NRNH 4H4FA 1SGRE 1GDUA 3VXEH 2ZHQH 1P3EA 5FX6A 1Q31A 3UIRA 1Z6JH 3CENA 4I8LA 1Q3XA 3TK9A 5GJ4B 1JXPA 1YPHE 1GI8B 3CS0A 3SV8A 3T2NA 3B9FH 1KXFA 1TGBA 4GAWA 3SGBE 3SORA 1NFXA 2Q1JA 3M7QA 1C4V2 1ELCA 3RM2H 1UTMA 1KXCA 1WQSA 3QUMP 1V2WT 3KQCA 3SQEE 3HATH 4F49A 1C2HA 1P3CA 5GPIB 3ZVGA 1XVMA 2VWOA 2HPQH 1C2EA 1F5LA 1MTNC 4O9VA 1QTFA 4YOJA 1XUHA 1ELDE 1RJXB 2ZGXH 3R0FA 1IQGA 6GCHG 1PPZA 5E0HA 1L1JA 5HMAA 6CHAC 2OUAA 2IOTA 1A7SA 2OP9A 5B6LA 4OS4A 2L6OA 4IMQA 1UTKA 2PSXA 2FODA 2O8UA 2P8OB 3SU2A 1TPOA 2WINI 2HVYB 4E7RG 2I6QA 2G4TA 3SJIA 1TIOA 1V2JT 2BOKA 5G4BA 1E35B 1KXBA 2A4GA 5HXFA 4X8UH 5H4IB 4I8JA 3UY9A 5F03A 1TNJA 1V2MT 4NIWA 1KXEA 3VB5A 1C1RA 2XXLA 3C1KA 1ELAA 3AW1A 4D7FA 1P9UA 2GCHF 1UCYE 4CHAC 1GHWH 4FUHA 4WVPE 2P3TB 2VVCA 2YMSC 2AEIH 4Q2KA 1MTWA 1YPHC 2F4LA 3BG4C 3GICB 5EW1H 2OCVB 1TA6A 1ZPCA 4FUGA 1KY9A 3S7KB 5EXNA 5GIBA 1C5SA 1QB9A 1C2DA 4MPUA 2LP6A 1HAXB 4PROA 1GI7B 4Y7AA 3U1JB 5LPEA 1P10A 3F2GA 1AZ8A 3GY7A 1H9LB 4CRAA 1QJ1B 3MI4A 2Z7FE 3Q00A 1NU9A 1SC8U 1F0RA 1W0JD 3QK1A 4JZ1A 1MKWK 1IHTH 4LXBH 2BLWA 1XXFA 3PYHA 3ODDA 2ZQ2A 4ABAA 1BT7A 2GCHG 3M3TA 4Y0YE 4X1PU 1CQQA 1EP5A 3OFND 4F55A 2AMPA 1HJAB 1QY6A 1SR5C 4O97A 1SPJA 1GI5A 1ZPZA 3W95A 1OOKB 2QV1A 5T6GA 2AGIX 2Y7XA 5FBEA 2B7DH 1O3DA 1DXPA 2CF9H 3KYGA 5FCKA 4WF8A 2ZFTA 3GISB 1TRNA 3N7EA 3UQVA 1LHFH 2ZCHP 1P06A 4K8YA 7ESTE 1C2GA 1ABIH 1YM0A 1EJAA 2O9QA 1QJ6B 4KKDA 1WUNH 1BRAA 2UWOA 2R3UA 1K1OA 2WV4A 1SQAA 4JK5A 4E06H 3M5MA 1GMHF 1FN8A 4MPWA 2Z6BD 2XW9A 3TNSA 4ISHH 3SNAA 3LGYA 2VU8E 3FOAA 5EJZA 1QIXB 2W3IA 4MPVA 5T3HA 3U69H 1BTUA 2A5KA 3P8NA 3EA9A 1GGDB 3TJUA 3VFEA 1SVPA 3QWCH 5E8EH 2RDLA 2SGPE 1NO9H 4FU7A 1WAYB 2VWNA 2BXTH 1KTTB 1V2ST 1MH0A 2QN5T 1EUFA 1D3PB 1ZHRA 5DN6D 2GCTC 1GMHG 2XBVA 2XCNA 4FUBA 4HI3A 4NA7A 1O38A 2P3FH 2TPIZ 1UO6A 1QL7A 3D49H 1C1PA 1E38B 1THRH 2RCEA 1DSTA 2QAAA 3MWIU 1EZQA 1LPKB 4GHQA 1O2ZA 3I77A 1AWFH 1K0HA 2J97A 3O8RA 2AFQB 1BTYA 4TPYA 3P8OA 4AGJA 1AVWA 4TY7A 1Y3WA 3A7WA 2FYRA 2ANWA 2W6JD 1FLEE 1OWDA 2ZFSA 3TK6A 1B0EA 2F43B 3K6ZA 3ZZ7A 2F9UA 5FBIA 5EG4A 1FY1A 2QC2A 1KYNA 3KEEA 5TJXA 3BTFE 3QGNB 9LPRA 2D26C 1HYLA 4FUFA 1S81A 2FOEA 4A92A 3ZVDA 1JMOH 1MTSA 2XC5A 1BTHH 4ISIH 1ETRH 1GBAA 3MNCA 3UTUH 3CP7A 3GOVB 3OSYA 1ANEA 2XC4A 3A85A 2RG3A 4D9RA 2EY4C 2K8IA 5JBBS 3M35A 8ESTE 4ZKNU 1K2I1 3ZZDA 1J15A 3TLOA 4AORA 2BX3A 1AFQB 1KIGH 3NZIA 4K1EA 5FL7D 1SGEE 2GMTB 2SNWA 1WQVH 4INHA 4AB9A 4ZAEA 1XUIA 1CGIE 1DLKB 2QXGA 4Y71A 1UHBB 1HRTH 2P8OC 3N7DA 5A2MH 3H09A 3F0OA 4YXWD 2P95A 1TX7A 2JKHA 3HKJB 3Q3YA 1ORFA 5EQRA 2NWNA 3OY6U 2G52A 1VCPA 3ZZBA 1TBQH 2JJ2D 2WPIS 4X6NA 1ZRKA 3E0PB 5DSFA 3HPTB 1THSH 4AG2A 1C5UA 3MU1A 2ZGJA 2J38A 1C5RA 3SGAE 1LHCH 2R2MB 4YO9A 3F2HA 1P11E 3EE0B 1GBMA 1GPZA 1P02A 2VB0A 3ZZ4A 3ATIA 3A8BA 1ZMNA 1T7CA 2J5UA 4K2YA 1QRXA 1AFEH 5IDKA 1TFXA 5CHAB 2XCFA 4VGCB 1HAGE 2ZFQH 1ZOMA 2OC1A 2P3UB 1W2KH 2OD3B 2STAE 5C5NA 4JMYA 4NFEA 3AASA 1EXFA 5CHBA 1Y5BT 3EDXB 4K1SA 5DGJA 1S6HA 2GTBA 2KAIB 3RXPA 1FY3A 2BMGB 1SGDE 1YYY1 5JBAS 1C2MA 4MTBA 5DK1A 4AB8A 1T32A 3SZEA 3QLPH 1S0RA 2VVUA 1BJVA 1ARCA 1O35A 3PMAB 3M5OA 1UVUH 1F0UA 5C17A 4JZIA 2WPDD 2Z9JA 5DP5A 1TRYA 4NWLA 1TNIA 2NU1E 2BD2A 3N99A 2XRCA 2VNTA 2ZHFH 1MBMA 2A4RA 1HJAC 2VWLA 2FOFA 1KXAA 5BPEA 1G32B 1TONA 2CJIA 3PV4A 2J34A 4ZUHA 5JPMH 1W11U 2ZO3H 1TALA 3PMBB 1AMHA 2P59A 1Y59T 4CREA 1YLNA 2KCYA 1BRBE 1WOFA 3O8BA 2C8WB 1SOTA 2WUCA 1GVLA 3O8CA 1S6LA 2GD4B 3NRLA 2A5IA 4RSPA 2XBWA 1H8HD 3KL6A 3FP6E 1IQEA 3V12A 1RD3B 2NU4E 2DE9A 4OS5A 1BBRH 4WXVA 2QXIA 1MAXA 5EQQA 3MH7A 2KCOA 1BTPA 2ZDVH 3SZNA 3V0XA 2HLDD 1BTZA 1QL8A 5FXLA 3RXFA 1A4WH 1XUGA 1OXGA 1UK4A 1K1PA 1V2OT 2ZFRH 1C5LH 5DP9A 1FX0B 2FS9A 1C2FA 2BD5A 3EQ0H 1GGDC 2EI8A 4YT7H 1IQLA 1U6QA 2VIDA 1CT0E 1TGCA 1MCVA 1HAPH 2KX4A 1O3EA 1HAVA 1ZSKA 3F9HA 1A5IA 4TY6A 3RXMA 3QGJA 4MVNA 3MMGA 2RDEA 1C5TA 3FANA 3U28C 2NU0E 1FUJA 4YTAA 4JYUH 2WV9A 2W7UA 1GBLA 2Y82A 3PO1B 2ZDKA 3RXGA 5ESBA 4B1TA 1LHEH 4AC9A 1HXEH 3F9EA 2SGAA 1MU6B 2HNTE 3SQHE 1QBVH 1QA7A 1GI3A 5C20A 1MBQA 3ATMA 5HIZA 3C27B 2FEQH 1GL0E 2FWWA 2ZI2H 2D1JA 1DX5M 2BY9X 1ETSH 5CDFE 1CSOE 1N8OB 2PW8H 1P9SA 1KDQB 3A88A 1SOZA 3DD2H 4R0IA 4F4OC 2FI3E 3RXVA 1ANBA 1WYKA 2AGEX 3IWMA 1OP0A 3STIA 3D62A 2JDID 1BIOA 1E1QD 4GUXA 1GVZA 4K69A 2FI4E 4A1TA 1CT4E 3O8DA 2D8WA 1L2EA 8KME2 1UCYK 1TNKA 4K3JA 4IN2A 1H1BA 4Z6AH 2PKSC 5EODA 3NKKA 1AFQC 1TMBH 2L74A 1BITA 2Y81A 4X8TH 4B73A 1YC0A 2HNTC 1CU1A 1Z8JB 5L2ZH 1DSUA 1MQ5A 4YZUA 1QJ7B 1F5RA 3TGKE 2UWLA 1CA8B 4I8KA 1B5GH 1O2UA 1F0TA 1AKSA 4A7IB 2XNDD 3MU4A 4BXSA 3PLBA 2ANYA 4RKJB 1GJ5H 4BNRA 4Z1MD 2AYWA 1YPMH 1O2GH 1NU7B 1PPGE 1BB0B 1O3LA 1ZHPA 2YNBA 1BHXF 1GMDF 2CV3A 1A5HA 3P70B 1HAOH 3A7YA 5BRRE 1S85A 5A8ZA 5F6MA 4VGCC 2BY5X 2PTNA 2SGDE 3A86A 4P00A 1P09A 3RXRA 3RXIA 1SLWB 5T6FA 1SFIA 3A81A 2C4FH 6ESTA 4R8TB 1LHGH 1LVYA 4BXWA 1HIAB 1P2MA 1EPTC 1H8IH 3BV9B 1MABB 2CF8H 1V3XA 1OKXA 1UTNA 1YCPH 2ZF0H 3E91A 4B6EA 4DCDA 3CNRA 3SI4H 4RI0A 1IQNA 1P2QA 3FZDA 2EC9H 3TK5A 8LPRA 2G55A 5K7RA 1YKTA 1KMHB 3E6PH 4U2WA 3DSGA 4X2YA 2ZG0H 2FMJA 2BDYA 3LGIA 2ZDMA 2RFKC 1J16A 4JYTA 1SGFA 1GMDG 3ODFA 3UPEA 2BQWB 3LIWA 1Y3VA 2FX6A 2BDIA 1UK3A 4YT6H 1P01A 2ZA5A 1XXDA 4I86A 1NBMD 1GJ6A 1DUEA 4NG9H 2QIQA 2CK3D 5A8YA 4NZLA 1A0HB 5B6OA 1FONA 1C1VH 1GJ8B 4DIHH 3OU0A 1GMCF 2XBYA 4ABDA 2BD7A 4YOGA 3RMNH 1YLDA 2KR7A 4MG3A 1NBME 2A4OA 5GCHF 1HUTH 2BZAA 2BDCA 2VBCA 1CA0C 2Z9IA 2Z94A 4RN6A 1DDJA 1C5NH 1MD7A 2JH5D 4MNXA 3F9GA 1IQMA 4ASUD 4LK4A 4J2YB 4UFEH 2FM2A 3UB0A 4X6PA 5CE1A 4DIIH 4CBNA 1ELVA 2SGEE 1GL1A 3ZZAA 3WWFA 2XNIA 5KEDA 1OP2A 2G81E 1GI9B 2F3CE 1Z1JA 3UR6A 4CBOA 3F0PA 3SHCH 1GMCG 1EAUA 2BYAX 5GCHG 2XC0A 1YY3A 1NESE 1OHHD 3U98H 1HPGA 3P17H 1O2MA 1A46H 4NIYA 2G8TA 4HFPB 1K1LA 4B74A 2TGTA 1L1NA 3I29A 1OYTH 4CRGA 2FXRA 5EPNA 1YCPM 4CRBA 4B6FA 3LGVA 5HM2A 4XDEA 5EU8A 3K2UA 1KXDA 2STBE 1YGCH 3SI3H 2FESH 3TVJB 3M5LA 1G37A 4KTSA 4FUDA 1WTHD 4BTTB 2CXVA 2Z9KA 3BTGE 2ASUB 1GCDA 1P03A 3T27A 2GT8A 3ZVEA 3URCA 4OGYA 4BAHB 5EIYA 2SFAA 2V3MA 5TCAA 5GNDA 1ELGA 1W0KD 3DHKH 4GSOA 4UE7H 3L33A 1FAXA 2H9EH 2FDAA 2IJD1 2WPKS 1EJNA 3BN9A 2ZGBH 1O3GA 1AUJA 1LKAA 3JZ1B 1TGTA 1LVOA 4FU8A 4Q63A 3RLYH 1C9PA 1DITH 2BLVA 4XSKU 1AY6H 1BQYA 4XE4A 4K5ZA 2TGDA 1T8NA 1C4Y2 1ZRBA 2A5AA 2OK5A 4GVUA 4BANB 2WYGA 1YPJH 2NU2E 2BTCE 4DURA 4Y7BA 4NSVA 1AVGH 1EAIA 4OS1A 3M3VA 4AYYB 1HAVB 2LNCA 5AFYH 1F7ZA 4BTUB 3TNTA 4ZCNA 3A7XA 1SKYE 4JK6A 3S7HB 3OX7U 3PRBA 4ZROA 3EA8A 3Q76A 3UREA 3SV9A 3M3SA 1EOLA 1F5KU 2ZU2A 2AMQA 1GI4A 1O5BB 2ZU3A 5IK2D 4X1RU 4J1YA 1D6RA 2ODYB 3HK3B 5J4SA 2OC8A 1ESBA 2V0BA 2G5NA 2H9TH 3VG8A 3RDZA 2Z3DA 1P0SH 4Y8YA 1B0FA 2ZCLP 3SW2B 4HZHA 1F2SE 3OE7D 1O3OA 2KCAA 4ZKOU 5HM9A 3BIUH 2FTMA 2GVFA 1N6YA 3A83A 3RXSA 4YLUA 1AB9B 3TH3H 1DUAA 3VPKA 4H6SB 2ANKH 1C1SA 3FAOA 4NFFA 1DANH 3SBKA 4ABGA 3G01A 3QX5H 2P16A 1TWXB 5DP8A 3GY3A 2J95A 3LGWA 3BTME 4O03A 3UWIA 1T4UH 4KGAA 3SNCA 2Y80A 1KLJH 2G4UA 1Y5UT 5EOKA 5LPRA 1FNIA 4UFFH 1GJAB 1GDNA 2O8LA 3SV2H 4D7GA 1HNEE 1OP8A 3WW7A 1PQ8A 4ABJA 4X1QU 5T1VA 3BTEE 1KLIH 2W26A 2W7SA 1K22H 1W7XH 1OWEA 2RA0A 3D65E 3SOSA 1LQEA 1GBBA 2CMYA 2ZQ1A 1VR1H 3MTYA 2R2WU 4XFQA 1HAYB 1VGCB 1ZJDA 3VGCC 3MYWA 2VGCB 3LJJA 3NPSA 4ABEA 1EP6A 1GI1A 1X7AC 1C5VA 1RTLA 1O36A 1EB1H 1S5SA 1UK2A 3VB3A 3A8CA 4CR9A 1HFDA 3HK6B 3SJKA 2F91A 4DW2U 2FOAA 1FAKH 3LC5A 4X2WA 5I46H 1BUIA 2OC7A 3UNRA 5C67A 1OPHB 5F53A 1RFNA 3PLPA 3HGNA 3PTBA 3TGIE 1O3AA 1OWJA 1C5MD 3SJ8A 3A7TA 3A84A 3S9AA 2RA3A 2ZU5A 3BTWE 1TAWA 5F8XA 2QXHA 4INKA 1G3EA 1EOJA 1GBJA 4YOIA 5C1XA 1TQ7B 2OQUA 1JRTA 9ESTA 1C2IA 4UEHH 2TGAA 1SFQB 1C1UH 2ZFFH 3M36A 1Y5AT 4CH8B 1C5OH 1G2MA 1P2OA 1W8BH 4XOJA 2THFB 1AZZA 1TX6A 1GI6A 1L1GA 2VIWA 2YOLA 4MLFB 1J17T 4B2AA 2AHME 2PTCE 3MOCA 1DS2E 3BEFB 2FO9A 1C5ZB 2VWMA 1JRSA 1FN6A 4M9FA 2FLBH 1PQ5A 3VB6A 3GDVA 2G00A 1LVMA 2H5DA 2BD3A 1CBWB 1AGJA 4X0WU 2HNTF 3ATKA 1H9HE 2FLRH 2XWAA 1A2CH 5KGOA 1HCGA 1G3BA 5AHGH 5ABWA 1SSXA 1B7XB 1EAWA 2ZKSA 4U30A 3DT0H 1PPFE 1DM4B 1MCTA 3RLWH 1LO6A 2P94A 4ZXXH 3V7TA 3H7TA 3KF2A 1N6XA 5FAHA 2KCPA 5F8TA 1DWDH 3W1EA 1XM1A 3H5CB 2F9NA 1L4DA 1Y3YA 3PMHB 1FV9A 1HGTH 2ZPRA 2V3HH 5JB9S 2VVVA 1O3CA 1D9IA 1H8ED 3SN8A 2HGTH 3MH4A 4CRCA 2P93A 1O0DH 4RKOB 1DFPA 4ACBA 3KHVA 1BTWA 1A1RA 1G36A 1E36B 1TOMH 4RT1A 4AZ2B 1W14U 1OSSA 4F48B 1TMTH 2GKVE 4ZKSU 3VB7A 2O8WA 3RXBA 5C2ZA 2W3KA 3A7VA 3U9AH 3GCOA 1S83A 1S0QA 1EATA 3K9XB 1T4VH 2ESTE 2PGQB 3RXJA 3ZV9A 1UVTH 3PRDA 3B8JA 4DOQA 1GWAA 1P2KA 3IITA 1YBWA 3LPRA 1ZZZA 1O32A 1ZGVA 3UR9A 5EXMA 3GCNA 3MNXA 4XRNA 2TGPZ 2OQ5A 1BRUP 2C8XB 5JBCS 2IJOB 3DUXH 1FIZA 3RC6A 1QRWA 1BBRK 1ZJKA 3NCLA 2F9VA 2KM0A 4AFZA 2BY8X 4Q4LA 1IQJA 3PM3A 4LZ4B 1PJPA 2BDBA 1MD8A 4JYVH 4MNWA 5EXLA 1BMLA 3RXDA 1EKBB 4AFUA 1KTSB 2UUKB 3K65B 3OEED 1AB9C 2ZC9H 1E1RD 1CHOF 5E2PA 4IC6A 5DPAA 2ZDNA 1O37A 1BMFD 2R0KA 2ZHDA 3T29A 1INCA 2YNAA 1O2NA 2Z9GA 5DP4A 5PTPA 4A1XA 5C0UA 3AVZA 2H2ZA 5LH8A 2ZIQH 3TJVA 1LHDH 2BQ7B 1QNJA 3BIVH 2OXSA 3E8LA 4XBDA 4AG1A 4BAQB 2ZZUH 3E3TA 2CHAB 4D76A 3ZIAD 1YP9A 4BAOB 1GBKA 2BDAA 5GDSH 4HTCH 1PPEE 1JIMA 2CN0H 2QF0A 1SGIB 2HWLB 3LGTA 1CHOG 3BEIB 3BTQE 4X1NU 1ZLRA 3LOXA 2OC0A 1QA0A 2Q6DA 1TBZH 5FCRA 3E16B 4HGCA 2GT7A 5FPTA 1NS3A 1O3FA 2ZPQA 1NC6A 4OS2A 3VEQB 2SGQE 4ZKRU 3ZVCA 4BAKB 2BY7X 1J8AA 4TYDA 3A80A 1O3MA 5L2YH 1MUEB 1LVBA 4O3TA 4FUJA 1ETTH 4TPIZ 3RU4T 3UWJH 4DGJA 2VGCC 1Z8RA 4Y76A 3SNBA 1EJMA 1MTNB 3MO3A 4Q7XA 1ZGIA 2ZEBA 1ZTLA 3UQOA 1IQFA 1GBCA 3GCTF 3EGKH 3L6PA 3PMJA 3W94A 4KTUA 2ODPA 3SU5A 1RTFB 1GBEA 3SUEA 2BLQA 1TPPA 3F2FA 3QTVH 1LTOA 2A31A 1OWIA 2ZU1A 2R9PA 1FY5A 2A2QH 1LQDB 1F92A 3RXUA 3QDZB 4BTIB 4A1VA 2Y5FA 2GDEH 1XKAC 1C2KA 3M61U 4FVBA 4MNYA 1QBOA 1EX3A 1AVXA 1WBGB 3BSQA 2BY6X 1G30B 5C0TA 3E90B 2PR3A 1TQ0B 2LELA 3T62A 1O2QA 2F9BH 3GCTG 7GCHF 3BG4B 2GMTC 3FFGA 1SQOA 1MMJN 1MKXH 1V2LT 5AFZH 1C5WB 1O34A 1AIXH 2J92A 2PGBB 3F6UH 2FPZA 2G51A 4HG6A 4Q80A 3MH5A 1SBWA 5HGGA 1NFWA 1THPB 1WTGH 1QCPA 4O3UA 3SNDA 6LPRA 3MU5A 1HAZB 3V3MA 2UWPA 4ACAA 2TBSA 1Z7KA 1WV7H 1K28D 3B23B 1BOQA 1YCPK 2QE7D 2UUYA 5EGMA 4ZXYH 1QL9A 1SLXB 4TSFD 3RXQA 3SU3A 1ZTKA 3LH1A 4X8VH 4AFQA 7GCHG 2BD9A 1ARBA 3KNXA 1D3QB 5CHAC 1SHYA 2PHBA 2BVXH 1Z71A 2B9LA 4NIXA 3UAIC 4K8BA 1A3BH 1C1OA 2PUXB 1QRZA 1O2HA 1BMNH 2PUQH 3KQEA 4ABBA 3DA9B 2VIPA 1P05A 2R0LA 3KQDA 4NA9H 3BTKE 1BA8B 3BTHE 5AF9H 2Y6TA 4OS7A 1OWKA 1NZQH 4WH8A 1W0YH 4MQAA 2XBXA 2JH0D 1SGYE 5GWZA 3QZQA 3GYMA 4K1TA 1AE5A 3DFLA 1O3BA 2DUCA 2AH4X 2H1UA 2JH6D 4Q7YA 4BOHA 1WDIA 1V2UT 2C93B 2VH6A 1SGTA 1SGNE 4TWYA 1BRCE 3CS7A 4IS5A 3RMMH 1P8VC 1SMFE 3LU9B 3ZVBA 1K9OE 2KFWA 3KGPA 4AFSA 5L6NH 2GDDA 1P12E 1GG6B 1V2KT 2A7JA 2D2DA 3F9FA 3RXLA 3SYJA 3T5FH 3ESTA 1HBTH 3SHAH 1CT2E 3ZZ5A 4IC5A 3ZYEA 1Z8GA 4GLYA 4YLQH 3ZVAA 1IQKA 2QF3A 1J14A 3MHWU 2WPJS 1A0JA 2O8MA 4KTCA 4WH6A 4GCHF 1NRRH 1BTXA 4FUEA 1GHZA 4MDSA 3TITA 3ZV8A 2ODQA 1SLUB 1GJ4H 4OGXA 3UOUA 2XYAA 3GY2A 1O39A 1AHTH 1W13U 2EI6A 3AK5A 4LZ1H 4FUIA 4XBCA 2CHAC 2BM2A 3A82A 1C1MA 1C4U2 3SV7A 1NROH 2I6SA 1JIRA 3SJOA 2FZZA 1DWEH 1O5FH 4D9QA 2C8YB 3PWBA 4QT8C 2Y7ZA 2BB4A 1TGSZ 3RC4A 3SO3A 1EFRD 5ESTE 1EPTA 1RTKA 4X8SH 5K0HA 1ZR0A 7KMEH 2M2AA 1A61H 1O2TA 4ABHA 1O31A 1HJ8A 4K60A 3KCGH 4CRDA 2KAIA 1C9TA 4FXGH 1LCYA 3PO1C 4GCHG 3OTJE 3U1IB 3Q3XA 2PSYA 2QF4A 4A5TS 2XTTB 1ZPBA 1YWUA 1E0FD 1V2QT 3A8AA 1SLVB 3PTNA 1KLTA 3TPIZ 1O3IA 4INLA 1E79D 1H8DH 2PV9B 3MO9A 3RXTA 5A0CA 1QB6A 2VIOA 1ZYOA 2WYJA 3OAAD 1H9IE 4ZH8A 1VCWA 3GY4A 3LC3A 1S84A 3SU4A 1N8OC 2G5VA 4SGBE 1NRPH 1O3NA 2WPMS 1WXRA 1NRSH 2O8TA 1TNLA 2GP9B 1C5XB 1YPEH 1ZMLA 2A0QB 1SG8B 2GX4A 3ATLA 3PWCA 1BMMH 1YF4A 3NXPA 3Q77A 1NM6A 1XX9A 4DY7B 1DVAH 1K1MA 1RS0A 5HIYA 1LMWB 1TX8A 1MZDA 3RXHA 2GV7A 3MU0A 1YPKH 1G3DA 5L30H 2J98A 2PKAA 2BXUH 4CR5A 1JOUB 1NFUA 1SQRA 3F68H 3QO6A 1O33A 1OWHA 1GBFA 2FOGA 3LDXH 1FY8E 1O2VA 1RRKA 3T26A 3S0NA 1C2JA 1P2NA 1G3CA 1UTPA 1SGQE 5A0BA 3ZYDA 1EASA 1SGCA 1ZMJA 2ZCKP 2JIZD 1ELTA 2VIQA 4UFDH 4IBLH 4BAMB 1UVPA 1WU1A 1XVOA 2V35A 4U32A 2Y5GA 1T8OA 3BF6H 2FIRH 5A09A 3F1SB 2A45B 4B2CA 1FPCH 1W7GH 4ZHAA 2OINA 1DICA 5SGAE 2FS8A 3DCLA 1MTVA 2ZFPH 4Y79A 1HV7A 1PPHE 1G9IE 2QF5A 3RXKA 5F8ZA 1K1NA 3BG8A 5JYIA 2HLCA 1MTUA 2V7QD 1QR3E 3F3BA 4ISLA 1GJ9B 1EZUC 1HDTH 2ZTXA 2Z3CA 3MFJA 1GVKB 1TYNA 1W3CA 3GS9A 1DPOA 1MKWH 1YPGH 2EEKA 4WMDA 4MPXA 2DE8A 1O2RA 3WY8A 1O5GH 2SNVA 4MNVA 4I8GA 2ULLA 2FOMB 2ZHWH 1MAYA 1QQUA 4AN7A 1Y8TA 1EAXA 4H6TA 2H5CA 1KDQA 1V2RT 2ZPSA 4JZEH 4NZQA 1DE7H 3GYLB 1TPAE 3QZRA 2FX4A 3KQ5A 1HLTH 4AX9H 4I33A 3WWBA 1ANDA 3MQKC 4B2BA 4CH2B 4THNH 5FHTA 2W6ID 1CGJE 3PV2A 1IOEA 3SU1A 4M7GA 3FP7E 1A0LA 1C1WH 1BJUA 1HAHH 3I78A 5DG6A 1SHHB 4NCYA 4Y10E 2OBQA 1D6WA 1GHBF 3N7OA 3FO8D 1DY8A 4ABIA 5EJLA 3TJOA 1EZXC 3SJ9A 4E7NA 1BMAA 7LPRA 5EPYA 1O2LA 5DP3A 1GG6C 3H7OA 2UUJB 2AMDA 1O2XA 5C1YA 2C3SA 5JBTA 1C5QA 1O2YA 1RIWB 1GDQA 2VH0A 3P8FA 3RMLH 1AKSB 4FUCA 1V2VT 4XD7D 1TMUH 1KSNA 2BD8A 1CGHA 3ZZ8A 2Z3EA 1QBNA 1UVSH 2F9OA 3SUGA 1GBDA 2IN2A 4A6LA 2OBOA 3T28A 2NU3E 3HGPA 3DFJA 1GHBG 1NPMA 1YLCA 2ZTZA 1ID5H 4WXIA 5J4QA 2OLGA 2Q6FA 2B8OH 2Z9LA 3AAVA 3P92A 4Q7ZA 4ZHLU 2BX4A 1OS8A 5LGOA 4I8HA 1LKBA 2V6NA 3IG6B 2XWBI 1TLDA 1DXWA 1D3TB 3OYPA 2PWXA 4IN1A 1ACBE 5FX5A 3U8OH 1HIAA 1QHRB 1QQ4A 1TOCB 3TU7H 2IPHA 1BCUH 1GJDB 2ZGHA 4ABFA 4X2VA 1WSSH 3SNEA 3OY5U 3LJOA 1AQ7A 1ELEE 2B5TB 1K1IA 5JDUB 1OX1A 5FPYA 1V2NT 2ZNKH 4GPGA 1G2LA 1O2PA 4ZHMU 3PLKA 4DG4A 1J9CH 1RGQA 3ENSB 5DKMA 1GCTB 1ZSLA 1RXPA 3AAUA 1E37B 1A3EH 2ZECA 3GDUA 1W10U 2CGAA 3STJA 3P95A 3HKIB 2UUFB 1UMAH 2JETB 1FY4A 3URDA 4D8NA 2AIQA 2PKSB 3GCHB 3P8GA 3M7TA 3RU4D 2H6MA 2FTLE 2QY0B 3RMOH 4DJZB 1JWTA 1GJ7B 1O2KA 4ASHA 5C5OA 3TH2H 2QA9E 1LPZB 1QB1A 2ZGCA 3RU4E 3LT3A 4XBBA 3DSOA 1DOJA 4Y8ZA 2QXJA 3QTOH 1FPHH 1V6DA 2FP7B 1O5DH 1SB1H 1AD8H 1TPSA 4UDWH 1L4ZA 3NK8A 1TABE 1V2PT 4FOUC 1LPGB 3BTDE 3UNSA 1Y3XA 2PFEA 5CMXH 4JCNA 3GY8A 5E0JA 2EI7A 1UTLM 1Z8IB 4OS6A 4NGAH 2EQNA 1SGFG 3MH6A 1QFKH 3E0NB 1DLEA 2WV5A 1K1JA 2QCYA 3A89A 4WMEA 2H9HA 1XKBC 2ANMH 1CE5A 3SGQE 3S9BA 2J94A 3NWUA
chains in the Genus database with same CATH topology
5EW2H 1DY9A 1EPTB 4IMZA 1D4PB 1AI8H 2BDHA 3EA7A 1VJ9U 3TIUA 1T8LA 5C3NA 4Y11E 2A7CA 2AERH 3SUFA 4ZMAH 1O3PB 3ZZ9A 4B71A 1AN1E 2FOCA 1IQIA 2ALPA 4AGKA 3FP8E 2FYQA 3EAJA 1BZXE 2B0FA 2R3YA 1UTJA 3JZ2B 1EZSC 4Z0KA 5T6DA 1NRQH 2ZP0H 3MNSA 4TWWA 4DT7B 5EQSA 1PYTD 3A87A 1GBHA 2GZ7A 3SV6A 1PPBH 1DWBH 4YESB 3GY5A 1H4WA 5DP6A 3U8RH 1O3JA 1S6FA 2HALA 1O2JA 4YM9A 2FI5E 1D3DB 5LPFA 4CRFA 1IHSH 1CA0B 1O5AB 1T31A 4Y8XA 1W0ZU 2C90B 4NSYA 3RXAA 2PKAB 1QURH 2FOHA 2BQ6B 4UD9H 1MU8B 1GI0A 2Q6GA 1Q2WA 2K1QA 2BD4A 3ATWA 1ESAA 2BHGA 2GV6A 1O5CB 3RXEA 1EQ9A 1VZQH 1P57B 1BDAA 3PB1E 1P2JA 1ZTJA 3BTTE 4UONA 3V13A 1VITH 1NT1A 1RIWC 5JB8S 1M9UA 1ANCA 2BZ6H 4WMFA 2M5TA 3RC5A 3A8DA 2VIVA 1DT2A 3R3GB 1VGCC 1GHAF 1TA2A 1PPCE 3T25A 2HRVA 1FDPA 3TGJE 3M37A 1HXFH 2AIPA 2QYIA 3FVFB 4WJG2 3QN7A 3UFAA 2PLXA 2TIOA 4B76A 3M7UA 1T8MA 1PYTC 5E2OA 4I7YH 1AUTC 1SI5H 1CHGA 6CHAB 1GHVH 3M5NA 4UFGH 3NUMA 3MNBA 4X6OA 3GDSA 4NWKA 3GY6A 5C1UA 1TB6H 4SGAE 3TH4H 4NA8A 3KIDU 2Y5HA 1O3HA 2A32A 3RM0H 2FOBA 1MKXK 1E34B 1FZZA 3UUZA 1AU8A 1JBUH 1SL3A 4U01A 1GI2A 1L0ZA 1VITF 1GHAG 1XUJA 2BOHB 4JZDH 1TNHA 1CVWH 1MZAA 4Y0ZE 1GHXH 4CHAB 3SU6A 3ITIA 1FI8A 1ABJH 1UVOA 2GZ9A 2ZU4A 4LOYH 2LPRA 4ISOA 5IYTA 3LONA 2ZTYA 1GCTC 1AWHB 2HVXA 1NN6A 1TRMA 2AGGX 4X6MA 3LGUA 1FJSA 3RXCA 4FU9A 5AVDA 2JETC 1ELBA 1XMNB 1UTQA 1A5GH 2J4IA 3S69A 1O2WA 2HPPH 3GCHC 3RP2A 4Y6DA 2ILNA 2EA3A 4JZFH 1LDTT 3RXOA 1TGNA 1VITG 2GGVB 2V3OH 2WPHS 1CBWC 5FPSA 2VJ1A 2A7HA 1O5EH 1P04A 1P2IA 1QGFA 3AW0A 1GBTA 1UCYH 2A1DB 1BHXB 1FIWA 1MQ6A 3ZZ3A 1AE8H 2ZDLA 1S82A 1DWCH 4GHTA 2F83A 2J9NA 5DP7A 3ELAH 1O3KA 2QGRA 1ZSJA 1O2SA 1TBRH 2GZ8A 3P6ZB 3VB4A 2BVSH 3TJNA 5DO4H 5I25A 4KELA 3SU0A 1TNGA 1XUFA 1GJCB 1O30A 1FXYA 4X1SU 1C1QA 3D23A 4KP0A 2WUBA 1IQHA 4ESTE 1GBIA 3KQBA 1IAUA 3E1XB 1V2TT 3A7ZA 3LKWA 5TCCA 8GCHF 4AOQA 1PQ7A 3EYDA 1C5YB 1C2LA 2BLOA 4ISNA 1SGPE 2J2UA 3LH3A 4IGDA 3S9CA 1HJ9A 4IW4E 1UTOA 5ETXA 1TE0A 4NIVA 4WY3A 3ZZCA 2A4QA 3ZZ6A 5E0GA 2ZDAH 1N1LA 2WPLS 5HYOA 1ZHMA 4FVDA 1GHYH 3KN2A 1VCQA 5A8XA 2HOBA 1PFXC 1PQAA 1O2IA 1BBRE 1C1NA 3VXFH 2BVRH 4B75A 2OTVA 5A0AE 1Z6EA 2ALVA 8GCHG 1UHBA 2BDGA 3BEUA 1GJBB 2AS9A 4AYVB 1NFYA 5DJ7A 1XUKA 2A2XH 1SQTA 2GCTB 2ZHEH 4H42U 1AO5A 3SUDA 1OYQA 1CO7E 1WCZA 1ESTA 2TRMA 1UJ1A 1K21H 2W5EA 4X2XA 1FQ3A 3FZZA 1VJAU 3Q3KA 3UOPA 4DVAU 1YPLH 1W12U 1NY22 2SGFE 3PROA 5GXPA 3L3TA 1C1TA 1HB0B 1O2OA 1Z1IA 1C5PA 2VINA 3U8TH 1FMGA 3K6YA 3MO6A 3VGCB 3ZVFA 3RUOA 3MU8A 1HAIH 1NTPA 4WWYA 1Y3UA 2C8ZB 2F9PA 1EB2A 1ELFA 3UNQA 6GCHF 4E05H 1F0SA 4I31A 2ZWLH 4I32A 1NRNH 4H4FA 1SGRE 1GDUA 3VXEH 2ZHQH 1P3EA 5FX6A 1Q31A 3UIRA 1Z6JH 3CENA 4I8LA 1Q3XA 3TK9A 5GJ4B 1JXPA 1YPHE 1GI8B 3CS0A 3SV8A 3T2NA 3B9FH 1KXFA 1TGBA 4GAWA 3SGBE 3SORA 1NFXA 2Q1JA 3M7QA 1C4V2 1ELCA 3RM2H 1UTMA 1KXCA 1WQSA 3QUMP 1V2WT 3KQCA 3SQEE 3HATH 4F49A 1C2HA 1P3CA 5GPIB 3ZVGA 1XVMA 2VWOA 2HPQH 1C2EA 1F5LA 1MTNC 4O9VA 1QTFA 4YOJA 1XUHA 1ELDE 1RJXB 2ZGXH 3R0FA 1IQGA 6GCHG 1PPZA 5E0HA 1L1JA 5HMAA 6CHAC 2OUAA 2IOTA 1A7SA 2OP9A 4OS4A 4IMQA 1UTKA 2PSXA 2FODA 2O8UA 2P8OB 3SU2A 1TPOA 2WINI 4E7RG 2I6QA 2G4TA 3SJIA 1TIOA 1V2JT 2BOKA 5G4BA 1E35B 1KXBA 2A4GA 5HXFA 4X8UH 5H4IB 4I8JA 3UY9A 5F03A 1TNJA 1V2MT 4NIWA 1KXEA 3VB5A 1C1RA 2XXLA 3C1KA 1ELAA 3AW1A 4D7FA 1P9UA 2GCHF 1UCYE 4CHAC 1GHWH 4FUHA 4WVPE 2P3TB 2VVCA 4Q2KA 2AEIH 1MTWA 1YPHC 3BG4C 3GICB 5EW1H 2OCVB 1TA6A 1ZPCA 4FUGA 1KY9A 3S7KB 5EXNA 5GIBA 1C5SA 1QB9A 1C2DA 4MPUA 1HAXB 4PROA 1GI7B 4Y7AA 3U1JB 5LPEA 1P10A 1AZ8A 3GY7A 1H9LB 4CRAA 1QJ1B 3MI4A 2Z7FE 3Q00A 1NU9A 1SC8U 1F0RA 3QK1A 4JZ1A 1MKWK 1IHTH 4LXBH 2BLWA 1XXFA 3PYHA 3ODDA 2ZQ2A 4ABAA 1BT7A 2GCHG 3M3TA 4Y0YE 4X1PU 1CQQA 1EP5A 2AMPA 1HJAB 1QY6A 1SR5C 4O97A 1SPJA 1GI5A 1ZPZA 3W95A 1OOKB 2QV1A 5T6GA 2AGIX 2Y7XA 5FBEA 2B7DH 1O3DA 1DXPA 2CF9H 5FCKA 4WF8A 2ZFTA 3GISB 1TRNA 3UQVA 1LHFH 2ZCHP 1P06A 4K8YA 7ESTE 1C2GA 1ABIH 1YM0A 1EJAA 2O9QA 1QJ6B 4KKDA 1WUNH 1BRAA 2UWOA 2R3UA 1K1OA 2WV4A 1SQAA 4JK5A 4E06H 3M5MA 1GMHF 1FN8A 4MPWA 2Z6BD 2XW9A 3TNSA 4ISHH 3SNAA 3LGYA 2VU8E 1QIXB 2W3IA 4MPVA 5T3HA 3U69H 1BTUA 2A5KA 3P8NA 3EA9A 1GGDB 3TJUA 3VFEA 1SVPA 3QWCH 5E8EH 2RDLA 2SGPE 1NO9H 4FU7A 1WAYB 2VWNA 2BXTH 1KTTB 1V2ST 1MH0A 2QN5T 1EUFA 1D3PB 1ZHRA 2GCTC 1GMHG 2XBVA 2XCNA 4FUBA 4HI3A 4NA7A 1O38A 2P3FH 2TPIZ 1UO6A 1QL7A 3D49H 1C1PA 1E38B 1THRH 2RCEA 1DSTA 2QAAA 3MWIU 1EZQA 1LPKB 4GHQA 1O2ZA 3I77A 1AWFH 3O8RA 2AFQB 1BTYA 4TPYA 3P8OA 4AGJA 1AVWA 4TY7A 1Y3WA 3A7WA 2FYRA 2ANWA 1FLEE 1OWDA 2ZFSA 3TK6A 1B0EA 3K6ZA 3ZZ7A 2F9UA 5FBIA 5EG4A 1FY1A 2QC2A 1KYNA 3KEEA 5TJXA 3BTFE 3QGNB 9LPRA 2D26C 1HYLA 4FUFA 1S81A 2FOEA 4A92A 3ZVDA 1JMOH 1MTSA 2XC5A 1BTHH 4ISIH 1ETRH 1GBAA 3MNCA 3UTUH 3CP7A 3GOVB 3OSYA 1ANEA 2XC4A 3A85A 2RG3A 4D9RA 5JBBS 3M35A 8ESTE 4ZKNU 1K2I1 3ZZDA 1J15A 3TLOA 4AORA 2BX3A 1AFQB 1KIGH 3NZIA 4K1EA 1SGEE 2GMTB 2SNWA 1WQVH 4INHA 4AB9A 4ZAEA 1XUIA 1CGIE 1DLKB 2QXGA 4Y71A 1UHBB 1HRTH 2P8OC 5A2MH 2P95A 1TX7A 2JKHA 3HKJB 3Q3YA 1ORFA 5EQRA 2NWNA 3OY6U 2G52A 1VCPA 3ZZBA 1TBQH 2WPIS 4X6NA 1ZRKA 3E0PB 3HPTB 1THSH 4AG2A 1C5UA 3MU1A 2ZGJA 2J38A 1C5RA 3SGAE 1LHCH 2R2MB 4YO9A 1P11E 3EE0B 1GBMA 1GPZA 1P02A 2VB0A 3ZZ4A 3ATIA 3A8BA 1ZMNA 1T7CA 4K2YA 1QRXA 1AFEH 5IDKA 1TFXA 5CHAB 2XCFA 4VGCB 1HAGE 2ZFQH 1ZOMA 2OC1A 2P3UB 1W2KH 2OD3B 2STAE 5C5NA 4JMYA 4NFEA 3AASA 1EXFA 1Y5BT 3EDXB 4K1SA 5DGJA 1S6HA 2GTBA 2KAIB 3RXPA 1FY3A 2BMGB 1SGDE 1YYY1 5JBAS 1C2MA 4MTBA 5DK1A 4AB8A 1T32A 3QLPH 1S0RA 2VVUA 1BJVA 1ARCA 1O35A 3PMAB 3M5OA 1UVUH 1F0UA 4JZIA 2Z9JA 5DP5A 1TRYA 4NWLA 1TNIA 2NU1E 2BD2A 2XRCA 2VNTA 2ZHFH 1MBMA 2A4RA 1HJAC 2VWLA 2FOFA 1KXAA 5BPEA 1G32B 1TONA 2CJIA 3PV4A 2J34A 4ZUHA 5JPMH 1W11U 2ZO3H 1TALA 3PMBB 1AMHA 2P59A 1Y59T 4CREA 1BRBE 1WOFA 3O8BA 2C8WB 1SOTA 2WUCA 1GVLA 3O8CA 2GD4B 2A5IA 4RSPA 2XBWA 3KL6A 3FP6E 1IQEA 3V12A 1RD3B 2NU4E 2DE9A 4OS5A 1BBRH 4WXVA 2QXIA 1MAXA 5EQQA 3MH7A 1BTPA 2ZDVH 3SZNA 3V0XA 1BTZA 1QL8A 5FXLA 3RXFA 1A4WH 1XUGA 1OXGA 1UK4A 1K1PA 1V2OT 2ZFRH 1C5LH 5DP9A 2FS9A 1C2FA 2BD5A 3EQ0H 1GGDC 2EI8A 4YT7H 1IQLA 1U6QA 2VIDA 1CT0E 1TGCA 1MCVA 1HAPH 1O3EA 1HAVA 1ZSKA 3F9HA 1A5IA 4TY6A 3RXMA 3QGJA 4MVNA 3MMGA 1C5TA 3FANA 2NU0E 1FUJA 4YTAA 4JYUH 2W7UA 1GBLA 2Y82A 3PO1B 2ZDKA 3RXGA 5ESBA 4B1TA 1LHEH 1HXEH 3F9EA 2SGAA 1MU6B 2HNTE 3SQHE 1QBVH 1QA7A 1GI3A 5C20A 1MBQA 3ATMA 3C27B 2FEQH 1GL0E 2FWWA 2ZI2H 2D1JA 1DX5M 2BY9X 1ETSH 1CSOE 1N8OB 2PW8H 1P9SA 1KDQB 3A88A 1SOZA 3DD2H 4R0IA 4F4OC 2FI3E 3RXVA 1ANBA 1WYKA 2AGEX 3IWMA 1OP0A 3STIA 3D62A 1BIOA 4GUXA 1GVZA 4K69A 2FI4E 4A1TA 1CT4E 3O8DA 2D8WA 1L2EA 8KME2 1UCYK 1TNKA 4K3JA 4IN2A 1H1BA 4Z6AH 2PKSC 5EODA 3NKKA 1AFQC 1TMBH 1BITA 2Y81A 4X8TH 4B73A 1YC0A 2HNTC 1CU1A 1Z8JB 5L2ZH 1DSUA 1MQ5A 4YZUA 1QJ7B 1F5RA 3TGKE 2UWLA 1CA8B 4I8KA 1B5GH 1O2UA 1F0TA 1AKSA 4A7IB 3MU4A 4BXSA 3PLBA 2ANYA 4RKJB 1GJ5H 4BNRA 2AYWA 1YPMH 1O2GH 1NU7B 1PPGE 1BB0B 1O3LA 1ZHPA 2YNBA 1BHXF 1GMDF 2CV3A 1A5HA 3P70B 1HAOH 3A7YA 5BRRE 1S85A 5A8ZA 5F6MA 4VGCC 2BY5X 2PTNA 2SGDE 3A86A 3RXRA 1P09A 3RXIA 1SLWB 5T6FA 1SFIA 3A81A 2C4FH 6ESTA 4R8TB 1LHGH 1LVYA 4BXWA 1HIAB 1P2MA 1EPTC 1H8IH 3BV9B 2CF8H 1V3XA 1OKXA 1UTNA 1YCPH 2ZF0H 3E91A 4DCDA 3SI4H 1IQNA 1P2QA 3FZDA 2EC9H 3TK5A 8LPRA 2G55A 5K7RA 1YKTA 3E6PH 4U2WA 4X2YA 2ZG0H 2FMJA 2BDYA 3LGIA 2ZDMA 1J16A 4JYTA 1SGFA 1GMDG 3ODFA 3UPEA 2BQWB 3LIWA 1Y3VA 2FX6A 2BDIA 1UK3A 4YT6H 1P01A 2ZA5A 1XXDA 1GJ6A 1DUEA 4NG9H 2QIQA 5A8YA 4NZLA 1A0HB 5B6OA 1FONA 1C1VH 1GJ8B 4DIHH 3OU0A 1GMCF 2XBYA 4ABDA 2BD7A 4YOGA 3RMNH 1YLDA 4MG3A 2A4OA 5GCHF 1HUTH 2BZAA 2BDCA 1CA0C 2Z9IA 2Z94A 4RN6A 1DDJA 1C5NH 1MD7A 2JH5D 4MNXA 3F9GA 1IQMA 4LK4A 4J2YB 4UFEH 2FM2A 4DIIH 4X6PA 5CE1A 4CBNA 1ELVA 2SGEE 1GL1A 3ZZAA 2XNIA 1OP2A 2G81E 1GI9B 2F3CE 1Z1JA 3UR6A 4CBOA 3SHCH 1GMCG 1EAUA 2BYAX 5GCHG 2XC0A 1NESE 3U98H 1HPGA 3P17H 1O2MA 1A46H 4NIYA 2G8TA 4HFPB 1K1LA 4B74A 2TGTA 1L1NA 3I29A 1OYTH 4CRGA 2FXRA 5EPNA 1YCPM 4CRBA 3LGVA 5HM2A 4XDEA 5EU8A 3K2UA 1KXDA 2STBE 1YGCH 3SI3H 2FESH 3TVJB 3M5LA 1G37A 4KTSA