1TGSZ

Three-dimensional structure of the complex between pancreatic secretory inhibitor (kazal type) and trypsinogen at 1.8 angstroms resolution. structure solution, crystallographic refinement and preliminary structural interpretation
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
225
structure length
225
Chain Sequence
DKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title Three-dimensional structure of the complex between pancreatic secretory trypsin inhibitor (Kazal type) and trypsinogen at 1.8 A resolution. Structure solution, crystallographic refinement and preliminary structural interpretation.
pubmed doi rcsb
source organism Bos taurus
molecule tags Complex (proteinase/inhibitor)
total genus 53
structure length 225
sequence length 225
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgsZ01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgsZ02
1D3PB 2B5TB 5EU8A 1GDUA 5JDUB 1UCYK 5EGMA 4I8HA 1GJ9B 2ZHWH 3OY6U 3M61U 1ELAA 1V2OT 2ZDKA 2A5IA 1AD8H 2JETB 2AEIH 1O35A 3I29A 1XUFA 4K1EA 4WMFA 2I6SA 1QJ6B 2QXIA 4CRBA 2UWLA 2Z6BD 3QGNB 1S0RA 1YM0A 5C3NA 2XCNA 1RIWC 4X2YA 1QBOA 1B0EA 3PM3A 5AHGH 2ZFQH 3RXAA 1O5FH 2ZECA 4ISIH 1D4PB 2H6MA 4ABGA 1CGJE 1P0SH 4ISLA 1J16A 4FUGA 1SOZA 1P04A 4BTIB 3SGBE 2H5DA 2FWWA 4DCDA 5A2MH 1PJPA 1C5VA 2THFB 3U8RH 3TJOA 5GWZA 2HWLB 1QFKH 1Y59T 4Q7XA 4CRAA 1EPTC 1CHOG 4BNRA 3TPIZ 5K7RA 5AVDA 4I8LA 1CT4E 2A1DB 1OWEA 2O8TA 2WPMS 1C1NA 1A46H 3QGJA 7ESTE 1PYTD 1QJ7B 1TNHA 3SHCH 1EOLA 1GBDA 1O3NA 1NRNH 5E8EH 5H4IB 1AHTH 1BTPA 4YLUA 3SI3H 1N8OC 2CF9H 4U32A 3SNBA 1O34A 1V2VT 2FPZA 3TVJB 2ZTYA 4YM9A 2WPHS 1HFDA 1SLWB 2PKSC 1HAVA 2OC0A 1GHYH 1O31A 4XE4A 2F9PA 1WTGH 4CHAC 1HLTH 2AERH 2PW8H 1K1JA 1RJXB 2FS9A 3LDXH 2BTCE 3FZZA 1PPGE 3A7WA 1ZPBA 2QY0B 1LO6A 4X8TH 1O3CA 3M3SA 4CR5A 3BN9A 2QXJA 2Z9JA 2R3YA 1Z8GA 2XBYA 1RD3B 4D76A 1GVZA 1IQEA 1NO9H 3AW1A 4NG9H 1P3EA 1K28D 3NZIA 1YF4A 3ZZAA 2GDDA 3ZZ6A 3SGAE 3S7HB 3BTDE 4K3JA 1SGCA 3MNSA 1ELGA 1O3PB 3RXBA 2QXGA 4BAMB 2V3OH 3NK8A 4CRDA 3M7UA 2ZDLA 1C5OH 1B7XB 2FOFA 4Q80A 3LT3A 1V2TT 4A1VA 1O37A 3ATMA 4KP0A 1S6HA 1TPPA 5CMXH 3LC5A 1GI3A 2R3UA 3K9XB 1X7AC 1T8MA 2I6QA 1O2LA 2F3CE 3QK1A 1L1GA 3M7QA 5EQSA 4DG4A 1ZGIA 4DIIH 2J4IA 3RXGA 3A87A 4MNWA 1P05A 1SGNE 4YOIA 4B2BA 3UTUH 2BY9X 2BD3A 3K65B 3UOUA 4IMQA 1XUJA 1PPCE 1C9TA 3Q3XA 4Q7ZA 3SJ8A 1HJAB 4WF8A 1Y3WA 1UTMA 4MVNA 4FVBA 3EA9A 2ZCKP 1L4DA 3OY5U 1HXEH 1NFYA 2FOAA 1W2KH 4DOQA 1ANBA 3O8DA 1KXBA 3FANA 2BY6X 4WH6A 4I8JA 1GJAB 1SQTA 4UE7H 1GBFA 5DP5A 3SI4H 4GAWA 5JBBS 2Q6GA 1C1RA 2W26A 5HM9A 3M5MA 1OP2A 1YPLH 3D65E 4ABFA 1XUIA 2GX4A 2ZU5A 3UNSA 1QY6A 1GPZA 1O3OA 3N7OA 4GPGA 3MFJA 1BTYA 1GI9B 1SMFE 3GOVB 1GJCB 1GHWH 1BJUA 1GMDF 3SUGA 2V35A 3EGKH 2FO9A 4YO9A 3QX5H 3A85A 1P02A 3U1JB 2VH0A 1JWTA 3MWIU 3LGYA 2D8WA 3RXMA 2BD8A 1TNGA 1NS3A 4XOJA 2XRCA 3GYLB 4NZLA 2A0QB 4Y7AA 3VFEA 1QB6A 3S0NA 2RDLA 4CBOA 1XVOA 1TQ0B 2F91A 1BHXB 1F5RA 1KLTA 1BRUP 1QHRB 3GCOA 4MQAA 3L33A 3UREA 2OQ5A 3LU9B 1TLDA 2GD4B 1C5LH 1MTVA 5HM2A 3QLPH 1LKBA 5JBCS 5GCHF 4X6MA 1DSTA 1GJ6A 1AO5A 1SGDE 1K1IA 1LQEA 3P8FA 4JZEH 1DE7H 1FNIA 3RC5A 2PSYA 1IQLA 2ZDAH 1T8OA 1IQHA 4ZXYH 1ZGVA 1C1PA 2JH0D 1SGRE 3RUOA 3P70B 3FZDA 2TRMA 4A92A 2Z7FE 1EOJA 1PPFE 1KY9A 1HGTH 1V6DA 1PQ8A 4DURA 4HGCA 1JOUB 3ELAH 1TABE 1EX3A 1LKAA 4YT6H 2H9HA 2V6NA 3KNXA 1DY9A 5FAHA 1E38B 1QL7A 2Y80A 3U98H 4Q2KA 1AU8A 1SOTA 4QT8C 4IMZA 3U8TH 2F9NA 1INCA 1GJ8B 5CHAB 2GMTC 1LPZB 1SVPA 4M7GA 1L2EA 3AAUA 4K5ZA 3M3VA 1OWIA 1TNIA 1G9IE 1GMHF 3TITA 3LJJA 3RXKA 1L1NA 2GCTB 5DP4A 2C8ZB 1IQMA 2BLOA 1KXFA 1V2WT 2ZFSA 1G3CA 2G51A 2JKHA 4WMDA 4X1NU 1ELCA 3A7YA 3H7TA 2A4QA 2F9BH 2HGTH 3IWMA 2P3TB 1SL3A 1HUTH 2AH4X 4AFUA 5A8YA 1P2NA 1VGCB 1MZAA 1TYNA 1GBCA 1QL8A 3GY2A 1O5EH 4PROA 1TNLA 1AVXA 2VWLA 2C8YB 2ZWLH 1Z8RA 3V0XA 3ZZ3A 4GCHF 2OINA 1D6RA 1EUFA 1P09A 1WV7H 2IN2A 8LPRA 4RKJB 3NUMA 1JIMA 4D7FA 2ZHDA 2FMJA 1C1UH 4RKOB 4JYTA 1ZHMA 2A7CA 4AG1A 5T6GA 3SNDA 4K69A 2HLCA 4GVUA 1YGCH 1S83A 2O8WA 1RFNA 1HAYB 1ETSH 1G3BA 1QGFA 3MNCA 3GISB 3PROA 2D1JA 2Q6DA 4X6OA 4ZUHA 1C5PA 1PPBH 2ZGBH 4MLFB 4ABAA 3A82A 1ID5H 3PMJA 2XC4A 2JH5D 3NCLA 2BLVA 1J15A 1QTFA 3D49H 2PV9B 3ZZ5A 4DGJA 2HALA 1FPCH 1OWHA 3KQEA 3A84A 4DW2U 2B9LA 3SJ9A 3UIRA 3UPEA 4A7IB 1OWDA 4BXWA 3T25A 1QB9A 2FOCA 6ESTA 5L6NH 3W95A 2PUQH 2WV4A 1FN6A 2VIDA 3F9HA 1SGYE 1S81A 3SN8A 2PUXB 1C2JA 2QXHA 3L6PA 1MCVA 4SGBE 2BZ6H 4FUHA 1Y3YA 3RXCA 2DUCA 5GXPA 4E05H 1DS2E 1MKWK 2BY5X 4Y10E 2JETC 4CRCA 4X0WU 2RG3A 1C2HA 1IQKA 3BTME 1UCYH 3SUEA 1MKXK 2BLQA 1RRKA 5TCAA 1O2WA 2JH6D 3RM0H 5J4QA 3FP7E 1LHDH 3ZZ7A 2BYAX 3VXEH 3TNSA 1RGQA 3EYDA 2KAIA 1C2MA 1K1MA 2QF3A 1YCPH 1AIXH 1ZMLA 4THNH 3TK6A 4RN6A 3A8BA 2AGGX 2VWMA 4Y8XA 1TOMH 5ABWA 1SG8B 2V0BA 3A7XA 3DUXH 4JK6A 5GCHG 3A8AA 2BDGA 3OSYA 3P17H 1PPZA 1HAIH 2UUKB 2FP7B 2SGEE 2CF8H 1SLXB 3RXUA 3BEUA 1TMUH 4MPUA 4KELA 2F9OA 1O3EA 3ZZBA 1TGTA 1C5SA 4BTUB 3GY6A 2CV3A 3F1SB 3GCHB 1BITA 1EAIA 1QA7A 1QRZA 1SC8U 1V2ST 1DICA 3GY5A 3BSQA 3QTVH 4FUIA 3ZVBA 1O3AA 2FEQH 5AF9H 1BA8B 1BT7A 5LPEA 1GJ4H 5CE1A 1LTOA 2CHAC 1GI4A 1C5MD 3ZZ9A 2IPHA 4A6LA 3A80A 1A3BH 1MBQA 1S85A 1W0ZU 2G55A 1UJ1A 2ZP0H 4CREA 5C5OA 1FZZA 3TH2H 5FCRA 1YPHC 1RS0A 2BXTH 3SU6A 1YBWA 1G3EA 3SV2H 2VWNA 4AX9H 1A7SA 2NU1E 1GBJA 1GMHG 3DT0H 1O2PA 1P2KA 3Q3KA 2BX4A 2A4RA 2QAAA 4Y7BA 1O2KA 1EPTA 2XTTB 2GT8A 3SZNA 1FDPA 1GBEA 2AFQB 2BVXH 1IHSH 3SV8A 1IQIA 1Y8TA 3ZVCA 1VJAU 1A5IA 4NZQA 3C27B 2O9QA 3STJA 2VWOA 4K8BA 4BAKB 2Q6FA 3ZZ4A 8KME2 1PQ5A 1ZJDA 1P10A 1Q2WA 2FOEA 3TLOA 3KF2A 1TX8A 3A7TA 4ASHA 1W14U 2BY8X 1BTUA 4GCHG 3E90B 3TH4H 1Z8JB 3HATH 3DHKH 4NIXA 1UVUH 4Z0KA 4FU7A 3SNCA 1NFXA 2FESH 1P9SA 1O2YA 1TPAE 4GUXA 2QYIA 2K1QA 3VEQB 1XXFA 4E7RG 2PSXA 3E8LA 1XX9A 4Q7YA 1SQAA 1FJSA 3C1KA 1QRWA 4A1TA 1H9HE 1EJNA 4BAQB 1H9IE 1VCWA 5E0GA 3RMMH 2ZEBA 1HJAC 5E2OA 4TWYA 5C67A 3OYPA 2ODQA 1O5CB 1AUJA 1IQJA 2A2QH 2ZI2H 5DPAA 1QRXA 3RXVA 5F8XA 4U30A 2WYJA 1ELFA 1AUTC 1BQYA 3QO6A 3SV9A 1BIOA 1WU1A 2Z94A 3GY7A 1KDQB 3MH7A 1J17T 1GBMA 2LNCA 4LZ4B 4NA9H 1C2DA 1UK3A 3RMOH 3SNEA 1DOJA 3VPKA 2P3FH 4ABBA 3ZZCA 5HXFA 1A0LA 3GICB 2QIQA 1GJ5H 1SR5C 1SLUB 2BDYA 1VZQH 4F4OC 3TGJE 2DE8A 3KL6A 4INKA 4AB9A 3QWCH 1W10U 4X2WA 1DX5M 1NFWA 4WH8A 7GCHG 5SGAE 4HI3A 1P2JA 4I8GA 1CSOE 1THPB 2BLWA 2ZPRA 3NWUA 1SHHB 3SU0A 3T29A 1C2GA 2ZFFH 3F9GA 2ZTZA 3FP8E 5JBTA 4FXGH 3TJNA 1ELEE 5BPEA 1O2TA 2ZFPH 1TMTH 3T28A 1C4V2 1MD7A 2UWPA 4BOHA 2NU4E 1O3GA 2EEKA 2BVRH 3UOPA 1O2GH 2UUFB 5IYTA 2PGBB 1SFIA 2Y82A 3P95A 2ZPSA 5JB8S 1T31A 1A0JA 4K1TA 2HVXA 2NU2E 1OYQA 4JMYA 5DG6A 3I77A 4J1YA 3CENA 1SHYA 3MO6A 5CHAC 2QC2A 3SO3A 2ZU1A 2QN5T 5A8ZA 2PKAB 3P92A 4ZAEA 1Z6JH 1VCPA 5JB9S 2FS8A 1SGEE 2J95A 2GCTC 1FMGA 2CHAB 3IITA 5TCCA 2HPQH 1UTJA 1T4UH 2Z3EA 2O8UA 3A86A 1OP0A 4XBDA 1OSSA 4YLQH 5A0CA 2CGAA 3V3MA 3P8NA 1A2CH 1J14A 4X2XA 3URCA 1VGCC 1GBKA 2NU3E 2V3HH 4KTUA 1V2PT 2VB0A 1NN6A 1TX7A 1MCTA 3BG4B 2PR3A 4ABIA 3RU4D 1N1LA 1XVMA 5EPNA 2C90B 4MTBA 4MDSA 3PLPA 1RTKA 2HNTC 3LPRA 1BMMH 1C2FA 1P8VC 4UFDH 1U6QA 3A83A 2FODA 4IC6A 4JZFH 5E0HA 4ESTE 1BJVA 1AQ7A 1HIAA 1ZZZA 1F0SA 3GCNA 2H9EH 1C4Y2 3RXOA 1JBUH 2ZC9H 5DK1A 3T26A 1FONA 1F5LA 1O2ZA 4BXSA 1FY8E 1OX1A 2R9PA 1Y5BT 1GJDB 1WQVH 6CHAB 2ZA5A 2G81E 1BDAA 1C4U2 3LH3A 4IBLH 1EATA 3K6ZA 1C1QA 3MU8A 5A0BA 1LHGH 3RXLA 1MAXA 2B0FA 1SGTA 3A89A 4JZ1A 2A5AA 4JZIA 1C5QA 1EASA 1O3BA 1G36A 1ZTJA 4A5TS 1P9UA 2R2WU 4CH2B 5GJ4B 3A7ZA 1CT2E 2GZ9A 2FLBH 1EKBB 3S9CA 1UVSH 3GDSA 2CXVA 3SGQE 1YP9A 2FZZA 3UY9A 4D9RA 4NFEA 4OGXA 3URDA 1H9LB 3SQHE 2ZO3H 1P2IA 3F9FA 4WVPE 1O39A 4WY3A 1XUGA 3MO3A 3EDXB 4TPYA 7LPRA 1WTHD 4FUDA 1KLIH 1C5ZB 5ETXA 1AWFH 1AE8H 1K1PA 4B2CA 2ZU3A 1ETTH 2FOMB 3KQDA 3FAOA 4FUFA 1KIGH 1UK2A 3BTTE 1FIZA 3A88A 3PO1C 4D9QA 1DT2A 2OTVA 4Z6AH 2WINI 2OLGA 2GZ7A 5DP3A 3TK5A 3RM2H 3GCTF 2ZF0H 1C2EA 3BTWE 1F5KU 1KYNA 1F7ZA 2Z9GA 2OXSA 1WSSH 2AMQA 1C2IA 1A4WH 2WPLS 1O0DH 1SBWA 5K0HA 1HJ8A 1OKXA 3KCGH 5A09A 1O33A 2Y7ZA 2P94A 4H6TA 1DWDH 3E1XB 2BHGA 1SPJA 2R0LA 4UEHH 5F8ZA 4JYVH 1K1OA 2BDBA 4ZKNU 4YT7H 2GCHG 4XFQA 1KXDA 3GCHC 3DD2H 2O8LA 4UFFH 4UDWH 3RP2A 4TY6A 1LMWB 1P06A 1V2JT 2VVUA 1E36B 2PGQB 4WMEA 3A7VA 4MPVA 2TIOA 1FV9A 1T8NA 1MQ5A 1NT1A 1IQFA 3T62A 1ZRBA 4LZ1H 1CT0E 2ZHFH 4ZXXH 3KGPA 4NIWA 2NWNA 4DY7B 1V2KT 2CMYA 2OCVB 5I25A 2WYGA 3SBKA 1C1MA 2PLXA 1DVAH 1T4VH 1ZSKA 1D3QB 4YOGA 2BOHB 7KMEH 3LOXA 1Y3UA 1SGPE 1C1OA 1V2MT 3RXJA 3UWIA 2G00A 3BIVH 2IOTA 5EPYA 4I32A 2PKAA 3TIUA 1FPHH 4AYYB 1V2NT 1EJAA 2SNVA 4ISNA 3Q00A 2VGCB 1LPGB 1DPOA 2A2XH 5EW2H 1A5HA 4AFQA 4OS1A 1UTQA 4MNYA 1Z8IB 4AG2A 4TYDA 2ASUB 1IOEA 4B75A 3MNBA 4TPIZ 1MMJN 1CO7E 2C93B 1YPMH 1BBRH 3RC6A 1C9PA 1P2QA 5DGJA 1V2UT 1NRPH 1TGSZ 3LH1A 5C1XA 2P95A 5DP6A 2ZGXH 1O32A 3FVFB 1O36A 1T7CA 2HOBA 4OS2A 3HK6B 1MQ6A 3BF6H 3H5CB 4B2AA 1TGNA 3WY8A 1GVKB 1QB1A 1VJ9U 4HZHA 2VH6A 4INLA 1AMHA 1FQ3A 1BMAA 1O3DA 4INHA 2P3UB 4NFFA 3UWJH 5FX5A 3E0PB 2BM2A 2LPRA 4BAOB 3E3TA 3LGIA 2VNTA 3SJIA 1GHBF 1CGIE 2ZHEH 2XC5A 4NSYA 1SQOA 1ZMNA 1D9IA 1HV7A 5C1UA 1SLVB 1O2QA 3RXQA 2D2DA 1V3XA 4OS5A 1TQ7B 1S5SA 1GVLA 1WYKA 4NIVA 3EE0B 1TONA 1CVWH 2ZQ1A 4ZROA 3E16B 4X2VA 1FI8A 1H8IH 1O2JA 1VR1H 2ZDVH 3PMHB 4NA8A 1NU7B 1ZPCA 3O8CA 1C5XB 1NM6A 3O8RA 1O2NA 3LGTA 2SFAA 2D26C 3W94A 1P12E 5T6FA 1UVTH 2BQWB 1MU6B 2XBVA 1BHXF 3HKIB 1BB0B 2Z3DA 4MPWA 1O2VA 3BEIB 4ISOA 1O3IA 1DXPA 4AGKA 1VITH 1L4ZA 1GHVH 2BD4A 2WUBA 1BUIA 4B1TA 4IN1A 4YTAA 5DP9A 1AB9B 1F0UA 3GCTG 4X1SU 1UTOA 5FXLA 5EQRA 1LHEH 7GCHF 1W8BH 2GKVE 1ELDE 2H2ZA 2G8TA 1CA0C 4GSOA 1H1BA 1EJMA 2C3SA 4IC5A 3S9AA 1GMCF 5DKMA 3RLWH 1DUAA 3PO1B 3UUZA 1OPHB 1MTNB 2FOGA 4I31A 2G4UA 1ZPZA 4B76A 2FM2A 3TJUA 1VITF 2AMPA 3LJOA 4FVDA 1HPGA 3JZ1B 2UUJB 1F0TA 1A5GH 1JIRA 3ENSB 3BTEE 3UQOA 1ESTA 1Y3XA 2XCFA 3M3TA 2DE9A 4JYUH 3TNTA 4WJG2 1FY5A 1YPEH 4Y11E 4U2WA 1QCPA 2ULLA 3OTJE 1C2KA 1LDTT 1NRRH 1O3KA 1OOKB 3PYHA 4WWYA 4XSKU 1NTPA 2GDEH 4TWWA 3RXRA 2XBXA 4ZH8A 4AN7A 3SJKA 4CRFA 1YYY1 3ZYDA 3G01A 4KGAA 4WXVA 3VGCB 1K1NA 1HDTH 1ZHRA 3MTYA 4X1PU 1DUEA 1HBTH 4XBBA 3D62A 2PTNA 4LK4A 2FI3E 3BIUH 3AW0A 1ZRKA 3BG4C 1OP8A 4IGDA 1NRSH 1QIXB 3HKJB 3B8JA 2J38A 3T27A 4E7NA 3ZV9A 2ZIQH 1QURH 1GI7B 2HNTF 3SU5A 1HAVB 1MTWA 1XKAC 1GBBA 5I46H 2EC9H 4BTTB 3ZVGA 9ESTA 1HRTH 1MH0A 1MUEB 1NY22 1W12U 1MBMA 1FXYA 2XYAA 1Q31A 3GY4A 2GP9B 1HAPH 1HJ9A 3RXIA 1D6WA 1GBTA 5FCKA 2H5CA 1QQUA 2AIPA 4NGAH 1AZ8A 3PV4A 2GV6A 5TJXA 6CHAC 2XC0A 1TNKA 1PPHE 2VVCA 2GT7A 2TPIZ 4ABDA 2FYQA 1UMAH 1GBLA 1ANCA 2FOHA 3HGPA 4OGYA 3SUFA 2AYWA 2RCEA 3BV9B 1NPMA 1O2UA 2AMDA 1O3FA 1ELTA 3ZZ8A 4K2YA 2SGAA 1ZSLA 1Z7KA 1IAUA 1KLJH 1GI0A 1NESE 5L2YH 3L3TA 1F2SE 4B73A 1GHBG 3A81A 3RC4A 1CQQA 4ZMAH 3ODDA 1Y3VA 5L2ZH 1BBRE 2WPIS 1A61H 1O5AB 3M36A 1TRYA 2ZNKH 2G5VA 1HAZB 2ESTE 2YNAA 1UO6A 1W11U 3EQ0H 1L0ZA 1G2MA 1SI5H 1F0RA 1FLEE 1W7XH 3SOSA 4CR9A 2G5NA 2Y7XA 3BTQE 4OS7A 2PWXA 3IG6B 3TGKE 1V2QT 1OWKA 2WPJS 3BTFE 4JK5A 4WXIA 1FY1A 3BTKE 1N6YA 3QZRA 1YPJH 2J94A 4X1QU 3RDZA 1UVOA 2RA0A 3PLKA 4ISHH 5EODA 2P93A 3PWBA 2BQ6B 1K9OE 1O2XA 1ZR0A 3AVZA 1W7GH 1CE5A 4GLYA 1C1WH 3M35A 2ZPQA 1V2LT 1B5GH 1GJ7B 1UK4A 1GMCG 1OS8A 1NROH 3Q77A 1P3CA 1UHBB 1ZSJA 1FAKH 1O2OA 1H4WA 3GY8A 4ABHA 3RU4T 3E0NB 1VITG 3MH5A 5HMAA 1GCTB 1CA0B 3P8GA 5ESBA 3SHAH 2GCHF 3MH4A 1P03A 2OBQA 1XM1A 1BTZA 4A1XA 3AAVA 4XDEA 2BD5A 3KQCA 2BDIA 2W3IA 1YCPK 1GHXH 3TU7H 1EAUA 1C1VH 1W13U 1HYLA 1A3EH 2R0KA 3EAJA 1UCYE 1BCUH 1IQGA 2OBOA 3UNQA 2FTLE 1HAHH 1P11E 1UVPA 3CS0A 4E06H 8GCHG 1S0QA 1Z1IA 3LIWA 2OC1A 4K60A 5EG4A 3MYWA 1DWCH 1ELVA 4B74A 2SGDE 3M37A 3T5FH 1EZXC 2ZHQH 5FX6A 2W3KA 1CGHA 4Y0YE 1HAXB 2VGCC 1DANH 1K22H 4NSVA 3E6PH 3GYMA 5LGOA 3FFGA 1DITH 3VB7A 4Y6DA 1XUKA 2OP9A 1LVYA 2VU8E 1GG6B 2QCYA 1SGFG 2YOLA 1GI6A 3B23B 3UQVA 3ZVFA 1C5UA 3ITIA 1XMNB 5FHTA 4K8YA 1AWHB 4UFGH 1ESAA 3SU2A 5JYIA 3EA8A 3KN2A 1TALA 2BD7A 2M5TA 1O38A 4RSPA 3I78A 2WV5A 4ABJA 1E35B 2A4GA 4YOJA 4UFEH 3F6UH 2UWOA 1UTNA 2HNTE 2QF0A 2ANKH 2ILNA 4R0IA 4NIYA 2P59A 5FPTA 1HXFH 1L1JA 1BTXA 1P01A 1G3DA 4I7YH 1HNEE 4K1SA 1UTKA 2P8OB 4NWLA 3MU1A 4O3UA 1TE0A 1NZQH 4AZ2B 1A1RA 1GI8B 2ZTXA 3FP6E 1MTSA 1ETRH 2YNBA 5PTPA 4J2YB 3U69H 1ZTLA 2BXUH 1YLDA 2Y81A 2ANMH 2VJ1A 3BG8A 2HPPH 4FU9A 3VB6A 5A8XA 1TPOA 2EA3A 3RXDA 4LXBH 1W3CA 1P2MA 2H9TH 1DDJA 1H8DH 1THSH 2ZKSA 3GDVA 1AFQB 1ZHPA 1P57B 3V7TA 1Q3XA 5A0AE 2AGEX 2SGQE 4CRGA 4ZKOU 1A0HB 2SGFE 4X6NA 5ESTE 4H6SB 3UR9A 1AKSB 1C5TA 3TGIE 2VIVA 5T6DA 3RXFA 1GGDB 1KXAA 1HCGA 2WUCA 8ESTE 1NFUA 3ZVAA 5EOKA 2HRVA 1PFXC 1M9UA 1SB1H 1SGIB 2A7HA 4YESB 2ZU2A 3SV7A 1GI5A 1DWEH 1ZYOA 2W7UA 2BB4A 3RXPA 1KDQA 1AB9C 2ALPA 1MKWH 2OD3B 3KHVA 3DFJA 4DJZB 3P8OA 5C5NA 1BTHH 2ZGHA 2B7DH 3VB5A 5C2ZA 4I8KA 2EI8A 1NRQH 9LPRA 1MKXH 2QGRA 3BTGE 4F49A 2STBE 4AFSA 1PQAA 2ODYB 5DP8A 2RA3A 3K6YA 3RMLH 4AB8A 1UTPA 1C2LA 1MTUA 3ATWA 1MTNC 3PWCA 2XBWA 1O3MA 1PPEE 2TGDA 4OS6A 1EB2A 1ZJKA 1TPSA 1TGCA 2KAIB 3NXPA 4AFZA 4AGJA 1MD8A 6GCHF 4BAHB 1WQSA 3QN7A 2Y5HA 4VGCB 5AFZH 1P2OA 3SNAA 4Y8ZA 1AN1E 1O5BB 1GBIA 1UHBA 3MO9A 1O5DH 3S69A 4O97A 2J34A 1LVBA 1THRH 3M5NA 2FYRA 1SSXA 1W0YH 2F83A 2VIWA 1EP5A 6LPRA 1KTSB 2XNIA 3MHWU 4ZHLU 3ZYEA 4NWKA 5LH8A 1J9CH 3RMNH 3VGCC 1TIOA 2FX4A 2O8MA 2ZQ2A 2CJIA 2TGAA 1WUNH 1PYTC 2FLRH 2QA9E 2VVVA 1RTLA 1QNJA 3MOCA 3QUMP 3RU4E 1RIWB 1YPKH 5G4BA 4TY7A 1BTWA 1AE5A 1ORFA 2FI4E 2Z3CA 4O3TA 1E37B 3LGUA 4HFPB 1TWXB 3PTNA 5EXLA 2BVSH 1SGQE 1EAXA 2GZ8A 4FUJA 1TA2A 2ZGCA 5BRRE 3OX7U 3BTHE 5EXMA 2ZG0H 3R3GB 1GHAF 2FOBA 4FUBA 1Z6EA 1EPTB 2BY7X 1CHGA 3D23A 4FUCA 4O03A 5GDSH 5GIBA 1GDNA 4Y0ZE 2J9NA 2FTMA 1QBNA 3A8CA 3SU3A 2ZCLP 2AS9A 1TOCB 2SNWA 1BRAA 1TRNA 4IN2A 3PB1E 2ANYA 3SU4A 2BD9A 2FXRA 2OQUA 1ZMJA 1LCYA 2OC8A 3MU5A 1KTTB 1ARBA 1WOFA 4KKDA 3NPSA 1XXDA 1BOQA 1N8OB 4AORA 1YCPM 1D3TB 3NKKA 3GY3A 5FPSA 1QQ4A 3S7KB 1ZTKA 2PHBA 4HTCH 4ZHMU 1C5WB 2PKSB 4X1RU 5IDKA 1RXPA 1YC0A 5LPFA 4CHAB 3PLBA 4ZKSU 4R8TB 2BDHA 1ESBA 2R2MB 1XKBC 1S6FA 1LHFH 2TGPZ 4ZKRU 1GCDA 3STIA 2GGVB 1C5YB 1OWJA 2PFEA 3VB3A 1AFEH 1C5NH 1J8AA 1TNJA 3U8OH 3VXFH 1DM4B 1C1SA 4JZDH 1Z1JA 1AI8H 4DT7B 1CBWC 4SGAE 2ZFRH 3SQEE 4CBNA 5J4SA 5EW1H 1TFXA 1BRCE 2ZCHP 5EXNA 1V2RT 5JPMH 1MZDA 3MMGA 1F92A 2BD2A 2AIQA 1KXEA 2VIOA 1KXCA 1FY3A 1EXFA 4Y76A 3UR6A 1S84A 1ANEA 4IW4E 2G4TA 4DVAU 3F9EA 2QV1A 4AYVB 1HB0B 3ATKA 1IHTH 1LVMA 1GI2A 3AASA 1GL0E 4Y79A 3K2UA 1AVWA 1QR3E 1UTLM 2BDCA 1AKSA 2XW9A 2CN0H 4UD9H 1QL9A 1YLCA 1AY6H 4DIHH 1C5RA 3MNXA 3V13A 4MNVA 2J92A 1JRSA 2BDAA 5FBIA 1K2I1 1SFQB 4XBCA 5FBEA 3PMAB 1OYTH 1GI1A 1O2IA 4ABEA 3ODFA 2BX3A 4NCYA 4X8SH 4KTSA 1EZQA 2AGIX 4IS5A 2XXLA 1WCZA 1GCTC 1AZZA 2A32A 3M5OA 2OUAA 1O3JA 6GCHG 4I33A 4LOYH 1EAWA 4YZUA 3RLYH 1GL1A 1GBHA 3DA9B 2TBSA 3U9AH 1GMDG 1TBQH 4UONA 1EB1H 3PMBB 2ALVA 4X8UH 3RXEA 1G30B 3SJOA 3P6ZB 3LONA 3E91A 3ZZDA 4O9VA 2BOKA 1T32A 1G32B 3SUDA 3TK9A 2ZZUH 5LPRA 5B6OA 2ODPA 1KSNA 3PTBA 1TBZH 3BEFB 1BZXE 1QA0A 4D7GA 2P16A 3SU1A 1MAYA 5HYOA 3EA7A 3ATLA 3A8DA 2H1UA 2A7JA 5GPIB 3Q3YA 2Y5GA 1LPKB 1TB6H 4KTCA 2VIQA 3HK3B 8GCHF 4OS4A 1CA8B 2A45B 4X6PA 1AVGH 1TMBH 1O2MA 3SORA 1DLKB 3O8BA 5E2PA 2WPKS 3ZVDA 4H4FA 1VCQA 1GG6C 4B71A 1Y5UT 1DWBH 2GVFA 1ANDA 5F8TA 2W7SA 1T8LA 1JMOH 2F9UA 2FDAA 1DLEA 3DFLA 3U1IB 2C8XB 2A5KA 1YPHE 5DO4H 1G37A 3ATIA 1YPGH 2UUYA 2GV7A 3F68H 2PTCE 1DXWA 1Y5AT 2XWBI 4FUEA 2Y6TA 1EZSC 4U01A 4H42U 1CHOF 1QJ1B 1CU1A 3CP7A 4X8VH 1S82A 1GHAG 3TH3H 2STAE 2Z9KA 3JZ2B 1FN8A 2VIPA 1PQ7A 5FPYA 1DFPA 1G2LA 3KEEA 4D8NA 2ZGJA 2EI7A 1Z71A 4ZHAA 1O2HA 3ZVEA 1N6XA 2Y5FA 3M7TA 3LC3A 1TX6A 3ZV8A 2BZAA 1ARCA 2TGTA 3LKWA 1C1TA 2IJOB 2ZDNA 1GDQA 2P8OC 3B9FH 1TGBA 4BANB 3KQBA 3MH6A 3S9BA 1AGJA 2ZU4A 3M5LA 3QDZB 2GMTB 1K21H 3ESTA 4Y71A 5C20A 3VB4A 1GJBB 5JBAS 2BMGB 1HIAB 4JCNA 3SW2B 1MU8B 3MU0A 1OXGA 1WAYB 3V12A 1O5GH 2G52A 5AFYH 1BBRK 1WBGB 5DJ7A 1O2SA 1NU9A 4NA7A 1B0FA 1AFQC 2ANWA 1SGFA 2Q1JA 4MPXA 1BMLA 4GHQA 3KIDU 1O3LA 2C8WB 2SGPE 2A4OA 1BMNH 2A31A 1FUJA 3RXTA 1EZUC 5EQQA 1GGDC 5F6MA 3LGWA 2XWAA 4MG3A 3T2NA 3OU0A 2F9VA 2BQ7B 3GDUA 1FIWA 2Z9LA 1GHZA 1DSUA 1EQ9A 2C4FH 2GTBA 4AOQA 1CBWB 4MNXA 2VINA 1FY4A 2Z9IA 1HAOH 2ZFTA 3SV6A 1JXPA 1K1LA 1BRBE 2FI5E 1ZOMA 1E0FD 5C1YA 1ABJH 3RXSA 1ELBA 5L30H 2EI6A 1JRTA 2FIRH 1O2RA 5HGGA 3LGVA 4CH8B 2J2UA 1FAXA 1O30A 3HGNA 3UNRA 3QTOH 1RTFB 2ZDMA 3MU4A 3TJVA 3MI4A 3UFAA 1ABIH 5E0JA 1GWAA 5DP7A 1LQDB 1QBVH 2FX6A 1ACBE 2NU0E 3QZQA 3RXHA 1EP6A 1TAWA 1LVOA 5T3HA 1XUHA 1D3DB 1TBRH 3CS7A 3H7OA 3HPTB 3R0FA 1IQNA 2B8OH 1GBAA 4FU8A 1LHCH 5F03A 1NC6A 1TRMA 4VGCC 2OC7A 3Q76A 1HAGE 4Y8YA 1TA6A 1ZLRA 1E34B 1DY8A 1YKTA 4GHTA 2W5EA 1O3HA
chains in the Genus database with same CATH superfamily
1D3PB 2B5TB 5EU8A 1GDUA 5JDUB 1UCYK 5EGMA 4I8HA 1GJ9B 2ZHWH 3OY6U 3M61U 1ELAA 1V2OT 2ZDKA 2A5IA 5KGOA 1AD8H 2JETB 2AEIH 1O35A 3I29A 1XUFA 4K1EA 4WMFA 2I6SA 1QJ6B 2QXIA 4CRBA 2UWLA 2Z6BD 3QGNB 1S0RA 1YM0A 5C3NA 2XCNA 1RIWC 4X2YA 5T1VA 1QBOA 1B0EA 3PM3A 5AHGH 2ZFQH 3RXAA 1O5FH 2ZECA 4ISIH 1D4PB 2H6MA 4ABGA 1CGJE 1P0SH 4ISLA 1J16A 4FUGA 1SOZA 1P04A 4BTIB 3SGBE 2H5DA 2FWWA 4DCDA 5A2MH 1PJPA 1C5VA 2THFB 3U8RH 3TJOA 5GWZA 2HWLB 4P02A 1QFKH 1Y59T 4Q7XA 4CRAA 1EPTC 1CHOG 4BNRA 3TPIZ 5K7RA 5AVDA 4I8LA 1CT4E 2A1DB 1OWEA 2O8TA 2WPMS 1C1NA 1A46H 3QGJA 3FN8A 7ESTE 1PYTD 1QJ7B 1TNHA 3SHCH 1EOLA 1GBDA 1O3NA 1NRNH 5E8EH 5H4IB 1AHTH 1BTPA 4YLUA 3SI3H 3PRBA 1N8OC 1OHHD 2CF9H 3OE7D 4U32A 3SNBA 1O34A 1V2VT 2FPZA 3TVJB 2ZTYA 4YM9A 2WPHS 1HFDA 1SLWB 5HIZA 2PKSC 1HAVA 2OC0A 1GHYH 1O31A 4XE4A 2F9PA 1WTGH 4CHAC 1HLTH 2AERH 2PW8H 1K1JA 1RJXB 2FS9A 3LDXH 2BTCE 3FZZA 1PPGE 3A7WA 1ZPBA 2QY0B 1LO6A 4X8TH 1O3CA 3M3SA 4CR5A 3BN9A 2QXJA 2Z9JA 2R3YA 1Z8GA 2XBYA 1RD3B 4D76A 1GVZA 1IQEA 1NO9H 3AW1A 4NG9H 4ACAA 1P3EA 1K28D 3NZIA 1YF4A 1EFRD 3ZZAA 2GDDA 3ZZ6A 3SGAE 3S7HB 3BTDE 4K3JA 1SGCA 3MNSA 1ELGA 1O3PB 3RXBA 2QXGA 4BAMB 2V3OH 3NK8A 4CRDA 3M7UA 2ZDLA 4AC9A 1C5OH 1B7XB 2FOFA 4Q80A 3LT3A 1V2TT 4A1VA 1O37A 3ATMA 4KP0A 4YXWD 1S6HA 1TPPA 5CMXH 3LC5A 1GI3A 2R3UA 3K9XB 1X7AC 1NBME 1T8MA 2I6QA 1O2LA 2F3CE 3QK1A 1L1GA 3M7QA 5EQSA 5CHBA 4DG4A 1ZGIA 2J98B 4DIIH 2J4IA 3RXGA 3A87A 4MNWA 1P05A 1SGNE 4YOIA 4B2BA 3UTUH 2BY9X 2BD3A 3K65B 3UOUA 4IMQA 1XUJA 1PPCE 1C9TA 3Q3XA 4Q7ZA 3SJ8A 1HJAB 4WF8A 1Y3WA 1UTMA 4MVNA 4FVBA 3EA9A 2ZCKP 1L4DA 3OY5U 1HXEH 1NFYA 2FOAA 1W2KH 4DOQA 1ANBA 3O8DA 1KXBA 3FANA 2BY6X 4WH6A 4I8JA 1GJAB 1SQTA 4UE7H 1GBFA 5DP5A 3SI4H 4GAWA 5JBBS 2Q6GA 1C1RA 2W26A 5HM9A 3M5MA 1OP2A 1YPLH 3D65E 4ABFA 1XUIA 2GX4A 2ZU5A 3UNSA 1QY6A 1GPZA 1O3OA 3N7OA 4GPGA 3MFJA 1BTYA 1GI9B 1SMFE 3GOVB 1GJCB 1GHWH 1BJUA 1GMDF 3SUGA 2V35A 3EGKH 2FO9A 4YO9A 3QX5H 3A85A 1P02A 3U1JB 2VH0A 1JWTA 3MWIU 3LGYA 2D8WA 5EJLA 3RXMA 2BD8A 1TNGA 1NS3A 4XOJA 2XRCA 3GYLB 4NZLA 2A0QB 4Y7AA 3VFEA 4Z1MD 1QB6A 3S0NA 2RDLA 4CBOA 1XVOA 1TQ0B 2F91A 1BHXB 1F5RA 1KLTA 1BRUP 1QHRB 3GCOA 4MQAA 2HVYB 3L33A 3UREA 2OQ5A 3LU9B 2KCYA 1TLDA 2GD4B 1C5LH 1MTVA 2J97A 5HM2A 3QLPH 1LKBA 5JBCS 5GCHF 2KX4A 4X6MA 1DSTA 1GJ6A 1AO5A 1SGDE 2KCOA 1K1IA 2OK5A 1LQEA 3P8FA 4JZEH 1DE7H 1FNIA 3RC5A 2PSYA 1IQLA 2ZDAH 1T8OA 4F48B 1IQHA 4ZXYH 1ZGVA 1C1PA 2JH0D 1SGRE 3RUOA 3P70B 3FZDA 2TRMA 4A92A 2Z7FE 4OM9A 1EOJA 1PPFE 1KY9A 1HGTH 1V6DA 1PQ8A 4DURA 4HGCA 1JOUB 3ELAH 1TABE 1EX3A 1LKAA 4YT6H 2H9HA 2V6NA 3KNXA 1DY9A 5FAHA 1E38B 1QL7A 2Y80A 3U98H 4Q2KA 1AU8A 1SOTA 4QT8C 4IMZA 3U8TH 2F9NA 3H09A 1INCA 1GJ8B 5CHAB 2GMTC 1LPZB 4ACBA 5DSFA 1SVPA 4M7GA 1L2EA 3AAUA 4K5ZA 3M3VA 1OWIA 1TNIA 1G9IE 1GMHF 3TITA 3LJJA 3RXKA 1L1NA 2GCTB 5DP4A 2C8ZB 1IQMA 2BLOA 1KXFA 1V2WT 2ZFSA 1G3CA 2G51A 2JKHA 4WMDA 4X1NU 1ELCA 3A7YA 3H7TA 2A4QA 2F9BH 2HGTH 3IWMA 2P3TB 1SL3A 1HUTH 2AH4X 4AFUA 5A8YA 1P2NA 1VGCB 1MZAA 1TYNA 1GBCA 1QL8A 3GY2A 1O5EH 4PROA 1TNLA 1AVXA 2VWLA 2C8YB 2ZWLH 1Z8RA 3V0XA 3ZZ3A 3KYFA 4GCHF 2OINA 1D6RA 1EUFA 1P09A 1WV7H 2IN2A 8LPRA 4RKJB 3NUMA 1JIMA 4D7FA 3UB0A 2ZHDA 2FMJA 1C1UH 4RKOB 4JYTA 1ZHMA 2A7CA 4AG1A 5T6GA 3SNDA 4K69A 2HLCA 4GVUA 1YGCH 1S83A 2O8WA 1BMFD 1RFNA 1HAYB 1ETSH 1G3BA 1QGFA 3MNCA 3GISB 3PROA 2D1JA 4FETA 2Q6DA 4X6OA 4ZUHA 1C5PA 1PPBH 2ZGBH 4MLFB 4ABAA 3A82A 1ID5H 3PMJA 2XC4A 2JH5D 3NCLA 2BLVA 1J15A 1QTFA 3D49H 2PV9B 3ZZ5A 4DGJA 2HALA 1FPCH 1OWHA 3KQEA 3A84A 4DW2U 2B9LA 3SJ9A 3UIRA 3UPEA 4A7IB 1OWDA 4BXWA 3T25A 1QB9A 2FOCA 4TSFD 6ESTA 5L6NH 3W95A 2PUQH 2WV4A 1FN6A 2VIDA 3F9HA 1SGYE 3F0PA 1S81A 3SN8A 2PUXB 1C2JA 2QXHA 3L6PA 1MCVA 4SGBE 2BZ6H 4FUHA 1Y3YA 3RXCA 2DUCA 5GXPA 4E05H 1DS2E 1MKWK 1UW7A 2BY5X 4Y10E 1SKYE 2JETC 4CRCA 4X0WU 2RG3A 1C2HA 1IQKA 3BTME 1UCYH 3SUEA 1MKXK 2BLQA 1RRKA 3F3BA 5TCAA 1O2WA 2JH6D 3RM0H 5J4QA 3FP7E 1LHDH 3ZZ7A 3FO8D 2BYAX 3VXEH 4DT4A 3TNSA 1RGQA 3EYDA 2KAIA 1C2MA 1K1MA 2QF3A 1YCPH 1AIXH 1ZMLA 4THNH 3TK6A 4RN6A 3A8BA 2AGGX 2VWMA 4Y8XA 1TOMH 5ABWA 1SG8B 2V0BA 3A7XA 3DUXH 4JK6A 5GCHG 3A8AA 2BDGA 3OSYA 3P17H 1PPZA 1W0JD 1HAIH 2UUKB 2FP7B 2SGEE 2CF8H 1SLXB 3RXUA 3BEUA 1TMUH 2YMSC 4MPUA 4KELA 2F9OA 1SQRA 1O3EA 3ZZBA 2RFKC 1TGTA 1C5SA 4BTUB 3GY6A 2CV3A 3F1SB 3GCHB 1BITA 1EAIA 1QA7A 1QRZA 1SC8U 1V2ST 1DICA 3GY5A 3BSQA 3QTVH 4FUIA 3ZVBA 1O3AA 2FEQH 5AF9H 1BA8B 1BT7A 5LPEA 1GJ4H 5CE1A 1LTOA 2CHAC 1GI4A 1C5MD 3ZZ9A 2IPHA 4A6LA 3A80A 1A3BH 1MBQA 1S85A 1W0ZU 2G55A 1UJ1A 2ZP0H 4CREA 5C5OA 1FZZA 3TH2H 5FCRA 1YPHC 1RS0A 2BXTH 3SU6A 1YBWA 1G3EA 3DSOA 2VWNA 3SV2H 3OEHD 4AX9H 1A7SA 2NU1E 1GBJA 1GMHG 3DT0H 1O2PA 1P2KA 3Q3KA 2BX4A 2A4RA 2QAAA 4Y7BA 1O2KA 2L74A 1EPTA 2XTTB 2GT8A 3SZNA 1FDPA 1GBEA 2AFQB 2QF5A 2BVXH 1IHSH 3SV8A 1IQIA 1Y8TA 3ZVCA 1VJAU 1A5IA 4NZQA 3C27B 2O9QA 3STJA 2VWOA 4K8BA 4BAKB 2Q6FA 3ZZ4A 8KME2 1PQ5A 1ZJDA 1P10A 1Q2WA 2FOEA 3TLOA 3KF2A 1TX8A 3A7TA 4ASHA 1W14U 2BY8X 1BTUA 4GCHG 3E90B 3TH4H 1Z8JB 3HATH 3DHKH 4NIXA 1UVUH 2K8IA 2M2AA 4Z0KA 4FU7A 3SNCA 5HKKD 1NFXA 1H8ED 1P9SA 2FESH 1O2YA 1TPAE 4GUXA 2QYIA 2K1QA 3VEQB 1XXFA 4E7RG 2PSXA 3E8LA 1XX9A 4Q7YA 1SQAA 1FJSA 3C1KA 1QRWA 4A1TA 1H9HE 1EJNA 4BAQB 1H9IE 1VCWA 5E0GA 3RMMH 2ZEBA 1HJAC 5E2OA 4TWYA 5C67A 3OYPA 2ODQA 1O5CB 1AUJA 1IQJA 2A2QH 2ZI2H 5DPAA 1QRXA 2XOKD 3RXVA 5F8XA 4U30A 2WYJA 1ELFA 1AUTC 1BQYA 3QO6A 3SV9A 1BIOA 1WU1A 2Z94A 3GY7A 1KDQB 3MH7A 1J17T 1GBMA 2LNCA 4LZ4B 4NA9H 1C2DA 1UK3A 3RMOH 3SNEA 4B6EA 1DOJA 3VPKA 2P3FH 4ABBA 3ZZCA 2GJGA 5HXFA 1A0LA 3GICB 2QIQA 1GJ5H 1SR5C 1SLUB 2BDYA 1VZQH 4F4OC 3TGJE 2DE8A 3KL6A 4INKA 4AB9A 3QWCH 1W10U 4X2WA 1DX5M 1NFWA 4WH8A 3WWFA 7GCHG 4HI3A 5SGAE 2KR7A 1P2JA 4I8GA 1CSOE 1THPB 2BLWA 2ZPRA 3NWUA 1SHHB 3SU0A 3T29A 1C2GA 2ZFFH 3F9GA 4XRNA 5HIYA 2ZTZA 5EJ1A 3FP8E 5JBTA 4FXGH 3TJNA 1ELEE 5BPEA 1O2TA 2ZFPH 1TMTH 3T28A 1C4V2 1MD7A 2UWPA 4BOHA 2NU4E 1O3GA 2EEKA 2BVRH 3UOPA 1O2GH 2UUFB 5IYTA 3DSGA 2PGBB 1SFIA 2Y82A 3P95A 2ZPSA 5JB8S 1T31A 1A0JA 4K1TA 2HVXA 2NU2E 1OYQA 4JMYA 5DG6A 3I77A 2YMSB 4J1YA 3CENA 1SHYA 3MO6A 5CHAC 2QC2A 3SO3A 2ZU1A 2QN5T 5A8ZA 2PKAB 3P92A 4ZAEA 2W6JD 1Z6JH 1VCPA 5JB9S 2FS8A 1SGEE 2J95A 2GCTC 1FMGA 2CHAB 3IITA 5TCCA 2EY4C 2HPQH 1UTJA 1T4UH 2Z3EA 2O8UA 3A86A 1OP0A 4XBDA 1OSSA 4YLQH 5A0CA 2CGAA 3V3MA 3P8NA 1A2CH 1J14A 4X2XA 3URCA 1VGCC 1GBKA 2NU3E 2V3HH 4KTUA 1V2PT 2VB0A 1NN6A 1TX7A 1MCTA 3BG4B 2PR3A 4ABIA 3RU4D 1N1LA 1XVMA 5EPNA 2C90B 4MTBA 4MDSA 1E1RD 3PLPA 1RTKA 2HNTC 3LPRA 1BMMH 1C2FA 1P8VC 4UFDH 1U6QA 3A83A 3OAAD 2FODA 4IC6A 4JZFH 5E0HA 4ESTE 1BJVA 1AQ7A 1HIAA 1ZZZA 1F0SA 3GCNA 2H9EH 1C4Y2 3RXOA 1JBUH 2ZC9H 5DK1A 3T26A 1FONA 1F5LA 1O2ZA 4BXSA 1FY8E 1OX1A 2R9PA 1Y5BT 1GJDB 1WQVH 6CHAB 2ZA5A 2G81E 1BDAA 1C4U2 3LH3A 4IBLH 1EATA 3K6ZA 1C1QA 3MU8A 5A0BA 2XNDD 1LHGH 3RXLA 1MAXA 2B0FA 1SGTA 3A89A 4JZ1A 2A5AA 4JZIA 2F43B 1C5QA 1EASA 1O3BA 1G36A 1ZTJA 4A5TS 1P9UA 2AHME 2R2WU 4CH2B 5GJ4B 3A7ZA 1CT2E 2GZ9A 2FLBH 1EKBB 3S9CA 1UVSH 3GDSA 2CXVA 3SGQE 1YP9A 3EE7A 4XD7D 2FZZA 3UY9A 4D9RA 4NFEA 4OGXA 3URDA 1H9LB 3ZIAD 1KMHB 2ZO3H 3SQHE 1P2IA 3F9FA 4WVPE 1O39A 4WY3A 1XUGA 3MO3A 3EDXB 4TPYA 7LPRA 1WTHD 4FUDA 1KLIH 1C5ZB 5ETXA 1AWFH 3DSPA 1AE8H 1K1PA 4B2CA 2ZU3A 1ETTH 2FOMB 3KQDA 3FAOA 4FUFA 1KIGH 1UK2A 3BTTE 1FIZA 3A88A 3PO1C 4D9QA 1DT2A 2OTVA 4Z6AH 2WINI 2OLGA 2GZ7A 5DP3A 3TK5A 3RM2H 3GCTF 2ZF0H 3N7DA 1C2EA 3BTWE 1F5KU 1KYNA 1F7ZA 2Z9GA 2OXSA 1WSSH 2AMQA 1C2IA 1A4WH 2WPLS 4FOUC 1O0DH 3F2FA 1SBWA 5K0HA 1HJ8A 1OKXA 3KCGH 5A09A 1O33A 2Y7ZA 2P94A 4H6TA 5EIYA 1DWDH 3E1XB 2BHGA 1SPJA 2R0LA 4UEHH 5F8ZA 4JYVH 1K1OA 2BDBA 4ZKNU 4YT7H 2GCHG 4XFQA 1KXDA 3GCHC 3DD2H 2K0QA 2O8LA 4UFFH 4UDWH 1VKYA 3RP2A 4TY6A 1LMWB 1P06A 1V2JT 2KM0A 3VG8A 2VVUA 1E36B 2PGQB 4WMEA 3A7VA 4MPVA 2TIOA 1FV9A 1T8NA 1MQ5A 1NT1A 1IQFA 3T62A 1ZRBA 4LZ1H 1CT0E 2ZHFH 4ZXXH 3KGPA 4NIWA 1K0HA 2NWNA 4DY7B 1V2KT 2CMYA 1COWD 2OCVB 5I25A 2WYGA 3SBKA 1C1MA 2PLXA 1DVAH 1T4VH 1ZSKA 1D3QB 4YOGA 2BOHB 7KMEH 2LELA 3LOXA 1Y3UA 1SGPE 1C1OA 1V2MT 3RXJA 3UWIA 2YMSD 2G00A 3BIVH 2CK3D 2IOTA 5EPYA 4I32A 2PKAA 4RT0A 3SYJA 3TIUA 1FPHH 4AYYB 1V2NT 1EJAA 2SNVA 4ISNA 3Q00A 2VGCB 1LPGB 1DPOA 2A2XH 5EW2H 1A5HA 4AFQA 4OS1A 1UTQA 4MNYA 1Z8IB 4AG2A 4TYDA 2ASUB 1IOEA 2QF4A 4B75A 3MNBA 4TPIZ 3CNRA 1MMJN 1CO7E 2C93B 1YPMH 1BBRH 3RC6A 1C9PA 1P2QA 5DGJA 1V2UT 1NRPH 1TGSZ 3LH1A 5C1XA 2P95A 5DP6A 2ZGXH 1O32A 3FVFB 1O36A 1T7CA 2HOBA 4OS2A 2EQNA 3HK6B 1MQ6A 3BF6H 3H5CB 4B2AA 1TGNA 3WY8A 1GVKB 1QB1A 1VJ9U 5C0UA 4HZHA 2VH6A 3OFND 4INLA 1AMHA 1FQ3A 2WV9A 1BMAA 1O3DA 4INHA 2P3UB 4NFFA 3UWJH 5FX5A 3E0PB 2LP6A 4F55A 5B6LA 2BM2A 2LPRA 4P00A 1FX0B 3E3TA 3LGIA 4BAOB 2VNTA 3SJIA 1GHBF 1CGIE 2ZHEH 2KCPA 2XC5A 4NSYA 1SQOA 1ZMNA 1D9IA 1HV7A 5C1UA 1SLVB 1O2QA 3RXQA 2D2DA 1V3XA 4OS5A 1TQ7B 1S5SA 1GVLA 1WYKA 2RDEA 4NIVA 2J98A 3EE0B 1TONA 1CVWH 2ZQ1A 4ZROA 3E16B 4X2VA 1FI8A 1H8IH 1O2JA 1VR1H 2ZDVH 3PMHB 4NA8A 1NU7B 1ZPCA 2V3MA 1C5XB 3O8CA 1NM6A 3O8RA 1O2NA 3LGTA 2SFAA 2D26C 3W94A 1P12E 5T6FA 1UVTH 2BQWB 1MU6B 2XBVA 1BHXF 3HKIB 1BB0B 2Z3DA 3MQKC 3FOAA 4MPWA 1O2VA 3BEIB 4ISOA 1O3IA 1DXPA 4RT1A 1VITH 1L4ZA 4AGKA 1GHVH 2BD4A 2WUBA 1BUIA 4B1TA 3WWBA 4IN1A 4YTAA 5DP9A 1AB9B 1F0UA 3GCTG 4X1SU 1UTOA 5FXLA 5EQRA 1LHEH 7GCHF 1W8BH 2GKVE 1ELDE 2H2ZA 2G8TA 1CA0C 4GSOA 2JDID 1H1BA 1EJMA 2C3SA 4IC5A 3S9AA 1GMCF 5DKMA 3RLWH 1DUAA 3PO1B 3UUZA 1OPHB 1MTNB 2FOGA 3GS9A 4I31A 2G4UA 2J5UA 1ZPZA 4B76A 2FM2A 3TJUA 1VITF 2AMPA 3LJOA 4FVDA 1HPGA 3JZ1B 2UUJB 1F0TA 1A5GH 1JIRA 3ENSB 3BTEE 3UQOA 1ESTA 1Y3XA 2XCFA 3M3TA 2DE9A 4JYUH 3TNTA 4WJG2 1FY5A 1YPEH 4Y11E 4U2WA 1QCPA 2ULLA 3OTJE 3N7EA 3F0OA 1C2KA 1LDTT 1NRRH 1O3KA 1OOKB 2WPDD 3PYHA 4WWYA 4XSKU 1NTPA 2GDEH 4TWWA 2IPQX 3N99A 3RXRA 2XBXA 4ZH8A 4AN7A 3SJKA 4CRFA 1YYY1 3ZYDA 3G01A 4KGAA 4WXVA 3VGCB 1K1NA 1HDTH 1QZ8A 3KYGA 1ZHRA 3MTYA 4X1PU 1DUEA 1HBTH 4XBBA 3D62A 2PTNA 4LK4A 2FI3E 3BIUH 3AW0A 1ZRKA 3BG4C 1OP8A 4IGDA 1NRSH 1QIXB 3HKJB 3B8JA 2J38A 3T27A 4E7NA 3ZV9A 2ZIQH 1QURH 1GI7B 2HNTF 2JIZD 3SU5A 1HAVB 1MTWA 1XKAC 1GBBA 5I46H 2EC9H 4BTTB 3ZVGA 9ESTA 1HRTH 1MH0A 1E79D 1MUEB 1NY22 1W12U 1MBMA 1FXYA 2XYAA 1H8HD 1Q31A 2GP9B 3GY4A 1HAPH 1HJ9A 3RXIA 1D6WA 1GBTA 2WHXA 5C94A 2H5CA 5FCKA 1QQUA 2AIPA 4NGAH 1AZ8A 3PV4A 2GV6A 5TJXA 3UAIC 6CHAC 2XC0A 1TNKA 1PPHE 2VVCA 2GT7A 3PRDA 2TPIZ 4ABDA 2FYQA 1UMAH 1GBLA 1ANCA 2FOHA 3HGPA 4OGYA 3SUFA 2AYWA 2RCEA 3BV9B 1NPMA 1O2UA 2AMDA 1O3FA 1ELTA 3ZZ8A 4K2YA 2SGAA 1ZSLA 1Z7KA 1IAUA 1KLJH 2L6OA 1GI0A 1NESE 5L2YH 3L3TA 1F2SE 4B73A 1GHBG 3A81A 3RC4A 2WSSD 1CQQA 4ZMAH 3PV5A 3ODDA 1Y3VA 5L2ZH 1BBRE 2WPIS 1A61H 1O5AB 3M36A 1TRYA 4I86A 2ZNKH 2G5VA 1HAZB 2ESTE 2YNAA 1UO6A 1W11U 3EQ0H 1L0ZA 1G2MA 1SI5H 1F0RA 1FLEE 1W7XH 3SOSA 4CR9A 2G5NA 2Y7XA 3BTQE 4OS7A 2PWXA 3IG6B 3TGKE 1V2QT 1OWKA 2WPJS 3BTFE 2HLDD 4JK5A 4WXIA 1FY1A 3BTKE 1N6YA 3QZRA 1YPJH 2J94A 4X1QU 3RDZA 1UVOA 4RI0A 2RA0A 3PLKA 4ISHH 1NBMD 5EODA 2P93A 3PWBA 2BQ6B 1K9OE 1O2XA 2KFWA 1ZR0A 3AVZA 1W7GH 1CE5A 4GLYA 1C1WH 3M35A 2ZPQA 1V2LT 1B5GH 1GJ7B 1UK4A 1GMCG 1OS8A 1NROH 3Q77A 1P3CA 1UHBB 1ZSJA 1FAKH 1O2OA 1H4WA 3OTPA 3GY8A 4ABHA 3RU4T 3E0NB 1VITG 2KCAA 3MH5A 5HMAA 1GCTB 1CA0B 3P8GA 5ESBA 3SHAH 2GCHF 3MH4A 1P03A 2OBQA 1XM1A 1BTZA 4A1XA 3AAVA 4XDEA 2BD5A 3KQCA 2BDIA 2W3IA 1YCPK 1GHXH 3TU7H 1EAUA 1C1VH 1W13U 1HYLA 1A3EH 2R0KA 3EAJA 1UCYE 1BCUH 5C0TA 1IQGA 2OBOA 3UNQA 2FTLE 1HAHH 1P11E 1UVPA 3CS0A 4E06H 8GCHG 4Q4LA 1S0QA 1Z1IA 3LIWA 2OC1A 4K60A 5EG4A 3MYWA 1DWCH 1ELVA 4B74A 2SGDE 3M37A 3T5FH 1EZXC 2ZHQH 5FX6A 2W3KA 1CGHA 4Y0YE 1HAXB 1YY3A 2VGCC 1DANH 1K22H 4NSVA 3E6PH 3GYMA 5LGOA 3FFGA 1DITH 5GNDA 3VB7A 4Y6DA 1XUKA 2OP9A 1LVYA 2VU8E 1GG6B 2QCYA 1SGFG 2YOLA 1GI6A 3B23B 3UQVA 3ZVFA 1WDIA 2W6ID 1C5UA 3ITIA 1XMNB 5FHTA 4K8YA 1AWHB 4UFGH 1ESAA 3SU2A 5JYIA 3EA8A 3KN2A 1TALA 2BD7A 2M5TA 1O38A 4RSPA 3I78A 2WV5A 4ABJA 2VBCA 1E35B 2A4GA 2WZQA 4YOJA 4UFEH 3F6UH 2UWOA 1UTNA 2HNTE 2QF0A 2ANKH 2ILNA 4R0IA 4NIYA 2P59A 5FPTA 1HXFH 1L1JA 1BTXA 1P01A 1G3DA 4I7YH 1HNEE 4K1SA 1UTKA 2P8OB 4NWLA 3MU1A 4O3UA 1TE0A 1NZQH 3F2HA 1YLNA 4AZ2B 1A1RA 1GI8B 2ZTXA 3FP6E 4ZCNA 1MTSA 1ETRH 2YNBA 5PTPA 4J2YB 3U69H 1ZTLA 2BXUH 1YLDA 2Y81A 2ANMH 2VJ1A 3BG8A 2HPPH 4FU9A 2V7QD 3VB6A 5A8XA 1TPOA 2EA3A 3RXDA 4LXBH 1W3CA 1P2MA 2H9TH 1DDJA 1H8DH 1THSH 2ZKSA 3GDVA 1AFQB 1ZHPA 1P57B 3V7TA 1Q3XA 5A0AE 2AGEX 2SGQE 4CRGA 4ZKOU 1A0HB 2SGFE 4X6NA 5ESTE 4H6SB 3UR9A 1AKSB 1C5TA 3TGIE 2VIVA 5FL7D 5T6DA 3RXFA 1GGDB 1KXAA 1HCGA 2WUCA 8ESTE 1NFUA 3ZVAA 5EOKA 1S6LA 2HRVA 1PFXC 1M9UA 1SB1H 1SGIB 2A7HA 4YESB 2ZU2A 3SV7A 1GI5A 1DWEH 1ZYOA 2W7UA 2BB4A 3RXPA 5C17A 1KDQA 1AB9C 2ALPA 1MKWH 2OD3B 3KHVA 3DFJA 4DJZB 3P8OA 5C5NA 1BTHH 2ZGHA 2B7DH 3VB5A 5C2ZA 5IK2D 4I8KA 2EI8A 1NRQH 9LPRA 1MKXH 2QGRA 3BTGE 4F49A 2STBE 4AFSA 1PQAA 2ODYB 5DP8A 2RA3A 3K6YA 3RMLH 4AB8A 1UTPA 1C2LA 1MTUA 3ATWA 1MTNC 3PWCA 2XBWA 1O3MA 1PPEE 2TGDA 4OS6A 1EB2A 1ZJKA 1TPSA 1TGCA 2KAIB 3NXPA 5F53A 4AFZA 4AGJA 1MD8A 6GCHF 4BAHB 1WQSA 3QN7A 2Y5HA 4VGCB 5AFZH 1P2OA 3SNAA 4Y8ZA 1AN1E 1O5BB 1GBIA 1UHBA 3F2GA 3MO9A 1O5DH 3S69A 4O97A 2J34A 1LVBA 1THRH 3M5NA 2FYRA 1SSXA 1W0YH 2F83A 2VIWA 1EP5A 6LPRA 1KTSB 2XNIA 3MHWU 4ZHLU 3ZYEA 4NWKA 5LH8A 1J9CH 3RMNH 3VGCC 1TIOA 2QE7D 2FX4A 2O8MA 4HG6A 2ZQ2A 2CJIA 2TGAA 4B6FA 1WUNH 1PYTC 2FLRH 2QA9E 2VVVA 1RTLA 1QNJA 3MOCA 3QUMP 3RU4E 1RIWB 1YPKH 5G4BA 4TY7A 1BTWA 1AE5A 1ORFA 2FI4E 2Z3CA 4O3TA 1E37B 3LGUA 4HFPB 3W1EA 1TWXB 3PTNA 5EXLA 1MABB 2BVSH 1SGQE 1EAXA 2GZ8A 4FUJA 3SZEA 1TA2A 2ZGCA 5BRRE 3OX7U 3BTHE 5EXMA 2ZG0H 3R3GB 2F4LA 1GHAF 2FOBA 4FUBA 1Z6EA 1EPTB 2BY7X 1CHGA 3D23A 4FUCA 4O03A 5GDSH 5GIBA 5CDFE 1GDNA 4Y0ZE 4ASUD 2J9NA 2FTMA 1QBNA 3A8CA 3SU3A 2ZCLP 2AS9A 1TOCB 2SNWA 1BRAA 1TRNA 4IN2A 3PB1E 2ANYA 3SU4A 2BD9A 2FXRA 2OQUA 1ZMJA 1LCYA 2OC8A 3MU5A 1KTTB 3OEED 1ARBA 1WOFA 3KQ5A 3NPSA 4KKDA 1XXDA 1BOQA 1N8OB 4AORA 1YCPM 1D3TB 3NKKA 3GY3A 5FPSA 1QQ4A 3S7KB 1ZTKA 2PHBA 4HTCH 4ZHMU 1C5WB 2PKSB 4X1RU 5IDKA 1RXPA 1YC0A 5LPFA 4CHAB 3PLBA 4ZKSU 4R8TB 2BDHA 1ESBA 2R2MB 1XKBC 1S6FA 1LHFH 2TGPZ 4ZKRU 1GCDA 3STIA 2GGVB 1C5YB 1OWJA 2PFEA 3VB3A 1AFEH 1C5NH 1J8AA 1TNJA 3U8OH 3VXFH 1DM4B 1C1SA 4JZDH 1Z1JA 1AI8H 4DT7B 1CBWC 4SGAE 2ZFRH 3SQEE 2PP6A 4CBNA 5J4SA 5EW1H 1TFXA 1BRCE 2ZCHP 5EXNA 1V2RT 5JPMH 1MZDA 3MMGA 1F92A 2BD2A 2AIQA 1KXEA 2VIOA 1KXCA 1FY3A 1EXFA 4Y76A 3UR6A 1S84A 5EJZA 1ANEA 4IW4E 2G4TA 4DVAU 3F9EA 2QV1A 4AYVB 1HB0B 3ATKA 3U28C 1IHTH 1LVMA 3AK5A 1GI2A 3AASA 1GL0E 4Y79A 3K2UA 5KECA 1AVWA 1QR3E 1UTLM 2BDCA 1AKSA 2XW9A 4Q63A 2CN0H 4UD9H 1QL9A 1YLCA 1AY6H 4DIHH 1C5RA 3MNXA 3V13A 4MNVA 2J92A 1JRSA 2BDAA 1E1QD 1WXRA 5FBIA 1K2I1 1SFQB 4XBCA 5FBEA 3PMAB 1OYTH 1YWUA 1GI1A 1O2IA 4ABEA 3ODFA 2BX3A 4NCYA 4X8SH 4KTSA 1EZQA 2AGIX 4IS5A 2XXLA 1WCZA 1GCTC 1AZZA 2A32A 3M5OA 2OUAA 1O3JA 6GCHG 4I33A 4LOYH 1EAWA 4YZUA 3RLYH 1GL1A 1GBHA 3DA9B 2TBSA 3U9AH 1GMDG 1TBQH 4UONA 1EB1H 3PMBB 2ALVA 4X8UH 3RXEA 5KEDA 1G30B 3SJOA 3P6ZB 3LONA 3E91A 3ZZDA 4O9VA 3DCLA 2BOKA 3PV2A 1T32A 1G32B 3SUDA 3TK9A 2ZZUH 5LPRA 5B6OA 2ODPA 1KSNA 3PTBA 3NRLA 1TBZH 3BEFB 1BZXE 1QA0A 4D7GA 2P16A 3SU1A 1MAYA 5HYOA 3EA7A 3ATLA 3A8DA 2H1UA 2A7JA 5GPIB 3Q3YA 2Y5GA 1LPKB 1TB6H 4KTCA 2VIQA 3HK3B 8GCHF 4OS4A 1CA8B 2A45B 4X6PA 1AVGH 1TMBH 1O2MA 3SORA 1DLKB 3O8BA 5E2PA 2WPKS 3ZVDA 4H4FA 1VCQA 1GG6C 4B71A 1Y5UT 1DWBH 2GVFA 1ANDA 5F8TA 4M9FA 2W7SA 1T8LA 3WW7A 1JMOH 2F9UA 2FDAA 1DLEA 3DFLA 3U1IB 2C8XB 2A5KA 1YPHE 5DO4H 1G37A 3ATIA 1YPGH 2UUYA 2GV7A 3F68H 2PTCE 1DXWA 1Y5AT 2XWBI 4FUEA 2Y6TA 1EZSC 4U01A 4H42U 1CHOF 1QJ1B 1CU1A 3CP7A 4X8VH 1S82A 1GHAG 3TH3H 2STAE 2Z9KA 3JZ2B 1FN8A 2VIPA 1PQ7A 5FPYA 1DFPA 1G2LA 1W0KD 3KEEA 4D8NA 2ZGJA 2EI7A 1Z71A 4ZHAA 1O2HA 3ZVEA 1N6XA 2Y5FA 3M7TA 3LC3A 1TX6A 3ZV8A 2BZAA 1ARCA 2TGTA 3LKWA 1C1TA 2IJOB 2ZDNA 1GDQA 2P8OC 3B9FH 1TGBA 4BANB 3KQBA 3MH6A 3S9BA 1AGJA 2ZU4A 3M5LA 2KZ4A 3QDZB 2GMTB 1K21H 3ESTA 4Y71A 5C20A 3VB4A 1GJBB 5JBAS 2BMGB 1HIAB 4JCNA 3SW2B 1MU8B 3MU0A 1OXGA 1WAYB 3V12A 1O5GH 2G52A 5AFYH 1BBRK 1WBGB 2JJ2D 5DJ7A 1O2SA 1NU9A 4NA7A 1B0FA 1AFQC 2ANWA 1SGFA 2JJ1D 2Q1JA 4MPXA 1BMLA 4GHQA 3KIDU 1O3LA 2C8WB 2SGPE 2A4OA 1BMNH 2A31A 1FUJA 3RXTA 1EZUC 5EQQA 1GGDC 5F6MA 3LGWA 2XWAA 4MG3A 3T2NA 3OU0A 2F9VA 2BQ7B 3GDUA 1FIWA 2Z9LA 1GHZA 1DSUA 1EQ9A 2C4FH 5DN6D 2GTBA 4AOQA 1CBWB 4MNXA 2VINA 1FY4A 2Z9IA 1HAOH 2ZFTA 3SV6A 1JXPA 1K1LA 1BRBE 2FI5E 1ZOMA 1E0FD 5C1YA 1ABJH 3RXSA 1ELBA 5L30H 2EI6A 1JRTA 2FIRH 1O2RA 5HGGA 3LGVA 4CH8B 2J2UA 1FAXA 1O30A 3HGNA 3UNRA 3QTOH 1RTFB 2ZDMA 3MU4A 3TJVA 3MI4A 3UFAA 1ABIH 5E0JA 1GWAA 5DP7A 1LQDB 1QBVH 2FX6A 1ACBE 2NU0E 3QZQA 3RXHA 1EP6A 1TAWA 1LVOA 5T3HA 1XUHA 1D3DB 1TBRH 3CS7A 3H7OA 3HPTB 2IJD1 1IQNA 2B8OH 1GBAA 3R0FA 4FU8A 1LHCH 5F03A 1NC6A 1TRMA 4VGCC 2OC7A 3Q76A 1HAGE 4Y8YA 1TA6A 3FKSD 1ZLRA 1E34B 1DY8A 4TT3D 1YKTA 4GHTA 2W5EA 1O3HA
chains in the Genus database with same CATH topology
1D3PB 2B5TB 5EU8A 1GDUA 5JDUB 1UCYK 5EGMA 4I8HA 1GJ9B 2ZHWH 3OY6U 3M61U 1ELAA 1V2OT 2ZDKA 2A5IA 1AD8H 2JETB 2AEIH 1O35A 3I29A 1XUFA 4K1EA 4WMFA 2I6SA 1QJ6B 2QXIA 4CRBA 2UWLA 2Z6BD 3QGNB 1S0RA 1YM0A 5C3NA 2XCNA 1RIWC 4X2YA 1QBOA 1B0EA 3PM3A 5AHGH 2ZFQH 3RXAA 1O5FH 2ZECA 4ISIH 1D4PB 2H6MA 4ABGA 1CGJE 1P0SH 4ISLA 1J16A 4FUGA 1SOZA 1P04A 4BTIB 3SGBE 2H5DA 2FWWA 4DCDA 5A2MH 1PJPA 1C5VA 2THFB 3U8RH 3TJOA 5GWZA 2HWLB 1QFKH 1Y59T 4Q7XA 4CRAA 1EPTC 1CHOG 4BNRA 3TPIZ 5K7RA 5AVDA 4I8LA 1CT4E 2A1DB 1OWEA 2O8TA 2WPMS 1C1NA 1A46H 3QGJA 7ESTE 1PYTD 1QJ7B 1TNHA 3SHCH 1EOLA 1GBDA 1O3NA 1NRNH 5E8EH 5H4IB 1AHTH 1BTPA 4YLUA 3SI3H 1N8OC 2CF9H 4U32A 3SNBA 1O34A 1V2VT 2FPZA 3TVJB 2ZTYA 4YM9A 2WPHS 1HFDA 1SLWB 2PKSC 1HAVA 2OC0A 1GHYH 1O31A 4XE4A 2F9PA 1WTGH 4CHAC 1HLTH 2AERH 2PW8H 1K1JA 1RJXB 2FS9A 3LDXH 2BTCE 3FZZA 1PPGE 3A7WA 1ZPBA 2QY0B 1LO6A 4X8TH 1O3CA 3M3SA 4CR5A 3BN9A 2QXJA 2Z9JA 2R3YA 1Z8GA 2XBYA 1RD3B 4D76A 1GVZA 1IQEA 1NO9H 3AW1A 4NG9H 1P3EA 1K28D 3NZIA 1YF4A 3ZZAA 2GDDA 3ZZ6A 3SGAE 3S7HB 3BTDE 4K3JA 1SGCA 3MNSA 1ELGA 1O3PB 3RXBA 2QXGA 4BAMB 2V3OH 3NK8A 4CRDA 3M7UA 2ZDLA 1C5OH 1B7XB 2FOFA 4Q80A 3LT3A 1V2TT 4A1VA 1O37A 3ATMA 4KP0A 1S6HA 1TPPA 5CMXH 3LC5A 1GI3A 2R3UA 3K9XB 1X7AC 1T8MA 2I6QA 1O2LA 2F3CE 3QK1A 1L1GA 3M7QA 5EQSA 4DG4A 1ZGIA 4DIIH 2J4IA 3RXGA 3A87A 4MNWA 1P05A 1SGNE 4YOIA 4B2BA 3UTUH 2BY9X 2BD3A 3K65B 3UOUA 4IMQA 1XUJA 1PPCE 1C9TA 3Q3XA 4Q7ZA 3SJ8A 1HJAB 4WF8A 1Y3WA 1UTMA 4MVNA 4FVBA 3EA9A 2ZCKP 1L4DA 3OY5U 1HXEH 1NFYA 2FOAA 1W2KH 4DOQA 1ANBA 3O8DA 1KXBA 3FANA 2BY6X 4WH6A 4I8JA 1GJAB 1SQTA 4UE7H 1GBFA 5DP5A 3SI4H 4GAWA 5JBBS 2Q6GA 1C1RA 2W26A 5HM9A 3M5MA 1OP2A 1YPLH 3D65E 4ABFA 1XUIA 2GX4A 2ZU5A 3UNSA 1QY6A 1GPZA 1O3OA 3N7OA 4GPGA 3MFJA 1BTYA 1GI9B 1SMFE 3GOVB 1GJCB 1GHWH 1BJUA 1GMDF 3SUGA 2V35A 3EGKH 2FO9A 4YO9A 3QX5H 3A85A 1P02A 3U1JB 2VH0A 1JWTA 3MWIU 3LGYA 2D8WA 3RXMA 2BD8A 1TNGA 1NS3A 4XOJA 2XRCA 3GYLB 4NZLA 2A0QB 4Y7AA 3VFEA 1QB6A 3S0NA 2RDLA 4CBOA 1XVOA 1TQ0B 2F91A 1BHXB 1F5RA 1KLTA 1BRUP 1QHRB 3GCOA 4MQAA 3L33A 3UREA 2OQ5A 3LU9B 1TLDA 2GD4B 1C5LH 1MTVA 5HM2A 3QLPH 1LKBA 5JBCS 5GCHF 4X6MA 1DSTA 1GJ6A 1AO5A 1SGDE 1K1IA 1LQEA 3P8FA 4JZEH 1DE7H 1FNIA 3RC5A 2PSYA 1IQLA 2ZDAH 1T8OA 1IQHA 4ZXYH 1ZGVA 1C1PA 2JH0D 1SGRE 3RUOA 3P70B 3FZDA 2TRMA 4A92A 2Z7FE 1EOJA 1PPFE 1KY9A 1HGTH 1V6DA 1PQ8A 4DURA 4HGCA 1JOUB 3ELAH 1TABE 1EX3A 1LKAA 4YT6H 2H9HA 2V6NA 3KNXA 1DY9A 5FAHA 1E38B 1QL7A 2Y80A 3U98H 4Q2KA 1AU8A 1SOTA 4QT8C 4IMZA 3U8TH 2F9NA 1INCA 1GJ8B 5CHAB 2GMTC 1LPZB 1SVPA 4M7GA 1L2EA 3AAUA 4K5ZA 3M3VA 1OWIA 1TNIA 1G9IE 1GMHF 3TITA 3LJJA 3RXKA 1L1NA 2GCTB 5DP4A 2C8ZB 1IQMA 2BLOA 1KXFA 1V2WT 2ZFSA 1G3CA 2G51A 2JKHA 4WMDA 4X1NU 1ELCA 3A7YA 3H7TA 2A4QA 2F9BH 2HGTH 3IWMA 2P3TB 1SL3A 1HUTH 2AH4X 4AFUA 5A8YA 1P2NA 1VGCB 1MZAA 1TYNA 1GBCA 1QL8A 3GY2A 1O5EH 4PROA 1TNLA 1AVXA 2VWLA 2C8YB 2ZWLH 1Z8RA 3V0XA 3ZZ3A 4GCHF 2OINA 1D6RA 1EUFA 1P09A 1WV7H 2IN2A 8LPRA 4RKJB 3NUMA 1JIMA 4D7FA 2ZHDA 2FMJA 1C1UH 4RKOB 4JYTA 1ZHMA 2A7CA 4AG1A 5T6GA 3SNDA 4K69A 2HLCA 4GVUA 1YGCH 1S83A 2O8WA 1RFNA 1HAYB 1ETSH 1G3BA 1QGFA 3MNCA 3GISB 3PROA 2D1JA 2Q6DA 4X6OA 4ZUHA 1C5PA 1PPBH 2ZGBH 4MLFB 4ABAA 3A82A 1ID5H 3PMJA 2XC4A 2JH5D 3NCLA 2BLVA 1J15A 1QTFA 3D49H 2PV9B 3ZZ5A 4DGJA 2HALA 1FPCH 1OWHA 3KQEA 3A84A 4DW2U 2B9LA 3SJ9A 3UIRA 3UPEA 4A7IB 1OWDA 4BXWA 3T25A 1QB9A 2FOCA 6ESTA 5L6NH 3W95A 2PUQH 2WV4A 1FN6A 2VIDA 3F9HA 1SGYE 1S81A 3SN8A 2PUXB 1C2JA 2QXHA 3L6PA 1MCVA 4SGBE 2BZ6H 4FUHA 1Y3YA 3RXCA 2DUCA 5GXPA 4E05H 1DS2E 1MKWK 2BY5X 4Y10E 2JETC 4CRCA 4X0WU 2RG3A 1C2HA 1IQKA 3BTME 1UCYH 3SUEA 1MKXK 2BLQA 1RRKA 5TCAA 1O2WA 2JH6D 3RM0H 5J4QA 3FP7E 1LHDH 3ZZ7A 2BYAX 3VXEH 3TNSA 1RGQA 3EYDA 2KAIA 1C2MA 1K1MA 2QF3A 1YCPH 1AIXH 1ZMLA 4THNH 3TK6A 4RN6A 3A8BA 2AGGX 2VWMA 4Y8XA 1TOMH 5ABWA 1SG8B 2V0BA 3A7XA 3DUXH 4JK6A 5GCHG 3A8AA 2BDGA 3OSYA 3P17H 1PPZA 1HAIH 2UUKB 2FP7B 2SGEE 2CF8H 1SLXB 3RXUA 3BEUA 1TMUH 4MPUA 4KELA 2F9OA 1O3EA 3ZZBA 1TGTA 1C5SA 4BTUB 3GY6A 2CV3A 3F1SB 3GCHB 1BITA 1EAIA 1QA7A 1QRZA 1SC8U 1V2ST 1DICA 3GY5A 3BSQA 3QTVH 4FUIA 3ZVBA 1O3AA 2FEQH 5AF9H 1BA8B 1BT7A 5LPEA 1GJ4H 5CE1A 1LTOA 2CHAC 1GI4A 1C5MD 3ZZ9A 2IPHA 4A6LA 3A80A 1A3BH 1MBQA 1S85A 1W0ZU 2G55A 1UJ1A 2ZP0H 4CREA 5C5OA 1FZZA 3TH2H 5FCRA 1YPHC 1RS0A 2BXTH 3SU6A 1YBWA 1G3EA 3SV2H 2VWNA 4AX9H 1A7SA 2NU1E 1GBJA 1GMHG 3DT0H 1O2PA 1P2KA 3Q3KA 2BX4A 2A4RA 2QAAA 4Y7BA 1O2KA 1EPTA 2XTTB 2GT8A 3SZNA 1FDPA 1GBEA 2AFQB 2BVXH 1IHSH 3SV8A 1IQIA 1Y8TA 3ZVCA 1VJAU 1A5IA 4NZQA 3C27B 2O9QA 3STJA 2VWOA 4K8BA 4BAKB 2Q6FA 3ZZ4A 8KME2 1PQ5A 1ZJDA 1P10A 1Q2WA 2FOEA 3TLOA 3KF2A 1TX8A 3A7TA 4ASHA 1W14U 2BY8X 1BTUA 4GCHG 3E90B 3TH4H 1Z8JB 3HATH 3DHKH 4NIXA 1UVUH 4Z0KA 4FU7A 3SNCA 1NFXA 2FESH 1P9SA 1O2YA 1TPAE 4GUXA 2QYIA 2K1QA 3VEQB 1XXFA 4E7RG 2PSXA 3E8LA 1XX9A 4Q7YA 1SQAA 1FJSA 3C1KA 1QRWA 4A1TA 1H9HE 1EJNA 4BAQB 1H9IE 1VCWA 5E0GA 3RMMH 2ZEBA 1HJAC 5E2OA 4TWYA 5C67A 3OYPA 2ODQA 1O5CB 1AUJA 1IQJA 2A2QH 2ZI2H 5DPAA 1QRXA 3RXVA 5F8XA 4U30A 2WYJA 1ELFA 1AUTC 1BQYA 3QO6A 3SV9A 1BIOA 1WU1A 2Z94A 3GY7A 1KDQB 3MH7A 1J17T 1GBMA 2LNCA 4LZ4B 4NA9H 1C2DA 1UK3A 3RMOH 3SNEA 1DOJA 3VPKA 2P3FH 4ABBA 3ZZCA 5HXFA 1A0LA 3GICB 2QIQA 1GJ5H 1SR5C 1SLUB 2BDYA 1VZQH 4F4OC 3TGJE 2DE8A 3KL6A 4INKA 4AB9A 3QWCH 1W10U 4X2WA 1DX5M 1NFWA 4WH8A 7GCHG 5SGAE 4HI3A 1P2JA 4I8GA 1CSOE 1THPB 2BLWA 2ZPRA 3NWUA 1SHHB 3SU0A 3T29A 1C2GA 2ZFFH 3F9GA 2ZTZA 3FP8E 5JBTA 4FXGH 3TJNA 1ELEE 5BPEA 1O2TA 2ZFPH 1TMTH 3T28A 1C4V2 1MD7A 2UWPA 4BOHA 2NU4E 1O3GA 2EEKA 2BVRH 3UOPA 1O2GH 2UUFB 5IYTA 2PGBB 1SFIA 2Y82A 3P95A 2ZPSA 5JB8S 1T31A 1A0JA 4K1TA 2HVXA 2NU2E 1OYQA 4JMYA 5DG6A 3I77A 4J1YA 3CENA 1SHYA 3MO6A 5CHAC 2QC2A 3SO3A 2ZU1A 2QN5T 5A8ZA 2PKAB 3P92A 4ZAEA 1Z6JH 1VCPA 5JB9S 2FS8A 1SGEE 2J95A 2GCTC 1FMGA 2CHAB 3IITA 5TCCA 2HPQH 1UTJA 1T4UH 2Z3EA 2O8UA 3A86A 1OP0A 4XBDA 1OSSA 4YLQH 5A0CA 2CGAA 3V3MA 3P8NA 1A2CH 1J14A 4X2XA 3URCA 1VGCC 1GBKA 2NU3E 2V3HH 4KTUA 1V2PT 2VB0A 1NN6A 1TX7A 1MCTA 3BG4B 2PR3A 4ABIA 3RU4D 1N1LA 1XVMA 5EPNA 2C90B 4MTBA 4MDSA 3PLPA 1RTKA 2HNTC 3LPRA 1BMMH 1C2FA 1P8VC 4UFDH 1U6QA 3A83A 2FODA 4IC6A 4JZFH 5E0HA 4ESTE 1BJVA 1AQ7A 1HIAA 1ZZZA 1F0SA 3GCNA 2H9EH 1C4Y2 3RXOA 1JBUH 2ZC9H 5DK1A 3T26A 1FONA 1F5LA 1O2ZA 4BXSA 1FY8E 1OX1A 2R9PA 1Y5BT 1GJDB 1WQVH 6CHAB 2ZA5A 2G81E 1BDAA 1C4U2 3LH3A 4IBLH 1EATA 3K6ZA 1C1QA 3MU8A 5A0BA 1LHGH 3RXLA 1MAXA 2B0FA 1SGTA 3A89A 4JZ1A 2A5AA 4JZIA 1C5QA 1EASA 1O3BA 1G36A 1ZTJA 4A5TS 1P9UA 2R2WU 4CH2B 5GJ4B 3A7ZA 1CT2E 2GZ9A 2FLBH 1EKBB 3S9CA 1UVSH 3GDSA 2CXVA 3SGQE 1YP9A 2FZZA 3UY9A 4D9RA 4NFEA 4OGXA 3URDA 1H9LB 3SQHE 2ZO3H 1P2IA 3F9FA 4WVPE 1O39A 4WY3A 1XUGA 3MO3A 3EDXB 4TPYA 7LPRA 1WTHD 4FUDA 1KLIH 1C5ZB 5ETXA 1AWFH 1AE8H 1K1PA 4B2CA 2ZU3A 1ETTH 2FOMB 3KQDA 3FAOA 4FUFA 1KIGH 1UK2A 3BTTE 1FIZA 3A88A 3PO1C 4D9QA 1DT2A 2OTVA 4Z6AH 2WINI 2OLGA 2GZ7A 5DP3A 3TK5A 3RM2H 3GCTF 2ZF0H 1C2EA 3BTWE 1F5KU 1KYNA 1F7ZA 2Z9GA 2OXSA 1WSSH 2AMQA 1C2IA 1A4WH 2WPLS 1O0DH 1SBWA 5K0HA 1HJ8A 1OKXA 3KCGH 5A09A 1O33A 2Y7ZA 2P94A 4H6TA 1DWDH 3E1XB 2BHGA 1SPJA 2R0LA 4UEHH 5F8ZA 4JYVH 1K1OA 2BDBA 4ZKNU 4YT7H 2GCHG 4XFQA 1KXDA 3GCHC 3DD2H 2O8LA 4UFFH 4UDWH 3RP2A 4TY6A 1LMWB 1P06A 1V2JT 2VVUA 1E36B 2PGQB 4WMEA 3A7VA 4MPVA 2TIOA 1FV9A 1T8NA 1MQ5A 1NT1A 1IQFA 3T62A 1ZRBA 4LZ1H 1CT0E 2ZHFH 4ZXXH 3KGPA 4NIWA 2NWNA 4DY7B 1V2KT 2CMYA 2OCVB 5I25A 2WYGA 3SBKA 1C1MA 2PLXA 1DVAH 1T4VH 1ZSKA 1D3QB 4YOGA 2BOHB 7KMEH 3LOXA 1Y3UA 1SGPE 1C1OA 1V2MT 3RXJA 3UWIA 2G00A 3BIVH 2IOTA 5EPYA 4I32A 2PKAA 3TIUA 1FPHH 4AYYB 1V2NT 1EJAA 2SNVA 4ISNA 3Q00A 2VGCB 1LPGB 1DPOA 2A2XH 5EW2H 1A5HA 4AFQA 4OS1A 1UTQA 4MNYA 1Z8IB 4AG2A 4TYDA 2ASUB 1IOEA 4B75A 3MNBA 4TPIZ 1MMJN 1CO7E 2C93B 1YPMH 1BBRH 3RC6A 1C9PA 1P2QA 5DGJA 1V2UT 1NRPH 1TGSZ 3LH1A 5C1XA 2P95A 5DP6A 2ZGXH 1O32A 3FVFB 1O36A 1T7CA 2HOBA 4OS2A 3HK6B 1MQ6A 3BF6H 3H5CB 4B2AA 1TGNA 3WY8A 1GVKB 1QB1A 1VJ9U 4HZHA 2VH6A 4INLA 1AMHA 1FQ3A 1BMAA 1O3DA 4INHA