1TGSZ

Three-dimensional structure of the complex between pancreatic secretory inhibitor (kazal type) and trypsinogen at 1.8 angstroms resolution. structure solution, crystallographic refinement and preliminary structural interpretation
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
225
structure length
225
Chain Sequence
DKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the complex between pancreatic secretory trypsin inhibitor (Kazal type) and trypsinogen at 1.8 A resolution. Structure solution, crystallographic refinement and preliminary structural interpretation.
pubmed doi rcsb
source organism Bos taurus
molecule tags Complex (proteinase/inhibitor)
molecule keywords TRYPSINOGEN
total genus 53
structure length 225
sequence length 225
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgsZ01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgsZ02
1YPKH 1KXDA 2NU3E 3FP6E 2ZHFH 2KAIA 5E0JA 2WV5A 2AGGX 2ZCKP 4FUIA 4BOHA 4Y11E 3DFJA 3SI4H 1QBVH 1TMTH 1UHBA 2VWOA 3TJNA 1UVOA 3MO6A 1Z8IB 5ETXA 2IOTA 3SGAE 4DW2U 1O2SA 4U01A 3SOSA 3AAUA 5DP3A 4OS6A 2B8OH 4UONA 1O5CB 3PROA 4X8UH 1ZYOA 1P12E 1IQIA 2WUBA 4YTAA 3SI3H 1C9TA 3A8BA 5TCAA 3SU0A 3N7OA 1C4U2 3B23B 5A8YA 4ZH8A 3BTWE 1AWFH 3F9HA 1GDQA 3GCNA 4X1PU 5EW1H 1O3DA 2D26C 1O3NA 1VR1H 2VIVA 1BQYA 1AIXH 1C5YB 1TB6H 1GMCF 4ASHA 1WAYB 3SJOA 1H9LB 4I8GA 1C2MA 4MNVA 1BDAA 1C5OH 1ZSJA 1ELCA 3E6PH 3VPKA 1TX7A 1QURH 1SR5C 1TAWA 1C5MD 1GJCB 2FP7B 1MU6B 8GCHG 4D8NA 3LKWA 3MNXA 1ZMJA 5JBAS 1AI8H 3Q3YA 1HJAB 2WUCA 3H7OA 2ZFQH 1YCPK 1IQMA 1DSUA 1WTGH 3MO3A 4Q80A 2VGCB 3TH4H 1GBDA 3RXDA 3A7WA 1YLCA 1J16A 1C5LH 3KGPA 2C90B 3EGKH 1B7XB 2BQWB 3S7KB 3MH6A 2NU1E 1O2YA 2Z9GA 2FIRH 1C1QA 4YLUA 4B74A 4OGXA 2O8WA 3GCTF 1P11E 1L4DA 1V2NT 1O2PA 3LGIA 3U1IB 1FXYA 1QRXA 2PKSB 3RC6A 1B0FA 2ZU5A 3MWIU 1MU8B 1H4WA 1P2JA 1W3CA 3RXPA 3UREA 1HJ9A 2XBWA 3B8JA 3PB1E 1C2HA 1V2PT 5EPNA 2BY6X 1QL7A 1FUJA 2HOBA 5A8ZA 4X2XA 3T25A 4O3UA 4WXVA 1PQAA 5CMXH 1O2MA 1ZGIA 4ZXXH 1SB1H 1DY8A 1GHWH 1D4PB 2ZO3H 4Y7AA 4ZHMU 4RKJB 3AVZA 3FZDA 3I77A 3L33A 5FPSA 4BXSA 1FN6A 1SGQE 1Z6JH 1DT2A 1GHVH 1UTQA 2D1JA 1BCUH 2FI4E 5ESTE 4LK4A 4U30A 1TE0A 1C5UA 3PO1C 1ELEE 3FP7E 4E05H 1BMMH 5EGMA 1OP2A 1LKAA 4Y8XA 2Z3EA 3F9EA 1GI0A 4DGJA 4MNWA 3A8DA 1V2VT 1SGTA 2ZG0H 3FANA 2BVRH 1NPMA 2FOFA 4I8KA 2EC9H 3A80A 2F9BH 3VB6A 1SGIB 1HAZB 1SGFG 1TGSZ 1O3FA 2ODPA 4XOJA 4AOQA 4K1SA 1HAIH 4K3JA 1QA7A 4GHTA 4UE7H 3PLKA 2STBE 1MBMA 1NFXA 3KL6A 1SGDE 1ARCA 1KDQB 2VU8E 2ZFFH 1P04A 4MLFB 4ZROA 2LPRA 1GBTA 3LGUA 2OC1A 1NRRH 2HRVA 2QIQA 1RIWC 2A4QA 3MNBA 3JZ2B 2VIDA 2ZIQH 2LNCA 1C2LA 2ZGHA 3RC5A 1GHYH 3ZZ6A 1CT4E 1MAXA 1SL3A 1QL8A 3EE0B 1YPLH 4FUDA 1CQQA 3RU4D 1K1PA 1GI8B 1A4WH 5F8XA 5JB9S 1TYNA 1HLTH 1O3JA 3MU1A 1O30A 1ZSKA 1ZTKA 1AD8H 4ZKNU 3OSYA 3RMOH 1D3PB 1EZUC 1O2OA 1TBQH 2ALVA 4FUBA 1MUEB 1F5KU 2BQ6B 2BXUH 1OWIA 6GCHF 1SFQB 4ISHH 1GJ6A 4OS2A 2FOMB 1D3QB 1XUJA 4CHAB 2GTBA 3F1SB 3LC5A 3ZZCA 3RU4E 1FJSA 2WINI 4ABBA 1S85A 1PPBH 4GAWA 4NIVA 1H1BA 1LKBA 1OPHB 4HFPB 1EOJA 4NFFA 4MTBA 1C2DA 4JK6A 1VITF 2O8TA 4FXGH 4TPYA 3SJKA 1GVLA 1EZSC 1CT0E 2ZNKH 3OX7U 3OYPA 1UMAH 3GDSA 1HYLA 1WQVH 2BD2A 1TFXA 1E35B 1W11U 3GCHC 1RRKA 1T7CA 2Y80A 4X2YA 3RXKA 4ABEA 5IDKA 1O3LA 5EG4A 1ZRKA 2BM2A 1IQEA 4BANB 2A4GA 3RXJA 2FDAA 4DIIH 3EA7A 5EQSA 4BTTB 1W7GH 1S6HA 5DP4A 3QWCH 1ELVA 4X1QU 3Q3XA 2RG3A 3SV8A 3ATLA 1BOQA 2ZPQA 4F4OC 4IN2A 1GBBA 2XCNA 4AFSA 3TPIZ 5J4QA 1MZDA 1LHGH 4HI3A 4B1TA 4OS5A 4Q7XA 1BTHH 1G32B 4WH8A 3ZZAA 1Z1JA 1ZRBA 4SGAE 2CN0H 2FI5E 4X2WA 3RMMH 5C67A 2Y7XA 4ISIH 5AFZH 1QJ1B 2BDYA 1JOUB 1KSNA 3ZZ3A 3O8CA 1YF4A 4Y6DA 1V2RT 1BMLA 4MPVA 3A81A 2PGQB 2W26A 1O3PB 4K69A 3UNQA 1ESAA 4AZ2B 3OTJE 3LU9B 4AB8A 1O5FH 2EA3A 3A8AA 4CR9A 3GDUA 1FLEE 3BEFB 1AVWA 1QRZA 3A7TA 2P3FH 1KIGH 2G55A 3VB7A 2ZPSA 1C1VH 1V2OT 1FPCH 1BTXA 1C1TA 1NTPA 1O2RA 4B75A 5FBIA 2ZDMA 1WU1A 2AMDA 2QXHA 2RCEA 1T4UH 2FODA 1K28D 1GI5A 3SORA 1S81A 5EQQA 4R0IA 3GDVA 1W10U 3SGQE 1SPJA 1UO6A 3ZVGA 1J17T 1IQFA 1Y3WA 1LCYA 1P2NA 2Y5FA 3QUMP 3PTNA 1P8VC 4YLQH 4CH2B 2P3TB 2BHGA 5C5NA 5F8ZA 1EKBB 1ELTA 3KF2A 1OX1A 3IG6B 1HAOH 1P02A 1HJ8A 1UVPA 1HCGA 1RTFB 1TGBA 3HK3B 5GCHF 4Z6AH 3M3TA 4GCHF 1A7SA 1P03A 2Y82A 1UK4A 2Y5HA 2BLQA 1DM4B 3ZZBA 1Y3XA 4DIHH 1GJAB 1TNGA 2VINA 2F9OA 1MCVA 2SGAA 4Q2KA 4WVPE 4OS4A 2BD8A 1VCWA 2J94A 3LONA 3SUDA 1GDNA 1A5IA 1WQSA 1H9HE 3PLPA 1T32A 1AU8A 3RMLH 1OWHA 4YOIA 2AIQA 4A1XA 4X8TH 4LZ4B 1C1SA 1EZXC 4FUHA 1AKSA 3BTTE 4JZIA 1AKSB 1GPZA 4ISNA 4WF8A 4DJZB 1Y3VA 3UWJH 3A89A 1BMNH 5H4IB 3SU4A 1ZHMA 1GI1A 3TH3H 4Y7BA 1FY8E 1WCZA 1F5LA 1OWDA 2WYGA 3D49H 3STJA 4H42U 2ZGJA 1OWJA 4JCNA 1EPTC 3SW2B 3DHKH 4RSPA 5ABWA 4ABJA 2K1QA 5K7RA 2CV3A 2Y6TA 4XBCA 2Q6DA 3TJOA 1PYTC 1LHEH 3EAJA 3TLOA 2FOHA 1XVMA 1AO5A 2WPKS 1YPMH 3LGYA 1KXBA 5E2OA 2FLRH 4I8HA 4Q7ZA 3RXIA 1SHYA 3KQEA 3TK5A 1GBKA 5L2YH 3TU7H 2V3OH 2G5VA 4NZLA 2NU2E 1RXPA 2D2DA 1F0SA 1LPGB 1K1LA 2JETB 4IW4E 4NGAH 3OU0A 1L0ZA 1TNJA 3NK8A 3A86A 1O3AA 3MYWA 1IQKA 3IWMA 3Q00A 1D3DB 1SBWA 3BTQE 4E06H 2WPJS 3HKIB 4PROA 3E0PB 1EASA 2ANMH 2EI8A 1TOCB 3PMJA 4E7RG 1SOZA 2GKVE 3SQHE 1GBHA 1GGDC 1ID5H 5FX6A 4TWWA 4FVDA 1DUEA 4XDEA 3UOUA 1LDTT 3M5MA 1P3CA 2HLCA 3H7TA 3SJ9A 1AMHA 5A0AE 1IHSH 1ZPZA 2A5AA 3UPEA 1N8OC 3UR9A 4CR5A 3HKJB 3EYDA 2J9NA 4Y0ZE 2BD4A 2Q1JA 2W7UA 1MTNC 1SFIA 2O8MA 3K2UA 2FZZA 2KAIB 1G36A 7LPRA 2SGEE 2BD7A 3RU4T 3SU3A 1EJAA 1ESTA 1MAYA 2OXSA 3S7HB 1PQ8A 1C2FA 1GBMA 1XUIA 1MQ6A 5JYIA 4GUXA 1ELDE 1O3BA 4KKDA 3DFLA 2CF9H 4AYVB 1E0FD 1CBWB 3UY9A 1HB0B 3KIDU 4AGJA 1W12U 3M36A 1EATA 4D9RA 3T62A 1BTPA 2ZQ2A 1HBTH 4DG4A 1VITG 5EODA 2GV7A 5DP8A 4A7IB 2ZI2H 1PPZA 2V6NA 1BITA 1VGCB 4ABHA 2A45B 1QR3E 3GY4A 2FX4A 5LPFA 1NS3A 4LOYH 1N6XA 3W95A 5FAHA 1Z8JB 4NSYA 2ZQ1A 1NC6A 2IN2A 1AN1E 3DUXH 2PGBB 3SHCH 3ZVAA 3ATKA 1DFPA 3LJOA 5J4SA 1O2QA 5GCHG 1P2IA 3BG8A 1F0TA 4ZKRU 3ZZDA 3QGNB 1FN8A 2ZP0H 4MPXA 2FOEA 4R8TB 3FVFB 3RUOA 1LMWB 2HALA 1S84A 1QTFA 2XCFA 1B0EA 1QL9A 4NZQA 4D7FA 2G51A 1D6RA 1SVPA 4NG9H 3PWCA 5SGAE 3VB3A 4JYVH 5AVDA 3NPSA 1TRNA 2H5DA 3SV6A 1PFXC 2ZKSA 2EEKA 2G4TA 4DVAU 2ZFTA 1SSXA 1A0JA 2BVSH 4KELA 4I8LA 4ESTE 3S9CA 4B76A 1A5HA 1C2EA 2XTTB 2OTVA 3MI4A 1O35A 2OC8A 1NY22 2QY0B 1KYNA 4A5TS 1G30B 3S0NA 2B5TB 1SMFE 2B7DH 1DXWA 3A87A 1IQJA 1W8BH 2BY5X 3QTVH 2GCHF 5GIBA 3KNXA 2QF0A 1GI6A 2BLVA 3V12A 1HUTH 1MKWH 3B9FH 1BTYA 4I31A 4I7YH 1NROH 2C8ZB 5B6OA 1C1UH 1N1LA 5FPTA 2HPPH 2ILNA 2W3KA 1L1GA 1ANBA 2VIPA 3KHVA 2ZA5A 3RXUA 3EDXB 1F5RA 1ELBA 1BJUA 5C3NA 2A2XH 4UEHH 2A0QB 1BBRH 1C4Y2 1Y59T 1CE5A 3MNSA 2VIOA 1CHOG 3ODDA 3PTBA 1AZ8A 3SNAA 3RXOA 1QRWA 2VVUA 2H1UA 5GPIB 1TNKA 2OD3B 2A4OA 3O8RA 5DPAA 2BDHA 3U8OH 1A61H 3C27B 1V2LT 3URDA 4XE4A 1MKXK 1HAXB 3BTGE 3ZV8A 3E90B 2TGPZ 1AY6H 2PV9B 1ZZZA 1ZPCA 1VZQH 3BF6H 3P6ZB 3RXBA 6LPRA 1BBRK 4NWLA 1EP6A 1HXEH 4JYTA 1YPJH 2WPMS 3T29A 3VEQB 4ISOA 2B9LA 2G5NA 4XBDA 1XX9A 4CRBA 1SI5H 1LTOA 2XBVA 1FONA 2BD3A 5A8XA 3MO9A 3KQCA 8KME2 4BAMB 2P93A 2QGRA 3UNRA 1OOKB 2Y81A 4JZ1A 4CRDA 1N8OB 1GI3A 2BY9X 4X6OA 1F2SE 1BRUP 1FDPA 1OS8A 1C5SA 4INHA 2GMTB 3GICB 3K6YA 2M5TA 4JK5A 1OYQA 5LPEA 5FCKA 2SGPE 1CT2E 1W0YH 4NIXA 1O0DH 1J14A 3PLBA 4RKOB 3UQVA 1XVOA 2UUKB 7KMEH 4MVNA 3MU8A 1CBWC 4YT7H 1YC0A 1Y3UA 4X6PA 1INCA 3SV2H 1KTTB 1O36A 3A88A 3BTEE 3ZZ4A 2NWNA 4NSVA 2AIPA 1HAHH 3BTHE 1KXCA 1UTJA 1UVUH 1VCQA 2ZEBA 2BDBA 2SGQE 1UK2A 2BY8X 2FYQA 1P2OA 2P16A 1H9IE 2FOBA 3HATH 3P8OA 3QLPH 1UVTH 1TPOA 1VCPA 4Y8YA 1KDQA 1EB2A 4NA9H 1DWBH 2EI7A 1HAPH 4WMFA 2W3IA 2ZDNA 3PO1B 4O9VA 1IAUA 5FPYA 1ESBA 2TGAA 1W0ZU 4K8BA 3BIVH 3GY8A 3GYLB 2W5EA 1PPEE 4NWKA 1WYKA 1EUFA 3RXVA 1ZOMA 2FEQH 1GHAG 1QFKH 4FU7A 5ESBA 3UIRA 1GG6B 1C2IA 4CRCA 3TJVA 1Z1IA 4K8YA 1S82A 1GJ9B 1ZHRA 2J2UA 4GPGA 3BG4C 1OYTH 5E0HA 2PLXA 1BA8B 2ZTZA 4ABAA 4AFUA 2FS9A 1UTKA 3RMNH 3ZZ7A 1EJMA 4WMEA 4X6MA 4LXBH 2F9NA 3ZVFA 1MD8A 4UFGH 4AFZA 5LGOA 5EQRA 2BMGB 3E16B 1ZPBA 1EX3A 1BRAA 5EW2H 2UWPA 1ZSLA 1YCPM 1DOJA 3GCHB 1WSSH 4D7GA 2BDGA 2Z3DA 2BXTH 1MZAA 1LVBA 1J9CH 1W7XH 4FUFA 5DP9A 3GCOA 1L1JA 3TNTA 3DT0H 2F9UA 2H9TH 2A1DB 1AB9C 2PKAB 2O9QA 1OP0A 2C3SA 1GI9B 1P3EA 2OBOA 5JPMH 1EXFA 1O2ZA 4FUEA 2V3HH 5DG6A 1XXDA 4BAQB 1T8NA 1S6FA 3SHAH 1XUFA 1QY6A 1HRTH 1NESE 7ESTE 2AFQB 1O2WA 5DP7A 1QA0A 2ANKH 3NCLA 1Z71A 1GCTC 2RDLA 4UFFH 2ZC9H 1A5GH 1PPHE 4WWYA 2XWAA 3SO3A 4X1RU 3DD2H 1SGCA 4Y71A 5GXPA 2UUFB 1MQ5A 1Z8GA 1O2GH 1F0UA 3T5FH 1C1MA 1HPGA 1RFNA 3SNEA 2TPIZ 1JWTA 3SJ8A 1ARBA 2OLGA 1PPFE 3P92A 3MTYA 4NA7A 5EXMA 1D9IA 2ZTXA 2FLBH 4Y0YE 1AHTH 3LGTA 1P0SH 1PYTD 5A0BA 1UCYH 1ETSH 2CHAB 3ITIA 1DUAA 3ELAH 3MH5A 1S0RA 3SU1A 4VGCC 4YOGA 2CXVA 1Z6EA 2QAAA 2GZ7A 1LO6A 1JXPA 3U98H 1QBOA 5FBEA 1E36B 1WV7H 1KLTA 1TQ0B 3T27A 2QXJA 4D9QA 5F6MA 2H2ZA 1OSSA 1O33A 1V2UT 1NRPH 3ATMA 2Z7FE 3U69H 2DE8A 3LT3A 5DK1A 2A31A 3KCGH 4A1VA 2BX4A 4O3TA 1P2QA 5G4BA 2QC2A 1CGIE 3RC4A 2G81E 3QDZB 3QK1A 3VXFH 1TX8A 2GVFA 3PMBB 2SNVA 3NXPA 3PMAB 2BB4A 2GT8A 1TGCA 1TPSA 1CGHA 2JH5D 1ACBE 3H5CB 2QYIA 2CGAA 4JZEH 3M5OA 1SGFA 3JZ1B 1O2XA 4O97A 1ELAA 1QB6A 4X0WU 3QN7A 1A3BH 1A0LA 1FV9A 1V2KT 1GGDB 3SV9A 2Y7ZA 2FOAA 2FTMA 3VFEA 4NFEA 3VB4A 1S0QA 5DGJA 1RS0A 1YM0A 1Y5UT 2VIWA 4BAOB 1W2KH 1DICA 2AGIX 3CS0A 2TGTA 1EAUA 5L30H 1AB9B 2PTNA 1ZJKA 2QXIA 1YPHC 1UJ1A 2GCTC 3KN2A 2Z3CA 1XXFA 1MTNB 5C1YA 4NIWA 2STAE 1QHRB 1TA6A 1PPCE 3SQEE 1MCTA 4HGCA 2AMPA 1FY4A 4CBOA 4WY3A 1BHXB 4MG3A 1GDUA 2ALPA 1O2HA 4O03A 1C5WB 1SHHB 3U1JB 2VH0A 6GCHG 4MQAA 1G9IE 4TWYA 3UTUH 3M7UA 3TNSA 2QA9E 1HIAA 1Q3XA 1N6YA 1PQ7A 3PYHA 1GI2A 1DXPA 3FP8E 1A0HB 3S69A 1K21H 1EAWA 2UWLA 3C1KA 3M3SA 3RDZA 1THRH 3HK6B 1EZQA 1K1OA 2GDDA 3E91A 2QF3A 3MMGA 2ZGBH 2O8UA 1MTWA 1NN6A 1O3OA 1IQGA 4B2BA 1C5QA 1BHXF 4GSOA 1YYY1 1RTLA 1C5VA 3RXTA 3LGWA 4INLA 2GZ9A 1DS2E 2WYJA 1LVOA 2J34A 6ESTA 2R2WU 3GY5A 1BTZA 1MH0A 2GT7A 2ZCLP 3W94A 1ZHPA 4OS1A 1NFYA 1O5BB 1H8IH 1V6DA 1NT1A 4F49A 2R2MB 4ZKSU 1BJVA 3ATWA 2ODYB 3A85A 1GJ4H 3FZZA 4CBNA 4B73A 2XNIA 2BDIA 4ISLA 3TH2H 4IC5A 3MU0A 2P95A 1BRBE 2I6SA 4Z0KA 5I25A 2J4IA 4WMDA 3RXQA 1MKWK 1BB0B 3SU5A 8LPRA 5FXLA 3ZZ8A 1BTUA 1FIWA 4YT6H 1FNIA 3V3MA 1HNEE 3F6UH 3TIUA 1ZJDA 2R3YA 2BOKA 2DUCA 4ZMAH 3PMHB 1UK3A 3TGJE 1Z7KA 3M37A 4FUCA 3LDXH 3TVJB 1SGEE 2C8XB 1YPHE 4AG1A 4BAKB 3D65E 4NIYA 2RA0A 2ZHEH 3BV9B 4DOQA 2CF8H 3CS7A 1DDJA 1DE7H 2ZCHP 1V2ST 4I32A 3MH7A 3RXCA 3MOCA 1AGJA 2FXRA 2PUXB 4ZKOU 1SQOA 2OINA 2Z6BD 1LVMA 3CENA 3SJIA 3RM2H 3I78A 1BUIA 1G37A 3I29A 2BD9A 1MKXH 1TX6A 3NKKA 1GJ8B 4BTIB 2ANWA 2XBXA 1BMAA 1JIRA 2JH0D 2PWXA 1RTKA 4AB9A 1V2TT 3HGNA 1ZLRA 2VB0A 5DO4H 3LJJA 5EPYA 5A0CA 3SU2A 2BLWA 1C2JA 4FUJA 1DWCH 1E34B 5IYTA 2BOHB 2WV4A 5JBBS 5JB8S 1TOMH 2VWNA 2PW8H 2WPLS 1NFUA 5C20A 3VB5A 1AQ7A 2GGVB 1C1OA 2GD4B 1O5EH 1A46H 3P8FA 3D23A 4JZFH 4X1NU 1OKXA 1CO7E 1E38B 2ZHWH 1SLWB 3P95A 3SN8A 3BTDE 5GWZA 4ABGA 2HWLB 1G3CA 2A7HA 5FX5A 1IQNA 2IPHA 1OWKA 2P8OC 1BT7A 2QN5T 1FY3A 2C93B 1WUNH 2J92A 3P8NA 1KXEA 2AERH 4ABDA 4A92A 1DLKB 1TPPA 4U2WA 3RLYH 1FY1A 5TCCA 2R3UA 4X6NA 4GCHG 1XKAC 4TPIZ 2FESH 3EQ0H 1K2I1 2ANYA 4KTUA 1ZTLA 2HGTH 1GMHG 1AE8H 5E8EH 1C1RA 5AFYH 3LH3A 1M9UA 5FHTA 4FVBA 3SZNA 1GI4A 3GISB 3OY6U 4HZHA 1FZZA 2ULLA 3CP7A 2ESTE 2BDCA 2RA3A 2R0KA 3MFJA 4Y79A 1Y5AT 2QV1A 1EQ9A 1PQ5A 5FCRA 1O37A 4BTUB 2DE9A 1SLXB 2AS9A 3ZZ5A 1QQ4A 4AGKA 1XMNB 4K1TA 3G01A 4SGBE 1AE5A 3BTME 1YGCH 3A7YA 7GCHF 1TALA 5LPRA 1QJ7B 1HAVA 3LOXA 2Z9LA 3S9AA 5EU8A 1ZMLA 3U9AH 2ZDAH 3A8CA 5DP5A 3MNCA 1GBCA 4XSKU 1VITH 3ZYEA 1HAGE 5C2ZA 1SLUB 3ATIA 3SUGA 5HGGA 2BVXH 5T6FA 1O39A 2A5KA 1CHGA 1LHDH 3LH1A 1ELFA 1K22H 1ZTJA 2ZTYA 1C5RA 5HM9A 1OXGA 2VGCC 2ZWLH 2XC0A 1QNJA 2FO9A 1GBIA 1THPB 3GY6A 1UTMA 1V2JT 3QGJA 2THFB 1O3HA 2AYWA 4MNXA 2ZDKA 1QB9A 1C1PA 1O3GA 4U32A 5AHGH 4RN6A 2BZAA 9LPRA 2PHBA 1MMJN 3P17H 3K65B 1AFQC 4JZDH 3SGBE 2OBQA 1GCDA 1KY9A 2VVCA 5F03A 1Y3YA 4H6SB 3RLWH 2CJIA 1Y8TA 1G2MA 1BIOA 4MNYA 5A2MH 4TYDA 5DP6A 1ZMNA 2PKSC 1LHCH 3O8BA 4NCYA 2BD5A 1YPGH 4KP0A 3T26A 4K2YA 1KLIH 1HDTH 1J8AA 3A82A 1TBZH 2GZ8A 4IBLH 3S9BA 1QIXB 5CHAB 3RM0H 4I33A 2FI3E 1SQAA 4BXWA 2SGDE 1D3TB 3AW0A 2FM2A 5PTPA 1GVZA 2YOLA 1BTWA 5EXNA 5T3HA 8ESTE 2ZDLA 3D62A 5F8TA 1NRQH 2FPZA 4WXIA 1GHBG 3MH4A 2XWBI 1TMUH 1L2EA 1CHOF 4TY6A 5TJXA 4UFDH 4GLYA 3GY2A 2ZHDA 3LGVA 2HPQH 3EA8A 4FUGA 2P8OB 1AFEH 1C1WH 1GBJA 2V35A 1S5SA 3RXSA 4KGAA 3NWUA 1ETTH 1A3EH 3PM3A 4E7NA 4A6LA 2SGFE 2ZF0H 4INKA 3SUFA 1UCYE 3RXAA 1HGTH 2FOGA 1P06A 2GMTC 1H8DH 3DA9B 4UDWH 1CGJE 5E0GA 4IMQA 1EOLA 1Q2WA 4ZUHA 1DPOA 2OUAA 2XC4A 1F0RA 1DANH 1CA8B 2Q6GA 3U8TH 3BG4B 2F3CE 1GI7B 1MD7A 5HYOA 3RXLA 4BNRA 1O2LA 2PFEA 4JMYA 1WTHD 4YESB 2ZECA 1TLDA 1KXFA 2PUQH 3A7ZA 1TNIA 5BPEA 1FQ3A 2O8LA 1U6QA 1GWAA 4ZAEA 1NM6A 1C4V2 1X7AC 1HJAC 1O3EA 4WJG2 1BZXE 1V3XA 2YNAA 3VXEH 4J2YB 2ZZUH 1L4ZA 1V2WT 1AVGH 1O3KA 2FMJA 2NU0E 1W14U 1VJAU 4AG2A 1UTLM 1TBRH 1IHTH 2OC7A 4CRGA 1AUTC 2XYAA 3L3TA 5JDUB 2OQUA 4YM9A 2B0FA 2UWOA 4VGCB 3E3TA 2AGEX 3M35A 1GJBB 1TIOA 1XKBC 3HPTB 1K1MA 3UOPA 1SGPE 5BRRE 3KQDA 2UUYA 3V7TA 5C1UA 1C5ZB 3QO6A 1IOEA 1MTUA 1RD3B 2VVVA 1GG6C 1AUJA 4MDSA 4QT8C 4AYYB 1O5AB 3FFGA 3BTKE 4B2CA 1QB1A 3Q3KA 3TK9A 3ZVDA 1DY9A 2UUJB 3E1XB 1SOTA 5C1XA 5CHAC 1PPGE 4A1TA 2ZPRA 2BX3A 5T6GA 3SBKA 1EAIA 1SLVB 1UVSH 1C2GA 2H5CA 3M5NA 2H9EH 1P2MA 4XBBA 5EXLA 2GV6A 4AFQA 1NRNH 1P01A 1UTPA 2AH4X 3ZVCA 2TGDA 2Z94A 4X8VH 1DITH 1TGTA 2Z9IA 2VIQA 3RXRA 2BY7X 1GJDB 4IN1A 4H6TA 3ZV9A 2ZHQH 1O3CA 1JRTA 4KTCA 1CA0B 1XUHA 1OWEA 1NZQH 1MBQA 2GDEH 1RIWB 1ANCA 2XBYA 2QCYA 1O3IA 4ZXYH 1TONA 3T2NA 2NU4E 4ABFA 4B71A 3E0NB 3R3GB 3RXEA 4GVUA 2F9PA 4WH6A 2D8WA 3SUEA 4B2AA 2AMQA 2ZU4A 1AFQB 4KTSA 1FPHH 2C8YB 4CH8B 2BZ6H 9ESTA 3MU5A 3NUMA 1ELGA 1T31A 1UCYK 2FX6A 4AN7A 2GX4A 1EB1H 1GCTB 4FU9A 4YZUA 3QTOH 1DVAH 1TRYA 1UHBB 3A7VA 3M7TA 2ASUB 1P09A 2R0LA 1ZGVA 2PSXA 2AEIH 2BLOA 2XXLA 2I6QA 2HNTC 1HAYB 3O8DA 4DCDA 2PTCE 3TJUA 1FMGA 3TGIE 4DY7B 1GHXH 1GHZA 1GHBF 3MU4A 1FAKH 5AF9H 4YO9A 2OQ5A 2ZGCA 5LH8A 1P57B 1NU7B 1GL1A 2WPHS 3BSQA 1NFWA 2VJ1A 3NZIA 1LQDB 2CHAC 1C5NH 3SNBA 3ZVEA 1O32A 1ETRH 1P9SA 2OCVB 1DWEH 2Y5GA 1O2KA 1GBEA 1GMCG 1XM1A 4TY7A 1FY5A 3Q77A 2C4FH 1EP5A 2BDAA 1NRSH 2HNTE 1T8MA 2YNBA 3MHWU 4HTCH 3VGCB 1BRCE 1O31A 1JMOH 2ZFPH 4OGYA 3RP2A 1TGNA 2A2QH 4BAHB 3E8LA 2F83A 3V13A 1AVXA 1J15A 2G00A 1KTSB 4ZHLU 2G52A 3BN9A 2ZGXH 1GMDG 3M7QA 4H4FA 4J1YA 1T4VH 3SNDA 2WPIS 1LPZB 1GMHF 1OP8A 5L2ZH 3AAVA 3UWIA 1O2JA 5L6NH 1DLEA 2GCHG 4CHAC 1GVKB 3UFAA 5DKMA 1JRSA 2SNWA 2P94A 2BQ7B 1EJNA 2FOCA 3F9FA 1GL0E 1YP9A 2ZU1A 1TRMA 1GHAF 2ZU2A 3L6PA 1E37B 1MTVA 3AASA 4LZ1H 3F9GA 1THSH 2H6MA 1O2NA 4CRFA 2TBSA 4NA8A 3QZQA 3ZVBA 1DX5M 4Y8ZA 1BBRE 2JH6D 3KEEA 5K0HA 4MPUA 1CA0C 3GOVB 1V2QT 1O5DH 1LQEA 2HNTF 3R0FA 5JBCS 1YKTA 1ORFA 2GP9B 1SG8B 4Q7YA 1GJ7B 4IGDA 3LIWA 1HFDA 2A5IA 5EOKA 1LHFH 3SNCA 3K9XB 3ODFA 4UFEH 5C5OA 1JBUH 1TNHA 1K1JA 2W7SA 1HIAB 2FS8A 3UR6A 2TIOA 1W13U 5CE1A 2ZDVH 2ZU3A 6CHAC 2P3UB 1ABJH 3A7XA 1Z8RA 2GCTB 1A1RA 3UNSA 1O2UA 1T8OA 3TK6A 1QCPA 1FI8A 4IS5A 2C8WB 1D6WA 3K6ZA 3P70B 1SC8U 1P05A 4X1SU 4OS7A 3OY5U 1QQUA 2J95A 1HXFH 1UTNA 1G3DA 1C5XB 1TWXB 2R9PA 1S83A 2PR3A 2VWMA 1SQTA 3URCA 2F91A 1K1NA 1GBAA 4JYUH 5HMAA 1NO9H 1F92A 4D76A 4X2VA 1G2LA 4X8SH 3BEUA 4DT7B 1AWHB 4ZHAA 1TQ7B 3FAOA 1XUKA 3A84A 4IC6A 1A2CH 1O38A 2VWLA 3QX5H 1O2TA 2FYRA 1UTOA 4YOJA 2HVXA 2V0BA 3UQOA 2Z9KA 2ZFSA 3M61U 2A7JA 1JIMA 2QXGA 3LPRA 3GY3A 1CU1A 1QBNA 3RXFA 1VJ9U 1DSTA 1F7ZA 3EA9A 1YLDA 2FTLE 1EPTA 1SGNE 1WBGB 2Q6FA 3T28A 1GMDF 2EI6A 1O3MA 4K60A 1L1NA 1EPTB 5HXFA 1O2IA 3PV4A 2CMYA 2FWWA 3A83A 1KXAA 1TMBH 2SFAA 1DWDH 4THNH 2G8TA 2PSYA 3TGKE 2A4RA 1O5GH 1CVWH 7GCHG 1XUGA 2XW9A 3BTFE 1ABIH 1TABE 4UD9H 5I46H 1C5TA 1RJXB 2F9VA 1GJ5H 3RXHA 3ZZ9A 4Y10E 5GDSH 1HV7A 1WOFA 4AORA 4MPWA 2P59A 3U8RH 3TITA 4CRAA 1Q31A 2JETC 4DURA 4K1EA 1YPEH 1P2KA 1G3BA 2OC0A 3IITA 1YCPH 2VNTA 1V2MT 3GCTG 1ANDA 3AW1A 3ZYDA 5T6DA 2VH6A 1CSOE 1KLJH 2A7CA 1FIZA 2XRCA 3LC3A 2TRMA 1Y5BT 3P8GA 1TA2A 3BIUH 1P10A 3ENSB 1ZR0A 1AZZA 1PJPA 5HM2A 1G3EA 2XC5A 1VGCC 4IMZA 2ODQA 4Y76A 4XFQA 1GBLA 5DJ7A 6CHAB 2J38A 1C1NA 1O2VA 2BTCE 1B5GH 3RXMA 5E2PA 4GHQA 1MTSA 5JBTA 3VGCC 2ZFRH 4I8JA 3UUZA 4CREA 1QJ6B 3BEIB 1TNLA 1EAXA 1C5PA 4FU8A 2JKHA 2BYAX 1QGFA 8GCHF 1P9UA 1C2KA 1HAVB 1O34A 3M5LA 3RXGA 1RGQA 1K9OE 1TPAE 3KQBA 3V0XA 2IJOB 3ESTA 1GBFA 5A09A 1SGYE 1IQLA 2Z9JA 3GYMA 4ABIA 2H9HA 3SU6A 1ANEA 3F68H 4AX9H 1K1IA 4K5ZA 3WY8A 2G4UA 3SV7A 1T8LA 2PKAA 2OP9A 3GY7A 1C9PA 1IQHA 3HGPA 5GJ4B 3PWBA 3Q76A 1YBWA 1LVYA 4M7GA 3M3VA 1LPKB 1NU9A 3STIA 1FAXA 3QZRA 2A32A 1SGRE
chains in the Genus database with same CATH superfamily
1YPKH 1KXDA 1QZ8A 2NU3E 3FP6E 2ZHFH 2KAIA 5E0JA 2WV5A 2AGGX 2ZCKP 4FUIA 4BOHA 4Y11E 3DFJA 3SI4H 1QBVH 1TMTH 1UHBA 4ACBA 2VWOA 3TJNA 1UVOA 3MO6A 1Z8IB 5ETXA 2IOTA 3PRBA 3SGAE 4DW2U 1O2SA 4U01A 5EJZA 3SOSA 3AAUA 5DP3A 4OS6A 2B8OH 4UONA 1O5CB 3PROA 4X8UH 1ZYOA 1P12E 1IQIA 2WUBA 4YTAA 3SI3H 1C9TA 3A8BA 2IPQX 5TCAA 3SU0A 3N7OA 1C4U2 3B23B 5A8YA 4ZH8A 3BTWE 1AWFH 3F9HA 1GDQA 3GCNA 4X1PU 5EW1H 1O3DA 2D26C 1O3NA 1VR1H 2VIVA 1BQYA 1AIXH 1C5YB 1TB6H 1GMCF 4ASHA 1WAYB 3SJOA 1H9LB 4I8GA 1C2MA 4MNVA 1BDAA 1C5OH 1ZSJA 1ELCA 3E6PH 3VPKA 1TX7A 1QURH 1SR5C 1TAWA 1C5MD 1GJCB 4RT1A 2FP7B 1MU6B 8GCHG 4D8NA 3N7EA 3LKWA 3MNXA 1ZMJA 5JBAS 1AI8H 3Q3YA 1HJAB 2WUCA 3H7OA 2ZFQH 1YCPK 1IQMA 1DSUA 1WTGH 3MO3A 4Q80A 2VGCB 3TH4H 1GBDA 3RXDA 3A7WA 1YLCA 1J16A 1C5LH 3KGPA 2C90B 3EGKH 1B7XB 2BQWB 2XOKD 3MH6A 3S7KB 2NU1E 1O2YA 2Z9GA 2FIRH 1C1QA 4YLUA 4B74A 4OGXA 2O8WA 3GCTF 1P11E 1L4DA 1V2NT 1O2PA 3LGIA 5HIYA 3U1IB 1FXYA 1QRXA 2PKSB 3RC6A 1B0FA 2ZU5A 5B6LA 3MWIU 1MU8B 1H4WA 1P2JA 1W3CA 3W1EA 3RXPA 3UREA 1HJ9A 2XBWA 3B8JA 3PB1E 1C2HA 1V2PT 5EPNA 2BY6X 1QL7A 1FUJA 2HOBA 5A8ZA 4X2XA 3T25A 5IK2D 4O3UA 4WXVA 1PQAA 3OEHD 3F2FA 5CMXH 1O2MA 1ZGIA 4ZXXH 1SB1H 1DY8A 1GHWH 1D4PB 2ZO3H 4Y7AA 4ZHMU 4RKJB 3AVZA 3FZDA 1SKYE 3I77A 3L33A 5FPSA 4BXSA 1FN6A 1SGQE 1Z6JH 1DT2A 1GHVH 1UTQA 2D1JA 3MQKC 1BCUH 2FI4E 5ESTE 2KR7A 4LK4A 4U30A 1TE0A 1C5UA 3PO1C 1ELEE 3FP7E 4E05H 1BMMH 5EGMA 1OP2A 1LKAA 4Y8XA 2Z3EA 3F9EA 1GI0A 4DGJA 4MNWA 3A8DA 1V2VT 1SGTA 5F53A 2ZG0H 3FANA 2BVRH 1NPMA 2FOFA 4I8KA 2EC9H 3A80A 2F9BH 3VB6A 1SGIB 1HAZB 1SGFG 1TGSZ 1O3FA 2ODPA 4XOJA 4AOQA 4K1SA 1HAIH 4K3JA 1QA7A 4GHTA 4UE7H 3PLKA 2STBE 1MBMA 1NFXA 3KL6A 1SGDE 1ARCA 1KDQB 2VU8E 2ZFFH 1P04A 4MLFB 4ZROA 2LPRA 1GBTA 3LGUA 2OC1A 1NRRH 2HRVA 2QIQA 1RIWC 2A4QA 3MNBA 2J97A 3JZ2B 2VIDA 2ZIQH 2LNCA 1C2LA 2ZGHA 3RC5A 1GHYH 3ZZ6A 1CT4E 1MAXA 1SL3A 1QL8A 3WWFA 3EE0B 1YPLH 4FUDA 1CQQA 3RU4D 1K1PA 1GI8B 1A4WH 5F8XA 5JB9S 1TYNA 4ACAA 1HLTH 1O3JA 3MU1A 1O30A 1ZSKA 1ZTKA 1AD8H 4ZKNU 3OSYA 3RMOH 1D3PB 1EZUC 1O2OA 1TBQH 2ALVA 4FUBA 1MUEB 1F5KU 2BQ6B 2BXUH 1OWIA 6GCHF 1SFQB 2L74A 4ISHH 1GJ6A 4OS2A 4P00A 2FOMB 1D3QB 1XUJA 4CHAB 2GTBA 3F1SB 3LC5A 3ZZCA 3RU4E 1FJSA 2WINI 4ABBA 1S85A 3H09A 1PPBH 4GAWA 4NIVA 1H1BA 5C17A 1LKBA 1OPHB 4HFPB 2W6ID 1EOJA 4Q4LA 4NFFA 3F2HA 4MTBA 1C2DA 4JK6A 1VITF 2O8TA 4FXGH 2PP6A 4TPYA 3SJKA 1GVLA 1EZSC 1CT0E 2ZNKH 3OX7U 3OYPA 1UMAH 3GDSA 1HYLA 1WQVH 2BD2A 1TFXA 1E35B 1W11U 4FETA 3GCHC 1RRKA 1T7CA 2Y80A 4X2YA 3RXKA 4ABEA 5IDKA 1O3LA 5EG4A 1ZRKA 2BM2A 1IQEA 4BANB 2A4GA 3RXJA 2FDAA 4DIIH 3EA7A 5EQSA 4BTTB 1W7GH 1S6HA 5DP4A 3QWCH 1ELVA 4X1QU 3Q3XA 2RG3A 3SV8A 3ATLA 1BOQA 2ZPQA 4F4OC 4IN2A 1GBBA 2XCNA 4AFSA 2LP6A 3TPIZ 5J4QA 1MZDA 1LHGH 4HI3A 4B1TA 4OS5A 4Q7XA 1BTHH 1G32B 4WH8A 3ZZAA 1Z1JA 1ZRBA 4SGAE 2CN0H 2FI5E 4X2WA 3RMMH 5C67A 2Y7XA 4ISIH 5AFZH 1QJ1B 5FL7D 2BDYA 1JOUB 1KSNA 3ZZ3A 3O8CA 1YF4A 4Y6DA 1V2RT 1BMLA 4MPVA 3A81A 2PGQB 2W26A 1O3PB 4K69A 3UNQA 1ESAA 4AZ2B 3OTJE 3LU9B 4AB8A 1O5FH 2EA3A 3A8AA 4CR9A 3GDUA 1FLEE 3BEFB 1AVWA 1QRZA 3A7TA 2P3FH 1KIGH 2G55A 3VB7A 2ZPSA 1C1VH 1V2OT 1FPCH 1BTXA 1C1TA 1NTPA 1O2RA 4B75A 5FBIA 5EIYA 2ZDMA 1WU1A 2AMDA 2QXHA 2RCEA 1T4UH 2FODA 1K28D 2J98B 1GI5A 3SORA 1S81A 5EQQA 4R0IA 3GDVA 1W10U 3SGQE 1SPJA 1UO6A 3ZVGA 1J17T 2GJGA 1IQFA 1YLNA 1Y3WA 1LCYA 1P2NA 2Y5FA 3QUMP 3PTNA 2OK5A 1P8VC 4YLQH 4CH2B 2P3TB 3OFND 2BHGA 5C5NA 5F8ZA 3SZEA 1EKBB 1ELTA 3KF2A 1OX1A 3IG6B 1HAOH 1P02A 1HJ8A 1UVPA 1HCGA 1RTFB 1TGBA 3HK3B 5GCHF 4Z6AH 5HIZA 3M3TA 4GCHF 1BMFD 1A7SA 1P03A 2Y82A 1UK4A 2Y5HA 2BLQA 1DM4B 3ZZBA 1Y3XA 4DIHH 1GJAB 1TNGA 2F9OA 2VINA 1MCVA 2SGAA 4Q2KA 4WVPE 4OS4A 2BD8A 1VCWA 2J94A 3LONA 3SUDA 1GDNA 1A5IA 1WQSA 1H9HE 3PLPA 1T32A 1AU8A 3RMLH 1OWHA 4YOIA 2AIQA 4B6FA 1NBMD 4A1XA 3WWBA 4X8TH 4LZ4B 1C1SA 1EZXC 4FUHA 1AKSA 3BTTE 4JZIA 1AKSB 1GPZA 3SYJA 4ISNA 4WF8A 4DJZB 1Y3VA 3UWJH 3A89A 1BMNH 5H4IB 3SU4A 1ZHMA 1GI1A 3TH3H 4Y7BA 1FY8E 1WCZA 1F5LA 1OWDA 2WYGA 3D49H 3STJA 4H42U 2ZGJA 1OWJA 4JCNA 1EPTC 3SW2B 3DHKH 4RSPA 5ABWA 4ABJA 2K1QA 5K7RA 1W0KD 2CV3A 2Y6TA 4XBCA 2Q6DA 3TJOA 3EE7A 1PYTC 1LHEH 3EAJA 3TLOA 2FOHA 1XVMA 1AO5A 2WPKS 1YPMH 3LGYA 1KXBA 5E2OA 2FLRH 4I8HA 4Q7ZA 3RXIA 1SHYA 3KQEA 3TK5A 1GBKA 5L2YH 3TU7H 2V3OH 2G5VA 4NZLA 2NU2E 1RXPA 2D2DA 1F0SA 1LPGB 1K1LA 2JETB 4IW4E 4NGAH 3OU0A 1L0ZA 1TNJA 3NK8A 3A86A 1O3AA 3MYWA 1IQKA 3IWMA 3Q00A 1D3DB 1SBWA 3BTQE 4E06H 2WPJS 3HKIB 4PROA 3E0PB 1EASA 2ANMH 4RI0A 2EI8A 1TOCB 3PMJA 4E7RG 1SOZA 2GKVE 3SQHE 3OAAD 1GBHA 1GGDC 1ID5H 5FX6A 4TWWA 4FVDA 1DUEA 4XDEA 3UOUA 1LDTT 3M5MA 2L6OA 1P3CA 2HLCA 3H7TA 3SJ9A 1AMHA 5A0AE 1IHSH 1ZPZA 2A5AA 3UPEA 1N8OC 3N7DA 3UR9A 4CR5A 3HKJB 3EYDA 2J9NA 4Y0ZE 2BD4A 2YMSB 2Q1JA 2W7UA 1MTNC 1SFIA 2O8MA 3K2UA 2FZZA 2KAIB 1G36A 7LPRA 2SGEE 2BD7A 3RU4T 3SU3A 1EJAA 1ESTA 1MAYA 2OXSA 3S7HB 2KCOA 1KMHB 1PQ8A 1C2FA 1GBMA 1XUIA 1MQ6A 5C0UA 5JYIA 4GUXA 1ELDE 1O3BA 4KKDA 3DFLA 2CF9H 4AYVB 1E0FD 1CBWB 3UY9A 1HB0B 3KIDU 4AGJA 1W12U 3M36A 1EATA 4D9RA 3T62A 1BTPA 3KQ5A 2ZQ2A 1HBTH 4DG4A 1VITG 5EODA 2GV7A 5DP8A 4A7IB 2ZI2H 1PPZA 2V6NA 1BITA 1VGCB 4ABHA 2A45B 1QR3E 3GY4A 2FX4A 5LPFA 1NS3A 4LOYH 1N6XA 3W95A 5FAHA 1Z8JB 4NSYA 2ZQ1A 1NC6A 2IN2A 1AN1E 3DUXH 4FOUC 2PGBB 3SHCH 3ZVAA 3ATKA 1DFPA 3LJOA 5J4SA 1O2QA 5GCHG 1P2IA 4TT3D 3BG8A 1F0TA 4ZKRU 3ZZDA 3QGNB 1FN8A 2ZP0H 4MPXA 2FOEA 4R8TB 3FVFB 3RUOA 1LMWB 2HALA 1S84A 1QTFA 2XCFA 1B0EA 1QL9A 4NZQA 4D7FA 2G51A 1D6RA 1SVPA 4NG9H 3PWCA 5SGAE 3VB3A 4JYVH 5AVDA 3NPSA 1TRNA 2H5DA 3SV6A 1PFXC 2ZKSA 2EEKA 2G4TA 4DVAU 2ZFTA 1SSXA 1A0JA 2BVSH 4KELA 4I8LA 4ESTE 3S9CA 4B76A 1A5HA 1C2EA 2XTTB 2OTVA 3MI4A 1O35A 2OC8A 1NY22 2QY0B 1KYNA 4A5TS 1G30B 3S0NA 2B5TB 1SMFE 2B7DH 1DXWA 3A87A 1IQJA 1W8BH 2BY5X 1COWD 3NRLA 3QTVH 2GCHF 5GIBA 3KNXA 2QF0A 1GI6A 2BLVA 3V12A 1HUTH 1MKWH 3B9FH 1BTYA 4I31A 4I7YH 1NROH 2C8ZB 5B6OA 1C1UH 1N1LA 5FPTA 2HPPH 2ILNA 1YY3A 2W3KA 1L1GA 1ANBA 2VIPA 3KHVA 3PV2A 2ZA5A 3RXUA 3EDXB 1F5RA 1ELBA 1BJUA 5C3NA 2A2XH 4UEHH 2A0QB 1BBRH 1C4Y2 1Y59T 1CE5A 3MNSA 2VIOA 1CHOG 3ODDA 3PTBA 1AZ8A 4HG6A 3SNAA 3RXOA 1QRWA 2VVUA 2H1UA 5GPIB 1TNKA 2OD3B 2A4OA 3O8RA 5DPAA 2BDHA 3U8OH 1A61H 3C27B 1V2LT 3URDA 4XE4A 3AK5A 1MKXK 1HAXB 3BTGE 3ZV8A 2IJD1 3E90B 2TGPZ 1AY6H 2PV9B 1ZZZA 1ZPCA 1VZQH 3BF6H 3P6ZB 3RXBA 6LPRA 1BBRK 4NWLA 1EP6A 1HXEH 4JYTA 1YPJH 2WPMS 3T29A 3VEQB 4ISOA 2B9LA 2G5NA 4XBDA 1XX9A 4CRBA 5C94A 1SI5H 1LTOA 2XBVA 1FONA 2BD3A 5A8XA 3MO9A 3KQCA 8KME2 4BAMB 2P93A 2QGRA 3UNRA 1OOKB 2Y81A 4JZ1A 4CRDA 1N8OB 1GI3A 2BY9X 4X6OA 1OHHD 1F2SE 1BRUP 1FDPA 1OS8A 1C5SA 4INHA 2GMTB 3GICB 3K6YA 2M5TA 4JK5A 1OYQA 5LPEA 4I86A 5FCKA 2SGPE 1CT2E 1W0YH 4NIXA 1O0DH 1J14A 3PLBA 4RKOB 3UQVA 1XVOA 2UUKB 7KMEH 4MVNA 3MU8A 1CBWC 4YT7H 1YC0A 1Y3UA 4X6PA 1INCA 3SV2H 1KTTB 1O36A 2QF5A 3A88A 3BTEE 3ZZ4A 2NWNA 4NSVA 2AIPA 4OM9A 1HAHH 3BTHE 1EFRD 1KXCA 1UTJA 1UVUH 1VCQA 2ZEBA 2BDBA 1K0HA 2SGQE 1UK2A 2BY8X 2FYQA 1P2OA 2P16A 1SQRA 1H9IE 2FOBA 3HATH 2KCAA 3P8OA 3QLPH 1UVTH 1TPOA 1VCPA 4Y8YA 1KDQA 1EB2A 4NA9H 1DWBH 2EI7A 1HAPH 4WMFA 2W3IA 2ZDNA 3PO1B 4O9VA 1IAUA 5FPYA 1ESBA 2KCYA 2TGAA 1W0ZU 4K8BA 3BIVH 3GY8A 3GYLB 3UB0A 2W5EA 1PPEE 4NWKA 1WYKA 3DCLA 1EUFA 3RXVA 1ZOMA 2FEQH 1GHAG 1QFKH 4FU7A 5ESBA 3UIRA 1GG6B 1C2IA 4CRCA 3TJVA 1Z1IA 4K8YA 1S82A 1GJ9B 1ZHRA 2J2UA 4GPGA 3BG4C 1OYTH 5E0HA 2PLXA 1BA8B 2ZTZA 4ABAA 4AFUA 5CDFE 2FS9A 1UTKA 3RMNH 4DT4A 3ZZ7A 1EJMA 4WMEA 4X6MA 4LXBH 2F9NA 3ZVFA 1MD8A 4UFGH 4AFZA 5LGOA 5EQRA 2BMGB 3E16B 5DSFA 1ZPBA 3F0PA 1EX3A 1BRAA 5EW2H 2UWPA 1ZSLA 1YCPM 1DOJA 3GCHB 1WSSH 3OEED 4D7GA 2BDGA 2Z3DA 2BXTH 1MZAA 1LVBA 1J9CH 1W7XH 4FUFA 5DP9A 3GCOA 1L1JA 3TNTA 3DT0H 2F9UA 2H9TH 2A1DB 1AB9C 2PKAB 2O9QA 1OP0A 2C3SA 1GI9B 1P3EA 2OBOA 5JPMH 1EXFA 1O2ZA 4FUEA 2V3HH 5DG6A 2KX4A 1XXDA 1UW7A 4BAQB 1T8NA 1S6FA 3SHAH 1XUFA 1QY6A 1HRTH 1NESE 7ESTE 2AFQB 1O2WA 2QE7D 5DP7A 2EQNA 1QA0A 2ANKH 3NCLA 1Z71A 1GCTC 2RDLA 4UFFH 2ZC9H 1A5GH 1PPHE 4WWYA 2XWAA 3SO3A 4X1RU 3DD2H 1SGCA 4Y71A 5GXPA 2UUFB 1MQ5A 1Z8GA 1O2GH 1F0UA 3T5FH 1C1MA 1HPGA 1RFNA 2F4LA 3SNEA 2TPIZ 1JWTA 3SJ8A 1ARBA 2OLGA 1PPFE 3P92A 3DSGA 3MTYA 4NA7A 5EXMA 1D9IA 2ZTXA 2FLBH 4Y0YE 1AHTH 3LGTA 1P0SH 1PYTD 5A0BA 1UCYH 1ETSH 2CHAB 3ITIA 4XD7D 1DUAA 3ELAH 3MH5A 1S0RA 3SU1A 4VGCC 4YOGA 2CXVA 1Z6EA 2QAAA 2GZ7A 1LO6A 1JXPA 3U98H 1QBOA 5FBEA 1E36B 1WV7H 1H8ED 1KLTA 1TQ0B 3T27A 2QXJA 4D9QA 5F6MA 2H2ZA 1OSSA 1O33A 1V2UT 1NRPH 3ATMA 2Z7FE 3U69H 2JDID 4XRNA 2DE8A 3LT3A 5DK1A 2A31A 3KCGH 4A1VA 2BX4A 4O3TA 1P2QA 3UAIC 5G4BA 2QC2A 1CGIE 3RC4A 2G81E 3QDZB 4RT0A 3KYFA 3QK1A 3VXFH 1TX8A 2GVFA 3PMBB 2SNVA 3NXPA 2YMSD 3PMAB 2BB4A 2GT8A 1TGCA 1TPSA 1CGHA 2JH5D 1ACBE 3H5CB 2QYIA 2CGAA 4JZEH 3M5OA 1SGFA 3JZ1B 1O2XA 4O97A 1ELAA 1QB6A 4X0WU 3QN7A 1A3BH 1A0LA 1FV9A 1V2KT 1GGDB 3SV9A 2Y7ZA 2FOAA 2FTMA 3VFEA 4NFEA 2VBCA 3VB4A 1S0QA 5DGJA 1RS0A 1E79D 1Y5UT 1YM0A 2VIWA 4BAOB 1W2KH 1DICA 2AGIX 3CS0A 2TGTA 1EAUA 5L30H 1AB9B 2PTNA 1ZJKA 2QXIA 1YPHC 1UJ1A 2GCTC 3KN2A 2Z3CA 1XXFA 1MTNB 5C1YA 4NIWA 2STAE 1QHRB 1TA6A 1PPCE 3SQEE 4YXWD 1MABB 1MCTA 4HGCA 2AMPA 1FY4A 4CBOA 4WY3A 1BHXB 4MG3A 1GDUA 2ALPA 1O2HA 4O03A 1C5WB 1SHHB 3U1JB 2VH0A 6GCHG 4MQAA 1G9IE 4TWYA 3UTUH 3M7UA 3TNSA 2QA9E 1HIAA 1Q3XA 1N6YA 1PQ7A 3PYHA 1GI2A 1DXPA 3FP8E 1A0HB 3S69A 1K21H 1EAWA 2UWLA 3C1KA 3M3SA 3RDZA 1THRH 3HK6B 1EZQA 1K1OA 2GDDA 3E91A 2QF3A 3MMGA 2RDEA 2ZGBH 2O8UA 1MTWA 1NN6A 3DSOA 1O3OA 1IQGA 4B2BA 1C5QA 1BHXF 4F55A 4GSOA 1YYY1 1RTLA 1C5VA 3RXTA 3LGWA 4INLA 2GZ9A 1DS2E 2WYJA 1LVOA 5EJ1A 2J34A 6ESTA 2R2WU 3GY5A 3OE7D 1BTZA 1MH0A 2GT7A 2ZCLP 3W94A 1ZHPA 4OS1A 1NFYA 1O5BB 1H8IH 1V6DA 1NT1A 4F49A 2R2MB 4ZKSU 1BJVA 3ATWA 2ODYB 3A85A 1GJ4H 3FZZA 4CBNA 4F48B 4B6EA 4B73A 2XNIA 2BDIA 2V3MA 4ISLA 3TH2H 4IC5A 3MU0A 2P95A 1BRBE 2I6SA 4Z0KA 5I25A 2J4IA 4WMDA 3RXQA 1MKWK 1BB0B 3SU5A 8LPRA 5FXLA 3ZZ8A 2HLDD 1BTUA 1FIWA 4YT6H 1FNIA 3V3MA 1HNEE 3F6UH 3TIUA 1ZJDA 2R3YA 2BOKA 2DUCA 4ZMAH 3PMHB 1UK3A 3TGJE 1Z7KA 3M37A 4FUCA 3LDXH 3TVJB 1SGEE 2C8XB 1YPHE 4AG1A 4BAKB 3D65E 4NIYA 2RA0A 2ZHEH 2WHXA 3BV9B 4DOQA 2CF8H 3CS7A 1DDJA 1DE7H 2ZCHP 1V2ST 4I32A 3MH7A 3RXCA 3MOCA 1AGJA 2FXRA 2PUXB 4ZKOU 1SQOA 2OINA 2Z6BD 1LVMA 3CENA 3SJIA 3RM2H 3I78A 1BUIA 1G37A 3I29A 2BD9A 1MKXH 1TX6A 3NKKA 1GJ8B 4BTIB 2ANWA 2XBXA 1BMAA 1JIRA 2JH0D 2PWXA 1RTKA 4AB9A 1V2TT 3HGNA 1ZLRA 2VB0A 4P02A 5DO4H 3LJJA 2WPDD 5EPYA 5A0CA 3SU2A 2BLWA 1C2JA 4FUJA 1DWCH 1E34B 5IYTA 2BOHB 2WV4A 5JBBS 5JB8S 1TOMH 2VWNA 2PW8H 5GNDA 2WPLS 1NFUA 5C20A 3VB5A 1AQ7A 2GGVB 1C1OA 2GD4B 3DSPA 1O5EH 1A46H 3P8FA 3D23A 4JZFH 4X1NU 3FO8D 1OKXA 1CO7E 1E38B 2ZHWH 1SLWB 3P95A 2KFWA 3SN8A 2QF4A 3BTDE 4ABGA 5GWZA 2HWLB 1G3CA 2A7HA 5FX5A 1IQNA 2IPHA 1OWKA 4Q63A 2P8OC 1BT7A 2QN5T 1FY3A 2C93B 1WUNH 2J92A 3P8NA 3GS9A 1KXEA 2AERH 5EJLA 4ABDA 4A92A 1DLKB 1TPPA 4U2WA 3RLYH 1FY1A 5TCCA 2R3UA 4X6NA 4GCHG 4AC9A 1XKAC 4TPIZ 2FESH 3EQ0H 1K2I1 2ANYA 4KTUA 1ZTLA 2HGTH 1GMHG 1AE8H 5E8EH 1C1RA 5AFYH 3LH3A 1M9UA 5FHTA 4FVBA 3SZNA 1GI4A 3GISB 3OY6U 4HZHA 1FZZA 2ULLA 3CP7A 2ESTE 2BDCA 3CNRA 2RA3A 2R0KA 3MFJA 4Y79A 1Y5AT 1VKYA 2QV1A 1EQ9A 1PQ5A 5FCRA 1O37A 4BTUB 2DE9A 3FN8A 1SLXB 2AS9A 3ZZ5A 1QQ4A 2KZ4A 4AGKA 1XMNB 2XNDD 4K1TA 3G01A 4SGBE 1AE5A 3BTME 1YGCH 3A7YA 7GCHF 1TALA 5LPRA 1QJ7B 1HAVA 3LOXA 1FX0B 1H8HD 2Z9LA 3S9AA 5EU8A 1ZMLA 3U9AH 2ZDAH 3A8CA 5DP5A 3MNCA 1GBCA 4XSKU 1VITH 3ZYEA 3KYGA 1HAGE 5C2ZA 1SLUB 3ATIA 3SUGA 5HGGA 2BVXH 5T6FA 1O39A 2A5KA 1CHGA 3FKSD 1LHDH 2JIZD 3LH1A 1ELFA 1K22H 1ZTJA 2ZTYA 1C5RA 5HM9A 1OXGA 2J5UA 2VGCC 2ZWLH 2XC0A 1QNJA 2FO9A 1GBIA 1THPB 3GY6A 1UTMA 1V2JT 3QGJA 2THFB 1O3HA 2AYWA 4MNXA 2ZDKA 1QB9A 1C1PA 1O3GA 4U32A 5AHGH 4RN6A 2BZAA 9LPRA 2PHBA 1MMJN 3P17H 3K65B 1AFQC 4JZDH 3SGBE 2OBQA 1GCDA 1KY9A 2VVCA 5F03A 1Y3YA 4H6SB 3RLWH 2CJIA 1Y8TA 1G2MA 1BIOA 2WV9A 4MNYA 5A2MH 4TYDA 5DP6A 1ZMNA 2PKSC 1LHCH 3O8BA 4NCYA 2BD5A 1YPGH 4KP0A 3T26A 2CK3D 4K2YA 1KLIH 1HDTH 1J8AA 3A82A 1TBZH 2GZ8A 4IBLH 2JJ2D 1QIXB 5CHAB 3S9BA 3RM0H 1W0JD 4I33A 2FI3E 1SQAA 4BXWA 2SGDE 1D3TB 3AW0A 2FM2A 5PTPA 1GVZA 2YOLA 1BTWA 5EXNA 5T3HA 8ESTE 2ZDLA 3D62A 5F8TA 1NRQH 2FPZA 4WXIA 1GHBG 3MH4A 1TMUH 2XWBI 4ASUD 1L2EA 1CHOF 4TY6A 5TJXA 4UFDH 4GLYA 3GY2A 2WZQA 2ZHDA 3LGVA 2HPQH 3EA8A 4FUGA 2P8OB 1AFEH 1C1WH 1GBJA 2V35A 1S5SA 3RXSA 4KGAA 3NWUA 1ETTH 1A3EH 3PM3A 4E7NA 4A6LA 2SGFE 2ZF0H 4INKA 3SUFA 1UCYE 3RXAA 1HGTH 2FOGA 1P06A 3ZIAD 2GMTC 1H8DH 3DA9B 4UDWH 1CGJE 5E0GA 4IMQA 1EOLA 1Q2WA 4ZUHA 1DPOA 2OUAA 2XC4A 1F0RA 2K8IA 1DANH 1CA8B 2Q6GA 3U8TH 3BG4B 2F3CE 1GI7B 1MD7A 5HYOA 2K0QA 3RXLA 4BNRA 1O2LA 2PFEA 4JMYA 1WTHD 4YESB 2ZECA 1TLDA 1KXFA 2PUQH 3A7ZA 1TNIA 5BPEA 1FQ3A 2O8LA 1U6QA 1GWAA 4ZAEA 1NM6A 1C4V2 1X7AC 1HJAC 1O3EA 4WJG2 1BZXE 1V3XA 2YNAA 3VXEH 4J2YB 2ZZUH 1L4ZA 1V2WT 1AVGH 1O3KA 2FMJA 2NU0E 5DN6D 1W14U 1VJAU 4AG2A 1UTLM 1TBRH 2AHME 1IHTH 2OC7A 4CRGA 1AUTC 2XYAA 3L3TA 5JDUB 2OQUA 4YM9A 2B0FA 2UWOA 4VGCB 3E3TA 2AGEX 3M35A 1GJBB 1TIOA 1XKBC 3HPTB 1K1MA 3UOPA 1SGPE 5BRRE 3KQDA 2UUYA 3V7TA 5C1UA 1C5ZB 3QO6A 1IOEA 1MTUA 1RD3B 2VVVA 1GG6C 1AUJA 4MDSA 4QT8C 4AYYB 1O5AB 3FFGA 3BTKE 4B2CA 1QB1A 3Q3KA 3TK9A 3ZVDA 1DY9A 2UUJB 3E1XB 1SOTA 5C1XA 2YMSC 5CHAC 1PPGE 4A1TA 2ZPRA 2BX3A 5T6GA 3SBKA 1EAIA 1SLVB 3OTPA 1UVSH 1C2GA 2H5CA 3M5NA 5T1VA 2H9EH 1P2MA 2RFKC 4XBBA 5EXLA 2GV6A 4AFQA 1NRNH 1P01A 1UTPA 2AH4X 3ZVCA 2TGDA 2Z94A 4X8VH 1DITH 1TGTA 1E1RD 2Z9IA 2VIQA 3RXRA 2BY7X 1GJDB 2HVYB 4IN1A 4H6TA 3ZV9A 2ZHQH 1O3CA 1JRTA 4KTCA 1CA0B 1XUHA 1OWEA 1NZQH 1MBQA 2GDEH 1RIWB 1ANCA 2XBYA 2QCYA 1O3IA 4ZXYH 1TONA 3T2NA 2NU4E 4ABFA 4B71A 3E0NB 3R3GB 3RXEA 4GVUA 2F9PA 4WH6A 2D8WA 3SUEA 4B2AA 2AMQA 2ZU4A 3VG8A 3PRDA 1AFQB 4KTSA 1FPHH 2C8YB 4CH8B 2BZ6H 5KGOA 9ESTA 3MU5A 3NUMA 1ELGA 1T31A 1UCYK 2FX6A 4AN7A 2GX4A 1EB1H 1GCTB 5C0TA 4FU9A 4YZUA 3QTOH 1DVAH 1TRYA 1UHBB 3A7VA 3M7TA 2ASUB 1P09A 2R0LA 1ZGVA 2PSXA 2AEIH 2BLOA 2XXLA 2I6QA 2HNTC 1HAYB 3O8DA 3N99A 4DCDA 2PTCE 3TJUA 1FMGA 2EY4C 2WSSD 3TGIE 4DY7B 1GHXH 3U28C 1GHZA 1GHBF 3MU4A 1FAKH 5AF9H 4YO9A 1WDIA 2OQ5A 1YWUA 2ZGCA 5LH8A 1P57B 1NU7B 1GL1A 2WPHS 3BSQA 1NFWA 3FOAA 2VJ1A 3NZIA 1LQDB 2CHAC 1C5NH 3SNBA 2V7QD 3ZVEA 1O32A 1WXRA 1ETRH 1P9SA 2OCVB 1DWEH 2Y5GA 1O2KA 1GBEA 1GMCG 1XM1A 4TY7A 1FY5A 3Q77A 2C4FH 1EP5A 2BDAA 1NRSH 2HNTE 1T8MA 2YNBA 3MHWU 4HTCH 3VGCB 1BRCE 1O31A 1JMOH 2ZFPH 4OGYA 3RP2A 1TGNA 2A2QH 4BAHB 3E8LA 5CHBA 2F83A 3V13A 1AVXA 1J15A 2G00A 1KTSB 4ZHLU 2G52A 3BN9A 2ZGXH 1GMDG 3M7QA 2JJ1D 4H4FA 4J1YA 1T4VH 3SNDA 2WPIS 1LPZB 1GMHF 1OP8A 5L2ZH 3AAVA 3UWIA 5HKKD 1O2JA 2KM0A 5L6NH 1DLEA 2GCHG 4CHAC 3WW7A 1GVKB 3UFAA 5DKMA 1JRSA 2SNWA 2P94A 2BQ7B 1EJNA 2FOCA 3F9FA 1GL0E 1YP9A 2ZU1A 1TRMA 1GHAF 2ZU2A 3L6PA 1E37B 1MTVA 3AASA 5KECA 4LZ1H 3F9GA 1THSH 2H6MA 1O2NA 4CRFA 2TBSA 4NA8A 3QZQA 3ZVBA 1DX5M 4Y8ZA 1BBRE 2JH6D 3KEEA 5K0HA 4MPUA 1CA0C 3GOVB 1V2QT 1O5DH 1LQEA 2HNTF 3R0FA 5JBCS 1YKTA 1ORFA 2GP9B 1SG8B 4Q7YA 1GJ7B 2F43B 4IGDA 3LIWA 1HFDA 2A5IA 5EOKA 1LHFH 2J98A 3SNCA 3K9XB 3ODFA 4UFEH 5C5OA 1JBUH 1TNHA 2M2AA 1K1JA 4ZCNA 2W7SA 1HIAB 2FS8A 3UR6A 2TIOA 1W13U 5CE1A 2ZDVH 2ZU3A 6CHAC 2P3UB 1ABJH 3A7XA 1Z8RA 2GCTB 1A1RA 3UNSA 1O2UA 1T8OA 3TK6A 1QCPA 1FI8A 4IS5A 2C8WB 1D6WA 3K6ZA 3P70B 1SC8U 1P05A 4X1SU 4OS7A 3OY5U 1QQUA 2J95A 1HXFH 1UTNA 1G3DA 1C5XB 1TWXB 2R9PA 1S83A 2PR3A 2VWMA 1SQTA 3URCA 2F91A 1K1NA 1GBAA 4JYUH 5HMAA 1NO9H 1F92A 2W6JD 4D76A 4X2VA 1G2LA 4X8SH 3BEUA 4DT7B 1AWHB 4ZHAA 1TQ7B 3FAOA 1XUKA 3A84A 4IC6A 1A2CH 1O38A 2VWLA 3QX5H 1O2TA 2FYRA 1UTOA 3F3BA 4YOJA 2HVXA 2V0BA 3UQOA 2Z9KA 2ZFSA 3M61U 2A7JA 1JIMA 2QXGA 3LPRA 3GY3A 1CU1A 1QBNA 3RXFA 1E1QD 1VJ9U 1DSTA 1F7ZA 3EA9A 1YLDA 1S6LA 2FTLE 1EPTA 1SGNE 1WBGB 2Q6FA 3T28A 1GMDF 2EI6A 1O3MA 4K60A 1L1NA 1EPTB 5HXFA 1O2IA 3PV4A 2CMYA 2FWWA 3A83A 3PV5A 1KXAA 1TMBH 2SFAA 1DWDH 4THNH 2G8TA 2PSYA 5KEDA 3TGKE 2A4RA 1O5GH 1CVWH 7GCHG 1XUGA 2XW9A 3BTFE 1ABIH 1TABE 4UD9H 5I46H 1C5TA 1RJXB 2KCPA 2F9VA 1GJ5H 3RXHA 3ZZ9A 4Y10E 5GDSH 1HV7A 1WOFA 4AORA 4MPWA 2P59A 3U8RH 3TITA 4CRAA 1Q31A 1NBME 2JETC 3F0OA 4DURA 4K1EA 1YPEH 1P2KA 1G3BA 2OC0A 3IITA 1YCPH 2VNTA 1V2MT 3GCTG 1ANDA 3AW1A 3ZYDA 5T6DA 2VH6A 1CSOE 1KLJH 2A7CA 1FIZA 2XRCA 3LC3A 2TRMA 1Y5BT 3P8GA 1TA2A 3BIUH 3F2GA 1P10A 3ENSB 1ZR0A 1AZZA 1PJPA 5HM2A 1G3EA 2XC5A 1VGCC 4IMZA 2ODQA 4Y76A 4XFQA 1GBLA 5DJ7A 6CHAB 2J38A 1C1NA 1O2VA 2BTCE 1B5GH 3RXMA 5E2PA 4GHQA 1MTSA 4Z1MD 5JBTA 3VGCC 2ZFRH 4I8JA 3UUZA 4CREA 1QJ6B 4TSFD 3BEIB 1TNLA 1EAXA 1C5PA 4FU8A 2LELA 2JKHA 2BYAX 1QGFA 8GCHF 1P9UA 1C2KA 1HAVB 1O34A 3M5LA 3RXGA 1RGQA 1K9OE 1TPAE 3KQBA 3V0XA 2IJOB 3ESTA 1GBFA 5A09A 1SGYE 1IQLA 2Z9JA 3GYMA 4ABIA 2H9HA 3SU6A 1ANEA 3F68H 4AX9H 1K1IA 4K5ZA 4M9FA 3WY8A 2G4UA 3SV7A 1T8LA 2PKAA 2OP9A 3GY7A 1C9PA 1IQHA 3HGPA 5GJ4B 3PWBA 3Q76A 1YBWA 1LVYA 4M7GA 3M3VA 1LPKB 1NU9A 3STIA 1FAXA 3QZRA 2A32A 1SGRE
chains in the Genus database with same CATH topology
1YPKH 1KXDA 2NU3E 3FP6E 2ZHFH 2KAIA 5E0JA 2WV5A 2AGGX 2ZCKP 4FUIA 4BOHA 4Y11E 3DFJA 3SI4H 1QBVH 1TMTH 1UHBA 2VWOA 3TJNA 1UVOA 3MO6A 1Z8IB 5ETXA 2IOTA 3SGAE 4DW2U 1O2SA 4U01A 3SOSA 3AAUA 5DP3A 4OS6A 2B8OH 4UONA 1O5CB 3PROA 4X8UH 1ZYOA 1P12E 1IQIA 2WUBA 4YTAA 3SI3H 1C9TA 3A8BA 5TCAA 3SU0A 3N7OA 1C4U2 3B23B 5A8YA 4ZH8A 3BTWE 1AWFH 3F9HA 1GDQA 3GCNA 4X1PU 5EW1H 1O3DA 2D26C 1O3NA 1VR1H 2VIVA 1BQYA 1AIXH 1C5YB 1TB6H 1GMCF 4ASHA 1WAYB 3SJOA 1H9LB 4I8GA 1C2MA 4MNVA 1BDAA 1C5OH 1ZSJA 1ELCA 3E6PH 3VPKA 1TX7A 1QURH 1SR5C 1TAWA 1C5MD 1GJCB 2FP7B 1MU6B 8GCHG 4D8NA 3LKWA 3MNXA 1ZMJA 5JBAS 1AI8H 3Q3YA 1HJAB 2WUCA 3H7OA 2ZFQH 1YCPK 1IQMA 1DSUA 1WTGH 3MO3A 4Q80A 2VGCB 3TH4H 1GBDA 3RXDA 3A7WA 1YLCA 1J16A 1C5LH 3KGPA 2C90B 3EGKH 1B7XB 2BQWB 3S7KB 3MH6A 2NU1E 1O2YA 2Z9GA 2FIRH 1C1QA 4YLUA 4B74A 4OGXA 2O8WA 3GCTF 1P11E 1L4DA 1V2NT 1O2PA 3LGIA 3U1IB 1FXYA 1QRXA 2PKSB 3RC6A 1B0FA 2ZU5A 3MWIU 1MU8B 1H4WA 1P2JA 1W3CA 3RXPA 3UREA 1HJ9A 2XBWA 3B8JA 3PB1E 1C2HA 1V2PT 5EPNA 2BY6X 1QL7A 1FUJA 2HOBA 5A8ZA 4X2XA 3T25A 4O3UA 4WXVA 1PQAA 5CMXH 1O2MA 1ZGIA 4ZXXH 1SB1H 1DY8A 1GHWH 1D4PB 2ZO3H 4Y7AA 4ZHMU 4RKJB 3AVZA 3FZDA 3I77A 3L33A 5FPSA 4BXSA 1FN6A 1SGQE 1Z6JH 1DT2A 1GHVH 1UTQA 2D1JA 1BCUH 2FI4E 5ESTE 4LK4A 4U30A 1TE0A 1C5UA 3PO1C 1ELEE 3FP7E 4E05H 1BMMH 5EGMA 1OP2A 1LKAA 4Y8XA 2Z3EA 3F9EA 1GI0A 4DGJA 4MNWA 3A8DA 1V2VT 1SGTA 2ZG0H 3FANA 2BVRH 1NPMA 2FOFA 4I8KA 2EC9H 3A80A 2F9BH 3VB6A 1SGIB 1HAZB 1SGFG 1TGSZ 1O3FA 2ODPA 4XOJA 4AOQA 4K1SA 1HAIH 4K3JA 1QA7A 4GHTA 4UE7H 3PLKA 2STBE 1MBMA 1NFXA 3KL6A 1SGDE 1ARCA 1KDQB 2VU8E 2ZFFH 1P04A 4MLFB 4ZROA 2LPRA 1GBTA 3LGUA 2OC1A 1NRRH 2HRVA 2QIQA 1RIWC 2A4QA 3MNBA 3JZ2B 2VIDA 2ZIQH 2LNCA 1C2LA 2ZGHA 3RC5A 1GHYH 3ZZ6A 1CT4E 1MAXA 1SL3A 1QL8A 3EE0B 1YPLH 4FUDA 1CQQA 3RU4D 1K1PA 1GI8B 1A4WH 5F8XA 5JB9S 1TYNA 1HLTH 1O3JA 3MU1A 1O30A 1ZSKA 1ZTKA 1AD8H 4ZKNU 3OSYA 3RMOH 1D3PB 1EZUC 1O2OA 1TBQH 2ALVA 4FUBA 1MUEB 1F5KU 2BQ6B 2BXUH 1OWIA 6GCHF 1SFQB 4ISHH 1GJ6A 4OS2A 2FOMB 1D3QB 1XUJA 4CHAB 2GTBA 3F1SB 3LC5A 3ZZCA 3RU4E 1FJSA 2WINI 4ABBA 1S85A 1PPBH 4GAWA 4NIVA 1H1BA 1LKBA 1OPHB 4HFPB 1EOJA 4NFFA 4MTBA 1C2DA 4JK6A 1VITF 2O8TA 4FXGH 4TPYA 3SJKA 1GVLA 1EZSC 1CT0E 2ZNKH 3OX7U 3OYPA 1UMAH 3GDSA 1HYLA 1WQVH 2BD2A 1TFXA 1E35B 1W11U 3GCHC 1RRKA 1T7CA 2Y80A 4X2YA 3RXKA 4ABEA 5IDKA 1O3LA 5EG4A 1ZRKA 2BM2A 1IQEA 4BANB 2A4GA 3RXJA 2FDAA 4DIIH 3EA7A 5EQSA 4BTTB 1W7GH 1S6HA 5DP4A 3QWCH 1ELVA 4X1QU 3Q3XA 2RG3A 3SV8A 3ATLA 1BOQA 2ZPQA 4F4OC 4IN2A 1GBBA 2XCNA 4AFSA 3TPIZ 5J4QA 1MZDA 1LHGH 4HI3A 4B1TA 4OS5A 4Q7XA 1BTHH 1G32B 4WH8A 3ZZAA 1Z1JA 1ZRBA 4SGAE 2CN0H 2FI5E 4X2WA 3RMMH 5C67A 2Y7XA 4ISIH 5AFZH 1QJ1B 2BDYA 1JOUB 1KSNA 3ZZ3A 3O8CA 1YF4A 4Y6DA 1V2RT 1BMLA 4MPVA 3A81A 2PGQB 2W26A 1O3PB 4K69A 3UNQA 1ESAA 4AZ2B 3OTJE 3LU9B 4AB8A 1O5FH 2EA3A 3A8AA 4CR9A 3GDUA 1FLEE 3BEFB 1AVWA 1QRZA 3A7TA 2P3FH 1KIGH 2G55A 3VB7A 2ZPSA 1C1VH 1V2OT 1FPCH 1BTXA 1C1TA 1NTPA 1O2RA 4B75A 5FBIA 2ZDMA 1WU1A 2AMDA 2QXHA 2RCEA 1T4UH 2FODA 1K28D 1GI5A 3SORA 1S81A 5EQQA 4R0IA 3GDVA 1W10U 3SGQE 1SPJA 1UO6A 3ZVGA 1J17T 1IQFA 1Y3WA 1LCYA 1P2NA 2Y5FA 3QUMP 3PTNA 1P8VC 4YLQH 4CH2B 2P3TB 2BHGA 5C5NA 5F8ZA 1EKBB 1ELTA 3KF2A 1OX1A 3IG6B 1HAOH 1P02A 1HJ8A 1UVPA 1HCGA 1RTFB 1TGBA 3HK3B 5GCHF 4Z6AH 3M3TA 4GCHF 1A7SA 1P03A 2Y82A 1UK4A 2Y5HA 2BLQA 1DM4B 3ZZBA 1Y3XA 4DIHH 1GJAB 1TNGA 2VINA 2F9OA 1MCVA 2SGAA 4Q2KA 4WVPE 4OS4A 2BD8A 1VCWA 2J94A 3LONA 3SUDA 1GDNA 1A5IA 1WQSA 1H9HE 3PLPA 1T32A 1AU8A 3RMLH 1OWHA 4YOIA 2AIQA 4A1XA 4X8TH 4LZ4B 1C1SA 1EZXC 4FUHA 1AKSA 3BTTE 4JZIA 1AKSB 1GPZA 4ISNA 4WF8A 4DJZB 1Y3VA 3UWJH 3A89A 1BMNH 5H4IB 3SU4A 1ZHMA 1GI1A 3TH3H 4Y7BA 1FY8E 1WCZA 1F5LA 1OWDA 2WYGA 3D49H 3STJA 4H42U 2ZGJA 1OWJA 4JCNA 1EPTC 3SW2B 3DHKH 4RSPA 5ABWA 4ABJA 2K1QA 5K7RA 2CV3A 2Y6TA 4XBCA 2Q6DA 3TJOA 1PYTC 1LHEH 3EAJA 3TLOA 2FOHA 1XVMA 1AO5A 2WPKS 1YPMH 3LGYA 1KXBA 5E2OA 2FLRH 4I8HA 4Q7ZA 3RXIA 1SHYA 3KQEA 3TK5A 1GBKA 5L2YH 3TU7H 2V3OH 2G5VA 4NZLA 2NU2E 1RXPA 2D2DA 1F0SA 1LPGB 1K1LA 2JETB 4IW4E 4NGAH 3OU0A 1L0ZA 1TNJA 3NK8A 3A86A 1O3AA 3MYWA 1IQKA 3IWMA 3Q00A 1D3DB 1SBWA 3BTQE 4E06H 2WPJS 3HKIB 4PROA 3E0PB 1EASA 2ANMH 2EI8A 1TOCB 3PMJA 4E7RG 1SOZA 2GKVE 3SQHE 1GBHA 1GGDC 1ID5H 5FX6A 4TWWA 4FVDA 1DUEA 4XDEA 3UOUA 1LDTT 3M5MA 1P3CA 2HLCA 3H7TA 3SJ9A 1AMHA 5A0AE 1IHSH 1ZPZA 2A5AA 3UPEA 1N8OC 3UR9A 4CR5A 3HKJB 3EYDA 2J9NA 4Y0ZE 2BD4A 2Q1JA 2W7UA 1MTNC 1SFIA 2O8MA 3K2UA 2FZZA 2KAIB 1G36A 7LPRA 2SGEE 2BD7A 3RU4T 3SU3A 1EJAA 1ESTA 1MAYA 2OXSA 3S7HB 1PQ8A 1C2FA 1GBMA 1XUIA 1MQ6A 5JYIA 4GUXA 1ELDE 1O3BA 4KKDA 3DFLA 2CF9H 4AYVB 1E0FD 1CBWB 3UY9A 1HB0B 3KIDU 4AGJA 1W12U 3M36A 1EATA 4D9RA 3T62A 1BTPA 2ZQ2A 1HBTH 4DG4A 1VITG 5EODA 2GV7A 5DP8A 4A7IB 2ZI2H 1PPZA 2V6NA 1BITA 1VGCB 4ABHA 2A45B 1QR3E 3GY4A 2FX4A 5LPFA 1NS3A 4LOYH 1N6XA 3W95A 5FAHA 1Z8JB 4NSYA 2ZQ1A 1NC6A 2IN2A 1AN1E 3DUXH 2PGBB 3SHCH 3ZVAA 3ATKA 1DFPA 3LJOA 5J4SA 1O2QA 5GCHG 1P2IA 3BG8A 1F0TA 4ZKRU 3ZZDA 3QGNB 1FN8A 2ZP0H 4MPXA 2FOEA 4R8TB 3FVFB 3RUOA 1LMWB 2HALA 1S84A 1QTFA 2XCFA 1B0EA 1QL9A 4NZQA 4D7FA 2G51A 1D6RA 1SVPA 4NG9H 3PWCA 5SGAE 3VB3A 4JYVH 5AVDA 3NPSA 1TRNA 2H5DA 3SV6A 1PFXC 2ZKSA 2EEKA 2G4TA 4DVAU 2ZFTA 1SSXA 1A0JA 2BVSH 4KELA 4I8LA 4ESTE 3S9CA 4B76A 1A5HA 1C2EA 2XTTB 2OTVA 3MI4A 1O35A 2OC8A 1NY22 2QY0B 1KYNA 4A5TS 1G30B 3S0NA 2B5TB 1SMFE 2B7DH 1DXWA 3A87A 1IQJA 1W8BH 2BY5X 3QTVH 2GCHF 5GIBA 3KNXA 2QF0A 1GI6A 2BLVA 3V12A 1HUTH 1MKWH 3B9FH 1BTYA 4I31A 4I7YH 1NROH 2C8ZB 5B6OA 1C1UH 1N1LA 5FPTA 2HPPH 2ILNA 2W3KA 1L1GA 1ANBA 2VIPA 3KHVA 2ZA5A 3RXUA 3EDXB 1F5RA 1ELBA 1BJUA 5C3NA 2A2XH 4UEHH 2A0QB 1BBRH 1C4Y2 1Y59T 1CE5A 3MNSA 2VIOA 1CHOG 3ODDA 3PTBA 1AZ8A 3SNAA 3RXOA 1QRWA 2VVUA 2H1UA 5GPIB 1TNKA 2OD3B 2A4OA 3O8RA 5DPAA 2BDHA 3U8OH 1A61H 3C27B 1V2LT 3URDA 4XE4A 1MKXK 1HAXB 3BTGE 3ZV8A 3E90B 2TGPZ 1AY6H 2PV9B 1ZZZA 1ZPCA 1VZQH 3BF6H 3P6ZB 3RXBA 6LPRA 1BBRK 4NWLA 1EP6A 1HXEH 4JYTA 1YPJH 2WPMS 3T29A 3VEQB 4ISOA 2B9LA 2G5NA 4XBDA 1XX9A 4CRBA 1SI5H 1LTOA 2XBVA 1FONA 2BD3A 5A8XA 3MO9A 3KQCA 8KME2 4BAMB 2P93A 2QGRA 3UNRA 1OOKB 2Y81A 4JZ1A 4CRDA 1N8OB 1GI3A 2BY9X 4X6OA 1F2SE 1BRUP 1FDPA 1OS8A 1C5SA 4INHA 2GMTB 3GICB 3K6YA 2M5TA 4JK5A 1OYQA 5LPEA 5FCKA 2SGPE 1CT2E 1W0YH 4NIXA 1O0DH 1J14A 3PLBA 4RKOB 3UQVA 1XVOA 2UUKB 7KMEH 4MVNA 3MU8A 1CBWC 4YT7H 1YC0A 1Y3UA 4X6PA 1INCA 3SV2H 1KTTB 1O36A 3A88A 3BTEE 3ZZ4A 2NWNA 4NSVA 2AIPA 1HAHH 3BTHE 1KXCA 1UTJA 1UVUH 1VCQA 2ZEBA 2BDBA 2SGQE 1UK2A 2BY8X 2FYQA 1P2OA 2P16A 1H9IE 2FOBA 3HATH 3P8OA 3QLPH 1UVTH 1TPOA 1VCPA 4Y8YA 1KDQA 1EB2A 4NA9H 1DWBH 2EI7A 1HAPH 4WMFA 2W3IA 2ZDNA 3PO1B 4O9VA 1IAUA 5FPYA 1ESBA 2TGAA 1W0ZU 4K8BA 3BIVH 3GY8A 3GYLB 2W5EA 1PPEE 4NWKA 1WYKA 1EUFA 3RXVA 1ZOMA 2FEQH 1GHAG 1QFKH 4FU7A 5ESBA 3UIRA 1GG6B 1C2IA 4CRCA 3TJVA 1Z1IA 4K8YA 1S82A 1GJ9B 1ZHRA 2J2UA 4GPGA 3BG4C 1OYTH 5E0HA 2PLXA 1BA8B 2ZTZA 4ABAA 4AFUA 2FS9A 1UTKA 3RMNH 3ZZ7A 1EJMA 4WMEA 4X6MA 4LXBH 2F9NA 3ZVFA 1MD8A 4UFGH 4AFZA 5LGOA 5EQRA 2BMGB 3E16B 1ZPBA 1EX3A 1BRAA 5EW2H 2UWPA 1ZSLA 1YCPM 1DOJA 3GCHB 1WSSH 4D7GA 2BDGA 2Z3DA 2BXTH 1MZAA 1LVBA 1J9CH 1W7XH 4FUFA 5DP9A 3GCOA 1L1JA 3TNTA 3DT0H 2F9UA 2H9TH 2A1DB 1AB9C 2PKAB 2O9QA 1OP0A 2C3SA 1GI9B 1P3EA 2OBOA 5JPMH 1EXFA 1O2ZA 4FUEA 2V3HH 5DG6A 1XXDA 4BAQB 1T8NA 1S6FA 3SHAH 1XUFA 1QY6A 1HRTH 1NESE 7ESTE 2AFQB 1O2WA 5DP7A 1QA0A 2ANKH 3NCLA 1Z71A 1GCTC 2RDLA 4UFFH 2ZC9H 1A5GH 1PPHE 4WWYA 2XWAA 3SO3A 4X1RU 3DD2H 1SGCA 4Y71A 5GXPA 2UUFB 1MQ5A 1Z8GA 1O2GH 1F0UA 3T5FH 1C1MA 1HPGA 1RFNA 3SNEA 2TPIZ 1JWTA 3SJ8A 1ARBA 2OLGA 1PPFE 3P92A 3MTYA 4NA7A 5EXMA 1D9IA 2ZTXA 2FLBH 4Y0YE 1AHTH 3LGTA 1P0SH 1PYTD 5A0BA 1UCYH 1ETSH 2CHAB 3ITIA 1DUAA 3ELAH 3MH5A 1S0RA 3SU1A 4VGCC 4YOGA 2CXVA 1Z6EA 2QAAA 2GZ7A 1LO6A 1JXPA 3U98H 1QBOA 5FBEA 1E36B 1WV7H 1KLTA 1TQ0B 3T27A 2QXJA 4D9QA 5F6MA 2H2ZA 1OSSA 1O33A 1V2UT 1NRPH 3ATMA 2Z7FE 3U69H 2DE8A 3LT3A 5DK1A 2A31A 3KCGH 4A1VA 2BX4A 4O3TA 1P2QA 5G4BA 2QC2A 1CGIE 3RC4A 2G81E