1TGSZ

Three-dimensional structure of the complex between pancreatic secretory inhibitor (kazal type) and trypsinogen at 1.8 angstroms resolution. structure solution, crystallographic refinement and preliminary structural interpretation
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
225
structure length
225
Chain Sequence
DKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (proteinase/inhibitor)
molecule keywords TRYPSINOGEN
publication title Three-dimensional structure of the complex between pancreatic secretory trypsin inhibitor (Kazal type) and trypsinogen at 1.8 A resolution. Structure solution, crystallographic refinement and preliminary structural interpretation.
pubmed doi rcsb
source organism Bos taurus
total genus 53
structure length 225
sequence length 225
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgsZ01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgsZ02
3MU8A 3AASA 1DSTA 3SU2A 3PMBB 4K1SA 1TALA 2CMYA 4WH8A 2BYAX 1AVWA 1E37B 3P95A 3ATKA 1ELBA 3RXTA 1UCYH 3V3MA 2CN0H 2J95A 1G36A 3SNEA 4D8NA 2ZDNA 1C5MD 1NFYA 2G5NA 2ZO3H 1BA8B 3QTOH 4WY3A 1G32B 1K22H 3BTDE 2B9LA 1QJ6B 2SGPE 1HCGA 1RTKA 4JYTA 5DKMA 1MD7A 1K1PA 1O0DH 1D6WA 3DHKH 5EQSA 2ZDVH 2GZ8A 1KYNA 2PV9B 2AFQB 4B1TA 1CO7E 1O2VA 1OKXA 2VIWA 2WPHS 2W26A 1WTHD 3A8DA 5FPTA 1G3EA 3RUOA 1SI5H 1BMLA 1LHGH 5T6FA 1ANEA 2C8WB 3PWCA 1BQYA 1O3BA 1EZQA 2ZCLP 3KCGH 1SGIB 2BD3A 1AUTC 1WAYB 1SGQE 2NU1E 3TNSA 3P8GA 1FY1A 3ESTA 2ZDKA 3U8TH 1O2XA 1VJAU 1IQHA 2BXUH 4YM9A 2FEQH 3R0FA 5TJXA 2A0QB 1W7XH 1B7XB 2SGAA 2GDEH 3LH1A 1BIOA 5CHAC 1GJ6A 2J2UA 1GI8B 3G01A 1IQJA 1ABJH 1DWDH 1BTWA 4NGAH 3TGKE 1J14A 2BB4A 1KDQA 4H6TA 1SSXA 3M5LA 2R3UA 1O2IA 1AIXH 5EXLA 4A5TS 1GHAF 3S7HB 4UFDH 4NWKA 2SGFE 1AWFH 1ETRH 1PJPA 4J2YB 1ZYOA 5AF9H 2A7JA 3P8FA 3UFAA 2DUCA 1OOKB 2CHAB 4DGJA 2G4TA 1VZQH 5HMAA 4D7GA 2ZTYA 4ZKSU 3MH5A 1GMDF 1ESBA 1AE5A 1WQVH 2J38A 2FI3E 1ZHMA 4KELA 4X8TH 4CRDA 1WOFA 4IN1A 3GY6A 5TCCA 4UFGH 1OPHB 2VVUA 1AI8H 5EG4A 2BD7A 3GCTF 1PYTD 4BOHA 1MD8A 4Y79A 3RXJA 1NRNH 2BD4A 3PO1C 4ISOA 1ZTLA 1QBVH 1O5AB 1YPHE 3LGUA 1SLWB 1UVSH 2FI4E 4U01A 2FOGA 1KXDA 2WPMS 3EDXB 3TJUA 2ZFSA 1TWXB 2PW8H 5BRRE 1HXEH 3GY7A 3RXGA 4BNRA 2SGEE 4RKJB 1KLJH 1GBFA 2BOHB 1DFPA 1TMTH 1HB0B 2ZQ2A 1O3PB 1MKXK 1GJCB 1SGFA 3ZZ5A 3IG6B 1P2MA 5FAHA 2BD9A 5HM9A 3P8OA 2ANKH 5GDSH 3EQ0H 3PV4A 4TY6A 1ACBE 2AIQA 1C1MA 1ELDE 3UQOA 4UDWH 3IWMA 3ODDA 2A4GA 2P59A 3SUFA 1EP6A 1C2IA 2EA3A 1YPEH 1TA2A 4JCNA 1PPFE 1BRBE 4AYVB 2XW9A 3F9GA 1OWJA 5F03A 3NK8A 1EPTA 4FVBA 2GT8A 7ESTE 2RDLA 5SGAE 1NESE 2GKVE 3RP2A 2NWNA 2I6QA 1EP5A 1CHGA 3BIUH 3MWIU 2VH6A 1Z6JH 4WF8A 1TMBH 5HM2A 2VWOA 2WYGA 1SPJA 5GWZA 2EI7A 4K69A 1W0YH 5DPAA 3ZZAA 3BF6H 2BM2A 1CHOF 1UCYE 1A61H 1ELGA 2JH6D 4D9QA 1GMCF 4DIHH 4IS5A 1LQDB 3SNAA 1DWBH 4Q7ZA 3DD2H 2IOTA 2ZHEH 4DIIH 8ESTE 3NKKA 2CHAC 1S0RA 2FOAA 2ALVA 1UTNA 5A2MH 2ZTZA 3SGBE 1TRYA 1GMHG 1DUEA 1QB1A 1PFXC 3B8JA 5FBIA 4DG4A 2V3OH 1WQSA 1FDPA 3NWUA 1BUIA 1L1NA 4ZHMU 1GMDG 3QK1A 3ATIA 8KME2 4AFZA 1AN1E 1MBQA 5I46H 2V3HH 4D76A 3RXKA 3LGWA 6LPRA 2ANMH 1YF4A 2BVRH 1RIWC 2BD5A 4CHAB 1C9TA 1P04A 3BTQE 3GCHC 2UWLA 1N1LA 1EOJA 2BQWB 4NIVA 2ZPRA 1MTSA 3ZVEA 4B2CA 3ZZDA 1V2MT 1C1NA 1ZSKA 3H7TA 1GBBA 3RMOH 1S81A 1V6DA 4GHTA 4ABBA 2BY6X 4NCYA 1TGCA 4IMQA 1P11E 1PQAA 2A31A 2AH4X 2RA0A 3MOCA 2M5TA 4ISNA 2P95A 2AMQA 3NXPA 3WY8A 3TITA 4D7FA 1O3DA 2Z6BD 1T8OA 1IAUA 5FPSA 2F9OA 2GZ9A 1C1TA 2OINA 3HATH 2BDBA 1P02A 4K2YA 1E38B 5HXFA 1AZZA 1SGFG 1IOEA 2ZFFH 3BEIB 2K1QA 3LDXH 1C5WB 2HPQH 1PPZA 4IGDA 2F9VA 2O8WA 4H6SB 2AEIH 2UUYA 2SFAA 2Z9JA 1J16A 2ZGXH 3A84A 2H5DA 4E06H 1GBLA 1TGTA 1Y3XA 4NG9H 1GI3A 1AB9B 2XYAA 4GHQA 3S7KB 4BTTB 3S0NA 3VFEA 1JRTA 2GMTC 1EXFA 2XTTB 1QL7A 3ODFA 3L33A 2Y7ZA 2STBE 1SGDE 3V13A 1ZGVA 3Q3KA 2KAIA 1O34A 1VCQA 4X1SU 1C5RA 2STAE 2BY7X 1TX6A 1Z1JA 1AKSB 1SHHB 3P6ZB 1V2VT 1D3QB 4MNYA 1P2KA 1HAZB 2A4OA 1GHXH 2ZQ1A 3UNSA 1Q31A 1SGTA 3K2UA 2C8XB 1P8VC 4XBCA 5B6OA 1TONA 3PMHB 1QRXA 4B2AA 1OYTH 4FUBA 1MMJN 1SQAA 4B73A 6GCHG 1KXEA 5J4QA 1P3CA 3LGTA 3RDZA 4O9VA 3LKWA 4TY7A 1P2IA 5H4IB 2YOLA 1UTOA 2WUCA 2G51A 3GY3A 1ARBA 3DFJA 3RXQA 3TGJE 1AVGH 1IHTH 4AFSA 3SJOA 4FUDA 1GBHA 1TB6H 2ZF0H 4FU7A 3BIVH 5GCHG 2ZU4A 1BTUA 3SGAE 3PMJA 4X8VH 5A09A 1AGJA 3SUDA 3M36A 2OD3B 1MZDA 2ZGCA 2J34A 5A8ZA 2H9TH 2A5AA 1GJ4H 3OY5U 4CHAC 2Z3DA 1LPGB 4TWYA 1NZQH 1DVAH 1O2HA 3UREA 1MTNB 4OS5A 3TK5A 1GBCA 2HPPH 4ISLA 4Z0KA 1OWHA 2HLCA 4IMZA 5AFYH 5BPEA 1A46H 1DWEH 2BDIA 2R9PA 4RKOB 1NRPH 2R0KA 1DLEA 2XRCA 3GY5A 4MNXA 3P70B 2YNAA 3ZVBA 1DY9A 1GJDB 2PGQB 1VITG 1D4PB 3SJ9A 4NA8A 3ATLA 2SGQE 4B2BA 1NN6A 4HGCA 2ZFTA 3HPTB 5A0BA 5DP5A 1N6XA 1GI5A 2OBQA 3VEQB 1QFKH 1EZUC 1IQIA 2ILNA 2BHGA 4AN7A 3E16B 4JK5A 1EPTC 4Z6AH 1O33A 1ID5H 7LPRA 2FOHA 1TRMA 1O3JA 1ZTKA 1C1RA 1V2WT 3RMNH 1RS0A 2PKAB 4X6PA 4I32A 8LPRA 3D49H 2VIVA 5C67A 4F49A 1FIZA 3RXHA 1OWIA 3UY9A 5T6DA 1HUTH 1TA6A 1GWAA 1AB9C 4AFQA 4JK6A 4ZKNU 1Z1IA 4BXWA 1CGIE 2FP7B 3E0NB 1BTHH 1GL1A 1ZPBA 2OCVB 3GCOA 3LGIA 2Y81A 1F5RA 4YOIA 1QJ7B 2OXSA 3MU4A 1YPHC 3BEUA 1UVPA 4Y0ZE 4X6NA 1OS8A 4JZEH 4X2VA 1O5GH 3ZVAA 1IQMA 2HVXA 2QGRA 3QWCH 4A7IB 1C1VH 1SLXB 3A7YA 2CGAA 4I8LA 3U98H 2IPHA 1HDTH 3E1XB 1ESAA 1JOUB 4B76A 2BZ6H 1PPBH 5JYIA 4ZHAA 1RGQA 4CR5A 5G4BA 1QL9A 1FJSA 1GI9B 4OS6A 1N6YA 1NY22 2VIOA 1AUJA 3M35A 2GVFA 4RN6A 1TGSZ 3ATWA 5GPIB 1P2JA 2PTCE 1WV7H 3HGNA 2AMDA 4A1TA 3MNCA 5C1XA 1ABIH 1C1SA 5T3HA 4LZ1H 1HRTH 2W3IA 4X2WA 4X8SH 2ZNKH 1C5LH 2BY9X 2ZFRH 1NC6A 1TOMH 1HPGA 3FP8E 2ZECA 2ZGHA 4YTAA 5C1UA 1EJMA 2Q1JA 4B75A 5DP4A 5C3NA 3SW2B 3RXLA 1MQ6A 1SOTA 4ZH8A 4X1QU 1ARCA 2FOMB 4E7NA 2ESTE 4OS1A 1HJ9A 5FCRA 3TGIE 4U30A 1T8MA 3HK3B 4OS2A 2AIPA 1Y3YA 4KTCA 3RXMA 5JB8S 2B0FA 3ZZ7A 3Q76A 1O30A 1BHXF 4M7GA 3UWIA 1PPCE 4MPVA 4AG1A 1DITH 3NZIA 1LHEH 2Z7FE 3A85A 2ZDLA 4TWWA 2EI6A 5EGMA 3MYWA 1TX7A 3VXFH 1BBRK 1OX1A 3D65E 3CP7A 1OWKA 3F68H 3KIDU 3SV2H 3DFLA 1G2MA 5CE1A 2PFEA 2XCFA 4JYUH 4ABGA 1DY8A 2QAAA 5JBCS 1BZXE 2OTVA 2W5EA 3TNTA 3SU5A 5EXMA 2WV5A 1EAUA 1RRKA 3UR9A 3NPSA 4Y7AA 1GJ9B 1O2LA 2Q6GA 2P16A 2Z9KA 3A86A 4R0IA 2ZHDA 1NPMA 1GG6B 1C2EA 3M7UA 1PPHE 2QC2A 4ESTE 2BOKA 2XXLA 5F8ZA 4B74A 2W7UA 2BLQA 1TNIA 1JMOH 3RXDA 4ABJA 4WWYA 3PB1E 2P94A 3Q00A 1GBIA 2TRMA 4MTBA 1TBRH 9ESTA 2JH5D 3MO9A 4I8HA 1K1LA 1YC0A 2EC9H 2FESH 4AG2A 1ELVA 2FTMA 5E2PA 4WVPE 3A89A 3KL6A 3BTGE 1EATA 2BDGA 4XBDA 1SL3A 1SOZA 3SV9A 3UWJH 1EOLA 1B5GH 2OC1A 4OS7A 3QDZB 4OS4A 1KLIH 3SJKA 3KN2A 2FS8A 2NU3E 5HGGA 4I8GA 3TJVA 4ZKRU 1HAPH 2AMPA 3K6ZA 4ZUHA 2A7HA 3SU1A 1J15A 1H1BA 1J8AA 2ZPSA 1ZJKA 4ZHLU 1GMHF 3RXRA 3BTFE 1WBGB 1NT1A 2P8OC 4R8TB 3T28A 4J1YA 1VCWA 2ZHWH 4FUFA 4INHA 4CR9A 2WPIS 4GSOA 4NZQA 2HNTC 1H4WA 5ESBA 2FX4A 1ELCA 4U32A 5L30H 5JPMH 3ATMA 3I78A 2TPIZ 1LVOA 2ZU5A 1WCZA 2O8UA 3M3SA 3URDA 1IQNA 2Z9GA 4YT7H 1BTPA 3L3TA 2PSYA 4YOGA 4BAHB 2ZFPH 1QY6A 2ZTXA 3BTME 1CBWB 1KTTB 1YPLH 4X0WU 1SLUB 4VGCB 3JZ2B 1L4ZA 1Z6EA 3SHCH 3ELAH 4A1XA 2D8WA 4BAKB 5LGOA 1AZ8A 1G30B 2GV6A 3F9HA 1KXCA 3FVFB 1HAIH 1HAOH 1TNHA 4A92A 1BCUH 1LMWB 1ZHPA 3M5MA 1UTPA 4DW2U 1IHSH 4FUEA 5E0GA 3SZNA 2GCTB 4UE7H 3BEFB 3FP7E 4H4FA 1V2JT 1GHBG 3F1SB 5F8XA 1ZLRA 4GAWA 3U8OH 5GXPA 1SFIA 1CVWH 1VCPA 2FOFA 3SU3A 4QT8C 3OYPA 3QZRA 2PHBA 1EQ9A 3AVZA 1F2SE 2PR3A 1UMAH 2QY0B 4BTUB 3RXCA 1F92A 4AX9H 2H6MA 2OC8A 1O2GH 3TJOA 5C2ZA 3MO6A 2VU8E 2YNBA 2J4IA 1GG6C 1O3EA 3DA9B 1TE0A 3SGQE 2TBSA 1GI2A 3HGPA 2NU4E 4UONA 4DT7B 1HJAB 2BD2A 3BSQA 1V2PT 2BMGB 3ENSB 3E0PB 2AYWA 1CGHA 3ZV8A 5A8XA 3VB6A 3SHAH 1ELEE 4MPXA 1D3DB 1LO6A 3A7ZA 2TGDA 2VWMA 1NFUA 2FZZA 1ZOMA 2RCEA 1HFDA 4MLFB 4A1VA 1G3CA 3A8BA 3PMAB 4ZROA 3K65B 2GV7A 2QF0A 5EXNA 1OP2A 5GJ4B 1O35A 1GJ5H 1T4VH 5C1YA 3T27A 1O2NA 3MHWU 3RU4E 3OSYA 1BMNH 1Z8GA 5C5OA 2G00A 3SNCA 1MKWK 1YBWA 1F5KU 3RXEA 1DUAA 5FCKA 3MTYA 1S85A 4K1EA 1ZMJA 4X2YA 1AKSA 3W95A 3TH3H 6GCHF 1FAXA 2ZI2H 3A81A 2A7CA 1YPMH 2ZDAH 4CBOA 1A3BH 1XUFA 2ZHQH 1GDUA 1O5DH 4TPYA 1EB2A 1L1GA 1ZSJA 2VNTA 4O3UA 1Y5BT 1MUEB 2XCNA 4YESB 3VGCB 1K1NA 2PUQH 3BN9A 2BD8A 2PKSB 3MNXA 4Y76A 2VJ1A 6ESTA 3JZ1B 5GCHF 1MCTA 2GX4A 2SNVA 4E7RG 3V0XA 2A32A 3QX5H 1B0FA 3L6PA 1GI0A 2Q6DA 1JIMA 2LNCA 1D3PB 2ODQA 1E34B 2ASUB 3LJOA 2IN2A 2UUJB 2AGIX 1L0ZA 1QA0A 1AFQB 5CMXH 1IQEA 3BTTE 5EU8A 1LHCH 4NWLA 5E2OA 4KGAA 7GCHF 1H8IH 1P3EA 1OP0A 2D2DA 2BY8X 1VITF 1GBKA 3C27B 5LPRA 1E35B 1S82A 1GHVH 2Z94A 3T2NA 4WMFA 1T31A 2GDDA 2GTBA 1RTLA 3TJNA 1O2WA 3KHVA 1SGRE 1NS3A 2PTNA 3BV9B 6CHAB 1CGJE 1LVMA 1C5NH 1L1JA 1SHYA 1PQ7A 2RG3A 2XBVA 3PLKA 5LH8A 4CH2B 1XKBC 4LXBH 1CE5A 2F9NA 3ZV9A 3RU4T 2D1JA 4MNWA 1T8NA 2BQ6B 3AAVA 2FYRA 1O2YA 4ASHA 2FLBH 1A0HB 1H9LB 1THRH 3NUMA 1J17T 4SGBE 1H8DH 4OGYA 1GDQA 4GCHF 4X2XA 1HIAB 2VVCA 2UUKB 1A5IA 1DICA 1O2RA 3E3TA 1AE8H 4ABDA 1TQ0B 1NRSH 1T7CA 4DCDA 1V2LT 1NU9A 1O2UA 2HNTE 2DE8A 2W7SA 1PYTC 1XXFA 1ZJDA 1NU7B 2BLWA 2PLXA 4Y0YE 3T62A 4AOQA 1U6QA 1LCYA 1SB1H 1XUIA 3M3VA 3MI4A 2PKAA 1UK4A 1Y5UT 3UNRA 3MO3A 4ZMAH 5I25A 2PUXB 1TPOA 2BY5X 5FPYA 2ULLA 3RMLH 1MQ5A 2H1UA 1THPB 2XWBI 1ETSH 2ZA5A 1ETTH 2FOBA 5EW1H 1C1WH 3K9XB 1SQTA 2TIOA 1QNJA 1C1QA 1CA0B 2ZPQA 4AGJA 5JBTA 4E05H 1GI4A 5A0AE 3I29A 1O2ZA 2WYJA 1N8OB 1RFNA 1K1IA 2BX3A 2FTLE 1O38A 4UD9H 1QQ4A 1O3FA 3P17H 1TFXA 3TH2H 1ZGIA 3MU0A 1O3NA 1HAGE 4X8UH 1V2OT 1A7SA 5DP6A 2BXTH 1FY5A 3KQEA 2BVSH 1FONA 1Z8IB 3QLPH 4I31A 2QXGA 2FO9A 5AFZH 3RMMH 3VXEH 4B71A 1YPGH 3M37A 3LGVA 1F0RA 5TCAA 1DXPA 1BBRH 1YPKH 5L6NH 3SV7A 4K3JA 4Q2KA 1QL8A 3A7VA 1GBTA 1ANBA 3SNDA 1XXDA 1XVMA 1Y3VA 5EQRA 2H9HA 1BB0B 3RXSA 1O2QA 1CQQA 1S6HA 3LH3A 1QB6A 4NZLA 4AZ2B 7GCHG 4Y71A 2HNTF 1HAVB 1O3MA 4ZXYH 4WXIA 1EB1H 3P92A 3QGNB 1CT0E 1A3EH 1ZRBA 4TPIZ 4K1TA 2FXRA 1GGDB 1DWCH 1TGNA 1O5EH 3O8BA 3GDVA 4X6MA 1NO9H 1G37A 1W7GH 3PLPA 5DK1A 1MU8B 4CRCA 1BTXA 3CS0A 4NSYA 2G8TA 1O37A 1CU1A 1BJVA 3SBKA 1V2NT 3ZVDA 1FQ3A 1Q2WA 3DT0H 1LHFH 1OWDA 2R0LA 4XBBA 5JDUB 1LQEA 2V35A 4ABAA 5GIBA 1FY3A 1V2QT 2XBYA 1GJBB 1KLTA 3KNXA 5EW2H 2F83A 3TIUA 1UJ1A 2GCHG 1F0UA 1V2RT 4GCHG 2C90B 1MZAA 3A8AA 1KIGH 1EZXC 4YO9A 1O3KA 4H42U 3LC3A 4X1PU 2G5VA 2BLVA 3MH6A 1AQ7A 3U1JB 3SQHE 4ISIH 1TX8A 5ABWA 1XVOA 5FBEA 1K1MA 1ZTJA 3RLWH 1GCTB 5K0HA 1GBEA 1AY6H 2ZDMA 1DOJA 1EKBB 5J4SA 1CA0C 1NTPA 1P12E 5DO4H 1TBQH 1L2EA 2BDCA 2VINA 2VIQA 3SORA 4Y8XA 1O3LA 2D26C 3E90B 4Y7BA 4WJG2 3Q77A 1N8OC 2H2ZA 4THNH 1NRQH 3H7OA 1B0EA 4FUCA 4XFQA 4LOYH 5DGJA 1QQUA 1KSNA 2J9NA 1TIOA 1DT2A 4K5ZA 4FU9A 1MH0A 3SU4A 3TH4H 3LT3A 4INKA 4NFEA 2OLGA 4BTIB 1GVKB 1C5UA 4FVDA 4AB9A 4HI3A 2JH0D 2THFB 1V2UT 3TVJB 4XOJA 4GLYA 1VR1H 1TPSA 2Y80A 1GVLA 4BXSA 2J92A 3O8RA 1DSUA 3HK6B 1UVOA 4YZUA 2IJOB 2QF3A 4UFEH 1F0TA 3SO3A 1Z8RA 3SI3H 2C3SA 1IQFA 1YCPH 2AERH 5DG6A 1C1UH 1UK2A 3FANA 2A5KA 1FNIA 5DP9A 3TLOA 1ELFA 3A80A 5EPNA 4AGKA 1LHDH 1O2SA 4JZ1A 2PGBB 3D62A 3KQCA 1UHBB 3F9EA 1MTNC 1F5LA 1ZR0A 2VIPA 1SR5C 1GBMA 1LKAA 1HAYB 3BTKE 2G81E 1GJ8B 2XWAA 2OQUA 1C5ZB 1HGTH 3M7QA 1YGCH 1XMNB 1QGFA 2P3TB 5FHTA 3OU0A 2EI8A 1FXYA 1S0QA 2ZCHP 4ISHH 3PLBA 1C5VA 1TBZH 1LTOA 2ANYA 3SUGA 1C2DA 4I8JA 1QBOA 1AO5A 1MU6B 1F7ZA 1HLTH 4O97A 1UTJA 4XSKU 1XM1A 2ZC9H 3RC5A 1GHBF 3FZZA 3PO1B 1C5YB 3GYLB 5F8TA 1YP9A 2BX4A 1SC8U 3V7TA 2FPZA 1V3XA 4IC5A 2O9QA 1ZHRA 1TMUH 2ZP0H 1FPHH 2WPLS 2ZU1A 2GT7A 1BBRE 2J94A 4Y8YA 2Y5HA 2ALPA 2OBOA 1GBJA 1OSSA 3UIRA 5PTPA 2UWOA 1O3OA 1BRUP 1QURH 1MKWH 1UTLM 1UK3A 2BQ7B 2ZKSA 5K7RA 3M5OA 1ZMNA 1ZRKA 1QBNA 1C2MA 3SV8A 2CF9H 3SQEE 1GJAB 3AW1A 2BTCE 1W10U 2UUFB 2NU2E 1DDJA 2VWLA 5ETXA 2CJIA 3PYHA 4FXGH 4AB8A 2G55A 4LK4A 4Q7YA 2R2WU 1KXAA 2FMJA 1GCTC 2AGGX 1BJUA 1BMMH 1C4Y2 1EUFA 2TGPZ 4ABFA 4ABEA 1AVXA 4DURA 2ZHFH 9LPRA 2FOEA 2QXHA 1BRCE 3FP6E 2F91A 1TABE 1S6FA 1C2JA 1O2JA 2Z9LA 1ZSLA 5C20A 1P01A 3EAJA 1HAXB 4HTCH 2Y5FA 4ZXXH 2VB0A 1WSSH 1JBUH 2ODYB 3QGJA 2DE9A 3VPKA 3BTEE 4FU8A 3SNBA 2WPJS 1D9IA 4MNVA 1XKAC 1GHWH 3OY6U 3KF2A 2SGDE 1BDAA 1A0LA 1CT4E 3FFGA 3SI4H 1SQOA 1UTQA 3QUMP 3UPEA 3IITA 1P06A 1QRWA 1TNLA 1XUKA 1YKTA 3FZDA 1ELAA 1YLCA 2VVVA 3PTNA 1IQGA 3BG8A 2WINI 3M3TA 1OP8A 1Y3UA 1PPEE 3RXFA 3O8DA 1KTSB 1LDTT 3LOXA 1A2CH 2XBWA 1DE7H 1Y5AT 3P8NA 4CRBA 1H9IE 8GCHG 5FX5A 3GICB 4DY7B 1C9PA 3MFJA 1X7AC 1P57B 1JXPA 3F9FA 2ZCKP 2BDAA 3AAUA 3HKJB 3Q3XA 5EOKA 1C2GA 2B8OH 1AD8H 1UO6A 3RM2H 3GDSA 1BHXB 3GDUA 4JZDH 4O03A 3T5FH 1GL0E 1O2PA 3RLYH 4JZIA 1YCPK 3VB5A 1XX9A 1YCPM 3FAOA 1RIWB 3RC4A 3SV6A 1O2OA 2QV1A 1P03A 3GCHB 1XUHA 3H5CB 3KQDA 3ZVGA 1FLEE 2C93B 2F9PA 1YYY1 5EODA 4FUHA 4F4OC 5DP8A 4BAQB 3RXVA 1QA7A 1P9UA 4UEHH 1TLDA 4HZHA 1MCVA 1FUJA 1SGNE 1ZZZA 2UWPA 3SU6A 2C8ZB 1OWEA 3CS7A 2OQ5A 2SNWA 3K6YA 4K60A 5DJ7A 1SMFE 1ELTA 3MH4A 2QIQA 4ABIA 1Q3XA 2F3CE 3ZZ4A 1BITA 2P3FH 4NA7A 3A87A 3EA9A 3D23A 1WUNH 1W0ZU 1AFEH 2TGAA 4FUIA 1HIAA 2WUBA 1H9HE 5DP7A 1FN8A 1GJ7B 3BTHE 3KQBA 1UVTH 1A0JA 4PROA 1DX5M 4JMYA 1UVUH 1NRRH 3O8CA 5FX6A 1IQKA 5IDKA 3OX7U 1YLDA 3I77A 3QO6A 1T4UH 3S9CA 1P05A 1TAWA 2W3KA 5F6MA 1SVPA 2GMTB 1SG8B 3SJIA 3E6PH 1C5OH 1SBWA 3EE0B 3RM0H 3GY4A 1QJ1B 2VH0A 1XUJA 3UNQA 1KDQB 1UCYK 1KY9A 4YLUA 1DANH 1K28D 1P09A 2FX6A 2XBXA 4U2WA 2FWWA 1Z71A 1C5SA 1SGEE 2ZEBA 1EJNA 2H5CA 3A7XA 1F0SA 1Y8TA 4I33A 1K1OA 2F9BH 2XNIA 1P2QA 3NCLA 1EJAA 2R2MB 4MVNA 3ZZ3A 1TNKA 1HNEE 1P0SH 1C5QA 3UQVA 1TGBA 1C2HA 1EAXA 1TOCB 1VGCB 3U1IB 1GHAG 1NFWA 2OC7A 3A7WA 3F6UH 4YOJA 1CBWC 1P10A 3QN7A 1LPKB 4VGCC 3EA7A 1MTVA 1QCPA 1WYKA 1NM6A 5A8YA 1SGCA 2XC0A 1LKBA 3TK6A 4CBNA 1L4DA 1QIXB 1S5SA 1AU8A 1HYLA 1JRSA 1O5FH 2JKHA 1SLVB 1K9OE 3LC5A 3MH7A 1TRNA 4X1NU 1T32A 2G52A 1QHRB 1MAXA 1K1JA 1Z8JB 4FUJA 4KTSA 5C5NA 1QTFA 4Y10E 1S84A 3MMGA 4CRFA 2GCTC 1FN6A 3GCTG 1FY8E 4NSVA 3U69H 1HAVA 4GUXA 1UTKA 3A7TA 4GVUA 4XDEA 3GY2A 3A88A 2Z9IA 4NIWA 5EPYA 5JBAS 4ZAEA 1EZSC 3ZYDA 1BRAA 2B5TB 3ZZBA 2CF8H 2Z3CA 1O3AA 2QXJA 2FM2A 3RXBA 2O8MA 1O5CB 2HALA 1O36A 1G3BA 5L2YH 2ZFQH 1QR3E 4UFFH 2GCHF 1FI8A 4D9RA 3RXUA 4X1RU 1A4WH 2A2QH 2FOCA 1ESTA 1KXBA 1P2NA 3GOVB 3BG4B 1HJAC 3KGPA 5HYOA 5E8EH 4IW4E 3CENA 3N7OA 2BDYA 4YLQH 3ZZ6A 1O3CA 1A1RA 4AFUA 4BAOB 2O8TA 3TPIZ 2LPRA 1BTYA 1XUGA 3E91A 3STJA 3UOPA 2XC5A 1RJXB 1C4V2 1TYNA 1EPTB 3GYMA 1GI6A 1O31A 4WMEA 2ANWA 1MAYA 3PWBA 1FMGA 3GY8A 3GISB 2QN5T 3W94A 1TPPA 3RXAA 3UR6A 3ZVFA 1W2KH 1O39A 3T26A 1INCA 4WH6A 3ZYEA 3GCNA 2ODPA 4JZFH 1K21H 2Z3EA 1UTMA 2P93A 3MNSA 5JB9S 2Y82A 2HGTH 1HXFH 2OUAA 1GHZA 1D6RA 2JETB 1FAKH 1HBTH 4WMDA 1Z7KA 1TNJA 1NROH 4YT6H 2OP9A 1LPZB 1SGYE 3EGKH 2BZAA 3EA8A 3LJJA 3LPRA 1O3HA 3B23B 4Q80A 1EX3A 1W12U 5DP3A 3AW0A 3VGCC 5T6GA 2A4QA 5E0HA 3T29A 1KXFA 2PKSC 1RTFB 2CXVA 3M7TA 3RU4D 1V2TT 3RXIA 1Y59T 4X6OA 2ZG0H 3C1KA 1C2KA 1C5TA 1W8BH 3ITIA 3URCA 3M61U 1CHOG 3UTUH 1VGCC 3LIWA 1GMCG 4CRGA 1AFQC 2I6SA 2Y6TA 4RSPA 1C2FA 4IBLH 3TU7H 4NIXA 3PROA 1HJ8A 3QTVH 2C4FH 2FDAA 1PQ8A 1O2TA 4SGAE 1C1OA 3ZZ8A 3V12A 1CSOE 2VGCB 4DVAU 3T25A 2ZGBH 4JYVH 3RXPA 1LVYA 2GZ7A 3M5NA 1UHBA 2FI5E 1MTWA 3RC6A 1FIWA 4KKDA 1ANCA 1S83A 1ANDA 3LU9B 3BTWE 6CHAC 2H9EH 1GPZA 2GP9B 1TPAE 2HRVA 1DLKB 4ABHA 1FV9A 1MBMA 1DPOA 1NFXA 1QB9A 4AYYB 3SUEA 4CH8B 2VWNA 1SFQB 2FYQA 2ZWLH 4Q7XA 2ZZUH 4CREA 4MG3A 3MU1A 2QA9E 1CA8B 2B7DH 1SGPE 4BANB 2Q6FA 2HWLB 4CRAA 4K8BA 3MNBA 1C5PA 2G4UA 1EASA 1G3DA 1O2MA 2C8YB 3PTBA 3SJ8A 3BG4C 1E36B 3Q3YA 1O2KA 2TGTA 3HKIB 1EAWA 1GBDA 1FZZA 1GDNA 1BOQA 2ZU2A 4FUGA 1P9SA 1AHTH 1D3TB 1T8LA 1CT2E 1G2LA 5FXLA 1GVZA 1VJ9U 3RXOA 1GI1A 1IQLA 4DJZB 2A45B 3UUZA 4NA9H 1M9UA 2ZGJA 3A8CA 5L2ZH 4K8YA 3A82A 4GPGA 2V6NA 4BAMB 1P2OA 4LZ4B 1C1PA 1GHYH 1RXPA 2KAIB 2OC0A 1DM4B 4MDSA 1YM0A 4I7YH 1JWTA 3S9AA 4HFPB 4I8KA 2A1DB 1C2LA 2JETC 1BT7A 4WXVA 2Y7XA 1WU1A 1YPJH 1V2KT 2AGEX 2QCYA 1JIRA 3PM3A 2BDHA 4Y6DA 1O3GA 1A5GH 1E0FD 1TNGA 5LPFA 2Y5GA 4DOQA 1GI7B 3EYDA 1G9IE 4Y8ZA 4NIYA 1Y3WA 1FY4A 1GCDA 3MU5A 1WTGH 1W13U 2V0BA 5IYTA 2AS9A 1HV7A 1THSH 1LVBA 1ZMLA 7KMEH 1GBAA 1RD3B 4Y11E 2WPKS 5LPEA 3R3GB 2VIDA 2ZIQH 3DUXH 5AHGH 4AORA 5CHAB 3ZVCA 1ZPCA 1O3IA 2PWXA 4MPUA 2F9UA 3E8LA 3ZZ9A 2XC4A 3LGYA 3VB7A 4MQAA 1PQ5A 3LONA 3B9FH 1TQ7B 4O3TA 5JBBS 3SN8A 2BVXH 3TK9A 3S9BA 1O32A 2O8LA 4ZKOU 1K2I1 2VGCC 2HOBA 2P8OB 3KEEA 1AMHA 1W11U 8GCHF 3SU0A 2A2XH 1PPGE 2NU0E 1OXGA 2FS9A 2GD4B 1EAIA 2ZU3A 2FLRH 2GGVB 1DS2E 2BLOA 1MKXH 5ESTE 5EQQA 1V2ST 1GGDC 3U8RH 1MTUA 1ZPZA 1O5BB 4IN2A 4KTUA 2R3YA 3S69A 1W3CA 2EEKA 2PSXA 1QRZA 2FODA 2A5IA 2WV4A 1HAHH 1VITH 2FIRH 3VB3A 3U9AH 1J9CH 5A0CA 1BTZA 1AWHB 4TYDA 3OTJE 3A83A 2QXIA 3QZQA 1W14U 4OGXA 1FPCH 3UOUA 1DXWA 4A6LA 4KP0A 3VB4A 1C5XB 2P3UB 4NFFA 3SOSA 2A4RA 4INLA 1C4U2 1BMAA 2RA3A 1ORFA 5AVDA 5E0JA 3STIA 2QYIA 3ZZCA 2CV3A 4MPWA 1OYQA 1A5HA 4XE4A 4IC6A
chains in the Genus database with same CATH superfamily
3MU8A 3AASA 1DSTA 3SU2A 3PMBB 4K1SA 1QZ8A 1TALA 2CMYA 4WH8A 2BYAX 1AVWA 1E37B 3VG8A 3P95A 3ATKA 1ELBA 3RXTA 1UCYH 3V3MA 2CN0H 2J95A 1G36A 3SNEA 4D8NA 5EJ1A 2ZDNA 1C5MD 1NFYA 2G5NA 2ZO3H 1BA8B 3QTOH 4WY3A 1G32B 2L6OA 1K22H 3BTDE 2B9LA 1QJ6B 2SGPE 1HCGA 1RTKA 4JYTA 3N7EA 1MD7A 1K1PA 5DKMA 4B6FA 1O0DH 1D6WA 3DHKH 5EQSA 2ZDVH 2GZ8A 1KYNA 2PV9B 2AFQB 4B1TA 1CO7E 1O2VA 1OKXA 2VIWA 2WPHS 2W26A 1WTHD 3A8DA 3FOAA 5FPTA 1G3EA 3RUOA 1SI5H 1BMLA 1COWD 1LHGH 5T6FA 1ANEA 2C8WB 3PWCA 1BQYA 1O3BA 1EZQA 2ZCLP 3KCGH 1SGIB 2BD3A 1AUTC 1WAYB 1SGQE 2NU1E 4P00A 3TNSA 3PRBA 3P8GA 1FY1A 3ESTA 2ZDKA 3U8TH 1O2XA 1VJAU 5F53A 5CHBA 1IQHA 2BXUH 4YM9A 2FEQH 3R0FA 5TJXA 2A0QB 1W7XH 1B7XB 2SGAA 2GDEH 3LH1A 1BIOA 5CHAC 1GJ6A 2J2UA 1GI8B 3G01A 1IQJA 1ABJH 1DWDH 1BTWA 4NGAH 3TGKE 1J14A 2BB4A 4Q4LA 1KDQA 4H6TA 1SSXA 3M5LA 2R3UA 1O2IA 1AIXH 5EXLA 4A5TS 1GHAF 3S7HB 4UFDH 4NWKA 2SGFE 1AWFH 1ETRH 1PJPA 4J2YB 1ZYOA 5AF9H 2A7JA 3P8FA 3UFAA 2DUCA 1OOKB 2CHAB 4DGJA 2G4TA 1VZQH 3N99A 5HMAA 4D7GA 2ZTYA 4ZKSU 3MH5A 1GMDF 1ESBA 1AE5A 1WQVH 2J38A 2FI3E 1ZHMA 3DSOA 4KELA 4X8TH 5FL7D 4CRDA 1OHHD 1WOFA 4IN1A 3GY6A 5TCCA 1NBME 2V3MA 4UFGH 1OPHB 2VVUA 1AI8H 5EG4A 2BD7A 3GCTF 1PYTD 4BOHA 1MD8A 4Y79A 3RXJA 2KM0A 1NRNH 2BD4A 3PO1C 4ISOA 1ZTLA 1QBVH 1O5AB 1YPHE 3LGUA 1SLWB 1UVSH 2FI4E 4U01A 2FOGA 3DSPA 1KXDA 2WPMS 3EDXB 3TJUA 2ZFSA 1TWXB 2PW8H 2WHXA 5BRRE 1HXEH 3GY7A 3RXGA 4BNRA 2SGEE 4RKJB 1KLJH 1GBFA 2BOHB 1DFPA 1TMTH 1HB0B 2ZQ2A 1O3PB 5DSFA 3SZEA 1MKXK 1GJCB 1SGFA 3ZZ5A 3IG6B 1P2MA 5FAHA 2BD9A 5HM9A 3P8OA 2ANKH 5GDSH 3EQ0H 3PV4A 4TY6A 1ACBE 2AIQA 1C1MA 1ELDE 3UQOA 4UDWH 3IWMA 3ODDA 3OEHD 2A4GA 2P59A 3SUFA 1EP6A 1C2IA 2EA3A 1YPEH 1TA2A 4JCNA 1PPFE 1BRBE 4AYVB 2XW9A 3F9GA 1OWJA 5F03A 3NK8A 1EPTA 4FVBA 2GT8A 3OE7D 7ESTE 3KYGA 2RDLA 5SGAE 1NESE 2GKVE 3RP2A 2NWNA 5C0UA 3ZIAD 2I6QA 1EP5A 1CHGA 3BIUH 3MWIU 2VH6A 1Z6JH 4WF8A 1TMBH 5HM2A 2VWOA 2WYGA 1SPJA 5GWZA 2EI7A 4K69A 1W0YH 5DPAA 3ZZAA 3BF6H 2BM2A 1CHOF 3N7DA 1UCYE 1A61H 1ELGA 2JH6D 4D9QA 1GMCF 2KR7A 4DIHH 4IS5A 5C0TA 1LQDB 3SNAA 1DWBH 4Q7ZA 3DD2H 2IOTA 2ZHEH 4DIIH 8ESTE 3NKKA 2CHAC 1S0RA 2FOAA 2ALVA 1UTNA 5A2MH 2ZTZA 2YMSB 3SGBE 3WW7A 5C94A 1TRYA 1GMHG 1DUEA 1QB1A 1PFXC 3B8JA 5FBIA 4DG4A 2V3OH 1WQSA 1FDPA 3NWUA 1BUIA 1L1NA 4ZHMU 1GMDG 3QK1A 4XD7D 3ATIA 8KME2 4AFZA 1AN1E 1MBQA 5I46H 2V3HH 4D76A 3RXKA 3LGWA 6LPRA 2ANMH 1YF4A 2BVRH 1RIWC 2BD5A 4CHAB 1C9TA 1P04A 3BTQE 4M9FA 3GCHC 2UWLA 1N1LA 1EOJA 2BQWB 4NIVA 2ZPRA 1MTSA 3ZVEA 4B2CA 3ZZDA 1V2MT 1C1NA 1ZSKA 3H09A 3H7TA 1GBBA 3RMOH 1S81A 1V6DA 4GHTA 4ABBA 2BY6X 4NCYA 1TGCA 4IMQA 1P11E 1PQAA 2A31A 2AH4X 2RA0A 3MOCA 2M5TA 4ISNA 5EJLA 1WXRA 1UW7A 2P95A 2AMQA 3NXPA 3WY8A 3TITA 4D7FA 1O3DA 2Z6BD 1T8OA 1IAUA 2QE7D 5FPSA 2F9OA 2GZ9A 5KEDA 1C1TA 2OINA 3HATH 2BDBA 1P02A 4K2YA 4B6EA 1E38B 5HXFA 1AZZA 1SGFG 1IOEA 2ZFFH 3BEIB 2K1QA 1YY3A 3LDXH 1C5WB 2HPQH 1PPZA 4IGDA 2F9VA 2O8WA 4H6SB 2AEIH 2UUYA 3F2FA 2SFAA 2Z9JA 1BMFD 1J16A 2ZGXH 3A84A 2H5DA 4E06H 1GBLA 1TGTA 1Y3XA 4NG9H 1GI3A 1AB9B 2XYAA 4GHQA 3S7KB 4BTTB 3S0NA 3VFEA 3OEED 1JRTA 2GMTC 1EXFA 2XTTB 1QL7A 2JDID 3ODFA 3L33A 2Y7ZA 2STBE 1SGDE 3V13A 1KMHB 1ZGVA 3Q3KA 2KAIA 1O34A 1VCQA 4X1SU 1C5RA 2STAE 2BY7X 1TX6A 1Z1JA 1AKSB 1SHHB 3P6ZB 2WSSD 1V2VT 1D3QB 4MNYA 2IPQX 1P2KA 1HAZB 2A4OA 1GHXH 2ZQ1A 3UNSA 1Q31A 1SGTA 3K2UA 2C8XB 1P8VC 4XBCA 5B6OA 1TONA 3PMHB 1QRXA 4B2AA 1OYTH 4FUBA 1MMJN 1SQAA 4B73A 2YMSC 1KXEA 6GCHG 5J4QA 1P3CA 4FOUC 3LGTA 3RDZA 4O9VA 3LKWA 4TY7A 1P2IA 5H4IB 2YOLA 1UTOA 2WUCA 2G51A 3GY3A 1ARBA 3DFJA 3RXQA 3TGJE 1AVGH 1IHTH 4AFSA 3SJOA 4FUDA 1GBHA 1TB6H 2ZF0H 4FU7A 3BIVH 5GCHG 2ZU4A 1BTUA 3SGAE 3PMJA 4X8VH 5A09A 1AGJA 3SUDA 3M36A 2OD3B 1MZDA 2ZGCA 2J34A 5A8ZA 2H9TH 2A5AA 1GJ4H 3OY5U 4CHAC 2Z3DA 1LPGB 4TWYA 1NZQH 1DVAH 1O2HA 3UREA 1MTNB 4OS5A 3TK5A 1GBCA 2HPPH 4ISLA 4Z0KA 1OWHA 2HLCA 4IMZA 5AFYH 5BPEA 1A46H 1DWEH 2BDIA 2R9PA 4RKOB 1NRPH 2R0KA 1DLEA 2XRCA 3GY5A 4MNXA 3P70B 2YNAA 3ZVBA 1DY9A 1GJDB 2PGQB 1VITG 1D4PB 3SJ9A 4NA8A 3ATLA 2SGQE 4B2BA 1NN6A 4HGCA 2ZFTA 3HPTB 5A0BA 5DP5A 1N6XA 1GI5A 2OBQA 3VEQB 1QFKH 1EZUC 1IQIA 2J98B 2ILNA 2BHGA 4AN7A 3E16B 4JK5A 2W6JD 1EPTC 4Z6AH 1O33A 1ID5H 7LPRA 2FOHA 1TRMA 1O3JA 3EE7A 1ZTKA 1C1RA 1V2WT 3RMNH 1RS0A 2PKAB 4X6PA 4I32A 8LPRA 3D49H 2VIVA 5C67A 4F49A 1FIZA 3RXHA 1OWIA 3UY9A 5T6DA 1HUTH 1TA6A 1GWAA 3PV2A 1AB9C 4AFQA 4JK6A 4ZKNU 1Z1IA 4BXWA 1CGIE 2FP7B 3E0NB 1BTHH 1GL1A 1ZPBA 2OCVB 3GCOA 3LGIA 2Y81A 1F5RA 4YOIA 1QJ7B 2OXSA 3MU4A 1YPHC 3BEUA 1UVPA 4Y0ZE 4X6NA 1OS8A 4JZEH 2KZ4A 4X2VA 1O5GH 3F2GA 3ZVAA 1IQMA 2HVXA 2QGRA 3QWCH 4A7IB 1C1VH 1SLXB 3A7YA 2CGAA 4I8LA 3U98H 2IPHA 1HDTH 3E1XB 1ESAA 1JOUB 4B76A 2BZ6H 1PPBH 5JYIA 4ZHAA 1RGQA 4CR5A 5G4BA 1QL9A 1FJSA 1GI9B 4OS6A 2VBCA 1N6YA 1NY22 2VIOA 1AUJA 3M35A 2GVFA 4RN6A 1TGSZ 3ATWA 5GPIB 1P2JA 2PTCE 1WV7H 3HGNA 2AMDA 4A1TA 3MNCA 5C1XA 1ABIH 1C1SA 5T3HA 4LZ1H 1HRTH 2W3IA 4X2WA 4X8SH 2AHME 2ZNKH 1C5LH 2BY9X 2ZFRH 1NC6A 1TOMH 1HPGA 4Z1MD 3FP8E 2ZECA 2ZGHA 4YTAA 5C1UA 1EJMA 2Q1JA 4B75A 5DP4A 5C3NA 3SW2B 3RXLA 1MQ6A 1SOTA 4ZH8A 2L74A 4X1QU 1ARCA 2FOMB 4E7NA 2ESTE 4OS1A 1HJ9A 5FCRA 3TGIE 4U30A 1T8MA 3HK3B 3F2HA 4OS2A 2AIPA 1Y3YA 4KTCA 3RXMA 5JB8S 2B0FA 3ZZ7A 3Q76A 1O30A 1BHXF 4M7GA 3UWIA 1PPCE 4MPVA 3OAAD 4AG1A 1DITH 3NZIA 1LHEH 2Z7FE 3A85A 2ZDLA 4TWWA 2EI6A 5EGMA 3MYWA 1TX7A 3VXFH 1BBRK 1OX1A 3D65E 3CP7A 1OWKA 3F68H 3KIDU 3SV2H 3DFLA 1G2MA 5CE1A 2PFEA 2XCFA 4JYUH 4TSFD 4ABGA 1DY8A 2QAAA 5JBCS 1BZXE 2OTVA 2W5EA 3TNTA 3SU5A 5EXMA 2WV5A 1EAUA 1RRKA 3UR9A 3NPSA 4Y7AA 1GJ9B 1O2LA 2Q6GA 2P16A 2Z9KA 3A86A 4R0IA 2ZHDA 1NPMA 1GG6B 1C2EA 3M7UA 1PPHE 2QC2A 4ESTE 2BOKA 2XXLA 5F8ZA 5HIZA 4B74A 2W7UA 2BLQA 1TNIA 1JMOH 3RXDA 4ABJA 4WWYA 3PB1E 1H8ED 2P94A 3Q00A 1GBIA 2TRMA 4MTBA 1TBRH 9ESTA 2JH5D 3MO9A 4I8HA 4RI0A 1K1LA 1YC0A 2EC9H 2FESH 4AG2A 1ELVA 2FTMA 5E2PA 4WVPE 3A89A 3KL6A 3BTGE 1EATA 2BDGA 4XBDA 1SL3A 1SOZA 3SV9A 2IJD1 3UWJH 1EOLA 1B5GH 2OC1A 4OS7A 3QDZB 4OS4A 1KLIH 3SJKA 3KN2A 2FS8A 2NU3E 2F43B 4I8GA 5HGGA 3TJVA 4ZKRU 1HAPH 2AMPA 3K6ZA 4ZUHA 2A7HA 3SU1A 1J15A 1H1BA 1J8AA 2ZPSA 1ZJKA 4ZHLU 1GMHF 3RXRA 3BTFE 1WBGB 1NT1A 2P8OC 4R8TB 3T28A 4J1YA 1VCWA 2ZHWH 4FUFA 4INHA 4CR9A 3W1EA 2WPIS 2JIZD 4GSOA 2HNTC 1H4WA 4NZQA 5ESBA 2FX4A 1ELCA 4U32A 5L30H 5JPMH 2JJ2D 3ATMA 4P02A 3I78A 2TPIZ 1LVOA 2ZU5A 1WCZA 2O8UA 3M3SA 3URDA 1IQNA 2Z9GA 4YT7H 1BTPA 3L3TA 2PSYA 4YOGA 4BAHB 2ZFPH 1QY6A 2ZTXA 3BTME 1CBWB 1KTTB 1YPLH 3FO8D 4X0WU 1K0HA 1SLUB 4VGCB 3JZ2B 1L4ZA 1Z6EA 3SHCH 3ELAH 5HIYA 4A1XA 2D8WA 4BAKB 5LGOA 1AZ8A 1G30B 2GV6A 3F9HA 1KXCA 3FVFB 1HAIH 1HAOH 1TNHA 4A92A 1BCUH 1LMWB 1ZHPA 2WZQA 3M5MA 1UTPA 4DW2U 1IHSH 4FUEA 5E0GA 3SZNA 2GCTB 4UE7H 3BEFB 3FP7E 4H4FA 1V2JT 1GHBG 2LELA 3F1SB 5F8XA 1ZLRA 4GAWA 3U8OH 5GXPA 1SFIA 1CVWH 1VCPA 2FOFA 3SU3A 4QT8C 3OYPA 4F55A 3QZRA 5HKKD 2PHBA 1EQ9A 3AVZA 1F2SE 2PR3A 1UMAH 1E1QD 2QY0B 4BTUB 3RXCA 1F92A 4AX9H 2H6MA 2OC8A 1O2GH 3TJOA 5C2ZA 3MO6A 2VU8E 2YNBA 2J4IA 1GG6C 1O3EA 3DA9B 1TE0A 3SGQE 2TBSA 1GI2A 3HGPA 2NU4E 4UONA 2RFKC 4DT7B 1HJAB 2BD2A 3BSQA 1V2PT 2BMGB 3ENSB 3E0PB 2AYWA 1CGHA 1SKYE 3ZV8A 5A8XA 3VB6A 3SHAH 1ELEE 4MPXA 1D3DB 1LO6A 3A7ZA 2TGDA 2VWMA 1NFUA 2FZZA 1ZOMA 2RCEA 1HFDA 4MLFB 4A1VA 1G3CA 3A8BA 3PMAB 4ZROA 3K65B 2GV7A 2QF0A 5EXNA 1OP2A 5GJ4B 1O35A 1GJ5H 1T4VH 5C1YA 3T27A 1O2NA 3MHWU 3RU4E 3OSYA 1BMNH 1Z8GA 5C5OA 2G00A 3SNCA 1MKWK 1YBWA 1F5KU 3RXEA 1DUAA 5FCKA 3MTYA 1S85A 4K1EA 1ZMJA 4X2YA 1AKSA 3W95A 3TH3H 6GCHF 1FAXA 2ZI2H 3A81A 2A7CA 1YPMH 2ZDAH 4CBOA 2F4LA 1A3BH 1XUFA 2ZHQH 1GDUA 1O5DH 4TPYA 1EB2A 1L1GA 1ZSJA 2VNTA 4O3UA 1Y5BT 1MUEB 2XCNA 4YESB 3VGCB 1K1NA 2PUQH 3BN9A 2BD8A 2PP6A 2PKSB 3MNXA 4Y76A 2KX4A 2VJ1A 3JZ1B 6ESTA 4IC6A 5GCHF 1MCTA 2GX4A 2SNVA 4E7RG 3V0XA 2A32A 3QX5H 1B0FA 3L6PA 1GI0A 2Q6DA 1JIMA 2LNCA 1D3PB 2ODQA 1E34B 2ASUB 3LJOA 2IN2A 2UUJB 2AGIX 1L0ZA 1QA0A 1AFQB 5CMXH 1IQEA 3BTTE 5EU8A 1LHCH 4NWLA 5E2OA 4KGAA 7GCHF 1H8IH 1P3EA 2V7QD 1OP0A 2D2DA 2BY8X 1VITF 1GBKA 3C27B 5LPRA 1E35B 1S82A 1GHVH 2Z94A 3T2NA 4WMFA 1T31A 1NBMD 2GDDA 2GTBA 1RTLA 2EQNA 3TJNA 1O2WA 2LP6A 3AK5A 3KHVA 1SGRE 1NS3A 2K8IA 2PTNA 3BV9B 6CHAB 1CGJE 1LVMA 1C5NH 1L1JA 1SHYA 1PQ7A 2RG3A 2XBVA 3PLKA 5LH8A 4CH2B 1XKBC 4LXBH 1CE5A 2F9NA 3ZV9A 3RU4T 2D1JA 4MNWA 1T8NA 2BQ6B 3AAVA 2FYRA 1O2YA 4ASHA 2FLBH 1A0HB 1H9LB 1THRH 3NUMA 1J17T 4SGBE 1H8DH 4OGYA 1GDQA 4GCHF 4X2XA 1HIAB 2VVCA 2UUKB 1A5IA 1DICA 1O2RA 2J98A 3E3TA 1AE8H 4ABDA 1TQ0B 1NRSH 1T7CA 4DCDA 1V2LT 1NU9A 1O2UA 2HNTE 2DE8A 2W7SA 1YLNA 2WPDD 1PYTC 1XXFA 1ZJDA 1NU7B 2BLWA 2PLXA 4Y0YE 3T62A 4AOQA 5EJZA 3MQKC 1U6QA 1LCYA 1SB1H 1XUIA 3M3VA 3MI4A 1UK4A 2PKAA 1Y5UT 3UNRA 3MO3A 4ZMAH 5I25A 2PUXB 1TPOA 2BY5X 5FPYA 2ULLA 3RMLH 1MQ5A 2H1UA 1THPB 2XWBI 1ETSH 2CK3D 1FX0B 2ZA5A 1ETTH 2FOBA 5EW1H 1C1WH 3K9XB 1SQTA 2TIOA 1QNJA 1C1QA 2KCAA 1CA0B 2ZPQA 5B6LA 4AGJA 5JBTA 4E05H 1GI4A 5A0AE 3I29A 1O2ZA 2WYJA 1N8OB 1W0KD 1RFNA 1K1IA 2BX3A 2FTLE 1O38A 4UD9H 1QQ4A 1O3FA 3P17H 1TFXA 3TH2H 1ZGIA 3MU0A 3U28C 1O3NA 4AC9A 1HAGE 4X8UH 1V2OT 2K0QA 1A7SA 5DP6A 2BXTH 1FY5A 3KQEA 2BVSH 1FONA 1Z8IB 3QLPH 4I31A 2QXGA 2FO9A 5AFZH 3RMMH 3VXEH 4B71A 1YPGH 3M37A 3LGVA 1F0RA 5TCAA 1DXPA 1BBRH 1YPKH 5L6NH 3SV7A 4K3JA 4Q2KA 1QL8A 2JJ1D 3A7VA 1GBTA 1ANBA 3SNDA 1XXDA 1XVMA 1Y3VA 5EQRA 5IK2D 2H9HA 1BB0B 3RXSA 1O2QA 1CQQA 1S6HA 3LH3A 1QB6A 4NZLA 4AZ2B 7GCHG 4Y71A 2HNTF 1HAVB 2J97A 1O3MA 4ZXYH 4WXIA 1EB1H 5DN6D 3P92A 3QGNB 1CT0E 1A3EH 1ZRBA 4TPIZ 5CDFE 4K1TA 2FXRA 1GGDB 1DWCH 1TGNA 1O5EH 3O8BA 3GDVA 4X6MA 1NO9H 1G37A 1W7GH 3PLPA 5DK1A 1MU8B 4CRCA 1BTXA 3CS0A 4NSYA 2G8TA 1O37A 1CU1A 1BJVA 3SBKA 1V2NT 3ZVDA 1FQ3A 1Q2WA 3DT0H 1LHFH 1OWDA 2R0LA 4XBBA 5JDUB 1LQEA 2V35A 4ABAA 5GIBA 1FY3A 1V2QT 2XBYA 1GJBB 1KLTA 3KNXA 5EW2H 2F83A 3TIUA 1UJ1A 2GCHG 1F0UA 1V2RT 4GCHG 2C90B 1MZAA 3A8AA 2RDEA 1KIGH 1EZXC 4YO9A 1O3KA 4H42U 3LC3A 4X1PU 2G5VA 2BLVA 3MH6A 1AQ7A 3U1JB 3SQHE 4ISIH 1TX8A 5ABWA 1XVOA 5FBEA 1K1MA 1ZTJA 3RLWH 1GCTB 5K0HA 1GBEA 1AY6H 2ZDMA 1DOJA 1EKBB 5J4SA 1CA0C 1NTPA 1P12E 5DO4H 1TBQH 1L2EA 2BDCA 2VINA 2VIQA 3SORA 4Y8XA 1O3LA 2D26C 3E90B 3WWFA 4Y7BA 4WJG2 3Q77A 1N8OC 2H2ZA 4THNH 1NRQH 3H7OA 1B0EA 4FUCA 4XFQA 4LOYH 5DGJA 1QQUA 1KSNA 2J9NA 1TIOA 1DT2A 4K5ZA 4FU9A 1MH0A 3SU4A 3TH4H 3LT3A 4INKA 4NFEA 2OLGA 4BTIB 1GVKB 1C5UA 4FVDA 4AB9A 4HI3A 2JH0D 2THFB 1V2UT 3TVJB 4XOJA 4GLYA 1VR1H 1TPSA 2Y80A 1GVLA 4BXSA 2J92A 3O8RA 1DSUA 3HK6B 1UVOA 4YZUA 2IJOB 2QF3A 4UFEH 2J5UA 1F0TA 3SO3A 1Z8RA 3SI3H 2C3SA 1IQFA 1YCPH 2AERH 5DG6A 3PV5A 1C1UH 1UK2A 3FANA 2A5KA 1FNIA 5DP9A 3TLOA 1ELFA 3A80A 5EPNA 4AGKA 1LHDH 1O2SA 4JZ1A 2PGBB 3D62A 3KQCA 1UHBB 3F9EA 1MTNC 1F5LA 1ZR0A 2VIPA 1SR5C 1GBMA 1E79D 1LKAA 1HAYB 3BTKE 2G81E 1GJ8B 2XWAA 2OQUA 1C5ZB 1HGTH 3M7QA 1YGCH 1XMNB 1QGFA 2P3TB 5FHTA 3OU0A 2EI8A 1FXYA 1S0QA 2ZCHP 4OM9A 4ISHH 3PLBA 1C5VA 1TBZH 1LTOA 2ANYA 2QF5A 3SUGA 1C2DA 4I8JA 1QBOA 1AO5A 1MU6B 1F7ZA 1HLTH 4O97A 1UTJA 4XSKU 1XM1A 5C17A 4ACBA 2ZC9H 3RC5A 1GHBF 3FZZA 3PO1B 1C5YB 3GYLB 5F8TA 1YP9A 2BX4A 1SC8U 3V7TA 2FPZA 1V3XA 4IC5A 2O9QA 1ZHRA 1TMUH 2ZP0H 1FPHH 2WPLS 2ZU1A 2GT7A 1BBRE 2J94A 4Y8YA 2Y5HA 2ALPA 2OBOA 1GBJA 1OSSA 3UIRA 2QF4A 5PTPA 2UWOA 1O3OA 1BRUP 1QURH 1MKWH 1UTLM 1UK3A 2BQ7B 2ZKSA 5K7RA 3M5OA 1S6LA 1ZMNA 3UB0A 3F0OA 1ZRKA 1QBNA 1C2MA 2KCOA 3SV8A 2CF9H 3SQEE 1GJAB 3AW1A 2BTCE 1W10U 2UUFB 2NU2E 1DDJA 2VWLA 5ETXA 2CJIA 3PYHA 4FXGH 4AB8A 2G55A 4LK4A 4Q7YA 2R2WU 1KXAA 2FMJA 1GCTC 2AGGX 1BJUA 1BMMH 1C4Y2 1EUFA 2TGPZ 4ABFA 4ABEA 1AVXA 4DURA 2ZHFH 9LPRA 2FOEA 2QXHA 1BRCE 3FP6E 2F91A 1TABE 1S6FA 1C2JA 1O2JA 2Z9LA 1ZSLA 4HG6A 5C20A 1P01A 3EAJA 1HAXB 5KGOA 4HTCH 2Y5FA 4ZXXH 2VB0A 1WSSH 1JBUH 2ODYB 3QGJA 2DE9A 3VPKA 3BTEE 4FU8A 3SNBA 2WPJS 1D9IA 4MNVA 1XKAC 1GHWH 3OY6U 3KF2A 2SGDE 1BDAA 1A0LA 1CT4E 3FFGA 3SI4H 1SQOA 1UTQA 3QUMP 3UPEA 3IITA 1P06A 1QRWA 1TNLA 1XUKA 1YKTA 3FZDA 1ELAA 1YLCA 2VVVA 3PTNA 1IQGA 3BG8A 2WINI 3M3TA 1OP8A 1Y3UA 1PPEE 3RXFA 3O8DA 1KTSB 1LDTT 3LOXA 2W6ID 1A2CH 1SQRA 2XBWA 1DE7H 1Y5AT 3P8NA 4CRBA 1H9IE 8GCHG 5FX5A 3GICB 4DY7B 1C9PA 3MFJA 1X7AC 1P57B 1JXPA 3F9FA 2ZCKP 2BDAA 3AAUA 3HKJB 3Q3XA 5EOKA 1C2GA 2B8OH 1AD8H 1UO6A 3RM2H 3GDSA 1BHXB 3GDUA 4JZDH 4O03A 3T5FH 1GL0E 1O2PA 3RLYH 4JZIA 1YCPK 3VB5A 1XX9A 1YCPM 3FAOA 1RIWB 3RC4A 3SV6A 1O2OA 2QV1A 1P03A 3GCHB 4XRNA 1XUHA 3H5CB 3KQDA 3ZVGA 1FLEE 2C93B 2F9PA 1YYY1 5EODA 4FUHA 3WWBA 4F4OC 5DP8A 4BAQB 3RXVA 1QA7A 1P9UA 4UEHH 5T1VA 1TLDA 4HZHA 1MCVA 1FUJA 1SGNE 1ZZZA 2UWPA 3SU6A 2C8ZB 1OWEA 3CS7A 2OQ5A 2SNWA 3K6YA 4K60A 5DJ7A 1SMFE 1ELTA 3MH4A 2QIQA 4ABIA 1Q3XA 2F3CE 3KQ5A 1BITA 3ZZ4A 2P3FH 4NA7A 3A87A 3EA9A 3D23A 1WUNH 1W0ZU 1AFEH 2YMSD 2TGAA 4FUIA 1HIAA 2WUBA 1H9HE 5DP7A 1FN8A 1GJ7B 2KFWA 3BTHE 3SYJA 3KQBA 1UVTH 1A0JA 4PROA 1DX5M 4JMYA 1UVUH 1NRRH 3O8CA 5FX6A 1IQKA 5IDKA 3OX7U 1YLDA 3I77A 3QO6A 1T4UH 3S9CA 1E1RD 1P05A 1TAWA 2W3KA 2XOKD 1SVPA 5F6MA 2GMTB 1SG8B 3SJIA 3E6PH 1C5OH 1SBWA 3EE0B 3RM0H 3GY4A 1QJ1B 2VH0A 1XUJA 4FETA 3UNQA 1KDQB 1UCYK 1KY9A 4YLUA 1DANH 1K28D 1P09A 2FX6A 2XBXA 4U2WA 2FWWA 1Z71A 1C5SA 1SGEE 2ZEBA 1EJNA 2H5CA 3A7XA 1F0SA 1Y8TA 4I33A 1K1OA 2F9BH 2XNIA 5GNDA 1P2QA 3NCLA 1EJAA 2R2MB 4MVNA 3ZZ3A 1TNKA 1HNEE 1P0SH 1C5QA 3UQVA 4TT3D 1TGBA 1C2HA 1EAXA 1TOCB 1VGCB 3U1IB 1GHAG 1NFWA 2OC7A 3A7WA 3F6UH 4YOJA 1CBWC 1P10A 3QN7A 1LPKB 4VGCC 3EA7A 1MTVA 1QCPA 1WYKA 1NM6A 5A8YA 1SGCA 2XC0A 1LKBA 3TK6A 4CBNA 1L4DA 1QIXB 1S5SA 1AU8A 1HYLA 1JRSA 1O5FH 2JKHA 3FN8A 3FKSD 1SLVB 1K9OE 3LC5A 3MH7A 1TRNA 4X1NU 1T32A 2G52A 1QHRB 1MAXA 3PRDA 1K1JA 1Z8JB 4FUJA 4KTSA 5C5NA 1QTFA 4Y10E 1S84A 1W0JD 3MMGA 4I86A 4CRFA 2GCTC 4DT4A 1FN6A 3GCTG 1FY8E 4NSVA 3U69H 1HAVA 4GUXA 1UTKA 2WV9A 3A7TA 4GVUA 4XDEA 3GY2A 3A88A 2Z9IA 4NIWA 5EPYA 5JBAS 4ZAEA 1EZSC 3ZYDA 1BRAA 2B5TB 3ZZBA 2CF8H 2Z3CA 1O3AA 2QXJA 2FM2A 3RXBA 2O8MA 1O5CB 2HALA 1O36A 1G3BA 5L2YH 2ZFQH 1QR3E 4UFFH 2GCHF 1FI8A 4D9RA 3F0PA 3RXUA 4X1RU 1A4WH 2A2QH 2FOCA 1ESTA 1KXBA 1P2NA 3GOVB 3BG4B 1HJAC 3KGPA 5HYOA 5E8EH 4IW4E 3CENA 1WDIA 3N7OA 2BDYA 2XNDD 4YLQH 3ZZ6A 1O3CA 1A1RA 4AFUA 4BAOB 2O8TA 3TPIZ 2LPRA 1BTYA 1XUGA 3E91A 3STJA 3UOPA 2XC5A 1RJXB 1C4V2 1TYNA 1EPTB 3GYMA 1GI6A 1O31A 4WMEA 2ANWA 1MAYA 3PWBA 1FMGA 3GY8A 3GISB 2QN5T 3W94A 1TPPA 3RXAA 3UR6A 3ZVFA 1W2KH 1O39A 3T26A 1INCA 4WH6A 3ZYEA 3GCNA 2ODPA 4JZFH 1K21H 2Z3EA 1UTMA 2P93A 3MNSA 5JB9S 2Y82A 2HGTH 3OFND 1HXFH 2OUAA 1GHZA 1D6RA 2JETB 1FAKH 1HBTH 4WMDA 1Z7KA 1TNJA 1NROH 4YT6H 2OP9A 2HVYB 1LPZB 1SGYE 3EGKH 2BZAA 3EA8A 3LJJA 3LPRA 1O3HA 3B23B 4Q80A 1EX3A 1W12U 5DP3A 3AW0A 3VGCC 3OTPA 5T6GA 2A4QA 5E0HA 3T29A 1KXFA 2PKSC 1RTFB 2CXVA 3M7TA 3RU4D 1V2TT 3RXIA 1Y59T 4X6OA 2ZG0H 3C1KA 1C2KA 1C5TA 1W8BH 3ITIA 3URCA 3M61U 1CHOG 3UTUH 2M2AA 1VGCC 3LIWA 1GMCG 4CRGA 1AFQC 2I6SA 2Y6TA 4RSPA 1C2FA 4IBLH 3TU7H 4NIXA 4RT1A 3PROA 1HJ8A 2OK5A 3QTVH 2C4FH 2FDAA 1PQ8A 1O2TA 4SGAE 1C1OA 3ZZ8A 3V12A 1CSOE 2VGCB 4DVAU 3T25A 2ZGBH 4JYVH 3RXPA 1LVYA 2GZ7A 3M5NA 1UHBA 2FI5E 1MTWA 3RC6A 1FIWA 4KKDA 1ANCA 1S83A 1ANDA 3LU9B 3BTWE 6CHAC 2H9EH 1GPZA 2GP9B 1TPAE 2HRVA 1DLKB 4ABHA 1FV9A 1MBMA 1VKYA 2GJGA 1DPOA 1NFXA 1QB9A 4AYYB 3SUEA 3F3BA 4CH8B 2VWNA 1SFQB 2FYQA 2ZWLH 4Q7XA 2ZZUH 4CREA 4MG3A 3MU1A 2EY4C 2QA9E 1CA8B 2B7DH 1SGPE 4BANB 2Q6FA 2HWLB 4CRAA 4K8BA 3MNBA 1C5PA 2G4UA 1EASA 3DCLA 1G3DA 1O2MA 2C8YB 3PTBA 3SJ8A 3BG4C 1E36B 3Q3YA 1O2KA 2TGTA 3HKIB 1EAWA 1GBDA 1FZZA 1GDNA 1BOQA 2HLDD 2ZU2A 4FUGA 4ACAA 1P9SA 1AHTH 1D3TB 1T8LA 1CT2E 1G2LA 4Q63A 5FXLA 1GVZA 1VJ9U 4ZCNA 3RXOA 1YWUA 1GI1A 1IQLA 4DJZB 2A45B 3UUZA 4NA9H 1M9UA 2ZGJA 3A8CA 5L2ZH 4K8YA 1MABB 3A82A 4GPGA 2V6NA 4ASUD 4BAMB 1P2OA 4LZ4B 1C1PA 1GHYH 1RXPA 2KAIB 3CNRA 2OC0A 1DM4B 4MDSA 1YM0A 5KECA 1JWTA 4I7YH 3S9AA 4HFPB 4I8KA 2A1DB 1C2LA 2JETC 1BT7A 4WXVA 2Y7XA 1WU1A 1YPJH 1V2KT 2AGEX 2QCYA 1JIRA 3PM3A 2BDHA 4Y6DA 1O3GA 1A5GH 1E0FD 4YXWD 1TNGA 5LPFA 2Y5GA 4DOQA 1GI7B 3EYDA 1G9IE 4Y8ZA 4NIYA 1Y3WA 1FY4A 2KCYA 3DSGA 1GCDA 3MU5A 1WTGH 1W13U 2V0BA 5IYTA 2AS9A 1HV7A 1THSH 1LVBA 1ZMLA 7KMEH 1GBAA 1RD3B 4Y11E 2WPKS 5LPEA 3R3GB 2VIDA 2ZIQH 3DUXH 5AHGH 4AORA 5CHAB 3ZVCA 1ZPCA 1H8HD 1O3IA 2PWXA 4MPUA 4RT0A 2F9UA 3E8LA 3ZZ9A 2XC4A 3LGYA 3VB7A 4MQAA 1PQ5A 3LONA 3B9FH 1TQ7B 4O3TA 5JBBS 3SN8A 2BVXH 3TK9A 3S9BA 1O32A 2O8LA 4ZKOU 1K2I1 2VGCC 2HOBA 3NRLA 2P8OB 2KCPA 1AMHA 3KEEA 1W11U 8GCHF 5EIYA 3SU0A 2A2XH 1PPGE 2NU0E 1OXGA 3GS9A 2FS9A 2GD4B 1EAIA 2ZU3A 2FLRH 3UAIC 2GGVB 1DS2E 2BLOA 1MKXH 5ESTE 5EQQA 1V2ST 1GGDC 3KYFA 3U8RH 1MTUA 1ZPZA 1O5BB 4IN2A 4KTUA 2R3YA 3S69A 1W3CA 2EEKA 2PSXA 1QRZA 2FODA 2A5IA 2WV4A 1HAHH 1VITH 2FIRH 3VB3A 3U9AH 1J9CH 5A0CA 1BTZA 1AWHB 4TYDA 3OTJE 3A83A 2QXIA 4F48B 3QZQA 1W14U 4OGXA 1FPCH 3UOUA 1DXWA 4A6LA 4KP0A 3VB4A 1C5XB 2P3UB 4NFFA 3SOSA 2A4RA 4INLA 1C4U2 1BMAA 2RA3A 1ORFA 5AVDA 5E0JA 3STIA 2QYIA 3ZZCA 2CV3A 4MPWA 1OYQA 1A5HA 4XE4A 1EFRD
chains in the Genus database with same CATH topology
3MU8A 3AASA 1DSTA 3SU2A 3PMBB 4K1SA 1TALA 2CMYA 4WH8A 2BYAX 1AVWA 1E37B 3P95A 3ATKA 1ELBA 3RXTA 1UCYH 3V3MA 2CN0H 2J95A 1G36A 3SNEA 4D8NA 2ZDNA 1C5MD 1NFYA 2G5NA 2ZO3H 1BA8B 3QTOH 4WY3A 1G32B 1K22H 3BTDE 2B9LA 1QJ6B 2SGPE 1HCGA 1RTKA 4JYTA 5DKMA 1MD7A 1K1PA 1O0DH 1D6WA 3DHKH 5EQSA 2ZDVH 2GZ8A 1KYNA 2PV9B 2AFQB 4B1TA 1CO7E 1O2VA 1OKXA 2VIWA 2WPHS 2W26A 1WTHD 3A8DA 5FPTA 1G3EA 3RUOA 1SI5H 1BMLA 1LHGH 5T6FA 1ANEA 2C8WB 3PWCA 1BQYA 1O3BA 1EZQA 2ZCLP 3KCGH 1SGIB 2BD3A 1AUTC 1WAYB 1SGQE 2NU1E 3TNSA 3P8GA 1FY1A 3ESTA 2ZDKA 3U8TH 1O2XA 1VJAU 1IQHA 2BXUH 4YM9A 2FEQH 3R0FA 5TJXA 2A0QB 1W7XH 1B7XB 2SGAA 2GDEH 3LH1A 1BIOA 5CHAC 1GJ6A 2J2UA 1GI8B 3G01A 1IQJA 1ABJH 1DWDH 1BTWA 4NGAH 3TGKE 1J14A 2BB4A 1KDQA 4H6TA 1SSXA 3M5LA 2R3UA 1O2IA 1AIXH 5EXLA 4A5TS 1GHAF 3S7HB 4UFDH 4NWKA 2SGFE 1AWFH 1ETRH 1PJPA 4J2YB 1ZYOA 5AF9H 2A7JA 3P8FA 3UFAA 2DUCA 1OOKB 2CHAB 4DGJA 2G4TA 1VZQH 5HMAA 4D7GA 2ZTYA 4ZKSU 3MH5A 1GMDF 1ESBA 1AE5A 1WQVH 2J38A 2FI3E 1ZHMA 4KELA 4X8TH 4CRDA 1WOFA 4IN1A 3GY6A 5TCCA 4UFGH 1OPHB 2VVUA 1AI8H 5EG4A 2BD7A 3GCTF 1PYTD 4BOHA 1MD8A 4Y79A 3RXJA 1NRNH 2BD4A 3PO1C 4ISOA 1ZTLA 1QBVH 1O5AB 1YPHE 3LGUA 1SLWB 1UVSH 2FI4E 4U01A 2FOGA 1KXDA 2WPMS 3EDXB 3TJUA 2ZFSA 1TWXB 2PW8H 5BRRE 1HXEH 3GY7A 3RXGA 4BNRA 2SGEE 4RKJB 1KLJH 1GBFA 2BOHB 1DFPA 1TMTH 1HB0B 2ZQ2A 1O3PB 1MKXK 1GJCB 1SGFA 3ZZ5A 3IG6B 1P2MA 5FAHA 2BD9A 5HM9A 3P8OA 2ANKH 5GDSH 3EQ0H 3PV4A 4TY6A 1ACBE 2AIQA 1C1MA 1ELDE 3UQOA 4UDWH 3IWMA 3ODDA 2A4GA 2P59A 3SUFA 1EP6A 1C2IA 2EA3A 1YPEH 1TA2A 4JCNA 1PPFE 1BRBE 4AYVB 2XW9A 3F9GA 1OWJA 5F03A 3NK8A 1EPTA 4FVBA 2GT8A 7ESTE 2RDLA 5SGAE 1NESE 2GKVE 3RP2A 2NWNA 2I6QA 1EP5A 1CHGA 3BIUH 3MWIU 2VH6A 1Z6JH 4WF8A 1TMBH 5HM2A 2VWOA 2WYGA 1SPJA 5GWZA 2EI7A 4K69A 1W0YH 5DPAA 3ZZAA 3BF6H 2BM2A 1CHOF 1UCYE 1A61H 1ELGA 2JH6D 4D9QA 1GMCF 4DIHH 4IS5A 1LQDB 3SNAA 1DWBH 4Q7ZA 3DD2H 2IOTA 2ZHEH 4DIIH 8ESTE 3NKKA 2CHAC 1S0RA 2FOAA 2ALVA 1UTNA 5A2MH 2ZTZA 3SGBE 1TRYA 1GMHG 1DUEA 1QB1A 1PFXC 3B8JA 5FBIA 4DG4A 2V3OH 1WQSA 1FDPA 3NWUA 1BUIA 1L1NA 4ZHMU 1GMDG 3QK1A 3ATIA 8KME2 4AFZA 1AN1E 1MBQA 5I46H 2V3HH 4D76A 3RXKA 3LGWA 6LPRA 2ANMH 1YF4A 2BVRH 1RIWC 2BD5A 4CHAB 1C9TA 1P04A 3BTQE 3GCHC 2UWLA 1N1LA 1EOJA 2BQWB 4NIVA 2ZPRA 1MTSA 3ZVEA 4B2CA 3ZZDA 1V2MT 1C1NA 1ZSKA 3H7TA 1GBBA 3RMOH 1S81A 1V6DA 4GHTA 4ABBA 2BY6X 4NCYA 1TGCA 4IMQA 1P11E 1PQAA 2A31A 2AH4X 2RA0A 3MOCA 2M5TA 4ISNA 2P95A 2AMQA 3NXPA 3WY8A 3TITA 4D7FA 1O3DA 2Z6BD 1T8OA 1IAUA 5FPSA 2F9OA 2GZ9A 1C1TA 2OINA 3HATH 2BDBA 1P02A 4K2YA 1E38B 5HXFA 1AZZA 1SGFG 1IOEA 2ZFFH 3BEIB 2K1QA 3LDXH 1C5WB 2HPQH 1PPZA 4IGDA 2F9VA 2O8WA 4H6SB 2AEIH 2UUYA 2SFAA 2Z9JA 1J16A 2ZGXH 3A84A 2H5DA 4E06H 1GBLA 1TGTA 1Y3XA 4NG9H 1GI3A 1AB9B 2XYAA 4GHQA 3S7KB 4BTTB 3S0NA 3VFEA 1JRTA 2GMTC 1EXFA 2XTTB 1QL7A 3ODFA 3L33A 2Y7ZA 2STBE 1SGDE 3V13A 1ZGVA 3Q3KA 2KAIA 1O34A 1VCQA 4X1SU 1C5RA 2STAE 2BY7X 1TX6A 1Z1JA 1AKSB 1SHHB 3P6ZB 1V2VT 1D3QB 4MNYA 1P2KA 1HAZB 2A4OA 1GHXH 2ZQ1A 3UNSA 1Q31A 1SGTA 3K2UA 2C8XB 1P8VC 4XBCA 5B6OA 1TONA 3PMHB 1QRXA 4B2AA 1OYTH 4FUBA 1MMJN 1SQAA 4B73A 6GCHG 1KXEA 5J4QA 1P3CA 3LGTA 3RDZA 4O9VA 3LKWA 4TY7A 1P2IA 5H4IB 2YOLA 1UTOA 2WUCA 2G51A 3GY3A 1ARBA 3DFJA 3RXQA 3TGJE 1AVGH 1IHTH 4AFSA 3SJOA 4FUDA 1GBHA 1TB6H 2ZF0H 4FU7A 3BIVH 5GCHG 2ZU4A 1BTUA 3SGAE 3PMJA 4X8VH 5A09A 1AGJA 3SUDA 3M36A 2OD3B 1MZDA 2ZGCA 2J34A 5A8ZA 2H9TH 2A5AA 1GJ4H 3OY5U 4CHAC 2Z3DA 1LPGB 4TWYA 1NZQH 1DVAH 1O2HA 3UREA 1MTNB 4OS5A 3TK5A 1GBCA 2HPPH 4ISLA 4Z0KA 1OWHA 2HLCA 4IMZA 5AFYH 5BPEA 1A46H 1DWEH 2BDIA 2R9PA 4RKOB 1NRPH 2R0KA 1DLEA 2XRCA 3GY5A 4MNXA 3P70B 2YNAA 3ZVBA 1DY9A 1GJDB 2PGQB 1VITG 1D4PB 3SJ9A 4NA8A 3ATLA 2SGQE 4B2BA 1NN6A 4HGCA 2ZFTA 3HPTB 5A0BA 5DP5A 1N6XA 1GI5A 2OBQA 3VEQB 1QFKH 1EZUC 1IQIA 2ILNA 2BHGA 4AN7A 3E16B 4JK5A 1EPTC 4Z6AH 1O33A 1ID5H 7LPRA 2FOHA 1TRMA 1O3JA 1ZTKA 1C1RA 1V2WT 3RMNH 1RS0A 2PKAB 4X6PA 4I32A 8LPRA 3D49H 2VIVA 5C67A 4F49A 1FIZA 3RXHA 1OWIA 3UY9A 5T6DA 1HUTH 1TA6A 1GWAA 1AB9C 4AFQA 4JK6A 4ZKNU 1Z1IA 4BXWA 1CGIE 2FP7B 3E0NB 1BTHH 1GL1A 1ZPBA 2OCVB 3GCOA 3LGIA 2Y81A 1F5RA 4YOIA 1QJ7B 2OXSA 3MU4A 1YPHC 3BEUA 1UVPA 4Y0ZE 4X6NA 1OS8A 4JZEH 4X2VA 1O5GH 3ZVAA 1IQMA 2HVXA 2QGRA 3QWCH 4A7IB 1C1VH 1SLXB 3A7YA 2CGAA 4I8LA 3U98H 2IPHA 1HDTH 3E1XB 1ESAA 1JOUB 4B76A 2BZ6H 1PPBH 5JYIA 4ZHAA 1RGQA 4CR5A 5G4BA 1QL9A 1FJSA 1GI9B 4OS6A 1N6YA 1NY22 2VIOA 1AUJA 3M35A 2GVFA 4RN6A 1TGSZ 3ATWA 5GPIB 1P2JA 2PTCE 1WV7H 3HGNA 2AMDA 4A1TA 3MNCA 5C1XA 1ABIH 1C1SA 5T3HA 4LZ1H 1HRTH 2W3IA 4X2WA 4X8SH 2ZNKH 1C5LH 2BY9X 2ZFRH 1NC6A 1TOMH 1HPGA 3FP8E 2ZECA 2ZGHA 4YTAA 5C1UA 1EJMA 2Q1JA 4B75A 5DP4A 5C3NA 3SW2B 3RXLA 1MQ6A 1SOTA 4ZH8A 4X1QU 1ARCA 2FOMB 4E7NA 2ESTE 4OS1A 1HJ9A 5FCRA 3TGIE 4U30A 1T8MA 3HK3B 4OS2A 2AIPA 1Y3YA 4KTCA 3RXMA 5JB8S 2B0FA 3ZZ7A 3Q76A 1O30A 1BHXF 4M7GA 3UWIA 1PPCE 4MPVA 4AG1A 1DITH 3NZIA 1LHEH 2Z7FE 3A85A 2ZDLA 4TWWA 2EI6A 5EGMA 3MYWA 1TX7A 3VXFH 1BBRK 1OX1A 3D65E 3CP7A 1OWKA 3F68H 3KIDU 3SV2H 3DFLA 1G2MA 5CE1A 2PFEA 2XCFA 4JYUH 4ABGA 1DY8A 2QAAA 5JBCS 1BZXE 2OTVA 2W5EA 3TNTA 3SU5A 5EXMA 2WV5A 1EAUA 1RRKA 3UR9A 3NPSA 4Y7AA 1GJ9B 1O2LA 2Q6GA 2P16A 2Z9KA 3A86A 4R0IA 2ZHDA 1NPMA 1GG6B 1C2EA 3M7UA 1PPHE 2QC2A 4ESTE 2BOKA 2XXLA 5F8ZA 4B74A 2W7UA 2BLQA 1TNIA 1JMOH 3RXDA 4ABJA 4WWYA 3PB1E 2P94A 3Q00A 1GBIA 2TRMA 4MTBA 1TBRH 9ESTA 2JH5D 3MO9A 4I8HA 1K1LA 1YC0A 2EC9H 2FESH 4AG2A 1ELVA 2FTMA 5E2PA 4WVPE 3A89A 3KL6A 3BTGE 1EATA 2BDGA 4XBDA 1SL3A 1SOZA 3SV9A 3UWJH 1EOLA 1B5GH 2OC1A 4OS7A 3QDZB 4OS4A 1KLIH 3SJKA 3KN2A 2FS8A 2NU3E 5HGGA 4I8GA 3TJVA 4ZKRU 1HAPH 2AMPA 3K6ZA 4ZUHA 2A7HA 3SU1A 1J15A 1H1BA 1J8AA 2ZPSA 1ZJKA 4ZHLU 1GMHF 3RXRA 3BTFE 1WBGB 1NT1A 2P8OC 4R8TB 3T28A 4J1YA 1VCWA 2ZHWH 4FUFA 4INHA 4CR9A 2WPIS 4GSOA 4NZQA 2HNTC 1H4WA 5ESBA 2FX4A 1ELCA 4U32A 5L30H 5JPMH 3ATMA 3I78A 2TPIZ 1LVOA 2ZU5A 1WCZA 2O8UA 3M3SA 3URDA 1IQNA 2Z9GA 4YT7H 1BTPA 3L3TA 2PSYA 4YOGA 4BAHB 2ZFPH 1QY6A 2ZTXA 3BTME 1CBWB 1KTTB 1YPLH 4X0WU 1SLUB 4VGCB 3JZ2B 1L4ZA 1Z6EA 3SHCH 3ELAH 4A1XA 2D8WA 4BAKB 5LGOA 1AZ8A 1G30B 2GV6A 3F9HA 1KXCA 3FVFB 1HAIH 1HAOH 1TNHA 4A92A 1BCUH 1LMWB 1ZHPA 3M5MA 1UTPA 4DW2U 1IHSH 4FUEA 5E0GA 3SZNA 2GCTB 4UE7H 3BEFB 3FP7E 4H4FA 1V2JT 1GHBG 3F1SB 5F8XA 1ZLRA 4GAWA 3U8OH 5GXPA 1SFIA 1CVWH 1VCPA 2FOFA 3SU3A 4QT8C 3OYPA 3QZRA 2PHBA 1EQ9A 3AVZA 1F2SE 2PR3A 1UMAH 2QY0B 4BTUB 3RXCA 1F92A 4AX9H 2H6MA 2OC8A 1O2GH 3TJOA 5C2ZA 3MO6A 2VU8E 2YNBA 2J4IA 1GG6C 1O3EA 3DA9B 1TE0A 3SGQE 2TBSA 1GI2A 3HGPA 2NU4E 4UONA 4DT7B 1HJAB 2BD2A 3BSQA 1V2PT 2BMGB 3ENSB 3E0PB 2AYWA 1CGHA 3ZV8A 5A8XA 3VB6A 3SHAH 1ELEE 4MPXA 1D3DB 1LO6A 3A7ZA 2TGDA 2VWMA 1NFUA 2FZZA 1ZOMA 2RCEA 1HFDA 4MLFB 4A1VA 1G3CA 3A8BA 3PMAB 4ZROA 3K65B 2GV7A 2QF0A 5EXNA 1OP2A 5GJ4B 1O35A 1GJ5H 1T4VH 5C1YA 3T27A 1O2NA 3MHWU 3RU4E 3OSYA 1BMNH 1Z8GA 5C5OA 2G00A 3SNCA 1MKWK 1YBWA 1F5KU 3RXEA 1DUAA 5FCKA 3MTYA 1S85A 4K1EA 1ZMJA 4X2YA 1AKSA 3W95A 3TH3H 6GCHF 1FAXA 2ZI2H 3A81A 2A7CA 1YPMH 2ZDAH 4CBOA 1A3BH 1XUFA 2ZHQH 1GDUA 1O5DH 4TPYA 1EB2A 1L1GA 1ZSJA 2VNTA 4O3UA 1Y5BT 1MUEB 2XCNA 4YESB 3VGCB 1K1NA 2PUQH 3BN9A 2BD8A 2PKSB 3MNXA 4Y76A 2VJ1A 6ESTA 3JZ1B 5GCHF 1MCTA 2GX4A 2SNVA 4E7RG 3V0XA 2A32A 3QX5H 1B0FA 3L6PA 1GI0A 2Q6DA 1JIMA 2LNCA 1D3PB 2ODQA 1E34B 2ASUB 3LJOA 2IN2A 2UUJB 2AGIX 1L0ZA 1QA0A 1AFQB 5CMXH 1IQEA 3BTTE 5EU8A 1LHCH 4NWLA 5E2OA 4KGAA 7GCHF 1H8IH 1P3EA 1OP0A 2D2DA 2BY8X 1VITF 1GBKA 3C27B 5LPRA 1E35B 1S82A 1GHVH 2Z94A 3T2NA 4WMFA 1T31A 2GDDA 2GTBA 1RTLA 3TJNA 1O2WA 3KHVA 1SGRE 1NS3A 2PTNA 3BV9B 6CHAB 1CGJE 1LVMA 1C5NH 1L1JA 1SHYA 1PQ7A 2RG3A 2XBVA 3PLKA 5LH8A 4CH2B 1XKBC 4LXBH 1CE5A 2F9NA 3ZV9A 3RU4T 2D1JA 4MNWA 1T8NA 2BQ6B 3AAVA 2FYRA 1O2YA 4ASHA 2FLBH 1A0HB 1H9LB 1THRH 3NUMA 1J17T 4SGBE 1H8DH 4OGYA 1GDQA 4GCHF 4X2XA 1HIAB 2VVCA 2UUKB 1A5IA 1DICA 1O2RA 3E3TA 1AE8H 4ABDA 1TQ0B 1NRSH 1T7CA 4DCDA 1V2LT 1NU9A 1O2UA 2HNTE 2DE8A 2W7SA 1PYTC 1XXFA 1ZJDA 1NU7B 2BLWA 2PLXA 4Y0YE 3T62A 4AOQA 1U6QA 1LCYA 1SB1