4TWWA

Structure of sars-3cl protease complex with a bromobenzoyl (s,r)-n-decalin type inhibitor
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fused-ring structure of decahydroisoquinolin as a novel scaffold for SARS 3CL protease inhibitors
pubmed doi rcsb
source organism Human sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
total genus 76
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4twwA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4twwA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4twwA02
1NN6A 2AFQB 3A7TA 1GBIA 1NFUA 1DSTA 2FX6A 3SHCH 2Z3DA 2ZDMA 3FP8E 3KQDA 2H5DA 3Q76A 3IG6B 4A5TS 3PWCA 4E7NA 3HK3B 2W5EA 3LIWA 1QGFA 1UK4A 1ZRKA 4X2YA 1S5SA 3DD2H 1H8DH 6LPRA 1K28D 1IQFA 3TLOA 1KTSB 3S0NA 2BDGA 1YKTA 2FWWA 1BJVA 1W10U 3SU3A 1PPZA 2PFEA 4IN1A 2VIDA 1RTFB 3MH7A 1HUTH 1XKBC 4ISIH 1EASA 1SI5H 5JB8S 1F0UA 1FZZA 2OBQA 3M36A 1GI6A 3P95A 1F0TA 1EZXC 4AFQA 1ZHRA 3SNBA 3EAJA 2FMJA 1YPKH 1AE8H 1UTMA 1V2ST 3H5CB 4YT6H 1CHOG 1TE0A 1UTOA 1BRUP 1JXPA 3KCGH 1ELCA 1E34B 3UWJH 3QN7A 2GT8A 2JKHA 4VGCB 2VJ1A 5EW1H 2F9UA 4ABJA 4Q2KA 1GJ6A 3MU1A 3SUGA 1PPEE 2G55A 2WV4A 4PROA 1Z71A 1O2WA 4U01A 1DITH 4YM9A 1BHXB 2IOTA 4FVDA 4ZROA 4R0IA 3PB1E 2VVUA 4BTIB 1GBCA 2OLGA 2P95A 3RXOA 5E8EH 1B7XB 3M3SA 3LH1A 1ELFA 1SHHB 3MH6A 1RXPA 1C2IA 5LPEA 2SGPE 3CS0A 2ZGCA 2WYGA 2TBSA 3QGNB 2AMPA 2YNBA 4I7YH 2ZECA 4AB9A 1QBVH 3T29A 1GBJA 1AQ7A 1UTKA 3MU4A 3NKKA 1M9UA 1YBWA 1LHEH 3JZ1B 1EUFA 3KN2A 3GCTF 3SU1A 1MBQA 2ZA5A 5FX5A 2QIQA 4ISLA 4YOIA 2AIQA 5TJXA 1IQEA 3SNEA 1H9LB 1LQEA 2ZFTA 3BEIB 2ZFQH 4DURA 1YPHE 2A2QH 1PFXC 1QQ4A 2Z9LA 2JH5D 2FXRA 1FJSA 1KLJH 1GBMA 3F1SB 2TGDA 1GHVH 4X1QU 1THPB 1K22H 4KKDA 1IHTH 4AYVB 1LVOA 1ARBA 4OS6A 3O8DA 1LVYA 1DOJA 1AUTC 3UQOA 1TBRH 1BTHH 2FLRH 2NWNA 1DY9A 4X6OA 2SGQE 2EI6A 1UVUH 4JYUH 4NWKA 2Y5GA 4X8TH 4Y10E 3E3TA 2FX4A 1GJDB 1UVPA 3LPRA 1E37B 2O8LA 1O38A 1C2LA 3GCHB 6GCHG 1ZOMA 1DPOA 2D1JA 1ANBA 4YLQH 4ZMAH 3PLBA 1ESBA 1N1LA 1TIOA 1ZTLA 2PHBA 1HAZB 3PMAB 3F9EA 1A4WH 2Q6DA 1QURH 3A82A 3EE0B 4ZHAA 1K1LA 2FOFA 2ZGBH 4ZHMU 1G3DA 2JH0D 2G51A 2GZ8A 3GISB 1GJBB 3AASA 4WMDA 4ZXXH 1LKBA 2C8XB 3BTME 4B74A 1C5NH 1NTPA 2ZTYA 3SV7A 1H1BA 3EGKH 1TPOA 5FCKA 1BTXA 2OC1A 5GDSH 1SC8U 1LDTT 3E0PB 3E90B 1NZQH 2SNVA 1SFIA 3P70B 1A46H 4WWYA 1EQ9A 3NWUA 3A85A 4JK6A 1BUIA 1ZHMA 1UCYE 1MAXA 1UMAH 1OSSA 2SGEE 4WMFA 2ZNKH 2C4FH 4FUIA 1DLEA 1OWDA 3TJUA 2ZCLP 2WPIS 3RMNH 1XUHA 1YLDA 3K6ZA 1ZTJA 4XSKU 1BTWA 1MZAA 3T27A 1IOEA 3T5FH 1QCPA 2QXIA 2AIPA 1HJAC 1S85A 1C1MA 3U69H 5DP7A 2ZHDA 1O35A 1BMNH 3GDUA 3SU0A 1NROH 1L2EA 3IWMA 1DWDH 3BTKE 3D65E 2BY8X 2Y81A 3A80A 4E05H 3U1IB 2ZU5A 2F3CE 1GJ8B 5HXFA 1BCUH 1WCZA 1JIMA 3OX7U 1ESTA 3RM0H 1V2OT 5DP4A 1UK3A 3SI3H 5E0HA 1GMDF 3C27B 1JOUB 2BDBA 2GKVE 3NCLA 5A09A 3KF2A 3BTWE 1QB1A 1YYY1 1F5LA 3PYHA 1SGYE 3MU5A 2V3HH 1THSH 1SHYA 2BZAA 1WYKA 3A84A 1A61H 2IJOB 5AVDA 4D9RA 1AB9B 1AE5A 3OYPA 5FPTA 2BVXH 1HDTH 3A81A 5F6MA 1BHXF 4XDEA 1DXWA 2BM2A 1MTSA 4AN7A 1C2JA 3V12A 7GCHG 1IQJA 4KTCA 1MKWH 1S83A 5EQQA 4LZ1H 3SBKA 4MPVA 1NRPH 2EA3A 3SORA 2BD2A 3ATLA 3V13A 2EI8A 5EPYA 4CHAB 3PROA 4Y6DA 4YESB 4D76A 2ZIQH 5JBAS 3BEUA 2A1DB 2BDHA 4O3TA 5DP5A 3S7KB 1O31A 1O2JA 3SW2B 3MU0A 2FODA 4NSYA 4X8VH 2Y5FA 1C9PA 3RXFA 5DG6A 3GY6A 2PUXB 1GJ9B 1ABJH 4U30A 1C5LH 2ZHQH 3ODFA 3BG4C 4A1TA 5CE1A 3T26A 3A8BA 1G3EA 2GDDA 3DA9B 4JZEH 3ZZ3A 1MKWK 2BVSH 2HRVA 4IC6A 1O2KA 2Q6FA 2FOBA 1ZPCA 1ZHPA 1GHBF 3DHKH 2BHGA 1LHFH 5C67A 1AGJA 2I6SA 1O2IA 1P03A 4A92A 1AI8H 1YP9A 1SLWB 4AB8A 1TNLA 5K7RA 3ZZDA 3M7TA 1D6WA 3A7ZA 1QJ7B 4OS1A 5DP9A 4CRFA 1O3IA 1MH0A 1BMAA 4NIWA 4NWLA 4I8JA 1QJ1B 1GCTC 1DSUA 1V2LT 3E1XB 3ZVFA 1C4V2 5DJ7A 4DJZB 1C4Y2 3OTJE 4MVNA 2GZ7A 3L3TA 1Z8IB 2OCVB 3VB3A 1EB2A 1GBTA 1AFQB 2EC9H 2JH6D 4Q7YA 3ATWA 4ZUHA 1FY3A 3UIRA 1KXEA 1GHWH 3RU4D 5JBTA 1O3DA 4NZLA 3I77A 1TWXB 3TH2H 4KGAA 4FUFA 2BOKA 1P01A 4GPGA 1AMHA 3LGIA 1ZJKA 1J15A 4WMEA 2A7HA 4Y79A 1TQ0B 3MO3A 2QXHA 1O5DH 2ZCHP 5LPFA 2O9QA 1TGTA 1V3XA 1W12U 4FUEA 1LQDB 3ZVBA 1T7CA 3SZNA 1WTGH 1HFDA 1GMDG 1NY22 4ABAA 5F8XA 2BTCE 3A87A 3FZDA 3E6PH 1CQQA 4SGAE 2RA3A 9ESTA 1QL7A 3K6YA 4WXVA 1GHAF 4D7GA 1ZSLA 4A1XA 3SGQE 3UNQA 3TK9A 4BOHA 2BD5A 1HAVB 2H1UA 2D2DA 3U1JB 1MU8B 2Z3CA 1SQOA 1AD8H 2FESH 1Q2WA 1C2EA 2Y5HA 3SJIA 1Z8GA 1ZZZA 3P6ZB 1PPHE 3RXJA 2V0BA 4GAWA 1RGQA 5F03A 1PJPA 2PUQH 3UOUA 1TX7A 1T32A 5DKMA 2BDIA 2ZU3A 4I8KA 4NIVA 2P59A 1GJ5H 1LHDH 1AKSB 3Q00A 5EGMA 3U8TH 4YTAA 5JBCS 4UONA 4F4OC 3D62A 1WQVH 5EOKA 1O3FA 2ZDNA 2QY0B 2BXTH 5E0GA 3SQHE 1OWKA 5I46H 1DT2A 3EYDA 3SI4H 3F9FA 4UD9H 2WPKS 3M5LA 5DP8A 1ZGVA 2HALA 5J4QA 2AYWA 4DCDA 1SGIB 1C5UA 1P9SA 1HPGA 9LPRA 4Y0YE 1IQGA 2BQ6B 1G9IE 1YCPM 2KAIB 1TGBA 1GCDA 1D3QB 1ELGA 1ELVA 3P8NA 2R3YA 4M7GA 3RU4E 3B8JA 2FOHA 2A4QA 1C2FA 4K3JA 3IITA 4ABEA 1FY1A 1ETSH 2ZEBA 1JBUH 1F5RA 1AVWA 4AGJA 1O2VA 4RSPA 2Y7XA 3RMLH 2YOLA 1SGRE 2ZU2A 1LVMA 2R2MB 2FS8A 2RDLA 4Y8XA 2FOCA 1SGNE 4D7FA 3UQVA 4BXWA 1O3NA 1V2VT 5T6FA 2GX4A 1L1JA 1OS8A 1TNJA 2G5NA 4ZKRU 3GYLB 3SGAE 4B2AA 1FV9A 1O33A 2A4RA 1OP8A 4CH8B 3V7TA 2B5TB 3UR9A 4NIXA 4YO9A 4I8HA 4CBNA 3RXGA 2FOAA 1UTQA 3URDA 1AUJA 2Y82A 5HM2A 1Y3VA 3RXRA 4X8UH 5IDKA 3H7OA 1P0SH 1MMJN 1V2UT 1GDUA 1KXBA 3RP2A 3MNCA 2CV3A 2CMYA 3GY2A 1V2TT 1SBWA 3HPTB 1SGTA 1NRSH 1S0RA 1TRYA 2Y6TA 4YOJA 1TABE 5ABWA 3RXSA 2PWXA 1SB1H 3K2UA 4JZIA 4I8LA 4NG9H 1HGTH 1H9IE 6ESTA 3BTDE 2F9PA 1MZDA 3F6UH 1OYTH 1Z6EA 1NU7B 2P93A 1C2DA 4ABIA 1E36B 3TGJE 4MDSA 2HLCA 3QTVH 2PSYA 3SU4A 3UNRA 2QYIA 3T25A 8ESTE 1Y59T 1QRZA 1C2HA 1MTUA 1TGCA 2G5VA 4X1PU 4ZXYH 1EJMA 1CGHA 2QCYA 1ARCA 3A7WA 4DG4A 2BD3A 1MCTA 2ZF0H 1NU9A 3GY7A 1O3PB 1PQAA 3L6PA 2OINA 4E7RG 3CP7A 3ESTA 1FONA 4UFDH 2VVVA 1SVPA 4OGYA 2GZ9A 2ZPSA 4IN2A 1J14A 1P2IA 1MQ5A 2G81E 1K1OA 1XXDA 2VIPA 3A8DA 3GCTG 2Y7ZA 1SGFG 2PKAB 3LONA 1SG8B 3RXVA 3SN8A 1ZMJA 2VWMA 4Y7BA 3BTFE 3FP6E 1L4ZA 4DIIH 1DLKB 2B7DH 2FI5E 5FX6A 1LTOA 1TMTH 1EAXA 2P3FH 4HFPB 3SU2A 1GHAG 1DANH 1GDNA 1OP0A 3P17H 2PTCE 1Z8JB 8GCHF 4YT7H 3HATH 2ALPA 4MNXA 1GBHA 1IQMA 1A1RA 4Y0ZE 1XX9A 1QBOA 4JYTA 2GV7A 1AY6H 1O2RA 3SO3A 1TB6H 1ZTKA 3T62A 3ZVDA 2HGTH 5CHAC 1SR5C 1WQSA 4NZQA 1Y8TA 2D8WA 2PR3A 1SGEE 3UUZA 2C90B 4IC5A 4J1YA 3LGUA 3RLWH 1KSNA 2W7SA 4AOQA 2FI3E 3OSYA 8KME2 4WY3A 1MAYA 1DVAH 1TLDA 1SGCA 2A2XH 1F0RA 5TCCA 1GMCF 2BDCA 1SSXA 4D8NA 4NIYA 1TX6A 2H5CA 5B6OA 1MCVA 2GMTB 3RXMA 4IS5A 4KTUA 1XMNB 3A7VA 1TYNA 2GCHG 1GVZA 5DK1A 1RD3B 1C2MA 3B23B 4MTBA 3VB7A 2ZFFH 4AFZA 2XCFA 3ZVEA 1AHTH 1TOMH 5EU8A 1GBFA 4YOGA 4H4FA 1LCYA 1T31A 1P04A 4K2YA 3MI4A 4NA8A 2BMGB 2OXSA 1O3JA 1C5MD 3U8RH 1Z1JA 1TALA 1NS3A 2ZGHA 2NU0E 2QAAA 2ZO3H 1XUKA 2Q1JA 1ZGIA 2VH6A 5C3NA 3MMGA 4JCNA 1ELDE 3GCHC 1IAUA 2BX4A 2THFB 2VWOA 5PTPA 4Z6AH 4U32A 2NU1E 1C5TA 4ABBA 1DE7H 1T4VH 5FBIA 5BRRE 2BXUH 1MU6B 3BTGE 4ZH8A 5DP6A 2TGAA 1V2NT 1EPTB 5EXMA 1WBGB 2OUAA 3JZ2B 1P2NA 5EODA 3A83A 4NGAH 2FIRH 4X1SU 1TNHA 2P94A 1C1NA 1TNGA 1C1SA 2Z9GA 4HTCH 3BTEE 1P11E 3LGYA 1KYNA 1A5IA 4X2XA 2B9LA 4BANB 3SJ8A 1VCWA 6GCHF 2ZGXH 1AWFH 1BA8B 2ZTXA 3HKIB 5FPYA 4U2WA 1JWTA 3ZVAA 3TJOA 1YF4A 1T8MA 1TNKA 2CN0H 2XXLA 3CS7A 4K1TA 5FAHA 1TNIA 2NU3E 5F8TA 2O8WA 5JBBS 2B0FA 5A0AE 3MYWA 2ZDAH 2Z9JA 1PYTD 2J2UA 3DFLA 4WVPE 2FDAA 1BIOA 4X6NA 3M5OA 3N7OA 4B71A 1VGCB 4CRGA 1D3DB 1UHBB 1V6DA 2R0KA 1O2HA 2M5TA 2OC7A 1YM0A 1HJAB 1W8BH 1GMHF 5C5NA 1C1WH 4XOJA 1EOJA 1HJ8A 3TJNA 2G8TA 2AS9A 1TGNA 1O3LA 1D3TB 2FS9A 4FVBA 4CRCA 1FAKH 1TONA 4Y76A 1O3GA 3FFGA 1ACBE 4RN6A 3QZQA 2ZHEH 1O32A 1ESAA 5L2YH 4I32A 4JYVH 5ESBA 1E0FD 1V2JT 5GWZA 5LPRA 1UHBA 5BPEA 1C5SA 4XE4A 1N6XA 1NRNH 1PPBH 1C5PA 1AVGH 3A86A 1G36A 2TGPZ 1QBNA 1VJ9U 2FZZA 1C5RA 4OS5A 2WPHS 2A7JA 4XBDA 3KNXA 1K2I1 4DW2U 1A7SA 5DGJA 2DE9A 4Y8YA 3PMJA 1TQ7B 1ID5H 2UUFB 5EG4A 3MWIU 3OU0A 2A4OA 5E2PA 1YLCA 3QUMP 4OS4A 4F49A 1ORFA 1TFXA 2VIOA 4Y71A 1RIWB 1SQAA 1MBMA 2OP9A 1F2SE 4MNWA 1UTJA 1QFKH 2ZHFH 3K9XB 4NFFA 4GCHG 1RTLA 1EPTC 4I33A 1EP6A 2ANKH 3PV4A 1O2YA 2ESTE 4MPWA 1BITA 1CT4E 1O3HA 1TRNA 3LH3A 5A0BA 1ZMLA 5AFZH 1HV7A 5A8ZA 1ZPBA 3LT3A 1LKAA 1OXGA 5DP3A 3RXTA 2G52A 1IQKA 3RLYH 1PQ5A 1FY4A 1Z6JH 1O2UA 2ZZUH 1TBZH 2ZPQA 3MH5A 4X1RU 3P92A 3I78A 3AW1A 1MKXK 4UE7H 1V2RT 2OC8A 3GYMA 4JMYA 1IQIA 2PKSB 1K1PA 1VITF 3BG4B 2QA9E 2BX3A 1O3KA 4KTSA 1QA0A 4BNRA 3RXIA 2PTNA 3RXPA 4Y11E 1PQ7A 3O8BA 4GVUA 5E0JA 1HIAA 2A32A 1BRAA 1QNJA 4UFEH 1H8IH 1QB9A 2TGTA 3TGKE 1LPGB 1W7GH 1J17T 1V2WT 4K60A 1PYTC 4CRDA 1A0HB 5L6NH 1FLEE 1G2LA 1YPEH 1CHOF 1O5AB 3G01A 4TYDA 1F7ZA 3ZV8A 3BF6H 3RM2H 1A2CH 2ZTZA 3ZZBA 2XCNA 3SOSA 4BAOB 1A0JA 2VH0A 3SNCA 4CBOA 3QZRA 4IGDA 2F9OA 3URCA 1TGSZ 3O8CA 1BTZA 1GG6B 1CA0B 7KMEH 1CBWB 1G3CA 1UTLM 3T28A 1MTVA 1AO5A 3GY8A 6CHAC 3KL6A 1Y5AT 1XUIA 2FTLE 3LC3A 1YPGH 2UUJB 4RKJB 2XBVA 3TK5A 1WAYB 4B2BA 1D3PB 3BIVH 4K5ZA 4A6LA 1W0ZU 5A0CA 3SV9A 1GI7B 4DOQA 3S9BA 1IQLA 1LPZB 1EKBB 2VIQA 1HXFH 4X0WU 1FNIA 1O2NA 2H9EH 5FBEA 4ASHA 2UWOA 4JZDH 5DO4H 2C93B 3TPIZ 1EAIA 1QJ6B 1NT1A 2VB0A 1F0SA 1ZLRA 2W26A 3RXHA 4IMZA 1TX8A 1EB1H 3GDVA 1GL1A 2XC5A 1SGFA 1ELBA 3EA8A 1YC0A 3HKJB 3AW0A 3RXUA 1CHGA 2H6MA 2HVXA 3BSQA 4INKA 1W7XH 2H9TH 1H9HE 2GCTB 1JIRA 1DUEA 4MNYA 3U9AH 4OGXA 1G30B 3VB6A 4BTTB 2C8YB 2AH4X 3SNDA 1LHGH 4HZHA 1OWIA 2ZC9H 1OOKB 3NZIA 1GBEA 3TVJB 2O8TA 1BB0B 2BOHB 2WPMS 3Q3XA 2BB4A 2FO9A 2Z6BD 4CH2B 1O34A 1W14U 1BQYA 3R3GB 3ZZ8A 1O2TA 4Y7AA 1ZSJA 1HLTH 1CT2E 1QRXA 2XW9A 3B9FH 4LOYH 3T2NA 3EDXB 1O5CB 4GHQA 4TWWA 4NCYA 2BLOA 5ETXA 1MTWA 2BQWB 1UVTH 1OP2A 4IBLH 2HWLB 2HOBA 5C1XA 3MH4A 2BLQA 1XKAC 1Z1IA 3H7TA 1MQ6A 3KEEA 1HAIH 2AGEX 1DWCH 4ZAEA 1T4UH 1FI8A 3PO1B 2K1QA 2TIOA 2A4GA 1THRH 4JK5A 4UFFH 4XBCA 1GBBA 1QB6A 1FPHH 2BLWA 1SLXB 5AHGH 2ODPA 1TAWA 5A2MH 3K65B 2G4UA 3NXPA 2I6QA 4A7IB 4OS2A 1D4PB 1L1NA 1C9TA 2ZQ1A 3HGPA 1EX3A 4ABHA 1GHXH 1GG6C 1UTNA 4FUCA 7LPRA 1CBWC 3OY6U 4FUGA 1FN8A 1QRWA 2PV9B 3E8LA 2OBOA 2V6NA 4H6SB 6CHAB 4IW4E 2Z9KA 4GLYA 2BDYA 1KXDA 3LOXA 2W3IA 4B1TA 3BV9B 5C5OA 3NK8A 1YCPH 4K8BA 2BYAX 3VFEA 1JRSA 1P02A 2BLVA 1SL3A 3GY3A 2FI4E 2VINA 1GDQA 1XXFA 3ATMA 2GV6A 2Q6GA 3MO6A 4DGJA 1FAXA 4GUXA 3ZVGA 2ZU4A 3D23A 3TIUA 1QHRB 1MTNB 3RXLA 2VGCC 1DWBH 2W7UA 3RXKA 1BRCE 1MD8A 2CF9H 5K0HA 3SHAH 3M5MA 2GCTC 2ZWLH 3CENA 2STAE 4ZHLU 1WU1A 5HMAA 3RXQA 4FUBA 1EZUC 2O8MA 3VEQB 1G37A 2AMDA 2WUCA 1QA7A 1GI2A 1L0ZA 3KHVA 1W11U 1O37A 4AFSA 2BZ6H 1CU1A 1HAYB 1WV7H 3BEFB 3UY9A 2AGGX 1EAUA 2ZU1A 2ANMH 2ALVA 1VR1H 2GVFA 2GP9B 1L4DA 2P3TB 3SUEA 3VB5A 2J94A 7ESTE 1KXFA 4DY7B 2ZGJA 4WJG2 2DE8A 3TNTA 3Q3YA 1UCYK 3UTUH 1OKXA 1RFNA 4TY7A 1HCGA 1W0YH 5J4SA 1O3OA 1C5YB 3QWCH 5GIBA 2ZFRH 1OWEA 1A3BH 1S0QA 3PO1C 3SNAA 1NC6A 1GGDB 3RC4A 1LO6A 2CJIA 1BBRK 2FOMB 4MLFB 1HRTH 1W2KH 1C1PA 1P8VC 4ISHH 2ANWA 2A5AA 2C8ZB 1GJ4H 4ZKNU 2XNIA 1GBAA 1HNEE 1KXCA 2JETC 2PSXA 2BQ7B 1C5OH 3M35A 3MO9A 1EJNA 3TU7H 3M7QA 3ZZ9A 5A8YA 2FOEA 5GJ4B 3ZYDA 5JB9S 3V0XA 5LH8A 1S6FA 3A8AA 1GMCG 2R3UA 3MU8A 3ODDA 4ABDA 1HJ9A 1EXFA 2Z7FE 5HYOA 1UK2A 3STJA 1QL8A 1ZR0A 3W95A 4DT7B 3RUOA 4CREA 1SOZA 4NSVA 5EXLA 1CGIE 1C1QA 1AIXH 5A8XA 2XBXA 1F5KU 4NA7A 2G4TA 2QC2A 4KP0A 1HAHH 1LPKB 4AYYB 1HXEH 1YPJH 1V2MT 4K69A 1HAVA 1ZSKA 1MTNC 1Y3WA 2VGCB 4OS7A 1EZQA 1NPMA 2ANYA 3ZV9A 1TA2A 2ZCKP 2ODQA 3EQ0H 5CHAB 1NO9H 3FANA 2D26C 2IPHA 3TNSA 5C2ZA 2VWNA 2CGAA 3PM3A 1FIWA 2F9VA 1E38B 1QL9A 1ZYOA 2K7XA 2FTMA 1NRRH 4MQAA 2P3UB 3TGIE 3AVZA 1AKSA 1X7AC 3PTNA 1ABIH 4FUDA 1LVBA 2CXVA 3ZZ4A 3LGTA 1BBRH 1Y5UT 3U98H 5F8ZA 2IN2A 2A5IA 1CT0E 2UWPA 2GMTC 2BY6X 1UVOA 4BAQB 1B0FA 1GI5A 4X8SH 2UUKB 1NM6A 2H9HA 3NPSA 4O03A 5G4BA 4AG2A 3GDSA 2HNTE 4X2WA 1GHBG 3LGVA 3SV2H 1J16A 3UREA 3DT0H 2B8OH 3TH4H 3QDZB 3MNXA 4WXIA 3LC5A 4TWYA 1BOQA 1CVWH 5E2OA 1OYQA 2WINI 1AU8A 3D49H 5HGGA 3RXBA 1BMMH 4AX9H 1CA8B 2KAIA 2XRCA 1C1VH 3LJOA 1V2KT 1IQHA 1YPLH 1S82A 1O2GH 3A8CA 5L30H 1BJUA 1FN6A 1ANDA 1A0LA 3BTTE 1GBDA 3U8OH 3Q77A 1WTHD 3BG8A 3RMOH 1ETRH 3GY5A 3QX5H 3LKWA 1C5VA 1FY5A 3DFJA 5EPNA 2ILNA 2BDAA 2NU4E 1TRMA 1EAWA 2JETB 1O3MA 4TPIZ 1ELAA 1PQ8A 1P09A 1ANCA 4XFQA 1P57B 5ESTE 3RC6A 1INCA 1DDJA 2BVRH 3M3TA 3KQBA 4FUJA 1O36A 3M61U 1GMHG 2O8UA 2SGDE 2XBYA 5FXLA 1Y3UA 3SJOA 3BTQE 3STIA 1TPSA 2P16A 1S81A 2TRMA 5H4IB 4TY6A 2AMQA 1YPMH 2XYAA 3GY4A 2ULLA 2F9NA 1QR3E 5GXPA 2PGQB 3GICB 4XBBA 5EQRA 2PLXA 4ISOA 1P2KA 2FM2A 2LIZA 1GI8B 5JDUB 1TMBH 2UUYA 2BD7A 4BAKB 1ELTA 2GTBA 1K1MA 1ZMNA 2V35A 3A7YA 2WYJA 1WSSH 1O2LA 4AORA 4H42U 1Y3YA 2VIVA 3L33A 4D9QA 1T8LA 4WH8A 1XUGA 5FPSA 1Y5BT 1C5XB 4FUHA 4DVAU 1FMGA 1VGCC 2J34A 1HBTH 1K21H 1DX5M 4J2YB 4UEHH 1JMOH 2F91A 1MD7A 4CRBA 5L2ZH 4B75A 2HNTF 1XVOA 2H2ZA 1C5WB 5HM9A 1C2GA 3EBNA 3ATIA 1KXAA 1MUEB 3M7UA 4WF8A 3FP7E 1C1UH 1GL0E 1GJAB 4Q7ZA 2R2WU 1O2SA 2Z9IA 3SV8A 1NFYA 1J9CH 1EP5A 3A7XA 1BTUA 2SFAA 4YZUA 5EXNA 2PKAA 1ANEA 1AWHB 5IYTA 5FHTA 3FAOA 2RG3A 3P8OA 1DM4B 1O5GH 1TMUH 2XC4A 4FXGH 3ZZAA 4LXBH 2HPQH 2OTVA 2XTTB 1P12E 4INLA 3QTOH 1C1TA 3FVFB 1UJ1A 1K9OE 1LHCH 1O30A 3ZVCA 2FYRA 2EI7A 1KY9A 1HAOH 1KIGH 2CF8H 3P8FA 3UR6A 2C3SA 1GVLA 8GCHG 4YLUA 1RIWC 1DXPA 1SOTA 1TBQH 1SLVB 1B0EA 2ZHWH 3BIUH 3MFJA 1GHZA 1O2QA 5SGAE 2BD8A 3S9CA 1SPJA 3SJKA 3FZZA 1BRBE 1B5GH 1U6QA 1O5EH 3RXDA 4NA9H 5EW2H 1FIZA 2SGFE 3M5NA 2AGIX 3VGCB 1VCPA 2QGRA 1OWHA 1GBLA 3GCNA 1GI0A 1RS0A 1T8NA 2FLBH 4ABFA 1OX1A 4JZFH 5JPMH 3GOVB 1S84A 2PKSC 3UFAA 1ELEE 1C5QA 3AAUA 1N6YA 1VCQA 4MPUA 2QV1A 1TPPA 2Z3EA 4GCHF 3EA7A 3SV6A 2GD4B 3RXAA 1XVMA 3ZZ5A 3MHWU 1GWAA 3KGPA 1A5HA 2A7CA 3RDZA 3VXEH 2OD3B 2W3KA 2Z94A 3HK6B 3ZZCA 2FYQA 2HNTC 3E16B 1FY8E 1HAPH 2J92A 2A5KA 4O9VA 4HI3A 5FCRA 1O5FH 3A89A 1G2MA 1AB9C 2ZG0H 1QIXB 1C4U2 1P2JA 1UO6A 3PTBA 1AZZA 5AFYH 5GPIB 1BZXE 4K1SA 1O2MA 1FPCH 4ESTE 1XUJA 1NFXA 1O5BB 3F9GA 3VPKA 1VJAU 2VU8E 1CA0C 1QTFA 1HB0B 3BTHE 1EATA 2F83A 1O2PA 1UCYH 1WUNH 3A88A 3RXEA 4CHAC 3ELAH 1IHSH 2G00A 1FUJA 2OQUA 1UTPA 1SQTA 3F68H 1GI1A 2QXJA 3PLKA 1C2KA 2ASUB 2CHAB 3SJ9A 1N8OB 2ZQ2A 2PW8H 1UVSH 1O2OA 3KIDU 3UOPA 4UFGH 2J38A 4Y8ZA 1SGQE 3RXCA 3EA9A 1WOFA 3W94A 5C1UA 2VIWA 2Y80A 3UPEA 4ZKOU 1EOLA 1PPCE 3NUMA 1CE5A 2FEQH 1SLUB 3LDXH 1DY8A 4NFEA 1G32B 4KELA 1O0DH 1A3EH 3QGJA 1VZQH 3OY5U 2V3OH 1CSOE 3SU5A 1BTYA 1BDAA 1C1OA 2BY7X 1HAXB 1T8OA 2DUCA 1S6HA 2BD9A 4SGBE 4X1NU 2LNCA 1KDQB 3VGCC 4MNVA 2BY9X 1K1JA 3WY8A 2OQ5A 3MNSA 1ZRBA 5GCHF 2UWLA 1VITH 4FU8A 1GHYH 1BBRE 3KQEA 3S69A 1FDPA 4GHTA 2LPRA 1GCTB 4A1VA 2A45B 1EZSC 1YCPK 4AGKA 2R9PA 3SU6A 4CR9A 1A5GH 1TPAE 2J4IA 1E35B 1J8AA 1GJ7B 1L1GA 1KLIH 2P8OB 2RA0A 1KDQA 3MNBA 1O3AA 1Z7KA 1QQUA 4O3UA 1XM1A 4CRAA 1AFQC 3MTYA 4LK4A 1FXYA 5T6DA 1KTTB 1DICA 4BAHB 1CO7E 3ITIA 1DUAA 1AVXA 2ZDKA 4BXSA 1YGCH 8LPRA 3UNSA 4RKOB 1SGDE 4JZ1A 5LGOA 4O97A 3ZZ6A 4LZ4B 1IQNA 2RCEA 1SFQB 1F92A 1NESE 4AFUA 2SGAA 3MOCA 2J9NA 2VVCA 2ZKSA 3ATKA 2OC0A 2SNWA 4THNH 1PPFE 4E06H 4ISNA 1GI4A 4FU9A 1BT7A 4R8TB 1GPZA 5CMXH 5I25A 1P3CA 2GGVB 1Q3XA 2ZI2H 2J95A 5AF9H 1XUFA 3M3VA 3QK1A 1ZJDA 4TPYA 1OPHB 2WPJS 1C5ZB 1OWJA 3Q3KA 1DS2E 1W13U 3SUFA 1NRQH 1KLTA 3HGNA 4MG3A 2A31A 2PGBB 2CHAC 3F9HA 2GDEH 1N8OC 2BY5X 2WV5A 4WH6A 7GCHF 1Q31A 3E91A 1GJCB 3PMHB 1O3CA 3UWIA 1H4WA 5T6GA 1K1NA 1PPGE 3SQEE 3VB4A 1GI3A 4K8YA 2ZP0H 3DUXH 3QO6A 1RRKA 3SUDA 5C20A 3P8GA 4QT8C 4ABGA 1VITG 1P9UA 2ODYB 2WUBA 4INHA 3E0NB 3ENSB 2EEKA 5TCAA 4X6PA 5T3HA 1P05A 4I31A 5GCHG 2XC0A 2GCHF 2ZDLA 1HIAB 3PWBA 4ZKSU 2C8WB 2NU2E 3C1KA 2R0LA 1P2OA 1C1RA 2QN5T 1G3BA 2QXGA 4H6TA 1YPHC 3LJJA 2AEIH 1CGJE 1P06A 5C1YA 3TH3H 1AN1E 3ZZ7A 2VNTA 1O2ZA 3S7HB 2P8OC 4B76A 1O39A 4Z0KA 2XWAA 1Z8RA 2QF0A 2BD4A 3RU4T 1D6RA 3LU9B 4X2VA 2ZPRA 4FU7A 4X6MA 4VGCC 2F9BH 3TITA 1P2QA 4IMQA 1V2PT 1D9IA 4K1EA 1GBKA 1O3BA 3BN9A 1W3CA 2YNAA 2WPLS 1GGDC 4Q7XA 2VWLA 4AG1A 1DWEH 1GVKB 1QY6A 3KQCA 3V3MA 4CR5A 4GSOA 4HGCA 1LMWB 1SGPE 4MPXA 1RTKA 1GI9B 1P10A 1BMLA 4BTUB 1O2XA 1EPTA 1HYLA 5JYIA 1TOCB 1Y3XA 1SMFE 3PLPA 1ZPZA 1RJXB 1V2QT 2XBWA 3VXFH 4BAMB 3ZYEA 3SGBE 1DFPA 2A0QB 3LGWA 2ZDVH 1JRTA 4UDWH 1AZ8A 4AZ2B 3PMBB 2AERH 4DIHH 1EJAA 3AAVA 1P3EA 3TJVA 3I29A 3R0FA 1O3EA 2FPZA 2TPIZ 3S9AA 4B2CA 3QLPH 2ZFPH 1MKXH 3O8RA 2FOGA 4B73A 2GT7A 1ETTH 2HPPH 3GCOA 2STBE 1BTPA 4I8GA 1HAGE 1P2MA 2ZFSA 3RC5A 1FQ3A 1NFWA 2FP7B 3RMMH 2QF3A 1TA6A 1K1IA 3M37A 4Q80A 2XWBI 1AFEH 3TK6A 5DPAA 5EQSA
chains in the Genus database with same CATH superfamily
1NN6A 2AFQB 3A7TA 1GBIA 1NFUA 1DSTA 2FX6A 3SHCH 2Z3DA 2ZDMA 3FP8E 3DSOA 2H5DA 3KQDA 3OFND 3IG6B 3Q76A 4A5TS 3PWCA 4E7NA 3HK3B 2W5EA 3LIWA 1QGFA 1UK4A 1ZRKA 4X2YA 1S5SA 3DD2H 1H8DH 6LPRA 1K28D 1IQFA 3TLOA 1KTSB 1E79D 2BDGA 3S0NA 1YKTA 2FWWA 1BJVA 1W10U 3SU3A 1PPZA 2PFEA 4IN1A 2VIDA 1RTFB 3MH7A 1HUTH 1XKBC 4ISIH 1EASA 1SI5H 5JB8S 1F0UA 1FZZA 2OBQA 3M36A 1GI6A 5CDFE 3P95A 1F0TA 1EZXC 4AFQA 1ZHRA 3SNBA 3EAJA 2FMJA 1YPKH 1AE8H 1UTMA 1V2ST 3H5CB 4YT6H 1CHOG 1TE0A 1UTOA 1BRUP 1JXPA 3KCGH 1ELCA 1E34B 2GJGA 3UWJH 3QN7A 2GT8A 2JKHA 4VGCB 2VJ1A 5EW1H 2F9UA 4ABJA 4Q2KA 1GJ6A 5C17A 3MU1A 3SUGA 1PPEE 2G55A 2WV4A 4PROA 1Z71A 1O2WA 4U01A 1DITH 4YM9A 1BHXB 2IOTA 4FVDA 4ZROA 4R0IA 3PB1E 2VVUA 4BTIB 1GBCA 2OLGA 2P95A 3RXOA 4ACAA 5E8EH 1B7XB 3M3SA 3LH1A 1ELFA 1SHHB 3MH6A 1RXPA 1C2IA 5LPEA 2SGPE 3CS0A 2ZGCA 2WYGA 2TBSA 3QGNB 2AMPA 2YNBA 4I7YH 2ZECA 4AB9A 1QBVH 3T29A 1GBJA 1AQ7A 1UTKA 3MU4A 3NKKA 1M9UA 1YBWA 1LHEH 3JZ1B 1EUFA 3KN2A 3GCTF 3SU1A 1MBQA 2ZA5A 5FX5A 2QIQA 4ISLA 4YOIA 2AIQA 1S6LA 5TJXA 1IQEA 3SNEA 1H9LB 1LQEA 2M2AA 2ZFTA 2YMSC 3BEIB 2ZFQH 4DURA 1YPHE 2A2QH 4Z1MD 1PFXC 1QQ4A 2Z9LA 2JH5D 2FXRA 1FJSA 1KLJH 1GBMA 3F1SB 2IPQX 1GHVH 2TGDA 4X1QU 1THPB 1K22H 4KKDA 1IHTH 4AYVB 1LVOA 1ARBA 4OS6A 3O8DA 1LVYA 1DOJA 1AUTC 3UQOA 1TBRH 1BTHH 2FLRH 2NWNA 1DY9A 4X6OA 2SGQE 2EI6A 1UVUH 4JYUH 4NWKA 2Y5GA 4X8TH 4Y10E 3E3TA 2FX4A 1GJDB 1UVPA 3LPRA 1E37B 2O8LA 1O38A 1C2LA 3GCHB 6GCHG 1ZOMA 3F0OA 1DPOA 2D1JA 1ANBA 4YLQH 4ZMAH 3PLBA 1ESBA 1MABB 1N1LA 1TIOA 1ZTLA 2PHBA 1HAZB 3PMAB 3F9EA 1A4WH 2Q6DA 1QURH 3A82A 3EE0B 4ZHAA 1K1LA 2FOFA 2ZGBH 4ZHMU 1G3DA 2JH0D 2G51A 2GZ8A 3GISB 1GJBB 3AASA 4WMDA 4ZXXH 1LKBA 2C8XB 3BTME 2OK5A 4B74A 1C5NH 1NTPA 2ZTYA 3SV7A 1H1BA 3EGKH 1TPOA 5FCKA 3SZEA 1BTXA 2OC1A 5GDSH 1SC8U 1LDTT 3GS9A 3E0PB 3E90B 1YLNA 1NZQH 2SNVA 1SFIA 3P70B 1A46H 4WWYA 1EQ9A 3NWUA 3A85A 4JK6A 1BUIA 1ZHMA 1UCYE 1MAXA 1UMAH 1OSSA 2SGEE 4WMFA 2ZNKH 2C4FH 4FUIA 1DLEA 1OWDA 3TJUA 2ZCLP 2WPIS 3RMNH 1XUHA 1YLDA 3K6ZA 1ZTJA 4XSKU 2WSSD 1BTWA 1MZAA 3T27A 1IOEA 3T5FH 1QCPA 2QXIA 2AIPA 1HJAC 2YMSB 1S85A 1C1MA 3U69H 5DP7A 2ZHDA 1O35A 1BMNH 3GDUA 3SU0A 1NROH 1L2EA 3IWMA 1VKYA 1DWDH 3BTKE 3D65E 2BY8X 2Y81A 3A80A 4E05H 3U1IB 2ZU5A 2F3CE 1GJ8B 5HXFA 1BCUH 1WCZA 1JIMA 3OX7U 1ESTA 3RM0H 1V2OT 5B6LA 5DP4A 1UK3A 3SI3H 5E0HA 1GMDF 3C27B 1JOUB 2BDBA 4OM9A 2GKVE 3NCLA 5A09A 3KF2A 3BTWE 1QB1A 1YYY1 1F5LA 2J5UA 3PYHA 1SGYE 3MU5A 2V3HH 1THSH 1SHYA 2BZAA 1WYKA 2JJ1D 3A84A 1A61H 2IJOB 5AVDA 4D9RA 1AB9B 2JIZD 1AE5A 3OYPA 5FPTA 2BVXH 3PV5A 1HDTH 3A81A 5F6MA 3WW7A 1BHXF 4XDEA 1DXWA 2BM2A 1MTSA 4AN7A 1C2JA 3V12A 7GCHG 1IQJA 4KTCA 1MKWH 1S83A 5EQQA 4LZ1H 3SBKA 4MPVA 1NRPH 2EA3A 3SORA 1COWD 2BD2A 3ATLA 3V13A 2EI8A 5EPYA 4CHAB 3PROA 4Y6DA 4YESB 4D76A 2ZIQH 5JBAS 3BEUA 2A1DB 2BDHA 4O3TA 5DP5A 3S7KB 2HLDD 1O31A 1O2JA 3SW2B 3MU0A 2FODA 4NSYA 4X8VH 1YWUA 2Y5FA 1C9PA 3RXFA 2L6OA 5DG6A 3GY6A 2PUXB 1GJ9B 1ABJH 4U30A 1C5LH 5GNDA 2ZHQH 3ODFA 3BG4C 3OAAD 4A1TA 5CE1A 3T26A 3A8BA 1G3EA 5EJ1A 2GDDA 3DA9B 4JZEH 1H8HD 3ZZ3A 1MKWK 2BVSH 3F2FA 4P00A 2HRVA 4IC6A 1O2KA 2Q6FA 2FOBA 1ZPCA 1ZHPA 1GHBF 3DHKH 2BHGA 1LHFH 5C67A 1AGJA 2I6SA 1O2IA 1P03A 4A92A 1AI8H 1YP9A 1SLWB 4AB8A 1TNLA 5K7RA 3ZZDA 3M7TA 1D6WA 3A7ZA 4TSFD 1QJ7B 4OS1A 5DP9A 4CRFA 1O3IA 1MH0A 1BMAA 4NIWA 4NWLA 4I8JA 1QJ1B 1GCTC 1DSUA 1V2LT 3E1XB 3ZVFA 1C4V2 5DJ7A 4DJZB 1C4Y2 3OTJE 4MVNA 2GZ7A 3L3TA 1Z8IB 2OCVB 3VB3A 1EB2A 1GBTA 1AFQB 2EC9H 2JH6D 4Q7YA 3ATWA 4ZUHA 1FY3A 3UIRA 1KXEA 1GHWH 3RU4D 5JBTA 1O3DA 4NZLA 3I77A 1TWXB 3TH2H 2HVYB 4FOUC 5F53A 4KGAA 4FUFA 2BOKA 1P01A 4GPGA 1AMHA 3LGIA 1ZJKA 1J15A 4WMEA 2A7HA 4Y79A 1TQ0B 3MO3A 2QXHA 1O5DH 2ZCHP 5LPFA 2O9QA 1TGTA 1V3XA 1W12U 4FUEA 1LQDB 3ZVBA 4RT1A 1T7CA 3SZNA 1WTGH 1HFDA 1GMDG 1NY22 4ABAA 5F8XA 2BTCE 4I86A 3A87A 3FZDA 1YY3A 1CQQA 3E6PH 4SGAE 2RA3A 9ESTA 1QL7A 3K6YA 4WXVA 1GHAF 4D7GA 1ZSLA 4A1XA 3PRBA 3SGQE 3UNQA 3TK9A 4BOHA 2BD5A 1HAVB 2H1UA 2D2DA 3U1JB 1MU8B 2J97A 2Z3CA 1SQOA 5DN6D 1AD8H 4F48B 2FESH 1Q2WA 1C2EA 2Y5HA 3SJIA 1Z8GA 1ZZZA 3P6ZB 1PPHE 5EJLA 3KQ5A 3RXJA 2V0BA 4GAWA 1RGQA 5F03A 1PJPA 2PUQH 5C94A 3UOUA 1TX7A 1T32A 2PP6A 5DKMA 2BDIA 2ZU3A 4I8KA 4NIVA 2P59A 1GJ5H 1LHDH 1AKSB 3Q00A 5EGMA 3U8TH 4YTAA 5JBCS 4UONA 4F4OC 3D62A 1WQVH 5EOKA 1O3FA 2ZDNA 2QY0B 2BXTH 5E0GA 3SQHE 1OWKA 5I46H 1DT2A 3EYDA 3SI4H 3F9FA 4UD9H 2WPKS 3M5LA 5DP8A 1ZGVA 2HALA 5J4QA 2AYWA 3ZIAD 4DCDA 1SGIB 1C5UA 1P9SA 1HPGA 9LPRA 4Y0YE 1IQGA 2BQ6B 1G9IE 1YCPM 2KAIB 1TGBA 1GCDA 1D3QB 1ELGA 1ELVA 3P8NA 2R3YA 4M7GA 3RU4E 3B8JA 2FOHA 2A4QA 1C2FA 4K3JA 3IITA 4ABEA 1FY1A 1ETSH 3DCLA 2ZEBA 1JBUH 1F5RA 1AVWA 4AGJA 1O2VA 4RSPA 2Y7XA 3RMLH 2YOLA 1SGRE 2ZU2A 1LVMA 2R2MB 2FS8A 2RDLA 4Y8XA 2FOCA 1SGNE 4D7FA 3UQVA 4BXWA 1O3NA 1V2VT 5T6FA 2GX4A 1L1JA 1OS8A 1TNJA 2G5NA 4ZKRU 3GYLB 3SGAE 4B2AA 4RI0A 1FV9A 1O33A 2A4RA 1OP8A 4CH8B 3V7TA 2B5TB 3UR9A 4NIXA 4YO9A 4I8HA 4CBNA 3RXGA 2FOAA 1UTQA 3URDA 1AUJA 2Y82A 5HM2A 1Y3VA 3RXRA 2KX4A 4X8UH 5IDKA 3H7OA 1P0SH 1MMJN 1V2UT 1GDUA 1KXBA 3RP2A 3MNCA 2CV3A 2CMYA 3GY2A 1V2TT 1SBWA 3HPTB 1SGTA 1NRSH 1S0RA 1TRYA 2Y6TA 4YOJA 1TABE 5ABWA 3RXSA 2PWXA 1SB1H 3K2UA 4JZIA 4I8LA 4NG9H 1HGTH 1H9IE 6ESTA 3BTDE 2F9PA 1MZDA 3F6UH 1OYTH 1Z6EA 1NU7B 2P93A 1C2DA 4ABIA 3WWBA 1E36B 1BMFD 3TGJE 4MDSA 2HLCA 3QTVH 2PSYA 3SU4A 3UNRA 2QYIA 3T25A 8ESTE 1Y59T 1QRZA 1C2HA 1MTUA 1TGCA 2G5VA 4X1PU 4ZXYH 1EJMA 5KECA 1CGHA 2QCYA 1ARCA 3A7WA 4DG4A 2BD3A 1MCTA 2ZF0H 1NU9A 3GY7A 1O3PB 1PQAA 3L6PA 2OINA 4E7RG 3CP7A 3ESTA 1FONA 4UFDH 2VVVA 1SVPA 4OGYA 2GZ9A 2ZPSA 4IN2A 1J14A 1P2IA 1MQ5A 2G81E 1K1OA 1XXDA 2VIPA 3A8DA 3GCTG 2Y7ZA 1SGFG 2PKAB 3LONA 1SG8B 3RXVA 3SN8A 1ZMJA 2VWMA 4Y7BA 3BTFE 3FP6E 1L4ZA 4DIIH 3NRLA 1DLKB 2B7DH 2FI5E 5FX6A 1LTOA 1TMTH 1EAXA 2P3FH 4HFPB 3SU2A 1GHAG 2KCPA 1DANH 1GDNA 1OP0A 3P17H 1NBMD 1Z8JB 2PTCE 3UAIC 8GCHF 1FX0B 2AHME 4YT7H 3HATH 5IK2D 2ALPA 4MNXA 1GBHA 2EY4C 1IQMA 1A1RA 4Y0ZE 1XX9A 1QBOA 4JYTA 2GV7A 1AY6H 1O2RA 3SO3A 1TB6H 1ZTKA 3T62A 3ZVDA 2HGTH 5CHAC 1SR5C 1WQSA 4NZQA 1Y8TA 2D8WA 2PR3A 1SGEE 3UUZA 2C90B 4IC5A 4J1YA 3LGUA 3RLWH 1KSNA 2W7SA 4AOQA 2FI3E 3OSYA 8KME2 4WY3A 1MAYA 1DVAH 1TLDA 1SGCA 1H8ED 2A2XH 1F0RA 3CNRA 5TCCA 3U28C 1GMCF 2BDCA 1SSXA 1W0KD 4D8NA 4NIYA 1TX6A 2H5CA 2WZQA 5B6OA 3EE7A 5KGOA 1MCVA 2GMTB 3RXMA 4IS5A 4KTUA 1XMNB 5HKKD 3A7VA 1TYNA 2GCHG 1GVZA 5DK1A 5FL7D 1WDIA 1RD3B 2CK3D 1C2MA 3B23B 4MTBA 3VB7A 2ZFFH 4AFZA 2XCFA 3ZVEA 1AHTH 1TOMH 5EU8A 1GBFA 4YOGA 4H4FA 1LCYA 1T31A 1P04A 4K2YA 3MI4A 4NA8A 2BMGB 2OXSA 1O3JA 1C5MD 3U8RH 1Z1JA 1TALA 1NS3A 2W6ID 2KCYA 2ZGHA 2NU0E 2QAAA 2ZO3H 1XUKA 2Q1JA 1ZGIA 2VH6A 5C3NA 3MMGA 4JCNA 1ELDE 3GCHC 1IAUA 2BX4A 2THFB 2VWOA 5PTPA 4Z6AH 4U32A 2NU1E 1C5TA 4ABBA 1DE7H 1T4VH 3KYGA 3UB0A 5FBIA 5BRRE 2BXUH 1MU6B 3BTGE 4ZH8A 5DP6A 2TGAA 1V2NT 1EPTB 5EXMA 1WBGB 2OUAA 3JZ2B 5EJZA 1P2NA 5EODA 3A83A 4NGAH 2FIRH 4X1SU 1TNHA 2P94A 1C1NA 1TNGA 1C1SA 2Z9GA 4HTCH 3BTEE 1P11E 3LGYA 1KYNA 1A5IA 1QZ8A 4X2XA 2B9LA 4BANB 3SJ8A 1VCWA 6GCHF 2ZGXH 1AWFH 1BA8B 2ZTXA 3HKIB 5FPYA 4U2WA 4HG6A 1JWTA 3ZVAA 3TJOA 1YF4A 1T8MA 1TNKA 2CN0H 2XXLA 3CS7A 4K1TA 5FAHA 1TNIA 2NU3E 5F8TA 2O8WA 5JBBS 2B0FA 5A0AE 3MYWA 2ZDAH 2Z9JA 1PYTD 2J2UA 3DFLA 4WVPE 2FDAA 1BIOA 4X6NA 3M5OA 3N7OA 4B71A 4M9FA 1VGCB 4CRGA 1D3DB 1UHBB 1V6DA 2R0KA 1O2HA 2M5TA 2KCAA 2OC7A 1YM0A 1HJAB 1W8BH 1GMHF 5C5NA 1C1WH 4XOJA 1EOJA 1HJ8A 3TJNA 2G8TA 2AS9A 1TGNA 1O3LA 1D3TB 2FS9A 4FVBA 4CRCA 1FAKH 1TONA 3FO8D 1O3GA 4Y76A 3FFGA 1ACBE 4RN6A 3QZQA 2ZHEH 1O32A 4ZCNA 1ESAA 5L2YH 3PRDA 4I32A 4JYVH 5ESBA 1E0FD 1V2JT 5GWZA 3N7DA 1UHBA 5LPRA 5BPEA 1C5SA 4XE4A 1N6XA 1NRNH 1PPBH 1C5PA 1AVGH 3A86A 3W1EA 1G36A 1QBNA 2TGPZ 1VJ9U 2F4LA 2FZZA 1C5RA 4OS5A 2WPHS 2A7JA 4XBDA 3KNXA 1K2I1 4DW2U 1A7SA 5DGJA 2DE9A 4Y8YA 3PMJA 1TQ7B 1ID5H 2UUFB 5EG4A 3MWIU 3OU0A 2A4OA 5E2PA 1YLCA 3QUMP 4OS4A 4F49A 1ORFA 1TFXA 2VIOA 4Y71A 1KMHB 1RIWB 1SQAA 1MBMA 2OP9A 1F2SE 4MNWA 1UTJA 1QFKH 2ZHFH 3K9XB 4NFFA 4GCHG 1RTLA 2V3MA 1EPTC 4I33A 1EP6A 2ANKH 3PV4A 1O2YA 2ESTE 4MPWA 1BITA 1CT4E 1O3HA 1TRNA 3LH3A 5A0BA 1ZMLA 5AFZH 1HV7A 3WWFA 5A8ZA 1ZPBA 3LT3A 1LKAA 1OXGA 5DP3A 3RXTA 2K0QA 2G52A 1IQKA 3RLYH 1PQ5A 1FY4A 1Z6JH 1O2UA 2ZZUH 1TBZH 2ZPQA 3MH5A 4X1RU 3P92A 3I78A 3AW1A 1MKXK 4UE7H 1V2RT 2OC8A 3GYMA 4JMYA 1IQIA 2PKSB 1K1PA 1VITF 3BG4B 2QA9E 2BX3A 1O3KA 4KTSA 1QA0A 5EIYA 4BNRA 3RXIA 2PTNA 2QE7D 3RXPA 4Y11E 5C0TA 1PQ7A 2WPDD 3O8BA 4GVUA 5E0JA 1HIAA 2A32A 1BRAA 1QNJA 4UFEH 1H8IH 1QB9A 2TGTA 3TGKE 1LPGB 1W7GH 1J17T 1UW7A 1V2WT 4K60A 1PYTC 4CRDA 1A0HB 5L6NH 1FLEE 1G2LA 1YPEH 1CHOF 1O5AB 3G01A 4TYDA 1F7ZA 3ZV8A 3BF6H 3RM2H 1A2CH 2ZTZA 5T1VA 3ZZBA 2XCNA 3SOSA 4BAOB 1A0JA 2VH0A 3SNCA 4CBOA 3QZRA 4IGDA 2F9OA 3URCA 1OHHD 1TGSZ 3O8CA 1BTZA 1GG6B 1CA0B 7KMEH 1CBWB 1G3CA 1UTLM 3T28A 1MTVA 1AO5A 3GY8A 6CHAC 3KL6A 1Y5AT 1XUIA 2FTLE 3LC3A 1YPGH 2UUJB 4RKJB 2XBVA 3TK5A 1WAYB 4B2BA 1D3PB 3BIVH 4K5ZA 4A6LA 1W0ZU 5A0CA 3SV9A 1GI7B 4DOQA 3S9BA 1IQLA 1LPZB 2EQNA 1EKBB 2VIQA 1HXFH 2F43B 4X0WU 1FNIA 1O2NA 2H9EH 5FBEA 4ASHA 2UWOA 4JZDH 4B6EA 5DO4H 2C93B 3TPIZ 1EAIA 1EFRD 1QJ6B 1NT1A 2VB0A 1F0SA 1ZLRA 2W26A 3RXHA 4IMZA 1TX8A 1EB1H 3GDVA 1GL1A 2XC5A 1SGFA 1ELBA 3EA8A 1YC0A 3HKJB 3AW0A 3RXUA 1CHGA 2H6MA 2HVXA 3BSQA 4INKA 1W7XH 2H9TH 1H9HE 2GCTB 1JIRA 1DUEA 4MNYA 3U9AH 4OGXA 1G30B 3VB6A 4BTTB 2C8YB 2AH4X 3SNDA 1LHGH 4HZHA 1OWIA 2ZC9H 1OOKB 3NZIA 1GBEA 3TVJB 2O8TA 1BB0B 2BOHB 2WPMS 3Q3XA 2BB4A 2FO9A 2Z6BD 4CH2B 1O34A 1W14U 1BQYA 3R3GB 3ZZ8A 1O2TA 4Y7AA 1ZSJA 1HLTH 1CT2E 1QRXA 2XW9A 3B9FH 4LOYH 3T2NA 3EDXB 1O5CB 4GHQA 4TWWA 4NCYA 2BLOA 5ETXA 3FOAA 1MTWA 2BQWB 1UVTH 1OP2A 4IBLH 2HWLB 2HOBA 5C1XA 3MH4A 2BLQA 1XKAC 1Z1IA 3H7TA 1MQ6A 3KEEA 1HAIH 2AGEX 1DWCH 4ZAEA 1T4UH 1FI8A 3PO1B 2K1QA 2TIOA 2A4GA 1THRH 4JK5A 4UFFH 4XBCA 1GBBA 1QB6A 1FPHH 2BLWA 1SLXB 5AHGH 2ODPA 1TAWA 2KCOA 5A2MH 3K65B 2G4UA 3NXPA 2I6QA 4A7IB 4OS2A 1D4PB 1L1NA 1C9TA 4B6FA 2ZQ1A 3HGPA 1EX3A 4ABHA 1GHXH 1GG6C 1UTNA 4FUCA 7LPRA 1CBWC 3OY6U 4FUGA 1FN8A 1QRWA 2PV9B 3E8LA 2OBOA 2V6NA 4H6SB 6CHAB 4IW4E 2Z9KA 4GLYA 2BDYA 1KXDA 3LOXA 2W3IA 4B1TA 3BV9B 5C5OA 3NK8A 1YCPH 4K8BA 2BYAX 3VFEA 1JRSA 1P02A 2BLVA 1SL3A 2J98B 3GY3A 3AK5A 2FI4E 2VINA 1GDQA 1XXFA 3ATMA 2GV6A 2Q6GA 3MO6A 4DGJA 1FAXA 4GUXA 3ZVGA 1NBME 2ZU4A 3D23A 3TIUA 1QHRB 1K0HA 1MTNB 3RXLA 2VGCC 1DWBH 2W7UA 3RXKA 2V7QD 1BRCE 1MD8A 2CF9H 5K0HA 2J98A 3SHAH 3M5MA 2GCTC 2ZWLH 3CENA 2STAE 4ZHLU 1WU1A 1WXRA 5HMAA 3RXQA 4FUBA 1EZUC 4ASUD 4F55A 2O8MA 4RT0A 3VEQB 1G37A 2AMDA 2WUCA 1QA7A 1GI2A 1L0ZA 3KHVA 1W11U 1O37A 4AFSA 2BZ6H 1CU1A 1HAYB 1WV7H 3BEFB 3UY9A 2AGGX 1EAUA 2ZU1A 2ANMH 2ALVA 1VR1H 2GVFA 2GP9B 1L4DA 2P3TB 3SUEA 3VB5A 2J94A 7ESTE 1KXFA 4DY7B 2ZGJA 4YXWD 2YMSD 4WJG2 2DE8A 3TNTA 3Q3YA 1UCYK 3UTUH 1OKXA 1RFNA 4TY7A 1HCGA 1W0YH 5J4SA 1O3OA 1C5YB 3QWCH 5GIBA 2ZFRH 1OWEA 1A3BH 1S0QA 3PO1C 3SNAA 2JJ2D 1NC6A 1GGDB 3RC4A 1LO6A 2CJIA 1BBRK 2FOMB 4MLFB 1HRTH 3F3BA 1W2KH 1C1PA 1P8VC 4ISHH 2ANWA 2A5AA 2C8ZB 1GJ4H 4ZKNU 2XNIA 1GBAA 1HNEE 5HIYA 1KXCA 2JETC 2PSXA 3F2HA 2BQ7B 1C5OH 3M35A 3MO9A 1EJNA 3TU7H 3M7QA 3ZZ9A 5A8YA 2FOEA 5GJ4B 3ZYDA 5JB9S 3V0XA 5LH8A 1S6FA 3A8AA 1GMCG 2R3UA 3MU8A 3ODDA 4ABDA 1HJ9A 1EXFA 2Z7FE 5HYOA 1UK2A 3STJA 1QL8A 1ZR0A 3W95A 4DT7B 5CHBA 3RUOA 4CREA 3OEHD 1SOZA 4NSVA 5EXLA 1CGIE 1C1QA 1AIXH 5A8XA 2XBXA 1F5KU 4NA7A 2G4TA 2QC2A 4KP0A 1HAHH 1LPKB 4AYYB 1HXEH 1YPJH 1V2MT 1SQRA 4K69A 1HAVA 1ZSKA 1MTNC 1Y3WA 2VGCB 4OS7A 1EZQA 1NPMA 2ANYA 3ZV9A 1TA2A 2ZCKP 2ODQA 3EQ0H 5CHAB 1NO9H 3FANA 2D26C 2IPHA 3TNSA 5C2ZA 4Q4LA 2VWNA 2CGAA 3PM3A 1FIWA 2F9VA 1E38B 1QL9A 1ZYOA 2K7XA 2FTMA 1NRRH 4MQAA 3DSPA 2P3UB 4AC9A 2XOKD 3TGIE 3AVZA 1AKSA 1X7AC 2KM0A 1ABIH 3PTNA 4FUDA 1LVBA 3F2GA 2CXVA 3ZZ4A 3LGTA 1BBRH 1Y5UT 3U98H 5F8ZA 2IN2A 2A5IA 1CT0E 2UWPA 2GMTC 2BY6X 1UVOA 4BAQB 1B0FA 1GI5A 4X8SH 2UUKB 1NM6A 2H9HA 3NPSA 4O03A 5G4BA 4AG2A 3GDSA 2HNTE 4X2WA 1GHBG 2L74A 3LGVA 3SV2H 1J16A 3UREA 3DT0H 2B8OH 3TH4H 3QDZB 3MNXA 4WXIA 3LC5A 4TWYA 1BOQA 1CVWH 5E2OA 1OYQA 2WINI 1AU8A 3D49H 5HGGA 3RXBA 1BMMH 4AX9H 5HIZA 1CA8B 2KAIA 2XRCA 1C1VH 3LJOA 1V2KT 1IQHA 1YPLH 1S82A 1O2GH 3A8CA 2W6JD 5L30H 1BJUA 1FN6A 1ANDA 5DSFA 1A0LA 3BTTE 1GBDA 3U8OH 3Q77A 3F0PA 1WTHD 3BG8A 3RMOH 1ETRH 3GY5A 3QX5H 3LKWA 1C5VA 1FY5A 3DFJA 5EPNA 2ILNA 2BDAA 2NU4E 1TRMA 1EAWA 2JETB 1O3MA 4TPIZ 1ELAA 1PQ8A 1P09A 1ANCA 4XFQA 1P57B 5ESTE 3RC6A 1INCA 4XD7D 1DDJA 2BVRH 3M3TA 3KQBA 4FUJA 1O36A 3M61U 1GMHG 2O8UA 2SGDE 2XBYA 5FXLA 1Y3UA 3SJOA 3BTQE 3STIA 1TPSA 2P16A 3N7EA 1S81A 2TRMA 5H4IB 4TY6A 2IJD1 2AMQA 1YPMH 2XYAA 3GY4A 2ULLA 2F9NA 1QR3E 5GXPA 2PGQB 3GICB 4XBBA 5EQRA 2PLXA 4ISOA 1P2KA 2FM2A 2LIZA 1GI8B 5JDUB 3N99A 1TMBH 2UUYA 2BD7A 4BAKB 1ELTA 2GTBA 1K1MA 1ZMNA 2V35A 3A7YA 2WYJA 1WSSH 1O2LA 4AORA 4H42U 1Y3YA 2VIVA 3L33A 4D9QA 1T8LA 4WH8A 1XUGA 5FPSA 1Y5BT 1C5XB 4FUHA 4DVAU 2QF4A 1FMGA 1VGCC 2J34A 3H09A 1HBTH 1K21H 1DX5M 4J2YB 4UEHH 2QF5A 1JMOH 2F91A 1MD7A 4CRBA 5L2ZH 4B75A 2HNTF 1XVOA 2H2ZA 1C5WB 5HM9A 1C2GA 3EBNA 3ATIA 1KXAA 1MUEB 3M7UA 4WF8A 3FP7E 1C1UH 1GL0E 1GJAB 4Q7ZA 2R2WU 1O2SA 2Z9IA 3SV8A 2KFWA 1NFYA 1J9CH 1EP5A 3A7XA 1BTUA 2SFAA 4YZUA 2KZ4A 2PKAA 5EXNA 1ANEA 1AWHB 5IYTA 5FHTA 3FAOA 2RG3A 3P8OA 1DM4B 1O5GH 1TMUH 2XC4A 4FXGH 3ZZAA 4LXBH 3KYFA 2HPQH 2OTVA 2XTTB 1P12E 4INLA 3QTOH 1C1TA 3FVFB 1UJ1A 1K9OE 1LHCH 1O30A 3ZVCA 2FYRA 2EI7A 1KY9A 2XNDD 1HAOH 1KIGH 2CF8H 3P8FA 3UR6A 2C3SA 1GVLA 8GCHG 4YLUA 1RIWC 1DXPA 1SOTA 1TBQH 1SLVB 1B0EA 2ZHWH 3BIUH 3MFJA 1GHZA 1O2QA 5SGAE 2BD8A 3S9CA 1SPJA 3SJKA 3FZZA 1BRBE 1B5GH 1U6QA 1O5EH 3RXDA 4NA9H 5EW2H 2RFKC 1FIZA 2SGFE 3M5NA 2AGIX 3VGCB 1VCPA 2QGRA 1OWHA 1GBLA 3GCNA 1GI0A 1RS0A 1T8NA 2FLBH 4ABFA 1OX1A 4JZFH 5JPMH 3GOVB 1S84A 2PKSC 3UFAA 1ELEE 1C5QA 3AAUA 1N6YA 1VCQA 4MPUA 2QV1A 1TPPA 2Z3EA 4GCHF 3EA7A 3SV6A 2GD4B 3RXAA 1XVMA 3ZZ5A 3MHWU 1GWAA 3KGPA 1A5HA 2A7CA 3RDZA 3VXEH 2OD3B 2W3KA 2K8IA 2Z94A 3HK6B 3ZZCA 2FYQA 2HNTC 3E16B 1FY8E 1HAPH 2J92A 2A5KA 4O9VA 4HI3A 5FCRA 1O5FH 3OE7D 4P02A 5C0UA 3A89A 4Q63A 1G2MA 1AB9C 2ZG0H 1QIXB 4DT4A 1C4U2 1P2JA 1UO6A 3PTBA 1AZZA 5AFYH 5GPIB 1BZXE 4K1SA 1O2MA 1FPCH 4ESTE 1XUJA 1NFXA 1O5BB 3F9GA 3VPKA 1VJAU 2VU8E 1CA0C 1QTFA 1HB0B 3BTHE 3PV2A 4FETA 1EATA 2F83A 4TT3D 1O2PA 1UCYH 1WUNH 3A88A 3RXEA 4CHAC 3ELAH 1IHSH 2G00A 1FUJA 2OQUA 1UTPA 1SQTA 3F68H 1GI1A 2QXJA 3PLKA 1C2KA 2ASUB 2CHAB 3SJ9A 1N8OB 2ZQ2A 2PW8H 1UVSH 1O2OA 3KIDU 3UOPA 4UFGH 2J38A 4Y8ZA 1SGQE 3RXCA 3EA9A 1WOFA 3W94A 5C1UA 2VIWA 2Y80A 3UPEA 4ZKOU 1EOLA 1PPCE 3NUMA 1CE5A 2FEQH 1SLUB 3LDXH 1DY8A 4NFEA 1G32B 4KELA 1O0DH 1A3EH 3QGJA 1VZQH 3OY5U 2V3OH 1CSOE 3SU5A 1BTYA 1BDAA 1C1OA 2BY7X 1HAXB 1T8OA 2DUCA 1S6HA 2BD9A 4SGBE 4X1NU 2LNCA 1KDQB 3VGCC 4MNVA 2BY9X 1K1JA 3WY8A 2OQ5A 3MNSA 1ZRBA 5GCHF 2UWLA 1VITH 4FU8A 1GHYH 1BBRE 3KQEA 3S69A 1FDPA 4GHTA 2LPRA 1GCTB 2JDID 4A1VA 2A45B 1EZSC 1YCPK 4AGKA 2R9PA 3SU6A 4CR9A 1A5GH 1TPAE 2J4IA 1E35B 1J8AA 1GJ7B 1L1GA 1KLIH 2P8OB 2RA0A 1KDQA 3MNBA 1O3AA 1Z7KA 1QQUA 4O3UA 1XM1A 4CRAA 1AFQC 3MTYA 4LK4A 1FXYA 5T6DA 1KTTB 1DICA 4BAHB 1CO7E 3ITIA 1DUAA 1E1QD 1AVXA 2ZDKA 4BXSA 2WHXA 1YGCH 8LPRA 3UNSA 4RKOB 1SGDE 4JZ1A 5LGOA 4O97A 3ZZ6A 4LZ4B 1IQNA 2RCEA 1SFQB 1F92A 1NESE 4AFUA 2SGAA 3MOCA 2J9NA 2VVCA 2ZKSA 3ATKA 2OC0A 2SNWA 4THNH 1PPFE 4E06H 4ISNA 1GI4A 4FU9A 1BT7A 4R8TB 1GPZA 5CMXH 5I25A 1P3CA 2GGVB 2RDEA 1Q3XA 2ZI2H 2J95A 5AF9H 1XUFA 3M3VA 3QK1A 1ZJDA 4TPYA 1OPHB 2WPJS 1C5ZB 1OWJA 1SKYE 3Q3KA 1DS2E 1W13U 3FN8A 3SUFA 1NRQH 1KLTA 3HGNA 2VBCA 4MG3A 2A31A 2PGBB 2CHAC 3F9HA 2GDEH 1N8OC 2BY5X 2WV5A 4WH6A 7GCHF 2LELA 1Q31A 3E91A 1GJCB 3PMHB 1O3CA 3UWIA 1H4WA 2WV9A 5T6GA 3OTPA 1K1NA 1PPGE 3OEED 3SQEE 3VB4A 1GI3A 4K8YA 2ZP0H 3DUXH 3QO6A 1RRKA 3FKSD 3SUDA 5C20A 3P8GA 4QT8C 4ABGA 1VITG 1P9UA 2ODYB 2WUBA 1W0JD 4INHA 3E0NB 3ENSB 2EEKA 5TCAA 4ACBA 4X6PA 5T3HA 1P05A 4I31A 5GCHG 2XC0A 2GCHF 2ZDLA 1HIAB 3PWBA 4ZKSU 2C8WB 2NU2E 3C1KA 2R0LA 1P2OA 1C1RA 2QN5T 1G3BA 2QXGA 4H6TA 1YPHC 1E1RD 3LJJA 2AEIH 1CGJE 1P06A 5C1YA 3TH3H 1AN1E 3ZZ7A 2VNTA 1O2ZA 3S7HB 3VG8A 5KEDA 2P8OC 4B76A 1O39A 4Z0KA 2XWAA 1Z8RA 2QF0A 2BD4A 3MQKC 3RU4T 1D6RA 3LU9B 4X2VA 2ZPRA 4FU7A 4X6MA 2LP6A 4VGCC 2F9BH 3TITA 1P2QA 4IMQA 1V2PT 1D9IA 4K1EA 1GBKA 1O3BA 3BN9A 1W3CA 2YNAA 2WPLS 1GGDC 4Q7XA 2VWLA 2KR7A 4AG1A 1DWEH 1GVKB 1QY6A 3KQCA 3V3MA 4CR5A 4GSOA 4HGCA 1LMWB 1SGPE 4MPXA 1RTKA 1GI9B 1P10A 1BMLA 4BTUB 1O2XA 1EPTA 1HYLA 5JYIA 1TOCB 1Y3XA 1SMFE 3PLPA 1ZPZA 1RJXB 1V2QT 2XBWA 3VXFH 3DSGA 4BAMB 3ZYEA 3SGBE 1DFPA 2A0QB 3LGWA 2ZDVH 1JRTA 4UDWH 1AZ8A 4AZ2B 3PMBB 2AERH 4DIHH 1EJAA 3AAVA 1P3EA 3TJVA 3I29A 3R0FA 1O3EA 2FPZA 2TPIZ 3S9AA 3SYJA 4B2CA 3QLPH 2ZFPH 1MKXH 3O8RA 2FOGA 4B73A 2GT7A 1ETTH 2HPPH 3GCOA 2STBE 1BTPA 4I8GA 1HAGE 1P2MA 2ZFSA 3RC5A 1FQ3A 1NFWA 2FP7B 3RMMH 1TA6A 2QF3A 1K1IA 3M37A 4XRNA 4Q80A 2XWBI 1AFEH 3TK6A 5DPAA 5EQSA
chains in the Genus database with same CATH topology
1NN6A 2AFQB 3A7TA 1GBIA 1NFUA 1DSTA 2FX6A 3SHCH 2Z3DA 2ZDMA 3FP8E 3KQDA 2H5DA 3Q76A 3IG6B 4A5TS 3PWCA 4E7NA 3HK3B 2W5EA 3LIWA 1QGFA 1UK4A 1ZRKA 4X2YA 1S5SA 3DD2H 1H8DH 6LPRA 1K28D 1IQFA 3TLOA 1KTSB 3S0NA 2BDGA 1YKTA 2FWWA 1BJVA 1W10U 3SU3A 1PPZA 2PFEA 4IN1A 2VIDA 1RTFB 3MH7A 1HUTH 1XKBC 4ISIH 1EASA 1SI5H 5JB8S 1F0UA 1FZZA 2OBQA 3M36A 1GI6A 3P95A 1F0TA 1EZXC 4AFQA 1ZHRA 3SNBA 3EAJA 2FMJA 1YPKH 1AE8H 1UTMA 1V2ST 3H5CB 4YT6H 1CHOG 1TE0A 1UTOA 1BRUP 1JXPA 3KCGH 1ELCA 1E34B 3UWJH 3QN7A 2GT8A 2JKHA 4VGCB 2VJ1A 5EW1H 2F9UA 4ABJA 4Q2KA 1GJ6A 3MU1A 3SUGA 1PPEE 2G55A 2WV4A 4PROA 1Z71A 1O2WA 4U01A 1DITH 4YM9A 1BHXB 2IOTA 4FVDA 4ZROA 4R0IA 3PB1E 2VVUA 4BTIB 1GBCA 2OLGA 2P95A 3RXOA 5E8EH 1B7XB 3M3SA 3LH1A 1ELFA 1SHHB 3MH6A 1RXPA 1C2IA 5LPEA 2SGPE 3CS0A 2ZGCA 2WYGA 2TBSA 3QGNB 2AMPA 2YNBA 4I7YH 2ZECA 4AB9A 1QBVH 3T29A 1GBJA 1AQ7A 1UTKA 3MU4A 3NKKA 1M9UA 1YBWA 1LHEH 3JZ1B 1EUFA 3KN2A 3GCTF 3SU1A 1MBQA 2ZA5A 5FX5A 2QIQA 4ISLA 4YOIA 2AIQA 5TJXA 1IQEA 3SNEA 1H9LB 1LQEA 2ZFTA 3BEIB 2ZFQH 4DURA 1YPHE 2A2QH 1PFXC 1QQ4A 2Z9LA 2JH5D 2FXRA 1FJSA 1KLJH 1GBMA 3F1SB 2TGDA 1GHVH 4X1QU 1THPB 1K22H 4KKDA 1IHTH 4AYVB 1LVOA 1ARBA 4OS6A 3O8DA 1LVYA 1DOJA 1AUTC 3UQOA 1TBRH 1BTHH 2FLRH 2NWNA 1DY9A 4X6OA 2SGQE 2EI6A 1UVUH 4JYUH 4NWKA 2Y5GA 4X8TH 4Y10E 3E3TA 2FX4A 1GJDB 1UVPA 3LPRA 1E37B 2O8LA 1O38A 1C2LA 3GCHB 6GCHG 1ZOMA 1DPOA 2D1JA 1ANBA 4YLQH 4ZMAH 3PLBA 1ESBA 1N1LA 1TIOA 1ZTLA 2PHBA 1HAZB 3PMAB 3F9EA 1A4WH 2Q6DA 1QURH 3A82A 3EE0B 4ZHAA 1K1LA 2FOFA 2ZGBH 4ZHMU 1G3DA 2JH0D 2G51A 2GZ8A 3GISB 1GJBB 3AASA 4WMDA 4ZXXH 1LKBA 2C8XB 3BTME 4B74A 1C5NH 1NTPA 2ZTYA 3SV7A 1H1BA 3EGKH 1TPOA 5FCKA 1BTXA 2OC1A 5GDSH 1SC8U 1LDTT 3E0PB 3E90B 1NZQH 2SNVA 1SFIA 3P70B 1A46H 4WWYA 1EQ9A 3NWUA 3A85A 4JK6A 1BUIA 1ZHMA 1UCYE 1MAXA 1UMAH 1OSSA 2SGEE 4WMFA 2ZNKH 2C4FH 4FUIA 1DLEA 1OWDA 3TJUA 2ZCLP 2WPIS 3RMNH 1XUHA 1YLDA 3K6ZA 1ZTJA 4XSKU 1BTWA 1MZAA 3T27A 1IOEA 3T5FH 1QCPA 2QXIA 2AIPA 1HJAC 1S85A 1C1MA 3U69H 5DP7A 2ZHDA 1O35A 1BMNH 3GDUA 3SU0A 1NROH 1L2EA 3IWMA 1DWDH 3BTKE 3D65E 2BY8X 2Y81A 3A80A 4E05H 3U1IB 2ZU5A 2F3CE 1GJ8B 5HXFA 1BCUH 1WCZA 1JIMA 3OX7U 1ESTA 3RM0H 1V2OT 5DP4A 1UK3A 3SI3H 5E0HA 1GMDF 3C27B 1JOUB 2BDBA 2GKVE 3NCLA 5A09A 3KF2A 3BTWE 1QB1A 1YYY1 1F5LA 3PYHA 1SGYE 3MU5A 2V3HH 1THSH 1SHYA 2BZAA 1WYKA 3A84A 1A61H 2IJOB 5AVDA 4D9RA 1AB9B 1AE5A 3OYPA 5FPTA 2BVXH 1HDTH 3A81A 5F6MA 1BHXF 4XDEA 1DXWA 2BM2A 1MTSA 4AN7A 1C2JA 3V12A 7GCHG 1IQJA 4KTCA 1MKWH 1S83A 5EQQA 4LZ1H 3SBKA 4MPVA 1NRPH 2EA3A 3SORA 2BD2A 3ATLA 3V13A 2EI8A 5EPYA 4CHAB 3PROA 4Y6DA 4YESB 4D76A 2ZIQH 5JBAS 3BEUA 2A1DB 2BDHA 4O3TA 5DP5A 3S7KB 1O31A 1O2JA 3SW2B 3MU0A 2FODA 4NSYA 4X8VH 2Y5FA 1C9PA 3RXFA 5DG6A 3GY6A 2PUXB 1GJ9B 1ABJH 4U30A 1C5LH 2ZHQH 3ODFA 3BG4C 4A1TA 5CE1A 3T26A 3A8BA 1G3EA 2GDDA 3DA9B 4JZEH 3ZZ3A 1MKWK 2BVSH 2HRVA 4IC6A 1O2KA 2Q6FA 2FOBA 1ZPCA 1ZHPA 1GHBF 3DHKH 2BHGA 1LHFH 5C67A 1AGJA 2I6SA 1O2IA 1P03A 4A92A 1AI8H 1YP9A 1SLWB 4AB8A 1TNLA 5K7RA 3ZZDA 3M7TA 1D6WA 3A7ZA 1QJ7B 4OS1A 5DP9A 4CRFA 1O3IA 1MH0A 1BMAA 4NIWA 4NWLA 4I8JA 1QJ1B 1GCTC 1DSUA 1V2LT 3E1XB 3ZVFA 1C4V2 5DJ7A 4DJZB 1C4Y2 3OTJE 4MVNA 2GZ7A 3L3TA 1Z8IB 2OCVB 3VB3A 1EB2A 1GBTA 1AFQB 2EC9H 2JH6D 4Q7YA 3ATWA 4ZUHA 1FY3A 3UIRA 1KXEA 1GHWH 3RU4D 5JBTA 1O3DA 4NZLA 3I77A 1TWXB 3TH2H 4KGAA 4FUFA 2BOKA 1P01A 4GPGA 1AMHA 3LGIA 1ZJKA 1J15A 4WMEA 2A7HA 4Y79A 1TQ0B 3MO3A 2QXHA 1O5DH 2ZCHP 5LPFA 2O9QA 1TGTA 1V3XA 1W12U 4FUEA 1LQDB 3ZVBA 1T7CA 3SZNA 1WTGH 1HFDA 1GMDG 1NY22 4ABAA 5F8XA 2BTCE 3A87A 3FZDA 3E6PH 1CQQA 4SGAE 2RA3A 9ESTA 1QL7A 3K6YA 4WXVA 1GHAF 4D7GA 1ZSLA 4A1XA 3SGQE 3UNQA 3TK9A 4BOHA 2BD5A 1HAVB 2H1UA 2D2DA 3U1JB 1MU8B 2Z3CA 1SQOA 1AD8H 2FESH 1Q2WA 1C2EA 2Y5HA 3SJIA 1Z8GA 1ZZZA 3P6ZB 1PPHE 3RXJA 2V0BA 4GAWA 1RGQA 5F03A 1PJPA 2PUQH 3UOUA 1TX7A 1T32A 5DKMA 2BDIA 2ZU3A 4I8KA 4NIVA 2P59A 1GJ5H 1LHDH 1AKSB 3Q00A 5EGMA 3U8TH 4YTAA 5JBCS 4UONA 4F4OC 3D62A 1WQVH 5EOKA 1O3FA 2ZDNA 2QY0B 2BXTH 5E0GA 3SQHE 1OWKA 5I46H 1DT2A 3EYDA 3SI4H 3F9FA 4UD9H 2WPKS 3M5LA 5DP8A 1ZGVA 2HALA 5J4QA 2AYWA 4DCDA 1SGIB 1C5UA 1P9SA 1HPGA 9LPRA 4Y0YE 1IQGA 2BQ6B 1G9IE 1YCPM 2KAIB 1TGBA 1GCDA 1D3QB 1ELGA 1ELVA 3P8NA 2R3YA 4M7GA 3RU4E 3B8JA 2FOHA 2A4QA 1C2FA 4K3JA 3IITA 4ABEA 1FY1A 1ETSH 2ZEBA 1JBUH 1F5RA 1AVWA 4AGJA 1O2VA 4RSPA 2Y7XA 3RMLH 2YOLA 1SGRE 2ZU2A 1LVMA 2R2MB 2FS8A 2RDLA 4Y8XA 2FOCA 1SGNE 4D7FA 3UQVA 4BXWA 1O3NA 1V2VT 5T6FA 2GX4A 1L1JA 1OS8A 1TNJA 2G5NA 4ZKRU 3GYLB 3SGAE 4B2AA 1FV9A 1O33A 2A4RA 1OP8A 4CH8B 3V7TA 2B5TB 3UR9A 4NIXA 4YO9A 4I8HA 4CBNA 3RXGA 2FOAA 1UTQA 3URDA 1AUJA 2Y82A 5HM2A 1Y3VA 3RXRA 4X8UH 5IDKA 3H7OA 1P0SH 1MMJN 1V2UT 1GDUA 1KXBA 3RP2A 3MNCA 2CV3A 2CMYA 3GY2A 1V2TT 1SBWA 3HPTB 1SGTA 1NRSH 1S0RA 1TRYA 2Y6TA 4YOJA 1TABE 5ABWA 3RXSA 2PWXA 1SB1H 3K2UA 4JZIA 4I8LA 4NG9H 1HGTH 1H9IE 6ESTA 3BTDE 2F9PA 1MZDA 3F6UH 1OYTH 1Z6EA 1NU7B 2P93A 1C2DA 4ABIA 1E36B 3TGJE 4MDSA 2HLCA 3QTVH 2PSYA 3SU4A 3UNRA 2QYIA 3T25A 8ESTE 1Y59T 1QRZA 1C2HA 1MTUA 1TGCA 2G5VA 4X1PU 4ZXYH 1EJMA 1CGHA 2QCYA 1ARCA 3A7WA 4DG4A 2BD3A 1MCTA 2ZF0H 1NU9A 3GY7A 1O3PB 1PQAA 3L6PA 2OINA 4E7RG 3CP7A 3ESTA 1FONA 4UFDH 2VVVA 1SVPA 4OGYA 2GZ9A 2ZPSA 4IN2A 1J14A 1P2IA 1MQ5A 2G81E 1K1OA 1XXDA 2VIPA 3A8DA 3GCTG 2Y7ZA 1SGFG 2PKAB 3LONA 1SG8B 3RXVA 3SN8A 1ZMJA 2VWMA 4Y7BA 3BTFE 3FP6E 1L4ZA 4DIIH 1DLKB 2B7DH 2FI5E 5FX6A 1LTOA 1TMTH 1EAXA 2P3FH 4HFPB 3SU2A 1GHAG 1DANH 1GDNA 1OP0A 3P17H 2PTCE 1Z8JB 8GCHF 4YT7H 3HATH 2ALPA 4MNXA 1GBHA 1IQMA 1A1RA 4Y0ZE 1XX9A 1QBOA 4JYTA 2GV7A 1AY6H 1O2RA 3SO3A 1TB6H 1ZTKA 3T62A 3ZVDA 2HGTH 5CHAC 1SR5C 1WQSA 4NZQA 1Y8TA 2D8WA 2PR3A 1SGEE 3UUZA 2C90B 4IC5A 4J1YA 3LGUA 3RLWH 1KSNA 2W7SA 4AOQA 2FI3E 3OSYA 8KME2 4WY3A 1MAYA 1DVAH 1TLDA 1SGCA 2A2XH 1F0RA 5TCCA 1GMCF 2BDCA 1SSXA 4D8NA 4NIYA 1TX6A 2H5CA 5B6OA 1MCVA 2GMTB 3RXMA 4IS5A 4KTUA 1XMNB 3A7VA 1TYNA 2GCHG 1GVZA 5DK1A 1RD3B 1C2MA 3B23B 4MTBA 3VB7A 2ZFFH 4AFZA 2XCFA 3ZVEA 1AHTH 1TOMH 5EU8A 1GBFA 4YOGA 4H4FA 1LCYA 1T31A 1P04A 4K2YA 3MI4A 4NA8A 2BMGB 2OXSA 1O3JA 1C5MD 3U8RH 1Z1JA 1TALA 1NS3A 2ZGHA 2NU0E 2QAAA 2ZO3H 1XUKA 2Q1JA 1ZGIA 2VH6A 5C3NA 3MMGA 4JCNA 1ELDE 3GCHC 1IAUA 2BX4A 2THFB 2VWOA 5PTPA 4Z6AH 4U32A 2NU1E 1C5TA 4ABBA 1DE7H 1T4VH 5FBIA 5BRRE 2BXUH 1MU6B 3BTGE 4ZH8A 5DP6A 2TGAA 1V2NT 1EPTB 5EXMA 1WBGB 2OUAA 3JZ2B 1P2NA 5EODA 3A83A 4NGAH 2FIRH 4X1SU 1TNHA 2P94A 1C1NA 1TNGA 1C1SA 2Z9GA 4HTCH 3BTEE 1P11E 3LGYA 1KYNA 1A5IA 4X2XA 2B9LA 4BANB 3SJ8A 1VCWA 6GCHF 2ZGXH 1AWFH 1BA8B 2ZTXA 3HKIB 5FPYA 4U2WA 1JWTA 3ZVAA 3TJOA 1YF4A 1T8MA 1TNKA 2CN0H 2XXLA 3CS7A 4K1TA 5FAHA 1TNIA 2NU3E 5F8TA 2O8WA 5JBBS 2B0FA 5A0AE 3MYWA 2ZDAH 2Z9JA 1PYTD 2J2UA 3DFLA 4WVPE 2FDAA 1BIOA 4X6NA 3M5OA 3N7OA 4B71A 1VGCB 4CRGA 1D3DB 1UHBB 1V6DA 2R0KA 1O2HA 2M5TA 2OC7A 1YM0A 1HJAB 1W8BH 1GMHF 5C5NA 1C1WH 4XOJA 1EOJA 1HJ8A 3TJNA 2G8TA 2AS9A 1TGNA 1O3LA 1D3TB 2FS9A 4FVBA 4CRCA 1FAKH 1TONA 4Y76A 1O3GA 3FFGA 1ACBE 4RN6A 3QZQA 2ZHEH 1O32A 1ESAA 5L2YH 4I32A 4JYVH 5ESBA 1E0FD 1V2JT 5GWZA 5LPRA 1UHBA 5BPEA 1C5SA 4XE4A 1N6XA 1NRNH 1PPBH 1C5PA 1AVGH 3A86A 1G36A 2TGPZ 1QBNA 1VJ9U 2FZZA 1C5RA 4OS5A 2WPHS 2A7JA 4XBDA 3KNXA 1K2I1 4DW2U 1A7SA 5DGJA 2DE9A 4Y8YA 3PMJA 1TQ7B 1ID5H 2UUFB 5EG4A 3MWIU 3OU0A 2A4OA 5E2PA 1YLCA 3QUMP 4OS4A 4F49A 1ORFA 1TFXA 2VIOA 4Y71A 1RIWB 1SQAA 1MBMA 2OP9A 1F2SE 4MNWA 1UTJA 1QFKH 2ZHFH 3K9XB 4NFFA 4GCHG 1RTLA 1EPTC 4I33A 1EP6A 2ANKH 3PV4A 1O2YA 2ESTE 4MPWA 1BITA 1CT4E 1O3HA 1TRNA 3LH3A 5A0BA 1ZMLA 5AFZH 1HV7A 5A8ZA 1ZPBA 3LT3A 1LKAA 1OXGA 5DP3A 3RXTA 2G52A 1IQKA 3RLYH 1PQ5A 1FY4A 1Z6JH 1O2UA 2ZZUH 1TBZH 2ZPQA 3MH5A 4X1RU 3P92A 3I78A 3AW1A 1MKXK 4UE7H 1V2RT 2OC8A 3GYMA 4JMYA 1IQIA 2PKSB 1K1PA 1VITF 3BG4B 2QA9E 2BX3A 1O3KA 4KTSA 1QA0A 4BNRA 3RXIA 2PTNA 3RXPA 4Y11E 1PQ7A 3O8BA 4GVUA 5E0JA 1HIAA 2A32A 1BRAA 1QNJA 4UFEH 1H8IH 1QB9A 2TGTA 3TGKE 1LPGB 1W7GH 1J17T 1V2WT 4K60A 1PYTC 4CRDA 1A0HB 5L6NH 1FLEE 1G2LA 1YPEH