1K2I1

Crystal structure of gamma-chymotrypsin in complex with 7-hydroxycoumarin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
245
structure length
236
Chain Sequence
CGVPAIQPVLIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYTPDRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMOTRYPSINOGEN A
publication title Crystal structure of gamma-chymotrypsin in complex with 7-hydroxycoumarin.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 236
sequence length 245
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 2001-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k2i102
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k2i101
1TA2A 3BTHE 2GCTC 2D2DA 1LHDH 4BAKB 4YM9A 1JOUB 1TGCA 2ZFFH 1SOZA 3NKKA 4WH8A 1DX5M 2VU8E 5EQRA 1UK4A 1EQ9A 2QXHA 1P01A 1P2MA 3P92A 1TPAE 3ZZAA 2O8LA 1AHTH 1ARBA 1PQ8A 1N8OC 2Y81A 2JETC 2ESTE 2VWNA 4X8UH 1QR3E 1HAYB 1GBDA 1QCPA 1O2OA 1OKXA 2W26A 2Q6GA 1XX9A 2ZTXA 3H7TA 2FM2A 1HAPH 1UTKA 3TK5A 1WBGB 2P3TB 4Z0KA 3A81A 2J95A 1P2KA 3GY7A 7KMEH 3SV6A 3SBKA 2J34A 2XC0A 1QQ4A 1G3BA 5FPSA 5JPMH 3SV9A 1HAVB 1O36A 2GT8A 2QXJA 1S0RA 5DP7A 1C5WB 3QLPH 1NM6A 1D4PB 1IQMA 1J16A 1F0RA 1P2OA 2G51A 3ZVAA 5C3NA 4OS7A 1OYTH 1YLCA 2OLGA 1E0FD 2ASUB 2V3OH 3BN9A 3SHAH 2G5VA 1SQTA 1J15A 1O2VA 2WPJS 1WQSA 4FUGA 1TLDA 1O3IA 2VVUA 2ZPRA 3UOUA 1GVKB 3BSQA 1G2MA 1JIMA 1O39A 4X2XA 5L6NH 1AIXH 1QHRB 4UEHH 3T2NA 4LOYH 1P09A 1D3PB 1GBCA 3L6PA 1SGEE 4XBCA 3TK6A 1C5NH 1O3GA 4IN2A 1LHCH 3GY6A 1ZOMA 4X6PA 5T6FA 4A6LA 5DGJA 2XC4A 2W3IA 1EXFA 1NROH 4VGCC 3TIUA 1CE5A 1NY22 1O3EA 1O2JA 1XUJA 1MCVA 1Z6JH 1EP6A 1SMFE 5C2ZA 3A7TA 2P94A 2RA3A 4DT7B 4ZAEA 5E2OA 1DT2A 5SGAE 1D9IA 4X6OA 2SGPE 4ABAA 2ZFSA 3A84A 3K65B 3UNSA 4E05H 3EA7A 3SU5A 1CGJE 3TJNA 1DM4B 1K1PA 4JZ1A 1DLKB 2ZFQH 2BLQA 2VIVA 2FTMA 2J4IA 4R8TB 1GI7B 1CU1A 1HDTH 5AF9H 1AU8A 1YPEH 1W3CA 3GY3A 1MTNC 2EI7A 3ZYEA 5DP4A 1DLEA 1O5DH 3ZVDA 1HNEE 1SQOA 4AX9H 4ZUHA 1O2YA 3HGNA 5C20A 1FONA 2ANKH 1A5HA 3MO9A 3U1JB 3ZZ9A 1O35A 1P3CA 1E35B 1BMLA 2ZDLA 3PMJA 4M7GA 4K5ZA 1JRSA 4XSKU 5C5OA 4KTCA 3TH2H 1QBOA 2A45B 4OS1A 1TNIA 1A1RA 1FN8A 1O33A 1RIWB 2V3HH 1E38B 4SGBE 2C8WB 2O9QA 3SV8A 4ABFA 2FODA 3GY5A 5EXLA 3K6ZA 4XE4A 3M3SA 3RU4D 3SU4A 2ZC9H 4Y10E 2WV5A 1GHAG 5TCCA 1GBFA 1LVOA 1P2IA 1ELGA 3TH3H 1MU8B 3QDZB 5DKMA 1SGIB 2OP9A 1GBLA 2ZGCA 5CHAB 1KXEA 3SUDA 2NU1E 1O32A 1C5MD 1CHOF 3RXPA 4ABIA 1GCDA 2AGEX 1SQAA 4Q7YA 2OINA 3BTDE 1MMJN 3AAVA 2GMTB 2ZECA 1O5FH 5FXLA 2RA0A 2P8OC 1ACBE 1CVWH 2ZA5A 3VGCB 1BMMH 2K1QA 3ZV9A 1OP8A 2A2XH 4FU8A 4INHA 4X0WU 1GDUA 4OGYA 1XUHA 2O8WA 4I8LA 3IWMA 3STJA 1QRZA 4HZHA 2FS9A 1HXEH 2JH0D 2QXGA 2SGAA 3KNXA 3LOXA 1VJ9U 1TBZH 4KKDA 1VR1H 1ESBA 1A5GH 5GIBA 3EA8A 3QUMP 5A8XA 1TNGA 5JBCS 2ZDVH 3TJUA 3RC5A 5FX5A 2DE8A 2KAIA 1W14U 4LK4A 2A7HA 1QRWA 3DFJA 2F3CE 2BOKA 4Y8YA 2VINA 1ZSJA 1V6DA 1ZRBA 4A7IB 1O2MA 3E90B 1ZLRA 4LZ4B 3O8CA 4Q80A 2PKSB 3E3TA 5HM9A 2F9VA 2ZU5A 1ZHRA 3NWUA 1ELEE 4XOJA 3T28A 2Z6BD 4AFZA 1GBTA 3BV9B 4I8HA 1QL7A 2Z9IA 3RXSA 3E16B 2PSXA 1BQYA 2BY8X 3AW0A 1GCTC 1BJVA 1C5XB 1TBQH 3RXGA 4BAHB 1WQVH 2ZIQH 1W0ZU 5C1XA 4TPYA 1G2LA 3GYMA 3PYHA 2BVSH 4XBBA 1EATA 1QJ1B 4BNRA 5DJ7A 2Y80A 1GMCF 4AYYB 2C93B 1EKBB 2GP9B 1FY4A 4IGDA 4DURA 4BTTB 2H2ZA 1PQ5A 2QV1A 1TOMH 2A7JA 1GJ7B 3RDZA 4D9RA 3LC3A 1O3AA 3QO6A 4YO9A 1T7CA 1YPMH 3GCHB 1HBTH 1K1OA 4DGJA 4XDEA 4NSYA 1TE0A 1LHEH 1HXFH 3D49H 1C2FA 3FP7E 4YLQH 3FVFB 3RXMA 1G37A 1GBHA 2EC9H 3SZNA 2H9HA 4GLYA 1HAZB 1LHGH 1UHBA 3MOCA 5B6OA 3DA9B 1N1LA 4X8TH 5DK1A 4B74A 1JIRA 1AMHA 1P06A 4FU7A 1ZR0A 1BBRE 1MCTA 1PPCE 4Y8XA 3M37A 4MNXA 3PWCA 4I7YH 3T27A 3F1SB 4TYDA 1MD7A 4BTUB 2ZDKA 1DSUA 2AEIH 1XUKA 2A4RA 1G36A 1TWXB 1IQLA 2BD7A 2CN0H 2Z7FE 3ZZCA 4AZ2B 3A7VA 1ARCA 1O5AB 1T32A 1INCA 3ESTA 4OS6A 3RXKA 1BRAA 1Y8TA 4BOHA 5AFYH 5GCHG 1GJ4H 2QIQA 1CHGA 1G9IE 1SLVB 3PLPA 4ABJA 4D9QA 1NN6A 2GCHF 1CT0E 1LQEA 3RLWH 1YP9A 1KXFA 5HYOA 3KIDU 1YKTA 8ESTE 3UR6A 2Z9KA 4H6SB 1E34B 3ZV8A 4Y11E 1XKBC 2UWPA 2OQUA 4Q7ZA 2WPMS 1C5QA 5E0GA 2O8TA 2F9OA 1FZZA 2ZPQA 3KQEA 1KXCA 3MFJA 1EUFA 2PKAA 4BTIB 1FV9A 1TFXA 3P70B 4MNVA 2R3UA 1GI2A 1XUGA 1C1RA 3S69A 3AASA 2OXSA 4DCDA 3H5CB 1ZGIA 1OX1A 3N7OA 1SGFA 2O8UA 3MU8A 4UD9H 2OC7A 9ESTA 1C4V2 1HYLA 1VGCC 1ZHMA 1MQ5A 2C3SA 2ZHFH 1LKAA 4K60A 3BEUA 1BBRK 1H9IE 2C4FH 3U69H 5L30H 2VGCC 4X6NA 4WXVA 1CA0B 1KDQB 3O8RA 3E0PB 4B76A 1TONA 4E06H 3FP8E 1BB0B 2BY9X 1KXDA 4INLA 1UVTH 1H1BA 1TRNA 4B2CA 1TIOA 2GZ8A 5A0CA 1VZQH 2VH6A 1UVSH 4RN6A 1GI5A 5J4QA 3LDXH 2FOEA 3MH5A 4Y79A 3RMNH 1OWEA 3NUMA 2WPLS 4I8GA 4MPXA 1MU6B 1NU9A 3M61U 2CXVA 1NU7B 1O3PB 5HXFA 1GI8B 3BTKE 5AHGH 1K21H 1LDTT 3FZZA 3M7UA 3P6ZB 1VITF 3PO1C 2JETB 1AGJA 1A0LA 4WMDA 1OWIA 3RXDA 4GSOA 3DD2H 1ELVA 5DO4H 2CF9H 1X7AC 1K1JA 3M5MA 5G4BA 1LVYA 1XVMA 4XBDA 3MTYA 3OSYA 2A5IA 4QT8C 2FI4E 4ABGA 4AORA 4NIXA 1MKXH 5J4SA 2P3FH 1C5LH 2TGTA 2TRMA 2H5CA 1XKAC 2WPKS 4NA9H 1XUIA 1QL9A 4JYTA 4GAWA 2BD2A 2VJ1A 1FN6A 2LPRA 4O3TA 1PPHE 4ABEA 1B0EA 4FVBA 3PTNA 1YYY1 1NRSH 4ABDA 3KGPA 1A7SA 4AN7A 2ZQ1A 3A87A 6ESTA 1HUTH 5C1UA 3JZ1B 2P95A 1CT4E 4MPUA 4I31A 5TJXA 1O34A 1DY9A 1YF4A 5C1YA 2TGAA 1GL0E 4THNH 5LPFA 1V2NT 1WTHD 4X2WA 3P8FA 5F8ZA 1ZSLA 1BTPA 1T8NA 2EI6A 1OPHB 4TWWA 2Z94A 1P04A 3A80A 4F49A 1V3XA 2PV9B 2Y6TA 3G01A 3SJKA 3SW2B 4FU9A 2BQ6B 1GI0A 2IJOB 4Q7XA 3MNXA 1RRKA 1C5VA 4LXBH 4I32A 3SJIA 2NU2E 4ZMAH 4DVAU 1B0FA 2D1JA 3KQCA 2PSYA 3ZZ7A 1O30A 4ZH8A 1Z1IA 3T29A 1C5RA 1RFNA 1W12U 1SLXB 1D3QB 2BX3A 3RXJA 2CGAA 2XCFA 4FUHA 4FUCA 2VWLA 3ATWA 1A0JA 5JBBS 2R0LA 2ZDMA 4Y0ZE 1V2PT 1UCYE 2HRVA 1NFXA 3MU5A 2A4QA 1DVAH 3PROA 1HJ9A 4CR9A 4YTAA 4CRBA 3GDUA 3A89A 1O2RA 2CJIA 4HI3A 3SNBA 4NZLA 4NG9H 1DXPA 1AUJA 2Z3EA 1U6QA 3F9FA 5ABWA 1WV7H 4IMQA 2G8TA 1ID5H 2A7CA 3RM2H 1Q3XA 3ZZ4A 1DWCH 4YLUA 1MTNB 1C1UH 1F92A 1P12E 1A46H 1Y3UA 4UFFH 3MH4A 2Z9JA 3C1KA 1C5YB 5FCRA 3ZZ5A 3QZRA 3LJJA 2G52A 1LMWB 1RTLA 1P05A 3RXFA 3BEFB 1GHVH 1T8OA 1AB9C 3BTEE 1SHHB 4GHTA 1O38A 1YGCH 2HVXA 2AGGX 1RXPA 2DE9A 3BF6H 3SUEA 1O2XA 1HGTH 4JZFH 4I8KA 1FY3A 4TY6A 3BTWE 3TU7H 4RKOB 1C1TA 1EZXC 1QBVH 4ZHAA 1SGDE 2F9BH 1TMBH 3Q77A 1IQIA 2QXIA 3UFAA 1AFEH 1ANDA 1C5SA 2VIOA 3TPIZ 3EE0B 1VCQA 3UNRA 1DWEH 1OYQA 5EW1H 3UUZA 3DUXH 2Z3CA 1C2IA 1PPGE 2G5NA 1GDNA 1CGIE 5H4IB 5FPYA 4FUFA 2P59A 1ELTA 6CHAB 2Y5GA 3BTQE 4JYUH 2RDLA 1P03A 4Q2KA 2XBXA 1UCYK 1GHZA 1PPEE 1SGRE 5I25A 4O97A 3L3TA 3ATMA 5ESTE 4X2VA 1DE7H 1F0TA 4ZXXH 1GBEA 3QZQA 1J14A 3M3TA 4FUIA 1GBIA 1GHWH 1GMHF 1KXAA 2QAAA 4KGAA 7LPRA 1AE8H 3FFGA 1S5SA 2PGBB 2ZGHA 4CRCA 4DY7B 1F0UA 4X8VH 1YCPM 2UUJB 1S85A 4ASHA 1DICA 1LPGB 2Q1JA 4GPGA 2XBWA 3ODFA 1KLIH 4DIHH 1ZTJA 1EOJA 1MAYA 1GI9B 4WH6A 2VIQA 3TNTA 3VXFH 1C4U2 3VEQB 3PMAB 1GGDC 3ATLA 1P9SA 3A85A 1NRPH 1V2JT 3R0FA 1BRUP 1A2CH 5ETXA 5HGGA 1C2LA 3ZZ3A 1CA8B 3DFLA 1E37B 2EEKA 2BD3A 5EQSA 2ZHWH 1MKWK 3RMLH 1GCTB 3F9HA 1C5TA 1B7XB 1AZ8A 4Y7BA 1LKBA 3TJVA 5LH8A 2WUBA 4B73A 1UTQA 1FIWA 2ZNKH 2ALVA 2XW9A 4KP0A 1T8LA 4CRGA 3TGJE 2P3UB 1GJDB 3LH1A 2UUFB 1Z8RA 5CE1A 2RCEA 3C27B 1Y59T 4WMFA 1BRCE 3GY2A 4NA7A 1XUFA 2FOBA 4IMZA 1AFQC 1TGNA 3S9BA 2ILNA 4TWYA 4AGKA 3EYDA 1EZUC 2SNVA 1C5ZB 2SGFE 2KAIB 1TGBA 2PHBA 2AIPA 1GG6C 4UFEH 4CHAC 3KCGH 2BZAA 2R9PA 1RTFB 2ZFPH 3SU1A 2BB4A 1HJAB 5AFZH 3UTUH 1AWFH 3TJOA 1MZDA 2JKHA 1UTMA 1F7ZA 1UJ1A 3UQOA 2XWBI 2OUAA 2CHAC 2QA9E 2EA3A 2AERH 5T6GA 3A8AA 2BHGA 3TGIE 1UO6A 1W10U 1C2JA 1A0HB 4ESTE 3M5NA 3AW1A 4KELA 1KTTB 5EG4A 4E7RG 4FUEA 2BD9A 1AVXA 4DIIH 1ZZZA 1CBWC 5GWZA 5JB8S 2GDEH 3SOSA 2STBE 3A86A 4IBLH 1RD3B 1AI8H 1C5PA 4K69A 1CHOG 1O3KA 1BZXE 1Z8GA 2H6MA 1DITH 2ZDAH 5EXMA 3T62A 2TGPZ 1EJAA 1F5RA 1SC8U 1Z7KA 1ZTKA 2GV6A 3OX7U 2A4OA 2BYAX 1ZJKA 1NS3A 1IQGA 1L2EA 3K6YA 3WY8A 4B2AA 1O3NA 2BQ7B 2AGIX 2AS9A 4NGAH 2AH4X 2G4TA 4UE7H 1UHBB 2BLVA 1ZJDA 1ELAA 2HPPH 3ATIA 4NCYA 4PROA 1P57B 3OYPA 1C2EA 1W11U 3M5LA 5DG6A 4K3JA 3RXCA 1Z8IB 2UUKB 2IOTA 1H8DH 2BDGA 3BTME 3FZDA 3RXLA 3FANA 1HAIH 3M7QA 2V35A 2ANMH 4K2YA 1W8BH 3B23B 1KYNA 1L1NA 1MZAA 1W0YH 3PMBB 3VB7A 1FPCH 3RXUA 1SOTA 2VGCB 1C1WH 2OD3B 1HV7A 2BLOA 1ZMJA 3UREA 2FXRA 1YPGH 3SU2A 5I46H 3E1XB 1EPTA 3LT3A 4O03A 5A0BA 1YPJH 3UOPA 2XNIA 2BQWB 1YM0A 4X1RU 2WYJA 3A7ZA 2G00A 1H4WA 1W7XH 2ODQA 1P9UA 3ZVGA 1DXWA 1F5KU 1GMCG 3KL6A 5C67A 4BXWA 1D3TB 3RMOH 1TRYA 1SI5H 2FS8A 2P16A 1AVWA 2QGRA 2AMQA 5EQQA 1NC6A 1K1IA 4H4FA 3CENA 1MAXA 3W95A 2PKAB 2GT7A 1IHSH 1NT1A 3TVJB 1O3LA 1O3JA 1LHFH 5EODA 4X1NU 2XXLA 4X1SU 1OWDA 1ZMNA 4KTUA 2ODYB 1L1JA 1ORFA 2WPHS 2RG3A 2ZTYA 5FAHA 1XVOA 1AZZA 1WSSH 1GDQA 3ZZDA 3MMGA 1BJUA 5FPTA 2BM2A 1GJ5H 4NSVA 1Z8JB 1V2LT 2W3KA 1FY5A 3MYWA 3SHCH 3GISB 2C90B 2ZI2H 2ZCLP 4A92A 4YT7H 4BANB 3PTBA 1S6FA 4UDWH 1EPTC 2OC0A 4HGCA 4OS2A 1RGQA 3V13A 1LCYA 1MBQA 8GCHF 1HJ8A 3NK8A 1S81A 2NWNA 1QNJA 1EZQA 1K2I1 3SV2H 1C5UA 5F6MA 2GCHG 1XM1A 3VB4A 1ETSH 3U9AH 3NZIA 1BMAA 3A8DA 9LPRA 3SNEA 1TAWA 3LGWA 3UWIA 1O3FA 3D62A 3P8GA 1BTXA 1YLDA 1PYTC 3KF2A 1KTSB 4RSPA 2FPZA 4U30A 3PMHB 2PGQB 2ZHEH 1PJPA 2GZ9A 2A32A 2BMGB 1TNLA 2ZU1A 4CRFA 4JK6A 1QA0A 2UUYA 3QTOH 1DSTA 2FOMB 3SGAE 1K1MA 1LO6A 6GCHF 2QF0A 3GCTF 2B9LA 1G30B 2FX4A 2BDHA 1KSNA 1SGFG 1GHBF 3QWCH 5EPNA 1MUEB 4NA8A 1VCWA 1OP2A 1JXPA 1ZSKA 3PB1E 1XXDA 1S6HA 1O2KA 1YCPH 1TPPA 4BXSA 1IQJA 4YOJA 1GI3A 3QTVH 1GMDF 2C8ZB 4BAMB 1H9HE 1PYTD 3P8NA 1FI8A 3ZVBA 3NCLA 1RIWC 1W2KH 1O3HA 4WMEA 1K1NA 3SU0A 3MH7A 3LGIA 1FAKH 4IC6A 3QX5H 4I8JA 3GCNA 1FQ3A 2QF3A 1KLTA 3S7HB 4FUDA 4GCHF 1GBMA 3I78A 4F4OC 1AB9B 1IQFA 1HFDA 1JBUH 5F03A 4AG1A 1SGQE 1WAYB 4WVPE 5EW2H 2ZP0H 1F0SA 1GHXH 1K9OE 1LPZB 1VITG 3SJ8A 4WXIA 2FI5E 1O2UA 2GMTC 2STAE 2C8YB 3VGCC 2SGEE 4FVDA 4MNWA 1ELCA 5DP6A 1AWHB 2FO9A 3TH4H 4D8NA 2GCTB 5HM2A 1D6WA 4A1TA 4B2BA 4J1YA 3M36A 2D8WA 2HWLB 3A82A 3ZVFA 3STIA 2R3YA 1P2QA 3V7TA 4HFPB 3HK3B 4MLFB 3F9GA 5HMAA 5E8EH 3VB3A 2CMYA 3E8LA 2VWOA 4NIWA 1DS2E 3LONA 4JZIA 1CO7E 1N8OB 3SUFA 2BDAA 2XWAA 1V2RT 2FLRH 1DWBH 3MI4A 5FBIA 3GY4A 3URDA 1HIAA 2ZU4A 1O3MA 2A2QH 1QTFA 1BITA 4D7GA 4U32A 2XC5A 1D3DB 4NWKA 1PPFE 1O2ZA 1D6RA 1V2OT 2PUQH 1VJAU 3SJ9A 1UTPA 5TCAA 2FLBH 2TPIZ 2G81E 1YPHE 1N6XA 1AVGH 3DHKH 3KN2A 2A5AA 1EAIA 4ZKNU 1PQAA 1SBWA 4ABHA 4BAQB 2FI3E 1ZPBA 1J9CH 1SFQB 3RUOA 1HAXB 1C1MA 1C5OH 2QYIA 4X6MA 1QY6A 1QA7A 2LNCA 4YOGA 4E7NA 4K1EA 1GBKA 2GVFA 1GGDB 1GBBA 2ZTZA 4YT6H 2ANWA 7ESTE 2VNTA 4A1VA 5A8YA 3LPRA 4DG4A 2UWOA 2FMJA 3SORA 3KHVA 1QGFA 1EAXA 1ZPZA 2BY6X 1Q2WA 4CBOA 2HOBA 2FOCA 3LJOA 3SQEE 1FJSA 3ZZ6A 3RXOA 3TK9A 1A4WH 5FX6A 1S83A 4JCNA 4BAOB 1T31A 2THFB 1YBWA 3BTGE 4MG3A 3ATKA 4VGCB 3U8OH 4A5TS 2FOGA 1TYNA 1GI6A 5F8XA 1YC0A 2O8MA 2XBYA 4AOQA 4CREA 2VVCA 1UVOA 3S9AA 1FY8E 2DUCA 3QGJA 4JYVH 1AFQB 5A09A 3LU9B 3RU4E 1HAHH 2FOHA 3UQVA 1W13U 1NPMA 2GKVE 3RXIA 1O5BB 4ZXYH 3RXHA 3VXEH 1PPZA 2VVVA 1C1QA 3GCOA 1AKSA 4CHAB 1WYKA 1MKXK 2ZF0H 2ZG0H 1FMGA 1FIZA 1TQ0B 3ENSB 2JH5D 4INKA 4Y71A 3UWJH 3MNBA 1TGSZ 2F9UA 1Y3YA 2FYQA 1HAOH 1KLJH 1WUNH 1BCUH 3URCA 1RJXB 2CHAB 2FEQH 1MTVA 1UVPA 4NIYA 1UVUH 1V2WT 3A7YA 1ESAA 2FDAA 2VB0A 3MHWU 1J8AA 1PPBH 4K8BA 5CMXH 1E36B 1MTWA 5JDUB 1CBWB 3M3VA 1BRBE 2FZZA 1W7GH 3O8DA 1GL1A 1YPLH 3SNCA 3RU4T 2PWXA 1TPOA 4WJG2 2BOHB 1Y5UT 1OSSA 3HATH 1DUEA 4XFQA 1HB0B 4NZQA 2I6QA 1TX8A 1SG8B 1IQNA 1QB9A 5DP3A 2B7DH 1ANBA 3PLBA 5EPYA 8LPRA 1FNIA 3Q76A 4SGAE 2A5KA 5IYTA 3RP2A 1V2TT 2OQ5A 1CA0C 2VIPA 1GMHG 1PQ7A 1S82A 1UK2A 3V0XA 7GCHF 4H6TA 1O2HA 1T8MA 2SFAA 1MD8A 2BY7X 1C1VH 2OCVB 2Z3DA 2PW8H 1OOKB 1FY1A 3TLOA 2P8OB 5LPRA 3GDVA 1THSH 5FBEA 4O9VA 2AFQB 2ZHQH 5LPEA 1UMAH 1AQ7A 3BG8A 1NO9H 1ZRKA 3ZZ8A 2W5EA 5JYIA 5L2YH 2BDYA 2BD5A 3UIRA 4H42U 1BHXF 1QB1A 1V2VT 4WWYA 1EB2A 1B5GH 1DOJA 4WF8A 3E91A 2BD8A 1SLUB 3M7TA 1QJ6B 3GY8A 2BXTH 1ZGVA 1FUJA 1QL8A 2PR3A 1L0ZA 1P10A 4DW2U 1NRQH 3R3GB 1RS0A 3F9EA 4K8YA 2HALA 1GVZA 2A4GA 5E2PA 1NESE 3CS0A 3SI3H 1OWJA 2AMPA 2BLWA 1DDJA 1HLTH 1G3CA 1SVPA 2FX6A 3AAUA 1DPOA 1NFUA 4LZ1H 3HPTB 1ELBA 2ZCHP 3SQHE 1O5CB 2A0QB 5A0AE 4D76A 1P0SH 2G4UA 3SO3A 4ABBA 1YPHC 2QY0B 2PFEA 3Q3KA 2I6SA 5GPIB 3BG4C 1LVMA 5LGOA 1TMUH 1WOFA 2V0BA 3MU4A 3SNDA 1O3CA 2B8OH 1P2NA 1BIOA 4CRAA 5F8TA 2ZGJA 1ZYOA 3SU3A 1M9UA 1ELFA 3BTFE 1BA8B 1QFKH 1AN1E 2G55A 4K1TA 4MPVA 3ZVEA 1EPTB 3NPSA 3RXRA 1QBNA 1SGTA 1TNKA 1K22H 1L4DA 4WY3A 2WUCA 3F6UH 3F68H 4Y7AA 3M35A 2Q6DA 3LKWA 1VCPA 2BXUH 2WPIS 4ZKSU 3K9XB 5DPAA 2OBOA 2ZQ2A 1T4VH 2Z9GA 1GJCB 1THPB 1K1LA 3BEIB 4AFQA 1NFYA 4DOQA 1LVBA 2HNTE 2QC2A 2VWMA 3OU0A 1WCZA 4IW4E 3KQDA 4Y6DA 1SGNE 1GI4A 5GXPA 4O3UA 3Q3YA 5BRRE 3T5FH 2XTTB 1DWDH 3VFEA 4CH8B 3S9CA 1O2PA 1GJ9B 3A8BA 4GUXA 1L1GA 1K28D 1XMNB 1SSXA 3EA9A 1C2GA 1JRTA 2QCYA 1KXBA 1TALA 3D65E 1KY9A 2NU3E 2BY5X 3Q3XA 2W7SA 3MU0A 3Q00A 1EAUA 3JZ2B 1THRH 2HGTH 1GBAA 1TOCB 2BVXH 1CSOE 1N6YA 2ODPA 3A88A 1HAVA 1TA6A 4MTBA 1ESTA 4FXGH 3QGNB 1UTJA 3GYLB 1Y3XA 1O5GH 3SGQE 2FYRA 3P95A 1VGCB 3RC4A 1H8IH 4ZROA 5BPEA 4OS5A 2VIDA 3W94A 1MH0A 4AGJA 4MVNA 2OTVA 6CHAC 2BDBA 1IQEA 1HPGA 2D26C 4X2YA 4AG2A 5EOKA 5DP9A 2ZZUH 2J9NA 2GX4A 2TIOA 3SGBE 2ULLA 4Y76A 1NZQH 3SJOA 2YNBA 1C9PA 3IITA 4ZHLU 3HK6B 1SL3A 2P93A 1GHAF 2Y7ZA 1ZPCA 1TNJA 1V2ST 1QURH 4JMYA 3VB5A 1UTOA 1BMNH 1NRNH 1T4UH 4X1QU 4UFDH 3PLKA 4TY7A 1SR5C 2QN5T 3RMMH 2H1UA 4KTSA 2Y5HA 1XXFA 5T6DA 1C1OA 3PO1B 1ZTLA 1Y3WA 2ANYA 1SLWB 1O2LA 2BTCE 4ISLA 4NFFA 1C2DA 4IN1A 1BTYA 3SU6A 2PTNA 1S84A 5EGMA 3MNSA 3T26A 1GVLA 2PTCE 2ZHDA 3MO6A 2FTLE 3GOVB 1MBMA 8GCHG 1BT7A 3V3MA 1P8VC 2JH6D 1V2QT 3FAOA 1NTPA 3MNCA 1TGTA 2F9NA 2XRCA 1LQDB 1TPSA 2FWWA 1AD8H 4JK5A 4GVUA 3A83A 2SGQE 2HPQH 3SUGA 3EQ0H 1C1SA 3UNQA 2SNWA 2BDIA 1VITH 1ABJH 2HNTF 1O2QA 3LGUA 4MPWA 1DANH 1YPKH 2B5TB 2VH0A 1QJ7B 1HRTH 1LPKB 1C2HA 1IQKA 4U2WA 1O31A 3OY6U 1O2WA 4AB9A 1WTGH 3GICB 6GCHG 1Z6EA 3GCTG 1WU1A 2FIRH 2J94A 2HLCA 2GDDA 1C2KA 1O3DA 3HKIB 2XBVA 4DJZB 3OY5U 2WYGA 5E0HA 1GHBG 1KIGH 1P02A 1FAXA 1O3BA 1UK3A 4NFEA 2NU4E 5E0JA 1O2TA 1ZHPA 1BBRH 1OWKA 3QN7A 1HJAC 2AMDA 3QK1A 3AVZA 1HIAB 1ANCA 4B75A 3RXBA 1DUAA 1GMDG 1OWHA 4JZDH 1G3EA 2Y7XA 3LC5A 1LTOA 3S7KB 1DFPA 1OS8A 2YNAA 3NXPA 1HAGE 1TMTH 1AO5A 2AYWA 5EXNA 1SB1H 2WINI 2F83A 4OGXA 5ESBA 2H9TH 1O5EH 5A2MH 2ZDNA 4GCHG 3UPEA 1EB1H 3UR9A 2HNTC 4B1TA 4Z6AH 2GD4B 2J2UA 5JBTA 1MQ6A 3SI4H 3RXTA 2ZKSA 5DP5A 4YOIA 1FPHH 4YZUA 1P3EA 3EAJA 3B9FH 2J38A 3PM3A 4IS5A 1GHYH 2H9EH 1C2MA 1TRMA 2FOFA 5L2ZH 3MO3A 3BIUH 3UY9A 4AB8A 5GDSH 1GWAA 3D23A 3VB6A 3SNAA 1O3OA 1RTKA 5CHAC 1BDAA 2UWLA 2ZGXH 3RXAA 3M5OA 1PFXC 2BZ6H 1SFIA 5GCHF 2B0FA 2SGDE 1JWTA 3RM0H 1BTZA 4ISHH 1UTLM 3RXVA 1QB6A 2Y5FA 1GI1A 6LPRA 3DT0H 5EU8A 2V6NA 1Y3VA 2ZFRH 5DP8A 4ISNA 2ZPSA 4Y8ZA 2PUXB 3U8RH 2ZCKP 3ZZBA 4CBNA 4FUBA 5IDKA 1A61H 2J92A 1ABIH 2ZEBA 4OS4A 2PLXA 3I77A 3FP6E 1Z1JA 5JB9S 2ZU3A 2YOLA 1FDPA 2ALPA 3EDXB 1AKSB 1OXGA 1CGHA 2R2MB 1G3DA 1QRXA 2CF8H 2Q6FA 1NFWA 4JZEH 4K1SA 2XCNA 3RXQA 1BTWA 3K2UA 1Y5BT 1J17T 3SN8A 3KEEA 2IPHA 1YCPK 3EGKH 2BX4A 2PKSC 2BDCA 1SPJA 4FUJA 1CQQA 4HTCH 4TPIZ 1DY8A 1EZSC 1H9LB 1F5LA 2IN2A 1Q31A 1JMOH 4CRDA 1TX6A 1EASA 1O2IA 4ZHMU 5T3HA 1OP0A 2GTBA 2OC1A 3TNSA 1BUIA 2R2WU 2ZU2A 3S0NA 1P11E 2Z9LA 2ZFTA 4UFGH 1C4Y2 5FHTA 3CP7A 2FOAA 5PTPA 3T25A 1G32B 1O2NA 3E6PH 3LGVA 3ZVCA 2FESH 1GJAB 2NU0E 1BOQA 2AIQA 1MTUA 3I29A 1TNHA 1Z71A 1TABE 1A3BH 4U01A 1O2SA 1A5IA 3GCHC 2VIWA 3V12A 2W7UA 3A8CA 1EJMA 1ZMLA 1MTSA 4GHQA 1P2JA 5K0HA 5JBAS 2ZGBH 4J2YB 3IG6B 1S0QA 1V2MT 1V2UT 3VPKA 2XYAA 2ZWLH 1C9TA 3HGPA 3BG4B 3A7WA 1ANEA 4YESB 4R0IA 5FCKA 2F91A 4A1XA 2GV7A 1AY6H 4UONA 1AUTC 1FLEE 3BIVH 1EP5A 2GGVB 3P8OA 3ZYDA 2C8XB 3MU1A 3GDSA 1ETRH 1SGPE 3LIWA 1ELDE 2OBQA 5GJ4B 4MQAA 2F9PA 3ELAH 1QQUA 1EX3A 1BHXB 2TBSA 3ITIA 3O8BA 1GJBB 4CR5A 5A8ZA 3OTJE 3U98H 1KDQA 5C5NA 4NIVA 2R0KA 4IC5A 2A1DB 4MDSA 1F2SE 4B71A 1GG6B 5AVDA 3RLYH 2Y82A 1TQ7B 3RC6A 2A31A 1IOEA 2GZ7A 8KME2 1UCYH 1TB6H 1V2KT 3MH6A 4MNYA 3P17H 1SHYA 1QIXB 1O37A 1C1PA 2ZO3H 1GJ6A 2WV4A 3LGYA 1SGCA 1TBRH 1EJNA 3E0NB 3PWBA 2CV3A 1C1NA 2EI8A 1EAWA 1EOLA 4CH2B 1UTNA 2FP7B 1O0DH 3TGKE 1HCGA 2OC8A 1AE5A 3TITA 4AFSA 3A7XA 7GCHG 4ISIH 3L33A 3CS7A 1GPZA 2BD4A 3LGTA 1CT2E 1NRRH 4X8SH 2TGDA 2M5TA 4Y0YE 1A3EH 1SGYE 4AFUA 1BTUA 3U8TH 3ODDA 2H5DA 3HKJB 1Y5AT 3BTTE 5K7RA 3KQBA 1TX7A 3B8JA 1IAUA 4X1PU 1O2GH 4RKJB 1GJ8B 1FXYA 1L4ZA 4I33A 3MWIU 3LH3A 3RXEA 1IQHA 4NWLA 3U1IB 4D7FA 1GBJA 1ETTH 1IHTH 2BVRH 4ZKRU 1MKWH 3SV7A 4ZKOU 4AYVB 3PV4A 4ISOA 1BTHH 3H7OA
chains in the Genus database with same CATH superfamily
1TA2A 3BTHE 2WPDD 2GCTC 2D2DA 1LHDH 4BAKB 4YM9A 1JOUB 1TGCA 2ZFFH 1SOZA 3NKKA 4WH8A 1DX5M 3F0OA 2VU8E 5EQRA 1UK4A 1EQ9A 2QXHA 1P01A 1P2MA 3P92A 1TPAE 3ZZAA 2O8LA 1AHTH 1ARBA 1PQ8A 1N8OC 2Y81A 2JETC 2ESTE 2VWNA 4X8UH 1QR3E 1VKYA 1HAYB 1GBDA 1QCPA 1O2OA 1OKXA 2W26A 2Q6GA 1XX9A 2ZTXA 3H7TA 2FM2A 1HAPH 1UTKA 3TK5A 1WBGB 2P3TB 4Z0KA 2KM0A 3A81A 2J95A 1P2KA 3GY7A 7KMEH 3SV6A 3SBKA 2J34A 3VG8A 2XC0A 1QQ4A 1G3BA 5FPSA 5JPMH 3SV9A 1HAVB 2KCYA 2WZQA 1O36A 2GT8A 2QXJA 1S0RA 5DP7A 1C5WB 3QLPH 1NM6A 1D4PB 2JDID 1IQMA 1J16A 1F0RA 1P2OA 2G51A 3ZVAA 5C3NA 4OS7A 1OYTH 1YLCA 2OLGA 1E0FD 2ASUB 2V3OH 3BN9A 2KZ4A 3SHAH 2G5VA 1SQTA 1J15A 1O2VA 2WPJS 1WQSA 4FUGA 1TLDA 1O3IA 2VVUA 2ZPRA 3UOUA 1GVKB 3BSQA 1G2MA 1JIMA 1O39A 4X2XA 5L6NH 1AIXH 1QHRB 2YMSC 4UEHH 3T2NA 4LOYH 1P09A 1D3PB 1GBCA 3L6PA 1SGEE 4XBCA 3TK6A 1C5NH 1O3GA 4IN2A 1LHCH 3GY6A 1ZOMA 4X6PA 5T6FA 4A6LA 5DGJA 5KEDA 2XC4A 2W3IA 1EXFA 1NROH 4VGCC 3TIUA 1CE5A 1NY22 1O3EA 1O2JA 1XUJA 1MCVA 1Z6JH 1EP6A 1SMFE 5C2ZA 3A7TA 2P94A 2RA3A 4DT7B 4ZAEA 5E2OA 1DT2A 5SGAE 1D9IA 4X6OA 2SGPE 4ABAA 2ZFSA 3A84A 3K65B 3UNSA 4E05H 3EA7A 3SU5A 1CGJE 3TJNA 1DM4B 1K1PA 4JZ1A 1DLKB 2ZFQH 2BLQA 2VIVA 2FTMA 2J4IA 4R8TB 1GI7B 1CU1A 1HDTH 5AF9H 1AU8A 1YPEH 2L6OA 1W3CA 3GY3A 1MTNC 2EI7A 3ZYEA 5DP4A 1DLEA 1O5DH 3ZVDA 1HNEE 1SQOA 4AX9H 4ZUHA 1O2YA 3HGNA 5C20A 1FONA 2ANKH 1A5HA 3MO9A 3U1JB 5CHBA 3ZZ9A 1O35A 1P3CA 1E35B 1BMLA 2ZDLA 3PMJA 4M7GA 4K5ZA 1NBMD 1JRSA 4XSKU 5C5OA 4KTCA 3TH2H 1QBOA 2A45B 4OS1A 1TNIA 1A1RA 1FN8A 1O33A 1RIWB 2V3HH 1E38B 4SGBE 2C8WB 2O9QA 3SV8A 4ABFA 2FODA 3GY5A 5EXLA 3K6ZA 4XE4A 3M3SA 3RU4D 3SU4A 2ZC9H 4Y10E 2WV5A 1GHAG 5TCCA 1GBFA 1LVOA 1P2IA 1ELGA 3TH3H 1MU8B 3QDZB 5DKMA 1SGIB 2OP9A 1GBLA 2EQNA 2ZGCA 5CHAB 1KXEA 3SUDA 2NU1E 1O32A 1C5MD 3DSGA 1CHOF 3RXPA 3UB0A 4ABIA 1GCDA 2AGEX 1SQAA 4Q7YA 1YWUA 2OINA 3BTDE 1MMJN 3AAVA 2GMTB 2ZECA 1O5FH 5FXLA 2RA0A 2P8OC 1ACBE 1CVWH 2ZA5A 3VGCB 1BMMH 2K1QA 3ZV9A 1OP8A 2A2XH 4FU8A 4INHA 4X0WU 1GDUA 4OGYA 4Q4LA 1XUHA 2O8WA 4I8LA 3IWMA 3STJA 2IPQX 1QRZA 4HZHA 2FS9A 1HXEH 2JH0D 2QXGA 2SGAA 3KNXA 3LOXA 1VJ9U 1TBZH 4KKDA 1VR1H 1ESBA 1A5GH 5GIBA 3EA8A 3QUMP 5A8XA 1TNGA 2KX4A 5JBCS 2KCOA 2ZDVH 3TJUA 3RC5A 5FX5A 2DE8A 2KAIA 1W14U 4LK4A 2A7HA 1QRWA 3DFJA 2F3CE 2BOKA 4Y8YA 2VINA 3N7EA 1ZSJA 1V6DA 1ZRBA 4A7IB 1O2MA 3E90B 1ZLRA 4LZ4B 3O8CA 4Q80A 2PKSB 3E3TA 5HM9A 2F9VA 2ZU5A 1ZHRA 3NWUA 1ELEE 4XOJA 3T28A 2Z6BD 4AFZA 1GBTA 3BV9B 4I8HA 1QL7A 2Z9IA 3RXSA 3E16B 2PSXA 1BQYA 2BY8X 3AW0A 1GCTC 1BJVA 1C5XB 1TBQH 3RXGA 4BAHB 1WQVH 2ZIQH 1W0ZU 5C1XA 4AC9A 4TPYA 1G2LA 3GYMA 3PYHA 3H09A 2BVSH 4XBBA 1EATA 1QJ1B 4BNRA 5DJ7A 2Y80A 2JJ2D 1GMCF 4AYYB 2C93B 1EKBB 2GP9B 1FY4A 4IGDA 4DURA 4BTTB 2H2ZA 1PQ5A 2QV1A 1TOMH 2A7JA 1GJ7B 3RDZA 1FX0B 4D9RA 3LC3A 1O3AA 3QO6A 4YO9A 1T7CA 1YPMH 3GCHB 5F53A 1HBTH 1K1OA 4DGJA 4XDEA 4NSYA 1TE0A 1LHEH 1HXFH 3D49H 1C2FA 3FP7E 4YLQH 4B6FA 3FVFB 3RXMA 1G37A 1GBHA 2EC9H 3SZNA 2H9HA 4GLYA 1HAZB 1LHGH 1UHBA 3MOCA 5B6OA 3DA9B 1N1LA 2W6ID 4X8TH 5DK1A 4B74A 1JIRA 1AMHA 1P06A 4FU7A 1ZR0A 1BBRE 1MCTA 1PPCE 4Y8XA 3M37A 4MNXA 3PWCA 4I7YH 3T27A 3F1SB 4TYDA 1MD7A 4BTUB 2ZDKA 1DSUA 2AEIH 1XUKA 2A4RA 1G36A 1TWXB 1IQLA 2BD7A 2CN0H 3MQKC 2Z7FE 3ZZCA 4AZ2B 3A7VA 1ARCA 1O5AB 1T32A 1INCA 3ESTA 4OS6A 3OFND 1BRAA 1Y8TA 3RXKA 4BOHA 5AFYH 5GCHG 1GJ4H 2QIQA 1CHGA 1G9IE 1SLVB 3PLPA 4ABJA 4D9QA 1NN6A 2GCHF 1CT0E 1LQEA 3RLWH 1YP9A 1KXFA 5HYOA 3KIDU 1YKTA 8ESTE 3UR6A 2Z9KA 4H6SB 1E34B 3ZV8A 4Y11E 1XKBC 2UWPA 2OQUA 4Q7ZA 2WPMS 1C5QA 5E0GA 2O8TA 2F9OA 1FZZA 2ZPQA 3KQEA 1KXCA 3MFJA 5HKKD 1EUFA 3KQ5A 5HIZA 2PKAA 4BTIB 1FV9A 1TFXA 3P70B 4MNVA 2R3UA 1GI2A 1XUGA 1C1RA 3S69A 3AASA 2OXSA 4DCDA 3H5CB 1ZGIA 1OX1A 3N7OA 1SGFA 2O8UA 3MU8A 4UD9H 2OC7A 9ESTA 1C4V2 1HYLA 1VGCC 1ZHMA 2IJD1 1MQ5A 2C3SA 2ZHFH 1LKAA 4K60A 3BEUA 1BBRK 1H9IE 2C4FH 3U69H 5L30H 2VGCC 4X6NA 4WXVA 1CA0B 1KDQB 3O8RA 3E0PB 4B76A 1TONA 4E06H 3FP8E 1BB0B 2BY9X 1KXDA 4INLA 1UVTH 1H1BA 1TRNA 4B2CA 1TIOA 4XRNA 2GZ8A 5A0CA 1VZQH 2VH6A 1UVSH 4RN6A 1GI5A 3PV5A 5J4QA 3LDXH 2FOEA 3MH5A 4Y79A 3RMNH 1OWEA 3NUMA 2WPLS 4I8GA 4MPXA 1MU6B 1NU9A 3M61U 2CXVA 1NU7B 1O3PB 5HXFA 1GI8B 3BTKE 5AHGH 1K21H 1LDTT 3FZZA 3M7UA 3P6ZB 1VITF 2KCPA 3PO1C 2JETB 1AGJA 1A0LA 4WMDA 1OWIA 3RXDA 4GSOA 3DD2H 1ELVA 5DO4H 2CF9H 1X7AC 1K1JA 3M5MA 1SKYE 4FETA 5G4BA 1LVYA 1XVMA 4XBDA 3MTYA 3OSYA 2A5IA 4QT8C 2FI4E 4ABGA 4AORA 4NIXA 1MKXH 5J4SA 2P3FH 1C5LH 2TGTA 2TRMA 2H5CA 1XKAC 2WPKS 4NA9H 1XUIA 1QL9A 4JYTA 4GAWA 2BD2A 2VJ1A 1FN6A 2LPRA 4O3TA 1PPHE 4ABEA 1B0EA 4HG6A 4FVBA 3PTNA 1YYY1 1NRSH 2V3MA 4ABDA 3KGPA 1A7SA 4AN7A 2ZQ1A 3FO8D 3A87A 6ESTA 1HUTH 5C1UA 3JZ1B 2P95A 1CT4E 4MPUA 4I31A 5TJXA 1O34A 1DY9A 1YF4A 1EFRD 5C1YA 2TGAA 1GL0E 4THNH 5LPFA 1V2NT 1WTHD 4X2WA 3P8FA 5F8ZA 1ZSLA 1BTPA 1T8NA 2EI6A 1OPHB 4TWWA 2Z94A 1P04A 3A80A 4F49A 1V3XA 2PV9B 2Y6TA 3G01A 3SJKA 3SW2B 4FU9A 2BQ6B 1GI0A 2IJOB 4Q7XA 3MNXA 1RRKA 1C5VA 4LXBH 4I32A 3SJIA 2NU2E 4ZMAH 4DVAU 1B0FA 2D1JA 3KQCA 2PSYA 3ZZ7A 1O30A 4ZH8A 1Z1IA 3T29A 1C5RA 1RFNA 1W12U 2WSSD 3WWFA 1SLXB 1D3QB 2BX3A 3RXJA 2CGAA 3ZIAD 2XCFA 2KCAA 4FUHA 4FUCA 2VWLA 3ATWA 1A0JA 5JBBS 2R0LA 2ZDMA 4Y0ZE 1V2PT 1UCYE 2HRVA 1NFXA 3MU5A 2A4QA 1DVAH 3PROA 1HJ9A 4CR9A 4YTAA 4CRBA 3GDUA 3A89A 1O2RA 2CJIA 4HI3A 3SNBA 4NZLA 4NG9H 1DXPA 1AUJA 2Z3EA 1U6QA 3F9FA 5ABWA 1WV7H 4IMQA 2G8TA 1ID5H 2A7CA 3RM2H 1Q3XA 3ZZ4A 1DWCH 4YLUA 1MTNB 1C1UH 1F92A 1P12E 1A46H 1Y3UA 4UFFH 3MH4A 2Z9JA 3C1KA 1C5YB 2W6JD 5FCRA 3ZZ5A 3QZRA 3LJJA 2G52A 1LMWB 1RTLA 1P05A 3RXFA 3BEFB 1GHVH 1T8OA 1AB9C 3BTEE 1SHHB 4GHTA 1O38A 1YGCH 4F55A 2HVXA 2AGGX 1RXPA 2DE9A 3BF6H 3SUEA 1O2XA 1HGTH 4JZFH 4I8KA 1FY3A 4TY6A 3BTWE 3TU7H 4RKOB 1C1TA 1EZXC 1QBVH 4ZHAA 1SGDE 2F9BH 1TMBH 3Q77A 1IQIA 2QXIA 3UFAA 1AFEH 1ANDA 1C5SA 2VIOA 3TPIZ 3EE0B 1VCQA 3UNRA 1DWEH 1OYQA 5EW1H 3UUZA 3DUXH 2Z3CA 1C2IA 1PPGE 2G5NA 1GDNA 1CGIE 5H4IB 3GS9A 5FPYA 4FUFA 2P59A 1ELTA 6CHAB 2Y5GA 3BTQE 4JYUH 2RDLA 1P03A 4Q2KA 2XBXA 1UCYK 1GHZA 1PPEE 1SGRE 5I25A 1QZ8A 4O97A 3L3TA 3EE7A 3ATMA 5ESTE 4X2VA 1DE7H 1F0TA 4ZXXH 1GBEA 3QZQA 1J14A 3M3TA 4FUIA 1GBIA 1GHWH 1GMHF 1KXAA 2QAAA 4KGAA 1H8HD 7LPRA 1AE8H 3FFGA 1S5SA 2PGBB 2ZGHA 4CRCA 1YLNA 4DY7B 2QE7D 1F0UA 4X8VH 1YCPM 2CK3D 1S85A 2UUJB 4ASHA 1DICA 1LPGB 2Q1JA 4GPGA 2XBWA 3ODFA 1KLIH 4DIHH 1ZTJA 1EOJA 1MAYA 1GI9B 4WH6A 2VIQA 3TNTA 3VXFH 1C4U2 3VEQB 3PMAB 1GGDC 3ATLA 1P9SA 1S6LA 3A85A 1NRPH 1V2JT 3R0FA 1BRUP 1A2CH 5ETXA 5HGGA 1C2LA 3ZZ3A 1CA8B 3DFLA 1E37B 2EEKA 2BD3A 5EQSA 2ZHWH 1MKWK 3RMLH 1GCTB 4XD7D 3F9HA 1C5TA 1B7XB 1AZ8A 4Y7BA 1LKBA 3TJVA 5LH8A 4ZCNA 2WUBA 4B73A 3PRDA 4ASUD 1UTQA 1FIWA 2ZNKH 2ALVA 2XW9A 4KP0A 1T8LA 4CRGA 3TGJE 2P3UB 1GJDB 3LH1A 2UUFB 1Z8RA 5CE1A 2RCEA 3C27B 5EJLA 1Y59T 4WMFA 1BRCE 3GY2A 4NA7A 1XUFA 2FOBA 4IMZA 1AFQC 1TGNA 3S9BA 2ILNA 4TWYA 4AGKA 3EYDA 1EZUC 2SNVA 1C5ZB 2SGFE 2KAIB 1TGBA 2PHBA 2AIPA 1GG6C 4UFEH 4CHAC 3KCGH 2BZAA 2R9PA 1RTFB 2ZFPH 3SU1A 2BB4A 1HJAB 5AFZH 2YMSD 3F3BA 3UTUH 1AWFH 3TJOA 1MZDA 2JKHA 1UTMA 1F7ZA 1UJ1A 3UQOA 2XWBI 1W0KD 2OUAA 2CHAC 2QA9E 2EA3A 2AERH 5T6GA 3A8AA 2BHGA 3TGIE 1UO6A 1W10U 1C2JA 1A0HB 4ESTE 3M5NA 3AW1A 4KELA 1KTTB 5EG4A 4E7RG 4FUEA 2BD9A 1AVXA 4DIIH 1ZZZA 1CBWC 3KYFA 5GWZA 5JB8S 2GDEH 3SOSA 2STBE 3A86A 4IBLH 1RD3B 1AI8H 1C5PA 4K69A 2KR7A 1CHOG 1O3KA 1BZXE 1Z8GA 2H6MA 1DITH 2ZDAH 5EXMA 3T62A 2TGPZ 1EJAA 1F5RA 1SC8U 1Z7KA 1ZTKA 2GV6A 3OX7U 2A4OA 2BYAX 1ZJKA 1NS3A 1IQGA 1L2EA 3K6YA 3WY8A 4B2AA 1O3NA 2BQ7B 2WHXA 2AGIX 2AS9A 4NGAH 2AH4X 2G4TA 4UE7H 1UHBB 2BLVA 1ZJDA 1ELAA 2HPPH 3ATIA 4NCYA 4PROA 1P57B 3OYPA 1C2EA 1W11U 3M5LA 5DG6A 4K3JA 3RXCA 1Z8IB 2UUKB 2IOTA 1H8DH 2BDGA 3BTME 3FZDA 3RXLA 3FANA 1HAIH 3M7QA 2V35A 2ANMH 4K2YA 1W8BH 3B23B 1KYNA 1L1NA 1MZAA 1W0YH 3PMBB 3VB7A 1FPCH 3RXUA 1SOTA 2VGCB 1C1WH 2OD3B 1HV7A 2BLOA 1ZMJA 3UREA 2FXRA 1YPGH 3SU2A 5I46H 3E1XB 1EPTA 3LT3A 4O03A 5A0BA 1YPJH 3UOPA 2XNIA 2BQWB 1YM0A 4X1RU 2WYJA 3A7ZA 2G00A 1H4WA 1W7XH 2ODQA 1P9UA 3ZVGA 1DXWA 1F5KU 1GMCG 3KL6A 5C67A 4BXWA 1D3TB 3RMOH 1TRYA 1SI5H 2FS8A 2J98A 2P16A 1AVWA 2QGRA 2AMQA 5EQQA 1NC6A 1K1IA 4H4FA 3CENA 1MAXA 3W95A 2PKAB 2GT7A 1IHSH 1NT1A 3TVJB 1O3LA 1O3JA 1LHFH 5EODA 4X1NU 2XXLA 4X1SU 1OWDA 1ZMNA 4KTUA 2ODYB 1L1JA 1ORFA 2WPHS 4OM9A 2RG3A 2ZTYA 5FAHA 1XVOA 1AZZA 1WSSH 1YY3A 1GDQA 3ZZDA 3MMGA 1BJUA 5FPTA 2BM2A 1GJ5H 4NSVA 1Z8JB 1V2LT 2W3KA 1FY5A 3MYWA 3SHCH 3GISB 2AHME 2C90B 2ZI2H 1K0HA 2ZCLP 4A92A 4YT7H 4BANB 3PTBA 1S6FA 4UDWH 1EPTC 2OC0A 4TT3D 4HGCA 4OS2A 1RGQA 3V13A 1LCYA 1MBQA 8GCHF 1HJ8A 3NK8A 1S81A 2NWNA 1QNJA 1EZQA 1K2I1 3SV2H 1C5UA 5F6MA 2GCHG 1XM1A 3VB4A 1ETSH 3U9AH 3NZIA 1BMAA 3A8DA 9LPRA 3SNEA 1TAWA 3LGWA 4TSFD 3UWIA 1O3FA 3D62A 3P8GA 1BTXA 1YLDA 1PYTC 3KF2A 1KTSB 4RSPA 2FPZA 4U30A 3PMHB 2PGQB 4RI0A 3FKSD 2ZHEH 1PJPA 2GZ9A 2A32A 2BMGB 1TNLA 2ZU1A 4CRFA 4JK6A 2GJGA 4DT4A 1QA0A 2UUYA 3QTOH 1DSTA 2FOMB 3SGAE 1K1MA 1LO6A 6GCHF 2QF0A 3GCTF 2B9LA 1G30B 2FX4A 3N99A 5EJZA 2BDHA 1KSNA 1SGFG 1GHBF 3QWCH 5EPNA 1MUEB 4NA8A 1VCWA 1OP2A 1JXPA 1ZSKA 3PB1E 1XXDA 1S6HA 1O2KA 5KGOA 1YCPH 1TPPA 4BXSA 1IQJA 4YOJA 1GI3A 3QTVH 2RFKC 1GMDF 2C8ZB 4BAMB 1H9HE 1PYTD 3P8NA 1FI8A 3ZVBA 3NCLA 1RIWC 1W2KH 1O3HA 4WMEA 1K1NA 3SU0A 3MH7A 3LGIA 1FAKH 4IC6A 3QX5H 4I8JA 3GCNA 1FQ3A 2QF3A 1KLTA 3S7HB 4FUDA 4GCHF 1GBMA 3I78A 4F4OC 1AB9B 1IQFA 1HFDA 1JBUH 5F03A 2M2AA 4AG1A 1SGQE 1WAYB 4WVPE 5EW2H 2ZP0H 1F0SA 1GHXH 1K9OE 1LPZB 1VITG 3SJ8A 5IK2D 4WXIA 2FI5E 2L74A 1O2UA 2GMTC 5EIYA 2STAE 4Z1MD 2C8YB 3VGCC 2SGEE 4FVDA 4MNWA 1ELCA 1H8ED 5DP6A 1AWHB 2FO9A 3TH4H 4D8NA 2GCTB 5HM2A 1D6WA 4A1TA 4B2BA 4J1YA 3M36A 2D8WA 2HWLB 3A82A 3ZVFA 3STIA 2R3YA 1P2QA 3V7TA 4HFPB 3HK3B 4MLFB 3F9GA 5HMAA 3U28C 5E8EH 3VB3A 2CMYA 3E8LA 3PRBA 2VWOA 4NIWA 1DS2E 3LONA 4JZIA 1CO7E 2HLDD 1N8OB 3SUFA 2BDAA 2XWAA 1V2RT 2FLRH 2QF5A 1DWBH 3MI4A 5FBIA 3GY4A 3URDA 1HIAA 3DSPA 2ZU4A 1O3MA 2A2QH 1QTFA 1BITA 4D7GA 4U32A 2XC5A 2LP6A 1D3DB 4NWKA 1PPFE 1O2ZA 1D6RA 1V2OT 2PUQH 1VJAU 3SJ9A 1UTPA 5TCAA 2FLBH 2TPIZ 2G81E 1YPHE 1N6XA 1AVGH 3DHKH 3KN2A 2A5AA 1EAIA 4ZKNU 1PQAA 1SBWA 4ABHA 4BAQB 2FI3E 4RT1A 1ZPBA 1J9CH 1SFQB 3RUOA 1HAXB 1C1MA 1C5OH 2QYIA 4X6MA 1QY6A 1QA7A 2LNCA 4YOGA 4ACAA 2XOKD 4K1EA 4E7NA 1GBKA 2GVFA 1GGDB 1GBBA 2ZTZA 4YT6H 2ANWA 7ESTE 2VNTA 4I86A 3F0PA 4A1VA 5A8YA 3LPRA 4DG4A 2UWOA 2FMJA 3SORA 3KHVA 1QGFA 1SQRA 1EAXA 1ZPZA 2BY6X 1Q2WA 4CBOA 2HOBA 2FOCA 3LJOA 3SQEE 4F48B 1FJSA 3ZZ6A 3RXOA 2YMSB 3TK9A 1A4WH 5FX6A 1S83A 4JCNA 4BAOB 1T31A 2THFB 1YBWA 3BTGE 4MG3A 3ATKA 4VGCB 3U8OH 4A5TS 2FOGA 1TYNA 1GI6A 5F8XA 1NBME 1YC0A 2O8MA 2XBYA 4AOQA 4CREA 4FOUC 2VVCA 1UVOA 3S9AA 1FY8E 2DUCA 3QGJA 4JYVH 1AFQB 5A09A 3LU9B 4P00A 3RU4E 1HAHH 2FOHA 3UQVA 1W13U 1NPMA 2GKVE 3RXIA 1O5BB 4ZXYH 3RXHA 3VXEH 1PPZA 2VVVA 1C1QA 1COWD 1AKSA 3GCOA 4CHAB 1WYKA 1MKXK 2ZF0H 2ZG0H 1FMGA 1FIZA 1TQ0B 3ENSB 2JH5D 4INKA 4Y71A 3UWJH 3MNBA 1TGSZ 2F9UA 1Y3YA 2FYQA 1HAOH 1KLJH 3CNRA 1WUNH 1BCUH 3URCA 1RJXB 2CHAB 2FEQH 1MTVA 1UVPA 4NIYA 1UVUH 1V2WT 3A7YA 2LELA 1ESAA 2FDAA 2VB0A 3MHWU 1J8AA 1PPBH 4K8BA 5CMXH 1E36B 1MTWA 5JDUB 1CBWB 3M3VA 1BRBE 2FZZA 1W7GH 3O8DA 1GL1A 1YPLH 3SNCA 3RU4T 2PWXA 1TPOA 4WJG2 2BOHB 1Y5UT 1OSSA 3HATH 1DUEA 4XFQA 1HB0B 4NZQA 2I6QA 1TX8A 1SG8B 1IQNA 1QB9A 5DP3A 2B7DH 1ANBA 3PLBA 5EPYA 8LPRA 1FNIA 3Q76A 4SGAE 2A5KA 5IYTA 3RP2A 1V2TT 2OQ5A 1CA0C 2VIPA 1GMHG 1PQ7A 1S82A 1UK2A 3V0XA 7GCHF 2V7QD 4H6TA 1O2HA 1T8MA 2SFAA 3UAIC 1MD8A 2BY7X 1C1VH 2OCVB 2Z3DA 2PW8H 1OOKB 1FY1A 3TLOA 2P8OB 5LPRA 2VBCA 3GDVA 1THSH 5FBEA 4O9VA 2AFQB 2ZHQH 5LPEA 1UMAH 1AQ7A 3BG8A 1NO9H 1ZRKA 3ZZ8A 2W5EA 5JYIA 5L2YH 2BDYA 2BD5A 1WXRA 3UIRA 4H42U 1BHXF 1QB1A 1V2VT 4WWYA 1EB2A 1B5GH 1DOJA 4M9FA 4WF8A 3E91A 1UW7A 2BD8A 1SLUB 3M7TA 1QJ6B 3GY8A 2BXTH 1ZGVA 1FUJA 1QL8A 2PR3A 1L0ZA 1P10A 4DW2U 1NRQH 3R3GB 1RS0A 3F9EA 4K8YA 2HALA 1GVZA 2A4GA 5E2PA 1NESE 3CS0A 3SI3H 1OWJA 2AMPA 2BLWA 1DDJA 1HLTH 1G3CA 1SVPA 2FX6A 3AAUA 1DPOA 1NFUA 4LZ1H 3HPTB 1ELBA 2ZCHP 3SQHE 1O5CB 2A0QB 3KYGA 5A0AE 4D76A 1P0SH 2G4UA 3SO3A 4ABBA 5GNDA 1YPHC 2QY0B 2PFEA 3Q3KA 2I6SA 5GPIB 3BG4C 1LVMA 5LGOA 1TMUH 1WOFA 2V0BA 3MU4A 3SNDA 1O3CA 2B8OH 1P2NA 1BIOA 3PV2A 4CRAA 5F8TA 2ZGJA 1ZYOA 3SU3A 1M9UA 1ELFA 3BTFE 1BA8B 1QFKH 1AN1E 1OHHD 2G55A 4K1TA 4MPVA 5KECA 3ZVEA 1EPTB 3NPSA 3RXRA 1QBNA 1SGTA 1TNKA 1K22H 1L4DA 4WY3A 2WUCA 3F6UH 3F68H 4Y7AA 4ACBA 3M35A 2Q6DA 3LKWA 1VCPA 1MABB 2BXUH 2WPIS 4ZKSU 3K9XB 5DPAA 2OBOA 2ZQ2A 1T4VH 2Z9GA 2J98B 1GJCB 2HVYB 1THPB 1K1LA 3BEIB 4AFQA 1NFYA 4DOQA 1LVBA 2HNTE 2QC2A 2VWMA 3OU0A 1WCZA 4IW4E 3KQDA 4Y6DA 1SGNE 3DCLA 1GI4A 5GXPA 4O3UA 3Q3YA 5BRRE 3T5FH 2XTTB 1DWDH 3VFEA 4CH8B 3S9CA 1O2PA 1GJ9B 3A8BA 4GUXA 1L1GA 1K28D 1XMNB 1SSXA 3EA9A 1C2GA 1JRTA 2QCYA 1KXBA 1TALA 3D65E 1KY9A 2NU3E 2BY5X 3Q3XA 2W7SA 3MU0A 3Q00A 1EAUA 2EY4C 3JZ2B 1THRH 2HGTH 1GBAA 1TOCB 5CDFE 2BVXH 1CSOE 1N6YA 2ODPA 3A88A 1HAVA 1TA6A 4MTBA 1ESTA 1WDIA 4FXGH 3QGNB 1UTJA 3GYLB 1Y3XA 1O5GH 3SGQE 2FYRA 3P95A 1VGCB 3RC4A 1H8IH 4ZROA 5BPEA 4OS5A 2VIDA 3W94A 1MH0A 4AGJA 4MVNA 2OTVA 6CHAC 2BDBA 1IQEA 1HPGA 2D26C 4X2YA 4AG2A 1W0JD 5EOKA 5DP9A 2ZZUH 2J9NA 2GX4A 2TIOA 3SGBE 2ULLA 4Y76A 1NZQH 3SJOA 2YNBA 1C9PA 3IITA 4ZHLU 3HK6B 1SL3A 2P93A 1GHAF 4B6EA 2Y7ZA 1ZPCA 1TNJA 1V2ST 1QURH 4JMYA 3VB5A 1UTOA 1BMNH 1NRNH 1T4UH 4X1QU 4UFDH 3PLKA 4TY7A 1SR5C 2QN5T 3RMMH 2J5UA 2H1UA 4KTSA 2Y5HA 1XXFA 5T6DA 1C1OA 3PO1B 1ZTLA 1Y3WA 2ANYA 1SLWB 1O2LA 2BTCE 4ISLA 4NFFA 1C2DA 4IN1A 1BTYA 3SU6A 2PTNA 1S84A 5EGMA 3MNSA 3T26A 1GVLA 2PTCE 2ZHDA 3MO6A 2FTLE 3GOVB 1MBMA 4YXWD 8GCHG 1BT7A 3V3MA 1P8VC 2JH6D 3N7DA 3WWBA 1V2QT 3FAOA 1NTPA 3MNCA 1TGTA 2F9NA 2XRCA 1LQDB 1TPSA 2FWWA 1AD8H 4JK5A 4GVUA 2F43B 2SGQE 2HPQH 3A83A 3SUGA 5C0TA 3EQ0H 1C1SA 3UNQA 2J97A 2SNWA 2BDIA 1VITH 1ABJH 2HNTF 1O2QA 3LGUA 4MPWA 1DANH 1YPKH 2B5TB 2VH0A 1QJ7B 1HRTH 3WW7A 1LPKB 1C2HA 5B6LA 1IQKA 4U2WA 1O31A 3OY6U 1O2WA 4AB9A 1WTGH 3GICB 4RT0A 6GCHG 1Z6EA 5DSFA 3GCTG 1WU1A 2FIRH 2J94A 4Q63A 2HLCA 2GDDA 1C2KA 1O3DA 3HKIB 2XBVA 4DJZB 3OY5U 2WYGA 5E0HA 1GHBG 1E1RD 1KIGH 1P02A 1FAXA 1O3BA 1UK3A 4NFEA 2NU4E 5E0JA 1E79D 1O2TA 1ZHPA 1BBRH 1OWKA 3OEED 3W1EA 5HIYA 3QN7A 1HJAC 2AMDA 3QK1A 3AVZA 1HIAB 3SYJA 1ANCA 4B75A 3RXBA 1DUAA 1GMDG 1OWHA 4JZDH 1G3EA 2Y7XA 3LC5A 1LTOA 3NRLA 3S7KB 1DFPA 1OS8A 2YNAA 3F2GA 2KFWA 3NXPA 1HAGE 1TMTH 2AYWA 1AO5A 5EXNA 1SB1H 2WINI 2F83A 4OGXA 5ESBA 3OTPA 2H9TH 1O5EH 5A2MH 2ZDNA 4GCHG 3UPEA 1EB1H 3UR9A 2HNTC 4B1TA 4Z6AH 2GD4B 2J2UA 5JBTA 1MQ6A 3SI4H 3RXTA 2ZKSA 5DP5A 4YOIA 1FPHH 4YZUA 1P3EA 3EAJA 3B9FH 2J38A 3PM3A 4IS5A 1GHYH 2H9EH 1C2MA 1TRMA 2FOFA 5L2ZH 3MO3A 3BIUH 3UY9A 4AB8A 5GDSH 1GWAA 3D23A 3DSOA 3VB6A 3SNAA 1O3OA 1RTKA 5CHAC 1BDAA 2UWLA 2ZGXH 3RXAA 3M5OA 1PFXC 2BZ6H 1SFIA 5GCHF 2B0FA 2SGDE 2JJ1D 1JWTA 3RM0H 1BTZA 4ISHH 1UTLM 3RXVA 1QB6A 2Y5FA 1GI1A 6LPRA 3DT0H 5EU8A 2V6NA 1Y3VA 2ZFRH 5DP8A 4ISNA 2ZPSA 4Y8ZA 2PUXB 3U8RH 2ZCKP 3ZZBA 4CBNA 4FUBA 5IDKA 1A61H 2J92A 1ABIH 2ZEBA 4OS4A 2PLXA 3I77A 3FP6E 1Z1JA 5JB9S 2ZU3A 2YOLA 1FDPA 2ALPA 3EDXB 1AKSB 1OXGA 1CGHA 2R2MB 1G3DA 1QRXA 2CF8H 2Q6FA 1NFWA 4JZEH 3OE7D 4K1SA 2XCNA 3RXQA 1BTWA 3K2UA 1Y5BT 1J17T 2XNDD 3SN8A 3KEEA 2IPHA 1YCPK 2K8IA 3EGKH 2BX4A 2PKSC 2BDCA 1SPJA 4FUJA 1CQQA 4HTCH 4TPIZ 1DY8A 1EZSC 1H9LB 1F5LA 2IN2A 1Q31A 1JMOH 4CRDA 1TX6A 1EASA 1O2IA 4ZHMU 5T3HA 1OP0A 2GTBA 2OC1A 3TNSA 1BUIA 2R2WU 2ZU2A 3S0NA 1P11E 2Z9LA 2ZFTA 4UFGH 1C4Y2 5FHTA 3CP7A 2FOAA 3F2HA 2PP6A 5C0UA 5PTPA 3T25A 1G32B 1O2NA 3E6PH 3LGVA 3ZVCA 2FESH 1GJAB 2NU0E 1BOQA 2AIQA 1MTUA 3I29A 1TNHA 1Z71A 1TABE 1A3BH 4U01A 1O2SA 1A5IA 3GCHC 4P02A 2VIWA 3V12A 2W7UA 3A8CA 1EJMA 1ZMLA 1MTSA 4GHQA 3SZEA 1P2JA 5K0HA 5JBAS 2ZGBH 4J2YB 3IG6B 1BMFD 1S0QA 1V2MT 1V2UT 3VPKA 2XYAA 2ZWLH 1C9TA 3HGPA 3BG4B 3A7WA 1ANEA 4YESB 4R0IA 5FCKA 2F91A 2OK5A 2GV7A 4A1XA 1AY6H 4UONA 5FL7D 1AUTC 1FLEE 3BIVH 1EP5A 2GGVB 3P8OA 3ZYDA 2C8XB 3MU1A 3GDSA 1ETRH 1SGPE 2JIZD 3LIWA 1ELDE 2OBQA 5GJ4B 4MQAA 2F9PA 3ELAH 1QQUA 1EX3A 1BHXB 2TBSA 3ITIA 3O8BA 1GJBB 4CR5A 5A8ZA 1E1QD 2QF4A 3OTJE 3U98H 1KDQA 5C5NA 4NIVA 2R0KA 3AK5A 4IC5A 2A1DB 4MDSA 1F2SE 4B71A 1GG6B 2RDEA 5AVDA 3RLYH 2Y82A 1TQ7B 3RC6A 2A31A 1IOEA 2GZ7A 8KME2 1UCYH 1TB6H 1V2KT 3MH6A 4MNYA 2F4LA 3P17H 1SHYA 2WV9A 5DN6D 1QIXB 3OAAD 1O37A 1C1PA 2ZO3H 1GJ6A 2WV4A 3LGYA 1SGCA 1TBRH 1EJNA 3E0NB 3PWBA 2CV3A 1C1NA 2EI8A 1EAWA 1EOLA 3FN8A 3OEHD 4CH2B 1UTNA 2FP7B 1O0DH 3TGKE 1HCGA 2OC8A 1AE5A 2K0QA 3TITA 4AFSA 3A7XA 5C94A 7GCHG 4ISIH 1KMHB 3CS7A 1GPZA 3L33A 2BD4A 3LGTA 1CT2E 1NRRH 4X8SH 2TGDA 2M5TA 4Y0YE 1A3EH 1SGYE 4AFUA 1BTUA 5EJ1A 5C17A 3U8TH 3ODDA 2H5DA 3HKJB 1Y5AT 3BTTE 5K7RA 3KQBA 1TX7A 3B8JA 1IAUA 3FOAA 4X1PU 1O2GH 4RKJB 1GJ8B 1FXYA 1L4ZA 4I33A 3MWIU 3LH3A 3RXEA 1IQHA 4NWLA 3U1IB 4D7FA 1GBJA 5T1VA 1ETTH 1IHTH 2BVRH 4ZKRU 1MKWH 3SV7A 4ZKOU 4AYVB 3PV4A 4ISOA 3F2FA 1BTHH 3H7OA
chains in the Genus database with same CATH topology
1TA2A 3BTHE 2GCTC 2D2DA 1LHDH 4BAKB 4YM9A 1JOUB 1TGCA 2ZFFH 1SOZA 3NKKA 4WH8A 1DX5M 2VU8E 5EQRA 1UK4A 1EQ9A 2QXHA 1P01A 1P2MA 3P92A 1TPAE 3ZZAA 2O8LA 1AHTH 1ARBA 1PQ8A 1N8OC 2Y81A 2JETC 2ESTE 2VWNA 4X8UH 1QR3E 1HAYB 1GBDA 1QCPA 1O2OA 1OKXA 2W26A 2Q6GA 1XX9A 2ZTXA 3H7TA 2FM2A 1HAPH 1UTKA 3TK5A 1WBGB 2P3TB 4Z0KA 3A81A 2J95A 1P2KA 3GY7A 7KMEH 3SV6A 3SBKA 2J34A 2XC0A 1QQ4A 1G3BA 5FPSA 5JPMH 3SV9A 1HAVB 1O36A 2GT8A 2QXJA 1S0RA 5DP7A 1C5WB 3QLPH 1NM6A 1D4PB 1IQMA 1J16A 1F0RA 1P2OA 2G51A 3ZVAA 5C3NA 4OS7A 1OYTH 1YLCA 2OLGA 1E0FD 2ASUB 2V3OH 3BN9A 3SHAH 2G5VA 1SQTA 1J15A 1O2VA 2WPJS 1WQSA 4FUGA 1TLDA 1O3IA 2VVUA 2ZPRA 3UOUA 1GVKB 3BSQA 1G2MA 1JIMA 1O39A 4X2XA 5L6NH 1AIXH 1QHRB 4UEHH 3T2NA 4LOYH 1P09A 1D3PB 1GBCA 3L6PA 1SGEE 4XBCA 3TK6A 1C5NH 1O3GA 4IN2A 1LHCH 3GY6A 1ZOMA 4X6PA 5T6FA 4A6LA 5DGJA 2XC4A 2W3IA 1EXFA 1NROH 4VGCC 3TIUA 1CE5A 1NY22 1O3EA 1O2JA 1XUJA 1MCVA 1Z6JH 1EP6A 1SMFE 5C2ZA 3A7TA 2P94A 2RA3A 4DT7B 4ZAEA 5E2OA 1DT2A 5SGAE 1D9IA 4X6OA 2SGPE 4ABAA 2ZFSA 3A84A 3K65B 3UNSA 4E05H 3EA7A 3SU5A 1CGJE 3TJNA 1DM4B 1K1PA 4JZ1A 1DLKB 2ZFQH 2BLQA 2VIVA 2FTMA 2J4IA 4R8TB 1GI7B 1CU1A 1HDTH 5AF9H 1AU8A 1YPEH 1W3CA 3GY3A 1MTNC 2EI7A 3ZYEA 5DP4A 1DLEA 1O5DH 3ZVDA 1HNEE 1SQOA 4AX9H 4ZUHA 1O2YA 3HGNA 5C20A 1FONA 2ANKH 1A5HA 3MO9A 3U1JB 3ZZ9A 1O35A 1P3CA 1E35B 1BMLA 2ZDLA 3PMJA 4M7GA 4K5ZA 1JRSA 4XSKU 5C5OA 4KTCA 3TH2H 1QBOA 2A45B 4OS1A 1TNIA 1A1RA 1FN8A 1O33A 1RIWB 2V3HH 1E38B 4SGBE 2C8WB 2O9QA 3SV8A 4ABFA 2FODA 3GY5A 5EXLA 3K6ZA 4XE4A 3M3SA 3RU4D 3SU4A 2ZC9H 4Y10E 2WV5A 1GHAG 5TCCA 1GBFA 1LVOA 1P2IA 1ELGA 3TH3H 1MU8B 3QDZB 5DKMA 1SGIB 2OP9A 1GBLA 2ZGCA 5CHAB 1KXEA 3SUDA 2NU1E 1O32A 1C5MD 1CHOF 3RXPA 4ABIA 1GCDA 2AGEX 1SQAA 4Q7YA 2OINA 3BTDE 1MMJN 3AAVA 2GMTB 2ZECA 1O5FH 5FXLA 2RA0A 2P8OC 1ACBE 1CVWH 2ZA5A 3VGCB 1BMMH 2K1QA 3ZV9A 1OP8A 2A2XH 4FU8A 4INHA 4X0WU 1GDUA 4OGYA 1XUHA 2O8WA 4I8LA 3IWMA 3STJA 1QRZA 4HZHA 2FS9A 1HXEH 2JH0D 2QXGA 2SGAA 3KNXA 3LOXA 1VJ9U 1TBZH 4KKDA 1VR1H 1ESBA 1A5GH 5GIBA 3EA8A 3QUMP 5A8XA 1TNGA 5JBCS 2ZDVH 3TJUA 3RC5A 5FX5A 2DE8A 2KAIA 1W14U 4LK4A 2A7HA 1QRWA 3DFJA 2F3CE 2BOKA 4Y8YA 2VINA 1ZSJA 1V6DA 1ZRBA 4A7IB 1O2MA 3E90B 1ZLRA 4LZ4B 3O8CA 4Q80A 2PKSB 3E3TA 5HM9A 2F9VA 2ZU5A 1ZHRA 3NWUA 1ELEE 4XOJA 3T28A 2Z6BD 4AFZA 1GBTA 3BV9B 4I8HA 1QL7A 2Z9IA 3RXSA 3E16B 2PSXA 1BQYA 2BY8X 3AW0A 1GCTC 1BJVA 1C5XB 1TBQH 3RXGA 4BAHB 1WQVH 2ZIQH 1W0ZU 5C1XA 4TPYA 1G2LA 3GYMA 3PYHA 2BVSH 4XBBA 1EATA 1QJ1B 4BNRA 5DJ7A 2Y80A 1GMCF 4AYYB 2C93B 1EKBB 2GP9B 1FY4A 4IGDA 4DURA 4BTTB 2H2ZA 1PQ5A 2QV1A 1TOMH 2A7JA 1GJ7B 3RDZA 4D9RA 3LC3A 1O3AA 3QO6A 4YO9A 1T7CA 1YPMH 3GCHB 1HBTH 1K1OA 4DGJA 4XDEA 4NSYA 1TE0A 1LHEH 1HXFH 3D49H 1C2FA 3FP7E 4YLQH 3FVFB 3RXMA 1G37A 1GBHA 2EC9H 3SZNA 2H9HA 4GLYA 1HAZB 1LHGH 1UHBA 3MOCA 5B6OA 3DA9B 1N1LA 4X8TH 5DK1A 4B74A 1JIRA 1AMHA 1P06A 4FU7A 1ZR0A 1BBRE 1MCTA 1PPCE 4Y8XA 3M37A 4MNXA 3PWCA 4I7YH 3T27A 3F1SB 4TYDA 1MD7A 4BTUB 2ZDKA 1DSUA 2AEIH 1XUKA 2A4RA 1G36A 1TWXB 1IQLA 2BD7A 2CN0H 2Z7FE 3ZZCA 4AZ2B 3A7VA 1ARCA 1O5AB 1T32A 1INCA 3ESTA 4OS6A 3RXKA 1BRAA 1Y8TA 4BOHA 5AFYH 5GCHG 1GJ4H 2QIQA 1CHGA 1G9IE 1SLVB 3PLPA 4ABJA 4D9QA 1NN6A 2GCHF 1CT0E 1LQEA 3RLWH 1YP9A 1KXFA 5HYOA 3KIDU 1YKTA 8ESTE 3UR6A 2Z9KA 4H6SB 1E34B 3ZV8A 4Y11E 1XKBC 2UWPA 2OQUA 4Q7ZA 2WPMS 1C5QA 5E0GA 2O8TA 2F9OA 1FZZA 2ZPQA 3KQEA 1KXCA 3MFJA 1EUFA 2PKAA 4BTIB 1FV9A 1TFXA 3P70B 4MNVA 2R3UA 1GI2A 1XUGA 1C1RA 3S69A 3AASA 2OXSA 4DCDA 3H5CB 1ZGIA 1OX1A 3N7OA 1SGFA 2O8UA 3MU8A 4UD9H 2OC7A 9ESTA 1C4V2 1HYLA 1VGCC 1ZHMA 1MQ5A 2C3SA 2ZHFH 1LKAA 4K60A 3BEUA 1BBRK 1H9IE 2C4FH 3U69H 5L30H 2VGCC 4X6NA 4WXVA 1CA0B 1KDQB 3O8RA 3E0PB 4B76A 1TONA 4E06H 3FP8E 1BB0B 2BY9X 1KXDA 4INLA 1UVTH 1H1BA 1TRNA 4B2CA 1TIOA 2GZ8A 5A0CA 1VZQH 2VH6A 1UVSH 4RN6A 1GI5A 5J4QA 3LDXH 2FOEA 3MH5A 4Y79A 3RMNH 1OWEA 3NUMA 2WPLS 4I8GA 4MPXA 1MU6B 1NU9A 3M61U 2CXVA 1NU7B 1O3PB 5HXFA 1GI8B 3BTKE 5AHGH 1K21H 1LDTT 3FZZA 3M7UA 3P6ZB 1VITF 3PO1C 2JETB 1AGJA 1A0LA 4WMDA 1OWIA 3RXDA 4GSOA 3DD2H 1ELVA 5DO4H 2CF9H 1X7AC 1K1JA 3M5MA 5G4BA 1LVYA 1XVMA 4XBDA 3MTYA 3OSYA 2A5IA 4QT8C 2FI4E 4ABGA 4AORA 4NIXA 1MKXH 5J4SA 2P3FH 1C5LH 2TGTA 2TRMA 2H5CA 1XKAC 2WPKS 4NA9H 1XUIA 1QL9A 4JYTA 4GAWA 2BD2A 2VJ1A 1FN6A 2LPRA 4O3TA 1PPHE 4ABEA 1B0EA 4FVBA 3PTNA 1YYY1 1NRSH 4ABDA 3KGPA 1A7SA 4AN7A 2ZQ1A 3A87A 6ESTA 1HUTH 5C1UA 3JZ1B 2P95A 1CT4E 4MPUA 4I31A 5TJXA 1O34A 1DY9A 1YF4A 5C1YA 2TGAA 1GL0E 4THNH 5LPFA 1V2NT 1WTHD 4X2WA 3P8FA 5F8ZA 1ZSLA 1BTPA 1T8NA 2EI6A 1OPHB 4TWWA 2Z94A 1P04A 3A80A 4F49A 1V3XA 2PV9B 2Y6TA 3G01A 3SJKA 3SW2B 4FU9A 2BQ6B 1GI0A 2IJOB 4Q7XA 3MNXA 1RRKA 1C5VA 4LXBH 4I32A 3SJIA 2NU2E 4ZMAH 4DVAU 1B0FA 2D1JA 3KQCA 2PSYA 3ZZ7A 1O30A 4ZH8A 1Z1IA 3T29A 1C5RA 1RFNA 1W12U 1SLXB 1D3QB 2BX3A 3RXJA 2CGAA 2XCFA 4FUHA 4FUCA 2VWLA 3ATWA 1A0JA 5JBBS 2R0LA 2ZDMA 4Y0ZE 1V2PT 1UCYE 2HRVA 1NFXA 3MU5A 2A4QA 1DVAH 3PROA 1HJ9A 4CR9A 4YTAA 4CRBA 3GDUA 3A89A 1O2RA 2CJIA 4HI3A 3SNBA 4NZLA 4NG9H 1DXPA 1AUJA 2Z3EA 1U6QA 3F9FA 5ABWA 1WV7H 4IMQA 2G8TA 1ID5H 2A7CA 3RM2H 1Q3XA 3ZZ4A 1DWCH 4YLUA 1MTNB 1C1UH 1F92A 1P12E 1A46H 1Y3UA 4UFFH 3MH4A 2Z9JA 3C1KA 1C5YB 5FCRA 3ZZ5A 3QZRA 3LJJA 2G52A 1LMWB 1RTLA 1P05A 3RXFA 3BEFB 1GHVH 1T8OA 1AB9C 3BTEE 1SHHB 4GHTA 1O38A 1YGCH 2HVXA 2AGGX 1RXPA 2DE9A 3BF6H 3SUEA 1O2XA 1HGTH 4JZFH 4I8KA 1FY3A 4TY6A 3BTWE 3TU7H 4RKOB 1C1TA 1EZXC 1QBVH 4ZHAA 1SGDE 2F9BH 1TMBH 3Q77A 1IQIA 2QXIA 3UFAA 1AFEH 1ANDA 1C5SA 2VIOA 3TPIZ 3EE0B 1VCQA 3UNRA 1DWEH 1OYQA 5EW1H 3UUZA 3DUXH 2Z3CA 1C2IA 1PPGE 2G5NA 1GDNA 1CGIE 5H4IB 5FPYA 4FUFA 2P59A 1ELTA 6CHAB 2Y5GA 3BTQE 4JYUH 2RDLA 1P03A 4Q2KA 2XBXA 1UCYK 1GHZA 1PPEE 1SGRE 5I25A 4O97A 3L3TA 3ATMA 5ESTE 4X2VA 1DE7H 1F0TA 4ZXXH 1GBEA 3QZQA 1J14A 3M3TA 4FUIA 1GBIA 1GHWH 1GMHF 1KXAA 2QAAA 4KGAA 7LPRA 1AE8H 3FFGA 1S5SA 2PGBB 2ZGHA 4CRCA 4DY7B 1F0UA 4X8VH 1YCPM 2UUJB 1S85A 4ASHA 1DICA 1LPGB 2Q1JA 4GPGA 2XBWA 3ODFA 1KLIH 4DIHH 1ZTJA 1EOJA 1MAYA 1GI9B 4WH6A 2VIQA 3TNTA 3VXFH 1C4U2 3VEQB 3PMAB 1GGDC 3ATLA 1P9SA 3A85A 1NRPH 1V2JT 3R0FA 1BRUP 1A2CH 5ETXA 5HGGA 1C2LA 3ZZ3A 1CA8B 3DFLA 1E37B 2EEKA 2BD3A 5EQSA 2ZHWH 1MKWK 3RMLH 1GCTB 3F9HA 1C5TA 1B7XB 1AZ8A 4Y7BA 1LKBA 3TJVA 5LH8A 2WUBA 4B73A 1UTQA 1FIWA 2ZNKH 2ALVA 2XW9A 4KP0A 1T8LA 4CRGA 3TGJE 2P3UB 1GJDB 3LH1A 2UUFB 1Z8RA 5CE1A 2RCEA 3C27B 1Y59T 4WMFA 1BRCE 3GY2A 4NA7A 1XUFA 2FOBA 4IMZA 1AFQC 1TGNA 3S9BA 2ILNA 4TWYA 4AGKA 3EYDA 1EZUC 2SNVA 1C5ZB 2SGFE 2KAIB 1TGBA 2PHBA 2AIPA 1GG6C 4UFEH 4CHAC 3KCGH 2BZAA 2R9PA 1RTFB 2ZFPH 3SU1A 2BB4A 1HJAB 5AFZH 3UTUH 1AWFH 3TJOA 1MZDA 2JKHA 1UTMA 1F7ZA 1UJ1A 3UQOA 2XWBI 2OUAA 2CHAC 2QA9E 2EA3A 2AERH 5T6GA 3A8AA 2BHGA 3TGIE 1UO6A 1W10U 1C2JA 1A0HB 4ESTE 3M5NA 3AW1A 4KELA 1KTTB 5EG4A 4E7RG 4FUEA 2BD9A 1AVXA 4DIIH 1ZZZA 1CBWC 5GWZA 5JB8S 2GDEH 3SOSA 2STBE 3A86A 4IBLH 1RD3B 1AI8H 1C5PA 4K69A 1CHOG 1O3KA 1BZXE 1Z8GA 2H6MA 1DITH 2ZDAH 5EXMA 3T62A 2TGPZ 1EJAA 1F5RA 1SC8U 1Z7KA 1ZTKA 2GV6A 3OX7U 2A4OA 2BYAX 1ZJKA 1NS3A 1IQGA 1L2EA 3K6YA 3WY8A 4B2AA 1O3NA 2BQ7B 2AGIX 2AS9A 4NGAH 2AH4X 2G4TA 4UE7H 1UHBB 2BLVA 1ZJDA 1ELAA 2HPPH 3ATIA 4NCYA 4PROA 1P57B 3OYPA 1C2EA 1W11U 3M5LA 5DG6A 4K3JA 3RXCA 1Z8IB 2UUKB 2IOTA 1H8DH 2BDGA 3BTME 3FZDA 3RXLA 3FANA 1HAIH 3M7QA 2V35A 2ANMH 4K2YA 1W8BH 3B23B 1KYNA 1L1NA 1MZAA 1W0YH 3PMBB 3VB7A 1FPCH 3RXUA 1SOTA 2VGCB 1C1WH 2OD3B 1HV7A 2BLOA 1ZMJA 3UREA 2FXRA 1YPGH 3SU2A 5I46H 3E1XB 1EPTA 3LT3A 4O03A 5A0BA 1YPJH 3UOPA 2XNIA 2BQWB 1YM0A 4X1RU 2WYJA 3A7ZA 2G00A 1H4WA 1W7XH 2ODQA 1P9UA 3ZVGA 1DXWA 1F5KU 1GMCG 3KL6A 5C67A 4BXWA 1D3TB 3RMOH 1TRYA 1SI5H 2FS8A 2P16A 1AVWA 2QGRA 2AMQA 5EQQA 1NC6A 1K1IA 4H4FA 3CENA 1MAXA 3W95A 2PKAB 2GT7A 1IHSH 1NT1A 3TVJB 1O3LA 1O3JA 1LHFH 5EODA 4X1NU 2XXLA 4X1SU 1OWDA 1ZMNA 4KTUA 2ODYB 1L1JA 1ORFA 2WPHS 2RG3A 2ZTYA 5FAHA 1XVOA 1AZZA 1WSSH 1GDQA 3ZZDA 3MMGA 1BJUA 5FPTA 2BM2A 1GJ5H 4NSVA 1Z8JB 1V2LT 2W3KA 1FY5A 3MYWA 3SHCH 3GISB 2C90B 2ZI2H 2ZCLP 4A92A 4YT7H 4BANB 3PTBA 1S6FA 4UDWH 1EPTC