1K2I1

Crystal structure of gamma-chymotrypsin in complex with 7-hydroxycoumarin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
245
structure length
236
Chain Sequence
CGVPAIQPVLIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYTPDRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CHYMOTRYPSINOGEN A
publication title Crystal structure of gamma-chymotrypsin in complex with 7-hydroxycoumarin.
pubmed doi rcsb
total genus 54
structure length 236
sequence length 245
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 2001-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k2i102
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k2i101
1WOFA 4U01A 1LKAA 5E0HA 4Y76A 1JXPA 1K1PA 1NY22 1TB6H 4BTIB 1GI4A 2A7HA 1EZUC 1WQSA 3PMHB 4E7RG 3MWIU 3NZIA 4AZ2B 1FN6A 4WY3A 3NWUA 1YPEH 4GAWA 4IC5A 2GV7A 3A8DA 1C2FA 1YPLH 1ZPBA 3ATMA 1OSSA 3UR6A 1AD8H 3M5NA 4K8BA 4B2BA 1GHBG 2FI3E 1P9UA 1NRNH 3FP7E 5JB9S 2P16A 4Y7AA 3M5OA 4Q7ZA 1TGSZ 5LH8A 4YTAA 1H4WA 4ABEA 5GWZA 3A7WA 3D62A 4FU7A 1TNGA 2G8TA 3CS7A 3VEQB 5FBIA 5J4QA 1KXEA 3SU0A 1TRYA 4ABBA 1OWEA 3MH5A 1C1UH 3CP7A 3SNCA 1F5RA 1GGDC 4OS1A 2Q6DA 3P95A 4I33A 1RTLA 5DP3A 1J14A 1QQ4A 4BAMB 1GBIA 8KME2 5FAHA 1GBBA 1F0TA 1DSUA 1W8BH 5SGAE 1UCYK 4B75A 3ODDA 2ZTXA 4JK6A 3FP6E 1P10A 2Z9JA 2HNTC 1HXEH 4NA9H 3EDXB 2NU1E 1JMOH 3O8RA 4Y10E 4UEHH 1MCTA 2AEIH 3UOUA 2SNVA 2EI8A 1O5CB 1VGCC 3U8TH 4INLA 1RRKA 1MTWA 1LCYA 3RXLA 1GHYH 2TGAA 1V6DA 2FESH 1OS8A 1RTFB 4VGCB 1C2KA 2H9EH 4QT8C 1UTMA 4R8TB 1S81A 1QL9A 4YLUA 4YZUA 1P2NA 1FY4A 1L1NA 1BMMH 1SL3A 2Y80A 4K8YA 3K6ZA 3I77A 3P92A 3FZZA 3VXFH 5ABWA 1ESTA 4MPUA 1V2QT 4TWYA 2C93B 3UPEA 2QIQA 4GCHG 4ZHLU 1C9TA 2BD5A 1GI8B 3MNCA 1NFUA 1ZSKA 3V7TA 1UMAH 1AVGH 5FBEA 4D7GA 1T8LA 1GBAA 1IQEA 1GJAB 1DANH 3DUXH 3Q3XA 2OC0A 4Y7BA 1BUIA 1OXGA 1TYNA 3BG8A 4LOYH 3SBKA 2A4QA 4Y6DA 3SV8A 3BV9B 1E36B 1TOCB 2ZHEH 3TJVA 3FFGA 3SHAH 3LGVA 4MNXA 2RA3A 4ZMAH 3KIDU 1TBQH 5F6MA 4HTCH 3I29A 1WU1A 4X2XA 2VWLA 2ZGJA 4OS5A 3ELAH 4SGBE 1SOZA 3BIVH 1HJAB 4HGCA 2A5KA 3SGQE 3O8BA 1ELEE 5CMXH 1DS2E 2A4OA 1C1PA 1A5IA 4IMZA 2ZHDA 1L2EA 2A4GA 2ZECA 1SI5H 1TABE 3E0PB 1ZGIA 5FX5A 4XDEA 1K28D 2UUKB 2W26A 2YNAA 4X2WA 2OC7A 5EXNA 1A0HB 1THSH 2ANYA 2O8TA 3UOPA 1QJ1B 4CBNA 5EXLA 1JRSA 2P3FH 5CE1A 1NT1A 4Q80A 3K2UA 3PTBA 2ZDAH 2PGBB 2UUYA 3PLPA 3EE0B 2UUFB 3A84A 1AWFH 1UVUH 5C3NA 4WVPE 6CHAC 1E37B 4ZKSU 1H9HE 1YLCA 1QHRB 1AZZA 3FZDA 3ZVGA 3KN2A 1ZMLA 4FUCA 1HNEE 1AFQB 1KIGH 2B9LA 2A0QB 2P94A 4DGJA 1T4UH 1NM6A 2FO9A 4KP0A 3Q3KA 3T26A 3SO3A 1UTNA 3GDUA 5GCHF 3OU0A 2BY7X 1NRSH 1EKBB 3MU0A 2G00A 1ETTH 1ZJDA 6ESTA 4A7IB 3F9HA 1C5RA 2AYWA 2P93A 1W10U 1EP6A 1XUJA 1P3CA 1HYLA 5C5OA 2AFQB 5A2MH 1G32B 2SNWA 3NUMA 5DP9A 2SGDE 4AFQA 4IC6A 3E3TA 2BQ6B 4ZAEA 1W0ZU 1W2KH 4MPVA 1UTLM 5DPAA 2BMGB 1P0SH 1T32A 1SGFG 1UTPA 4ZROA 1EQ9A 3M61U 2CF8H 1FAKH 5JYIA 1PQ5A 3HKJB 3E8LA 1ZJKA 4WJG2 1C1TA 3MHWU 1FAXA 1Y8TA 2Z9LA 1SLXB 2XC0A 3E0NB 4YM9A 2BXTH 1UK4A 2OLGA 2ZCHP 4B73A 3MYWA 1B5GH 1PQ8A 2FOFA 3AAVA 4JZFH 2EI7A 4O3TA 3PWBA 2GCTC 1C2IA 2J38A 1IHSH 3U69H 2ALVA 2Q1JA 1Y3XA 3ODFA 5I25A 2A45B 3A7XA 1DE7H 3H5CB 3SNDA 3DA9B 2B0FA 4XSKU 5CHAC 4CBOA 3TK9A 1E35B 4CHAB 1QFKH 1AIXH 3VGCC 5JBTA 1TAWA 4A1XA 2ZCKP 1XKAC 2P8OC 3QDZB 1V2KT 2BQWB 1MBMA 4ZXXH 1ZPZA 1F2SE 4UE7H 1D6WA 1FLEE 5EG4A 1KLJH 4AX9H 4IGDA 4XE4A 5JPMH 3UTUH 1QIXB 1MQ6A 1Z8IB 2DE9A 1DICA 4X2YA 1EJNA 2V35A 1KSNA 3BTHE 3RM0H 3ZZ7A 4UD9H 3E91A 4WF8A 1P03A 4K1TA 1G2LA 1HJ8A 3GY5A 1GCTB 1IQGA 2TGPZ 2A7JA 1VR1H 4MPXA 7KMEH 3QTOH 1J17T 2JETC 3BEIB 1A46H 4K2YA 4H6TA 3SU4A 4AGJA 3SW2B 2NU4E 3A88A 1O0DH 1QB9A 2F9OA 4WH8A 3IITA 1O34A 3RXDA 3MMGA 1HUTH 2BZAA 1OWJA 3U1JB 2ODYB 1NZQH 3A83A 1WCZA 1TE0A 2QV1A 2BLVA 3LONA 2G4TA 1TRNA 3GICB 1GVLA 1EPTC 3LGIA 1BTWA 3HK3B 1O2WA 1EOJA 1O5GH 1O5FH 2F9UA 3AW0A 3PTNA 3T2NA 1A0JA 1MUEB 3E90B 2YOLA 1SBWA 1F0UA 4LXBH 1IQHA 1V2OT 2OBQA 2BD9A 1HGTH 1CHOF 3A82A 1A2CH 3MFJA 3OY5U 1PJPA 1QL7A 1SGNE 2J92A 2A32A 5CHAB 2FP7B 1C5TA 3K9XB 5DO4H 3FVFB 1EUFA 5BRRE 1QJ6B 3RC6A 2PW8H 6LPRA 1O39A 2PGQB 5C2ZA 1GJ7B 3LU9B 4KKDA 2D1JA 2ANWA 1QBNA 4F49A 2P8OB 1CSOE 2UWLA 2DUCA 2VIVA 1HCGA 4TY6A 3P8OA 3RUOA 2DE8A 1QA7A 1BOQA 1WSSH 2FODA 2G5NA 5GJ4B 1PQ7A 3E6PH 3IG6B 1X7AC 4E7NA 1QTFA 4OS2A 1FXYA 1D3QB 4B1TA 4ZKNU 2R2MB 3ZZ8A 2FTLE 3V3MA 3LGWA 3BTQE 2V0BA 2NWNA 3NKKA 2Y7XA 1ZLRA 1DWEH 1A7SA 1GJBB 1F5KU 3PMBB 2R2WU 4X6MA 3RXKA 1HJ9A 1P2MA 3U1IB 1PFXC 1UO6A 4I7YH 1DWDH 2XCFA 1QB1A 3DT0H 1HDTH 2VWNA 3BG4C 5A0BA 3RXEA 1E34B 1L1JA 4ISLA 2F3CE 2NU3E 5A8ZA 2BD3A 4AB8A 3RDZA 1NFXA 1UHBB 1FPHH 2BVXH 1TA2A 1DX5M 3PWCA 1EZSC 5LGOA 1B0EA 2C8YB 3C27B 2ZGBH 2AMPA 2BM2A 2J95A 1DITH 3ZVAA 2HPPH 1SFQB 1NRRH 2J4IA 1GMDG 2LPRA 2BB4A 1DXWA 1XUGA 5FCRA 4WXVA 4CRBA 3PB1E 1SLUB 3T28A 4X1PU 2G81E 3JZ2B 2FZZA 4NWLA 1LMWB 5C1UA 1GJ8B 2WYGA 1DDJA 4I8LA 2Z9IA 3SU5A 3SGBE 2HOBA 1A5HA 5HM9A 4ISHH 4AFZA 2IPHA 1O2MA 2P3TB 5L30H 2AGIX 2Z3CA 1QL8A 2VH6A 4DJZB 1D4PB 2QAAA 3SNBA 3TNSA 1KXCA 1QQUA 2AGEX 3UUZA 4LZ4B 3URCA 2ZO3H 3RC5A 1GBFA 4D8NA 5EOKA 2OQ5A 2PWXA 4CRAA 1BZXE 1DSTA 1A0LA 4CRFA 1Y5BT 4CR9A 1J9CH 1IQJA 2BLWA 1Q2WA 1BTXA 4RN6A 1TLDA 2R0KA 7ESTE 2AIQA 2AS9A 2QF3A 1JIRA 1ZMNA 3KQDA 3MU4A 5EQQA 3QGNB 3UNQA 1DUEA 3GCTF 1GL0E 3BG4B 1THPB 5JDUB 5GXPA 1KDQA 3M3SA 4JK5A 4Y11E 1C1QA 1P2IA 4ZKOU 5C5NA 5ESBA 3MO9A 4CH8B 4NFFA 4MVNA 3TH4H 1Z71A 1CGJE 2GGVB 1WTHD 1O3MA 5IYTA 3T29A 1K2I1 2GCHG 1AY6H 1S0RA 1K1NA 1LVMA 4A92A 2BHGA 3SJ9A 1BT7A 1C1SA 1IQMA 2C3SA 4YT7H 1INCA 1HLTH 1DPOA 2HNTF 3UQOA 1AVXA 1PPZA 1D3DB 1HAOH 1HBTH 1O32A 3EA7A 4SGAE 1D6RA 1SGTA 4I32A 1ZHRA 3M5LA 1K1IA 1GG6B 2A1DB 2ZNKH 2BZ6H 4KTSA 1LPZB 1UTKA 2Y6TA 2VIWA 1SPJA 4UFDH 3RC4A 1C5UA 3W94A 1P2QA 2Y5GA 1V2PT 3RXAA 4B74A 1GDQA 1DUAA 3SV7A 3S7KB 3RXUA 2ZQ2A 3UFAA 1ETRH 4JYUH 4XFQA 4JYVH 4VGCC 4X8SH 1FJSA 2ZTZA 2C4FH 1FIZA 4YESB 4OS6A 1OOKB 1NTPA 2EEKA 3QX5H 3A89A 4O9VA 1XUIA 3GYLB 2F91A 3SJOA 1CT2E 3JZ1B 5AHGH 3SORA 3OX7U 3BTWE 2A5IA 2KAIB 1YPHE 2G5VA 3D65E 3ZV9A 2QXHA 4K3JA 1QURH 1K9OE 4ABHA 2ZP0H 3ZV8A 3ATWA 3MNXA 1YF4A 3ZYEA 2WINI 2GT7A 4KTCA 4Y8YA 2QXGA 4CREA 3A80A 4NG9H 3BF6H 1VITG 1CU1A 4UFFH 1OWKA 1UVOA 3GDVA 2ZU3A 1BBRE 1ZSLA 2FOMB 1GHXH 3UY9A 1TGCA 1TMBH 1CHGA 2O8WA 2ZDLA 4Y71A 1NRQH 3BN9A 1TMUH 3UNRA 1GVKB 2BOHB 5HYOA 4AB9A 4H6SB 4D76A 1GL1A 1EJAA 5DP5A 3AASA 4X8TH 3TLOA 2HVXA 3RXVA 1ZHMA 2BDAA 2PUXB 2ULLA 3MH6A 2BLQA 5AF9H 2HPQH 1V2NT 1CHOG 1MZDA 2SGEE 4ABGA 3TGKE 1BRBE 1C1RA 2ZPQA 1CBWB 2K1QA 1PQAA 3RMMH 1HAIH 1V3XA 3U9AH 1ELAA 4YOIA 1C2EA 1GJ4H 1S83A 2FX6A 4NIXA 5A8XA 1O33A 2BDHA 3HKIB 3SU3A 1RD3B 1EAIA 2PR3A 1W0YH 4X0WU 3RU4E 1C2JA 3A86A 2W7SA 1BBRH 1O2GH 1HJAC 1CO7E 7LPRA 4AOQA 2BYAX 2P3UB 1B7XB 4Y79A 3SJIA 1C1OA 1OKXA 1ARBA 1W7GH 1G3CA 3RXIA 2BY6X 1O36A 3F9GA 1YLDA 4A1VA 1C5QA 2Y82A 5EQRA 1EAWA 5C1YA 1HAXB 1TRMA 4JCNA 2GZ9A 3TH3H 4AYYB 3OYPA 1NN6A 3W95A 3RXPA 5DJ7A 3BTTE 4YLQH 1XKBC 3TH2H 3F68H 2VWMA 1C4V2 1QR3E 2H2ZA 1ANEA 5GDSH 3ZVEA 1O5DH 1YYY1 3QGJA 2F9BH 1QA0A 1LVBA 2ZFRH 3NXPA 1AFQC 1O3FA 3OSYA 2BX3A 1C5NH 1O2SA 1FONA 2ASUB 1PPFE 3VPKA 1FMGA 4B76A 4DOQA 2VNTA 4OS4A 2Y7ZA 3GYMA 1AB9B 2GMTB 1FY8E 1VJAU 5E8EH 1SGEE 3RP2A 3L6PA 1T31A 1GI0A 4YO9A 4Z0KA 4AG1A 2JKHA 3A7VA 3D49H 1SHYA 2XC5A 5GIBA 1GJDB 3STIA 1E0FD 1DWBH 3R0FA 2ZG0H 1S5SA 2SGQE 5FXLA 1JRTA 2OTVA 3F9FA 2PKSC 2R0LA 1IQKA 1DM4B 1JOUB 3LH3A 4Q2KA 1H9IE 1IQNA 1Z7KA 2G52A 2ZU4A 3LIWA 1ZMJA 3E16B 3LC3A 4WMDA 1LPGB 1HAHH 1Y3WA 3RXMA 2VVVA 3LGTA 1AUJA 3RXOA 1O2NA 3AVZA 1CT4E 4FUHA 3SI4H 1AE8H 1ZTJA 4DG4A 2O8LA 1GI7B 1MAYA 2ZWLH 1P02A 1GMDF 1RIWB 3RMNH 5TCCA 1C5VA 5JBAS 1RTKA 4CHAC 1C5LH 2RCEA 1C1WH 1NU7B 5FCKA 3LGUA 3PMJA 4BTUB 5DP7A 2BY9X 1MKWK 3A7ZA 2FI4E 4IW4E 1YCPK 3B23B 1MBQA 2XNIA 1SR5C 1LHCH 1JBUH 1IHTH 4ISOA 3B8JA 3A85A 3TIUA 3M7TA 4PROA 2ZC9H 3S9CA 1TNKA 5T6FA 4WMFA 3M37A 3P17H 1G3DA 4DY7B 4JYTA 3GCTG 1PPCE 1FDPA 3ZVCA 2PLXA 3KF2A 5EPYA 2IOTA 5EPNA 1GCTC 4GVUA 5DP4A 1AKSA 2LNCA 1C2MA 1IQLA 3K6YA 5I46H 2CN0H 2H9TH 2GDEH 3SJ8A 2XTTB 3EAJA 2VINA 1O2LA 4INHA 1WYKA 1YBWA 2GP9B 2V3OH 1SGDE 1O2ZA 2WYJA 4A1TA 2FOCA 1Z6EA 2PKSB 3GY2A 2AERH 3PLBA 2A2XH 1YGCH 4HI3A 2Q6GA 3RLYH 1MTUA 3GY6A 3M3VA 3TNTA 4LK4A 2GKVE 4FUDA 1GHAF 2ZHFH 4FUIA 1ZTLA 9ESTA 2QN5T 1YCPM 5T3HA 1AQ7A 1DWCH 1BQYA 2FOAA 5H4IB 2ZFPH 1NC6A 1TBZH 2GCHF 3RXFA 2XW9A 3VB4A 1LQDB 1TGBA 1UCYE 4JZEH 1KXFA 1A3EH 2QF0A 3A8BA 1E38B 3UREA 1TX8A 3R3GB 3QO6A 3MO3A 2THFB 3RXGA 2Y5FA 2ZPSA 5TCAA 3F9EA 1C5SA 4GLYA 5K0HA 1SLVB 3S9AA 2PHBA 4Y0YE 5DKMA 4THNH 1ZSJA 1UVTH 4BAQB 5LPEA 2UWPA 1O2HA 1O2PA 1W7XH 1L0ZA 2ZU5A 1UVSH 2TRMA 1VITH 1NU9A 3UIRA 3NK8A 4ABDA 1MTNB 1TBRH 1CE5A 1WQVH 2FEQH 2F9PA 5LPFA 3ZYDA 1SGQE 4CRCA 3SJKA 3S9BA 2TPIZ 4MQAA 3LH1A 3HATH 2XXLA 1FZZA 2FOGA 4OGXA 3HGPA 1UCYH 5AFYH 1V2TT 5B6OA 1Y59T 1QGFA 1TQ7B 2XBXA 2ZTYA 1YPKH 4IMQA 1U6QA 1VITF 1N1LA 2B8OH 1FY3A 4ASHA 5HGGA 3GDSA 5F8XA 1C2HA 3ITIA 1NFWA 1TPOA 4I8KA 1O2YA 4RKJB 3M35A 1S85A 3SV2H 1W12U 4HFPB 1UTJA 2BY8X 2CXVA 2I6SA 1O2QA 3PROA 2GD4B 4X6NA 2UUJB 2PKAB 2C8XB 1LKBA 1G36A 3KHVA 1EP5A 3Q76A 2GX4A 5A8YA 2XCNA 1MAXA 1H8DH 2D26C 2FS9A 5JBBS 4B2CA 4K69A 1AMHA 4BAKB 2BDBA 1GWAA 2J2UA 4TY7A 5FHTA 3SV9A 4D9RA 1O2XA 2FPZA 2CGAA 4DCDA 3MOCA 1EB2A 1DXPA 1J15A 1CGIE 2WV5A 1V2JT 3MH7A 1ZZZA 3QLPH 2G51A 1YPJH 1O38A 4AG2A 5DP6A 2VGCC 1SGYE 2ZEBA 3PM3A 1ESAA 4ZKRU 1VCWA 2ZPRA 1W13U 1THRH 4RKOB 1HIAA 4MTBA 1QB6A 1UTOA 4NZQA 4ZUHA 1A1RA 3FP8E 4K1SA 1T4VH 2OINA 3C1KA 1AWHB 1BMLA 1O3GA 2Z7FE 4XBDA 1GBJA 3S7HB 3SQHE 2ZHQH 2A5AA 1ESBA 6GCHG 1BITA 2PV9B 1YPMH 1K1MA 1KYNA 5ESTE 3SOSA 4MG3A 1CT0E 2FYQA 3RXQA 1EPTA 1O2RA 3P8GA 2XBVA 4ZXYH 2H5CA 2TGTA 1G3EA 4J2YB 1C5MD 3ZZAA 1LO6A 1SHHB 4RSPA 5A09A 4X1QU 2WPIS 3GY8A 4BXSA 4MNYA 2JH6D 4FUBA 5E0JA 1V2ST 2JH0D 1B0FA 1HAVA 2FXRA 4TWWA 2Z9KA 3ENSB 1NROH 5HM2A 1BDAA 4GSOA 3SQEE 3TVJB 1EB1H 4J1YA 1A4WH 3RXRA 4OGYA 5A0CA 1GI3A 1Z8RA 1GG6C 2H9HA 2UWOA 1N8OB 1C5YB 1OPHB 1TNIA 3ZVBA 1SG8B 2HNTE 2ANKH 1GBKA 1ZHPA 4MLFB 4I8HA 4R0IA 2ZF0H 1V2LT 1GHWH 4YT6H 3T62A 2FOBA 4IN1A 1P12E 4U2WA 1D9IA 1S82A 1XVMA 1T8MA 2VGCB 3DFLA 1S6HA 2CJIA 3H7OA 3V12A 4A5TS 2J34A 1MU6B 1MU8B 5HXFA 1XUKA 1K1JA 2BVRH 1QRZA 3G01A 4KELA 1O3OA 2AMDA 4NZLA 1PPHE 3BTKE 4KGAA 1GI9B 2SGAA 5AFZH 2PSXA 1MD7A 2BVSH 1JWTA 1N6YA 1M9UA 4AFSA 4Y8ZA 1GBEA 3RXJA 2BQ7B 1A5GH 1CA8B 2EC9H 4DIHH 2FI5E 4WXIA 2NU2E 2QA9E 1O3JA 1DY9A 2ZDKA 3Q00A 1FQ3A 1YPGH 2QC2A 1P11E 4IBLH 1XVOA 2VH0A 1GHAG 1XXFA 2TGDA 4K1EA 1DY8A 5C1XA 1XX9A 2GTBA 3BSQA 1CGHA 1J16A 1AFEH 4Y0ZE 1HV7A 4GHQA 3F1SB 1CBWC 4O03A 1Z1IA 2XRCA 1AUTC 4FVDA 1GJ5H 1DVAH 1DLEA 2RG3A 1W11U 1FPCH 2ANMH 2HALA 2WPJS 1FNIA 2B5TB 3F6UH 1QY6A 4DIIH 4X2VA 1PYTC 3TJUA 1O3AA 3RMLH 1OWHA 2FYRA 1C5OH 1CQQA 5E2OA 1KDQB 3QTVH 1V2RT 2WUBA 3QN7A 1Z8GA 5TJXA 3KQBA 1EXFA 1TQ0B 2A31A 1GHVH 2O8MA 4X1RU 1ELVA 1BRUP 3LT3A 2J94A 1VCPA 1F0SA 2F9NA 1O2UA 2ZIQH 1HXFH 1O3DA 1EAXA 3TITA 4FVBA 1BTHH 2ZU2A 1JIMA 3SUFA 2V3HH 1TPAE 1BA8B 4JZ1A 1C5XB 5F8ZA 2ZA5A 1TA6A 4FU9A 3UQVA 1GBDA 4UFGH 1SLWB 2ZZUH 2XWAA 4JMYA 2SFAA 2XBWA 1O2KA 1BMNH 1F92A 1SVPA 9LPRA 4ZHAA 1Z6JH 8GCHF 1NRPH 1SSXA 1RGQA 4ABAA 1FN8A 1EX3A 1IQFA 3SI3H 2STBE 3EYDA 1ANDA 2Y81A 5EXMA 1V2MT 2Z3EA 1P2KA 2AH4X 3QZQA 3ZZ3A 1GBCA 4UFEH 3VB7A 3DD2H 1AB9C 1QCPA 2GMTC 2FX4A 2BDIA 2VIOA 2IN2A 1RS0A 3URDA 1KY9A 1HRTH 3MNSA 3P8FA 5DG6A 5EU8A 1EOLA 1KXBA 1GI2A 3EGKH 2HWLB 1AU8A 1O3IA 1CA0C 1DOJA 1ZPCA 3E1XB 1FI8A 2ZCLP 2BLOA 4BTTB 1V2UT 5DGJA 1LHGH 1NFYA 1WUNH 1O5AB 3VB5A 3RXTA 2CHAB 5GPIB 1SMFE 3ZVFA 2TIOA 3AW1A 2ZFSA 1BJVA 3B9FH 2W3IA 1D3TB 3UNSA 3VB6A 1OWIA 2R9PA 3ZZCA 1P06A 2ZI2H 3UWJH 1F0RA 3WY8A 2WPKS 3SGAE 2ZHWH 1GJ6A 1BIOA 2QXIA 3GCOA 1EASA 1QBOA 3PO1C 1AO5A 1RIWC 1XMNB 1SGCA 1YKTA 4ABJA 3P6ZB 1GBLA 1DT2A 3LC5A 1O31A 1ANBA 1O2IA 1LHEH 3HGNA 3K65B 1EZXC 2P95A 5E0GA 3NCLA 2QGRA 2WPMS 2CF9H 1O5EH 2D8WA 3A81A 1UK3A 1AVWA 2A7CA 1YP9A 2P59A 2XWBI 3S69A 2F83A 4A6LA 1NPMA 1HAYB 2OD3B 4DT7B 2M5TA 4FUJA 3EA9A 3GCHC 4GPGA 1TMTH 1LVOA 3RXHA 5L2ZH 1FUJA 1UTQA 2BD8A 1KXAA 1BHXF 4I8GA 4FUGA 1Y3VA 4NWKA 3ZVDA 1ELDE 2TBSA 1ACBE 1P01A 1PPGE 1P05A 5L2YH 2WUCA 4MNWA 5FPSA 4DVAU 5T6DA 1FY1A 1MZAA 3ZZ4A 2IJOB 2ZFQH 3QZRA 1MD8A 2PTCE 6GCHF 1CA0B 2C8ZB 2VB0A 2VJ1A 4BANB 3L33A 1RXPA 2WV4A 3BEFB 2ZDNA 3QWCH 3D23A 3TGJE 4B71A 1C1NA 5A0AE 2AGGX 3BTGE 2F9VA 3P70B 1QNJA 1GGDB 1Z1JA 1HFDA 1H1BA 4XBBA 1F5LA 1SFIA 3SNEA 2FLRH 3KCGH 1P3EA 2FOHA 7GCHG 4X8VH 2OCVB 1W3CA 1OP8A 1P2OA 3TU7H 1BTYA 1GBHA 4I8JA 3LKWA 1SGFA 1ABJH 3SU2A 3MO6A 4K5ZA 1MTVA 2G55A 3BTFE 2FLBH 3Q3YA 3PO1B 2A4RA 3SZNA 2ODQA 3BTME 2OC8A 3T27A 1LDTT 4FUEA 2HLCA 1PPBH 1NS3A 1GVZA 1VGCB 1L4ZA 3V13A 1GJCB 1TOMH 4TPYA 1AN1E 1T8NA 1EZQA 1AZ8A 1BTPA 1V2WT 3A7YA 1TONA 1YPHC 2BOKA 1P2JA 1IOEA 4CRDA 1UK2A 1KLTA 2GDDA 4CH2B 3KNXA 1MTNC 1D3PB 3GCHB 3LGYA 4NA7A 3MNBA 4M7GA 2BD7A 2ZDVH 1BRAA 5AVDA 3FAOA 3RU4T 2R3UA 1MQ5A 3RMOH 8ESTE 2Y5HA 2ZFTA 3VXEH 3MTYA 2SGPE 3GY4A 4U32A 4E06H 1WBGB 2VVUA 4TPIZ 1BTZA 1GBTA 1MKXK 4WWYA 2YNBA 1PPEE 3OY6U 2ZKSA 4Y8XA 3Q77A 1T8OA 2PSYA 3KL6A 1TNJA 3GY3A 3M7QA 2PTNA 3AAUA 5T6GA 4WMEA 1G2MA 4CR5A 1GMCF 3MU8A 3TK5A 1TIOA 1C2DA 1ORFA 3MU5A 3TJNA 4LZ1H 1MMJN 2HRVA 5FX6A 1TFXA 3ZZ6A 4IN2A 1AKSB 3CENA 1PYTD 1Q3XA 1O30A 1Y5UT 1SC8U 1OYQA 2GT8A 4O97A 2OQUA 1TPPA 5K7RA 3KQEA 3PYHA 1LVYA 2ZQ1A 2VVCA 3T25A 5C20A 1MH0A 5DK1A 1VJ9U 2BD2A 5LPRA 3M5MA 2FTMA 1ZOMA 2XBYA 2V6NA 1ZRBA 4BAHB 3LOXA 2BX4A 2GZ8A 2QXJA 1XUHA 2BDGA 1C1MA 4NIYA 2ZGCA 4NIWA 1S0QA 3A8AA 3MI4A 1TALA 2ODPA 8GCHG 1K21H 1UVPA 5C67A 2OC1A 5HMAA 3SUDA 1SB1H 2PFEA 2ZU1A 3O8CA 1ID5H 1SGPE 2RA0A 2FWWA 4NIVA 2QY0B 4F4OC 1TGNA 1GI1A 1K1LA 1QRWA 2XC4A 3EA8A 1C4U2 1BTUA 1O3BA 3N7OA 1GDUA 4ABIA 4NSYA 4JZDH 3A87A 1HAGE 3DFJA 2W7UA 1QBVH 2D2DA 1GI5A 5F8TA 4BNRA 1FIWA 3LJOA 2VIPA 1P04A 2W3KA 3VB3A 2G4UA 3V0XA 3KGPA 4ZHMU 1SQAA 1T7CA 6CHAB 1IAUA 1C9PA 1HPGA 1A61H 2Z94A 2RDLA 1ARCA 1IQIA 1S84A 1YC0A 3ZZ9A 1GMHF 2HGTH 4GUXA 1WAYB 3ZZ5A 2FDAA 2ALPA 4BAOB 1EATA 3ATKA 1ELCA 1OWDA 3CS0A 4XOJA 2WPHS 2OXSA 1ELTA 4UDWH 2O9QA 2PKAA 1BHXB 4H4FA 1GBMA 3OTJE 2ZDMA 2Z6BD 3SV6A 3RM2H 3PLKA 4NSVA 5EGMA 3KQCA 3FANA 2J9NA 5EODA 5J4SA 1GHBF 1TGTA 3MU1A 1NESE 1FY5A 1SGRE 1WV7H 4FUFA 2GZ7A 2FM2A 1ELFA 4WH6A 2BTCE 1BCUH 3SN8A 3UR9A 1LHFH 2ZGHA 1G30B 1RJXB 4AGKA 3U8RH 1O2VA 4JZIA 3BIUH 1N8OC 1O2TA 3U98H 1ZR0A 1LHDH 3QUMP 1TWXB 1OYTH 1S6FA 5EQSA 1C5WB 3ZZBA 2AMQA 3RXBA 1G3BA 3A8CA 1LQEA 1QJ7B 2GCTB 1J8AA 1AHTH 1O3EA 4FXGH 1MCVA 2ZFFH 3GCNA 3PMAB 1ZTKA 3TK6A 2R3YA 4UONA 1Y3UA 2GVFA 2ILNA 1UJ1A 3TJOA 2BY5X 2C8WB 1CVWH 1TPSA 1YM0A 4O3UA 2BDCA 3A7TA 3SUGA 2WPLS 1O3KA 4YOGA 2O8UA 3VGCB 4AYVB 4X6PA 4X8UH 1H8IH 4MDSA 5FPTA 3RLWH 2W5EA 3TPIZ 4ISNA 1C2LA 4ISIH 1GHZA 1AE5A 2ESTE 4NFEA 3SU6A 1BBRK 3GY7A 1QRXA 1ELBA 1BRCE 3ESTA 2B7DH 3I78A 2FOEA 1OP2A 1Y5AT 3M3TA 3ZZDA 4U30A 1UHBA 1EAUA 1Q31A 4ABFA 3GISB 3RXSA 1AI8H 1G9IE 1SQTA 1XM1A 2SGFE 1HIAB 3IWMA 1LTOA 4K60A 1HAPH 3H7TA 1F7ZA 1OP0A 2VWOA 4X6OA 2H1UA 1GPZA 2JETB 1O3HA 3O8DA 4OS7A 4GCHF 4Z6AH 1TX7A 1O3LA 1VCQA 4AFUA 1XXDA 1TX6A 8LPRA 2EA3A 2QYIA 1K22H 1KLIH 4NGAH 3S0NA 3LDXH 1TNHA 1MKWH 1WTGH 4INKA 4TYDA 3UWIA 2CV3A 1YCPH 2H6MA 1GI6A 1EPTB 5L6NH 3HK6B 1OX1A 1O5BB 3BTEE 4KTUA 2FIRH 2Z9GA 1Y3YA 1P9SA 1DLKB 1GCDA 5EW2H 1ZRKA 1O37A 4GHTA 1ABIH 1ZGVA 3SHCH 1HAVB 3BEUA 3KEEA 7GCHF 1FV9A 5F03A 1KTTB 2I6QA 1VZQH 1TNLA 4NA8A 2QCYA 2STAE 1ETSH 1C5ZB 4IS5A 4DURA 3ATLA 2ZGXH 3VFEA 1MKXH 1GJ9B 1O3PB 2PUQH 4Q7XA 5JB8S 5JBCS 5BPEA 2OP9A 3ATIA 2BXUH 4E05H 4X1NU 1GDNA 3DHKH 5E2PA 5GCHG 4Q7YA 3SU1A 1O35A 2A2QH 1GMCG 4AORA 4YOJA 1P57B 4I31A 1RFNA 3L3TA 5G4BA 1ANCA 2XYAA 1W14U 1O3NA 3RXCA 2OUAA 1P09A 1LPKB 2VIDA 4ZH8A 3LJJA 3EQ0H 2BDYA 2GV6A 3MH4A 4DW2U 1SGIB 1P8VC 5FPYA 1C1VH 1SOTA 2OBOA 2CHAC 3M7UA 3RU4D 3SNAA 4XBCA 3U8OH 1BMAA 4D7FA 2NU0E 2FMJA 1A3BH 1N6XA 3T5FH 4AN7A 1XUFA 4FU8A 3QK1A 1DFPA 2C90B 5DP8A 3SUEA 1H9LB 1O2OA 4B2AA 3STJA 1NO9H 2AIPA 4BXWA 1ZYOA 4X1SU 3TGIE 1KTSB 1KXDA 3GOVB 1HAZB 2EI6A 5EW1H 1BJUA 2KAIA 1ELGA 4NCYA 1C5PA 4MNVA 4MPWA 5ETXA 4H42U 5PTPA 1O2JA 3M36A 4ESTE 1C4Y2 2JH5D 2VU8E 4D9QA 1EJMA 3NPSA 3PV4A 1G37A 4CRGA 3P8NA 1O3CA 2Q6FA 2Z3DA 1V2VT 4HZHA 2VIQA 2CMYA 4BOHA 1K1OA 1Z8JB 1GMHG 1C2GA 3BTDE 1SQOA 1L1GA 2BD4A 2H5DA 3HPTB 1L4DA 1BB0B 3LPRA 2FS8A 1MTSA 5IDKA 1HB0B 1AGJA
chains in the Genus database with same CATH superfamily
1WOFA 4U01A 1LKAA 5E0HA 3F3BA 4Y76A 1JXPA 1K1PA 1NY22 1TB6H 4BTIB 1GI4A 2A7HA 1EZUC 1WQSA 3PMHB 4E7RG 3MWIU 3NZIA 4AZ2B 1FN6A 2JIZD 3NWUA 1YPEH 4GAWA 4IC5A 2GV7A 3A8DA 4WY3A 1C2FA 1YPLH 1ZPBA 3ATMA 1OSSA 3UR6A 1AD8H 3DCLA 3M5NA 4K8BA 4B2BA 1GHBG 2FI3E 1P9UA 4TSFD 5EIYA 1NRNH 3FP7E 5JB9S 2P16A 4Y7AA 4F55A 3M5OA 4I86A 4Q7ZA 1TGSZ 5LH8A 4YTAA 1H4WA 4ABEA 5GWZA 3A7WA 3D62A 4FU7A 4Z1MD 1TNGA 2G8TA 3CS7A 3VEQB 5FBIA 5J4QA 1KXEA 3SU0A 1TRYA 4ABBA 1OWEA 3MH5A 1C1UH 3CP7A 3SNCA 1F5RA 1GGDC 4OS1A 2Q6DA 3P95A 4I33A 1RTLA 1COWD 5DP3A 1J14A 1QQ4A 4BAMB 1GBIA 8KME2 5FAHA 1GBBA 1F0TA 1DSUA 1AGJA 1W8BH 5SGAE 1UCYK 4B75A 3ODDA 2ZTXA 3F2FA 4JK6A 3FP6E 1P10A 2Z9JA 2HNTC 1HXEH 2WHXA 4NA9H 3EDXB 2NU1E 2OK5A 1JMOH 3O8RA 4Y10E 4UEHH 1MCTA 2AEIH 3UOUA 2SNVA 2EI8A 1O5CB 1VGCC 3U8TH 4INLA 1RRKA 1MTWA 1LCYA 3RXLA 1GHYH 2VBCA 2TGAA 1V6DA 2FESH 1OS8A 1RTFB 4VGCB 1C2KA 2PP6A 1W0KD 2H9EH 4QT8C 1UTMA 4R8TB 1S81A 1QL9A 4YLUA 4YZUA 1P2NA 1FY4A 1L1NA 1BMMH 1SL3A 2Y80A 4K8YA 3FO8D 3K6ZA 3KYGA 3I77A 3P92A 3FZZA 3VXFH 5ABWA 1ESTA 4MPUA 1V2QT 3F2GA 2RFKC 4TWYA 2C93B 3UPEA 4AC9A 2QIQA 4HG6A 4GCHG 4ZHLU 1C9TA 2BD5A 3FOAA 1GI8B 3MNCA 1NFUA 1ZSKA 3WWFA 3V7TA 1UMAH 1AVGH 5FBEA 4D7GA 1T8LA 1GBAA 5B6LA 1IQEA 1GJAB 1DANH 5C94A 3DUXH 3Q3XA 2OC0A 4Y7BA 1BUIA 1OXGA 1TYNA 3BG8A 4LOYH 3SBKA 2A4QA 4Y6DA 3SV8A 3BV9B 1E36B 1TOCB 2ZHEH 3TJVA 3FFGA 3SHAH 3LGVA 4MNXA 2RA3A 4ZMAH 3KIDU 1TBQH 5F6MA 4HTCH 3I29A 1WU1A 4X2XA 2VWLA 2ZGJA 4OS5A 3ELAH 4SGBE 1SOZA 3BIVH 1HJAB 4HGCA 2A5KA 3SGQE 3O8BA 1ELEE 5CMXH 1DS2E 3DSGA 2A4OA 1C1PA 1A5IA 4IMZA 2ZHDA 1L2EA 2A4GA 3F2HA 2ZECA 1SI5H 1TABE 3E0PB 1ZGIA 5FX5A 4XDEA 1K28D 2UUKB 2W26A 2YNAA 4X2WA 2OC7A 5EXNA 1A0HB 1THSH 2ANYA 2O8TA 5KECA 3UOPA 1QJ1B 4CBNA 5EXLA 1JRSA 2J97A 2P3FH 5CE1A 1NT1A 4Q80A 3K2UA 3PTBA 2ZDAH 2PGBB 2UUYA 3PLPA 3EE0B 3KYFA 2UUFB 3A84A 1AWFH 1UVUH 5C3NA 4WVPE 6CHAC 1E37B 4ZKSU 1H9HE 1YLCA 2GJGA 1QHRB 1AZZA 3FZDA 3ZVGA 3KN2A 1ZMLA 4FUCA 1HNEE 1AFQB 1KIGH 2B9LA 1S6LA 2A0QB 2P94A 4DGJA 1T4UH 1NM6A 2FO9A 4KP0A 3Q3KA 4RI0A 3T26A 3SO3A 1UTNA 3GDUA 5GCHF 3OU0A 2BY7X 1NRSH 1EKBB 3MU0A 2G00A 1ETTH 1ZJDA 6ESTA 4A7IB 3F9HA 1C5RA 2AYWA 1W10U 2P93A 1EP6A 1XUJA 1P3CA 1HYLA 4OM9A 2AFQB 5C5OA 5A2MH 1G32B 2SNWA 1SKYE 3NUMA 5DP9A 2SGDE 4AFQA 4IC6A 3E3TA 2BQ6B 4ZAEA 1W0ZU 1W2KH 4MPVA 1UTLM 5DPAA 2BMGB 1P0SH 1T32A 1SGFG 1UTPA 2LP6A 1EQ9A 3M61U 4ZROA 2CF8H 1FAKH 5JYIA 1PQ5A 3HKJB 3E8LA 1ZJKA 4WJG2 1C1TA 5HKKD 3MHWU 1FAXA 1Y8TA 2Z9LA 1SLXB 2XC0A 3E0NB 4YM9A 2BXTH 1UK4A 2OLGA 2ZCHP 4B73A 3MYWA 1B5GH 1PQ8A 2FOFA 3AAVA 4JZFH 3DSPA 2EI7A 4O3TA 3PWBA 2GCTC 1C2IA 1OHHD 2J38A 1IHSH 3U69H 2ALVA 2Q1JA 1Y3XA 2WZQA 3ODFA 5I25A 2A45B 3A7XA 1DE7H 3H5CB 3SNDA 3DA9B 2B0FA 4XSKU 5CHAC 4CBOA 3TK9A 1E35B 4CHAB 2QF4A 1QFKH 1AIXH 3VGCC 5JBTA 1TAWA 1E1QD 4A1XA 2ZCKP 1XKAC 2P8OC 1UW7A 3QDZB 1V2KT 2BQWB 1MBMA 4ZXXH 1ZPZA 1F2SE 4UE7H 1D6WA 1FLEE 5EG4A 1KLJH 4AX9H 4IGDA 4XE4A 5JPMH 3UTUH 1QIXB 1MQ6A 1Z8IB 2DE9A 1DICA 4X2YA 1EJNA 2V35A 1KSNA 3BTHE 3RM0H 3ZZ7A 4UD9H 3E91A 4WF8A 1P03A 4K1TA 1G2LA 1HJ8A 3GY5A 1GCTB 1IQGA 2TGPZ 2A7JA 1VR1H 4MPXA 7KMEH 3QTOH 1J17T 2JETC 3BEIB 1A46H 4K2YA 4H6TA 3SU4A 4AGJA 3SW2B 2NU4E 3A88A 1O0DH 1QB9A 2F9OA 4WH8A 3IITA 1O34A 3RXDA 3MMGA 1HUTH 2BZAA 1OWJA 3U1JB 2ODYB 1NZQH 3A83A 1WCZA 1TE0A 2QV1A 2BLVA 3LONA 2G4TA 1TRNA 3GICB 1GVLA 1EPTC 3LGIA 1BTWA 3HK3B 1O2WA 1EOJA 1O5GH 1O5FH 2F9UA 3AW0A 3PTNA 3T2NA 1A0JA 1MUEB 3N7EA 3E90B 2YOLA 1SBWA 3MQKC 1F0UA 4LXBH 1IQHA 1V2OT 2OBQA 2BD9A 1HGTH 1CHOF 3A82A 1A2CH 3MFJA 4Q63A 3OY5U 1PJPA 1QL7A 1SGNE 2J92A 2A32A 5CHAB 2FP7B 1C5TA 3K9XB 5DO4H 3FVFB 1EUFA 5BRRE 1QJ6B 1MABB 3RC6A 2PW8H 6LPRA 1O39A 2PGQB 5C2ZA 1GJ7B 3LU9B 4KKDA 2D1JA 2ANWA 1QBNA 4F49A 2P8OB 1CSOE 2UWLA 2DUCA 3FKSD 1H8HD 2VIVA 1HCGA 3W1EA 4TY6A 3P8OA 1WXRA 3RUOA 2DE8A 1QA7A 1BOQA 1WSSH 2FODA 2G5NA 5GJ4B 1YWUA 1PQ7A 3E6PH 1YLNA 1X7AC 3IG6B 1QTFA 4E7NA 4OS2A 1FXYA 1D3QB 3WWBA 4B1TA 4ZKNU 2R2MB 3ZZ8A 2FTLE 3V3MA 3LGWA 3BTQE 2V0BA 2NWNA 3NKKA 2Y7XA 1ZLRA 1DWEH 4FETA 1A7SA 1GJBB 1F5KU 3PMBB 2R2WU 4X6MA 3RXKA 1HJ9A 1P2MA 3U1IB 1PFXC 1UO6A 4I7YH 1DWDH 2XCFA 1QB1A 4ZCNA 3DT0H 1HDTH 2VWNA 3BG4C 5A0BA 3RXEA 1E34B 1L1JA 4ISLA 2F3CE 2NU3E 5A8ZA 2BD3A 4AB8A 3RDZA 1NFXA 1UHBB 1FPHH 2BVXH 1TA2A 1DX5M 3PWCA 1EZSC 5LGOA 3VG8A 1B0EA 2C8YB 3C27B 2ZGBH 2AMPA 2BM2A 2J95A 1DITH 3ZVAA 2HPPH 1SFQB 1NRRH 2J4IA 1GMDG 2LPRA 2BB4A 1DXWA 4B6EA 1XUGA 5FCRA 4WXVA 4CRBA 3PB1E 1SLUB 3T28A 4X1PU 2G81E 3JZ2B 2FZZA 4NWLA 1LMWB 5C1UA 1GJ8B 2WYGA 1DDJA 4I8LA 2V7QD 2Z9IA 3SU5A 3SGBE 2HOBA 1A5HA 5HM9A 4ISHH 4AFZA 2IPHA 1O2MA 2P3TB 5L30H 2AGIX 3OEHD 2Z3CA 1QL8A 2VH6A 4DJZB 1D4PB 2QAAA 3SNBA 3TNSA 1KXCA 1QQUA 2M2AA 2AGEX 3UUZA 4LZ4B 3URCA 2ZO3H 3RC5A 1GBFA 4D8NA 5EOKA 2OQ5A 2PWXA 4CRAA 1BZXE 1DSTA 1A0LA 4CRFA 1Y5BT 5HIZA 4CR9A 1J9CH 1IQJA 2BLWA 1Q2WA 1BTXA 4RN6A 1TLDA 2R0KA 7ESTE 2AIQA 2AS9A 2QF3A 1FX0B 1JIRA 1ZMNA 3KQDA 3MU4A 5EQQA 3QGNB 3UNQA 1DUEA 3GCTF 1GL0E 3BG4B 1THPB 5JDUB 5GXPA 1KDQA 3M3SA 4JK5A 2EQNA 4Y11E 1C1QA 1P2IA 4ZKOU 5C5NA 5ESBA 3MO9A 4CH8B 4NFFA 4MVNA 2YMSD 3TH4H 1Z71A 1CGJE 2GGVB 1WTHD 1O3MA 5IYTA 3T29A 1K2I1 2GCHG 1AY6H 1S0RA 1K1NA 1LVMA 4A92A 2BHGA 3SJ9A 1BT7A 1C1SA 1IQMA 2C3SA 4YT7H 1INCA 1HLTH 5EJZA 1DPOA 2HNTF 3UQOA 4RT0A 1AVXA 1PPZA 1D3DB 1HAOH 1HBTH 1O32A 3EA7A 4SGAE 1D6RA 1SGTA 4I32A 1ZHRA 3M5LA 1K1IA 1GG6B 2A1DB 2ZNKH 2BZ6H 4KTSA 1LPZB 1UTKA 2Y6TA 2VIWA 1SPJA 4UFDH 3RC4A 1C5UA 3W94A 1P2QA 2Y5GA 1V2PT 3RXAA 4B74A 1GDQA 1DUAA 3SV7A 2XOKD 3S7KB 3RXUA 2ZQ2A 3UFAA 1ETRH 4JYUH 4XFQA 4JYVH 4VGCC 4X8SH 1FJSA 2ZTZA 2C4FH 1FIZA 4YESB 4OS6A 1H8ED 1OOKB 1NTPA 2EEKA 3QX5H 3A89A 4O9VA 1XUIA 3GYLB 2F91A 3SJOA 1CT2E 3JZ1B 5AHGH 3SORA 5DN6D 3OX7U 3BTWE 2A5IA 2KAIB 1YPHE 2G5VA 3D65E 3ZV9A 2QXHA 4K3JA 5HIYA 1QURH 1K9OE 4ABHA 2ZP0H 3ZV8A 3ATWA 3MNXA 1YF4A 3ZYEA 2WINI 2GT7A 4KTCA 1K0HA 4Y8YA 2QXGA 4CREA 3A80A 4NG9H 3BF6H 1VITG 1CU1A 3PRBA 4UFFH 1OWKA 1UVOA 3GDVA 2ZU3A 1BBRE 1ZSLA 2FOMB 1GHXH 3UY9A 1TGCA 1TMBH 1CHGA 2O8WA 2WSSD 2ZDLA 4Y71A 1NRQH 3BN9A 1TMUH 3UNRA 1GVKB 2BOHB 5HYOA 4AB9A 4H6SB 4D76A 1GL1A 1EJAA 5DP5A 3AASA 4X8TH 3TLOA 2HVXA 3RXVA 1ZHMA 2BDAA 2PUXB 2ULLA 3MH6A 2BLQA 2KM0A 5AF9H 2HPQH 1V2NT 1CHOG 1MZDA 2SGEE 4ABGA 3TGKE 1BRBE 1C1RA 2ZPQA 1CBWB 2K1QA 1PQAA 3RMMH 3PRDA 1HAIH 1V3XA 3U9AH 1ELAA 4YOIA 1C2EA 1GJ4H 1S83A 2FX6A 4NIXA 5A8XA 1O33A 2BDHA 3HKIB 3SU3A 1RD3B 1EAIA 2PR3A 1W0YH 4X0WU 3RU4E 1C2JA 3A86A 2W7SA 1BBRH 1O2GH 1HJAC 1CO7E 7LPRA 4AOQA 2BYAX 2P3UB 1B7XB 4Y79A 3SJIA 1C1OA 1OKXA 1ARBA 1W7GH 1G3CA 3RXIA 2BY6X 1O36A 3F9GA 1YLDA 4A1VA 1C5QA 2Y82A 5EQRA 1EAWA 5C1YA 1HAXB 1TRMA 4JCNA 2GZ9A 3TH3H 4AYYB 3OYPA 1NN6A 3W95A 3RXPA 5DJ7A 3BTTE 4YLQH 1XKBC 3TH2H 3F68H 4M9FA 3SYJA 2VWMA 1C4V2 1QR3E 2H2ZA 1ANEA 5GDSH 3ZVEA 1O5DH 1YYY1 3QGJA 2F9BH 1QA0A 1LVBA 2ZFRH 3NXPA 1AFQC 1O3FA 3OSYA 2BX3A 1C5NH 1O2SA 1FONA 2ASUB 1PPFE 3VPKA 1FMGA 4B76A 4DOQA 2VNTA 4OS4A 1WDIA 2Y7ZA 3GYMA 1AB9B 2GMTB 1FY8E 1VJAU 5E8EH 1SGEE 3RP2A 3L6PA 1T31A 1GI0A 4YO9A 4Z0KA 4AG1A 2JKHA 3A7VA 5EJ1A 3D49H 1SHYA 2XC5A 5GIBA 1GJDB 3GS9A 3STIA 1E0FD 5T1VA 1DWBH 3R0FA 2ZG0H 1S5SA 2SGQE 5FXLA 1JRTA 2OTVA 3F9FA 2PKSC 2R0LA 1IQKA 1DM4B 1JOUB 3LH3A 4Q2KA 1H9IE 1IQNA 1Z7KA 2G52A 2ZU4A 3LIWA 1ZMJA 3E16B 3LC3A 2K8IA 1LPGB 1HAHH 4WMDA 1Y3WA 3RXMA 2VVVA 3LGTA 1AUJA 3RXOA 5CDFE 1O2NA 3AVZA 1CT4E 4FUHA 3SI4H 1AE8H 1ZTJA 4DG4A 1GI7B 2O8LA 1MAYA 2ZWLH 1P02A 1GMDF 1RIWB 2HLDD 3RMNH 5TCCA 1C5VA 5JBAS 1RTKA 4CHAC 1C5LH 2RCEA 1C1WH 1NU7B 5FCKA 3LGUA 4DT4A 3PMJA 4BTUB 5DP7A 2BY9X 1MKWK 3A7ZA 2FI4E 4IW4E 1YCPK 3B23B 1MBQA 2XNIA 1SR5C 5FL7D 1LHCH 1JBUH 1IHTH 4ISOA 3B8JA 3A85A 3TIUA 3M7TA 4PROA 2ZC9H 3S9CA 1TNKA 5T6FA 3FN8A 4WMFA 3M37A 3P17H 1G3DA 4DY7B 4JYTA 2J98A 3GCTG 1PPCE 1FDPA 3ZVCA 2PLXA 3KF2A 5EPYA 2IOTA 5EPNA 1GCTC 4GVUA 5DP4A 1AKSA 2LNCA 1C2MA 1IQLA 3U28C 3K6YA 5I46H 2CN0H 2H9TH 2GDEH 3SJ8A 2XTTB 3EAJA 2VINA 1O2LA 4INHA 1WYKA 1YBWA 2GP9B 2XNDD 2V3OH 1SGDE 1O2ZA 2WYJA 4A1TA 2FOCA 1Z6EA 2PKSB 3GY2A 2AERH 3PLBA 2A2XH 1YGCH 4HI3A 2Q6GA 3RLYH 1MTUA 3GY6A 3M3VA 3TNTA 4LK4A 2GKVE 4FUDA 1GHAF 2ZHFH 4FUIA 1ZTLA 4FOUC 9ESTA 2QN5T 1YCPM 5T3HA 1AQ7A 1DWCH 1BQYA 2L74A 2FOAA 5H4IB 2ZFPH 1NC6A 1TBZH 2GCHF 3RXFA 2XW9A 3VB4A 1LQDB 1TGBA 1UCYE 4JZEH 1KXFA 1A3EH 2QF0A 3A8BA 1E38B 3UREA 1TX8A 3R3GB 3QO6A 3MO3A 4B6FA 2THFB 3RXGA 2Y5FA 1EFRD 2ZPSA 3CNRA 5TCAA 3F9EA 1C5SA 4GLYA 5K0HA 2IPQX 1SLVB 3S9AA 2PHBA 4Y0YE 5DKMA 4THNH 1ZSJA 1UVTH 4BAQB 5LPEA 2KCYA 2UWPA 1O2HA 1O2PA 1W7XH 1L0ZA 2ZU5A 1UVSH 2TRMA 1VITH 1NU9A 3UIRA 2W6JD 3NK8A 4ABDA 1MTNB 1TBRH 1CE5A 1WQVH 2FEQH 2F9PA 4XD7D 5F53A 3ZYDA 5LPFA 1SGQE 4CRCA 3SJKA 3S9BA 2TPIZ 4MQAA 3LH1A 3HATH 2XXLA 1FZZA 1NBMD 2FOGA 4OGXA 3HGPA 1UCYH 5AFYH 1V2TT 5B6OA 1Y59T 1QGFA 1TQ7B 2XBXA 2ZTYA 1YPKH 4IMQA 1U6QA 1VITF 1N1LA 2B8OH 1FY3A 4ASHA 5HGGA 3GDSA 5F8XA 1C2HA 3ITIA 1NFWA 1TPOA 4I8KA 1O2YA 4RKJB 1VKYA 3M35A 1S85A 3SV2H 1W12U 4HFPB 1UTJA 2BY8X 2CXVA 2I6SA 1O2QA 3PROA 2GD4B 4X6NA 2UUJB 2PKAB 2C8XB 1LKBA 1G36A 3KHVA 1EP5A 3Q76A 2KX4A 2GX4A 5A8YA 2XCNA 1MAXA 1H8DH 4P02A 2D26C 2FS9A 5JBBS 4B2CA 4K69A 1W0JD 1AMHA 4BAKB 5GNDA 2BDBA 1GWAA 2J2UA 4TY7A 5FHTA 3SV9A 4D9RA 3OEED 1O2XA 2FPZA 2CGAA 4DCDA 3MOCA 3PV5A 1EB2A 1DXPA 1J15A 2F43B 1CGIE 2WV5A 1V2JT 3MH7A 1ZZZA 3QLPH 2G51A 1YPJH 1O38A 4AG2A 5DP6A 2VGCC 1SGYE 2WV9A 2ZEBA 1ESAA 3PM3A 4ZKRU 1VCWA 2ZPRA 1W13U 1THRH 4RKOB 1HIAA 4MTBA 1QB6A 1UTOA 4NZQA 4ZUHA 1A1RA 3FP8E 4K1SA 1T4VH 2OINA 3C1KA 1AWHB 1BMLA 1O3GA 2Z7FE 4XBDA 2HVYB 1GBJA 3S7HB 3SQHE 2ZHQH 2A5AA 1ESBA 6GCHG 1BITA 2PV9B 1YPMH 1K1MA 2QF5A 1KYNA 5ESTE 3SOSA 4MG3A 1CT0E 2FYQA 3RXQA 1EPTA 1O2RA 3P8GA 2XBVA 4ZXYH 2H5CA 2TGTA 1G3EA 4J2YB 1C5MD 3ZZAA 1LO6A 1SHHB 4RSPA 5A09A 4X1QU 2WPIS 3GY8A 4BXSA 3N7DA 4MNYA 2JH6D 4FUBA 4ACBA 5E0JA 1V2ST 2JH0D 1B0FA 1HAVA 2FXRA 4TWWA 2Z9KA 3ENSB 1NROH 5HM2A 2LELA 1BDAA 4GSOA 3SQEE 3TVJB 1EB1H 4J1YA 1A4WH 3RXRA 4OGYA 5KGOA 5A0CA 1GI3A 1Z8RA 1GG6C 2H9HA 2UWOA 1N8OB 1C5YB 1OPHB 1TNIA 3ZVBA 2JDID 1SG8B 2HNTE 2ANKH 1GBKA 1ZHPA 4MLFB 4I8HA 4R0IA 2ZF0H 1V2LT 1GHWH 4YT6H 3T62A 2FOBA 4IN1A 1P12E 4U2WA 1D9IA 1S82A 1XVMA 1T8MA 2VGCB 3DFLA 1S6HA 2CJIA 3H7OA 3V12A 4A5TS 2J34A 1MU6B 1MU8B 5HXFA 1XUKA 1K1JA 2BVRH 1QRZA 3G01A 4KELA 1O3OA 2AMDA 4NZLA 1PPHE 3BTKE 4KGAA 1GI9B 2SGAA 5AFZH 2PSXA 1MD7A 2BVSH 1JWTA 1N6YA 2V3MA 1M9UA 4AFSA 4Y8ZA 1GBEA 3RXJA 2BQ7B 1A5GH 1CA8B 2EC9H 4DIHH 2FI5E 4WXIA 2NU2E 2QA9E 1O3JA 1DY9A 2ZDKA 3Q00A 1FQ3A 1YPGH 2W6ID 2QC2A 1P11E 4IBLH 1XVOA 2VH0A 3EE7A 1GHAG 1XXFA 2TGDA 4K1EA 1DY8A 5C1XA 1XX9A 2GTBA 3BSQA 1CGHA 1J16A 1AFEH 4Y0ZE 1HV7A 4GHQA 3F1SB 1CBWC 4O03A 1Z1IA 2XRCA 1AUTC 4FVDA 1GJ5H 1DVAH 1DLEA 2RG3A 1W11U 1FPCH 2ANMH 2HALA 2WPJS 1FNIA 2B5TB 3F6UH 1QY6A 4DIIH 4X2VA 1PYTC 3TJUA 1O3AA 3RMLH 1OWHA 2FYRA 1C5OH 1CQQA 5E2OA 1KDQB 3QTVH 1V2RT 2WUBA 3QN7A 1Z8GA 5TJXA 3N99A 3KQBA 3OFND 1EXFA 1TQ0B 2A31A 1GHVH 2O8MA 4X1RU 1ELVA 1BRUP 3LT3A 2J94A 1VCPA 1F0SA 2F9NA 1O2UA 2ZIQH 1HXFH 1O3DA 1EAXA 3TITA 4FVBA 1BTHH 2ZU2A 1JIMA 3SUFA 2V3HH 3NRLA 1TPAE 1BA8B 4JZ1A 1C5XB 5F8ZA 2ZA5A 1TA6A 4FU9A 3UQVA 1GBDA 4UFGH 1SLWB 2ZZUH 2XWAA 4JMYA 2SFAA 2XBWA 1O2KA 1BMNH 1F92A 1SVPA 2AHME 9LPRA 4ZHAA 1Z6JH 8GCHF 1NRPH 1SSXA 1RGQA 4ABAA 1FN8A 1EX3A 1IQFA 3SI3H 5DSFA 2STBE 3EYDA 1ANDA 2Y81A 5EXMA 1V2MT 2Z3EA 4ASUD 1P2KA 2AH4X 3QZQA 3ZZ3A 1GBCA 4UFEH 3VB7A 3DD2H 1AB9C 1QCPA 2GMTC 2FX4A 2BDIA 3OE7D 2VIOA 2IN2A 1RS0A 3URDA 1KY9A 1HRTH 3H09A 3MNSA 3P8FA 5DG6A 5EU8A 1EOLA 1KXBA 1GI2A 3EGKH 2HWLB 1AU8A 1O3IA 1CA0C 1DOJA 1ZPCA 3E1XB 1FI8A 2ZCLP 2BLOA 4BTTB 1V2UT 5DGJA 1LHGH 1NFYA 1WUNH 1O5AB 3VB5A 3RXTA 2CHAB 5GPIB 1SMFE 3ZVFA 2TIOA 3AW1A 2ZFSA 1BJVA 3B9FH 2W3IA 1BMFD 1D3TB 3UNSA 3VB6A 1OWIA 2R9PA 3ZZCA 1P06A 1QZ8A 2ZI2H 3UWJH 1F0RA 1E79D 3WY8A 2WPKS 3SGAE 2ZHWH 1GJ6A 2RDEA 1BIOA 2QXIA 3GCOA 1EASA 1QBOA 3PO1C 1AO5A 1RIWC 1XMNB 1SGCA 1YKTA 4ABJA 3P6ZB 1GBLA 1DT2A 3LC5A 1O31A 1ANBA 1O2IA 1LHEH 3HGNA 3K65B 1EZXC 2P95A 3OTPA 5E0GA 3NCLA 2QGRA 2WPMS 2CF9H 1O5EH 2D8WA 3A81A 1UK3A 1AVWA 2A7CA 1YP9A 2P59A 2XWBI 3S69A 2F83A 4A6LA 1NPMA 1HAYB 2OD3B 3KQ5A 4DT7B 2M5TA 4FUJA 3EA9A 3F0PA 3GCHC 4GPGA 1TMTH 1LVOA 3RXHA 2J5UA 5L2ZH 1FUJA 1UTQA 2BD8A 1KXAA 1BHXF 4I8GA 4FUGA 1Y3VA 4NWKA 3ZVDA 1ELDE 2TBSA 1ACBE 1P01A 1PPGE 1P05A 5L2YH 2F4LA 2WUCA 4MNWA 5FPSA 4DVAU 5T6DA 1FY1A 1MZAA 3ZZ4A 2IJOB 2ZFQH 3QZRA 1MD8A 2PTCE 6GCHF 1CA0B 2C8ZB 2VB0A 2VJ1A 4BANB 3L33A 1RXPA 2WV4A 4TT3D 3BEFB 2ZDNA 3QWCH 3D23A 3TGJE 4B71A 1C1NA 5A0AE 2AGGX 3BTGE 2F9VA 3P70B 1QNJA 1GGDB 1Z1JA 1HFDA 1H1BA 3PV2A 4XBBA 1F5LA 4YXWD 1SFIA 3SNEA 2FLRH 3KCGH 1P3EA 2FOHA 7GCHG 4X8VH 2OCVB 1W3CA 1OP8A 1P2OA 3TU7H 1BTYA 1GBHA 4I8JA 2KFWA 3DSOA 3LKWA 3AK5A 1SGFA 1ABJH 3SU2A 3MO6A 4K5ZA 1MTVA 2G55A 3BTFE 2FLBH 3Q3YA 3PO1B 2A4RA 3SZNA 2ODQA 3BTME 2OC8A 3T27A 1LDTT 4FUEA 2HLCA 4F48B 1PPBH 1NS3A 1GVZA 1VGCB 1L4ZA 3V13A 1GJCB 1TOMH 4TPYA 1AN1E 1T8NA 1EZQA 1AZ8A 1BTPA 1V2WT 3A7YA 1TONA 1YPHC 2BOKA 1P2JA 1IOEA 4CRDA 1UK2A 1KLTA 2GDDA 4CH2B 3KNXA 1MTNC 1D3PB 3GCHB 3LGYA 4NA7A 3MNBA 4M7GA 2JJ2D 2BD7A 2ZDVH 1BRAA 5C17A 5AVDA 3FAOA 2L6OA 3RU4T 2R3UA 1MQ5A 5C0UA 3RMOH 8ESTE 2Y5HA 2ZFTA 3VXEH 3MTYA 2SGPE 3GY4A 4U32A 4E06H 1WBGB 2VVUA 4TPIZ 1BTZA 1GBTA 1MKXK 4WWYA 2YNBA 1PPEE 3OY6U 4P00A 2ZKSA 4Y8XA 3Q77A 1T8OA 2PSYA 3F0OA 1TNJA 3GY3A 3KL6A 2PTNA 3AAUA 3M7QA 5T6GA 4WMEA 1G2MA 4CR5A 1GMCF 3MU8A 3TK5A 1TIOA 1C2DA 2J98B 1ORFA 3MU5A 3TJNA 4LZ1H 1MMJN 2HRVA 5FX6A 1TFXA 3ZZ6A 4IN2A 1AKSB 2QE7D 3CENA 1PYTD 1Q3XA 1O30A 1Y5UT 1SC8U 1OYQA 2GT8A 4O97A 2OQUA 1TPPA 5K7RA 3KQEA 3PYHA 1LVYA 2ZQ1A 2VVCA 3T25A 5C20A 1MH0A 5DK1A 1VJ9U 2BD2A 5LPRA 3M5MA 2FTMA 1ZOMA 2XBYA 2YMSC 2V6NA 1ZRBA 4BAHB 3LOXA 2BX4A 2GZ8A 2QXJA 1XUHA 2BDGA 1C1MA 4NIYA 2ZGCA 4NIWA 1S0QA 3A8AA 3MI4A 1TALA 2ODPA 8GCHG 1K21H 1UVPA 5C67A 2OC1A 5HMAA 3SUDA 1SB1H 2PFEA 2ZU1A 3O8CA 1ID5H 1SGPE 2RA0A 2FWWA 4NIVA 2QY0B 4F4OC 1TGNA 1GI1A 1K1LA 1QRWA 2XC4A 3EA8A 1C4U2 1BTUA 2KZ4A 1O3BA 3N7OA 1GDUA 4ABIA 2WPDD 4NSYA 4JZDH 3A87A 1HAGE 3DFJA 2W7UA 1QBVH 2D2DA 1GI5A 5F8TA 4BNRA 1FIWA 3LJOA 2VIPA 1P04A 2W3KA 3VB3A 2G4UA 3V0XA 3KGPA 4ZHMU 1SQAA 1T7CA 6CHAB 1IAUA 1C9PA 1HPGA 1A61H 2Z94A 3UAIC 2RDLA 1ARCA 1IQIA 1S84A 1YC0A 3ZZ9A 1GMHF 2HGTH 2KR7A 4GUXA 1WAYB 3ZZ5A 2FDAA 2ALPA 4BAOB 1EATA 4Q4LA 3ATKA 1ELCA 1OWDA 3CS0A 4XOJA 2WPHS 2OXSA 1ELTA 4UDWH 2O9QA 2PKAA 1BHXB 4H4FA 1GBMA 3OTJE 2ZDMA 2Z6BD 3SV6A 3RM2H 3PLKA 4NSVA 5EGMA 3KQCA 3FANA 2J9NA 5EODA 5J4SA 1GHBF 1TGTA 3MU1A 1NESE 1FY5A 1SGRE 1WV7H 4FUFA 2GZ7A 2FM2A 1ELFA 4WH6A 2BTCE 1BCUH 2KCAA 3SN8A 3UR9A 1LHFH 2ZGHA 1G30B 1RJXB 4AGKA 2YMSB 1O2VA 3U8RH 4JZIA 3BIUH 1N8OC 1O2TA 3U98H 1ZR0A 1LHDH 3QUMP 1TWXB 1OYTH 1S6FA 5EQSA 1C5WB 3ZZBA 4ACAA 2AMQA 3RXBA 1G3BA 3A8CA 1LQEA 1QJ7B 2GCTB 1J8AA 1AHTH 1O3EA 4FXGH 1MCVA 2ZFFH 3GCNA 3PMAB 1ZTKA 3TK6A 2R3YA 4UONA 1Y3UA 2GVFA 2ILNA 1UJ1A 3TJOA 2BY5X 2C8WB 1CVWH 1TPSA 1YM0A 2K0QA 4O3UA 2BDCA 3A7TA 3SUGA 2WPLS 1O3KA 4YOGA 3OAAD 2O8UA 3VGCB 4AYVB 4X6PA 4X8UH 1H8IH 4MDSA 5FPTA 3RLWH 2W5EA 3TPIZ 4ISNA 1C2LA 4ISIH 1GHZA 1AE5A 2ESTE 4NFEA 3SU6A 1BBRK 3GY7A 1QRXA 1ELBA 1BRCE 3ESTA 2B7DH 3I78A 2FOEA 1OP2A 1Y5AT 3M3TA 3ZZDA 4U30A 1UHBA 1EAUA 1Q31A 4ABFA 3GISB 3RXSA 1AI8H 1G9IE 1SQTA 1XM1A 2SGFE 1HIAB 3IWMA 1LTOA 4K60A 1HAPH 3H7TA 1F7ZA 1OP0A 2VWOA 4X6OA 2H1UA 1GPZA 2JETB 1O3HA 3O8DA 1NBME 4OS7A 4GCHF 4Z6AH 1TX7A 1O3LA 5IK2D 1VCQA 4AFUA 1XXDA 1TX6A 3WW7A 8LPRA 2EA3A 2QYIA 1K22H 1KLIH 4NGAH 5C0TA 3S0NA 3LDXH 1TNHA 1MKWH 1WTGH 4INKA 4TYDA 3UWIA 2CV3A 1YCPH 2H6MA 1GI6A 1EPTB 5L6NH 3HK6B 1OX1A 1O5BB 3BTEE 4KTUA 2FIRH 2Z9GA 1Y3YA 1P9SA 1DLKB 1GCDA 5EW2H 1ZRKA 1O37A 4GHTA 1ABIH 3SZEA 1ZGVA 3SHCH 1HAVB 3BEUA 3KEEA 7GCHF 1YY3A 2JJ1D 5CHBA 1FV9A 5F03A 1KTTB 2I6QA 1VZQH 1TNLA 4NA8A 2QCYA 2STAE 1ETSH 1C5ZB 4IS5A 4DURA 2IJD1 3ATLA 2ZGXH 3VFEA 5KEDA 1MKXH 1GJ9B 1O3PB 2PUQH 4Q7XA 5JB8S 5JBCS 5BPEA 2EY4C 2OP9A 3ATIA 2BXUH 4E05H 4X1NU 1GDNA 4RT1A 3DHKH 5E2PA 5GCHG 3ZIAD 4Q7YA 3SU1A 1O35A 1KMHB 1GMCG 2A2QH 4AORA 4YOJA 1P57B 4I31A 1RFNA 3L3TA 5G4BA 1ANCA 2XYAA 1W14U 1O3NA 3RXCA 2OUAA 1P09A 1LPKB 2VIDA 4ZH8A 3LJJA 3EQ0H 2BDYA 2GV6A 3MH4A 5EJLA 4DW2U 1SGIB 1P8VC 5FPYA 1C1VH 1SOTA 2OBOA 2CHAC 3M7UA 3RU4D 3SNAA 4XBCA 3U8OH 1BMAA 4D7FA 2NU0E 2FMJA 1A3BH 1N6XA 3T5FH 4AN7A 1XUFA 4FU8A 3QK1A 1DFPA 2C90B 5DP8A 2KCOA 3SUEA 1H9LB 1O2OA 4B2AA 3STJA 1NO9H 2AIPA 4BXWA 1ZYOA 4X1SU 4XRNA 3TGIE 1KTSB 1KXDA 3GOVB 1HAZB 2EI6A 5EW1H 1BJUA 2KCPA 2KAIA 1ELGA 4NCYA 1C5PA 4MNVA 1SQRA 4MPWA 5ETXA 3UB0A 4H42U 5PTPA 1O2JA 3M36A 4ESTE 1C4Y2 2JH5D 2VU8E 4D9QA 1EJMA 3NPSA 3PV4A 1G37A 4CRGA 3P8NA 1O3CA 2Q6FA 2Z3DA 1V2VT 4HZHA 2VIQA 2CMYA 4BOHA 1K1OA 1Z8JB 1GMHG 1C2GA 3BTDE 1SQOA 1E1RD 1L1GA 2H5DA 2BD4A 3HPTB 1L4DA 1BB0B 3LPRA 2FS8A 1MTSA 5IDKA 1HB0B 2CK3D
chains in the Genus database with same CATH topology
1WOFA 4U01A 1LKAA 5E0HA 4Y76A 1JXPA 1K1PA 1NY22 1TB6H 4BTIB 1GI4A 2A7HA 1EZUC 1WQSA 3PMHB 4E7RG 3MWIU 3NZIA 4AZ2B 1FN6A 4WY3A 3NWUA 1YPEH 4GAWA 4IC5A 2GV7A 3A8DA 1C2FA 1YPLH 1ZPBA 3ATMA 1OSSA 3UR6A 1AD8H 3M5NA 4K8BA 4B2BA 1GHBG 2FI3E 1P9UA 1NRNH 3FP7E 5JB9S 2P16A 4Y7AA 3M5OA 4Q7ZA 1TGSZ 5LH8A 4YTAA 1H4WA 4ABEA 5GWZA 3A7WA 3D62A 4FU7A 1TNGA 2G8TA 3CS7A 3VEQB 5FBIA 5J4QA 1KXEA 3SU0A 1TRYA 4ABBA 1OWEA 3MH5A 1C1UH 3CP7A 3SNCA 1F5RA 1GGDC 4OS1A 2Q6DA 3P95A 4I33A 1RTLA 5DP3A 1J14A 1QQ4A 4BAMB 1GBIA 8KME2 5FAHA 1GBBA 1F0TA 1DSUA 1W8BH 5SGAE 1UCYK 4B75A 3ODDA 2ZTXA 4JK6A 3FP6E 1P10A 2Z9JA 2HNTC 1HXEH 4NA9H 3EDXB 2NU1E 1JMOH 3O8RA 4Y10E 4UEHH 1MCTA 2AEIH 3UOUA 2SNVA 2EI8A 1O5CB 1VGCC 3U8TH 4INLA 1RRKA 1MTWA 1LCYA 3RXLA 1GHYH 2TGAA 1V6DA 2FESH 1OS8A 1RTFB 4VGCB 1C2KA 2H9EH 4QT8C 1UTMA 4R8TB 1S81A 1QL9A 4YLUA 4YZUA 1P2NA 1FY4A 1L1NA 1BMMH 1SL3A 2Y80A 4K8YA 3K6ZA 3I77A 3P92A 3FZZA 3VXFH 5ABWA 1ESTA 4MPUA 1V2QT 4TWYA 2C93B 3UPEA 2QIQA 4GCHG 4ZHLU 1C9TA 2BD5A 1GI8B 3MNCA 1NFUA 1ZSKA 3V7TA 1UMAH 1AVGH 5FBEA 4D7GA 1T8LA 1GBAA 1IQEA 1GJAB 1DANH 3DUXH 3Q3XA 2OC0A 4Y7BA 1BUIA 1OXGA 1TYNA 3BG8A 4LOYH 3SBKA 2A4QA 4Y6DA 3SV8A 3BV9B 1E36B 1TOCB 2ZHEH 3TJVA 3FFGA 3SHAH 3LGVA 4MNXA 2RA3A 4ZMAH 3KIDU 1TBQH 5F6MA 4HTCH 3I29A 1WU1A 4X2XA 2VWLA 2ZGJA 4OS5A 3ELAH 4SGBE 1SOZA 3BIVH 1HJAB 4HGCA 2A5KA 3SGQE 3O8BA 1ELEE 5CMXH 1DS2E 2A4OA 1C1PA 1A5IA 4IMZA 2ZHDA 1L2EA 2A4GA 2ZECA 1SI5H 1TABE 3E0PB 1ZGIA 5FX5A 4XDEA 1K28D 2UUKB 2W26A 2YNAA 4X2WA 2OC7A 5EXNA 1A0HB 1THSH 2ANYA 2O8TA 3UOPA 1QJ1B 4CBNA 5EXLA 1JRSA 2P3FH 5CE1A 1NT1A 4Q80A 3K2UA 3PTBA 2ZDAH 2PGBB 2UUYA 3PLPA 3EE0B 2UUFB 3A84A 1AWFH 1UVUH 5C3NA 4WVPE 6CHAC 1E37B 4ZKSU 1H9HE 1YLCA 1QHRB 1AZZA 3FZDA 3ZVGA 3KN2A 1ZMLA 4FUCA 1HNEE 1AFQB 1KIGH 2B9LA 2A0QB 2P94A 4DGJA 1T4UH 1NM6A 2FO9A 4KP0A 3Q3KA 3T26A 3SO3A 1UTNA 3GDUA 5GCHF 3OU0A 2BY7X 1NRSH 1EKBB 3MU0A 2G00A 1ETTH 1ZJDA 6ESTA 4A7IB 3F9HA 1C5RA 2AYWA 2P93A 1W10U 1EP6A 1XUJA 1P3CA 1HYLA 5C5OA 2AFQB 5A2MH 1G32B 2SNWA 3NUMA 5DP9A 2SGDE 4AFQA 4IC6A 3E3TA 2BQ6B 4ZAEA 1W0ZU 1W2KH 4MPVA 1UTLM 5DPAA 2BMGB 1P0SH 1T32A 1SGFG 1UTPA 4ZROA 1EQ9A 3M61U 2CF8H 1FAKH 5JYIA 1PQ5A 3HKJB 3E8LA 1ZJKA 4WJG2 1C1TA 3MHWU 1FAXA 1Y8TA 2Z9LA 1SLXB 2XC0A 3E0NB 4YM9A 2BXTH 1UK4A 2OLGA 2ZCHP 4B73A 3MYWA 1B5GH 1PQ8A 2FOFA 3AAVA 4JZFH 2EI7A 4O3TA 3PWBA 2GCTC 1C2IA 2J38A 1IHSH 3U69H 2ALVA 2Q1JA 1Y3XA 3ODFA 5I25A 2A45B 3A7XA 1DE7H 3H5CB 3SNDA 3DA9B 2B0FA 4XSKU 5CHAC 4CBOA 3TK9A 1E35B 4CHAB 1QFKH 1AIXH 3VGCC 5JBTA 1TAWA 4A1XA 2ZCKP 1XKAC 2P8OC 3QDZB 1V2KT 2BQWB 1MBMA 4ZXXH 1ZPZA 1F2SE 4UE7H 1D6WA 1FLEE 5EG4A 1KLJH 4AX9H 4IGDA 4XE4A 5JPMH 3UTUH 1QIXB 1MQ6A 1Z8IB 2DE9A 1DICA 4X2YA 1EJNA 2V35A 1KSNA 3BTHE 3RM0H 3ZZ7A 4UD9H 3E91A 4WF8A 1P03A 4K1TA 1G2LA 1HJ8A 3GY5A 1GCTB 1IQGA 2TGPZ 2A7JA 1VR1H 4MPXA 7KMEH 3QTOH 1J17T 2JETC 3BEIB 1A46H 4K2YA 4H6TA 3SU4A 4AGJA 3SW2B 2NU4E 3A88A 1O0DH 1QB9A 2F9OA 4WH8A 3IITA 1O34A 3RXDA 3MMGA 1HUTH 2BZAA 1OWJA 3U1JB 2ODYB 1NZQH 3A83A 1WCZA 1TE0A 2QV1A 2BLVA 3LONA 2G4TA 1TRNA 3GICB 1GVLA 1EPTC 3LGIA 1BTWA 3HK3B 1O2WA 1EOJA 1O5GH 1O5FH 2F9UA 3AW0A 3PTNA 3T2NA 1A0JA 1MUEB 3E90B 2YOLA 1SBWA 1F0UA 4LXBH 1IQHA 1V2OT 2OBQA 2BD9A 1HGTH 1CHOF 3A82A 1A2CH 3MFJA 3OY5U 1PJPA 1QL7A 1SGNE 2J92A 2A32A 5CHAB 2FP7B 1C5TA 3K9XB 5DO4H 3FVFB 1EUFA 5BRRE 1QJ6B 3RC6A 2PW8H 6LPRA 1O39A 2PGQB 5C2ZA 1GJ7B 3LU9B 4KKDA 2D1JA 2ANWA 1QBNA 4F49A 2P8OB 1CSOE 2UWLA 2DUCA 2VIVA 1HCGA 4TY6A 3P8OA 3RUOA 2DE8A 1QA7A 1BOQA 1WSSH 2FODA 2G5NA 5GJ4B 1PQ7A 3E6PH 3IG6B 1X7AC 4E7NA 1QTFA 4OS2A 1FXYA 1D3QB 4B1TA 4ZKNU 2R2MB 3ZZ8A 2FTLE 3V3MA 3LGWA 3BTQE 2V0BA 2NWNA 3NKKA 2Y7XA 1ZLRA 1DWEH 1A7SA 1GJBB 1F5KU 3PMBB 2R2WU 4X6MA 3RXKA 1HJ9A 1P2MA 3U1IB 1PFXC 1UO6A 4I7YH 1DWDH 2XCFA 1QB1A 3DT0H 1HDTH 2VWNA 3BG4C 5A0BA 3RXEA 1E34B 1L1JA 4ISLA 2F3CE 2NU3E 5A8ZA 2BD3A 4AB8A 3RDZA 1NFXA 1UHBB 1FPHH 2BVXH 1TA2A 1DX5M 3PWCA 1EZSC 5LGOA 1B0EA 2C8YB 3C27B 2ZGBH 2AMPA 2BM2A 2J95A 1DITH 3ZVAA 2HPPH 1SFQB 1NRRH 2J4IA 1GMDG 2LPRA 2BB4A 1DXWA 1XUGA 5FCRA 4WXVA 4CRBA 3PB1E 1SLUB 3T28A 4X1PU 2G81E 3JZ2B 2FZZA 4NWLA 1LMWB 5C1UA 1GJ8B 2WYGA 1DDJA 4I8LA 2Z9IA 3SU5A 3SGBE 2HOBA 1A5HA 5HM9A 4ISHH 4AFZA 2IPHA 1O2MA 2P3TB 5L30H 2AGIX 2Z3CA 1QL8A 2VH6A 4DJZB 1D4PB 2QAAA 3SNBA 3TNSA 1KXCA 1QQUA 2AGEX 3UUZA 4LZ4B 3URCA 2ZO3H 3RC5A 1GBFA 4D8NA 5EOKA 2OQ5A 2PWXA 4CRAA 1BZXE 1DSTA 1A0LA 4CRFA 1Y5BT 4CR9A 1J9CH 1IQJA 2BLWA 1Q2WA 1BTXA 4RN6A 1TLDA 2R0KA 7ESTE 2AIQA 2AS9A 2QF3A 1JIRA 1ZMNA 3KQDA 3MU4A 5EQQA 3QGNB 3UNQA 1DUEA 3GCTF 1GL0E 3BG4B 1THPB 5JDUB 5GXPA 1KDQA 3M3SA 4JK5A 4Y11E 1C1QA 1P2IA 4ZKOU 5C5NA 5ESBA 3MO9A 4CH8B 4NFFA 4MVNA 3TH4H 1Z71A 1CGJE 2GGVB 1WTHD 1O3MA 5IYTA 3T29A 1K2I1 2GCHG 1AY6H 1S0RA 1K1NA 1LVMA 4A92A 2BHGA 3SJ9A 1BT7A 1C1SA 1IQMA 2C3SA 4YT7H 1INCA 1HLTH 1DPOA 2HNTF 3UQOA 1AVXA 1PPZA 1D3DB 1HAOH 1HBTH 1O32A 3EA7A 4SGAE 1D6RA 1SGTA 4I32A 1ZHRA 3M5LA 1K1IA 1GG6B 2A1DB 2ZNKH 2BZ6H 4KTSA 1LPZB 1UTKA 2Y6TA 2VIWA 1SPJA 4UFDH 3RC4A 1C5UA 3W94A 1P2QA 2Y5GA 1V2PT 3RXAA 4B74A 1GDQA 1DUAA 3SV7A 3S7KB 3RXUA 2ZQ2A 3UFAA 1ETRH 4JYUH 4XFQA 4JYVH 4VGCC 4X8SH 1FJSA 2ZTZA 2C4FH 1FIZA 4YESB 4OS6A 1OOKB 1NTPA 2EEKA 3QX5H 3A89A 4O9VA 1XUIA 3GYLB 2F91A 3SJOA 1CT2E 3JZ1B 5AHGH 3SORA 3OX7U 3BTWE 2A5IA 2KAIB 1YPHE 2G5VA 3D65E 3ZV9A 2QXHA 4K3JA 1QURH 1K9OE 4ABHA 2ZP0H 3ZV8A 3ATWA 3MNXA 1YF4A 3ZYEA 2WINI 2GT7A 4KTCA 4Y8YA 2QXGA 4CREA 3A80A 4NG9H 3BF6H 1VITG 1CU1A 4UFFH 1OWKA 1UVOA 3GDVA 2ZU3A 1BBRE 1ZSLA 2FOMB 1GHXH 3UY9A 1TGCA 1TMBH 1CHGA 2O8WA 2ZDLA 4Y71A 1NRQH 3BN9A 1TMUH 3UNRA 1GVKB 2BOHB 5HYOA 4AB9A 4H6SB 4D76A 1GL1A 1EJAA 5DP5A 3AASA 4X8TH 3TLOA 2HVXA 3RXVA 1ZHMA 2BDAA 2PUXB 2ULLA 3MH6A 2BLQA 5AF9H 2HPQH 1V2NT 1CHOG 1MZDA 2SGEE 4ABGA 3TGKE 1BRBE 1C1RA 2ZPQA 1CBWB 2K1QA 1PQAA 3RMMH 1HAIH 1V3XA 3U9AH 1ELAA 4YOIA 1C2EA 1GJ4H 1S83A 2FX6A 4NIXA 5A8XA 1O33A 2BDHA 3HKIB 3SU3A 1RD3B 1EAIA 2PR3A 1W0YH 4X0WU 3RU4E 1C2JA 3A86A 2W7SA 1BBRH 1O2GH 1HJAC 1CO7E 7LPRA 4AOQA 2BYAX 2P3UB 1B7XB 4Y79A 3SJIA 1C1OA 1OKXA 1ARBA 1W7GH 1G3CA 3RXIA 2BY6X 1O36A 3F9GA 1YLDA 4A1VA 1C5QA 2Y82A 5EQRA 1EAWA 5C1YA 1HAXB 1TRMA 4JCNA 2GZ9A 3TH3H 4AYYB 3OYPA 1NN6A 3W95A 3RXPA 5DJ7A 3BTTE 4YLQH 1XKBC 3TH2H 3F68H 2VWMA 1C4V2 1QR3E 2H2ZA 1ANEA 5GDSH 3ZVEA 1O5DH 1YYY1 3QGJA 2F9BH 1QA0A 1LVBA 2ZFRH 3NXPA 1AFQC 1O3FA 3OSYA 2BX3A 1C5NH 1O2SA 1FONA 2ASUB 1PPFE 3VPKA 1FMGA 4B76A 4DOQA 2VNTA 4OS4A 2Y7ZA 3GYMA 1AB9B 2GMTB 1FY8E 1VJAU 5E8EH 1SGEE 3RP2A 3L6PA 1T31A 1GI0A 4YO9A 4Z0KA 4AG1A 2JKHA 3A7VA 3D49H 1SHYA 2XC5A 5GIBA 1GJDB 3STIA 1E0FD 1DWBH 3R0FA 2ZG0H 1S5SA 2SGQE 5FXLA 1JRTA 2OTVA 3F9FA 2PKSC 2R0LA 1IQKA 1DM4B 1JOUB 3LH3A 4Q2KA 1H9IE 1IQNA 1Z7KA 2G52A 2ZU4A 3LIWA 1ZMJA 3E16B 3LC3A 4WMDA 1LPGB 1HAHH 1Y3WA 3RXMA 2VVVA 3LGTA 1AUJA 3RXOA 1O2NA 3AVZA 1CT4E 4FUHA 3SI4H 1AE8H 1ZTJA 4DG4A 2O8LA 1GI7B 1MAYA 2ZWLH 1P02A 1GMDF 1RIWB 3RMNH 5TCCA 1C5VA 5JBAS 1RTKA 4CHAC 1C5LH 2RCEA 1C1WH 1NU7B 5FCKA 3LGUA 3PMJA 4BTUB 5DP7A 2BY9X 1MKWK 3A7ZA 2FI4E 4IW4E 1YCPK 3B23B 1MBQA 2XNIA 1SR5C 1LHCH 1JBUH 1IHTH 4ISOA 3B8JA 3A85A 3TIUA 3M7TA 4PROA 2ZC9H 3S9CA 1TNKA 5T6FA 4WMFA 3M37A 3P17H 1G3DA 4DY7B 4JYTA 3GCTG 1PPCE 1FDPA 3ZVCA 2PLXA 3KF2A 5EPYA 2IOTA 5EPNA 1GCTC 4GVUA 5DP4A 1AKSA 2LNCA 1C2MA 1IQLA 3K6YA 5I46H 2CN0H 2H9TH 2GDEH 3SJ8A 2XTTB 3EAJA 2VINA 1O2LA 4INHA 1WYKA 1YBWA 2GP9B 2V3OH 1SGDE 1O2ZA 2WYJA 4A1TA 2FOCA 1Z6EA 2PKSB 3GY2A 2AERH 3PLBA 2A2XH 1YGCH 4HI3A 2Q6GA 3RLYH 1MTUA 3GY6A 3M3VA 3TNTA 4LK4A 2GKVE 4FUDA 1GHAF 2ZHFH 4FUIA 1ZTLA 9ESTA 2QN5T 1YCPM 5T3HA 1AQ7A 1DWCH 1BQYA 2FOAA 5H4IB 2ZFPH 1NC6A 1TBZH 2GCHF 3RXFA 2XW9A 3VB4A 1LQDB 1TGBA 1UCYE 4JZEH 1KXFA 1A3EH 2QF0A 3A8BA 1E38B 3UREA 1TX8A 3R3GB 3QO6A 3MO3A 2THFB 3RXGA 2Y5FA 2ZPSA 5TCAA 3F9EA 1C5SA 4GLYA 5K0HA 1SLVB 3S9AA 2PHBA 4Y0YE 5DKMA 4THNH 1ZSJA 1UVTH 4BAQB 5LPEA 2UWPA 1O2HA 1O2PA 1W7XH 1L0ZA 2ZU5A 1UVSH 2TRMA 1VITH 1NU9A 3UIRA 3NK8A 4ABDA 1MTNB 1TBRH 1CE5A 1WQVH 2FEQH 2F9PA