3ATKA

Crystal structure of trypsin complexed with cycloheptanamine
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3atkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3atkA02
2HNTF 1SGIB 2Z94A 3SUGA 4Y71A 1TPPA 4WXIA 3E1XB 1MTWA 2SGQE 4DY7B 3B9FH 3KCGH 1GHWH 1EZUC 3A7VA 4XDEA 5GIBA 1F2SE 1OWJA 2ZQ1A 2JH6D 3SUEA 2ZTYA 1BB0B 1UVPA 5SGAE 1C5VA 1G2MA 3TNTA 4O3UA 3GDVA 5LH8A 2FOCA 3E8LA 1JIRA 1OYQA 1TGCA 4ZHAA 1EAXA 4ZHMU 1RGQA 1Q31A 1EATA 3MYWA 5F6MA 2QAAA 2FLRH 3V0XA 1H9IE 4LZ4B 1VR1H 1C2FA 4NA7A 3PO1C 1CGHA 3VB6A 1MH0A 1MD8A 1O2NA 4UFEH 5CMXH 2ANKH 3T28A 3S9CA 3RXJA 1TX7A 2C8ZB 1O3PB 2Z9JA 1BBRK 2GGVB 1AZZA 3QWCH 9ESTA 4DVAU 3P8OA 5EXLA 2UUYA 2GT7A 1ID5H 3T25A 1INCA 1SG8B 2FPZA 1HXEH 1ZPBA 3ATIA 1OXGA 2A5AA 5BRRE 1EJAA 5DPAA 3K6YA 2PV9B 2BDCA 3UR6A 1NTPA 1A0HB 2Y7ZA 3B8JA 3IG6B 2BDIA 3M7QA 6GCHF 1NROH 1OX1A 1C4Y2 1HLTH 2ZHWH 4NIYA 4BAOB 1G3CA 1A5GH 1TQ0B 3UOUA 1MAYA 3ZZ3A 1O32A 1KXBA 1NY22 2ZGHA 1UTJA 4DW2U 1UVSH 1GI5A 1GBCA 1GJ5H 1O38A 4TYDA 4MNYA 1EB1H 3ZZAA 5CHAC 4X6MA 1Z8JB 2C4FH 1FY4A 5FX5A 2ZHEH 3L3TA 5FBEA 2P3FH 4ZHLU 1NRNH 5ESBA 1UCYH 2B7DH 2JH5D 3PMBB 3A7ZA 1W7XH 2O8UA 1ELCA 3KF2A 2CN0H 3DFLA 4ABIA 1G30B 8ESTE 4UFDH 4CREA 1FLEE 1O35A 1TWXB 1IQNA 1MD7A 2R9PA 4KTUA 1QJ7B 2FOHA 1SHYA 2AGGX 1MTVA 1O3AA 3T27A 1D3TB 4RKJB 1MKWK 2ZDLA 1PQ8A 3C27B 2ZDAH 4FU8A 2SGDE 2BY9X 4Y7AA 3IWMA 1Y5UT 1AU8A 4TWYA 3TNSA 3I29A 2HPPH 4X2XA 4ZXYH 2HNTE 1GBTA 1ETTH 1F5RA 1ZTLA 3SU0A 8GCHG 4DT7B 4IC5A 1GG6C 5GCHG 3K65B 3PV4A 3BG4B 1UTPA 5A8XA 7ESTE 2PLXA 2YNBA 1A0LA 3QX5H 1TGSZ 3SJOA 1GWAA 1FJSA 2H5DA 2V0BA 4ABHA 1SGYE 2O9QA 1SGFA 2OC7A 4OS4A 2BMGB 1CBWC 1UTLM 1YLCA 1EX3A 4TWWA 3TK6A 2QGRA 3BTKE 3HATH 2Z9LA 1XUHA 1TGBA 2HWLB 3SU1A 2R3YA 1AFEH 3GY3A 3VXFH 2FLBH 1AB9C 1P3CA 2OP9A 1TMUH 5TCCA 1XXFA 3SORA 3E6PH 2ZU1A 3LDXH 2Y81A 2PKSB 2J38A 2GV6A 3QGJA 4Y8XA 1ELAA 4O3TA 1MTNB 3RMNH 1OSSA 4D7GA 3PMAB 1O2XA 1NT1A 5L30H 3EQ0H 1C2LA 2FI4E 2FTLE 5DP6A 2ZP0H 4JYVH 1HDTH 4I32A 2Z3CA 1BITA 2QXHA 2AGIX 3BTDE 5LPEA 3FANA 6CHAB 1Z6EA 1AWHB 1O33A 1WQSA 4RN6A 1Y5AT 3GY6A 1C1OA 1BRAA 3DD2H 1BJVA 3G01A 3BTEE 1UCYE 4A1XA 1TNLA 1ZPCA 4MG3A 1FY8E 2A0QB 1H8DH 1TQ7B 3GDSA 3A87A 5EXMA 3PTNA 6GCHG 3SU5A 1O5DH 3LGUA 3LJOA 1NRQH 2J9NA 1BTYA 4CR9A 1D3PB 1GI9B 5L2ZH 1E36B 4YLQH 3N7OA 1CSOE 1ABJH 2STBE 3O8RA 3GCHB 1GGDB 1SSXA 1HRTH 3CS7A 1O2HA 3BN9A 1V2ST 1LHGH 1L0ZA 1QRZA 3GY5A 5K0HA 1NFUA 4R8TB 2PR3A 2OBQA 5E8EH 3I77A 5C67A 2GMTB 2FX6A 1Z8GA 2XC5A 3D23A 1D3QB 1QRXA 3V7TA 2ODQA 1P2MA 2FOFA 1SLUB 3OY6U 1V2QT 2WUBA 2Z9IA 1F5KU 2TRMA 3BTFE 4D7FA 1AD8H 1IQMA 4B2BA 2BD3A 3TITA 1T32A 3BIVH 1A1RA 2G55A 5JBTA 1Z8IB 1GJAB 3RU4D 1YCPH 1ZMNA 3BEIB 3O8BA 1W3CA 5EQSA 3ZZDA 1C5UA 5GDSH 1O3JA 3RXCA 3SJ8A 1V2VT 1BT7A 1GJ4H 2A5IA 4DCDA 3I78A 3CENA 1DPOA 3EA8A 3LONA 1ARCA 1ZMJA 1KXFA 3M5NA 2FOEA 1OYTH 2ESTE 2BDHA 2SNWA 2BX3A 1KLIH 2GCTC 3SNAA 4D76A 2EC9H 5DP7A 1VJ9U 1CT4E 4WJG2 3EYDA 2XXLA 1AIXH 1TMTH 3MU8A 1SGCA 3ZZ4A 3QGNB 1OWEA 1AQ7A 1T7CA 2OQ5A 3RXQA 4NFFA 1A2CH 3RXOA 1O2IA 3ESTA 3KNXA 1UTMA 1AVXA 1Z1JA 1K28D 3ZVDA 1O3BA 3BEUA 1GCDA 1O3KA 1TRYA 3M5LA 4O03A 1XUIA 1SB1H 4ABDA 5PTPA 4MPUA 3QTVH 1HJAC 1D4PB 2Y5FA 1H9LB 1LCYA 4K5ZA 1QQ4A 4MTBA 3E90B 2XTTB 1ANEA 4BTIB 2QXIA 1YPEH 1N6YA 1OS8A 1ZTKA 3M5MA 1WTGH 1QY6A 4CHAC 1DXPA 1A5IA 3D49H 2D26C 4MQAA 1C5QA 4X6NA 1GCTC 1VGCB 1WBGB 3TPIZ 1CU1A 3NXPA 1S82A 4TY6A 4CRDA 3BTWE 2PTNA 3QTOH 2QF3A 1TOCB 3KQEA 3SU4A 4WVPE 3ZVEA 3U8TH 2BVSH 1ELGA 1ESTA 1TPSA 1UHBB 1W14U 2W3IA 1C2MA 2A7JA 4JYTA 4FUGA 1L4ZA 3S7KB 3V12A 3SU6A 3PWCA 3STJA 5DJ7A 4BOHA 1W2KH 2FOAA 1SC8U 3MH7A 5H4IB 4U32A 1OWKA 2SNVA 5E2PA 2GDDA 1KY9A 1E37B 1BTUA 7KMEH 4BTUB 2XW9A 1CQQA 5DG6A 1EP6A 2GTBA 2XBXA 3URCA 2FM2A 5HYOA 3RC5A 4GAWA 1DY9A 3BV9B 3A7WA 2OBOA 3QZRA 3FZDA 2R2WU 2QC2A 1P01A 1IQFA 2GX4A 2FMJA 1C2HA 3RXTA 2W26A 3SN8A 1QB9A 2R2MB 4OS5A 2VVCA 1ANCA 3A84A 1NFWA 4NGAH 1WUNH 1KXAA 3SQHE 1OKXA 4WH6A 4ZAEA 3EA7A 4FUBA 2PKAA 1UO6A 3IITA 1ORFA 1T8LA 2IN2A 2G4TA 1S5SA 1O2VA 3QZQA 3MH6A 1EOJA 4I8LA 1GJCB 1MMJN 2P8OC 1L1JA 1O3EA 5FCKA 2ANWA 4Q7ZA 3SJIA 1O3DA 3UIRA 2OINA 3OYPA 1SLWB 1C1RA 5I46H 2P16A 2R0LA 4OGXA 5DP4A 1GMDF 4X8UH 1C1QA 4Y79A 3SW2B 1F0TA 2ZKSA 4B74A 1KXEA 2FYQA 1DM4B 1PPHE 1V2UT 4FUHA 4NZQA 1BTWA 2BLWA 1DWDH 1O2WA 3MMGA 2BDBA 4B71A 5EPNA 1O3HA 3SJKA 4BXWA 3ZZBA 2D1JA 2TGAA 2ZHQH 2CMYA 3KQDA 5A2MH 5J4QA 2TGTA 1J9CH 1GI8B 3PMJA 1C1NA 3GOVB 1DSTA 1A0JA 3EA9A 2J95A 1ELBA 4Y8YA 4WH8A 1L2EA 3NUMA 2ZHDA 4BTTB 5CE1A 1GMCF 2G4UA 1IQJA 1YC0A 1NZQH 4VGCB 1MCTA 2ALVA 4ZXXH 3SGQE 1J17T 2B5TB 2BQ6B 4RKOB 1OP0A 3BIUH 2BB4A 1GPZA 1V6DA 2CV3A 1K9OE 3OTJE 1ARBA 1DICA 2GT8A 3DUXH 3A81A 1AO5A 1C1VH 1IQIA 1O3LA 3T5FH 1T8NA 2EI7A 3MO6A 1K1IA 5DGJA 2TIOA 1NS3A 4IS5A 1UTNA 2OXSA 3SGBE 3BTTE 3QK1A 2ZFRH 2W3KA 5A0BA 1M9UA 1UVTH 4ZUHA 4K1TA 1P06A 5EQQA 3VPKA 1H4WA 1NFYA 2A1DB 2AMDA 4K3JA 2WYGA 4I31A 1GHZA 2ZDVH 2WUCA 1P04A 3MU1A 1EUFA 1GBFA 5DK1A 2XBYA 3SZNA 4DURA 2PGQB 4TY7A 2QIQA 1KLTA 1KIGH 1AFQC 2A4OA 2Q6DA 1AGJA 3SNEA 1T4VH 3SU2A 1O2JA 1HYLA 1O3NA 4CRAA 4O9VA 4FVDA 1C1MA 4K2YA 4Y10E 4XBBA 3A7XA 4B76A 3TGKE 1WQVH 1HAHH 1GG6B 4ZH8A 1TLDA 1NO9H 2G5NA 2Y7XA 1HAIH 1YPHC 3P8GA 2WPLS 1O37A 2P94A 1VCPA 1GMHF 2BYAX 2H9EH 3LU9B 4YT6H 1FN8A 1YPGH 1Z8RA 4NSYA 3SJ9A 4IN1A 1EZSC 3FAOA 1CBWB 2FIRH 1LPZB 1U6QA 4NFEA 1QB1A 4FVBA 3P92A 3RXRA 1ZHRA 2OUAA 4Q7XA 1GMDG 3KQBA 3W95A 1Z71A 2ZHFH 4AGJA 1LHCH 2PW8H 3ATLA 4IN2A 5AF9H 1O30A 1C9PA 1HUTH 2DE8A 2HGTH 5FX6A 1P12E 2P59A 2SFAA 2H5CA 3Q00A 1DDJA 4HZHA 3GY8A 4MPVA 3RM0H 4NZLA 1K1NA 3MH4A 3LOXA 3MHWU 1ZGIA 2IOTA 1EASA 1O2TA 3NWUA 5TCAA 4B2AA 1P03A 4A5TS 2G5VA 1MU8B 1YPJH 3T62A 3Q76A 4GVUA 2A31A 1ELDE 4YTAA 1TX6A 3EDXB 1ESBA 5HXFA 1GMCG 1EKBB 1GHVH 1HBTH 3ODFA 3QUMP 1W8BH 4NIWA 3FP8E 2GKVE 1F5LA 2FWWA 1PPEE 1MKXH 2FI3E 2PUQH 1A3EH 3OU0A 3SNCA 2D2DA 1SPJA 2VWLA 3UR9A 1C9TA 1PPZA 2GDEH 1V2WT 1DSUA 1FI8A 4TPYA 1UK2A 1ANBA 1FY3A 3RC4A 1ZSLA 4Q80A 4XOJA 1RD3B 3JZ1B 4X1SU 1BBRH 1E0FD 1Z6JH 4OS2A 5JBCS 1BTZA 1CVWH 4H6TA 3F9HA 2XBVA 3RC6A 5L6NH 1ZMLA 1D3DB 1TNJA 3A8DA 1HIAA 1G37A 1Q3XA 2Y5HA 2QCYA 3PB1E 4U01A 1GBJA 4TPIZ 2PTCE 1QL9A 1GBEA 4AORA 3RU4E 4YT7H 3ODDA 1QA7A 1CGJE 5A0CA 3HPTB 3KHVA 1C4V2 1C5OH 3UPEA 4I8GA 5DO4H 2A5KA 1O2MA 1VITF 3T29A 3KIDU 2BQWB 2EI6A 4Z6AH 2PSYA 4UDWH 1ZJKA 4M7GA 1UCYK 1O2SA 4ABJA 1BQYA 1GI3A 1JMOH 3ZVAA 2ZQ2A 1SGTA 2ANYA 3A85A 3SV8A 1VITH 1EOLA 1DT2A 1TBRH 1O3FA 1MKWH 4DIHH 5JBBS 1XVMA 3Q77A 1GMHG 1J15A 2GCTB 2XRCA 5FHTA 4K69A 1NC6A 5AVDA 2O8LA 1O2LA 3ZZ9A 2GZ8A 1KXDA 3KL6A 5F03A 3E3TA 1PYTC 2JETB 1KXCA 1P2OA 3TVJB 1EPTC 3HK6B 4ISOA 1VCQA 4LZ1H 1DVAH 3RXAA 3GICB 2PSXA 2UUJB 4X2VA 1EAUA 3HK3B 2ZWLH 2ZNKH 1O5FH 1V3XA 2DE9A 1WYKA 2EI8A 3U98H 4HTCH 4XBDA 1C5SA 2UUFB 4E05H 5HM2A 3RMOH 1MCVA 2Y82A 4HGCA 4XE4A 4AFQA 1BBRE 3LH3A 3SV6A 2PWXA 1NRPH 3MI4A 1RIWB 1PPBH 4CHAB 3OY5U 4H4FA 1O39A 1GCTB 3PWBA 3LC3A 3VB7A 1TGNA 1EPTA 1A5HA 2Q6FA 1C1WH 1SBWA 3SI3H 4Y0YE 1O3CA 1RTLA 2AEIH 3UREA 2G8TA 1Q2WA 2BZAA 3O8CA 4INKA 1VZQH 1MBMA 3L6PA 4UFGH 1ZZZA 5AFZH 1GVZA 2VH6A 4IC6A 1G3EA 1EZXC 1Z1IA 2TGPZ 1LVBA 2A45B 2H9TH 2PKAB 1QIXB 1CGIE 1ELVA 1OOKB 4CH8B 2RA0A 2BD7A 4JK5A 1ETSH 2F9VA 2Y6TA 1DLKB 1DX5M 4KTCA 5EODA 4K1SA 3KN2A 4ISHH 2C8XB 1GBLA 4JCNA 2P3TB 1SGPE 3M36A 4H6SB 5I25A 2ZI2H 3TH2H 4WWYA 2A2XH 1O2YA 2ZA5A 2CHAC 3QDZB 1IQKA 1VITG 1TNKA 1FIWA 1PQAA 3MU5A 1SGDE 1K1JA 1C5NH 2BX4A 2BD5A 1UTOA 3RXMA 5FPSA 1H1BA 1SVPA 2FESH 1WV7H 4JMYA 1CHOG 1EQ9A 2ANMH 1GVLA 1G2LA 2ZFSA 1TIOA 1YBWA 3UQOA 1QGFA 1S84A 2ZC9H 1ELFA 1QBVH 1G36A 1CO7E 1C4U2 2H9HA 3A8BA 4WMFA 1MZDA 4O97A 1YYY1 2P8OB 1V2NT 1G9IE 1S0QA 3K9XB 5C20A 2ZO3H 3KEEA 2BM2A 4FU9A 3VGCC 5JDUB 3ATWA 2XC4A 2WPIS 4ZKSU 1EB2A 2ALPA 1T8OA 1C5LH 4AYYB 2TGDA 3K6ZA 4I8KA 1ZPZA 4NA9H 5F8TA 4AYVB 1GBHA 1YPHE 3URDA 1RXPA 2OTVA 3M5OA 1P3EA 1LQEA 1ZR0A 3E91A 3ATKA 4NWKA 1JIMA 1LHDH 4Y8ZA 1O2GH 4MDSA 1D6WA 4GCHF 1IOEA 5JPMH 3P95A 1S85A 1GHXH 1W13U 1DOJA 3SNDA 3RLWH 5E2OA 2G81E 4UE7H 1XKBC 3FVFB 1F92A 2BHGA 2OLGA 3DHKH 2HOBA 3P17H 3PROA 5IDKA 1OWHA 1W11U 4Y6DA 1TFXA 4X8TH 3RXVA 4ZROA 2F9PA 1CA8B 5JYIA 3BTGE 1P2KA 2VIOA 5LGOA 1MZAA 4A7IB 2BLQA 1AZ8A 1NRRH 1C5RA 2YNAA 4DOQA 3BG8A 2BD8A 3CS0A 4MLFB 4B75A 2EEKA 2CF9H 5FPYA 1ESAA 1ZJDA 5E0HA 1A4WH 1HPGA 1LMWB 1FPCH 1TNGA 3S69A 3SNBA 4DIIH 3BTQE 4NCYA 1BMMH 3RXUA 3M3VA 3MO3A 3UQVA 1A46H 2HRVA 3NZIA 1EJNA 1TA2A 2C3SA 2J92A 3M35A 4U2WA 2CGAA 3M7TA 4LK4A 3PLPA 5A0AE 1TOMH 3S0NA 3ZVCA 3LIWA 3VB5A 2H2ZA 2AFQB 1C1SA 3F9GA 5LPFA 1Y8TA 1MTNC 4X0WU 1MAXA 2I6QA 1AWFH 2VWMA 4X2WA 3TIUA 3LKWA 1C2IA 2EA3A 2NU0E 3ZVGA 1AFQB 4OS1A 4CBOA 1C1UH 1TONA 4B1TA 1T8MA 2VINA 4Q2KA 1IHSH 1CT0E 2LPRA 1YPLH 5C1UA 1SGEE 1FY5A 3QN7A 1IHTH 4AG2A 5GWZA 1A3BH 4ASHA 1PPCE 1BMAA 3RMLH 4MVNA 2XWAA 1O2ZA 1O5AB 2CXVA 4FUFA 1DWEH 1BRUP 2ZPSA 4GLYA 1TMBH 1K1OA 4X1NU 1ZSKA 3LGTA 1QNJA 1C1PA 1THPB 4IBLH 1GBDA 1C5MD 4FU7A 1XKAC 1XM1A 2A7CA 4ABEA 1DLEA 3GCTF 5TJXA 4GSOA 5F8XA 2VVVA 1NESE 3U9AH 3HKIB 1HAOH 3LGIA 5FAHA 3U1JB 1G32B 4NSVA 1GJ9B 3SV2H 2SGEE 1PQ5A 1WAYB 2GMTC 1W12U 2BDGA 1FQ3A 4JK6A 1TPAE 2FS8A 2NU2E 3SI4H 3NK8A 2XYAA 2RDLA 1YGCH 4NWLA 1HAYB 3TJVA 4GCHG 5HGGA 2RCEA 4MPXA 1GL0E 3KGPA 2UWOA 2ODPA 1HFDA 2ZFQH 1DWCH 3S9BA 2HLCA 2ZTZA 1BOQA 1K1PA 3K2UA 2VU8E 4JYUH 1ZHMA 4BAKB 1HIAB 1ZYOA 1BRBE 4Y0ZE 5EW1H 1W7GH 3GCOA 3M3SA 3SOSA 1O3OA 3T2NA 1Y5BT 1O5GH 2C8YB 2P93A 4NIVA 5EW2H 2ZGCA 3UY9A 2FO9A 1TPOA 2OQUA 2NWNA 1GHAF 1V2TT 3PO1B 3ZZ7A 4D9QA 2BY5X 1ZOMA 4CRGA 2ULLA 1F0UA 3H7TA 2P3UB 1O2KA 3FP7E 1IQGA 1V2LT 1HAVB 1HJ8A 4AFUA 2J94A 3D62A 2C93B 1ZGVA 1Y3WA 3SV9A 1B0EA 2F9BH 5C1XA 3RXHA 5C2ZA 2FOGA 4FUEA 5EXNA 4UD9H 1XUFA 1CE5A 1LDTT 2ZIQH 3F1SB 1E35B 4I33A 1BTPA 2A4RA 2V35A 1NFXA 4ZMAH 4IMZA 1HCGA 1BRCE 1P8VC 4UEHH 2ZCKP 2Z6BD 1GI0A 1GL1A 1O3IA 4F4OC 5GXPA 1SFIA 3MNBA 4BAQB 1O31A 1N8OC 2Z9GA 1GJBB 1ZTJA 3P8NA 2V3HH 4WMEA 5CHAB 3GISB 3W94A 2OC0A 2SGPE 1ZHPA 5GJ4B 1TAWA 1GI6A 2WPJS 2AYWA 5LPRA 3PM3A 4IMQA 1BDAA 2FEQH 1DS2E 1GHBF 4BAHB 3M61U 2QXGA 2XBWA 1EP5A 4WMDA 1UK4A 1ANDA 1E38B 1YF4A 4X2YA 3ZVFA 2W7UA 3U8OH 2G51A 3RU4T 4SGBE 3A8CA 1VGCC 1QB6A 1C2EA 3RXLA 4Q7YA 4YZUA 5FBIA 1GI1A 2CJIA 4ABFA 1UVUH 2AMQA 3C1KA 3GYMA 1YKTA 2GZ9A 1JXPA 2ZFTA 1QRWA 1EAWA 3RXKA 2ZF0H 2QF0A 2ZGXH 3LC5A 3A8AA 4XBCA 3GY4A 3GCTG 3Q3KA 2F9OA 4KKDA 3TGIE 1KDQA 1GI4A 1YCPM 2IJOB 2FXRA 2Y5GA 1B0FA 3OX7U 1WCZA 2J4IA 4U30A 1YM0A 3AAUA 1EPTB 1UK3A 5E0GA 4E06H 1IAUA 1SMFE 2GV7A 2AMPA 4OS6A 5T6FA 2W7SA 5G4BA 2ZU2A 2Z7FE 3L33A 3M7UA 1OP2A 2KAIB 1MTSA 3PLKA 1THSH 2XCFA 3TK9A 1AB9B 4X6PA 2ZGJA 3PLBA 3U8RH 4ABGA 3MU0A 2AIPA 3RXIA 2DUCA 3BEFB 3Q3XA 1DE7H 2HPQH 2VIPA 4NG9H 4ESTE 2R0KA 2FX4A 1GDUA 2D8WA 3ZV8A 1X7AC 3UFAA 2XC0A 3E16B 1MUEB 2ZDNA 3ITIA 2SGFE 1GHAG 1GBAA 4YOJA 3LGVA 4ABAA 1LHFH 2F91A 3QLPH 1LQDB 3TH3H 2I6SA 2Q6GA 4ISLA 1QL7A 2OC1A 1QR3E 1GJ6A 1PYTD 1P10A 2ASUB 1DITH 4ZKRU 3FFGA 4AB8A 5C3NA 2BXUH 1NU7B 2ZECA 2GCHF 1HJ9A 2ZDMA 5C1YA 1SGRE 1AUJA 4ISNA 1MKXK 1XUJA 2BY8X 1LPKB 1GBBA 3M37A 2GD4B 1O2OA 5A8YA 1A7SA 1AI8H 3S9AA 3RXFA 1L1GA 1SL3A 2CHAB 1C5PA 3AAVA 3TJNA 4GUXA 2LNCA 4CRFA 1AKSB 4UFFH 4VGCC 3MNCA 4AFZA 1TYNA 1GHBG 1J14A 3ATMA 1GVKB 1C5YB 2H6MA 3MU4A 4A92A 2BY6X 4K1EA 2ZCLP 2V3OH 2Y80A 4WXVA 4QT8C 4YOGA 5JB9S 2VH0A 2VGCC 1DUEA 5EOKA 4AN7A 1E34B 1LVYA 1HAVA 1CHOF 1LVOA 2ZDKA 2J34A 3D65E 3T26A 3P8FA 3VGCB 2W5EA 4KTSA 3R0FA 2JH0D 4ISIH 1MBQA 4R0IA 2FDAA 4I8HA 2BQ7B 2AGEX 1C2DA 1K1MA 2NU3E 5DP9A 1BA8B 3BTME 3MH5A 4GHTA 1CT2E 1Y3XA 1DUAA 6ESTA 2RA3A 1RJXB 3RXSA 4YO9A 4FUDA 5K7RA 1FPHH 3GYLB 1BMNH 2BLOA 2R3UA 1QBOA 1K21H 4INLA 1N1LA 1QCPA 2AERH 1FXYA 3ZZ5A 1KYNA 5T6DA 3TJUA 2XCNA 1D9IA 1HXFH 2CF8H 3PTBA 1BTXA 1AY6H 2ZEBA 4GHQA 1QFKH 3SQEE 3NPSA 2AH4X 3A82A 3RM2H 2IPHA 3Q3YA 5C5OA 2UWLA 1Y3YA 1JBUH 3HGNA 4H42U 2BTCE 4OS7A 4DG4A 2AS9A 4FUJA 1HJAB 2A32A 1AHTH 2BLVA 1K2I1 1TRMA 1IQHA 1GI2A 5A09A 3BF6H 1TGTA 3E0NB 1CA0C 1LKBA 2C8WB 1Y59T 1P9SA 4YLUA 1C1TA 2ZTXA 3VXEH 2TBSA 7GCHF 2ZPRA 1HGTH 2ODYB 5FPTA 1FMGA 3SUDA 1O5CB 1YP9A 4YESB 1LTOA 1C5TA 1J16A 3ZZ6A 2GCHG 1RFNA 4CRCA 4KELA 2ZGBH 2ZZUH 1P2JA 2BXTH 1P09A 1FZZA 4ZKOU 2KAIA 5EU8A 3EAJA 1H9HE 1L4DA 1F0RA 1OP8A 1SQOA 2B8OH 1LO6A 2M5TA 4FUCA 1LHEH 4HI3A 2ZG0H 1O0DH 2VIQA 3A80A 1ACBE 3MFJA 1S83A 1W0ZU 1GBKA 1FNIA 3E0PB 2PGBB 5B6OA 4NA8A 1ELEE 1ZLRA 2QV1A 1EZQA 3DFJA 1A61H 1PFXC 2WPMS 4FXGH 3UOPA 3F9FA 3B23B 1WOFA 3UNRA 4CH2B 1YPMH 2J2UA 4AZ2B 1MTUA 1C5ZB 4X6OA 3NCLA 3MOCA 2F9UA 4PROA 3VB4A 9LPRA 1MQ6A 1QA0A 2BVRH 2FOMB 3RP2A 2C90B 2G00A 3SBKA 3AASA 1RRKA 1SR5C 5GPIB 2NU1E 3OSYA 1LPGB 1MQ5A 1BHXF 2AIQA 4I8JA 7LPRA 4X8SH 1TNHA 4MNXA 4WF8A 3A83A 1HB0B 1FUJA 4XFQA 1ZRKA 4XSKU 4OGYA 1RTKA 3HKJB 4HFPB 1O5BB 2G52A 4BAMB 3RXGA 3TJOA 2HVXA 3MWIU 3ENSB 2STAE 2RG3A 1S6FA 4J2YB 1UJ1A 2BDAA 3RXEA 3A89A 1V2OT 3FP6E 3KQCA 4X8VH 1FIZA 1YCPK 1IQEA 4IW4E 2ZU5A 3SU3A 5ABWA 6LPRA 1BTHH 1KTTB 2K1QA 1TB6H 3ZYDA 1AKSA 5DP3A 1KLJH 2H1UA 1XX9A 4Y7BA 2ILNA 1JOUB 5T3HA 1FAKH 2BDYA 3A7TA 3VB3A 4MPWA 1HAXB 2FS9A 2FTMA 2F3CE 1MU6B 1O2PA 5AFYH 1DY8A 1XUKA 2BZ6H 1C5WB 2FOBA 1QURH 1TBQH 1V2RT 2WPKS 8KME2 2ZFFH 1AN1E 3AVZA 1SGQE 1VCWA 2VIWA 1XMNB 2Z9KA 1SGNE 1TNIA 2BD4A 4UONA 4AB9A 3R3GB 1LVMA 1KSNA 2VNTA 5ESTE 1HAGE 1PPFE 4JZIA 1RS0A 3O8DA 3BG4C 5A8ZA 3A7YA 3UWJH 7GCHG 4THNH 4A1VA 2JETC 1DFPA 1PQ7A 3GY7A 1AMHA 1S81A 2BOHB 2WPHS 1KTSB 4B2CA 1DXWA 3UTUH 2ZU4A 1FAXA 5FXLA 5T6GA 3CP7A 3ZVBA 1XVOA 3NKKA 1N8OB 1SHHB 1O3GA 1SLXB 1UVOA 4MNVA 1GHYH 2PHBA 1CHGA 1EAIA 1SOTA 1KDQB 2Q1JA 2WINI 3DT0H 3LGWA 3QO6A 1F0SA 1TX8A 3VFEA 3RXDA 2PKSC 3H7OA 1J8AA 4Y11E 3S7HB 4JZ1A 1GBMA 4B73A 3STIA 1RIWC 5C5NA 1BUIA 3TLOA 1TBZH 1N6XA 3RXBA 3MO9A 2VB0A 2YOLA 1O34A 3V13A 3RLYH 5JB8S 4CRBA 3MNXA 2O8WA 2WV4A 3SHAH 6CHAC 5E0JA 1Y3UA 3EGKH 4JZEH 1BCUH 2A4QA 1UTKA 1JWTA 1TALA 1SLVB 2VVUA 4E7RG 1EJMA 3UNQA 2FP7B 1P2QA 2QXJA 3AW0A 1YPKH 4F49A 1G3DA 1K22H 4MNWA 2JKHA 1LKAA 4JZFH 2QN5T 4YM9A 3ZZ8A 3UNSA 1D6RA 2ZU3A 1K1LA 1P2IA 1SOZA 3A86A 3A88A 1FY1A 1JRSA 3BSQA 1AVGH 3F9EA 5DKMA 1Y3VA 3WY8A 1QJ6B 5FCRA 2P95A 1DANH 4Y76A 3GCHC 1GGDC 1NM6A 4JZDH 1GDNA 2Z3EA 4Z0KA 2FI5E 3U69H 1FN6A 4AFSA 1W10U 1P2NA 5L2YH 1FONA 4AGKA 4KP0A 1P0SH 1AE8H 4FUIA 1T31A 1B5GH 4X1QU 2HNTC 1BMLA 2B0FA 4KGAA 1F7ZA 1P11E 3LT3A 2A4GA 5ETXA 4D9RA 4GPGA 4K60A 2THFB 1S0RA 2VWOA 2B9LA 1V2KT 3LGYA 1TA6A 1TE0A 1O2QA 2BY7X 4D8NA 1DWBH 1AUTC 5DP8A 1PPGE 3MTYA 1JRTA 1SGFG 3TH4H 1QJ1B 3TGJE 2GVFA 2WYJA 5HM9A 1B7XB 1HAZB 5EG4A 3ELAH 1FV9A 1QL8A 1O36A 1GDQA 3SO3A 2ZPQA 1C2JA 3LPRA 1HNEE 4CR5A 2F83A 4X1PU 5DP5A 2VJ1A 4ZKNU 4RSPA 1WSSH 2PUXB 1W0YH 3FZZA 2VIDA 3HGPA 3ZZCA 1BIOA 2OC8A 4BXSA 5EQRA 2BVXH 3V3MA 2VWNA 1C2KA 4LXBH 4I7YH 3U1IB 1P9UA 4YOIA 1UMAH 8LPRA 4DGJA 1AVWA 1ELTA 1T4UH 1SQTA 3H5CB 3MNSA 3PMHB 2BD9A 1VJAU 2UUKB 1H8IH 1GJ7B 1QBNA 2BD2A 1SFQB 1XXDA 1IQLA 1BHXB 3F68H 5EGMA 2ZFPH 3SGAE 1NN6A 2TPIZ 3SUFA 1BZXE 1HV7A 2HALA 3BTHE 1WU1A 2UWPA 1V2PT 1L1NA 1THRH 4AX9H 4X1RU 1SI5H 3M3TA 2XNIA 1OWIA 1V2JT 3RDZA 5AHGH 3RMMH 4SGAE 4LOYH 2ZCHP 1O2UA 2FYRA 3TU7H 2VGCB 3EE0B 3GY2A 3LJJA 2BOKA 2OD3B 4IGDA 2Z3DA 2F9NA 1WTHD 5IYTA 1OWDA 2A2QH 2XWBI 1QHRB 1UTQA 1NPMA 3UUZA 1SQAA 1XUGA 2WV5A 1FDPA 2PFEA 4NIXA 3SHCH 1TABE 2OCVB 4ABBA 1HAPH 4CBNA 3LH1A 3JZ2B 1P02A 1TRNA 4AOQA 1G3BA 2QYIA 2FZZA 1S6HA 5F8ZA 2FODA 1ETRH 1GJDB 4A6LA 1ABIH 1QTFA 4E7NA 5EPYA 2O8TA 1BJUA 1QQUA 1YLDA 3P70B 4A1TA 1AE5A 3DA9B 3GCNA 2GZ7A 3VEQB 1PJPA 1O3MA 3ZYEA 3GDUA 3TK5A 3P6ZB 3PYHA 5J4SA 4BNRA 4WY3A 2QA9E 4DJZB 1RTFB 2V6NA 1NRSH 5JBAS 2O8MA 4K8BA 2VIVA 4BANB 2A7HA 4AG1A 1NU9A 1O2RA 1O5EH 3ZV9A 1P57B 2QY0B 4K8YA 3UWIA 4INHA 1ZSJA 2NU4E 1GJ8B 1ZRBA 1P05A 5BPEA 1V2MT 2SGAA 3F6UH 3RXPA 1UHBA 3AW1A 5HMAA 1GI7B 2GP9B 3RUOA 1OPHB 3SV7A 1CA0B 8GCHF 1Z7KA 5GCHF 4J1YA 1GBIA 1EXFA 1C5XB 1C2GA
chains in the Genus database with same CATH superfamily
2HNTF 1SGIB 2Z94A 2V3MA 3SUGA 4Y71A 1TPPA 4WXIA 3E1XB 1MTWA 2SGQE 4DY7B 3B9FH 3KCGH 1GHWH 1EZUC 3A7VA 4XDEA 5GIBA 1F2SE 1OWJA 2ZQ1A 2JH6D 3SUEA 2ZTYA 1BB0B 1UVPA 5SGAE 1C5VA 1G2MA 3TNTA 4O3UA 3GDVA 5LH8A 2FOCA 3E8LA 1JIRA 1OYQA 1TGCA 4ZHAA 3F2FA 1EAXA 4ZHMU 1RGQA 1Q31A 1EATA 3MYWA 5F6MA 2QAAA 2FLRH 5KEDA 3V0XA 1H9IE 4LZ4B 1VR1H 1C2FA 4NA7A 3PO1C 1CGHA 3VB6A 1MH0A 1MD8A 1O2NA 4UFEH 5CMXH 2ANKH 3T28A 3S9CA 3RXJA 1TX7A 2C8ZB 1O3PB 2Z9JA 1BBRK 2GGVB 1AZZA 3QWCH 9ESTA 4DVAU 3P8OA 5EXLA 2UUYA 2GT7A 1ID5H 3T25A 1INCA 2KCYA 1SG8B 2FPZA 1HXEH 1ZPBA 3ATIA 1OXGA 2A5AA 5BRRE 1EJAA 5DPAA 3K6YA 2PV9B 2BDCA 3UR6A 1NTPA 1A0HB 2Y7ZA 3B8JA 3IG6B 2BDIA 3M7QA 6GCHF 1NROH 1OX1A 1C4Y2 1HLTH 2ZHWH 4NIYA 4BAOB 1G3CA 3DSGA 1A5GH 1TQ0B 3UOUA 1MAYA 3ZZ3A 1O32A 3SYJA 1KXBA 1NY22 2ZGHA 1UTJA 4DW2U 1UVSH 1GI5A 1GBCA 1GJ5H 1O38A 4TYDA 4MNYA 1EB1H 3ZZAA 5CHAC 4X6MA 1Z8JB 3SZEA 2C4FH 1FY4A 5FX5A 2ZHEH 3L3TA 5FBEA 2P3FH 4ZHLU 1NRNH 5ESBA 1UCYH 2B7DH 2JH5D 3PMBB 3A7ZA 1W7XH 2O8UA 1ELCA 3KF2A 2CN0H 3DFLA 4ABIA 1E1QD 1G30B 8ESTE 4UFDH 4CREA 1FLEE 1O35A 1TWXB 1IQNA 1MD7A 2R9PA 2W6JD 4KTUA 1QJ7B 2FOHA 5KECA 1SHYA 2AGGX 1MTVA 1O3AA 3T27A 1D3TB 4RKJB 4ACBA 1MKWK 2ZDLA 1PQ8A 4RT0A 3C27B 2ZDAH 4FU8A 2SGDE 2BY9X 4Y7AA 2KR7A 3IWMA 2KCAA 1Y5UT 1AU8A 4TWYA 3TNSA 3I29A 2HPPH 4X2XA 4ZXYH 2HNTE 1GBTA 1ETTH 1F5RA 1ZTLA 3SU0A 8GCHG 4DT7B 1YLNA 4IC5A 1GG6C 5GCHG 3K65B 3PV4A 3BG4B 1UTPA 5A8XA 7ESTE 2PLXA 2YNBA 1A0LA 3N99A 3QX5H 2WV9A 1TGSZ 3SJOA 1GWAA 1FJSA 2H5DA 2V0BA 4ABHA 2LELA 1SGYE 1EFRD 2O9QA 1SGFA 2OC7A 4OS4A 2BMGB 1CBWC 1UTLM 1YLCA 1EX3A 4TWWA 3TK6A 2QGRA 3FO8D 3BTKE 3HATH 2Z9LA 1XUHA 1TGBA 2HWLB 3SU1A 2R3YA 1AFEH 3GY3A 2J98A 3VXFH 2FLBH 1AB9C 1P3CA 2OP9A 1TMUH 5TCCA 1XXFA 3SORA 3E6PH 2ZU1A 3LDXH 2Y81A 2PKSB 2J38A 2GV6A 3QGJA 4Y8XA 1ELAA 4O3TA 1MTNB 3RMNH 1OSSA 4D7GA 3PMAB 1O2XA 1NT1A 5L30H 3EQ0H 2EY4C 1C2LA 2FI4E 2FTLE 5DP6A 2ZP0H 4JYVH 1HDTH 4I32A 2Z3CA 1BITA 2QXHA 2AGIX 3BTDE 5LPEA 3FANA 6CHAB 1Z6EA 1AWHB 1O33A 1WQSA 4RN6A 1Y5AT 3GY6A 1C1OA 1BRAA 3DD2H 1BJVA 3G01A 3BTEE 1UCYE 4A1XA 1TNLA 1ZPCA 4MG3A 1FY8E 2A0QB 1H8DH 1TQ7B 2J97A 3GDSA 3A87A 5EXMA 3PTNA 6GCHG 3SU5A 1O5DH 3LGUA 3LJOA 1NRQH 2J9NA 1BTYA 4CR9A 1D3PB 1GI9B 5L2ZH 1E36B 4YLQH 3N7OA 1CSOE 1ABJH 2STBE 3O8RA 3GCHB 1GGDB 1SSXA 1HRTH 3CS7A 4P00A 1O2HA 3BN9A 1V2ST 1LHGH 1L0ZA 1QRZA 3GY5A 5K0HA 1NFUA 4R8TB 2PR3A 2OBQA 5E8EH 3I77A 5C67A 2GMTB 2FX6A 1Z8GA 2XC5A 3F0OA 3D23A 1D3QB 1QRXA 3V7TA 2ODQA 2EQNA 1P2MA 2FOFA 1SLUB 3OY6U 4HG6A 1V2QT 2WUBA 2Z9IA 1F5KU 4TSFD 2TRMA 3BTFE 4D7FA 1AD8H 1IQMA 4B2BA 2BD3A 3TITA 1T32A 3BIVH 1A1RA 2G55A 5JBTA 1Z8IB 4YXWD 1GJAB 3RU4D 1YCPH 1ZMNA 3BEIB 3O8BA 1W3CA 5EQSA 3ZZDA 1C5UA 4AC9A 5GDSH 1YY3A 1O3JA 3RXCA 3SJ8A 1V2VT 1BT7A 1GJ4H 2A5IA 4DCDA 3I78A 3CENA 1DPOA 2CK3D 3EA8A 3LONA 1ARCA 1ZMJA 1KXFA 3M5NA 2FOEA 1OYTH 2ESTE 2BDHA 2SNWA 2BX3A 1KLIH 2GCTC 3SNAA 4D76A 2EC9H 3FOAA 5DP7A 1VJ9U 1CT4E 4WJG2 3EYDA 2XXLA 1AIXH 1TMTH 2QF4A 3MU8A 1SGCA 3ZZ4A 3QGNB 1OWEA 1AQ7A 5C0TA 1T7CA 2OQ5A 3RXQA 4NFFA 1A2CH 3RXOA 1O2IA 3ESTA 3KNXA 1FX0B 1UTMA 1AVXA 1Z1JA 1K28D 3ZVDA 1O3BA 3BEUA 1GCDA 1O3KA 1TRYA 3M5LA 4O03A 1XUIA 1SB1H 4ABDA 5PTPA 4MPUA 3QTVH 1HJAC 1D4PB 2Y5FA 1H9LB 1LCYA 4K5ZA 1QQ4A 4MTBA 3E90B 2XTTB 1ANEA 4BTIB 2QXIA 1YPEH 1N6YA 1OS8A 1ZTKA 3M5MA 1WTGH 3KQ5A 1QY6A 4CHAC 1DXPA 1A5IA 3D49H 2D26C 4MQAA 1C5QA 4X6NA 1GCTC 1VGCB 1WBGB 4XD7D 3TPIZ 1CU1A 3NXPA 1S82A 4TY6A 4CRDA 3BTWE 2J5UA 2PTNA 3QTOH 2QF3A 1TOCB 3KQEA 3SU4A 4WVPE 3ZVEA 3U8TH 2BVSH 1ELGA 1ESTA 1TPSA 1UHBB 1W14U 2W3IA 1C2MA 2A7JA 4JYTA 4FUGA 1L4ZA 3S7KB 5T1VA 3V12A 3SU6A 3PWCA 3STJA 5DJ7A 4BOHA 1W2KH 2FOAA 1SC8U 3F2GA 3MH7A 5H4IB 4U32A 2YMSB 1OWKA 2SNVA 5E2PA 2GDDA 1KY9A 1E37B 1BTUA 7KMEH 4BTUB 2XW9A 1CQQA 5DG6A 1EP6A 2GTBA 2XBXA 4ACAA 3URCA 2FM2A 5HYOA 3RC5A 4GAWA 5FL7D 1DY9A 3BV9B 3A7WA 2OBOA 3QZRA 3FZDA 2R2WU 2QC2A 1P01A 2FMJA 2GX4A 1IQFA 1C2HA 3RXTA 2JJ1D 2W26A 3SN8A 1QB9A 2R2MB 4OS5A 2VVCA 1ANCA 3A84A 1NFWA 4NGAH 1WUNH 1KXAA 3SQHE 1OKXA 4WH6A 4ZAEA 3EA7A 4FUBA 2PKAA 1UO6A 3IITA 1ORFA 1T8LA 2IN2A 2G4TA 1S5SA 1O2VA 3QZQA 3MH6A 1EOJA 4I8LA 1GJCB 1MMJN 2P8OC 1L1JA 1O3EA 5FCKA 2ANWA 4Q7ZA 3SJIA 1O3DA 3UIRA 1H8HD 2OINA 3OYPA 1SLWB 1C1RA 5I46H 2P16A 2R0LA 4OGXA 5DP4A 1GMDF 4X8UH 1C1QA 4Y79A 3SW2B 1F0TA 2ZKSA 4B74A 1KXEA 2FYQA 1DM4B 1PPHE 1V2UT 4FUHA 4NZQA 1BTWA 2BLWA 1DWDH 1O2WA 3MMGA 2BDBA 4B71A 5EPNA 1O3HA 3SJKA 4BXWA 2KM0A 3ZZBA 2D1JA 2TGAA 2ZHQH 2CMYA 4F55A 2IJD1 3KQDA 5A2MH 2TGTA 5J4QA 1J9CH 1GI8B 3PMJA 1C1NA 3GOVB 1DSTA 1A0JA 3EA9A 2J95A 1ELBA 4Y8YA 4WH8A 1L2EA 3NUMA 2ZHDA 4BTTB 5CE1A 2QE7D 1GMCF 2G4UA 1IQJA 1YC0A 1NZQH 4VGCB 1MCTA 2ALVA 4ZXXH 3SGQE 1J17T 2B5TB 2BQ6B 4RKOB 1OP0A 3BIUH 2BB4A 1GPZA 1V6DA 2CV3A 1K9OE 3OTJE 1ARBA 1DICA 2GT8A 3DUXH 3A81A 1AO5A 1C1VH 1IQIA 1O3LA 3T5FH 1T8NA 2EI7A 3MO6A 1K1IA 5DGJA 2TIOA 1NS3A 2KFWA 4IS5A 1UTNA 2OXSA 3SGBE 3BTTE 3QK1A 2ZFRH 2W3KA 5A0BA 1M9UA 2L74A 2RDEA 1UVTH 4ZUHA 4K1TA 1MABB 1P06A 5EQQA 3VPKA 1H4WA 1NFYA 2A1DB 2AMDA 4K3JA 1E79D 2WYGA 4I31A 1GHZA 2ZDVH 2WUCA 1P04A 3MU1A 1EUFA 1GBFA 3OEHD 5DK1A 2XBYA 3SZNA 4DURA 2PGQB 4TY7A 2QIQA 1KLTA 1KIGH 1AFQC 2A4OA 2Q6DA 1AGJA 1K0HA 2WZQA 3SNEA 1T4VH 3SU2A 1O2JA 1HYLA 1O3NA 4CRAA 4O9VA 4FVDA 1C1MA 4K2YA 4Y10E 4XBBA 3A7XA 4B76A 3TGKE 1WQVH 1HAHH 1GG6B 4ZH8A 1TLDA 1NO9H 2G5NA 2Y7XA 1HAIH 1YPHC 3P8GA 2WPLS 1O37A 2P94A 1VCPA 1GMHF 2BYAX 2H9EH 3LU9B 4YT6H 1SKYE 1FN8A 1YPGH 1Z8RA 4NSYA 3SJ9A 4IN1A 1EZSC 3FAOA 1CBWB 2FIRH 1LPZB 1U6QA 4NFEA 1QB1A 4FVBA 3P92A 3RXRA 1ZHRA 2OUAA 4Q7XA 1GMDG 3KQBA 3W95A 1Z71A 2ZHFH 4AGJA 1LHCH 2PW8H 3ATLA 4IN2A 5AF9H 2M2AA 1O30A 1C9PA 5EIYA 1HUTH 2DE8A 2HGTH 5FX6A 1P12E 2P59A 2SFAA 2H5CA 3Q00A 1DDJA 4HZHA 3GY8A 4MPVA 3RM0H 4NZLA 1K1NA 3MH4A 3LOXA 2KX4A 1ZGIA 3MHWU 2IOTA 1EASA 1O2TA 3NWUA 5TCAA 4B2AA 1P03A 4A5TS 2G5VA 1MU8B 1YPJH 3T62A 3Q76A 4GVUA 2A31A 1ELDE 4YTAA 1TX6A 3EDXB 1ESBA 5HXFA 1GMCG 1EKBB 1GHVH 1HBTH 3ODFA 3QUMP 1W8BH 1UW7A 4NIWA 3FP8E 2GKVE 1F5LA 2FWWA 1PPEE 1MKXH 2FI3E 2PUQH 1A3EH 4FETA 3OU0A 3SNCA 2D2DA 1SPJA 2VWLA 3UR9A 1C9TA 1PPZA 2GDEH 1V2WT 1DSUA 1FI8A 4TPYA 1UK2A 5C0UA 1ANBA 1FY3A 3RC4A 1ZSLA 4Q80A 4XOJA 1RD3B 3JZ1B 4X1SU 3H09A 1BBRH 1E0FD 1Z6JH 4OS2A 5JBCS 1BTZA 1CVWH 4H6TA 3F9HA 2XBVA 3RC6A 5L6NH 1ZMLA 1D3DB 1TNJA 3A8DA 1HIAA 1G37A 1Q3XA 2Y5HA 2QCYA 3PB1E 4U01A 1GBJA 4TPIZ 2PTCE 1QL9A 1GBEA 4AORA 3RU4E 4YT7H 3ODDA 1QA7A 1CGJE 1W0KD 5A0CA 3HPTB 3KHVA 1C4V2 1WXRA 1C5OH 3UPEA 2PP6A 4I8GA 5DO4H 2A5KA 1O2MA 1VITF 3T29A 3KIDU 4M9FA 2BQWB 2EI6A 4Z6AH 2PSYA 4UDWH 1ZJKA 4M7GA 1UCYK 1O2SA 4ABJA 1BQYA 1GI3A 1JMOH 3ZVAA 2ZQ2A 1SGTA 2ANYA 3A85A 3SV8A 1VITH 3MQKC 1EOLA 1DT2A 2JDID 1TBRH 1O3FA 1MKWH 4DIHH 5JBBS 3VG8A 1XVMA 3Q77A 1GMHG 1J15A 2GCTB 2XRCA 5FHTA 4K69A 1NC6A 5AVDA 2O8LA 1O2LA 3ZZ9A 2GZ8A 2JJ2D 1KXDA 3KL6A 2VBCA 5F03A 3E3TA 1PYTC 2JETB 4RI0A 1KXCA 1P2OA 3TVJB 1EPTC 3HK6B 4ISOA 3N7EA 1VCQA 4LZ1H 1DVAH 3RXAA 3GICB 2PSXA 2UUJB 4X2VA 1EAUA 3HK3B 2ZWLH 2ZNKH 1O5FH 1V3XA 2DE9A 1WYKA 2EI8A 3U98H 4HTCH 4XBDA 1C5SA 2UUFB 4E05H 5HM2A 3RMOH 1MCVA 2Y82A 4HGCA 4XE4A 4AFQA 1BBRE 3LH3A 3SV6A 2XNDD 2PWXA 5C94A 1NRPH 3PV5A 2V7QD 3MI4A 1RIWB 1PPBH 4CHAB 3OY5U 4H4FA 1O39A 4DT4A 1GCTB 3PWBA 3LC3A 3VB7A 1TGNA 1EPTA 1A5HA 2Q6FA 1C1WH 1SBWA 3SI3H 4Y0YE 1OHHD 1O3CA 1RTLA 2AEIH 3UREA 2G8TA 1Q2WA 2BZAA 3O8CA 4INKA 1VZQH 1MBMA 3CNRA 3L6PA 1ZZZA 4UFGH 1GVZA 5AFZH 2VH6A 4IC6A 1G3EA 1EZXC 1Z1IA 2TGPZ 1LVBA 2A45B 2H9TH 2PKAB 1QIXB 1CGIE 3EE7A 1ELVA 2RFKC 1OOKB 4CH8B 2RA0A 2BD7A 3OFND 4JK5A 1ETSH 2F9VA 2Y6TA 1DLKB 1DX5M 3WWBA 2AHME 4KTCA 5EODA 4K1SA 3KN2A 4ISHH 2C8XB 1GBLA 4JCNA 2GJGA 2P3TB 1SGPE 3M36A 4H6SB 5I25A 2ZI2H 3TH2H 4WWYA 2A2XH 1O2YA 2ZA5A 2CHAC 3QDZB 1IQKA 1VITG 1TNKA 1FIWA 1PQAA 3MU5A 1SGDE 1K1JA 1C5NH 2BX4A 2BD5A 1UTOA 3RXMA 5FPSA 1H1BA 1SVPA 2FESH 1WV7H 4JMYA 1CHOG 1EQ9A 2ANMH 1GVLA 1G2LA 2ZFSA 1TIOA 1YBWA 3UQOA 1QGFA 1S84A 2ZC9H 1ELFA 1QBVH 1G36A 1CO7E 1C4U2 2H9HA 3A8BA 4WMFA 1MZDA 4O97A 1YYY1 2P8OB 1V2NT 1G9IE 1S0QA 3K9XB 5C20A 2ZO3H 3KEEA 2BM2A 4FU9A 3VGCC 5JDUB 3ATWA 2XC4A 2WPIS 4ZKSU 1EB2A 2ALPA 1T8OA 1C5LH 4AYYB 2TGDA 3K6ZA 4I8KA 1ZPZA 4NA9H 3OTPA 4Q4LA 1GBHA 1YPHE 5F8TA 1RXPA 3URDA 4AYVB 5B6LA 2OTVA 3M5OA 1P3EA 1LQEA 1ZR0A 3E91A 3ATKA 4NWKA 1JIMA 1LHDH 4Y8ZA 1O2GH 4MDSA 1D6WA 4GCHF 1IOEA 5JPMH 3P95A 1S85A 1GHXH 3FN8A 1W13U 1DOJA 3SNDA 3RLWH 5E2OA 2G81E 4UE7H 1XKBC 3FVFB 1F92A 2BHGA 2OLGA 3DHKH 2HOBA 3P17H 3PROA 5IDKA 1OWHA 1W11U 4Y6DA 1TFXA 4X8TH 3RXVA 4ZROA 2F9PA 1CA8B 3UB0A 3BTGE 5JYIA 1P2KA 5F53A 2VIOA 5LGOA 1MZAA 4A7IB 4I86A 2BLQA 1AZ8A 1NRRH 4ASUD 1C5RA 2YNAA 4DOQA 3BG8A 2BD8A 3CS0A 4MLFB 4B75A 2EEKA 2CF9H 5FPYA 1ESAA 1ZJDA 5E0HA 1A4WH 1HPGA 1LMWB 1FPCH 1TNGA 3S69A 3SNBA 4DIIH 2QF5A 3BTQE 5C17A 4NCYA 1BMMH 3RXUA 2K0QA 3M3VA 3MO3A 3UQVA 3WW7A 1A46H 2HRVA 3NZIA 1EJNA 1TA2A 2C3SA 2J92A 3M35A 4U2WA 2CGAA 3M7TA 4LK4A 3PLPA 5A0AE 1TOMH 3S0NA 3ZVCA 3LIWA 3VB5A 2H2ZA 2AFQB 1C1SA 3F9GA 5HKKD 5LPFA 1Y8TA 1MTNC 5EJLA 4X0WU 1MAXA 2I6QA 1AWFH 2VWMA 4X2WA 3TIUA 3LKWA 1C2IA 2EA3A 2NU0E 3ZVGA 4Z1MD 1AFQB 4OS1A 4CBOA 1C1UH 1TONA 4B1TA 1T8MA 2VINA 4Q2KA 1IHSH 1CT0E 2LPRA 1YPLH 5C1UA 1SGEE 1FY5A 3QN7A 1IHTH 4AG2A 5GWZA 1A3BH 2WSSD 4ASHA 1PPCE 1BMAA 3RMLH 4MVNA 2XWAA 1O2ZA 1O5AB 2CXVA 4FUFA 1DWEH 1BRUP 2ZPSA 4GLYA 1TMBH 1K1OA 4X1NU 1ZSKA 3LGTA 1QNJA 1C1PA 1THPB 4IBLH 1GBDA 1C5MD 4FU7A 1XKAC 1XM1A 2A7CA 3N7DA 4ABEA 5CDFE 1DLEA 3GCTF 5TJXA 4GSOA 5F8XA 2VVVA 1NESE 3U9AH 3HKIB 1HAOH 3LGIA 5FAHA 3U1JB 1G32B 4NSVA 1GJ9B 3SV2H 2SGEE 1PQ5A 1WAYB 2GMTC 1W12U 2BDGA 1FQ3A 2L6OA 4JK6A 1TPAE 2FS8A 2NU2E 3SI4H 3NK8A 2XYAA 2RDLA 1YGCH 4NWLA 1HAYB 1NBMD 3TJVA 4GCHG 5HGGA 2RCEA 4MPXA 1GL0E 3KGPA 2UWOA 2ODPA 1HFDA 2ZFQH 1DWCH 3S9BA 2HLCA 2ZTZA 1BOQA 1K1PA 3K2UA 2VU8E 4JYUH 1ZHMA 4BAKB 1HIAB 1ZYOA 1BRBE 4Y0ZE 5EW1H 1W7GH 3GCOA 3M3SA 3SOSA 1O3OA 3T2NA 1Y5BT 1O5GH 2C8YB 2P93A 4NIVA 5EW2H 2ZGCA 3UY9A 2FO9A 1TPOA 2OQUA 2NWNA 1GHAF 1V2TT 3PO1B 3ZZ7A 4D9QA 2BY5X 1ZOMA 2F43B 4CRGA 2ULLA 1F0UA 3H7TA 2P3UB 1O2KA 3OAAD 3FP7E 1IQGA 1V2LT 1HAVB 1HJ8A 4AFUA 2J94A 3D62A 2C93B 1ZGVA 1Y3WA 3SV9A 1B0EA 2F9BH 5C1XA 3RXHA 5C2ZA 2FOGA 4FUEA 5EXNA 4UD9H 1XUFA 1CE5A 1LDTT 2ZIQH 3F1SB 1E35B 4I33A 2A4RA 1BTPA 2V35A 1SQRA 1NFXA 4ZMAH 4IMZA 1HCGA 1BRCE 1P8VC 4UEHH 2ZCKP 2Z6BD 1GI0A 1GL1A 1O3IA 4F4OC 5GXPA 1SFIA 3MNBA 4BAQB 1O31A 1N8OC 2Z9GA 1GJBB 1ZTJA 3P8NA 2V3HH 4WMEA 5CHAB 3GISB 3W94A 2OC0A 2SGPE 1ZHPA 5GJ4B 1TAWA 1GI6A 5HIYA 2WPJS 2AYWA 5LPRA 3PM3A 4IMQA 1BDAA 2FEQH 1DS2E 1GHBF 4BAHB 3M61U 2QXGA 2XBWA 1EP5A 4WMDA 1UK4A 5DSFA 1ANDA 1E38B 1YF4A 4X2YA 3ZVFA 2W7UA 3U8OH 2G51A 3RU4T 4SGBE 3A8CA 1VGCC 1QB6A 1C2EA 3RXLA 4Q7YA 3PRBA 4YZUA 5FBIA 1GI1A 2CJIA 4ABFA 1UVUH 2AMQA 3C1KA 3GYMA 1YKTA 2GZ9A 1JXPA 2ZFTA 1QRWA 1EAWA 3RXKA 2ZF0H 2QF0A 2ZGXH 3LC5A 3A8AA 4XBCA 3GY4A 3GCTG 4P02A 3Q3KA 2F9OA 4KKDA 3TGIE 1KDQA 1GI4A 1YCPM 2IJOB 2FXRA 2Y5GA 1B0FA 3OX7U 1WCZA 2J4IA 4U30A 1YM0A 3AAUA 1EPTB 1UK3A 5E0GA 4E06H 1IAUA 1SMFE 2KCOA 2GV7A 2AMPA 4OS6A 5T6FA 2W7SA 5G4BA 2ZU2A 2Z7FE 3L33A 3M7UA 1OP2A 2KAIB 1MTSA 3PLKA 1THSH 2XCFA 3TK9A 1AB9B 4X6PA 3KYGA 2ZGJA 3PLBA 3U8RH 4ABGA 3MU0A 2AIPA 3RXIA 2DUCA 3BEFB 3Q3XA 1DE7H 2HPQH 2VIPA 4NG9H 4ESTE 2R0KA 2FX4A 1GDUA 2D8WA 3ZV8A 1X7AC 3UFAA 3ZIAD 2XC0A 3E16B 1MUEB 2ZDNA 3ITIA 2SGFE 1GHAG 1VKYA 1GBAA 4YOJA 3LGVA 4ABAA 1LHFH 2F91A 3QLPH 1LQDB 3TH3H 2I6SA 2Q6GA 4ISLA 1QL7A 2OC1A 1QR3E 1GJ6A 1PYTD 1P10A 2ASUB 1DITH 4ZKRU 3FFGA 4AB8A 5C3NA 2BXUH 1NU7B 2ZECA 2GCHF 1HJ9A 2ZDMA 5C1YA 1SGRE 5HIZA 1AUJA 4ISNA 1MKXK 1XUJA 2BY8X 1LPKB 1GBBA 3M37A 2GD4B 1O2OA 5A8YA 1A7SA 1AI8H 3S9AA 3RXFA 1L1GA 1SL3A 2CHAB 1C5PA 3AAVA 3TJNA 4GUXA 2LNCA 4CRFA 1AKSB 4UFFH 4VGCC 3MNCA 4AFZA 1TYNA 1GHBG 1J14A 3ATMA 1GVKB 1C5YB 2H6MA 3DSOA 2KCPA 3MU4A 4A92A 2BY6X 4K1EA 2ZCLP 2V3OH 2Y80A 4WXVA 4QT8C 4YOGA 5JB9S 2VH0A 2VGCC 1DUEA 5EOKA 4AN7A 1E34B 1LVYA 1HAVA 1CHOF 1LVOA 2ZDKA 2J34A 3D65E 3T26A 3P8FA 3VGCB 2W5EA 4KTSA 3R0FA 2JH0D 4ISIH 1MBQA 4R0IA 2FDAA 4I8HA 2BQ7B 4B6EA 2AGEX 1C2DA 1K1MA 2NU3E 5DP9A 1BA8B 1BMFD 3BTME 3MH5A 4GHTA 1CT2E 1Y3XA 1DUAA 6ESTA 2RA3A 2F4LA 1RJXB 3RXSA 4YO9A 4FUDA 5K7RA 1FPHH 3GYLB 1BMNH 2BLOA 2R3UA 1QBOA 2W6ID 1K21H 4INLA 1N1LA 2OK5A 1QCPA 2AERH 1WDIA 1FXYA 3ZZ5A 1KYNA 5T6DA 3TJUA 2XCNA 1D9IA 1HXFH 1S6LA 1YWUA 3PRDA 2CF8H 3PTBA 1BTXA 1AY6H 2ZEBA 4GHQA 1QFKH 3SQEE 3NPSA 2AH4X 3A82A 3RM2H 2IPHA 3Q3YA 5C5OA 2UWLA 1Y3YA 1JBUH 3HGNA 4H42U 2BTCE 4OS7A 4DG4A 2AS9A 4FUJA 1HJAB 2A32A 1AHTH 2BLVA 1K2I1 1TRMA 1IQHA 1GI2A 5EJ1A 5A09A 3BF6H 1TGTA 3E0NB 5EJZA 1CA0C 1LKBA 2C8WB 1Y59T 1P9SA 4YLUA 1C1TA 2ZTXA 3VXEH 2TBSA 7GCHF 2ZPRA 1HGTH 3F0PA 2ODYB 5FPTA 1FMGA 3SUDA 1O5CB 1YP9A 4YESB 1LTOA 1E1RD 1C5TA 1J16A 3ZZ6A 3FKSD 2GCHG 1RFNA 4CRCA 4XRNA 4KELA 2ZGBH 2ZZUH 1P2JA 2BXTH 1P09A 1FZZA 4ZKOU 2KAIA 5EU8A 3EAJA 1H9HE 3KYFA 1L4DA 1F0RA 1OP8A 1SQOA 2B8OH 2HLDD 1LO6A 2M5TA 4FUCA 1LHEH 4HI3A 2ZG0H 1O0DH 2VIQA 3A80A 1ACBE 3MFJA 1S83A 1W0ZU 1GBKA 1H8ED 1FNIA 3E0PB 2PGBB 5B6OA 4NA8A 5KGOA 2XOKD 1ELEE 1ZLRA 2QV1A 1EZQA 3DFJA 4OM9A 1A61H 1PFXC 2WPMS 4FXGH 3UOPA 3F9FA 3B23B 1WOFA 3UNRA 4CH2B 1YPMH 2J2UA 4AZ2B 1MTUA 1C5ZB 4X6OA 3NCLA 3MOCA 2F9UA 4PROA 3DCLA 3VB4A 1MQ6A 9LPRA 1QA0A 2BVRH 2FOMB 3RP2A 2C90B 2G00A 3SBKA 3AASA 3UAIC 1RRKA 1SR5C 5GPIB 2NU1E 3OSYA 1LPGB 1MQ5A 1BHXF 2AIQA 4I8JA 7LPRA 4X8SH 1TNHA 4MNXA 4WF8A 3A83A 1HB0B 1NBME 1FUJA 4XFQA 1ZRKA 4XSKU 4OGYA 1RTKA 3HKJB 4HFPB 2JIZD 1O5BB 2G52A 4BAMB 3RXGA 3TJOA 2HVXA 3MWIU 3ENSB 2STAE 2RG3A 1S6FA 4J2YB 1UJ1A 2BDAA 4RT1A 3RXEA 3A89A 1V2OT 3FP6E 3KQCA 2LP6A 4X8VH 1FIZA 1YCPK 1IQEA 4IW4E 2ZU5A 3SU3A 5ABWA 6LPRA 1BTHH 1KTTB 2K1QA 1TB6H 3ZYDA 1AKSA 2KZ4A 5DP3A 1KLJH 2H1UA 1XX9A 4Y7BA 2ILNA 1JOUB 5T3HA 1FAKH 2BDYA 3A7TA 3VB3A 4MPWA 1HAXB 2FS9A 2FTMA 2F3CE 1MU6B 1O2PA 5AFYH 1KMHB 1DY8A 1XUKA 2BZ6H 1C5WB 2FOBA 1QURH 1TBQH 1V2RT 2WPKS 8KME2 2ZFFH 1AN1E 3AVZA 1SGQE 1VCWA 2VIWA 1XMNB 2Z9KA 1SGNE 1TNIA 2BD4A 3OEED 4UONA 4AB9A 4F48B 5CHBA 3R3GB 1LVMA 1KSNA 2VNTA 5ESTE 1HAGE 1PPFE 4JZIA 1RS0A 3O8DA 3BG4C 5A8ZA 3A7YA 3UWJH 7GCHG 4THNH 4A1VA 2JETC 1DFPA 1PQ7A 3GY7A 1AMHA 1S81A 2BOHB 2WPHS 1KTSB 4B2CA 1DXWA 3UTUH 2ZU4A 1FAXA 1COWD 5FXLA 5T6GA 3CP7A 3ZVBA 1XVOA 3NKKA 1N8OB 1SHHB 2WPDD 1O3GA 1SLXB 1UVOA 4MNVA 3F3BA 1GHYH 2PHBA 1CHGA 1EAIA 1SOTA 1KDQB 2Q1JA 2WINI 3DT0H 3LGWA 3QO6A 1F0SA 1TX8A 3VFEA 3RXDA 2PKSC 3H7OA 1J8AA 4Y11E 3S7HB 4JZ1A 1GBMA 4B73A 3STIA 1RIWC 3AK5A 5C5NA 1BUIA 3TLOA 1TBZH 1N6XA 3RXBA 3MO9A 2VB0A 3DSPA 2YOLA 1O34A 3V13A 3RLYH 5JB8S 4CRBA 3MNXA 2O8WA 2WV4A 3SHAH 2IPQX 6CHAC 5E0JA 1Y3UA 3EGKH 4JZEH 1BCUH 2A4QA 1UTKA 1JWTA 1TALA 1SLVB 2VVUA 4E7RG 1EJMA 3UNQA 2FP7B 1P2QA 2QXJA 3AW0A 1YPKH 4F49A 1G3DA 1K22H 4MNWA 2JKHA 1LKAA 4JZFH 2QN5T 4YM9A 3ZZ8A 3UNSA 1D6RA 2ZU3A 1K1LA 1P2IA 1SOZA 3A86A 3A88A 1FY1A 1JRSA 3BSQA 1AVGH 3F9EA 5DKMA 1Y3VA 3WY8A 1QJ6B 5FCRA 2P95A 1DANH 4Y76A 3GCHC 1GGDC 1NM6A 4JZDH 1GDNA 2Z3EA 4Z0KA 2FI5E 3U69H 1FN6A 4AFSA 1W10U 1P2NA 5L2YH 1FONA 4AGKA 4KP0A 1P0SH 1AE8H 4FUIA 1T31A 1B5GH 4X1QU 2HNTC 1BMLA 2B0FA 4KGAA 1F7ZA 1P11E 3LT3A 2A4GA 5ETXA 4D9RA 4GPGA 4K60A 2THFB 1S0RA 2VWOA 2B9LA 1V2KT 3LGYA 1TA6A 1TE0A 4TT3D 1O2QA 2BY7X 4D8NA 1DWBH 1AUTC 5DP8A 5DN6D 1PPGE 3MTYA 1JRTA 1SGFG 3TH4H 1QJ1B 3TGJE 2GVFA 1W0JD 2WYJA 5HM9A 1B7XB 2WHXA 4Q63A 1HAZB 5EG4A 3ELAH 1FV9A 3WWFA 1QL8A 1O36A 1GDQA 3SO3A 2ZPQA 1C2JA 3LPRA 1HNEE 2YMSD 4CR5A 2F83A 4X1PU 5DP5A 2VJ1A 4ZKNU 3GS9A 4RSPA 1WSSH 2PUXB 1W0YH 3FZZA 2VIDA 3OE7D 3HGPA 3ZZCA 1BIOA 2OC8A 4BXSA 5EQRA 2BVXH 3V3MA 2VWNA 1C2KA 4LXBH 4I7YH 3U1IB 1P9UA 4YOIA 1UMAH 8LPRA 4DGJA 1AVWA 1ELTA 1T4UH 1SQTA 3H5CB 3MNSA 3PMHB 2BD9A 3W1EA 1VJAU 2UUKB 1H8IH 1GJ7B 1QBNA 2BD2A 1SFQB 1XXDA 1IQLA 1BHXB 3F68H 5EGMA 2ZFPH 3SGAE 4ZCNA 4B6FA 1NN6A 2TPIZ 3SUFA 1BZXE 1HV7A 2HALA 3BTHE 1WU1A 2UWPA 1V2PT 1L1NA 1THRH 4AX9H 4X1RU 1SI5H 3M3TA 2XNIA 1OWIA 1V2JT 3RDZA 5AHGH 3F2HA 3RMMH 4SGAE 4LOYH 2ZCHP 1O2UA 2FYRA 3TU7H 2VGCB 3EE0B 4FOUC 3GY2A 3LJJA 2K8IA 2BOKA 2OD3B 4IGDA 2Z3DA 2F9NA 1WTHD 5IYTA 1OWDA 2A2QH 2XWBI 1QHRB 1UTQA 1NPMA 3UUZA 1SQAA 1XUGA 2WV5A 1FDPA 2PFEA 4NIXA 3SHCH 1TABE 2OCVB 4ABBA 1HAPH 4CBNA 3LH1A 3JZ2B 1P02A 1TRNA 4AOQA 1G3BA 2QYIA 2FZZA 1S6HA 5F8ZA 2FODA 1ETRH 1GJDB 4A6LA 3NRLA 1ABIH 1QTFA 4E7NA 5EPYA 2O8TA 1BJUA 1QQUA 1YLDA 3P70B 4A1TA 5IK2D 5GNDA 2J98B 2YMSC 1AE5A 3DA9B 3GCNA 2GZ7A 3VEQB 1PJPA 1O3MA 3ZYEA 3GDUA 3TK5A 3P6ZB 3PYHA 5J4SA 4BNRA 4WY3A 2QA9E 4DJZB 1RTFB 2V6NA 1NRSH 5JBAS 2O8MA 3PV2A 4K8BA 2VIVA 2HVYB 4BANB 2A7HA 4AG1A 1NU9A 1O2RA 1O5EH 3ZV9A 1P57B 2QY0B 4K8YA 3UWIA 4INHA 1ZSJA 2NU4E 1QZ8A 1GJ8B 1ZRBA 1P05A 5BPEA 1V2MT 2SGAA 3F6UH 3RXPA 1UHBA 3AW1A 5HMAA 1GI7B 2GP9B 3RUOA 1OPHB 3SV7A 1CA0B 3U28C 8GCHF 1Z7KA 5GCHF 4J1YA 1GBIA 1EXFA 1C5XB 1C2GA
chains in the Genus database with same CATH topology
2HNTF 1SGIB 2Z94A 3SUGA 4Y71A 1TPPA 4WXIA 3E1XB 1MTWA 2SGQE 4DY7B 3B9FH 3KCGH 1GHWH 1EZUC 3A7VA 4XDEA 5GIBA 1F2SE 1OWJA 2ZQ1A 2JH6D 3SUEA 2ZTYA 1BB0B 1UVPA 5SGAE 1C5VA 1G2MA 3TNTA 4O3UA 3GDVA 5LH8A 2FOCA 3E8LA 1JIRA 1OYQA 1TGCA 4ZHAA 1EAXA 4ZHMU 1RGQA 1Q31A 1EATA 3MYWA 5F6MA 2QAAA 2FLRH 3V0XA 1H9IE 4LZ4B 1VR1H 1C2FA 4NA7A 3PO1C 1CGHA 3VB6A 1MH0A 1MD8A 1O2NA 4UFEH 5CMXH 2ANKH 3T28A 3S9CA 3RXJA 1TX7A 2C8ZB 1O3PB 2Z9JA 1BBRK 2GGVB 1AZZA 3QWCH 9ESTA 4DVAU 3P8OA 5EXLA 2UUYA 2GT7A 1ID5H 3T25A 1INCA 1SG8B 2FPZA 1HXEH 1ZPBA 3ATIA 1OXGA 2A5AA 5BRRE 1EJAA 5DPAA 3K6YA 2PV9B 2BDCA 3UR6A 1NTPA 1A0HB 2Y7ZA 3B8JA 3IG6B 2BDIA 3M7QA 6GCHF 1NROH 1OX1A 1C4Y2 1HLTH 2ZHWH 4NIYA 4BAOB 1G3CA 1A5GH 1TQ0B 3UOUA 1MAYA 3ZZ3A 1O32A 1KXBA 1NY22 2ZGHA 1UTJA 4DW2U 1UVSH 1GI5A 1GBCA 1GJ5H 1O38A 4TYDA 4MNYA 1EB1H 3ZZAA 5CHAC 4X6MA 1Z8JB 2C4FH 1FY4A 5FX5A 2ZHEH 3L3TA 5FBEA 2P3FH 4ZHLU 1NRNH 5ESBA 1UCYH 2B7DH 2JH5D 3PMBB 3A7ZA 1W7XH 2O8UA 1ELCA 3KF2A 2CN0H 3DFLA 4ABIA 1G30B 8ESTE 4UFDH 4CREA 1FLEE 1O35A 1TWXB 1IQNA 1MD7A 2R9PA 4KTUA 1QJ7B 2FOHA 1SHYA 2AGGX 1MTVA 1O3AA 3T27A 1D3TB 4RKJB 1MKWK 2ZDLA 1PQ8A 3C27B 2ZDAH 4FU8A 2SGDE 2BY9X 4Y7AA 3IWMA 1Y5UT 1AU8A 4TWYA 3TNSA 3I29A 2HPPH 4X2XA 4ZXYH 2HNTE 1GBTA 1ETTH 1F5RA 1ZTLA 3SU0A 8GCHG 4DT7B 4IC5A 1GG6C 5GCHG 3K65B 3PV4A 3BG4B 1UTPA 5A8XA 7ESTE 2PLXA 2YNBA 1A0LA 3QX5H 1TGSZ 3SJOA 1GWAA 1FJSA 2H5DA 2V0BA 4ABHA 1SGYE 2O9QA 1SGFA 2OC7A 4OS4A 2BMGB 1CBWC 1UTLM 1YLCA 1EX3A 4TWWA 3TK6A 2QGRA 3BTKE 3HATH 2Z9LA 1XUHA 1TGBA 2HWLB 3SU1A 2R3YA 1AFEH 3GY3A 3VXFH 2FLBH 1AB9C 1P3CA 2OP9A 1TMUH 5TCCA 1XXFA 3SORA 3E6PH 2ZU1A 3LDXH 2Y81A 2PKSB 2J38A 2GV6A 3QGJA 4Y8XA 1ELAA 4O3TA 1MTNB 3RMNH 1OSSA 4D7GA 3PMAB 1O2XA 1NT1A 5L30H 3EQ0H 1C2LA 2FI4E 2FTLE 5DP6A 2ZP0H 4JYVH 1HDTH 4I32A 2Z3CA 1BITA 2QXHA 2AGIX 3BTDE 5LPEA 3FANA 6CHAB 1Z6EA 1AWHB 1O33A 1WQSA 4RN6A 1Y5AT 3GY6A 1C1OA 1BRAA 3DD2H 1BJVA 3G01A 3BTEE 1UCYE 4A1XA 1TNLA 1ZPCA 4MG3A 1FY8E 2A0QB 1H8DH 1TQ7B 3GDSA 3A87A 5EXMA 3PTNA 6GCHG 3SU5A 1O5DH 3LGUA 3LJOA 1NRQH 2J9NA 1BTYA 4CR9A 1D3PB 1GI9B 5L2ZH 1E36B 4YLQH 3N7OA 1CSOE 1ABJH 2STBE 3O8RA 3GCHB 1GGDB 1SSXA 1HRTH 3CS7A 1O2HA 3BN9A 1V2ST 1LHGH 1L0ZA 1QRZA 3GY5A 5K0HA 1NFUA 4R8TB 2PR3A 2OBQA 5E8EH 3I77A 5C67A 2GMTB 2FX6A 1Z8GA 2XC5A 3D23A 1D3QB 1QRXA 3V7TA 2ODQA 1P2MA 2FOFA 1SLUB 3OY6U 1V2QT 2WUBA 2Z9IA 1F5KU 2TRMA 3BTFE 4D7FA 1AD8H 1IQMA 4B2BA 2BD3A 3TITA 1T32A 3BIVH 1A1RA 2G55A 5JBTA 1Z8IB 1GJAB 3RU4D 1YCPH 1ZMNA 3BEIB 3O8BA 1W3CA 5EQSA 3ZZDA 1C5UA 5GDSH 1O3JA 3RXCA 3SJ8A 1V2VT 1BT7A 1GJ4H 2A5IA 4DCDA 3I78A 3CENA 1DPOA 3EA8A 3LONA 1ARCA 1ZMJA 1KXFA 3M5NA 2FOEA 1OYTH 2ESTE 2BDHA 2SNWA 2BX3A 1KLIH 2GCTC 3SNAA 4D76A 2EC9H 5DP7A 1VJ9U 1CT4E 4WJG2 3EYDA 2XXLA 1AIXH 1TMTH 3MU8A 1SGCA 3ZZ4A 3QGNB 1OWEA 1AQ7A 1T7CA 2OQ5A 3RXQA 4NFFA 1A2CH 3RXOA 1O2IA 3ESTA 3KNXA 1UTMA 1AVXA 1Z1JA 1K28D 3ZVDA 1O3BA 3BEUA 1GCDA 1O3KA 1TRYA 3M5LA 4O03A 1XUIA 1SB1H 4ABDA 5PTPA 4MPUA 3QTVH 1HJAC 1D4PB 2Y5FA 1H9LB 1LCYA 4K5ZA 1QQ4A 4MTBA 3E90B 2XTTB 1ANEA 4BTIB 2QXIA 1YPEH 1N6YA 1OS8A 1ZTKA 3M5MA 1WTGH 1QY6A 4CHAC 1DXPA 1A5IA 3D49H 2D26C 4MQAA 1C5QA 4X6NA 1GCTC 1VGCB 1WBGB 3TPIZ 1CU1A 3NXPA 1S82A 4TY6A 4CRDA 3BTWE 2PTNA 3QTOH 2QF3A 1TOCB 3KQEA 3SU4A 4WVPE 3ZVEA 3U8TH 2BVSH 1ELGA 1ESTA 1TPSA 1UHBB 1W14U 2W3IA 1C2MA 2A7JA 4JYTA 4FUGA 1L4ZA 3S7KB 3V12A 3SU6A 3PWCA 3STJA 5DJ7A 4BOHA 1W2KH 2FOAA 1SC8U 3MH7A 5H4IB 4U32A 1OWKA 2SNVA 5E2PA 2GDDA 1KY9A 1E37B 1BTUA 7KMEH 4BTUB 2XW9A 1CQQA 5DG6A 1EP6A 2GTBA 2XBXA 3URCA 2FM2A 5HYOA 3RC5A 4GAWA 1DY9A 3BV9B 3A7WA 2OBOA 3QZRA 3FZDA 2R2WU 2QC2A 1P01A 1IQFA 2GX4A 2FMJA 1C2HA 3RXTA 2W26A 3SN8A 1QB9A 2R2MB 4OS5A 2VVCA 1ANCA 3A84A 1NFWA 4NGAH 1WUNH 1KXAA 3SQHE 1OKXA 4WH6A 4ZAEA 3EA7A 4FUBA 2PKAA 1UO6A 3IITA 1ORFA 1T8LA 2IN2A 2G4TA 1S5SA 1O2VA 3QZQA 3MH6A 1EOJA 4I8LA 1GJCB 1MMJN 2P8OC 1L1JA 1O3EA 5FCKA 2ANWA 4Q7ZA 3SJIA 1O3DA 3UIRA 2OINA 3OYPA 1SLWB 1C1RA 5I46H 2P16A 2R0LA 4OGXA 5DP4A 1GMDF 4X8UH 1C1QA 4Y79A 3SW2B 1F0TA 2ZKSA 4B74A 1KXEA 2FYQA 1DM4B 1PPHE 1V2UT 4FUHA 4NZQA 1BTWA 2BLWA 1DWDH 1O2WA 3MMGA 2BDBA 4B71A 5EPNA 1O3HA 3SJKA 4BXWA 3ZZBA 2D1JA 2TGAA 2ZHQH 2CMYA 3KQDA 5A2MH 5J4QA 2TGTA 1J9CH 1GI8B 3PMJA 1C1NA 3GOVB 1DSTA 1A0JA 3EA9A 2J95A 1ELBA 4Y8YA 4WH8A 1L2EA 3NUMA 2ZHDA 4BTTB 5CE1A 1GMCF 2G4UA 1IQJA 1YC0A 1NZQH 4VGCB 1MCTA 2ALVA 4ZXXH 3SGQE 1J17T 2B5TB 2BQ6B 4RKOB 1OP0A 3BIUH 2BB4A 1GPZA 1V6DA 2CV3A 1K9OE 3OTJE 1ARBA 1DICA 2GT8A 3DUXH 3A81A 1AO5A 1C1VH 1IQIA 1O3LA 3T5FH 1T8NA 2EI7A 3MO6A 1K1IA 5DGJA 2TIOA 1NS3A 4IS5A 1UTNA 2OXSA 3SGBE 3BTTE 3QK1A 2ZFRH 2W3KA 5A0BA 1M9UA 1UVTH 4ZUHA 4K1TA 1P06A 5EQQA 3VPKA 1H4WA 1NFYA 2A1DB 2AMDA 4K3JA 2WYGA 4I31A 1GHZA 2ZDVH 2WUCA 1P04A 3MU1A 1EUFA 1GBFA 5DK1A 2XBYA 3SZNA 4DURA 2PGQB 4TY7A 2QIQA 1KLTA 1KIGH 1AFQC 2A4OA 2Q6DA 1AGJA 3SNEA 1T4VH 3SU2A 1O2JA 1HYLA 1O3NA 4CRAA 4O9VA 4FVDA 1C1MA 4K2YA 4Y10E 4XBBA 3A7XA 4B76A 3TGKE 1WQVH 1HAHH 1GG6B 4ZH8A 1TLDA 1NO9H 2G5NA 2Y7XA 1HAIH 1YPHC 3P8GA 2WPLS 1O37A 2P94A 1VCPA 1GMHF 2BYAX 2H9EH 3LU9B 4YT6H 1FN8A 1YPGH 1Z8RA 4NSYA 3SJ9A 4IN1A 1EZSC 3FAOA 1CBWB 2FIRH 1LPZB 1U6QA 4NFEA 1QB1A 4FVBA 3P92A 3RXRA 1ZHRA 2OUAA 4Q7XA 1GMDG 3KQBA 3W95A 1Z71A 2ZHFH 4AGJA 1LHCH 2PW8H 3ATLA 4IN2A 5AF9H 1O30A 1C9PA 1HUTH 2DE8A 2HGTH 5FX6A 1P12E 2P59A 2SFAA 2H5CA 3Q00A 1DDJA 4HZHA 3GY8A 4MPVA 3RM0H 4NZLA 1K1NA 3MH4A 3LOXA 3MHWU 1ZGIA 2IOTA 1EASA 1O2TA 3NWUA 5TCAA 4B2AA 1P03A 4A5TS 2G5VA 1MU8B 1YPJH 3T62A 3Q76A 4GVUA 2A31A 1ELDE 4YTAA 1TX6A 3EDXB 1ESBA 5HXFA 1GMCG 1EKBB 1GHVH 1HBTH 3ODFA 3QUMP 1W8BH 4NIWA 3FP8E 2GKVE 1F5LA 2FWWA 1PPEE 1MKXH 2FI3E 2PUQH 1A3EH 3OU0A 3SNCA 2D2DA 1SPJA 2VWLA 3UR9A 1C9TA 1PPZA 2GDEH 1V2WT 1DSUA 1FI8A 4TPYA 1UK2A 1ANBA 1FY3A 3RC4A 1ZSLA 4Q80A 4XOJA 1RD3B 3JZ1B 4X1SU 1BBRH 1E0FD 1Z6JH 4OS2A 5JBCS 1BTZA 1CVWH 4H6TA 3F9HA 2XBVA 3RC6A 5L6NH 1ZMLA 1D3DB 1TNJA 3A8DA 1HIAA 1G37A 1Q3XA 2Y5HA 2QCYA 3PB1E 4U01A 1GBJA 4TPIZ 2PTCE 1QL9A 1GBEA 4AORA 3RU4E 4YT7H 3ODDA 1QA7A 1CGJE 5A0CA 3HPTB 3KHVA 1C4V2 1C5OH 3UPEA 4I8GA 5DO4H 2A5KA 1O2MA 1VITF 3T29A 3KIDU 2BQWB 2EI6A 4Z6AH 2PSYA 4UDWH 1ZJKA 4M7GA 1UCYK 1O2SA 4ABJA 1BQYA 1GI3A 1JMOH 3ZVAA 2ZQ2A 1SGTA 2ANYA 3A85A 3SV8A 1VITH 1EOLA 1DT2A 1TBRH 1O3FA 1MKWH 4DIHH 5JBBS 1XVMA 3Q77A 1GMHG 1J15A 2GCTB 2XRCA 5FHTA 4K69A 1NC6A 5AVDA 2O8LA 1O2LA 3ZZ9A 2GZ8A 1KXDA 3KL6A 5F03A 3E3TA 1PYTC 2JETB 1KXCA 1P2OA 3TVJB 1EPTC 3HK6B 4ISOA 1VCQA 4LZ1H 1DVAH 3RXAA 3GICB 2PSXA 2UUJB 4X2VA 1EAUA 3HK3B 2ZWLH 2ZNKH 1O5FH 1V3XA 2DE9A 1WYKA 2EI8A 3U98H 4HTCH 4XBDA 1C5SA 2UUFB 4E05H 5HM2A 3RMOH 1MCVA 2Y82A 4HGCA 4XE4A 4AFQA 1BBRE 3LH3A 3SV6A 2PWXA 1NRPH 3MI4A 1RIWB 1PPBH 4CHAB 3OY5U 4H4FA 1O39A 1GCTB 3PWBA 3LC3A 3VB7A 1TGNA 1EPTA 1A5HA 2Q6FA 1C1WH 1SBWA 3SI3H 4Y0YE 1O3CA 1RTLA 2AEIH 3UREA 2G8TA 1Q2WA 2BZAA 3O8CA 4INKA 1VZQH 1MBMA 3L6PA 4UFGH 1ZZZA 5AFZH 1GVZA 2VH6A 4IC6A 1G3EA 1EZXC 1Z1IA 2TGPZ 1LVBA 2A45B 2H9TH 2PKAB 1QIXB 1CGIE 1ELVA 1OOKB 4CH8B 2RA0A 2BD7A 4JK5A 1ETSH 2F9VA 2Y6TA 1DLKB 1DX5M 4KTCA 5EODA 4K1SA 3KN2A 4ISHH 2C8XB 1GBLA 4JCNA 2P3TB 1SGPE 3M36A 4H6SB 5I25A 2ZI2H 3TH2H 4WWYA 2A2XH 1O2YA 2ZA5A 2CHAC 3QDZB 1IQKA 1VITG 1TNKA 1FIWA 1PQAA 3MU5A 1SGDE 1K1JA 1C5NH 2BX4A 2BD5A 1UTOA 3RXMA 5FPSA 1H1BA 1SVPA 2FESH 1WV7H 4JMYA 1CHOG 1EQ9A 2ANMH 1GVLA 1G2LA 2ZFSA 1TIOA 1YBWA 3UQOA 1QGFA 1S84A 2ZC9H 1ELFA 1QBVH 1G36A 1CO7E 1C4U2 2H9HA 3A8BA 4WMFA 1MZDA 4O97A 1YYY1 2P8OB 1V2NT 1G9IE 1S0QA 3K9XB 5C20A 2ZO3H 3KEEA 2BM2A 4FU9A 3VGCC 5JDUB 3ATWA 2XC4A 2WPIS 4ZKSU 1EB2A 2ALPA 1T8OA 1C5LH 4AYYB 2TGDA 3K6ZA 4I8KA 1ZPZA 4NA9H 5F8TA 4AYVB 1GBHA 1YPHE 3URDA 1RXPA 2OTVA 3M5OA 1P3EA 1LQEA 1ZR0A 3E91A 3ATKA 4NWKA 1JIMA 1LHDH 4Y8ZA 1O2GH 4MDSA 1D6WA 4GCHF 1IOEA 5JPMH 3P95A 1S85A 1GHXH 1W13U 1DOJA 3SNDA 3RLWH 5E2OA 2G81E 4UE7H 1XKBC 3FVFB 1F92A 2BHGA 2OLGA 3DHKH 2HOBA 3P17H 3PROA 5IDKA 1OWHA 1W11U 4Y6DA 1TFXA 4X8TH 3RXVA 4ZROA 2F9PA 1CA8B 5JYIA 3BTGE 1P2KA 2VIOA 5LGOA 1MZAA 4A7IB 2BLQA 1AZ8A