3ATKA

Crystal structure of trypsin complexed with cycloheptanamine
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3atkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3atkA02
2PKSB 1GMCG 3BV9B 3RU4E 2ZGCA 3E6PH 2W7UA 1W13U 2QXIA 3AASA 2FOGA 3BTKE 1YGCH 1AWFH 1V2PT 1AVGH 2A2XH 1MKXK 4CBOA 3EQ0H 1C2EA 1YC0A 1ARBA 4B75A 1P04A 1BJVA 1ZHPA 3LIWA 1OS8A 4BAKB 8ESTE 2IJOB 1D3DB 2EI7A 2PGBB 3BEFB 1MU6B 2Y80A 3D65E 2ZKSA 3TU7H 4B1TA 6ESTA 3VFEA 3FZDA 1TNGA 1NRQH 3SJ8A 1O5AB 4TWWA 1N8OB 1SLWB 1HJAB 1TGBA 4NIYA 2FI3E 1HGTH 1GJ7B 5B6OA 1SGTA 1P06A 1SGFG 4THNH 1DSUA 2FWWA 1O3AA 3HKJB 1O3PB 6CHAB 4A1TA 1XVOA 4NFFA 1F5KU 3S7HB 2KAIA 2TPIZ 7GCHG 4ZKRU 1A3BH 3SUDA 3R0FA 4GLYA 2CF9H 3HPTB 1DXWA 1B0FA 4Y6DA 4ZUHA 2GZ9A 1TMUH 2BVSH 3TK6A 2Z9GA 3UQVA 3FP6E 1ANDA 3GY3A 3ZV9A 3SO3A 2A4OA 2BX3A 4O97A 1DUEA 1DY9A 7GCHF 1O3DA 1LVYA 4NSVA 1QL7A 2FOCA 2J95A 2FESH 1EXFA 4O9VA 3LGUA 3SNAA 5DP5A 4B73A 4Y10E 1FJSA 1MUEB 1XKAC 2GMTC 4Y7BA 3PTNA 1SC8U 2FX6A 1YPKH 5DKMA 1TX7A 1GJAB 1MZAA 1NC6A 5E2PA 1GHWH 1NFUA 4K69A 2F3CE 1UTNA 1MQ5A 2FLRH 1GG6B 1HIAB 1QRXA 2VH6A 4UFDH 1J17T 1S83A 2PSXA 1WAYB 4FUJA 1VGCC 2DUCA 1GJ5H 1MTVA 3MNBA 1TPOA 3Q3KA 2DE9A 3OX7U 4J2YB 4AZ2B 4BANB 4CRAA 2BHGA 2NU0E 2HPPH 3SU5A 3RMMH 2F9NA 2A2QH 4D76A 1O2ZA 4HI3A 4RKJB 1YM0A 2ZDMA 2V3HH 3MU0A 3ATIA 2ODPA 3VGCC 3TH4H 4NZLA 1KDQB 3M5OA 1P0SH 4AOQA 2C8XB 2A5KA 1IQFA 2BD3A 4ZKNU 1HV7A 2C8YB 1GDQA 1VJ9U 4LZ4B 1XUIA 1H8IH 1OP8A 1P12E 2EC9H 1DLKB 4GHTA 3HK3B 2D2DA 4ZHLU 2GKVE 3SUFA 5C2ZA 1AFQC 1MBQA 5C5OA 2HNTE 1FXYA 2SFAA 1MTNB 1GHZA 1O3BA 1MTSA 5E0GA 2BD5A 1FY4A 1BMNH 3MWIU 1GWAA 2IN2A 1M9UA 2G52A 1EAIA 1YBWA 4XFQA 1TA2A 1RXPA 4IC6A 2P3TB 1BMAA 1MCTA 4OS7A 3SU3A 1O3IA 1C2FA 1A3EH 3W95A 1P9UA 3M37A 3C27B 2SNWA 4X2XA 3RDZA 4I8KA 3BG8A 5C20A 4INHA 4IMZA 4YLQH 5LPFA 1GVKB 1TPAE 3KCGH 1T8OA 4X8VH 1FIZA 1GI9B 1EAWA 4NIXA 1W11U 4Q7YA 4KTUA 4FUBA 1LHFH 1SR5C 1TX6A 4TPIZ 2AYWA 4KKDA 3BTQE 3G01A 3ODFA 4WWYA 5LH8A 3LDXH 1G30B 1HJ9A 1YPMH 3SV8A 1HNEE 4BTTB 1DWEH 3GY6A 2XCNA 1O2UA 1EPTC 1AWHB 1LPZB 2PFEA 4NSYA 2BDYA 2EI8A 2O8MA 4FVBA 1AGJA 2YNAA 2V6NA 4K3JA 1LO6A 1AZ8A 1EAXA 1V3XA 2P59A 4ABIA 1FNIA 1O2YA 1MAYA 1C1TA 5TJXA 1W10U 1P8VC 1BHXF 1MD8A 2BDIA 5EG4A 1HJ8A 1TPSA 3SZNA 5DP8A 1UCYH 4KTCA 1LDTT 1OXGA 5F8XA 1GJDB 4OS1A 3RXDA 2WPKS 2CHAB 3K9XB 3M35A 3S9AA 1LHEH 4K8BA 2HNTF 4Y79A 1GPZA 2GZ8A 3HGPA 3GY5A 2OTVA 2FP7B 4NIWA 3MH4A 4AG2A 5E0JA 4TY7A 2XYAA 5H4IB 1KTSB 1PPFE 1WSSH 2Z3CA 2UUKB 1BQYA 5C3NA 2BYAX 1Q31A 1G3EA 4OS5A 1EX3A 2ZC9H 3ZV8A 1TA6A 4ABEA 1NY22 1FPHH 2OP9A 3SORA 2NU2E 1HAVB 1SOTA 5T3HA 3M3SA 3HATH 1DICA 5FAHA 5JBTA 1LMWB 1GGDC 1G2MA 1NTPA 1EP6A 5T6FA 3P8OA 4FXGH 1NRPH 3TJNA 2ZCKP 3STJA 1YLCA 1EJMA 2FI4E 3GICB 4DW2U 1O2MA 5L2ZH 5JBAS 4X8SH 3BTDE 3BG4C 3RLWH 1A1RA 1B7XB 1UVPA 5HYOA 3KHVA 1T8NA 1SBWA 3LJJA 1JOUB 1FN8A 2I6QA 4J1YA 1K21H 4OGYA 5FHTA 3SGAE 1F7ZA 3VB5A 3SHAH 4DT7B 4XDEA 3TJUA 3QLPH 3BSQA 1HAGE 2XC5A 1C5WB 1A5HA 1BITA 1GL1A 3M7TA 1NU9A 4Q2KA 3A7VA 2A32A 2H5CA 2J94A 3EGKH 3UTUH 1C5VA 1VCQA 2Y5HA 1HAZB 4YZUA 1P10A 5T6DA 1C2KA 4AGJA 3GDUA 1AE5A 1H4WA 5EODA 1DS2E 2AMPA 3LONA 1UTMA 2FTMA 5EW1H 1GHAF 2UWPA 8GCHF 1FY1A 1TIOA 3PYHA 3UOUA 1BTYA 1TNHA 1OWHA 2H1UA 1IAUA 1F0SA 2O8TA 5F03A 5L2YH 1ESAA 1BTWA 1G32B 1LCYA 4CBNA 1GHBG 3BTFE 1JIRA 4AYYB 1VITH 3A87A 2G5NA 1LHCH 3VB7A 5K7RA 1O2HA 4MLFB 3LGWA 4XE4A 4E06H 4INKA 1HFDA 1ORFA 2F9UA 1K1LA 2QIQA 1L0ZA 1ELEE 3V13A 4CRBA 1P2MA 1H8DH 1V2ST 2BXTH 3GCTG 8KME2 1J8AA 2Z9IA 3HGNA 2WPLS 1HAIH 2G51A 4ABBA 1GBJA 1YF4A 1MBMA 1C2GA 3ZZ9A 3RC4A 2A1DB 1O5BB 1AVWA 3ELAH 1C1OA 1GMDF 1C5LH 3RXTA 3SJKA 2HVXA 3RXHA 2AGIX 2VWLA 5C1XA 3ZZ3A 5GDSH 1OX1A 3A7YA 2SGAA 1HIAA 4CH8B 4TPYA 5J4QA 2C3SA 1GBMA 1A0HB 5C67A 2HOBA 1LPKB 2VJ1A 2RDLA 2ULLA 4Y11E 2Z9KA 2HLCA 1GBDA 1Z71A 3ENSB 3ZVEA 1PQ8A 2YOLA 1FPCH 3Q3YA 2GMTB 2SGFE 4ZH8A 1GBFA 4JMYA 3UNSA 3K65B 4UE7H 1DWBH 2VIDA 1KDQA 1C1WH 1HCGA 4WMEA 1O3OA 1CO7E 3LPRA 1BRUP 2ALPA 1AZZA 3DD2H 2VGCC 1Y3UA 2UUJB 3TJOA 5G4BA 4H4FA 4I33A 5I46H 2GCTC 1P2QA 1VGCB 1P2KA 3RC5A 3SU4A 4VGCC 3LJOA 3FFGA 1H1BA 1YPLH 1GCTC 4ESTE 1CGIE 3A85A 2TGAA 1WUNH 5DJ7A 2ZO3H 3E0NB 1EKBB 1TRYA 4NGAH 3RXEA 2ZDKA 4LK4A 1O2IA 1W14U 2ZTYA 5A8YA 4GAWA 1S5SA 3VGCB 3N7OA 1SGIB 2C90B 2VH0A 2ZI2H 1UVUH 1QRWA 1DITH 1MH0A 1YPEH 1N1LA 1E36B 2Y5FA 4K1SA 2AIQA 3HK6B 1IQMA 2Z94A 1IQIA 1SGCA 3F1SB 3Q3XA 5EQRA 3JZ1B 2QXHA 4GPGA 2D8WA 1NS3A 1BTUA 1KXCA 1ZPBA 3TNTA 1RIWC 2OCVB 1T32A 1GBCA 1IHSH 2STBE 2AERH 2GD4B 3DFLA 1TNIA 2Z9JA 3DT0H 4X6NA 4JZDH 1J14A 1NU7B 1F5LA 1P09A 3K6YA 2CV3A 2VIPA 3IG6B 1LQEA 4GSOA 2FYQA 2WPMS 3P8NA 1LVMA 1PQ5A 2A4GA 1P11E 4A92A 1GHXH 1LVBA 1MQ6A 2OQUA 2Z7FE 1C5YB 2WYJA 1K1IA 1PPCE 4KGAA 1K1PA 1HBTH 1Z6JH 2FDAA 1GI7B 1O30A 1CA8B 1J16A 4X6MA 4AORA 4HZHA 3H5CB 1SGQE 3K2UA 1KLTA 4UDWH 1QGFA 4MPXA 4YESB 2BM2A 2CMYA 4X1PU 2ALVA 4R0IA 6GCHF 1AUJA 1AIXH 3LC3A 1O5GH 1EPTB 4B2AA 3MNXA 1LHGH 1O2TA 1CHOF 3KQCA 2AFQB 1A46H 1GI0A 1MTWA 4A6LA 2BY9X 1QHRB 1AKSB 5TCCA 1C9TA 3A88A 3TITA 1BBRE 3SV6A 1D4PB 1WQVH 1AY6H 1C2IA 3FANA 1SVPA 1QRZA 1UTPA 1S0RA 1RTKA 1ELBA 1SHYA 3KF2A 1HAVA 1ELDE 3NUMA 4U2WA 2G55A 3SN8A 1YPHC 1AUTC 4Y0ZE 1C5QA 1HAXB 5C5NA 2J92A 4ISNA 1OYTH 1QIXB 1HXEH 1O5CB 1PPZA 3ZYDA 3IWMA 4YTAA 3O8BA 1UVSH 2G5VA 2OC8A 4SGBE 1MD7A 2B7DH 3D49H 1PPEE 4TWYA 3MO6A 2P3UB 3UREA 1C1UH 5EXMA 1RTFB 2AS9A 2ZHWH 3TPIZ 3RXRA 1GGDB 1RTLA 1SHHB 1XUGA 4LOYH 5ESBA 3TH2H 3OYPA 1TBZH 2TGDA 1CGHA 2RG3A 3ZZ8A 3UIRA 4BXSA 4ISOA 1UTJA 3GY2A 3BG4B 1G37A 2A7HA 4INLA 1ESTA 2ZPSA 2FEQH 2SGPE 2QXGA 1P9SA 1Y3VA 2AGEX 1UTLM 4FUIA 1UTQA 1CA0C 4WH6A 4ISIH 3RXFA 2BLOA 2Q6DA 4UFEH 3VPKA 4LXBH 4AFZA 2G81E 3EE0B 3PLBA 4AB8A 3AAVA 3E91A 1SGEE 1DY8A 3EA9A 1AO5A 2GT7A 2A4RA 2XBYA 1YCPM 2AMDA 1HUTH 1Q2WA 1SGFA 1SLUB 3B8JA 3ZZ7A 1SGPE 2P95A 2QCYA 2R2MB 5AFZH 3ZYEA 4IBLH 2ZU4A 1O3MA 1N6XA 3SJ9A 5EPYA 1TAWA 1BTHH 2TGPZ 2THFB 1TGNA 4I8GA 1GBIA 2HRVA 2BOHB 5C1YA 5PTPA 1TLDA 1FMGA 1A4WH 2VB0A 5DGJA 4CRCA 1ZHMA 5EOKA 2NU3E 3KNXA 4CH2B 1O2SA 4YOIA 2JETC 4CRDA 2BD9A 3OU0A 4O3UA 1OWKA 4Q7XA 4AFSA 3UNRA 2VIVA 5HM2A 3I77A 4JZFH 3SV9A 1J15A 1XUKA 3BIVH 1TGSZ 2RA3A 4AFUA 1O5FH 1O3LA 3RM2H 2YNBA 3U9AH 1V2MT 1HXFH 1ZSLA 4FU8A 1K9OE 2Z6BD 4AGKA 1H9IE 1GVLA 2QY0B 1BRBE 2ILNA 3LC5A 2VVCA 3P8GA 3TGKE 2A45B 3P6ZB 3BF6H 1K1OA 3T27A 3MNCA 3ODDA 2VWMA 5DP3A 2R9PA 4O03A 1XKBC 2EI6A 3EAJA 1GCDA 3RXKA 1Z1JA 3GCOA 1UHBB 4Z0KA 3RP2A 2FXRA 3URDA 3PMAB 1TWXB 8LPRA 5FX5A 1F0TA 4YLUA 3VB4A 2Y7XA 3QGNB 1SLXB 3PMJA 3NXPA 1Q3XA 1ETRH 1B5GH 1O37A 2ZGBH 1LPGB 3DA9B 5CHAC 2GV6A 2P8OC 3E8LA 1O3JA 2Y82A 4UFGH 1QB9A 1YPGH 2AGGX 2OUAA 1ZTJA 2NWNA 2ZGJA 3TK5A 1TYNA 3F9EA 4FVDA 2BXUH 1NZQH 1BTZA 1QA7A 2ANKH 2ZA5A 2VGCB 1D6WA 2ZU1A 4RKOB 2XWBI 2BDGA 1ANEA 3MH5A 2GCTB 1AFEH 3PMHB 4YO9A 4VGCB 4KTSA 1O5DH 2F9BH 1JRTA 5DP9A 4CHAC 4DJZB 1GCTB 2SNVA 4XBBA 2CN0H 2FODA 1JRSA 3UPEA 3SOSA 3SU6A 1GJ4H 2ZFSA 1FQ3A 4TY6A 4A5TS 1BB0B 1C4Y2 1H9LB 2HNTC 2FOFA 3A7XA 5AFYH 3SUGA 1D3QB 3QWCH 1T31A 3SBKA 1SGDE 1KXEA 3BIUH 3A7WA 1QCPA 3PM3A 1QL8A 3SU1A 4F4OC 2Y6TA 3FZZA 3RXMA 1N6YA 2UUFB 2WUCA 1GBBA 1E0FD 1E34B 2QGRA 3E0PB 1C5SA 2ZFRH 1T4UH 2J34A 1NPMA 2VNTA 3SNCA 3EDXB 4JZIA 5DPAA 2PLXA 4JYVH 1CT4E 1CU1A 4MDSA 3URCA 4WY3A 2PHBA 5J4SA 1EQ9A 1EAUA 4BAMB 3BTHE 1Z8GA 1BTPA 1EPTA 3GY8A 5L6NH 1LVOA 1O2PA 1O2WA 2O9QA 2JKHA 3M5NA 2WPJS 1V6DA 2XBVA 4M7GA 1EASA 5BRRE 3PLKA 1S0QA 1NM6A 3P92A 5AF9H 1THPB 2ZQ1A 4X2VA 5IYTA 5C1UA 2FTLE 3U1JB 1HAYB 1C4U2 3F6UH 1QTFA 1GJCB 1ZSKA 2OC1A 5A0AE 2G4UA 1C5TA 1SQTA 5HM9A 2BDBA 1O2RA 1O3KA 3KGPA 2TBSA 2W26A 1QQUA 2FO9A 3MTYA 5E8EH 1Z8IB 1G2LA 1O2XA 3M5LA 1U6QA 4WH8A 1Y5BT 3UFAA 1FUJA 3H7TA 3UR9A 1PPGE 1QBNA 4XBDA 3RMOH 4ABAA 1UK4A 1TNJA 3SNEA 2TGTA 4Y7AA 2XBXA 4BTUB 2GCHF 1VITF 3AAUA 1MU8B 2PWXA 4X8TH 4BOHA 1O0DH 1BCUH 1ETSH 1SSXA 3A84A 2JH5D 1ZPZA 1GI6A 3E16B 3NKKA 3GCHB 2W3IA 3A82A 5K0HA 6LPRA 5ETXA 1GHAG 1N8OC 1V2TT 8GCHG 1ELGA 2A4QA 4Y0YE 1QURH 1C2DA 3SNDA 4A7IB 3FP7E 2O8UA 4MTBA 5GXPA 1W8BH 1W2KH 4D9RA 1C4V2 6CHAC 4DOQA 5DO4H 1C5MD 3RU4T 1OWJA 1HYLA 3TH3H 1THRH 1TOCB 5A09A 1L2EA 2AEIH 3RXJA 2JH0D 3P95A 3MNSA 2BY7X 1SFIA 1C2LA 1YP9A 3DHKH 5AVDA 4DGJA 1F2SE 1W0YH 1OWEA 2LPRA 3I78A 3KL6A 1V2UT 1ZGVA 3MH6A 3NWUA 4KELA 4TYDA 1BBRK 2UUYA 3PWCA 2BD8A 1DX5M 3IITA 3A83A 2BX4A 4IMQA 2C8ZB 1BMLA 4JK6A 2ZFTA 1QFKH 2ZZUH 3T25A 1EATA 5A0BA 3CS7A 2ODQA 4NIVA 1GMDG 1O2NA 1LTOA 1QNJA 1Z6EA 3A7TA 5FPYA 1DDJA 5JYIA 1KLJH 1O31A 3S9CA 1O32A 1CA0B 3VXFH 1ARCA 3TGJE 3SU0A 2BY5X 1C5NH 4MPVA 1BMMH 1FDPA 1SQOA 1TABE 2A0QB 3QN7A 1YPJH 4D8NA 3MOCA 2FMJA 3RXBA 4MG3A 2BB4A 2GV7A 9ESTA 1SI5H 2UWLA 2QXJA 4FUGA 1ABJH 5A2MH 5A8ZA 4YOJA 1F5RA 1NRRH 2H9EH 3A8CA 4JZ1A 1EZUC 1LHDH 4AN7A 2F83A 2ZPRA 1TNKA 4IS5A 4MPUA 3EA7A 1XMNB 3MH7A 3W94A 1D9IA 2F9PA 4HGCA 5IDKA 3C1KA 2PR3A 4WMFA 4Y71A 3A89A 3RUOA 1TBQH 1MCVA 1Y3WA 1J9CH 1ZGIA 4I8HA 3P70B 1EB1H 1A7SA 5GCHF 4GUXA 2GTBA 1IQJA 3PWBA 2FPZA 2ZFPH 3A8BA 3SNBA 4CR5A 2NU4E 3ZVBA 1OKXA 3ZVDA 5ABWA 2VWNA 3CP7A 3V0XA 4ZKSU 1GBAA 3U8RH 4CR9A 4Y76A 4UFFH 2JETB 1DANH 4YOGA 1A0JA 1OWIA 2BY8X 5DP7A 4ABFA 1UHBA 1ZJDA 1NFXA 5JBBS 2VINA 1A0LA 4B74A 1SOZA 1T7CA 2G8TA 4K1TA 3RXLA 3Q76A 4JZEH 1GVZA 1YCPH 4NZQA 5E2OA 3M36A 4U01A 1C2JA 1O3EA 1ZYOA 2Y7ZA 1K1JA 3PMBB 2BZ6H 3GY7A 4NG9H 5EU8A 3MFJA 1GL0E 3TGIE 4B2CA 7KMEH 3QUMP 5FCRA 1WTHD 2G4TA 1LKAA 4D7GA 1L1JA 1XXFA 3ZZBA 2EA3A 1KYNA 3RXVA 1L1GA 1QJ1B 1W0ZU 3F68H 4Q7ZA 3K6ZA 1AFQB 3S9BA 3RXCA 4LZ1H 1A5IA 2F9VA 4WMDA 3CS0A 4WJG2 5L30H 2C93B 2XBWA 4HFPB 4FUFA 1TFXA 3LT3A 1ELCA 2OD3B 3T29A 5CHAB 2ZP0H 4ASHA 3O8RA 1Y5UT 3KQEA 3GOVB 2FOHA 1NT1A 2QYIA 2BLVA 1XUFA 4K8YA 3F9FA 3U69H 3EA8A 4FUHA 1NRSH 1RRKA 2VVUA 6GCHG 1E35B 1AHTH 1AD8H 2CHAC 4X1QU 1QJ6B 4FUDA 1DFPA 3NZIA 1CHOG 1L1NA 4CHAB 1QA0A 2ZU3A 1T8LA 2BD4A 3BTTE 4FU7A 4PROA 1VCWA 1BHXB 3NCLA 2PUQH 2ZHDA 1DM4B 1TQ7B 1Z1IA 2RA0A 2PTNA 2TIOA 3M7UA 1MTUA 4DURA 1YLDA 3UUZA 2ZCLP 4ABJA 1O38A 1OYQA 3T28A 2XTTB 2H2ZA 1YKTA 3PB1E 1S85A 2FX4A 1EB2A 2H9TH 2J9NA 2H6MA 2PGQB 3VB3A 1O39A 3GYLB 4MNWA 1CGJE 1GDUA 3E3TA 1ELTA 3SI3H 1BJUA 1PPBH 3B23B 2ZDLA 5EQSA 3ZZ4A 1G9IE 4X6PA 1JMOH 2VIWA 1DSTA 3E90B 3RXPA 5F6MA 2J38A 3MU8A 3AVZA 1QL9A 1T4VH 2V3OH 5CMXH 1UVOA 2ZDAH 1HDTH 1C5ZB 1NN6A 1C5OH 1O34A 1NO9H 2NU1E 5DP6A 1P2OA 1O3FA 3QTOH 4X2YA 3ZVCA 2ZEBA 1QJ7B 1GBKA 2R3UA 1RJXB 1EJNA 3UNQA 4H6TA 5EPNA 2FS9A 3SW2B 4X1RU 4H42U 4NA8A 2GT8A 2WV4A 4DIIH 1E37B 1EUFA 4ISLA 2GVFA 3B9FH 2Q1JA 1SB1H 1VR1H 2PW8H 3V3MA 1Y5AT 1O3NA 3MYWA 3ZVFA 1TX8A 1PQ7A 4BAQB 4DCDA 4WXVA 1TOMH 1IOEA 2ZHFH 2XC0A 4BNRA 2H9HA 2CGAA 1JBUH 2O8WA 2VIQA 4X1NU 1ANCA 3LH1A 1PYTD 1ZMLA 1Y8TA 3RXOA 3PTBA 3P8FA 1EOJA 4Y8ZA 1WTGH 1S81A 4ABGA 1AN1E 1THSH 3KEEA 3RLYH 3TJVA 3M3TA 1F0UA 1Z7KA 2QN5T 4Q80A 2F9OA 5JB9S 3DFJA 4GVUA 1ZMJA 1TGCA 3CENA 4X8UH 5FBIA 2ZNKH 1GMCF 1GBLA 3KIDU 1GI3A 1DWCH 1AMHA 1C1RA 2VVVA 1C5XB 1V2VT 1QB1A 2CXVA 3I29A 3MI4A 2VU8E 2ZDVH 3VEQB 2Y5GA 5T6GA 1KXAA 1P02A 3BTGE 4Y8YA 5JPMH 1EP5A 2C8WB 4KP0A 3BTEE 4JCNA 2Q6GA 3V12A 1P57B 5FBEA 3QK1A 1O2QA 2XXLA 2A7JA 2GP9B 2OC7A 4BAOB 4NFEA 3UR6A 4FU9A 1YCPK 1TQ0B 2BY6X 1XM1A 2HWLB 2PUXB 1V2JT 1HAOH 1GJ9B 2WPHS 1KXDA 1UCYE 1OOKB 5EGMA 2BVRH 3SQEE 4HTCH 1IQGA 1ZSJA 2PTCE 1S6HA 3UQOA 2ZGHA 3BN9A 1SGNE 2PKAB 2XC4A 2J4IA 2HALA 3M7QA 1RS0A 1P2JA 1ZTKA 1FN6A 1PFXC 2DE8A 4DG4A 2VWOA 1GBHA 5ESTE 3ZVGA 3LGIA 3ZZDA 2ZU2A 2D26C 1C2MA 4RSPA 1AB9C 1KXFA 2BQ6B 3UWIA 3T26A 2BLWA 3ESTA 3QX5H 4O3TA 2ZECA 1WOFA 2P3FH 1B0EA 2OBOA 3MO3A 1O2KA 1ZZZA 1ELFA 1SLVB 1O2VA 1SL3A 5BPEA 3QO6A 1F0RA 4ZHMU 2FOAA 3TVJB 5CE1A 1X7AC 3LGTA 4OS6A 1QQ4A 1S6FA 1WYKA 4U32A 1BUIA 1G3BA 2Y81A 2ZFFH 3UWJH 1K22H 1FZZA 2GGVB 1CBWC 2K1QA 4QT8C 4BAHB 5GPIB 1BBRH 1HAPH 1O35A 4UEHH 4X6OA 3MMGA 4B76A 1V2OT 1XUHA 2ZGXH 1FAXA 3QZQA 3FAOA 3SJOA 5DG6A 3P17H 3QTVH 2D1JA 2Z3EA 3D62A 3QDZB 1ELAA 1ZMNA 2BDAA 3RXAA 3GCNA 2F91A 1FIWA 3TLOA 2G00A 4K2YA 4K60A 1GHVH 2OINA 3TNSA 4IN2A 1DPOA 3U8OH 1O3CA 3RXSA 1JXPA 5DP4A 2H5DA 3GDSA 1ZJKA 4FUCA 4R8TB 2QF3A 3S7KB 2SGEE 4WF8A 1BA8B 3U8TH 4NWLA 1QR3E 4ZHAA 4B71A 1TNLA 4OGXA 1DOJA 2P94A 1D6RA 1FAKH 2A7CA 3SQHE 1LKBA 1MKWH 5EW2H 1O33A 1A5GH 2ODYB 3KN2A 2JH6D 3NK8A 1P01A 3OY5U 1FLEE 9LPRA 1VCPA 3BEIB 3BTWE 2BOKA 5E0HA 1TPPA 1OWDA 2OXSA 4NCYA 5HMAA 2UWOA 4ZXXH 3PO1C 1QBVH 3F9GA 1AU8A 5JDUB 4AFQA 4GCHG 5EQQA 2BZAA 5I25A 3S69A 4DY7B 3HKIB 1TMTH 2GDEH 3D23A 2HPQH 4I8JA 1XXDA 3RU4D 1UMAH 1CSOE 2WYGA 4WXIA 7LPRA 3ATLA 3M3VA 1GI2A 1F92A 1DVAH 1C1QA 4ABHA 1DLEA 5JB8S 1H9HE 1TRMA 1W3CA 1V2KT 1EZQA 3F9HA 1A2CH 4GCHF 1AQ7A 1WQSA 1RIWB 3BTME 2ZF0H 4UONA 1TGTA 4XBCA 3S0NA 1O5EH 3STIA 2ANWA 2ANMH 3MU5A 1C1SA 3V7TA 1GBEA 1GI1A 2Q6FA 3SI4H 1MAXA 1UJ1A 3A8AA 4E7NA 3LU9B 1NESE 2QF0A 2OLGA 2QA9E 5GIBA 2XNIA 4ISHH 3RXQA 3ATMA 1XUJA 1S84A 1AKSA 1BDAA 4NWKA 1C1VH 1ZR0A 1AVXA 5LPRA 1FV9A 3SV7A 3EYDA 1ETTH 1CQQA 2OBQA 2GCHG 1VITG 2ZDNA 2PKSC 4X1SU 5DK1A 5TCAA 1O2JA 2WINI 4D9QA 3GYMA 2VIOA 1RD3B 3ATKA 3ZVAA 1A61H 3RXGA 1K1NA 4NA9H 3H7OA 2PV9B 2RCEA 4OS2A 2LNCA 3SUEA 3GISB 1UO6A 2GX4A 2ZPQA 3MHWU 4D7FA 1V2NT 2BLQA 5AHGH 4YM9A 1OSSA 1PPHE 3KQDA 3O8DA 4YT6H 2BD7A 1P3CA 1Y3XA 3A80A 5JBCS 1ELVA 1C5UA 1QBOA 1C5PA 1OPHB 2W3KA 4E05H 4AB9A 1HJAC 1GJBB 3QGJA 1KLIH 1NFYA 2ANYA 2XRCA 4XSKU 2ZCHP 1Y3YA 1NROH 4I7YH 2ZIQH 5F8ZA 3M5MA 3RM0H 3ZZ6A 3AW0A 3U1IB 2BDHA 1DWDH 3RXIA 1IQLA 1ZPCA 5HGGA 2R3YA 3LGYA 4AYVB 2QAAA 3MU4A 3VB6A 4B2BA 4Z6AH 2GDDA 1O3HA 1UTOA 1EZXC 1T8MA 1KTTB 1O3GA 3VXEH 2V35A 4CRFA 1EJAA 2FOEA 2FLBH 1HB0B 1GI8B 1V2RT 3A86A 3RMLH 1HLTH 1O2LA 1P2IA 4F49A 4A1VA 2ZHEH 4ZROA 3T62A 4BXWA 3Q77A 2ZG0H 5LPEA 1V2LT 1MMJN 1YYY1 1FONA 2IOTA 1GMHG 1DT2A 2KAIB 3SGQE 2FOMB 3R3GB 2ESTE 1SFQB 1C2HA 1BRAA 5GJ4B 1ZHRA 1TB6H 1GG6C 3O8CA 4I32A 1E38B 2P93A 3DUXH 1WBGB 3ZZCA 1O2GH 1TE0A 5A8XA 1BRCE 1TONA 4CREA 1GMHF 1ABIH 1NFWA 2B0FA 1GJ6A 1RFNA 1ZLRA 2WV5A 4RN6A 2P16A 2PKAA 3ZZ5A 2B9LA 1GHBF 3NPSA 5GCHG 1ZOMA 1SGRE 2M5TA 1KY9A 2A5IA 1W7XH 1MKWK 1Z8JB 3L6PA 4NA7A 3UOPA 1IHTH 5LGOA 3SV2H 2ZFQH 2ZTXA 1G3CA 1ACBE 2TRMA 3ATWA 4MNYA 2OQ5A 3OTJE 2XW9A 1V2WT 1GDNA 2FM2A 4DIHH 1V2QT 2QC2A 1MKXH 1P03A 2ZHQH 4AX9H 2FOBA 5F8TA 5EXLA 2ZWLH 4DVAU 2BTCE 1C9PA 2WUBA 2STAE 3GCTF 4MVNA 1GJ8B 3TK9A 1XX9A 3PROA 4YT7H 3RXUA 5EXNA 2ZU5A 1TALA 3RMNH 3SU2A 1CE5A 3JZ2B 3Q00A 2CJIA 2R0LA 1CHGA 2W7SA 4Y8XA 1LQDB 1MTNC 1K2I1 1OP0A 4ZXYH 1KIGH 4UD9H 1PJPA 1SG8B 4WVPE 3M61U 1C5RA 1Z8RA 7ESTE 2Z3DA 4MPWA 2B8OH 1AB9B 1BIOA 1MZDA 4ABDA 1BZXE 4BTIB 1CVWH 2BVXH 1P2NA 3OSYA 1FI8A 3LKWA 1SPJA 3PV4A 1HPGA 1W7GH 4H6SB 1PQAA 3AW1A 1JWTA 1UTKA 4ZKOU 1UCYK 1FY5A 4K1EA 1W12U 1KXBA 2Z9LA 5HXFA 1UK3A 1K28D 1PYTC 5SGAE 1CBWB 1O36A 4K5ZA 5A0CA 2BDCA 2BQWB 1JIMA 2SGDE 1TBRH 1L4ZA 1NRNH 2AMQA 4I8LA 3MU1A 1KSNA 3L33A 3QZRA 1P05A 2AH4X 1P3EA 2IPHA 2V0BA 2J2UA 1VJAU 1C1MA 2OC0A 4I31A 4X0WU 1IQEA 2ASUB 3SHCH 2P8OB 4U30A 4MNXA 4E7RG 2A5AA 1DE7H 2FI5E 3A81A 4XOJA 4ZMAH 1O2OA 3TIUA 1BTXA 2CF8H 1CT0E 4FUEA 1GI4A 4ZAEA 1QY6A 1HRTH 4CRGA 1BT7A 4X2WA 4AG1A 1WU1A 1TRNA 1SGYE 2B5TB 3FP8E 1SMFE 3LGVA 3SJIA 3LH3A 1WV7H 5FCKA 3OY6U 1DXPA 4A1XA 1BOQA 2HGTH 2I6SA 4IGDA 2O8LA 3LOXA 2WPIS 5FXLA 1ANBA 3PO1B 3ITIA 1C1PA 5FX6A 2A31A 1ID5H 2BMGB 1YPHE 3KQBA 3L3TA 2R2WU 3A8DA 1Y59T 5FPTA 5GWZA 1EOLA 3U98H 1AE8H 4JK5A 3T2NA 1ZRBA 1EZSC 1C1NA 3MO9A 2FS8A 2ZQ2A 3RC6A 1IQKA 1FY8E 2BQ7B 1IQHA 2SGQE 2XCFA 2ZTZA 1S82A 2FIRH 3WY8A 4OS4A 3SGBE 1TMBH 4JYTA 1G3DA 2PSYA 4IC5A 4MQAA 2AIPA 2QV1A 4SGAE 1CT2E 2XWAA 1IQNA 3BEUA 3ZZAA 1ZTLA 1WCZA 2FYRA 1D3PB 3UY9A 2FZZA 3T5FH 1RGQA 4IN1A 1UK2A 2EEKA 1ZRKA 1G36A 3PLPA 1INCA 2R0KA 1GI5A 1K1MA 1L4DA 3E1XB 1FY3A 3GCHC 2C4FH 1ESBA 1QB6A 2W5EA 1SQAA 4MNVA 1UVTH 3GDVA 1HAHH 1D3TB 1DUAA 1OP2A 2GZ7A 4JYUH 4GHQA 5FPSA 1GHYH 2BD2A 4IW4E 1AI8H 3FVFB 1VZQH 1GBTA 3GY4A 3A7ZA 1XVMA
chains in the Genus database with same CATH superfamily
2PKSB 1GMCG 3BV9B 3RU4E 2ZGCA 2YMSC 3E6PH 2W7UA 1W13U 2IPQX 2QXIA 3AASA 2FOGA 3BTKE 1YGCH 1AWFH 1V2PT 1AVGH 1SQRA 2A2XH 1MKXK 4CBOA 3EQ0H 1C2EA 1YC0A 1ARBA 4B75A 1P04A 1E79D 1BJVA 1ZHPA 3LIWA 1OS8A 4BAKB 8ESTE 2IJOB 1D3DB 2EI7A 2PGBB 3BEFB 1MU6B 2Y80A 3D65E 2ZKSA 3TU7H 4B1TA 6ESTA 3VFEA 3FZDA 2JJ1D 1TNGA 1NRQH 3SJ8A 1O5AB 4TWWA 1N8OB 1K0HA 1SLWB 1HJAB 1TGBA 4NIYA 2FI3E 1HGTH 1GJ7B 5B6OA 3DSOA 1SGTA 1P06A 1SGFG 4THNH 1DSUA 2FWWA 1O3AA 3HKJB 1O3PB 6CHAB 4A1TA 2EY4C 1XVOA 4NFFA 1F5KU 3S7HB 2KAIA 2TPIZ 7GCHG 4ZKRU 1A3BH 3SUDA 3R0FA 4GLYA 2CF9H 3HPTB 1DXWA 1B0FA 4Y6DA 4ZUHA 2GZ9A 1TMUH 2BVSH 3TK6A 2Z9GA 3UQVA 3FP6E 1ANDA 3GY3A 3ZV9A 3SO3A 2A4OA 2BX3A 4O97A 1DUEA 2M2AA 1DY9A 7GCHF 1O3DA 1LVYA 4NSVA 1QL7A 2FOCA 2J95A 2FESH 1EXFA 4O9VA 3F0OA 3LGUA 3SNAA 5DP5A 4B73A 4Y10E 1FJSA 1MUEB 1XKAC 2GMTC 4Y7BA 3PTNA 1SC8U 2FX6A 1YPKH 5DKMA 1TX7A 1GJAB 1MZAA 1NC6A 5E2PA 1GHWH 1NFUA 4K69A 2F3CE 1UTNA 1MQ5A 2FLRH 1GG6B 1HIAB 1QRXA 2VH6A 4UFDH 1J17T 5T1VA 1S83A 1WDIA 2PSXA 1WAYB 4FUJA 1VGCC 2DUCA 1GJ5H 1MTVA 3MNBA 1TPOA 3Q3KA 2DE9A 3OX7U 4J2YB 4AZ2B 4BANB 5EIYA 4CRAA 2BHGA 2K0QA 2NU0E 2HPPH 3SU5A 3RMMH 2F9NA 2A2QH 4D76A 1O2ZA 4HI3A 4RKJB 1YM0A 2ZDMA 2V3HH 3MU0A 3ATIA 2ODPA 3VGCC 3TH4H 4NZLA 1KDQB 3M5OA 1P0SH 4AOQA 2C8XB 2A5KA 1IQFA 2BD3A 2IJD1 4ZKNU 1HV7A 2C8YB 1GDQA 1VJ9U 4LZ4B 2EQNA 1XUIA 1H8IH 1OP8A 1P12E 2EC9H 1DLKB 4GHTA 3HK3B 2D2DA 4ZHLU 2GKVE 3SUFA 2CK3D 5C2ZA 1AFQC 1MBQA 5C5OA 2HNTE 1FXYA 2SFAA 1MTNB 1GHZA 1O3BA 3FKSD 1QZ8A 1MTSA 5E0GA 2BD5A 1FY4A 1BMNH 3MWIU 1GWAA 2IN2A 1M9UA 2G52A 1EAIA 1YBWA 4XFQA 1TA2A 1RXPA 4IC6A 2P3TB 1BMAA 1MCTA 4OS7A 3SU3A 1O3IA 1C2FA 1A3EH 3W95A 1P9UA 3M37A 3C27B 2SNWA 4X2XA 3RDZA 4I8KA 3BG8A 5C20A 4DT4A 4INHA 4IMZA 4YLQH 5LPFA 1GVKB 3WW7A 1TPAE 3KCGH 1T8OA 4X8VH 1FIZA 1GI9B 1EAWA 4NIXA 1W11U 4Q7YA 4KTUA 4FUBA 1LHFH 1SR5C 1TX6A 4TPIZ 2AYWA 4KKDA 2GJGA 5KECA 3BTQE 1COWD 3G01A 3ODFA 4WWYA 5LH8A 3LDXH 1G30B 1HJ9A 1YPMH 3SV8A 1HNEE 4BTTB 1DWEH 3GY6A 2XCNA 1O2UA 1EPTC 1AWHB 1LPZB 2PFEA 4NSYA 2BDYA 2EI8A 2O8MA 4FVBA 1AGJA 2YNAA 2V6NA 5CDFE 4K3JA 1LO6A 1AZ8A 1EAXA 1V3XA 2P59A 4ABIA 1FNIA 1O2YA 1MAYA 1C1TA 5TJXA 1W10U 1P8VC 1BHXF 4TSFD 1MD8A 2BDIA 5EG4A 2OK5A 1HJ8A 1TPSA 3SZNA 5DP8A 1UCYH 3OTPA 1LDTT 4KTCA 1OXGA 5F8XA 1GJDB 4OS1A 3RXDA 2WPKS 2CHAB 3K9XB 4Q4LA 3M35A 3S9AA 1LHEH 4K8BA 2HNTF 4Y79A 1GPZA 2GZ8A 3HGPA 3GY5A 2OTVA 2FP7B 4NIWA 3MH4A 4AG2A 5E0JA 4TY7A 2XYAA 5H4IB 1KTSB 1PPFE 1MABB 1WSSH 2Z3CA 2UUKB 1BQYA 5C3NA 2BYAX 1Q31A 3UB0A 1G3EA 4OS5A 1EX3A 2ZC9H 3ZV8A 1TA6A 4ABEA 1NY22 1FPHH 2OP9A 3SORA 2NU2E 1HAVB 1SOTA 5T3HA 3M3SA 3HATH 1DICA 5FAHA 5JBTA 1LMWB 1GGDC 1G2MA 1NTPA 4B6FA 1EP6A 5T6FA 3P8OA 4FXGH 1NRPH 4HG6A 3TJNA 2ZCKP 3STJA 1YLCA 1EJMA 2FI4E 3GICB 4DW2U 1O2MA 5L2ZH 5JBAS 4X8SH 3BTDE 3BG4C 3PV5A 3RLWH 1A1RA 1B7XB 1UVPA 5HYOA 3KHVA 1T8NA 1SBWA 3LJJA 1JOUB 1FN8A 2I6QA 4J1YA 1K21H 4OGYA 5FHTA 3SGAE 1F7ZA 3VB5A 3SHAH 4DT7B 4XDEA 3TJUA 3QLPH 2K8IA 3BSQA 1HAGE 2XC5A 1C5WB 3OEED 1A5HA 1BITA 1GL1A 3M7TA 1NU9A 4Q2KA 1E1QD 3A7VA 2A32A 2H5CA 2J94A 3EGKH 3UTUH 1C5VA 1VCQA 2Y5HA 1HAZB 1E1RD 4YZUA 1P10A 5T6DA 1C2KA 4AGJA 3GDUA 1AE5A 1H4WA 5EODA 2YMSB 1DS2E 2AMPA 3LONA 1UTMA 2FTMA 5EW1H 1GHAF 2UWPA 8GCHF 1FY1A 1TIOA 3PYHA 3UOUA 1BTYA 1TNHA 1OWHA 2H1UA 1IAUA 1F0SA 2O8TA 5F03A 5L2YH 1ESAA 1BTWA 1G32B 1LCYA 4CBNA 1GHBG 2W6JD 3BTFE 1JIRA 4AYYB 1VITH 3A87A 2G5NA 1LHCH 3VB7A 5K7RA 1O2HA 4MLFB 3LGWA 4XE4A 4E06H 4INKA 1HFDA 4TT3D 1ORFA 2F9UA 1K1LA 2QIQA 1L0ZA 1ELEE 3V13A 4CRBA 1P2MA 1H8DH 1V2ST 2BXTH 3GCTG 5EJZA 8KME2 1J8AA 2Z9IA 3HGNA 2WPLS 1HAIH 2G51A 4ABBA 1GBJA 1YF4A 1MBMA 1C2GA 3ZZ9A 3RC4A 2A1DB 1O5BB 1AVWA 3ELAH 1C1OA 1GMDF 1C5LH 3RXTA 3SJKA 2HVXA 3RXHA 2AGIX 2VWLA 5C1XA 3ZZ3A 5GDSH 3FO8D 3PV2A 1OX1A 3A7YA 2SGAA 1HIAA 4CH8B 4TPYA 5J4QA 2C3SA 1GBMA 1A0HB 5C67A 2HOBA 1LPKB 2VJ1A 2RDLA 2ULLA 4Y11E 2Z9KA 2HLCA 1GBDA 1Z71A 3ENSB 3ZVEA 1PQ8A 2YOLA 1FPCH 3Q3YA 2GMTB 2SGFE 4ZH8A 1GBFA 4JMYA 3UNSA 3K65B 4UE7H 1DWBH 2LELA 2VIDA 1KDQA 1C1WH 1HCGA 4WMEA 1O3OA 1CO7E 3LPRA 1BRUP 2ALPA 1AZZA 3DD2H 2VGCC 1Y3UA 2UUJB 3TJOA 5G4BA 4H4FA 4I33A 5I46H 2GCTC 1P2QA 1VGCB 1P2KA 3RC5A 3SU4A 4VGCC 3LJOA 3FFGA 1H1BA 1YPLH 1WXRA 1GCTC 3KYGA 4ESTE 1CGIE 3A85A 2TGAA 1WUNH 5DJ7A 2ZO3H 3E0NB 1EKBB 1TRYA 4NGAH 3RXEA 5B6LA 2ZDKA 4LK4A 1O2IA 1W14U 2ZTYA 5A8YA 2VBCA 4GAWA 1S5SA 3VGCB 3N7OA 1SGIB 2C90B 2VH0A 2ZI2H 1UVUH 1QRWA 1DITH 1MH0A 1YPEH 1N1LA 1E36B 2Y5FA 4K1SA 2AIQA 3HK6B 1IQMA 2Z94A 1IQIA 1SGCA 3F1SB 3Q3XA 5EQRA 3JZ1B 2QXHA 4M9FA 4GPGA 2D8WA 2KZ4A 1NS3A 1BTUA 1KXCA 1ZPBA 3TNTA 1RIWC 2OCVB 1T32A 1GBCA 1IHSH 2STBE 2AERH 2GD4B 3DFLA 1TNIA 2Z9JA 3DT0H 4X6NA 4JZDH 1J14A 1BMFD 1NU7B 1F5LA 1P09A 3K6YA 3F2FA 2CV3A 2VIPA 3IG6B 1LQEA 4GSOA 2FYQA 2WPMS 3P8NA 1LVMA 1PQ5A 2A4GA 1P11E 4A92A 1GHXH 1LVBA 1MQ6A 2OQUA 2Z7FE 1C5YB 2WYJA 1K1IA 1PPCE 4KGAA 1K1PA 1HBTH 1Z6JH 2FDAA 1GI7B 1O30A 1CA8B 1J16A 3F3BA 4X6MA 4AORA 4HZHA 3H5CB 1SGQE 3K2UA 1KLTA 4UDWH 1QGFA 4MPXA 4YESB 2L6OA 2BM2A 2CMYA 4X1PU 2ALVA 4R0IA 6GCHF 1AUJA 1AIXH 3LC3A 1O5GH 1EPTB 4B2AA 3MNXA 1LHGH 1O2TA 1CHOF 3KQCA 2AFQB 1A46H 1GI0A 1MTWA 4A6LA 2BY9X 1QHRB 1AKSB 5TCCA 1C9TA 3VG8A 3A88A 3TITA 3KYFA 1BBRE 3SV6A 1D4PB 1WQVH 1AY6H 1C2IA 3FANA 1SVPA 1QRZA 1UTPA 1S0RA 1RTKA 1ELBA 1SHYA 3KF2A 1HAVA 1ELDE 3NUMA 4U2WA 2G55A 3SN8A 1YPHC 1AUTC 4Y0ZE 1C5QA 1HAXB 5C5NA 2J92A 2WSSD 4ISNA 1OYTH 1QIXB 1HXEH 1O5CB 1PPZA 3ZYDA 3IWMA 4YTAA 3O8BA 1UVSH 2G5VA 2OC8A 4SGBE 1MD7A 2B7DH 3D49H 1PPEE 4TWYA 3MO6A 2P3UB 3UREA 1C1UH 5EXMA 1RTFB 2AS9A 2ZHWH 3TPIZ 3RXRA 1GGDB 1RTLA 1SHHB 1XUGA 4LOYH 5ESBA 3TH2H 3OYPA 1TBZH 2TGDA 1CGHA 2RG3A 3ZZ8A 3UIRA 4BXSA 4ISOA 1UTJA 3GY2A 3BG4B 1G37A 2A7HA 4INLA 1ESTA 2ZPSA 2FEQH 2SGPE 2QXGA 1P9SA 1Y3VA 2AGEX 1UTLM 4FUIA 4ACBA 1UTQA 1CA0C 4RT1A 4WH6A 4ISIH 3RXFA 2BLOA 2Q6DA 4UFEH 3VPKA 4LXBH 1VKYA 4AFZA 4XRNA 2G81E 3EE0B 3PLBA 4AB8A 3AAVA 3E91A 1SGEE 1DY8A 3EA9A 1AO5A 2GT7A 2A4RA 2XBYA 1YCPM 2AMDA 1HUTH 1Q2WA 2XOKD 1SGFA 1SLUB 3B8JA 3ZZ7A 1SGPE 2P95A 2QCYA 2R2MB 5AFZH 3ZYEA 4IBLH 2ZU4A 1KMHB 1O3MA 1N6XA 3SJ9A 5EPYA 1TAWA 1BTHH 2TGPZ 2THFB 1TGNA 4I8GA 1GBIA 1SKYE 5DN6D 2HRVA 2BOHB 5C1YA 5PTPA 2JIZD 1TLDA 1FMGA 1A4WH 4AC9A 2VB0A 5DGJA 4CRCA 1ZHMA 5EOKA 2NU3E 3KNXA 4CH2B 1O2SA 4YOIA 2JETC 4CRDA 2BD9A 3OU0A 4O3UA 1OWKA 4Q7XA 4AFSA 3UNRA 2VIVA 5HM2A 3I77A 4JZFH 3SV9A 1J15A 1XUKA 3BIVH 1TGSZ 2RA3A 4AFUA 1O5FH 1O3LA 3RM2H 1H8HD 2YNBA 3U9AH 1V2MT 1HXFH 4XD7D 1ZSLA 4FU8A 1K9OE 2Z6BD 4AGKA 1H9IE 2JDID 1GVLA 2QY0B 1BRBE 2ILNA 3LC5A 2VVCA 3P8GA 3TGKE 2A45B 3P6ZB 3BF6H 1K1OA 3T27A 3MNCA 3ODDA 2VWMA 5DP3A 2R9PA 4O03A 1XKBC 2EI6A 3EAJA 1GCDA 3RXKA 1Z1JA 3GCOA 1UHBB 4Z0KA 3RP2A 2FXRA 3URDA 3PMAB 1TWXB 8LPRA 5FX5A 1F0TA 4YLUA 3VB4A 2Y7XA 3QGNB 3FOAA 1SLXB 3PMJA 3NXPA 1Q3XA 1ETRH 1B5GH 2YMSD 1O37A 2ZGBH 1LPGB 3DA9B 5CHAC 2GV6A 2P8OC 3E8LA 1O3JA 2Y82A 4UFGH 1QB9A 1YPGH 2AGGX 2OUAA 1ZTJA 2NWNA 2ZGJA 3TK5A 1TYNA 3F9EA 4FVDA 2BXUH 1NZQH 3OAAD 1BTZA 1QA7A 2ANKH 2ZA5A 2KFWA 2VGCB 1D6WA 2ZU1A 4RKOB 2XWBI 2BDGA 1ANEA 2QF5A 3MH5A 3N7EA 2GCTB 1AFEH 3PMHB 4YO9A 4VGCB 4KTSA 1O5DH 2F9BH 1JRTA 5DP9A 4CHAC 4DJZB 1GCTB 2SNVA 4XBBA 5F53A 2CN0H 2J5UA 2FODA 1JRSA 3UPEA 3F2HA 3SOSA 3SU6A 1GJ4H 2ZFSA 1FQ3A 4TY6A 4A5TS 1BB0B 2W6ID 1C4Y2 3OE7D 1H9LB 2HNTC 3DSGA 2FOFA 3A7XA 5AFYH 3SUGA 1D3QB 3QWCH 1T31A 3SBKA 1SGDE 1KXEA 3BIUH 3A7WA 1QCPA 3PM3A 1QL8A 3SU1A 4F4OC 2Y6TA 3FZZA 3RXMA 1N6YA 2UUFB 2WUCA 1GBBA 1E0FD 1E34B 2QGRA 3E0PB 1C5SA 2ZFRH 1T4UH 2J34A 1NPMA 2VNTA 3SNCA 3EDXB 4JZIA 5DPAA 2PLXA 4JYVH 1CT4E 1CU1A 4MDSA 3URCA 4WY3A 2PHBA 2QE7D 3FN8A 5J4SA 1EQ9A 1EAUA 4BAMB 3ZIAD 3BTHE 1Z8GA 1BTPA 1EPTA 3GY8A 5L6NH 1LVOA 1O2PA 1O2WA 2O9QA 2JKHA 3M5NA 2WPJS 2KX4A 1V6DA 3MQKC 2XBVA 4M7GA 1EASA 5BRRE 3PLKA 1S0QA 1NM6A 3GS9A 3P92A 5AF9H 1THPB 2ZQ1A 4X2VA 5IYTA 5C1UA 2FTLE 3U1JB 1HAYB 1C4U2 3F6UH 1QTFA 1GJCB 1ZSKA 2OC1A 5A0AE 2G4UA 1C5TA 1SQTA 5HM9A 2BDBA 1O2RA 1O3KA 3KGPA 2TBSA 2W26A 1QQUA 2FO9A 3MTYA 5E8EH 1Z8IB 1G2LA 1O2XA 3M5LA 1U6QA 4WH8A 1Y5BT 3UFAA 1FUJA 3H7TA 3UR9A 1PPGE 1QBNA 4XBDA 3RMOH 4ABAA 1UK4A 1TNJA 3SNEA 2TGTA 4Y7AA 2XBXA 4BTUB 2GCHF 1VITF 3AAUA 1MU8B 2PWXA 4X8TH 4BOHA 1O0DH 3CNRA 1BCUH 2F4LA 1YWUA 1ETSH 1SSXA 3A84A 2JH5D 1ZPZA 1GI6A 3E16B 3NKKA 3GCHB 2W3IA 3A82A 5K0HA 6LPRA 5ETXA 1GHAG 1N8OC 1V2TT 8GCHG 5C0UA 1ELGA 2A4QA 4Y0YE 1QURH 1C2DA 3SNDA 4A7IB 3FP7E 2O8UA 4MTBA 3DCLA 1W8BH 5CHBA 5GXPA 1W2KH 4D9RA 1C4V2 6CHAC 4DOQA 3OEHD 5DO4H 1C5MD 3RU4T 1OWJA 1HYLA 3TH3H 1THRH 1TOCB 5A09A 1L2EA 2AEIH 3RXJA 2JH0D 3P95A 3MNSA 2BY7X 1SFIA 1C2LA 1YP9A 3DHKH 5AVDA 4OM9A 4DGJA 1F2SE 1W0YH 4P00A 1OWEA 2LPRA 3I78A 3KL6A 1V2UT 1ZGVA 3NRLA 3MH6A 3NWUA 4KELA 4TYDA 1BBRK 2UUYA 3PWCA 2BD8A 1DX5M 3IITA 3A83A 2BX4A 4IMQA 2C8ZB 3H09A 1BMLA 4JK6A 2ZFTA 1QFKH 2ZZUH 3T25A 1EATA 5A0BA 3CS7A 2ODQA 4NIVA 1GMDG 1O2NA 1LTOA 1QNJA 1Z6EA 3A7TA 5FPYA 1DDJA 5JYIA 1KLJH 5FL7D 1O31A 3S9CA 1O32A 1CA0B 3VXFH 1ARCA 3TGJE 3SU0A 2BY5X 1C5NH 4MPVA 1BMMH 1FDPA 1SQOA 2AHME 1TABE 2A0QB 3SZEA 3QN7A 1YPJH 4D8NA 3MOCA 2FMJA 3RXBA 4MG3A 2BB4A 2GV7A 9ESTA 1SI5H 2UWLA 2QXJA 4FUGA 1ABJH 5A2MH 5A8ZA 4YOJA 1F5RA 1NRRH 2H9EH 3A8CA 4JZ1A 1EZUC 1LHDH 4AN7A 2F83A 2ZPRA 1TNKA 4IS5A 4MPUA 3EA7A 1XMNB 3MH7A 3W94A 1D9IA 2F9PA 4HGCA 5IDKA 3C1KA 2J97A 2PR3A 4WMFA 4Y71A 3A89A 3RUOA 1TBQH 1MCVA 1Y3WA 1J9CH 1ZGIA 4I8HA 3P70B 1EB1H 1A7SA 5GCHF 4GUXA 2GTBA 1IQJA 3PWBA 2FPZA 2ZFPH 3A8BA 3SNBA 4CR5A 2NU4E 3ZVBA 1OKXA 3ZVDA 5ABWA 2VWNA 3CP7A 3V0XA 4ZKSU 2WHXA 1GBAA 3U8RH 4CR9A 4Y76A 4UFFH 2JETB 1DANH 2LP6A 4YOGA 1A0JA 2KCOA 1OWIA 2BY8X 5DP7A 4ABFA 1UHBA 1ZJDA 1NFXA 5JBBS 2VINA 1A0LA 4B74A 1SOZA 1T7CA 2G8TA 4K1TA 3RXLA 3Q76A 4JZEH 1GVZA 1YCPH 4NZQA 5E2OA 3M36A 4U01A 1C2JA 1O3EA 1ZYOA 2Y7ZA 1K1JA 3PMBB 2BZ6H 3GY7A 4NG9H 5EU8A 3MFJA 1GL0E 3TGIE 4B2CA 7KMEH 3QUMP 5FCRA 1WTHD 2G4TA 1LKAA 4D7GA 1L1JA 1XXFA 3ZZBA 2EA3A 3N7DA 2RFKC 1KYNA 3RXVA 1L1GA 1QJ1B 1W0ZU 3F68H 4Q7ZA 3K6ZA 1AFQB 3S9BA 3RXCA 4LZ1H 1A5IA 2F9VA 2V3MA 4WMDA 3CS0A 4WJG2 5L30H 2C93B 2XBWA 4HFPB 4FUFA 1TFXA 3LT3A 1ELCA 2OD3B 3T29A 5CHAB 2ZP0H 4ASHA 3O8RA 1Y5UT 3KQEA 3GOVB 2FOHA 3KQ5A 1NT1A 2QYIA 5GNDA 2BLVA 1XUFA 4K8YA 3F9FA 3U69H 3EA8A 4FUHA 1NRSH 1RRKA 2VVUA 4FOUC 6GCHG 1E35B 3EE7A 3WWFA 1AHTH 1AD8H 2CHAC 4X1QU 3AK5A 1QJ6B 3F0PA 1DFPA 4FUDA 3U28C 3NZIA 1CHOG 1L1NA 4CHAB 1QA0A 2ZU3A 5EJ1A 1T8LA 2BD4A 3BTTE 4FU7A 4PROA 1VCWA 1BHXB 3NCLA 2PUQH 2ZHDA 1DM4B 1TQ7B 1Z1IA 2RA0A 2PTNA 2TIOA 3M7UA 1MTUA 4DURA 1YLDA 3UUZA 3DSPA 2ZCLP 4ABJA 1O38A 1OYQA 3T28A 2XTTB 2H2ZA 1YKTA 3PB1E 2WV9A 1S85A 2FX4A 1EB2A 2H9TH 2J9NA 2H6MA 2PGQB 3VB3A 4RT0A 1O39A 3GYLB 4MNWA 1CGJE 1GDUA 3E3TA 1ELTA 3SI3H 1BJUA 1PPBH 3B23B 2ZDLA 5EQSA 3ZZ4A 1G9IE 4X6PA 1JMOH 2VIWA 1DSTA 3E90B 3RXPA 5F6MA 2J38A 3MU8A 5DSFA 3AVZA 1QL9A 1T4VH 2V3OH 5CMXH 1UVOA 2ZDAH 1HDTH 1C5ZB 1NN6A 1C5OH 2V7QD 1O34A 1NO9H 2NU1E 5DP6A 1P2OA 1O3FA 3QTOH 4X2YA 3ZVCA 3F2GA 2ZEBA 1W0KD 1QJ7B 1GBKA 2R3UA 1RJXB 1EJNA 3UNQA 4H6TA 5EPNA 2FS9A 3SW2B 4X1RU 4H42U 4NA8A 2GT8A 2WV4A 4DIIH 1E37B 1EUFA 4ISLA 5IK2D 2GVFA 3B9FH 2Q1JA 1SB1H 1VR1H 2PW8H 3V3MA 1Y5AT 1O3NA 3MYWA 3ZVFA 1TX8A 1PQ7A 4BAQB 4DCDA 4WXVA 1TOMH 1IOEA 2ZHFH 2XC0A 4BNRA 2H9HA 2CGAA 1JBUH 2O8WA 2VIQA 4X1NU 1ANCA 3LH1A 1PYTD 1ZMLA 1Y8TA 3RXOA 3PTBA 3P8FA 1EOJA 4Y8ZA 1WTGH 1S81A 4ABGA 1AN1E 1THSH 3KEEA 3RLYH 3TJVA 3M3TA 1F0UA 1Z7KA 2QN5T 4Q80A 2F9OA 5JB9S 3DFJA 4GVUA 1ZMJA 1TGCA 3CENA 4X8UH 5FBIA 2ZNKH 1GMCF 1GBLA 3KIDU 1GI3A 1DWCH 1AMHA 1C1RA 2VVVA 1C5XB 1V2VT 1QB1A 2CXVA 3I29A 3MI4A 2VU8E 2ZDVH 3VEQB 2Y5GA 5T6GA 1KXAA 1P02A 3BTGE 4Y8YA 5JPMH 1EP5A 2C8WB 1YLNA 4KP0A 3BTEE 4JCNA 2Q6GA 3V12A 1P57B 5FBEA 3QK1A 1O2QA 2XXLA 2A7JA 2GP9B 2OC7A 4BAOB 4NFEA 3UR6A 4FU9A 1YCPK 1TQ0B 2BY6X 1XM1A 2HWLB 2PUXB 1V2JT 1HAOH 1GJ9B 1FX0B 2WPHS 1KXDA 4F55A 1UCYE 1OOKB 5EGMA 2BVRH 3SQEE 4HTCH 1IQGA 2KCYA 3PRBA 1YY3A 1ZSJA 2PTCE 1S6HA 3UQOA 2ZGHA 3BN9A 1SGNE 2PKAB 2XC4A 2J4IA 2HALA 3M7QA 1RS0A 1P2JA 1ZTKA 3N99A 5HIZA 1FN6A 1PFXC 2DE8A 4DG4A 2HLDD 2VWOA 1GBHA 5ESTE 3ZVGA 3LGIA 3ZZDA 2ZU2A 2D26C 1C2MA 4RSPA 1AB9C 1KXFA 2BQ6B 3UWIA 3T26A 2BLWA 3ESTA 3QX5H 4O3TA 2ZECA 1WOFA 2P3FH 1B0EA 2OBOA 3MO3A 1O2KA 1ZZZA 1ELFA 1SLVB 1O2VA 1SL3A 5BPEA 3QO6A 1F0RA 4ZHMU 2FOAA 3TVJB 5CE1A 1X7AC 3LGTA 4OS6A 1QQ4A 1S6FA 2WZQA 2PP6A 1WYKA 4U32A 1BUIA 1G3BA 2Y81A 2ZFFH 1EFRD 3UWJH 1K22H 1FZZA 2GGVB 1CBWC 2K1QA 1NBME 4QT8C 2L74A 4BAHB 5GPIB 1BBRH 1HAPH 1O35A 4UEHH 4X6OA 3MMGA 4B76A 1V2OT 1XUHA 2ZGXH 1FAXA 3QZQA 3FAOA 3SJOA 5DG6A 3P17H 3QTVH 2D1JA 2Z3EA 3D62A 3QDZB 4P02A 1ELAA 1ZMNA 2BDAA 3RXAA 3GCNA 2F91A 1S6LA 1FIWA 3TLOA 2G00A 4K2YA 4K60A 1GHVH 2OINA 3TNSA 4IN2A 1DPOA 3U8OH 1O3CA 2KCAA 3RXSA 1JXPA 5DP4A 2H5DA 3GDSA 1ZJKA 4FUCA 4R8TB 2QF3A 3S7KB 2SGEE 4WF8A 1BA8B 3U8TH 4NWLA 4Z1MD 1QR3E 4ZHAA 4B71A 2J98B 1H8ED 1TNLA 4OGXA 1DOJA 2P94A 1D6RA 1FAKH 2A7CA 3SQHE 1LKBA 1MKWH 5EW2H 1O33A 1A5GH 2ODYB 3KN2A 2JH6D 3NK8A 1P01A 3OY5U 1FLEE 9LPRA 1VCPA 3BEIB 3BTWE 2BOKA 5E0HA 1TPPA 1OWDA 2OXSA 4NCYA 5HMAA 2UWOA 4ZXXH 3PO1C 1QBVH 3F9GA 1AU8A 5JDUB 4AFQA 4GCHG 5EQQA 2BZAA 5I25A 3S69A 4DY7B 3HKIB 1TMTH 2GDEH 3D23A 2HPQH 2WPDD 4I8JA 1XXDA 3RU4D 1UMAH 1CSOE 2WYGA 4WXIA 7LPRA 3ATLA 3M3VA 1W0JD 1GI2A 1F92A 1DVAH 1C1QA 4ABHA 1DLEA 5JB8S 1H9HE 1TRMA 1W3CA 1V2KT 1EZQA 3F9HA 1A2CH 4GCHF 1AQ7A 1WQSA 1RIWB 3BTME 2ZF0H 4UONA 1TGTA 4XBCA 4F48B 3S0NA 1O5EH 3STIA 2ANWA 2ANMH 3MU5A 1C1SA 3V7TA 1GBEA 1GI1A 2Q6FA 3SI4H 1MAXA 1UJ1A 3A8AA 4E7NA 5C0TA 3LU9B 1NESE 2QF0A 2OLGA 2QA9E 5GIBA 2XNIA 4ISHH 3RXQA 3ATMA 1XUJA 1S84A 5KGOA 1AKSA 1BDAA 4NWKA 1C1VH 1ZR0A 5EJLA 5C17A 1AVXA 4Q63A 5LPRA 1FV9A 3SV7A 3EYDA 1ETTH 1CQQA 2OBQA 2GCHG 1VITG 2ZDNA 2PKSC 4X1SU 5DK1A 5TCAA 1O2JA 2WINI 2F43B 4D9QA 3GYMA 2VIOA 1RD3B 3ATKA 3ZVAA 1A61H 3RXGA 4ASUD 1K1NA 4NA9H 3H7OA 4YXWD 2PV9B 2RCEA 4OS2A 2LNCA 3SUEA 3GISB 1UO6A 2GX4A 2ZPQA 3MHWU 4D7FA 1V2NT 2BLQA 5AHGH 4YM9A 1OSSA 5HKKD 1PPHE 3KQDA 3O8DA 4YT6H 2BD7A 1P3CA 1Y3XA 2KCPA 3A80A 1ELVA 1C5UA 5JBCS 1QBOA 1C5PA 1OPHB 1UW7A 2W3KA 4E05H 4AB9A 1HJAC 1GJBB 3QGJA 1KLIH 1NFYA 2ANYA 2XRCA 4XSKU 2ZCHP 1Y3YA 1NROH 4I7YH 2ZIQH 5F8ZA 3M5MA 3RM0H 3ZZ6A 3AW0A 3U1IB 2BDHA 1DWDH 3RXIA 1IQLA 3WWBA 1ZPCA 5HGGA 2R3YA 3LGYA 4AYVB 2QAAA 1NBMD 3MU4A 3VB6A 4B2BA 4Z6AH 2GDDA 1O3HA 1UTOA 1EZXC 2HVYB 1T8MA 1KTTB 1O3GA 3VXEH 2V35A 4CRFA 1EJAA 2FOEA 2FLBH 1HB0B 1GI8B 1V2RT 3A86A 3RMLH 1HLTH 1O2LA 1P2IA 4F49A 4A1VA 2ZHEH 4ZROA 3T62A 4BXWA 3Q77A 2ZG0H 5LPEA 1V2LT 1MMJN 1YYY1 1FONA 2IOTA 1GMHG 1DT2A 2KAIB 3SGQE 2FOMB 3R3GB 2ESTE 2KR7A 1SFQB 1C2HA 1BRAA 5GJ4B 1ZHRA 1TB6H 1GG6C 3O8CA 4I32A 1E38B 2P93A 3DUXH 4FETA 1WBGB 3ZZCA 1O2GH 1TE0A 5A8XA 1BRCE 1TONA 4CREA 1GMHF 1ABIH 1NFWA 2B0FA 1GJ6A 1RFNA 1ZLRA 2WV5A 4RN6A 2P16A 1OHHD 2PKAA 3ZZ5A 3OFND 2B9LA 1GHBF 3NPSA 5GCHG 1ZOMA 1SGRE 2M5TA 1KY9A 2A5IA 1W7XH 1MKWK 1Z8JB 3L6PA 4NA7A 3UOPA 1IHTH 2RDEA 3SV2H 5LGOA 2ZFQH 2ZTXA 1G3CA 1ACBE 2TRMA 3ATWA 4MNYA 2OQ5A 3OTJE 2XW9A 1V2WT 1GDNA 2FM2A 4DIHH 1V2QT 2QC2A 1MKXH 1P03A 2ZHQH 4AX9H 2FOBA 5F8TA 5EXLA 2ZWLH 4DVAU 2BTCE 1C9PA 2WUBA 2STAE 3GCTF 4MVNA 1GJ8B 3TK9A 1XX9A 3PROA 4YT7H 3RXUA 5EXNA 2ZU5A 1TALA 3RMNH 3SU2A 1CE5A 3JZ2B 3Q00A 2CJIA 2R0LA 1CHGA 2W7SA 4B6EA 4Y8XA 1LQDB 1MTNC 1K2I1 1OP0A 4ZXYH 1KIGH 4UD9H 1PJPA 1SG8B 4WVPE 3M61U 1C5RA 1Z8RA 7ESTE 2Z3DA 4MPWA 2B8OH 1AB9B 1BIOA 1MZDA 4ABDA 1BZXE 4BTIB 1CVWH 2BVXH 1P2NA 3OSYA 1FI8A 3LKWA 1SPJA 3PV4A 1HPGA 1W7GH 4H6SB 1PQAA 3AW1A 1JWTA 1UTKA 5C94A 4ZKOU 1UCYK 1FY5A 4K1EA 1W12U 5HIYA 1KXBA 2Z9LA 5HXFA 1UK3A 1K28D 1PYTC 5SGAE 1CBWB 1O36A 4K5ZA 5A0CA 2BDCA 2BQWB 1JIMA 2J98A 2SGDE 1TBRH 1L4ZA 1NRNH 2AMQA 4I8LA 4RI0A 3MU1A 1KSNA 3L33A 3QZRA 1P05A 2AH4X 3UAIC 3PRDA 1P3EA 2IPHA 3W1EA 2V0BA 2J2UA 1VJAU 1C1MA 2OC0A 4I31A 4X0WU 1IQEA 2ASUB 3SHCH 2P8OB 4U30A 4MNXA 4E7RG 2A5AA 1DE7H 2FI5E 3A81A 4XOJA 4ZMAH 5KEDA 1O2OA 3TIUA 1BTXA 3SYJA 2CF8H 1CT0E 4FUEA 1GI4A 4ZAEA 1QY6A 1HRTH 4CRGA 1BT7A 4X2WA 4AG1A 1WU1A 1TRNA 1SGYE 2B5TB 3FP8E 1SMFE 3LGVA 3SJIA 3LH3A 1WV7H 5FCKA 3OY6U 1DXPA 4A1XA 1BOQA 2HGTH 2I6SA 4IGDA 2O8LA 3LOXA 2WPIS 5FXLA 1ANBA 3PO1B 3ITIA 1C1PA 5FX6A 2A31A 1ID5H 2BMGB 1YPHE 3KQBA 3L3TA 2R2WU 3A8DA 1Y59T 5FPTA 5GWZA 1EOLA 3U98H 1AE8H 4JK5A 3T2NA 1ZRBA 1EZSC 1C1NA 3MO9A 2FS8A 2ZQ2A 3RC6A 1IQKA 1FY8E 2BQ7B 1IQHA 2SGQE 2XCFA 2ZTZA 1S82A 2FIRH 3WY8A 4OS4A 3SGBE 1TMBH 4JYTA 1G3DA 2PSYA 4IC5A 4MQAA 2AIPA 2QV1A 4SGAE 1CT2E 2XWAA 1IQNA 3BEUA 4ACAA 3ZZAA 1ZTLA 1WCZA 2FYRA 1D3PB 3UY9A 2FZZA 3T5FH 1RGQA 4IN1A 1UK2A 2EEKA 1ZRKA 1G36A 3PLPA 1INCA 2R0KA 1GI5A 1K1MA 1L4DA 3E1XB 1FY3A 3GCHC 2C4FH 4I86A 1ESBA 1QB6A 2JJ2D 2W5EA 1SQAA 2QF4A 1UVTH 4MNVA 2KM0A 3GDVA 1HAHH 1D3TB 1DUAA 1OP2A 2GZ7A 4JYUH 4GHQA 5FPSA 1GHYH 2BD2A 4IW4E 1AI8H 2XNDD 3FVFB 1VZQH 4ZCNA 1GBTA 3GY4A 3A7ZA 1XVMA
chains in the Genus database with same CATH topology
2PKSB 1GMCG 3BV9B 3RU4E 2ZGCA 3E6PH 2W7UA 1W13U 2QXIA 3AASA 2FOGA 3BTKE 1YGCH 1AWFH 1V2PT 1AVGH 2A2XH 1MKXK 4CBOA 3EQ0H 1C2EA 1YC0A 1ARBA 4B75A 1P04A 1BJVA 1ZHPA 3LIWA 1OS8A 4BAKB 8ESTE 2IJOB 1D3DB 2EI7A 2PGBB 3BEFB 1MU6B 2Y80A 3D65E 2ZKSA 3TU7H 4B1TA 6ESTA 3VFEA 3FZDA 1TNGA 1NRQH 3SJ8A 1O5AB 4TWWA 1N8OB 1SLWB 1HJAB 1TGBA 4NIYA 2FI3E 1HGTH 1GJ7B 5B6OA 1SGTA 1P06A 1SGFG 4THNH 1DSUA 2FWWA 1O3AA 3HKJB 1O3PB 6CHAB 4A1TA 1XVOA 4NFFA 1F5KU 3S7HB 2KAIA 2TPIZ 7GCHG 4ZKRU 1A3BH 3SUDA 3R0FA 4GLYA 2CF9H 3HPTB 1DXWA 1B0FA 4Y6DA 4ZUHA 2GZ9A 1TMUH 2BVSH 3TK6A 2Z9GA 3UQVA 3FP6E 1ANDA 3GY3A 3ZV9A 3SO3A 2A4OA 2BX3A 4O97A 1DUEA 1DY9A 7GCHF 1O3DA 1LVYA 4NSVA 1QL7A 2FOCA 2J95A 2FESH 1EXFA 4O9VA 3LGUA 3SNAA 5DP5A 4B73A 4Y10E 1FJSA 1MUEB 1XKAC 2GMTC 4Y7BA 3PTNA 1SC8U 2FX6A 1YPKH 5DKMA 1TX7A 1GJAB 1MZAA 1NC6A 5E2PA 1GHWH 1NFUA 4K69A 2F3CE 1UTNA 1MQ5A 2FLRH 1GG6B 1HIAB 1QRXA 2VH6A 4UFDH 1J17T 1S83A 2PSXA 1WAYB 4FUJA 1VGCC 2DUCA 1GJ5H 1MTVA 3MNBA 1TPOA 3Q3KA 2DE9A 3OX7U 4J2YB 4AZ2B 4BANB 4CRAA 2BHGA 2NU0E 2HPPH 3SU5A 3RMMH 2F9NA 2A2QH 4D76A 1O2ZA 4HI3A 4RKJB 1YM0A 2ZDMA 2V3HH 3MU0A 3ATIA 2ODPA 3VGCC 3TH4H 4NZLA 1KDQB 3M5OA 1P0SH 4AOQA 2C8XB 2A5KA 1IQFA 2BD3A 4ZKNU 1HV7A 2C8YB 1GDQA 1VJ9U 4LZ4B 1XUIA 1H8IH 1OP8A 1P12E 2EC9H 1DLKB 4GHTA 3HK3B 2D2DA 4ZHLU 2GKVE 3SUFA 5C2ZA 1AFQC 1MBQA 5C5OA 2HNTE 1FXYA 2SFAA 1MTNB 1GHZA 1O3BA 1MTSA 5E0GA 2BD5A 1FY4A 1BMNH 3MWIU 1GWAA 2IN2A 1M9UA 2G52A 1EAIA 1YBWA 4XFQA 1TA2A 1RXPA 4IC6A 2P3TB 1BMAA 1MCTA 4OS7A 3SU3A 1O3IA 1C2FA 1A3EH 3W95A 1P9UA 3M37A 3C27B 2SNWA 4X2XA 3RDZA 4I8KA 3BG8A 5C20A 4INHA 4IMZA 4YLQH 5LPFA 1GVKB 1TPAE 3KCGH 1T8OA 4X8VH 1FIZA 1GI9B 1EAWA 4NIXA 1W11U 4Q7YA 4KTUA 4FUBA 1LHFH 1SR5C 1TX6A 4TPIZ 2AYWA 4KKDA 3BTQE 3G01A 3ODFA 4WWYA 5LH8A 3LDXH 1G30B 1HJ9A 1YPMH 3SV8A 1HNEE 4BTTB 1DWEH 3GY6A 2XCNA 1O2UA 1EPTC 1AWHB 1LPZB 2PFEA 4NSYA 2BDYA 2EI8A 2O8MA 4FVBA 1AGJA 2YNAA 2V6NA 4K3JA 1LO6A 1AZ8A 1EAXA 1V3XA 2P59A 4ABIA 1FNIA 1O2YA 1MAYA 1C1TA 5TJXA 1W10U 1P8VC 1BHXF 1MD8A 2BDIA 5EG4A 1HJ8A 1TPSA 3SZNA 5DP8A 1UCYH 4KTCA 1LDTT 1OXGA 5F8XA 1GJDB 4OS1A 3RXDA 2WPKS 2CHAB 3K9XB 3M35A 3S9AA 1LHEH 4K8BA 2HNTF 4Y79A 1GPZA 2GZ8A 3HGPA 3GY5A 2OTVA 2FP7B 4NIWA 3MH4A 4AG2A 5E0JA 4TY7A 2XYAA 5H4IB 1KTSB 1PPFE 1WSSH 2Z3CA 2UUKB 1BQYA 5C3NA 2BYAX 1Q31A 1G3EA 4OS5A 1EX3A 2ZC9H 3ZV8A 1TA6A 4ABEA 1NY22 1FPHH 2OP9A 3SORA 2NU2E 1HAVB 1SOTA 5T3HA 3M3SA 3HATH 1DICA 5FAHA 5JBTA 1LMWB 1GGDC 1G2MA 1NTPA 1EP6A 5T6FA 3P8OA 4FXGH 1NRPH 3TJNA 2ZCKP 3STJA 1YLCA 1EJMA 2FI4E 3GICB 4DW2U 1O2MA 5L2ZH 5JBAS 4X8SH 3BTDE 3BG4C 3RLWH 1A1RA 1B7XB 1UVPA 5HYOA 3KHVA 1T8NA 1SBWA 3LJJA 1JOUB 1FN8A 2I6QA 4J1YA 1K21H 4OGYA 5FHTA 3SGAE 1F7ZA 3VB5A 3SHAH 4DT7B 4XDEA 3TJUA 3QLPH 3BSQA 1HAGE 2XC5A 1C5WB 1A5HA 1BITA 1GL1A 3M7TA 1NU9A 4Q2KA 3A7VA 2A32A 2H5CA 2J94A 3EGKH 3UTUH 1C5VA 1VCQA 2Y5HA 1HAZB 4YZUA 1P10A 5T6DA 1C2KA 4AGJA 3GDUA 1AE5A 1H4WA 5EODA 1DS2E 2AMPA 3LONA 1UTMA 2FTMA 5EW1H 1GHAF 2UWPA 8GCHF 1FY1A 1TIOA 3PYHA 3UOUA 1BTYA 1TNHA 1OWHA 2H1UA 1IAUA 1F0SA 2O8TA 5F03A 5L2YH 1ESAA 1BTWA 1G32B 1LCYA 4CBNA 1GHBG 3BTFE 1JIRA 4AYYB 1VITH 3A87A 2G5NA 1LHCH 3VB7A 5K7RA 1O2HA 4MLFB 3LGWA 4XE4A 4E06H 4INKA 1HFDA 1ORFA 2F9UA 1K1LA 2QIQA 1L0ZA 1ELEE 3V13A 4CRBA 1P2MA 1H8DH 1V2ST 2BXTH 3GCTG 8KME2 1J8AA 2Z9IA 3HGNA 2WPLS 1HAIH 2G51A 4ABBA 1GBJA 1YF4A 1MBMA 1C2GA 3ZZ9A 3RC4A 2A1DB 1O5BB 1AVWA 3ELAH 1C1OA 1GMDF 1C5LH 3RXTA 3SJKA 2HVXA 3RXHA 2AGIX 2VWLA 5C1XA 3ZZ3A 5GDSH 1OX1A 3A7YA 2SGAA 1HIAA 4CH8B 4TPYA 5J4QA 2C3SA 1GBMA 1A0HB 5C67A 2HOBA 1LPKB 2VJ1A 2RDLA 2ULLA 4Y11E 2Z9KA 2HLCA 1GBDA 1Z71A 3ENSB 3ZVEA 1PQ8A 2YOLA 1FPCH 3Q3YA 2GMTB 2SGFE 4ZH8A 1GBFA 4JMYA 3UNSA 3K65B 4UE7H 1DWBH 2VIDA 1KDQA 1C1WH 1HCGA 4WMEA 1O3OA 1CO7E 3LPRA 1BRUP 2ALPA 1AZZA 3DD2H 2VGCC 1Y3UA 2UUJB 3TJOA 5G4BA 4H4FA 4I33A 5I46H 2GCTC 1P2QA 1VGCB 1P2KA 3RC5A 3SU4A 4VGCC 3LJOA 3FFGA 1H1BA 1YPLH 1GCTC 4ESTE 1CGIE 3A85A 2TGAA 1WUNH 5DJ7A 2ZO3H 3E0NB 1EKBB 1TRYA 4NGAH 3RXEA 2ZDKA 4LK4A 1O2IA 1W14U 2ZTYA 5A8YA 4GAWA 1S5SA 3VGCB 3N7OA 1SGIB 2C90B 2VH0A 2ZI2H 1UVUH 1QRWA 1DITH 1MH0A 1YPEH 1N1LA 1E36B 2Y5FA 4K1SA 2AIQA 3HK6B 1IQMA 2Z94A 1IQIA 1SGCA 3F1SB 3Q3XA 5EQRA 3JZ1B 2QXHA 4GPGA 2D8WA 1NS3A 1BTUA 1KXCA 1ZPBA 3TNTA 1RIWC 2OCVB 1T32A 1GBCA 1IHSH 2STBE 2AERH 2GD4B 3DFLA 1TNIA 2Z9JA 3DT0H 4X6NA 4JZDH 1J14A 1NU7B 1F5LA 1P09A 3K6YA 2CV3A 2VIPA 3IG6B 1LQEA 4GSOA 2FYQA 2WPMS 3P8NA 1LVMA 1PQ5A 2A4GA 1P11E 4A92A 1GHXH 1LVBA 1MQ6A 2OQUA 2Z7FE 1C5YB 2WYJA 1K1IA 1PPCE 4KGAA 1K1PA 1HBTH 1Z6JH 2FDAA 1GI7B 1O30A 1CA8B 1J16A 4X6MA 4AORA 4HZHA 3H5CB 1SGQE 3K2UA 1KLTA 4UDWH 1QGFA 4MPXA 4YESB 2BM2A 2CMYA 4X1PU 2ALVA 4R0IA 6GCHF 1AUJA 1AIXH 3LC3A 1O5GH 1EPTB 4B2AA 3MNXA 1LHGH 1O2TA 1CHOF 3KQCA 2AFQB 1A46H 1GI0A 1MTWA 4A6LA 2BY9X 1QHRB 1AKSB 5TCCA 1C9TA 3A88A 3TITA 1BBRE 3SV6A 1D4PB 1WQVH 1AY6H 1C2IA 3FANA 1SVPA 1QRZA 1UTPA 1S0RA 1RTKA 1ELBA 1SHYA 3KF2A 1HAVA 1ELDE 3NUMA 4U2WA 2G55A 3SN8A 1YPHC 1AUTC 4Y0ZE 1C5QA 1HAXB 5C5NA 2J92A 4ISNA 1OYTH 1QIXB 1HXEH 1O5CB 1PPZA 3ZYDA 3IWMA 4YTAA 3O8BA 1UVSH 2G5VA 2OC8A 4SGBE 1MD7A 2B7DH 3D49H 1PPEE 4TWYA 3MO6A 2P3UB 3UREA 1C1UH 5EXMA 1RTFB 2AS9A 2ZHWH 3TPIZ 3RXRA 1GGDB 1RTLA 1SHHB 1XUGA 4LOYH 5ESBA 3TH2H 3OYPA 1TBZH 2TGDA 1CGHA 2RG3A 3ZZ8A 3UIRA 4BXSA 4ISOA 1UTJA 3GY2A 3BG4B 1G37A 2A7HA 4INLA 1ESTA 2ZPSA 2FEQH 2SGPE 2QXGA 1P9SA 1Y3VA 2AGEX 1UTLM 4FUIA 1UTQA 1CA0C 4WH6A 4ISIH 3RXFA 2BLOA 2Q6DA 4UFEH 3VPKA 4LXBH 4AFZA 2G81E 3EE0B 3PLBA 4AB8A 3AAVA 3E91A 1SGEE 1DY8A 3EA9A 1AO5A 2GT7A 2A4RA 2XBYA 1YCPM 2AMDA 1HUTH 1Q2WA 1SGFA 1SLUB 3B8JA 3ZZ7A 1SGPE 2P95A 2QCYA 2R2MB 5AFZH 3ZYEA 4IBLH 2ZU4A 1O3MA 1N6XA 3SJ9A 5EPYA 1TAWA 1BTHH 2TGPZ 2THFB 1TGNA 4I8GA 1GBIA 2HRVA 2BOHB 5C1YA 5PTPA 1TLDA 1FMGA 1A4WH 2VB0A 5DGJA 4CRCA 1ZHMA 5EOKA 2NU3E 3KNXA 4CH2B 1O2SA 4YOIA 2JETC 4CRDA 2BD9A 3OU0A 4O3UA 1OWKA 4Q7XA 4AFSA 3UNRA 2VIVA 5HM2A 3I77A 4JZFH 3SV9A 1J15A 1XUKA 3BIVH 1TGSZ 2RA3A 4AFUA 1O5FH 1O3LA 3RM2H 2YNBA 3U9AH 1V2MT 1HXFH 1ZSLA 4FU8A 1K9OE 2Z6BD 4AGKA 1H9IE 1GVLA 2QY0B 1BRBE 2ILNA 3LC5A 2VVCA 3P8GA 3TGKE 2A45B 3P6ZB 3BF6H 1K1OA 3T27A 3MNCA 3ODDA 2VWMA 5DP3A 2R9PA 4O03A 1XKBC 2EI6A 3EAJA 1GCDA 3RXKA 1Z1JA 3GCOA 1UHBB 4Z0KA 3RP2A 2FXRA 3URDA 3PMAB 1TWXB 8LPRA 5FX5A 1F0TA 4YLUA 3VB4A 2Y7XA 3QGNB 1SLXB 3PMJA 3NXPA 1Q3XA 1ETRH 1B5GH 1O37A 2ZGBH 1LPGB 3DA9B 5CHAC 2GV6A 2P8OC 3E8LA 1O3JA 2Y82A 4UFGH 1QB9A 1YPGH 2AGGX 2OUAA 1ZTJA 2NWNA 2ZGJA 3TK5A 1TYNA 3F9EA 4FVDA 2BXUH 1NZQH 1BTZA 1QA7A 2ANKH 2ZA5A 2VGCB 1D6WA 2ZU1A 4RKOB 2XWBI 2BDGA 1ANEA 3MH5A 2GCTB 1AFEH 3PMHB 4YO9A 4VGCB 4KTSA 1O5DH 2F9BH 1JRTA 5DP9A 4CHAC 4DJZB 1GCTB 2SNVA 4XBBA 2CN0H 2FODA 1JRSA 3UPEA 3SOSA 3SU6A 1GJ4H 2ZFSA 1FQ3A 4TY6A 4A5TS 1BB0B 1C4Y2 1H9LB 2HNTC 2FOFA 3A7XA 5AFYH 3SUGA 1D3QB 3QWCH 1T31A 3SBKA 1SGDE 1KXEA 3BIUH 3A7WA 1QCPA 3PM3A 1QL8A 3SU1A 4F4OC 2Y6TA 3FZZA 3RXMA 1N6YA 2UUFB 2WUCA 1GBBA 1E0FD 1E34B 2QGRA 3E0PB 1C5SA 2ZFRH 1T4UH 2J34A 1NPMA 2VNTA 3SNCA 3EDXB 4JZIA 5DPAA 2PLXA 4JYVH 1CT4E 1CU1A 4MDSA 3URCA 4WY3A 2PHBA 5J4SA 1EQ9A 1EAUA 4BAMB 3BTHE 1Z8GA 1BTPA 1EPTA 3GY8A 5L6NH 1LVOA 1O2PA 1O2WA 2O9QA 2JKHA 3M5NA 2WPJS 1V6DA 2XBVA 4M7GA 1EASA 5BRRE 3PLKA 1S0QA 1NM6A 3P92A 5AF9H 1THPB 2ZQ1A 4X2VA 5IYTA 5C1UA 2FTLE 3U1JB 1HAYB 1C4U2 3F6UH 1QTFA 1GJCB 1ZSKA 2OC1A 5A0AE 2G4UA 1C5TA 1SQTA 5HM9A 2BDBA 1O2RA 1O3KA 3KGPA 2TBSA 2W26A 1QQUA 2FO9A 3MTYA 5E8EH 1Z8IB 1G2LA 1O2XA 3M5LA 1U6QA 4WH8A 1Y5BT 3UFAA 1FUJA 3H7TA 3UR9A 1PPGE 1QBNA 4XBDA 3RMOH 4ABAA 1UK4A 1TNJA 3SNEA 2TGTA 4Y7AA 2XBXA 4BTUB 2GCHF 1VITF 3AAUA 1MU8B 2PWXA 4X8TH 4BOHA 1O0DH 1BCUH 1ETSH 1SSXA 3A84A 2JH5D 1ZPZA 1GI6A 3E16B 3NKKA 3GCHB 2W3IA 3A82A 5K0HA 6LPRA 5ETXA 1GHAG 1N8OC 1V2TT 8GCHG 1ELGA 2A4QA 4Y0YE 1QURH 1C2DA 3SNDA 4A7IB 3FP7E 2O8UA 4MTBA 5GXPA 1W8BH 1W2KH 4D9RA 1C4V2 6CHAC 4DOQA 5DO4H 1C5MD 3RU4T 1OWJA 1HYLA 3TH3H 1THRH 1TOCB 5A09A 1L2EA 2AEIH 3RXJA 2JH0D 3P95A 3MNSA 2BY7X 1SFIA 1C2LA 1YP9A 3DHKH 5AVDA