2BY7X

Is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title Is Radiation Damage Dependent on the Dose-Rate Used During Macromolecular Crystallography Data Collection?
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2by7X01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2by7X02
3M3SA 1BT7A 1AUJA 1TONA 2SGAA 4FXGH 1YF4A 3E6PH 1TNHA 3GCTF 1GI6A 4AB8A 2PWXA 1FY5A 2QF0A 4I31A 5K7RA 1DWCH 4IMZA 2NU1E 4XE4A 3TK9A 1UCYH 3SBKA 3SJ9A 2JETC 1O5AB 2BX4A 3PWBA 1K22H 2BVXH 4K1SA 3GY8A 1O33A 1O2XA 4JYTA 2Z7FE 1OXGA 2TIOA 5JB8S 2BDIA 2FX6A 2STAE 3BF6H 3PV4A 1GJ6A 2BD9A 1GCDA 3SW2B 2QXJA 1GG6C 4MPWA 3A85A 8KME2 1OX1A 1AMHA 3T29A 3N7OA 4B75A 1ANCA 1S0QA 2JH5D 4NIVA 4O3TA 3VB4A 4NSVA 5EU8A 1ZSJA 4HZHA 1BTYA 1VITG 1UVTH 2TGTA 4WWYA 1MCVA 1GVZA 5FCKA 4WMEA 1CBWB 2WUBA 1BJVA 1QQ4A 3M3TA 1GBIA 3UNRA 2P8OB 1ESTA 3E0NB 3RXFA 4CHAC 2ZEBA 2JH6D 2BDHA 3M3VA 4UEHH 4FUDA 3JZ2B 2WV5A 3E8LA 3SV2H 1OYQA 4ABEA 1Y5BT 4ZHAA 3TPIZ 1C2DA 1MAYA 1HV7A 1UHBB 4LXBH 1QFKH 1WOFA 4ZKOU 1EP6A 1GMDG 1ELAA 2F91A 1AFQC 4OS6A 6GCHG 2WPJS 2BB4A 3OX7U 4CR9A 9ESTA 2BXTH 3VB3A 1GWAA 1GHBG 1EJMA 1XUHA 1ACBE 1SQOA 2CHAC 2ULLA 2ZTXA 2BHGA 2XBWA 1LHEH 1WU1A 1UO6A 1F92A 2HRVA 3FP6E 3TNSA 2WYGA 3A7XA 2QA9E 1PJPA 3A80A 1ELTA 1G2LA 1T32A 1DOJA 1ZRBA 1YGCH 5CE1A 1SGYE 2A7JA 3BIVH 1TX7A 2GCHF 1TALA 1VJ9U 3URCA 4CREA 1C4Y2 3RUOA 2G52A 1CT4E 3BV9B 1KXAA 1ZHMA 3L33A 1FUJA 3C27B 3A7TA 1GHXH 2Z3DA 2ZECA 1W0ZU 2O8LA 2P59A 3AW0A 1O3FA 2R3UA 3T62A 2VIVA 2C4FH 1YPJH 3UREA 1AQ7A 1TPOA 4I7YH 3P8OA 4DY7B 3PLKA 1HAYB 2ZCLP 3RU4E 1TNJA 2ZFFH 2CXVA 1NM6A 5H4IB 1UTOA 2QF3A 4DG4A 1Z8JB 4XBCA 2F9OA 3UR9A 1VGCB 1HXEH 2ZQ2A 3ATWA 3IITA 2NU3E 2W3KA 1P09A 2WPIS 3SV6A 2BDAA 4YLQH 4H42U 3SGQE 4O9VA 4A5TS 4PROA 4X2WA 3QWCH 3TK6A 1ZSLA 2A4OA 2CF9H 3RXDA 1KXFA 2B9LA 4OGYA 2J38A 3UWIA 4I8JA 4MNVA 4KTUA 1GCTB 5EODA 1C2IA 1A4WH 2G5NA 7GCHG 1O2TA 5GWZA 3LKWA 1SGPE 2H9TH 1UTNA 2ZKSA 1ZHPA 3V12A 2D2DA 1CHGA 1NZQH 3ZZBA 3LGYA 3SV8A 2J9NA 2QXGA 2FTMA 4ISHH 1QA0A 3T25A 1CT2E 1LHDH 2VH0A 3H7TA 3NWUA 2PKSB 1GI1A 3TH2H 3MO6A 1GBCA 1AE5A 4Q7YA 1GI8B 1GHVH 3SU5A 3VB6A 2PFEA 3ZVGA 1EAWA 1RJXB 1T4UH 1PPGE 4NG9H 2CMYA 1H9IE 2A0QB 1F5KU 4Y8ZA 1N1LA 1EB1H 2K1QA 4NSYA 1CA0B 1W2KH 3HGPA 1P57B 3URDA 3LOXA 4JYVH 3IWMA 4DIHH 2THFB 3SU3A 2FTLE 2FYQA 4B71A 1Q31A 1QB9A 2XWAA 1K1IA 3ENSB 1CHOG 1ESAA 1UTJA 3SORA 3KEEA 1HAGE 1Y5UT 5JBTA 1EZSC 3V3MA 1C2HA 5EPNA 2ZDAH 4YT7H 3MO9A 2ZFQH 1A5IA 1AUTC 4I33A 2ZI2H 1BDAA 1MQ6A 1VITH 4JZ1A 4X1PU 2TRMA 2BD3A 1EASA 1C2EA 4NGAH 1L1JA 1PPFE 3M5NA 1MUEB 1TGBA 1ZZZA 1C5UA 3ESTA 1XVMA 5IYTA 5SGAE 1LVMA 3QO6A 8GCHF 4MG3A 4BAOB 2UUJB 2R2MB 1WQVH 3ZZ6A 2ZF0H 1O2MA 1AO5A 3RXHA 1FAKH 2NU4E 2EA3A 1O3NA 2ILNA 2J95A 1UMAH 2P8OC 1P10A 3SNBA 1AE8H 4NA7A 3EA8A 1BOQA 1QQUA 1B5GH 1RXPA 5FCRA 3M7QA 1ZYOA 3HATH 2ZC9H 5C2ZA 1HLTH 3S9BA 1Q3XA 5GDSH 3A8CA 3DD2H 2XRCA 1YPEH 2ZDLA 1BTXA 3ZV9A 2ZFTA 1KTSB 1TB6H 4CRAA 2HALA 1Y3YA 2BDBA 1UTKA 1ZHRA 2FDAA 1NU7B 1A3BH 3F6UH 1EJAA 2F83A 5JYIA 4AX9H 1FDPA 3MO3A 1OWHA 5FX6A 4O03A 2WPLS 1WBGB 2M5TA 2ZU1A 3M7TA 2PKAB 1F5RA 2AS9A 1MTUA 2ZA5A 2O9QA 4D8NA 1W7GH 4ZKSU 2ZDMA 2H5CA 1ZMLA 1TGTA 2ZNKH 5CHAC 2PSXA 3LH3A 7GCHF 4K1EA 1O3AA 3NKKA 1GMHG 3ELAH 3K6YA 2FOAA 2GGVB 2JKHA 1C1TA 5HMAA 1BMAA 1W8BH 3ITIA 2PTCE 5FAHA 2ZFSA 1QRWA 2HPPH 2G4UA 3U8OH 1UTLM 1SPJA 2FS9A 1WUNH 1V2ST 2Y5HA 2A7HA 1JRTA 1SLWB 3PO1B 1UTPA 2BOHB 3T27A 3UR6A 1GI3A 1VGCC 1BQYA 1NN6A 1XUKA 3GISB 3ATIA 5DG6A 4NA9H 4X8TH 3P95A 1LO6A 3UWJH 4F4OC 1FIZA 3BTME 1C2JA 1KXCA 1Y3VA 2DUCA 3MU0A 5ESTE 3SI4H 1AVXA 2FXRA 4FUIA 3ZYDA 5HXFA 2GKVE 1FPCH 4X0WU 3U9AH 4OS2A 1HAPH 1ZMNA 3VXFH 3BG4C 1CHOF 1GCTC 3A81A 1OOKB 3K6ZA 2BVSH 3MOCA 3BG8A 4UD9H 3FAOA 1SQTA 1XM1A 3HPTB 4IBLH 4TPIZ 5EW1H 1TLDA 2CJIA 3SO3A 1L1NA 2P95A 3HGNA 3TJNA 1BZXE 4JZFH 1L2EA 2W3IA 2TPIZ 5A8XA 2AIQA 4WH8A 2P3FH 1F0TA 1THRH 5AF9H 2VJ1A 3UQOA 2F9UA 2ZGXH 1XXDA 1AWFH 3B8JA 4JZDH 4A1TA 1SGRE 1C5PA 1S82A 4MVNA 3OY5U 1FZZA 2WINI 3TVJB 1GG6B 2ZDVH 1SSXA 1N8OB 3EA9A 3NPSA 3GDVA 1IQLA 1V2MT 1EXFA 1UTQA 1GBJA 1WSSH 2I6SA 2PKAA 2BLVA 2OQ5A 1LCYA 4LZ1H 1P01A 1Z6JH 1DANH 2ZU5A 3LC5A 1XUFA 1NS3A 1H4WA 2YOLA 4A1VA 4TWYA 3SU4A 2FOGA 1ANBA 4OS4A 5J4QA 4ZUHA 3VGCB 1EZUC 1BBRE 2WPHS 3BTTE 3GY2A 3M37A 5DPAA 2CN0H 3SU6A 4ZKRU 1C5WB 1O3OA 1WYKA 3SV9A 3VPKA 2V0BA 4UFGH 1XUJA 1GVKB 1MKXK 3OSYA 2H1UA 4X2XA 1O2ZA 3RU4D 1O3BA 1V2NT 4DW2U 3K9XB 3LGTA 1GDNA 1HIAB 4Z0KA 4ZMAH 3BEIB 2AH4X 3ZVCA 1SGQE 1AZ8A 3QTVH 4AB9A 3RXRA 3S0NA 4X6MA 1MBMA 1GJ9B 1GMHF 1EOJA 1XUGA 3W94A 3EAJA 3A7YA 2ZFRH 1IOEA 1O3HA 2FLBH 4ABIA 1MD7A 5K0HA 1GBLA 3V0XA 1V2PT 2GT7A 2SNVA 2Z3EA 4J1YA 2BD4A 3U69H 4B2CA 7ESTE 1A46H 4X2YA 3LT3A 1HAVB 1LDTT 2EC9H 3LH1A 1TX8A 3D23A 4KTSA 2VH6A 1F0SA 3RC6A 1TMBH 4XBBA 3F68H 5FPYA 2R3YA 1MZAA 3S9AA 3STIA 1GPZA 2R0KA 1T8OA 2VIPA 3O8DA 2C93B 4INKA 2W5EA 2PLXA 1FQ3A 1D9IA 2LNCA 4ABFA 4Y10E 3BTEE 5C1YA 3ATMA 2I6QA 2Y5FA 4NWLA 2G00A 2GD4B 2PUXB 1FY3A 2VIDA 1DUEA 4AFQA 1QBOA 4RSPA 5DP8A 2BD5A 4THNH 3TNTA 1GJCB 2R2WU 2QAAA 4SGBE 3TGKE 4MLFB 2FM2A 2B0FA 2OC8A 1A2CH 3K65B 1BCUH 1J15A 5TCCA 4OGXA 1C5ZB 1CQQA 1ZTJA 2BDYA 1OWJA 2FZZA 4FVBA 4Y8XA 1ARBA 2OLGA 2FOMB 3EA7A 4H4FA 2H6MA 2Z94A 2AGGX 3UY9A 3A8DA 4X6OA 2IJOB 1ETSH 3SHAH 1ELGA 4Y76A 1MTNB 1HJAC 4YESB 3QDZB 2AMPA 3UOUA 1O3DA 1UK4A 2Z9IA 4X6PA 4BAQB 1GL0E 1AGJA 1W7XH 3RXGA 1IQGA 1GJAB 1P3CA 3TJVA 2WUCA 3AAVA 3SHCH 1P03A 1P9SA 4DJZB 2V6NA 2HNTF 1F0UA 4KTCA 3K2UA 5FBEA 2FEQH 1F5LA 1O39A 1GJ7B 1Z71A 1GJ4H 2BD7A 1HBTH 3T2NA 5J4SA 3C1KA 1EAXA 1V2OT 5LPRA 4AFSA 5LPFA 2ZU3A 4Q7ZA 5HM9A 4DIIH 1SVPA 3B23B 4O97A 3E3TA 2ZZUH 1TGCA 3ZVAA 3EE0B 3SQHE 1N6XA 2Q6FA 1TFXA 2VWMA 1N8OC 1O2GH 1TOCB 1KLTA 1MH0A 5FHTA 4X1SU 2BZ6H 2ZHFH 1LHCH 1C2MA 1SFQB 2V35A 3TITA 4D7FA 1SMFE 2G8TA 3TGIE 3ODDA 1YPMH 1MKWK 4WY3A 3RM2H 1BHXF 2BOKA 3M7UA 3NK8A 2EEKA 1V2WT 1QHRB 1S6FA 2F3CE 2FYRA 3VGCC 1FY4A 4OS7A 3QLPH 2V3HH 1JIRA 1CA8B 4BTTB 1V2QT 1BTZA 4RKOB 1FY8E 3E0PB 1TRYA 1FPHH 1QRZA 3SJIA 3KQCA 4E05H 4YOGA 1QNJA 3FZDA 1KXDA 4NZQA 1DSUA 2ZDKA 3PLPA 1YPHE 2FI4E 5GPIB 4CR5A 2ZHDA 1QJ7B 1ANEA 1M9UA 4FUJA 1XVOA 2FPZA 1HAXB 4I8LA 2HLCA 1O3CA 1SLUB 2XW9A 3ZZCA 1TMTH 1TQ0B 1SL3A 5IDKA 1G32B 1UJ1A 1IHTH 2VWOA 1PQ8A 3MH5A 1NRNH 1B0EA 2BD2A 5LGOA 2GZ9A 4INHA 1KLIH 3A7WA 1C1RA 1BRCE 2RG3A 2A31A 1ETTH 3RC5A 2GZ8A 5EQSA 1SHHB 1O2QA 4AG1A 1O2KA 1G36A 2ZHWH 1C2LA 1DPOA 5C20A 1TE0A 4AZ2B 3DUXH 4Y11E 5C3NA 2UUYA 1P12E 2AMQA 2ZHEH 3PMBB 3BEFB 1FN6A 2HNTE 5CHAB 1S5SA 2FO9A 4SGAE 2SGFE 1YLCA 4CH8B 1O37A 5C67A 1DLEA 1PYTC 3F1SB 3Q77A 1RTFB 4X1QU 1BHXB 1GBAA 3ZVFA 4BANB 2VIWA 1AZZA 2WPMS 5CMXH 3RXUA 3GY4A 1GVLA 1K1MA 4UFEH 1IQMA 2Z9KA 1YPKH 2D1JA 1ELEE 3B9FH 3EYDA 1TPSA 3GOVB 1ELFA 1YLDA 1C1VH 3RXEA 4TY6A 2TBSA 1NFYA 4MPVA 1OP8A 1TBRH 3H5CB 2DE8A 1SGNE 2VIQA 1D3QB 3CP7A 3TU7H 1FMGA 1HAZB 3RMNH 1SOZA 2A4GA 5T6DA 1NTPA 1J14A 1SHYA 4H6TA 2UWOA 1E0FD 2UUKB 1QBVH 2ALVA 1EQ9A 1GMCG 2ZGHA 2WV4A 1KIGH 1TIOA 1QGFA 2FESH 1K1OA 2BY8X 5GIBA 3BG4B 3U98H 3O8CA 5FPTA 1MCTA 4UE7H 3P17H 1INCA 1G9IE 2D8WA 1MTSA 3DHKH 1Y5AT 4A1XA 2QGRA 1G3DA 2G55A 2EI7A 4E7NA 3OTJE 3MWIU 3RDZA 1C5MD 2AFQB 5DO4H 1GI2A 1UHBA 3ATLA 1TABE 3RXKA 4D9RA 1MTNC 1NFWA 1V2JT 5EQQA 1OWIA 1C4V2 5E0GA 5EW2H 3F9FA 1O2JA 4I8KA 2GDDA 4ISIH 4YM9A 1HB0B 2GMTB 1VITF 4HI3A 1AU8A 1DUAA 1JXPA 3RC4A 1WQSA 1RIWC 2BY6X 4I32A 1SGFA 1J17T 3SU2A 1AN1E 3BTFE 1C4U2 3ZZ9A 8ESTE 2ZU4A 3ATKA 2UUFB 4TWWA 1H8IH 1PPCE 1GJ5H 3ZZ8A 3QK1A 3UOPA 3E1XB 1V2KT 4Q80A 1GMDF 1O3IA 2GCTB 4X8UH 5DP4A 1K1PA 6GCHF 1TBQH 4GAWA 1AFEH 1LPZB 3LIWA 1GHBF 3RXTA 1FN8A 1TBZH 1V6DA 1XKBC 2ASUB 1C5RA 4KGAA 1YPHC 4Y79A 1DX5M 1AI8H 4ABGA 3GCHB 3PB1E 2ZPQA 2A1DB 4K8YA 3TH4H 1W13U 1J9CH 1KSNA 3KNXA 1AIXH 3M35A 1ID5H 2Q6DA 5PTPA 5C5OA 1EZQA 3RXMA 3ZVBA 2QIQA 2Z9JA 4ZXXH 1FLEE 1VZQH 2ESTE 1IHSH 2W7SA 4UDWH 4D7GA 1TX6A 4AYVB 1B0FA 4AYYB 3OYPA 2ANMH 1IAUA 1TA2A 3UIRA 4A7IB 4AORA 2HNTC 4YLUA 4FUFA 2FIRH 1SG8B 1QB6A 3FP7E 3W95A 4ABAA 1P05A 1O2PA 1PYTD 1BBRK 2HOBA 2XYAA 5L6NH 1O2IA 1YCPK 3GY3A 1O2HA 1ZOMA 1N6YA 1NO9H 1C5VA 1GGDB 4CRDA 1QJ1B 2BQ7B 1HYLA 1ZPCA 1BA8B 1GBEA 2P93A 3AW1A 4MNXA 1SR5C 2O8WA 1NFUA 5JBBS 1BB0B 2J2UA 3ZZAA 3RXSA 2PGBB 5L2ZH 1Z8RA 1VCPA 1NROH 3M5LA 2ZPSA 2QC2A 1ABJH 1TMUH 4YO9A 1DSTA 1LMWB 2F9VA 5DP7A 3P70B 4LZ4B 4VGCB 3UNQA 1MBQA 2VINA 2ZFPH 2Y82A 3GY7A 3KQBA 3QUMP 1W14U 1MD8A 2BZAA 1GJDB 1GI9B 2QXHA 4K3JA 3MH6A 2TGAA 1QA7A 1RFNA 4Y0YE 5T6GA 4IC6A 1ZPZA 3MH7A 4FUGA 1QIXB 3U1JB 1O5BB 1WCZA 1EZXC 2FMJA 1FI8A 1SGCA 1FXYA 4AFUA 4NFEA 1G3EA 1OWDA 1E35B 1IQEA 1NC6A 1RTKA 2XTTB 1S0RA 2BTCE 4OS5A 3MU8A 1Y3UA 2RDLA 5EGMA 2O8UA 4X8VH 2BQWB 2B7DH 1DVAH 1W0YH 2A5IA 2GVFA 5TCAA 1SBWA 2SFAA 2SNWA 5EXMA 1HJAB 1J16A 1DY9A 3PTBA 3RM0H 4TY7A 1EB2A 1V2VT 5L30H 1PPHE 4MPUA 1GBFA 4B73A 1O34A 1W10U 3R0FA 1C5YB 2VVUA 1WAYB 1T7CA 3BEUA 1ELVA 4GCHG 3QTOH 1SOTA 3I29A 2AERH 1BBRH 1IQIA 3RXVA 1XKAC 2H5DA 3TJUA 1O2UA 1J8AA 4ZHLU 1TRNA 2GP9B 2UWLA 3D62A 2IN2A 1P9UA 3ODFA 4CRFA 3D49H 2STBE 1GI0A 1G3BA 1OWEA 2AIPA 5EXNA 1FNIA 4CBNA 4KKDA 5EQRA 2GMTC 1C5QA 2DE9A 4X1RU 1ZGVA 4XOJA 2VVCA 1H9HE 3KCGH 2Y5GA 3QZRA 3A87A 1TPPA 1HNEE 4DOQA 1C5NH 2NU2E 4Z6AH 2EI6A 1OKXA 1YYY1 2XWBI 2PSYA 1ZRKA 1HAHH 1UVPA 4GUXA 3UPEA 1K2I1 2C8WB 3ZYEA 5LH8A 4TPYA 1O3PB 3SQEE 1P2OA 4B2AA 1P2QA 3UNSA 3PTNA 2BDGA 1SGIB 2GCTC 1QCPA 3S7KB 1QY6A 5FPSA 1HPGA 3FVFB 3UQVA 1YC0A 5GXPA 3GCNA 1NU9A 1ZMJA 4IN1A 1ZGIA 3RXAA 4F49A 1A0HB 5DP3A 5F8ZA 3RMLH 3GCTG 4CRGA 3PMAB 1DXPA 3GCHC 2XXLA 2OP9A 5F8TA 1P3EA 1F7ZA 1AY6H 1LTOA 4BTIB 3I78A 2PHBA 2FS8A 4AGKA 4ABHA 5I46H 1OP2A 2ZDNA 5HM2A 1GHAG 4JYUH 1P2IA 3T28A 3T5FH 2J4IA 2LPRA 2XBYA 3SNAA 2BY7X 1D3PB 3P8NA 1O5EH 4IS5A 3MNCA 3NCLA 3LDXH 1O2VA 5AFZH 4ABDA 1DWEH 1QURH 2TGDA 2AGEX 1ZTLA 4QT8C 1GJ8B 4WXVA 1EATA 1SLXB 1O31A 4D9QA 1SGEE 1NT1A 3STJA 1L1GA 1LHGH 2ZQ1A 3LJJA 1GGDC 1EKBB 2SGPE 3LGVA 3MU4A 4RKJB 4ZROA 5JBCS 2C8ZB 3RLWH 2BVRH 2Q6GA 1AB9B 3RXOA 1A5GH 3CS0A 2VGCC 2OQUA 1C1PA 1O2LA 3OY6U 1CVWH 1KY9A 2R9PA 6LPRA 3U8TH 3BTHE 4UFFH 1JOUB 2BX3A 3P6ZB 1MQ5A 4VGCC 4ABJA 2PV9B 1Z6EA 1L4DA 1B7XB 2QV1A 2VWLA 2AEIH 3RXQA 1QRXA 1IQNA 3Q3XA 4K1TA 3V7TA 3BTDE 4NIWA 3SZNA 2EI8A 5F6MA 2QYIA 2O8MA 3L6PA 1TNLA 1OP0A 1YM0A 4GHQA 2C90B 3ZVDA 1EPTC 1CO7E 2A32A 1GBMA 1THPB 1VR1H 1C9TA 1QL9A 1PQ5A 4HGCA 1HCGA 1TNGA 1ZSKA 4DCDA 2F9PA 3KQEA 1LHFH 4IN2A 4DT7B 1P04A 3LGIA 1GDQA 5DP6A 1T8NA 3MFJA 5A8YA 4OS1A 1MKXH 1IQKA 3MTYA 1PQ7A 1AKSB 5C5NA 4WVPE 5EXLA 1F2SE 4GPGA 1Z7KA 1Y3XA 3GYMA 2FX4A 3KN2A 4U01A 3SNEA 4DGJA 3GDUA 1YBWA 3RXBA 1O2OA 1D3DB 1P2KA 4O3UA 2AYWA 3RXLA 1PFXC 5EG4A 1S85A 3AAUA 1IQHA 1CGJE 1HIAA 1T4VH 4XFQA 3RP2A 2P16A 1ETRH 4X2VA 1LQEA 3NXPA 2Y81A 1ORFA 3TGJE 3A7ZA 3M36A 1RIWB 2FOHA 1TGNA 8LPRA 5AFYH 3SV7A 3ZZ7A 2Z3CA 5A0AE 4FU9A 2BLWA 3HKIB 2G51A 2YNAA 2BDCA 3KIDU 3TK5A 1TPAE 2P94A 1HAVA 5C1UA 2GV6A 3A86A 3A8BA 3BTWE 3AVZA 1YPGH 1P2MA 3DFLA 1ARCA 2ZWLH 1GHAF 1QR3E 1KYNA 4UFDH 1V2LT 1D6WA 2P3TB 1H9LB 1TAWA 1Z8IB 4A92A 1ZJKA 2OC1A 4CBOA 3I77A 4B76A 4MTBA 1K9OE 2FP7B 3RXIA 3AASA 1S81A 1O3JA 2H2ZA 4KP0A 2A2XH 2FLRH 1GBBA 2BY5X 2C8XB 1BTPA 1C9PA 3M5MA 5T3HA 1GI7B 1DT2A 1MTWA 5TJXA 2QXIA 2VU8E 1LPGB 4BXWA 2W26A 1QB1A 3BTKE 2B8OH 1A3EH 3A89A 4XDEA 2OBOA 2JH0D 2VWNA 1K21H 4XSKU 4RN6A 1O5FH 3MNSA 1O32A 1P11E 1AHTH 1MMJN 5L2YH 3S7HB 2OXSA 3FZZA 3SGBE 1D3TB 4WMFA 1DM4B 1QJ6B 1FY1A 5GCHG 2VIOA 2FOEA 3RMOH 5DP5A 1UCYE 1GBHA 2GZ7A 4ISOA 3RXCA 1F0RA 1AKSA 1GBKA 4MPXA 4CRCA 1O3KA 3FFGA 3PYHA 5AVDA 3SJ8A 1VCQA 1C5XB 1GHYH 2B5TB 4JCNA 4R0IA 3SUEA 1BMMH 2A7CA 5C1XA 3M61U 1C5OH 3OU0A 3MNXA 3TH3H 1O2NA 2RA0A 3MMGA 2C8YB 5E0JA 1ABIH 9LPRA 1MU8B 1K1NA 4ASHA 3MH4A 1MAXA 1DFPA 8GCHG 3KL6A 1Z1JA 1XXFA 4Y8YA 2J94A 1DICA 2FOCA 2V3OH 3ZZ3A 1AB9C 3SGAE 3S9CA 4JZIA 1HAIH 1S83A 1LKAA 5AHGH 1QL8A 4JMYA 3SUGA 1TNIA 4NCYA 1UVUH 2QN5T 4B2BA 1TGSZ 3KHVA 1H8DH 2CGAA 2Z9GA 1P06A 1O2SA 3QGNB 1T8LA 1LKBA 1NESE 1TOMH 3LU9B 5DGJA 2UWPA 3JZ1B 3SOSA 1JWTA 4K2YA 1TQ7B 1KXEA 3TLOA 1MKWH 4YOJA 3ZV8A 1BMNH 4YT6H 4B74A 1AWHB 5A8ZA 6ESTA 4BTUB 4B1TA 1NRRH 2XC0A 2AGIX 1O30A 1C2FA 3DFJA 1ZTKA 1A5HA 1MU6B 4U30A 2H9EH 4INLA 1QL7A 2GX4A 2H9HA 1YPLH 1ZLRA 3O8BA 4E06H 1XMNB 2FODA 3ZZDA 1TWXB 4FVDA 1TA6A 1EUFA 1G3CA 4ZKNU 1V2UT 4LOYH 3VB7A 2OBQA 1DS2E 3H7OA 6CHAB 1V3XA 4FUHA 1G30B 2KAIB 3P8GA 1BRBE 4ZXYH 1O5GH 3Q3KA 1ZPBA 1SGTA 4K5ZA 3SNDA 5EOKA 3HK3B 4IW4E 5FX5A 3F9EA 3E90B 2A4RA 3MNBA 1DLKB 4Y7AA 1K1JA 4MNYA 1VJAU 4YOIA 2OCVB 1A0JA 2BD8A 2F9BH 4GLYA 4M7GA 1NRSH 1V2TT 4AGJA 3DA9B 3T26A 1RRKA 2G4TA 2OTVA 4YTAA 1HJ9A 1D6RA 2ZG0H 1E34B 1P8VC 1C5SA 5E2PA 3LPRA 3S69A 1WV7H 1U6QA 1C2GA 5JBAS 5A0CA 2ZCHP 4A6LA 4NIYA 2Y80A 4JK5A 3MYWA 1YKTA 3ZVEA 5T6FA 2ZTZA 1LPKB 2OINA 1BTHH 4Y71A 1TRMA 3WY8A 1ZR0A 4CRBA 4BNRA 5GCHF 3EQ0H 1IQJA 2Y6TA 4AOQA 1S84A 3IG6B 3TJOA 3F9GA 1DDJA 1GHWH 4ESTE 1SGDE 1EAIA 3A83A 4BAMB 1BTWA 2HPQH 2ZPRA 2FI3E 2HWLB 1SC8U 1W11U 1C1MA 1P02A 4AG2A 1ZJDA 4ISLA 3RU4T 1G37A 1JIMA 5DP9A 1MZDA 2ANKH 2A4QA 4U2WA 2ZGJA 1S6HA 1GL1A 2Z9LA 2YNBA 2ZGBH 4ZHMU 1FONA 4LK4A 2XNIA 1O2YA 1E38B 5ESBA 2GTBA 1GJBB 3NZIA 3SUDA 1C1UH 3EGKH 1EOLA 4WMDA 1XUIA 4I8GA 3L3TA 3MHWU 2SGDE 1CBWC 2XC4A 3A7VA 1HXFH 1Z8GA 3P8FA 1HRTH 1DITH 1VCWA 4WH6A 2IPHA 4D76A 1GHZA 2OD3B 2BMGB 2J34A 5DJ7A 5ETXA 1LVYA 2Y7ZA 1BRAA 1CT0E 1JMOH 2GV7A 1IQFA 5G4BA 4FUBA 2FWWA 2ZGCA 3VFEA 4IMQA 5HYOA 2IOTA 3QN7A 4H6SB 2SGEE 2VGCB 1EX3A 5A2MH 3RMMH 3MU5A 2A2QH 4R8TB 3LGWA 4WJG2 2KAIA 2PW8H 1GMCF 2ODQA 1SQAA 3BN9A 4WF8A 3KGPA 1THSH 1EJNA 3EDXB 3BTGE 2PR3A 3RLYH 5B6OA 1KDQB 2CF8H 2Y7XA 1KLJH 1UTMA 5HGGA 5I25A 1T8MA 1AVWA 3ZZ5A 1PQAA 3SJOA 1AVGH 2FOFA 2HVXA 2VVVA 5BPEA 1G2MA 1O5DH 1AD8H 4CH2B 4BXSA 1EPTB 2BY9X 2AMDA 2ALPA 2ZP0H 1HFDA 1NRQH 4YZUA 3P92A 3LC3A 2RA3A 1OWKA 4DVAU 1OYTH 1PPZA 1LVOA 3D65E 3LGUA 4NZLA 2ZCKP 4K69A 3A88A 3LONA 2ODYB 3GYLB 4GSOA 1GDUA 2BLOA 4Q7XA 5DK1A 1FIWA 1O3EA 3PMHB 2PTNA 1W12U 1DY8A 3QX5H 2HGTH 1C5LH 5EPYA 5JPMH 2ANWA 2R0LA 2RCEA 1OPHB 3GY6A 3SUFA 4X6NA 1ELCA 2PGQB 3UTUH 1GBDA 3DT0H 1DE7H 3FANA 5E8EH 2QY0B 2ZO3H 1DWDH 3BIUH 1GI5A 2F9NA 4ZAEA 2BQ6B 5ABWA 1UVSH 1SLVB 4K60A 3KF2A 1GBTA 2BM2A 1PPEE 2ODPA 3UFAA 1BJUA 1QTFA 1XX9A 4FUEA 1O3GA 2XCFA 5GJ4B 5FBIA 2XCNA 5E0HA 1O36A 1C1SA 1A61H 1YCPH 1O3MA 1O2RA 5JB9S 3G01A 4ZH8A 6CHAC 1Z1IA 5F8XA 1KXBA 1UK3A 4E7RG 3E16B 1RTLA 3O8RA 1SI5H 1BUIA 4Q2KA 3SI3H 2A5KA 3V13A 1ANDA 1CSOE 1O0DH 4Y0ZE 2O8TA 4X8SH 1LQDB 2Q1JA 2ZHQH 2JETB 3A84A 2PKSC 1HAOH 3CS7A 1CU1A 3E91A 3VB5A 1E37B 2GT8A 1A7SA 1RD3B 3VEQB 3HK6B 1Y8TA 1MTVA 1SB1H 4DURA 5JDUB 4I8HA 1JBUH 1TYNA 4IGDA 1CA0C 3F9HA 1DXWA 2VB0A 4NA8A 1BRUP 1YP9A 2BYAX 1KDQA 3RXPA 1T31A 3PLBA 4AN7A 1C5TA 1JRSA 2WYJA 1ESBA 5FXLA 2PUQH 2BLQA 4NIXA 1C1WH 1LVBA 2CV3A 3SNCA 1EPTA 3Q3YA 1BTUA 3QZQA 4GHTA 5DKMA 1UK2A 1K28D 2WPKS 3GICB 5F03A 4FU7A 5E2OA 4MQAA 1ELBA 1D4PB 4WXIA 4BOHA 1WTGH 1OS8A 4ABBA 2BXUH 1C1OA 4CHAB 1Y59T 4MNWA 2W7UA 1HUTH 2SGQE 2OC7A 4X1NU 4TYDA 1P2JA 3PMJA 4FU8A 3SJKA 1NFXA 1WTHD 2G81E 4XBDA 1CE5A 4HTCH 3R3GB 1O3LA 4K8BA 2A45B 4UONA 1SGFG 1O5CB 1AFQB 2FI5E 2XBXA 1H1BA 4U32A 2A5AA 1A1RA 1TNKA 1NPMA 3CENA 2CHAB 4KELA 4Y7BA 3QGJA 1FV9A 3LJOA 3MI4A 1E36B 2OUAA 2ZU2A 4MDSA 1CGIE 3U8RH 3GCOA 2ZIQH 1RS0A 4NWKA 2FOBA 1HJ8A 4HFPB 2G5VA 7LPRA 4AFZA 3TIUA 1QBNA 5LPEA 2XBVA 3GY5A 1UCYK 3PWCA 2GDEH 1FJSA 1FAXA 3FP8E 1RGQA 2D26C 1O2WA 3UUZA 2NWNA 1DWBH 2NU0E 1UVOA 1X7AC 4JK6A 1C1QA 1HGTH 1P0SH 3BSQA 1O35A 2QCYA 1L0ZA 2TGPZ 1Y3WA 5A09A 1C1NA 3SU0A 4ISNA 1PPBH 4IC5A 3Q00A 3U1IB 4GCHF 1EAUA 3SN8A 1Q2WA 1CGHA 3VXEH 1O38A 1V2RT 3BTQE 1A0LA 1BIOA 1W3CA 2ZTYA 2J92A 2OC0A 3ZZ4A 1BITA 1YCPM 3SU1A 1P2NA 3PROA 1KTTB 3A8AA 4BAHB 1EP5A 4BAKB 3PM3A 4JZEH 3MU1A 1BMLA 5A0BA 2Z6BD 1ELDE 1NRPH 2GCHG 5BRRE 7KMEH 2ANYA 1GI4A 4Y6DA 2P3UB 3M5OA 4NFFA 2C3SA 1NY22 3NUMA 3GDSA 3Q76A 3RXJA 3A82A 3KQDA 1HDTH 1L4ZA 3PO1C 1K1LA 1OSSA 2XC5A 2VNTA 3HKJB 4GVUA 4FUCA 4J2YB 1C2KA 1SFIA
chains in the Genus database with same CATH superfamily
3M3SA 1BT7A 1AUJA 1TONA 2SGAA 4FXGH 1YF4A 3E6PH 1TNHA 3GCTF 1GI6A 4AB8A 2PWXA 1FY5A 2QF0A 4I31A 5K7RA 2RDEA 1DWCH 3OTPA 4IMZA 2NU1E 4XE4A 3TK9A 1UCYH 3SBKA 5CHBA 3SJ9A 2JETC 3UB0A 1O5AB 2BX4A 3PWBA 2WSSD 1K22H 2BVXH 4K1SA 3GY8A 1O33A 1O2XA 4JYTA 2Z7FE 1OXGA 2TIOA 5JB8S 2BDIA 2FX6A 2STAE 3BF6H 4AC9A 3PV4A 1GJ6A 5GNDA 1S6LA 2BD9A 1GCDA 3SW2B 2QXJA 1GG6C 4MPWA 3A85A 8KME2 1OX1A 1AMHA 3T29A 3N7OA 4B75A 1ANCA 1S0QA 2JH5D 4NIVA 4O3TA 3VB4A 4NSVA 5EU8A 1ZSJA 4HZHA 1BTYA 1VITG 1UVTH 2TGTA 4WWYA 1MCVA 1GVZA 5FCKA 4WMEA 1CBWB 2WUBA 1BJVA 1QQ4A 3M3TA 1GBIA 3UNRA 2P8OB 1ESTA 3E0NB 3RXFA 4CHAC 2ZEBA 2JH6D 2BDHA 3M3VA 4UEHH 4FUDA 3JZ2B 2WV5A 3E8LA 3SV2H 1OYQA 4ABEA 1Y5BT 4ZHAA 3TPIZ 1C2DA 1MAYA 1HV7A 1UHBB 4LXBH 1QFKH 1WOFA 2KCYA 1EP6A 4ZKOU 1GMDG 1ELAA 1NBME 2F91A 4B6FA 1AFQC 4OS6A 6GCHG 2WPJS 2BB4A 3OX7U 4CR9A 9ESTA 2BXTH 3VB3A 1GWAA 1GHBG 1EJMA 5C17A 1XUHA 1ACBE 1SQOA 2CHAC 2ULLA 2ZTXA 2BHGA 2XBWA 1LHEH 1WU1A 1UO6A 1F92A 2HRVA 3FP6E 3TNSA 2WYGA 3A7XA 2QA9E 1PJPA 3A80A 2J97A 4DT4A 1ELTA 1G2LA 1T32A 1DOJA 1ZRBA 1YGCH 5CE1A 1SGYE 2A7JA 3BIVH 1BMFD 1TX7A 2GCHF 1TALA 1VJ9U 3URCA 4CREA 1C4Y2 3RUOA 2G52A 1CT4E 3BV9B 1KXAA 1ZHMA 3L33A 3PV2A 1FUJA 3C27B 3A7TA 1GHXH 2Z3DA 2ZECA 1W0ZU 2O8LA 2P59A 3AW0A 1O3FA 2R3UA 3T62A 2VIVA 2C4FH 1YPJH 3UREA 1AQ7A 1TPOA 4I7YH 3P8OA 4DY7B 3PLKA 1HAYB 2ZCLP 3RU4E 1TNJA 2ZFFH 2CXVA 1NM6A 5H4IB 4XRNA 1UTOA 3F0OA 2QF3A 4DG4A 1Z8JB 4XBCA 2F9OA 3UR9A 1VGCB 1HXEH 2ZQ2A 3ATWA 3IITA 2NU3E 2W3KA 1P09A 2WPIS 3SV6A 2BDAA 4YLQH 4H42U 3SGQE 4O9VA 4A5TS 4PROA 4X2WA 1E1RD 3QWCH 3TK6A 1ZSLA 2A4OA 2CF9H 3RXDA 1KXFA 2B9LA 4OGYA 2J38A 3UWIA 4I8JA 4MNVA 4KTUA 1GCTB 5EODA 1C2IA 1A4WH 2G5NA 3OE7D 7GCHG 1O2TA 5GWZA 3LKWA 1SGPE 1VKYA 2H9TH 1UTNA 2ZKSA 1ZHPA 3V12A 2D2DA 1CHGA 1NZQH 3ZZBA 3LGYA 3SV8A 2J9NA 2QXGA 2FTMA 4ISHH 1QA0A 3T25A 1CT2E 1LHDH 2VH0A 3H7TA 3NWUA 2PKSB 1GI1A 3TH2H 3MO6A 1GBCA 1AE5A 4Q7YA 1GI8B 1GHVH 3SU5A 3VB6A 2PFEA 3ZVGA 1EAWA 1RJXB 1T4UH 2KR7A 1PPGE 4NG9H 2CMYA 1H9IE 2A0QB 1F5KU 4Y8ZA 1N1LA 1EB1H 2K1QA 4NSYA 1CA0B 1W2KH 3HGPA 1P57B 3URDA 3LOXA 4JYVH 3IWMA 4DIHH 5DSFA 2THFB 3SU3A 2FTLE 2FYQA 2EQNA 4B71A 1Q31A 1QB9A 2XWAA 1K1IA 3ENSB 1CHOG 1ESAA 1UTJA 3SORA 2KCPA 1HAGE 1Y5UT 3KEEA 5JBTA 4F55A 1EZSC 3V3MA 1C2HA 5EPNA 2ZDAH 4YT7H 3MO9A 2ZFQH 1A5IA 1AUTC 4I33A 2ZI2H 1BDAA 1MQ6A 1VITH 4JZ1A 4X1PU 2TRMA 2BD3A 1EASA 1C2EA 4NGAH 1L1JA 1PPFE 3M5NA 1MUEB 2J98A 1TGBA 1ZZZA 1C5UA 3ESTA 1XVMA 3CNRA 5IYTA 5SGAE 1LVMA 3QO6A 8GCHF 4MG3A 4BAOB 2UUJB 2R2MB 1WQVH 3ZZ6A 2ZF0H 2JIZD 2KX4A 1O2MA 1AO5A 3RXHA 1FAKH 2NU4E 2EA3A 1O3NA 2ILNA 3F2FA 2J95A 1UMAH 1YLNA 2P8OC 1P10A 5EJLA 3SNBA 1AE8H 4NA7A 3EA8A 1BOQA 1QQUA 1B5GH 1RXPA 5FCRA 3M7QA 1ZYOA 3HATH 2ZC9H 5C2ZA 1HLTH 3S9BA 1Q3XA 5GDSH 3A8CA 2XNDD 3DD2H 2XRCA 1YPEH 2ZDLA 1BTXA 3ZV9A 2ZFTA 1KTSB 1TB6H 4CRAA 2HALA 1Y3YA 2BDBA 1UTKA 1ZHRA 4RT0A 3N7EA 2FDAA 1NU7B 1A3BH 3F6UH 1EJAA 4ACAA 2F83A 5JYIA 4AX9H 1FDPA 3MO3A 1OWHA 5FX6A 4O03A 2WPLS 1WBGB 2M5TA 2ZU1A 1YWUA 3M7TA 2PKAB 1F5RA 2AS9A 1MTUA 2ZA5A 2O9QA 4D8NA 1W7GH 4ZKSU 2ZDMA 3KYGA 2H5CA 1ZMLA 1TGTA 2ZNKH 5CHAC 2PSXA 3LH3A 7GCHF 4K1EA 1O3AA 5DN6D 3NKKA 1GMHG 3ELAH 3K6YA 3GS9A 2FOAA 2GGVB 2JKHA 1C1TA 5HMAA 1BMAA 1W8BH 3N7DA 3ITIA 2PTCE 5FAHA 2ZFSA 1QRWA 2HPPH 2G4UA 3U8OH 1UTLM 1SPJA 2FS9A 1WUNH 1V2ST 2V7QD 2Y5HA 2A7HA 1JRTA 2L6OA 1SLWB 3PO1B 1UTPA 2BOHB 3T27A 3UR6A 1GI3A 1VGCC 1BQYA 1NN6A 1XUKA 3GISB 3ATIA 5DG6A 4NA9H 4X8TH 3P95A 1LO6A 3UWJH 4F4OC 2QE7D 1FIZA 3BTME 1C2JA 1KXCA 1Y3VA 2DUCA 3MU0A 5ESTE 3SI4H 1AVXA 2FXRA 4FUIA 3ZYDA 5HXFA 2GKVE 1FPCH 4X0WU 3U9AH 4OS2A 1HAPH 1ZMNA 3VXFH 3BG4C 1CHOF 1GCTC 3A81A 1OOKB 3K6ZA 2BVSH 3MOCA 3BG8A 4UD9H 3FAOA 1SQTA 1XM1A 3HPTB 4IBLH 4TPIZ 5EW1H 1TLDA 2CJIA 3SO3A 1L1NA 2XOKD 2P95A 3HGNA 3TJNA 1BZXE 4JZFH 3PRDA 1L2EA 2W3IA 2TPIZ 5A8XA 5C0UA 3SYJA 2AIQA 4WH8A 2P3FH 3F2GA 1F0TA 1THRH 5AF9H 2VJ1A 3UQOA 2V3MA 2F9UA 2ZGXH 1NBMD 1AWFH 1XXDA 3B8JA 4JZDH 4A1TA 1SGRE 1C5PA 1S82A 4MVNA 3OY5U 2RFKC 1FZZA 2WINI 3TVJB 1GG6B 2ZDVH 1SSXA 1N8OB 3EA9A 2IJD1 3NPSA 3GDVA 1IQLA 3OFND 1V2MT 1EXFA 1UTQA 1GBJA 1WSSH 2I6SA 2PKAA 2BLVA 2OQ5A 1LCYA 5KGOA 3OEHD 1COWD 1P01A 4LZ1H 1Z6JH 1DANH 2ZU5A 3LC5A 1XUFA 1NS3A 1H4WA 2YOLA 4A1VA 4TWYA 3SU4A 2FOGA 1ANBA 4OS4A 5J4QA 4ZUHA 3VGCB 1EZUC 1BBRE 2WPHS 3BTTE 3GY2A 3M37A 5DPAA 2CN0H 3SU6A 4ZKRU 1C5WB 1O3OA 1WYKA 5F53A 3SV9A 3VPKA 2V0BA 4UFGH 1XUJA 1GVKB 1MKXK 3OSYA 2H1UA 4X2XA 1O2ZA 3RU4D 1O3BA 1V2NT 4DW2U 3K9XB 3LGTA 1GDNA 1HIAB 4Z0KA 4ZMAH 3BEIB 2AH4X 3ZVCA 1SGQE 1AZ8A 3QTVH 4AB9A 3RXRA 3S0NA 4X6MA 1MBMA 1GJ9B 2PP6A 1GMHF 1EOJA 1XUGA 3W94A 3EAJA 3A7YA 2VBCA 2ZFRH 1IOEA 1O3HA 2FLBH 4ABIA 1MD7A 5K0HA 1GBLA 3V0XA 1V2PT 2GT7A 2SNVA 2Z3EA 4J1YA 2BD4A 3U69H 4B2CA 4ASUD 1A46H 7ESTE 4X2YA 3LT3A 1HAVB 1LDTT 2EC9H 3LH1A 1TX8A 3D23A 4KTSA 2VH6A 1F0SA 3RC6A 1TMBH 4XBBA 3F68H 5FPYA 2R3YA 1MZAA 3S9AA 3STIA 1GPZA 2R0KA 1T8OA 2VIPA 3O8DA 2C93B 4INKA 2W5EA 2PLXA 1FQ3A 1D9IA 2LNCA 4ABFA 4Y10E 3BTEE 5C1YA 3DSGA 3ATMA 2I6QA 2Y5FA 4NWLA 2G00A 2GD4B 2PUXB 1FY3A 2VIDA 1WXRA 1DUEA 4AFQA 1QBOA 4RSPA 5DP8A 2BD5A 4THNH 3TNTA 1GJCB 2R2WU 2QAAA 4SGBE 3TGKE 4MLFB 3FN8A 2FM2A 2B0FA 2OC8A 1A2CH 2LELA 3K65B 1BCUH 1J15A 5TCCA 4OGXA 1C5ZB 1CQQA 1ZTJA 2BDYA 1OWJA 2FZZA 4FVBA 4Y8XA 1ARBA 2OLGA 2FOMB 3EA7A 4H4FA 2H6MA 2Z94A 2AGGX 3UY9A 3A8DA 4X6OA 2IJOB 1ETSH 3SHAH 1ELGA 4Y76A 1MTNB 1HJAC 4YESB 3QDZB 2AMPA 3UOUA 1O3DA 1UK4A 2Z9IA 4X6PA 4BAQB 1GL0E 1AGJA 1W7XH 3RXGA 1IQGA 1GJAB 1P3CA 3TJVA 2WUCA 3AAVA 3SHCH 1P03A 1P9SA 4DJZB 2V6NA 2HNTF 1F0UA 4KTCA 3WWBA 3K2UA 5FBEA 2FEQH 1F5LA 1O39A 1GJ7B 1Z71A 1GJ4H 2BD7A 1HBTH 3T2NA 5J4SA 3C1KA 2WZQA 1EAXA 1V2OT 5LPRA 4AFSA 5LPFA 2ZU3A 4Q7ZA 5HM9A 4DIIH 1SVPA 3B23B 4O97A 3E3TA 2ZZUH 1TGCA 3ZVAA 3EE0B 3SQHE 1N6XA 2Q6FA 1TFXA 2YMSC 2VWMA 1N8OC 1O2GH 1TOCB 1KLTA 1MH0A 4M9FA 5FHTA 4X1SU 2BZ6H 2ZHFH 1LHCH 1C2MA 1SFQB 2V35A 3TITA 4D7FA 1SMFE 2G8TA 3TGIE 3ODDA 1YPMH 1MKWK 4WY3A 3RM2H 1BHXF 2BOKA 3M7UA 5IK2D 3NK8A 2EEKA 1V2WT 1QHRB 1S6FA 2F3CE 2FYRA 3VGCC 1FY4A 4OS7A 3QLPH 2V3HH 1JIRA 1CA8B 4BTTB 1V2QT 1BTZA 4RKOB 1FY8E 3E0PB 1TRYA 1FPHH 1QRZA 3SJIA 3KQCA 4E05H 1MABB 4YOGA 1QNJA 3FZDA 1KXDA 4NZQA 1DSUA 2ZDKA 3PLPA 1YPHE 2FI4E 5GPIB 4CR5A 2ZHDA 1QJ7B 1ANEA 1M9UA 4FUJA 1XVOA 2FPZA 1HAXB 4I8LA 2HLCA 1O3CA 1SLUB 2XW9A 3ZZCA 1TMTH 1TQ0B 1SL3A 5IDKA 1G32B 1UJ1A 1IHTH 2VWOA 1PQ8A 3MH5A 3OAAD 1NRNH 1B0EA 2BD2A 5LGOA 2GZ9A 4INHA 1KLIH 3A7WA 1C1RA 1BRCE 2RG3A 2A31A 1ETTH 3RC5A 2GZ8A 5EQSA 1SHHB 1O2QA 5HIZA 4AG1A 1O2KA 1G36A 2ZHWH 1C2LA 1DPOA 5C20A 1TE0A 4AZ2B 3DUXH 4Y11E 5C3NA 2UUYA 1P12E 2AMQA 2ZHEH 3PMBB 3BEFB 4Q4LA 1FN6A 2HNTE 5CHAB 1S5SA 2FO9A 4SGAE 4TT3D 2SGFE 1YLCA 4RI0A 1O37A 4CH8B 5C67A 1DLEA 1PYTC 3F1SB 3Q77A 1RTFB 4X1QU 1BHXB 1GBAA 3WW7A 3ZVFA 4BANB 2VIWA 1AZZA 4Z1MD 2WPMS 5CMXH 3RXUA 3GY4A 1GVLA 1K1MA 4UFEH 1IQMA 2Z9KA 2LP6A 1YPKH 2D1JA 1ELEE 3B9FH 3EYDA 1TPSA 3GOVB 1ELFA 1YLDA 1C1VH 3RXEA 4TY6A 2TBSA 1NFYA 4MPVA 1OP8A 3AK5A 1TBRH 3H5CB 5C0TA 2DE8A 1SGNE 2VIQA 1D3QB 3CP7A 3TU7H 2M2AA 1FMGA 1HAZB 4XD7D 3RMNH 1SOZA 2A4GA 5T6DA 1NTPA 1J14A 1SHYA 4H6TA 2UWOA 1E0FD 2UUKB 1QBVH 2ALVA 1EQ9A 1GMCG 2ZGHA 2WV4A 1KMHB 1KIGH 1TIOA 1QGFA 2FESH 1K1OA 2BY8X 5GIBA 3BG4B 3U98H 3O8CA 5FPTA 1MCTA 4UE7H 3P17H 1YY3A 1INCA 1G9IE 2D8WA 1MTSA 4FOUC 3F0PA 5HKKD 3DHKH 1Y5AT 4A1XA 2QGRA 1G3DA 2G55A 2EI7A 4E7NA 3OTJE 3MWIU 3DSOA 3RDZA 1C5MD 2AFQB 5DO4H 1GI2A 1UHBA 3ATLA 1TABE 3RXKA 4D9RA 1MTNC 1NFWA 1V2JT 5EQQA 1OWIA 1C4V2 5E0GA 5EW2H 3F9FA 1O2JA 4I8KA 2GDDA 4ISIH 4YM9A 1HB0B 2GMTB 1VITF 4HI3A 1AU8A 1W0KD 1DUAA 1JXPA 3FO8D 3RC4A 1WQSA 1RIWC 2BY6X 4I32A 1SGFA 1J17T 3SU2A 1AN1E 3BTFE 1C4U2 3ZZ9A 8ESTE 2ZU4A 3ATKA 2UUFB 4TWWA 1H8IH 1PPCE 1GJ5H 3ZZ8A 3QK1A 3UOPA 3E1XB 4I86A 1V2KT 4Q80A 1GMDF 1O3IA 2GCTB 4X8UH 5DP4A 1K1PA 6GCHF 1TBQH 4GAWA 1AFEH 1LPZB 3LIWA 1GHBF 3RXTA 1FN8A 1TBZH 1V6DA 1XKBC 2ASUB 1C5RA 4KGAA 1YPHC 4Y79A 1DX5M 1AI8H 4ABGA 3GCHB 3PB1E 2ZPQA 2A1DB 4K8YA 3TH4H 1W13U 1J9CH 1KSNA 3KNXA 1AIXH 3M35A 1ID5H 2Q6DA 5PTPA 5C5OA 1EZQA 3RXMA 3ZVBA 2QIQA 2Z9JA 4ZXXH 1FLEE 1VZQH 2ESTE 1IHSH 2W7SA 4UDWH 4D7GA 5EIYA 1TX6A 4AYVB 1B0FA 4AYYB 3OYPA 2ANMH 1IAUA 1TA2A 3UIRA 4A7IB 4AORA 2HNTC 4YLUA 4FUFA 2FIRH 1SG8B 1QB6A 3FP7E 3W95A 4ABAA 1P05A 1O2PA 1PYTD 1BBRK 1EFRD 2HOBA 2XYAA 5L6NH 1O2IA 1YCPK 3GY3A 1O2HA 1ZOMA 1N6YA 1NO9H 1C5VA 1GGDB 4CRDA 1QJ1B 2BQ7B 1HYLA 1ZPCA 1BA8B 1GBEA 2P93A 3AW1A 4MNXA 1SR5C 2O8WA 1NFUA 5JBBS 1BB0B 2J2UA 3ZZAA 3RXSA 2PGBB 5L2ZH 1Z8RA 1VCPA 3WWFA 1NROH 3M5LA 2ZPSA 2QC2A 1ABJH 1TMUH 4YO9A 1DSTA 1LMWB 2F9VA 3VG8A 5DP7A 3P70B 4LZ4B 4VGCB 3UNQA 1MBQA 2F4LA 2VINA 3PRBA 2ZFPH 2Y82A 3GY7A 3KQBA 3QUMP 1W14U 1MD8A 2BZAA 1GJDB 1GI9B 2QXHA 4K3JA 3MH6A 2QF5A 2TGAA 2HLDD 1QA7A 1RFNA 4Y0YE 5T6GA 4IC6A 1ZPZA 3MH7A 4FUGA 1QIXB 3U1JB 1O5BB 1WCZA 1EZXC 2FMJA 4OM9A 1FI8A 1SGCA 1FXYA 4AFUA 4NFEA 1G3EA 1OWDA 1E35B 1IQEA 1NC6A 1RTKA 2XTTB 1S0RA 2BTCE 4OS5A 3MU8A 3ZIAD 1Y3UA 2RDLA 5EGMA 2O8UA 4X8VH 2BQWB 2B7DH 1DVAH 1W0YH 2A5IA 2GVFA 5TCAA 1SBWA 2SFAA 2SNWA 5EXMA 1HJAB 1J16A 1DY9A 3PTBA 3RM0H 4TY7A 1EB2A 1V2VT 5L30H 1PPHE 4MPUA 1GBFA 1UW7A 4B73A 1O34A 1W10U 3R0FA 1C5YB 2VVUA 1WAYB 1T7CA 3BEUA 4FETA 1ELVA 2W6ID 4GCHG 3QTOH 1SOTA 3I29A 2AERH 1BBRH 1IQIA 3RXVA 1XKAC 2H5DA 3TJUA 1O2UA 1J8AA 3N99A 4ZHLU 1TRNA 2GP9B 2UWLA 3D62A 2IN2A 1P9UA 3ODFA 4CRFA 3D49H 2STBE 1GI0A 1G3BA 3FOAA 1OWEA 4HG6A 2AIPA 5EXNA 1FNIA 4CBNA 2QF4A 4KKDA 5EQRA 2GMTC 1C5QA 2DE9A 4X1RU 1ZGVA 4XOJA 2VVCA 1H9HE 3KCGH 2Y5GA 3QZRA 3A87A 1TPPA 5CDFE 1HNEE 2YMSB 4DOQA 1C5NH 2NU2E 4Z6AH 2EI6A 1OKXA 1YYY1 2XWBI 2PSYA 1ZRKA 1HAHH 1UVPA 4GUXA 3UPEA 1K2I1 2C8WB 3ZYEA 5LH8A 4TPYA 1O3PB 3SQEE 1P2OA 4B2AA 1P2QA 3UNSA 3PTNA 2BDGA 1SGIB 2IPQX 2GCTC 1QCPA 3S7KB 1QY6A 5FPSA 1HPGA 3PV5A 3FVFB 3UQVA 1YC0A 5GXPA 3GCNA 4B6EA 1NU9A 1ZMJA 4IN1A 1ZGIA 3RXAA 4F49A 1A0HB 5DP3A 5F8ZA 3RMLH 3GCTG 4CRGA 3PMAB 1DXPA 3GCHC 2XXLA 2OP9A 5F8TA 1P3EA 1F7ZA 1AY6H 1LTOA 4BTIB 3I78A 2PHBA 2EY4C 2FS8A 4ABHA 4AGKA 4F48B 5I46H 1FX0B 1OP2A 2ZDNA 5HM2A 1GHAG 4JYUH 1P2IA 3T28A 3T5FH 2J4IA 2LPRA 2XBYA 3SNAA 2BY7X 1D3PB 3P8NA 1O5EH 4IS5A 3MNCA 3NCLA 3LDXH 1O2VA 5AFZH 4ABDA 1DWEH 1QURH 2TGDA 2AGEX 1ZTLA 4QT8C 1GJ8B 4WXVA 5C94A 1EATA 1SLXB 1O31A 4D9QA 1SGEE 1NT1A 3STJA 1L1GA 1H8ED 1LHGH 2ZQ1A 3LJJA 1GGDC 1EKBB 2SGPE 3LGVA 3MU4A 4RKJB 4ZROA 5JBCS 2C8ZB 3RLWH 2BVRH 2Q6GA 1AB9B 3RXOA 1A5GH 3CS0A 2VGCC 2OQUA 2KFWA 1C1PA 1O2LA 3OY6U 1CVWH 1KY9A 2R9PA 6LPRA 3U8TH 2JJ1D 3BTHE 4UFFH 1JOUB 2BX3A 3P6ZB 1MQ5A 4VGCC 3FKSD 4ABJA 2PV9B 1Z6EA 1L4DA 1B7XB 2QV1A 2VWLA 2AEIH 3RXQA 1QRXA 1IQNA 3KYFA 3Q3XA 4K1TA 3BTDE 4NIWA 3SZNA 3V7TA 2EI8A 5F6MA 2QYIA 2O8MA 3L6PA 1TNLA 1OP0A 2AHME 1YM0A 4GHQA 2C90B 3ZVDA 1EPTC 2KM0A 1CO7E 2A32A 1GBMA 1THPB 1VR1H 1C9TA 1QL9A 1PQ5A 4HGCA 1HCGA 1TNGA 1ZSKA 4DCDA 2F9PA 3KQEA 1LHFH 4IN2A 4DT7B 1P04A 3LGIA 1GDQA 5DP6A 1T8NA 3MFJA 5A8YA 4OS1A 1MKXH 1IQKA 3MTYA 1PQ7A 1AKSB 5C5NA 4WVPE 5EXLA 1H8HD 1F2SE 4GPGA 1Z7KA 1Y3XA 3GYMA 2FX4A 3KN2A 4U01A 3SNEA 4DGJA 3GDUA 1YBWA 3RXBA 1O2OA 1D3DB 1P2KA 4O3UA 2AYWA 3RXLA 1PFXC 2KCOA 5EG4A 1S85A 3AAUA 1IQHA 1CGJE 1HIAA 1T4VH 4XFQA 3RP2A 2P16A 1ETRH 4X2VA 1LQEA 1W0JD 3NXPA 2Y81A 1ORFA 3TGJE 3A7ZA 3M36A 1RIWB 3F3BA 2FOHA 1TGNA 8LPRA 5AFYH 3F2HA 3SV7A 3ZZ7A 1QZ8A 2Z3CA 5A0AE 4FU9A 1K0HA 2BLWA 3HKIB 2G51A 2YNAA 2BDCA 3KIDU 3TK5A 1TPAE 2P94A 1HAVA 5C1UA 2GV6A 3A86A 3A8BA 3BTWE 3AVZA 1YPGH 1P2MA 3DFLA 1ARCA 2ZWLH 1GHAF 1QR3E 1KYNA 4UFDH 1V2LT 1D6WA 2P3TB 1H9LB 1TAWA 1Z8IB 4A92A 1ZJKA 2OC1A 4CBOA 3I77A 4B76A 4MTBA 1K9OE 2FP7B 3RXIA 3AASA 1S81A 1O3JA 2H2ZA 4KP0A 2A2XH 5KECA 2FLRH 1GBBA 2BY5X 2C8XB 1BTPA 2F43B 1C9PA 3M5MA 5T3HA 1GI7B 1DT2A 1MTWA 5TJXA 2QXIA 2VU8E 1LPGB 3DCLA 5EJZA 4BXWA 2W26A 1QB1A 3BTKE 2B8OH 1A3EH 3A89A 4XDEA 2OBOA 2JH0D 2VWNA 1K21H 4XSKU 4RN6A 1O5FH 3MNSA 1O32A 1P11E 1AHTH 1MMJN 5L2YH 3S7HB 2OXSA 3FZZA 3SGBE 1D3TB 4WMFA 1DM4B 1QJ6B 1FY1A 5GCHG 2VIOA 2FOEA 3RMOH 5DP5A 1UCYE 1GBHA 2GZ7A 4ISOA 1E1QD 3RXCA 1F0RA 1AKSA 1GBKA 4MPXA 4CRCA 1O3KA 3FFGA 3PYHA 5AVDA 3SJ8A 1VCQA 1C5XB 1GHYH 2B5TB 4JCNA 4R0IA 3SUEA 1BMMH 2A7CA 3KQ5A 5C1XA 3M61U 1C5OH 3OU0A 3MNXA 3TH3H 1O2NA 2RA0A 3MMGA 2C8YB 5E0JA 2L74A 5HIYA 1ABIH 9LPRA 1MU8B 1K1NA 4ASHA 3MH4A 1MAXA 1DFPA 8GCHG 3KL6A 1Z1JA 1XXFA 4Y8YA 2J94A 1DICA 2FOCA 2V3OH 3ZZ3A 1AB9C 3SGAE 3S9CA 4JZIA 1HAIH 1S83A 1LKAA 5AHGH 1QL8A 4JMYA 3SUGA 1TNIA 4NCYA 1UVUH 2QN5T 4B2BA 1TGSZ 3KHVA 1H8DH 2CGAA 2Z9GA 1P06A 1O2SA 3QGNB 4P02A 1T8LA 1LKBA 1NESE 1TOMH 3LU9B 5DGJA 2UWPA 3JZ1B 3SOSA 1JWTA 4K2YA 1TQ7B 2J98B 1KXEA 3TLOA 1MKWH 4YOJA 3ZV8A 1BMNH 4YT6H 4B74A 1AWHB 5A8ZA 6ESTA 4BTUB 4B1TA 1NRRH 2XC0A 5EJ1A 2AGIX 1O30A 1C2FA 3DFJA 1ZTKA 2JJ2D 1A5HA 1MU6B 4U30A 2H9EH 4INLA 1QL7A 2GX4A 2H9HA 1YPLH 1ZLRA 3O8BA 4E06H 1XMNB 2FODA 3ZZDA 1TWXB 4FVDA 1TA6A 1EUFA 1G3CA 4ZKNU 1V2UT 4LOYH 2WHXA 3VB7A 2OBQA 1DS2E 3H7OA 6CHAB 1V3XA 4FUHA 1G30B 2JDID 2YMSD 2KAIB 3P8GA 1BRBE 4ZXYH 1O5GH 3Q3KA 1ZPBA 1SGTA 4K5ZA 3SNDA 5EOKA 3HK3B 5B6LA 4IW4E 5FX5A 2HVYB 3U28C 3F9EA 3E90B 2A4RA 3MNBA 1DLKB 4Y7AA 1K1JA 3EE7A 4MNYA 1VJAU 4YOIA 2OCVB 1A0JA 2BD8A 2F9BH 4GLYA 4M7GA 1NRSH 1V2TT 4AGJA 3DA9B 3T26A 1RRKA 2G4TA 2OTVA 4YTAA 1HJ9A 1D6RA 2ZG0H 1E34B 1P8VC 1C5SA 5E2PA 3LPRA 3S69A 1WV7H 1U6QA 3UAIC 1C2GA 5JBAS 5A0CA 2ZCHP 4A6LA 4NIYA 2Y80A 4JK5A 3MYWA 1YKTA 3ZVEA 5T6FA 2ZTZA 1LPKB 2OINA 1BTHH 4Y71A 1TRMA 3WY8A 1ZR0A 4CRBA 4BNRA 5GCHF 3EQ0H 1IQJA 2Y6TA 4AOQA 1S84A 3IG6B 3TJOA 3F9GA 1DDJA 1GHWH 4ESTE 1SGDE 1EAIA 3A83A 4BAMB 1BTWA 2HPQH 2ZPRA 2FI3E 5KEDA 2HWLB 1SC8U 1W11U 1C1MA 1P02A 4AG2A 1ZJDA 4ISLA 2GJGA 1G37A 3RU4T 2J5UA 1JIMA 5DP9A 1MZDA 2ANKH 2A4QA 4U2WA 2ZGJA 1S6HA 1GL1A 2Z9LA 2YNBA 2ZGBH 4ZHMU 1FONA 4LK4A 2XNIA 1O2YA 1E38B 5ESBA 2GTBA 1GJBB 3NZIA 3SUDA 2W6JD 1C1UH 3EGKH 1EOLA 4WMDA 1XUIA 4I8GA 3L3TA 3MHWU 2SGDE 1CBWC 2XC4A 3A7VA 1HXFH 1Z8GA 3P8FA 1HRTH 1DITH 1VCWA 4WH6A 2IPHA 4D76A 1GHZA 2OD3B 2BMGB 2J34A 5DJ7A 5ETXA 1LVYA 2Y7ZA 1BRAA 1CT0E 1JMOH 2GV7A 1IQFA 5G4BA 4FUBA 2FWWA 2ZGCA 3VFEA 4IMQA 5HYOA 2IOTA 3QN7A 2K8IA 4H6SB 2SGEE 2VGCB 1EX3A 5A2MH 3RMMH 3MU5A 2A2QH 4R8TB 3LGWA 4WJG2 2KAIA 2PW8H 1GMCF 1E79D 2ODQA 1SQAA 4Q63A 3BN9A 4WF8A 3KGPA 1THSH 1EJNA 3EDXB 3BTGE 2PR3A 3RLYH 5B6OA 4P00A 1KDQB 2CF8H 2Y7XA 1KLJH 1UTMA 5HGGA 5I25A 1T8MA 1AVWA 2WV9A 3ZZ5A 1PQAA 3SJOA 1AVGH 2FOFA 2HVXA 3MQKC 2VVVA 5BPEA 1G2MA 1O5DH 1AD8H 4RT1A 4BXSA 4CH2B 1EPTB 2BY9X 2AMDA 2ALPA 2ZP0H 1HFDA 1NRQH 4YZUA 3P92A 3LC3A 2RA3A 1OWKA 4DVAU 1OYTH 1PPZA 1LVOA 3D65E 3LGUA 4NZLA 2ZCKP 4K69A 3A88A 3LONA 2ODYB 3GYLB 4GSOA 1GDUA 2BLOA 4Q7XA 5DK1A 1FIWA 1SQRA 1O3EA 3PMHB 2PTNA 1W12U 2KCAA 1DY8A 3QX5H 2HGTH 1C5LH 5EPYA 5JPMH 2ANWA 2R0LA 2RCEA 1OPHB 3GY6A 3SUFA 4X6NA 1ELCA 2PGQB 3UTUH 1GBDA 3DT0H 1DE7H 3FANA 5E8EH 2QY0B 2ZO3H 1DWDH 3BIUH 1GI5A 2F9NA 4ZAEA 2BQ6B 5ABWA 1UVSH 1SLVB 4K60A 3KF2A 1GBTA 1SKYE 2BM2A 1PPEE 2ODPA 3UFAA 1BJUA 1QTFA 1XX9A 4FUEA 1O3GA 2XCFA 5GJ4B 5FBIA 2XCNA 5E0HA 2OK5A 1O36A 1C1SA 1A61H 1YCPH 1O3MA 1O2RA 5JB9S 3G01A 4ZH8A 6CHAC 1Z1IA 5F8XA 1KXBA 1UK3A 4E7RG 3E16B 1RTLA 3O8RA 1SI5H 1BUIA 4Q2KA 3SI3H 2A5KA 3V13A 1ANDA 1CSOE 1O0DH 4Y0ZE 2O8TA 3DSPA 4X8SH 1LQDB 2Q1JA 2ZHQH 2JETB 3A84A 2PKSC 1HAOH 3CS7A 1CU1A 3E91A 3VB5A 1E37B 2GT8A 1A7SA 1RD3B 3VEQB 3HK6B 1Y8TA 1MTVA 1SB1H 4DURA 5JDUB 4I8HA 1JBUH 1TYNA 3W1EA 2WPDD 4IGDA 1CA0C 3F9HA 1DXWA 2CK3D 2VB0A 4NA8A 1BRUP 1YP9A 2BYAX 1KDQA 3RXPA 1T31A 3PLBA 4AN7A 1C5TA 1JRSA 2WYJA 1ESBA 5FXLA 2PUQH 2BLQA 4NIXA 1C1WH 1LVBA 2CV3A 3SNCA 1EPTA 3Q3YA 1BTUA 3QZQA 4GHTA 5DKMA 1UK2A 1K28D 2WPKS 3GICB 5F03A 4FU7A 5E2OA 4MQAA 1ELBA 1D4PB 4WXIA 4ZCNA 4BOHA 1WTGH 1OS8A 3OEED 4ABBA 2BXUH 3SZEA 1C1OA 4CHAB 1Y59T 4MNWA 2W7UA 1HUTH 2SGQE 2OC7A 4X1NU 1OHHD 4TYDA 1P2JA 3PMJA 4FU8A 3SJKA 1NFXA 1WTHD 2G81E 4XBDA 5FL7D 1CE5A 4HTCH 3R3GB 1O3LA 4K8BA 2A45B 4UONA 1SGFG 1O5CB 1AFQB 2FI5E 2XBXA 1H1BA 4U32A 2A5AA 1WDIA 1A1RA 1TNKA 1NPMA 3CENA 2CHAB 4KELA 4Y7BA 3QGJA 1FV9A 3LJOA 3H09A 3NRLA 3MI4A 1E36B 2OUAA 2ZU2A 4MDSA 1CGIE 3U8RH 3GCOA 2ZIQH 1RS0A 4NWKA 2FOBA 1HJ8A 4HFPB 5T1VA 2G5VA 7LPRA 4AFZA 3TIUA 1QBNA 5LPEA 2XBVA 3GY5A 1UCYK 3PWCA 2GDEH 1FJSA 1FAXA 3FP8E 1RGQA 2D26C 1O2WA 3UUZA 2NWNA 1DWBH 2NU0E 1UVOA 1X7AC 4JK6A 1C1QA 1HGTH 1P0SH 3BSQA 1O35A 2QCYA 1L0ZA 2TGPZ 1Y3WA 4YXWD 5A09A 1C1NA 3SU0A 4ISNA 1PPBH 4IC5A 3Q00A 3U1IB 4GCHF 1EAUA 3SN8A 2KZ4A 1Q2WA 1CGHA 3VXEH 1O38A 1V2RT 3BTQE 1A0LA 1BIOA 1W3CA 2ZTYA 2J92A 2OC0A 3ZZ4A 1BITA 1YCPM 3SU1A 4TSFD 1P2NA 3PROA 1KTTB 3A8AA 4BAHB 1EP5A 4BAKB 3PM3A 4JZEH 3MU1A 4ACBA 1BMLA 5A0BA 2K0QA 2Z6BD 1ELDE 1NRPH 2GCHG 5BRRE 7KMEH 2ANYA 1GI4A 4Y6DA 2P3UB 3M5OA 4NFFA 2C3SA 1NY22 3NUMA 3GDSA 3Q76A 3RXJA 3A82A 3KQDA 1HDTH 1L4ZA 3PO1C 1K1LA 1OSSA 2XC5A 2VNTA 3HKJB 4GVUA 4FUCA 4J2YB 1C2KA 1SFIA
chains in the Genus database with same CATH topology
3M3SA 1BT7A 1AUJA 1TONA 2SGAA 4FXGH 1YF4A 3E6PH 1TNHA 3GCTF 1GI6A 4AB8A 2PWXA 1FY5A 2QF0A 4I31A 5K7RA 1DWCH 4IMZA 2NU1E 4XE4A 3TK9A 1UCYH 3SBKA 3SJ9A 2JETC 1O5AB 2BX4A 3PWBA 1K22H 2BVXH 4K1SA 3GY8A 1O33A 1O2XA 4JYTA 2Z7FE 1OXGA 2TIOA 5JB8S 2BDIA 2FX6A 2STAE 3BF6H 3PV4A 1GJ6A 2BD9A 1GCDA 3SW2B 2QXJA 1GG6C 4MPWA 3A85A 8KME2 1OX1A 1AMHA 3T29A 3N7OA 4B75A 1ANCA 1S0QA 2JH5D 4NIVA 4O3TA 3VB4A 4NSVA 5EU8A 1ZSJA 4HZHA 1BTYA 1VITG 1UVTH 2TGTA 4WWYA 1MCVA 1GVZA 5FCKA 4WMEA 1CBWB 2WUBA 1BJVA 1QQ4A 3M3TA 1GBIA 3UNRA 2P8OB 1ESTA 3E0NB 3RXFA 4CHAC 2ZEBA 2JH6D 2BDHA 3M3VA 4UEHH 4FUDA 3JZ2B 2WV5A 3E8LA 3SV2H 1OYQA 4ABEA 1Y5BT 4ZHAA 3TPIZ 1C2DA 1MAYA 1HV7A 1UHBB 4LXBH 1QFKH 1WOFA 4ZKOU 1EP6A 1GMDG 1ELAA 2F91A 1AFQC 4OS6A 6GCHG 2WPJS 2BB4A 3OX7U 4CR9A 9ESTA 2BXTH 3VB3A 1GWAA 1GHBG 1EJMA 1XUHA 1ACBE 1SQOA 2CHAC 2ULLA 2ZTXA 2BHGA 2XBWA 1LHEH 1WU1A 1UO6A 1F92A 2HRVA 3FP6E 3TNSA 2WYGA 3A7XA 2QA9E 1PJPA 3A80A 1ELTA 1G2LA 1T32A 1DOJA 1ZRBA 1YGCH 5CE1A 1SGYE 2A7JA 3BIVH 1TX7A 2GCHF 1TALA 1VJ9U 3URCA 4CREA 1C4Y2 3RUOA 2G52A 1CT4E 3BV9B 1KXAA 1ZHMA 3L33A 1FUJA 3C27B 3A7TA 1GHXH 2Z3DA 2ZECA 1W0ZU 2O8LA 2P59A 3AW0A 1O3FA 2R3UA 3T62A 2VIVA 2C4FH 1YPJH 3UREA 1AQ7A 1TPOA 4I7YH 3P8OA 4DY7B 3PLKA 1HAYB 2ZCLP 3RU4E 1TNJA 2ZFFH 2CXVA 1NM6A 5H4IB 1UTOA 2QF3A 4DG4A 1Z8JB 4XBCA 2F9OA 3UR9A 1VGCB 1HXEH 2ZQ2A 3ATWA 3IITA 2NU3E 2W3KA 1P09A 2WPIS 3SV6A 2BDAA 4YLQH 4H42U 3SGQE 4O9VA 4A5TS 4PROA 4X2WA 3QWCH 3TK6A 1ZSLA 2A4OA 2CF9H 3RXDA 1KXFA 2B9LA 4OGYA 2J38A 3UWIA 4I8JA 4MNVA 4KTUA 1GCTB 5EODA 1C2IA 1A4WH 2G5NA 7GCHG 1O2TA 5GWZA 3LKWA 1SGPE 2H9TH 1UTNA 2ZKSA 1ZHPA 3V12A 2D2DA 1CHGA 1NZQH 3ZZBA 3LGYA 3SV8A 2J9NA 2QXGA 2FTMA 4ISHH 1QA0A 3T25A 1CT2E 1LHDH 2VH0A 3H7TA 3NWUA 2PKSB 1GI1A 3TH2H 3MO6A 1GBCA 1AE5A 4Q7YA 1GI8B 1GHVH 3SU5A 3VB6A 2PFEA 3ZVGA 1EAWA 1RJXB 1T4UH 1PPGE 4NG9H 2CMYA 1H9IE 2A0QB 1F5KU 4Y8ZA 1N1LA 1EB1H 2K1QA 4NSYA 1CA0B 1W2KH 3HGPA 1P57B 3URDA 3LOXA 4JYVH 3IWMA 4DIHH 2THFB 3SU3A 2FTLE 2FYQA 4B71A 1Q31A 1QB9A 2XWAA 1K1IA 3ENSB 1CHOG 1ESAA 1UTJA 3SORA 3KEEA 1HAGE 1Y5UT 5JBTA 1EZSC 3V3MA 1C2HA 5EPNA 2ZDAH 4YT7H 3MO9A 2ZFQH 1A5IA 1AUTC 4I33A 2ZI2H 1BDAA 1MQ6A 1VITH 4JZ1A 4X1PU 2TRMA 2BD3A 1EASA 1C2EA 4NGAH 1L1JA 1PPFE 3M5NA 1MUEB 1TGBA 1ZZZA 1C5UA 3ESTA 1XVMA 5IYTA 5SGAE 1LVMA 3QO6A 8GCHF 4MG3A 4BAOB 2UUJB 2R2MB 1WQVH 3ZZ6A 2ZF0H 1O2MA 1AO5A 3RXHA 1FAKH 2NU4E 2EA3A 1O3NA 2ILNA 2J95A 1UMAH 2P8OC 1P10A 3SNBA 1AE8H 4NA7A 3EA8A 1BOQA 1QQUA 1B5GH 1RXPA 5FCRA 3M7QA 1ZYOA 3HATH 2ZC9H 5C2ZA 1HLTH 3S9BA 1Q3XA 5GDSH 3A8CA 3DD2H 2XRCA 1YPEH 2ZDLA 1BTXA 3ZV9A 2ZFTA 1KTSB 1TB6H 4CRAA 2HALA 1Y3YA 2BDBA 1UTKA 1ZHRA 2FDAA 1NU7B 1A3BH 3F6UH 1EJAA 2F83A 5JYIA 4AX9H 1FDPA 3MO3A 1OWHA 5FX6A 4O03A 2WPLS 1WBGB 2M5TA 2ZU1A 3M7TA 2PKAB 1F5RA 2AS9A 1MTUA 2ZA5A 2O9QA 4D8NA 1W7GH 4ZKSU 2ZDMA 2H5CA 1ZMLA 1TGTA 2ZNKH 5CHAC 2PSXA 3LH3A 7GCHF 4K1EA 1O3AA 3NKKA 1GMHG 3ELAH 3K6YA 2FOAA 2GGVB 2JKHA 1C1TA 5HMAA 1BMAA 1W8BH 3ITIA 2PTCE 5FAHA 2ZFSA 1QRWA 2HPPH 2G4UA 3U8OH 1UTLM 1SPJA 2FS9A 1WUNH 1V2ST 2Y5HA 2A7HA 1JRTA 1SLWB 3PO1B 1UTPA 2BOHB 3T27A 3UR6A 1GI3A 1VGCC 1BQYA 1NN6A 1XUKA 3GISB 3ATIA 5DG6A 4NA9H 4X8TH 3P95A 1LO6A 3UWJH 4F4OC 1FIZA 3BTME 1C2JA 1KXCA 1Y3VA 2DUCA 3MU0A 5ESTE 3SI4H 1AVXA 2FXRA 4FUIA 3ZYDA 5HXFA 2GKVE 1FPCH 4X0WU 3U9AH 4OS2A 1HAPH 1ZMNA 3VXFH 3BG4C 1CHOF 1GCTC 3A81A 1OOKB 3K6ZA 2BVSH 3MOCA 3BG8A 4UD9H 3FAOA 1SQTA 1XM1A 3HPTB 4IBLH 4TPIZ 5EW1H 1TLDA 2CJIA 3SO3A 1L1NA 2P95A 3HGNA 3TJNA 1BZXE 4JZFH 1L2EA 2W3IA 2TPIZ 5A8XA 2AIQA 4WH8A 2P3FH 1F0TA 1THRH 5AF9H 2VJ1A 3UQOA 2F9UA 2ZGXH 1XXDA 1AWFH 3B8JA 4JZDH 4A1TA 1SGRE 1C5PA 1S82A 4MVNA 3OY5U 1FZZA 2WINI 3TVJB 1GG6B 2ZDVH 1SSXA 1N8OB 3EA9A 3NPSA 3GDVA 1IQLA 1V2MT 1EXFA 1UTQA 1GBJA 1WSSH 2I6SA 2PKAA 2BLVA 2OQ5A 1LCYA 4LZ1H 1P01A 1Z6JH 1DANH 2ZU5A 3LC5A 1XUFA 1NS3A 1H4WA 2YOLA 4A1VA 4TWYA 3SU4A 2FOGA 1ANBA 4OS4A 5J4QA 4ZUHA 3VGCB 1EZUC 1BBRE 2WPHS 3BTTE 3GY2A 3M37A 5DPAA 2CN0H 3SU6A 4ZKRU 1C5WB 1O3OA 1WYKA 3SV9A 3VPKA 2V0BA 4UFGH 1XUJA 1GVKB 1MKXK 3OSYA 2H1UA 4X2XA 1O2ZA 3RU4D 1O3BA 1V2NT 4DW2U 3K9XB 3LGTA 1GDNA 1HIAB 4Z0KA 4ZMAH 3BEIB 2AH4X 3ZVCA 1SGQE 1AZ8A 3QTVH 4AB9A 3RXRA 3S0NA 4X6MA 1MBMA 1GJ9B 1GMHF 1EOJA 1XUGA 3W94A 3EAJA 3A7YA 2ZFRH 1IOEA 1O3HA 2FLBH 4ABIA 1MD7A 5K0HA 1GBLA 3V0XA 1V2PT 2GT7A 2SNVA 2Z3EA 4J1YA 2BD4A 3U69H 4B2CA 7ESTE 1A46H 4X2YA 3LT3A 1HAVB 1LDTT 2EC9H 3LH1A 1TX8A 3D23A 4KTSA 2VH6A 1F0SA 3RC6A 1TMBH 4XBBA 3F68H 5FPYA 2R3YA 1MZAA 3S9AA 3STIA 1GPZA 2R0KA 1T8OA 2VIPA 3O8DA 2C93B 4INKA 2W5EA 2PLXA 1FQ3A 1D9IA 2LNCA 4ABFA 4Y10E 3BTEE 5C1YA 3ATMA 2I6QA 2Y5FA 4NWLA 2G00A 2GD4B 2PUXB 1FY3A 2VIDA 1DUEA 4AFQA 1QBOA 4RSPA 5DP8A 2BD5A 4THNH 3TNTA 1GJCB 2R2WU 2QAAA 4SGBE 3TGKE 4MLFB 2FM2A 2B0FA 2OC8A 1A2CH 3K65B 1BCUH 1J15A 5TCCA 4OGXA 1C5ZB 1CQQA 1ZTJA 2BDYA 1OWJA 2FZZA 4FVBA 4Y8XA 1ARBA 2OLGA 2FOMB 3EA7A 4H4FA 2H6MA 2Z94A 2AGGX 3UY9A 3A8DA 4X6OA 2IJOB 1ETSH 3SHAH 1ELGA 4Y76A 1MTNB 1HJAC 4YESB 3QDZB 2AMPA 3UOUA 1O3DA 1UK4A 2Z9IA 4X6PA 4BAQB 1GL0E 1AGJA 1W7XH 3RXGA 1IQGA 1GJAB 1P3CA 3TJVA 2WUCA 3AAVA 3SHCH 1P03A 1P9SA 4DJZB 2V6NA 2HNTF 1F0UA 4KTCA 3K2UA 5FBEA 2FEQH 1F5LA 1O39A 1GJ7B 1Z71A 1GJ4H 2BD7A 1HBTH 3T2NA 5J4SA 3C1KA 1EAXA 1V2OT 5LPRA 4AFSA 5LPFA 2ZU3A 4Q7ZA 5HM9A 4DIIH 1SVPA 3B23B 4O97A 3E3TA 2ZZUH 1TGCA 3ZVAA 3EE0B 3SQHE 1N6XA 2Q6FA 1TFXA 2VWMA 1N8OC 1O2GH 1TOCB 1KLTA 1MH0A 5FHTA 4X1SU 2BZ6H 2ZHFH 1LHCH 1C2MA 1SFQB 2V35A 3TITA 4D7FA 1SMFE 2G8TA 3TGIE 3ODDA 1YPMH 1MKWK 4WY3A 3RM2H 1BHXF 2BOKA 3M7UA 3NK8A 2EEKA 1V2WT 1QHRB 1S6FA 2F3CE 2FYRA 3VGCC 1FY4A 4OS7A 3QLPH 2V3HH 1JIRA 1CA8B 4BTTB 1V2QT 1BTZA 4RKOB 1FY8E 3E0PB 1TRYA 1FPHH 1QRZA 3SJIA 3KQCA 4E05H 4YOGA 1QNJA 3FZDA 1KXDA 4NZQA 1DSUA 2ZDKA 3PLPA 1YPHE 2FI4E 5GPIB 4CR5A 2ZHDA 1QJ7B 1ANEA 1M9UA 4FUJA 1XVOA 2FPZA 1HAXB 4I8LA 2HLCA 1O3CA 1SLUB 2XW9A 3ZZCA 1TMTH 1TQ0B 1SL3A 5IDKA 1G32B 1UJ1A 1IHTH 2VWOA 1PQ8A 3MH5A 1NRNH 1B0EA 2BD2A 5LGOA 2GZ9A 4INHA 1KLIH 3A7WA 1C1RA 1BRCE 2RG3A 2A31A 1ETTH 3RC5A 2GZ8A 5EQSA 1SHHB 1O2QA 4AG1A 1O2KA 1G36A 2ZHWH 1C2LA 1DPOA 5C20A 1TE0A 4AZ2B 3DUXH 4Y11E 5C3NA 2UUYA 1P12E 2AMQA 2ZHEH 3PMBB 3BEFB 1FN6A 2HNTE 5CHAB 1S5SA 2FO9A 4SGAE 2SGFE 1YLCA 4CH8B 1O37A 5C67A 1DLEA 1PYTC 3F1SB 3Q77A 1RTFB 4X1QU 1BHXB 1GBAA 3ZVFA 4BANB 2VIWA 1AZZA 2WPMS 5CMXH 3RXUA 3GY4A 1GVLA 1K1MA 4UFEH 1IQMA 2Z9KA 1YPKH 2D1JA 1ELEE 3B9FH 3EYDA 1TPSA 3GOVB 1ELFA 1YLDA 1C1VH 3RXEA 4TY6A 2TBSA 1NFYA 4MPVA 1OP8A 1TBRH 3H5CB 2DE8A 1SGNE 2VIQA 1D3QB 3CP7A 3TU7H 1FMGA 1HAZB 3RMNH 1SOZA 2A4GA 5T6DA 1NTPA 1J14A 1SHYA 4H6TA 2UWOA 1E0FD 2UUKB 1QBVH 2ALVA 1EQ9A 1GMCG 2ZGHA 2WV4A 1KIGH 1TIOA 1QGFA 2FESH 1K1OA 2BY8X 5GIBA 3BG4B 3U98H 3O8CA 5FPTA 1MCTA 4UE7H 3P17H 1INCA 1G9IE 2D8WA 1MTSA 3DHKH 1Y5AT 4A1XA 2QGRA 1G3DA 2G55A 2EI7A 4E7NA 3OTJE 3MWIU 3RDZA 1C5MD 2AFQB 5DO4H 1GI2A 1UHBA 3ATLA 1TABE 3RXKA 4D9RA 1MTNC 1NFWA 1V2JT 5EQQA 1OWIA 1C4V2 5E0GA 5EW2H 3F9FA 1O2JA 4I8KA 2GDDA 4ISIH 4YM9A 1HB0B 2GMTB 1VITF 4HI3A 1AU8A 1DUAA 1JXPA 3RC4A 1WQSA 1RIWC 2BY6X 4I32A 1SGFA 1J17T 3SU2A 1AN1E 3BTFE 1C4U2 3ZZ9A 8ESTE 2ZU4A 3ATKA 2UUFB 4TWWA 1H8IH 1PPCE 1GJ5H 3ZZ8A 3QK1A 3UOPA 3E1XB 1V2KT 4Q80A 1GMDF 1O3IA 2GCTB 4X8UH 5DP4A 1K1PA 6GCHF 1TBQH 4GAWA 1AFEH 1LPZB 3LIWA 1GHBF 3RXTA 1FN8A 1TBZH 1V6DA 1XKBC 2ASUB 1C5RA 4KGAA 1YPHC 4Y79A 1DX5M 1AI8H 4ABGA 3GCHB 3PB1E 2ZPQA 2A1DB 4K8YA 3TH4H 1W13U 1J9CH 1KSNA 3KNXA 1AIXH 3M35A 1ID5H 2Q6DA 5PTPA 5C5OA 1EZQA 3RXMA 3ZVBA 2QIQA 2Z9JA 4ZXXH 1FLEE 1VZQH 2ESTE 1IHSH 2W7SA 4UDWH 4D7GA 1TX6A 4AYVB 1B0FA 4AYYB 3OYPA 2ANMH 1IAUA 1TA2A 3UIRA 4A7IB 4AORA 2HNTC 4YLUA 4FUFA 2FIRH 1SG8B 1QB6A 3FP7E 3W95A 4ABAA 1P05A 1O2PA 1PYTD 1BBRK 2HOBA 2XYAA 5L6NH 1O2IA 1YCPK 3GY3A 1O2HA 1ZOMA 1N6YA 1NO9H 1C5VA 1GGDB 4CRDA 1QJ1B 2BQ7B 1HYLA 1ZPCA 1BA8B 1GBEA 2P93A 3AW1A 4MNXA 1SR5C 2O8WA 1NFUA 5JBBS 1BB0B 2J2UA 3ZZAA 3RXSA 2PGBB 5L2ZH 1Z8RA 1VCPA 1NROH 3M5LA 2ZPSA 2QC2A 1ABJH 1TMUH 4YO9A 1DSTA 1LMWB 2F9VA 5DP7A