2BY7X

Is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATIONIC TRYPSIN
publication title Is Radiation Damage Dependent on the Dose-Rate Used During Macromolecular Crystallography Data Collection?
pubmed doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2by7X01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2by7X02
1TRMA 5GCHF 3U9AH 5HXFA 5AVDA 2NU4E 3ZVCA 2RA3A 1MKXH 1YPHE 2R0LA 3BG8A 4H6SB 3RXOA 4DT7B 1AWHB 1Y5BT 3A82A 1BRCE 2XRCA 4ZKSU 3TH3H 5EXLA 1ESBA 3M37A 1O35A 2QCYA 1O3HA 2GP9B 1K28D 2ZI2H 3RXQA 1VZQH 4BTTB 1IOEA 1GGDC 5C3NA 1O2WA 5TCAA 4MVNA 2OUAA 2XYAA 1NFXA 5TJXA 1FIWA 2TRMA 1TABE 2FOGA 8KME2 2FZZA 2PLXA 1O33A 5JBAS 3PMHB 3MMGA 1V2OT 3MO6A 1TQ0B 1P11E 1AWFH 2WPIS 5I25A 2ZEBA 5JB8S 1IQLA 1NFWA 1O2JA 1FY1A 1UTJA 1UCYE 2PKSC 1C1PA 3MU1A 4ZXXH 4MLFB 1CGJE 4RSPA 1XKAC 2WYJA 2CJIA 2A5KA 1AVXA 1BTUA 2BVSH 2SGDE 4AFSA 1Y5UT 4O97A 2BDBA 2FOAA 1ZMLA 1Y3XA 2PHBA 2SGPE 2C4FH 1W2KH 2ZP0H 4SGAE 4AB8A 1UCYH 2A31A 2OINA 5G4BA 1FAKH 1NU9A 1V2JT 4WF8A 1ZSJA 1F0TA 1Q3XA 2VNTA 2WPJS 3KCGH 1Y3YA 3FZDA 1ZOMA 4UFGH 3A89A 3RMLH 3QWCH 4UONA 1YCPH 3TGJE 3MU0A 3VXFH 2A4RA 2XW9A 1BITA 4O9VA 3ZZ3A 3SU6A 1O5FH 3DHKH 1HAHH 3TNTA 3LIWA 4DIHH 4MPWA 1V2NT 1QCPA 1AE8H 3SNAA 2J34A 3MFJA 3RXPA 2BLVA 1GCTC 1ZZZA 1VITG 1SGIB 2NU2E 1NESE 4GLYA 3SU1A 5C1XA 3RXCA 2GV7A 1BTYA 1GI4A 1T31A 2GCTB 2PSXA 2VVUA 3KIDU 1OP8A 1C5RA 1W7XH 1BOQA 1XUJA 1AU8A 1J14A 1ELTA 4JK5A 3LT3A 5A0AE 1DY8A 1OWKA 1P06A 2NWNA 3RXHA 1NTPA 2ZHWH 4E05H 1O2XA 1P57B 5EGMA 2CF9H 1DWBH 1TMTH 1XVOA 3GY6A 5EODA 3S9BA 5EXMA 4X8TH 1N8OB 2ZECA 3VB5A 3LOXA 2IPHA 5E2PA 4IN2A 3BEUA 3GY5A 3O8RA 2FI5E 1JMOH 1J8AA 2BD3A 3LH3A 5CE1A 3E6PH 3RU4D 2ZGHA 5FAHA 3VPKA 1C2KA 1BMNH 3BTGE 1G3DA 3V12A 1BIOA 1MH0A 2ZTZA 2FI3E 1TALA 2Z9GA 1ABIH 3PLPA 1TOMH 1GCDA 1WTHD 1O37A 8GCHG 2XCFA 5AF9H 1MKXK 2XWBI 2Z9IA 1DXWA 1Z8JB 1DUAA 2CHAB 3ZYDA 3N7OA 5DP7A 1DWDH 2ZF0H 2R3UA 4WXIA 5FBEA 1XXFA 2ZHQH 1ZTKA 4KKDA 1W0ZU 1EZQA 2W26A 3A8BA 4NG9H 4FUFA 2VIQA 3L3TA 4Q7XA 3RXGA 4VGCB 4U01A 1N6XA 1YYY1 1P3CA 3BTTE 3F1SB 4JZEH 4Y8YA 1SFQB 1BRAA 1ZTLA 3QK1A 2BXTH 2G5VA 1OX1A 5JDUB 4WY3A 1C5ZB 1XVMA 2BOHB 1EAWA 1O2OA 1WYKA 5DPAA 1XUFA 2WUCA 1ZHPA 3LKWA 1V2ST 3D62A 1E37B 2GCHG 1HAOH 2F9OA 4Y8XA 2D26C 4WMDA 2Y7ZA 1P2QA 1TPSA 1BTHH 1UCYK 1YPHC 1ZJDA 1SQAA 1OWHA 2VGCB 1HAYB 1S84A 1O3JA 3PB1E 3K9XB 2P3FH 1SLWB 4JZDH 3UNSA 1NRQH 1ZTJA 1H9LB 1NRPH 5TCCA 3ATIA 1YCPK 2J9NA 1GWAA 2QN5T 1E34B 3F6UH 3OU0A 1EKBB 1ETSH 1HAXB 2ZU3A 4GAWA 3BTQE 3SV2H 2A32A 4XBCA 1GBAA 1LHCH 4GHQA 1S0QA 2BD2A 1GJAB 4AB9A 1IQGA 2J94A 3L33A 1UVSH 1P09A 3T28A 3MH6A 3U8OH 1C5NH 5FPSA 2ZDKA 4NIXA 2VH0A 9LPRA 3SJ8A 1P0SH 3GY7A 2XBXA 2ZDNA 1SGNE 4O3TA 1GI2A 2FOBA 2VVVA 1QJ1B 3QZRA 3QGNB 2GD4B 5C1UA 1SGPE 2Y6TA 4FVBA 3SJ9A 2ZTXA 1F7ZA 3A7YA 2BLWA 2BMGB 4M7GA 1FI8A 2OC8A 4DOQA 3UWIA 1EPTB 3RXTA 1PYTC 5DP6A 4UFDH 4H6TA 4ABHA 1CT0E 2SFAA 1RFNA 1ANDA 4F49A 5DP9A 4A6LA 1TLDA 2J2UA 1OKXA 1QIXB 4X1SU 3W94A 1KSNA 1RD3B 1TWXB 4TPYA 1BTWA 1O5AB 4JMYA 4BOHA 4OS6A 1EOLA 1PQ5A 4RKOB 5DO4H 3SGBE 1O2IA 3RP2A 5K7RA 1BRUP 1C1SA 1C9TA 1EP5A 1Z1JA 2ANWA 3H7OA 2CGAA 2G4TA 1C4U2 3UNQA 1SGCA 2Q6GA 4DG4A 1SI5H 1Z8IB 1IHSH 1UTKA 2ASUB 1QJ7B 2NU0E 2Q6DA 5B6OA 2A4QA 2DE8A 3BTEE 4RN6A 3RC4A 4X6MA 1AVGH 1O2HA 1P2MA 1PQAA 1SOZA 3BTHE 1FY3A 2XC5A 3KNXA 4WWYA 4JYVH 2H9HA 1KDQA 1P2KA 5F03A 3GCOA 2PFEA 2HRVA 1TA2A 4ZMAH 3TH4H 3GY3A 5DGJA 1LQEA 1HBTH 2B8OH 2C90B 3Q3KA 3BTFE 5IYTA 1GHBG 2P8OB 2HPPH 4X1QU 3GCTF 5AFZH 2Y5GA 3QGJA 2FEQH 1S0RA 2VIOA 4OS5A 1TX7A 3AASA 1AFEH 3ZV9A 2HOBA 1XUGA 3M5MA 3SNCA 4DGJA 5FPTA 4TPIZ 1O3PB 4ABFA 4LK4A 1O3CA 1J15A 2BLOA 2GVFA 5JBBS 1VR1H 1A3EH 2I6SA 1C4V2 2FESH 3LU9B 3UOPA 1NRSH 1T32A 1AHTH 3KQBA 1AKSB 1PQ7A 5DP4A 1W11U 1GI0A 1CQQA 1NT1A 2BDGA 4ASHA 1O3LA 1O2YA 1S82A 4FXGH 4MNXA 5E8EH 1K1PA 3PO1B 2FI4E 1UHBB 3K6ZA 4FVDA 2BOKA 2FS8A 3V13A 1MQ5A 3FZZA 1KXAA 1SLUB 3MU4A 1CA8B 1QL8A 1KIGH 1DOJA 3EQ0H 3DUXH 2TGDA 2A4OA 2UWOA 1F2SE 4K1EA 2A5IA 3RC6A 2AYWA 1ID5H 1GBBA 1C5OH 3GDUA 3CENA 1KLJH 7ESTE 1P04A 5L6NH 5HM2A 3ZZ5A 4Y71A 1ANEA 4Q7ZA 1GI9B 4GVUA 1V2QT 2WYGA 2BQWB 2QF3A 3NKKA 3UNRA 3GOVB 1DWEH 2XCNA 1IQKA 3AAUA 1L4ZA 1SQOA 3K2UA 4KTUA 5FBIA 1ZRBA 2P93A 1VCWA 1C5TA 1G37A 2BDHA 1BTXA 1O2VA 1QBOA 3EYDA 1B7XB 1NRNH 3BTKE 1O3EA 2O8MA 1MBMA 1WTGH 3SBKA 3VB3A 2BZAA 4UD9H 1N6YA 5T6DA 1GJ9B 4IMZA 4CRCA 1HAGE 1O39A 3R3GB 3W95A 1C2MA 8GCHF 2FX4A 1J17T 1FIZA 4CH2B 3K6YA 1WU1A 1Y59T 3ODDA 5ABWA 4AG1A 1MTVA 1PPEE 1YLDA 3B8JA 1Z1IA 3RXBA 4HTCH 5JB9S 3R0FA 2VU8E 2PSYA 5FPYA 4CR5A 2QXJA 3LC3A 1AI8H 2ESTE 2GT8A 2J4IA 1DS2E 1P02A 1SGDE 3GICB 1A7SA 1NZQH 1RTKA 1C5LH 1CE5A 1TMUH 1L4DA 1EQ9A 3QZQA 1G32B 1HCGA 2BB4A 2K1QA 1GL1A 1DXPA 2BD4A 3O8DA 3UPEA 1FY8E 3A80A 1MAYA 3S9AA 2R0KA 3QDZB 3MNCA 2Y80A 3ZVGA 2ZFQH 1TA6A 2F9UA 2J95A 5C5NA 3AW1A 3ZZDA 5EW1H 1D6WA 1LVYA 1UK3A 1LHGH 2BDAA 2XNIA 3FVFB 3P6ZB 1O3NA 4UE7H 1O5CB 3OY5U 1YCPM 1EAIA 3RXVA 3H7TA 1FNIA 1MZAA 3LGWA 2CHAC 2AERH 3PROA 2QXGA 1C5QA 1FZZA 2GTBA 3M7QA 1B0EA 1S5SA 3VB6A 3ZZ6A 1GJ8B 4DIIH 1FLEE 1O2GH 5C1YA 3B23B 3PMJA 4Q2KA 4D7GA 4AX9H 2ZCLP 1GMDG 1DE7H 1ARBA 3PV4A 1IAUA 4CRBA 3EE0B 1M9UA 3EDXB 3IG6B 4NZLA 2ZTYA 5CHAC 2PTCE 1DSTA 1WOFA 4YM9A 2AMDA 1YPEH 1JIRA 2HLCA 2RCEA 4Q7YA 2H9EH 1JRTA 1PPHE 1LKBA 1SGFG 2R2WU 1JXPA 3PLBA 1P05A 4AZ2B 1BDAA 1PJPA 4PROA 4MNYA 4ABGA 2BQ7B 1QB9A 5GWZA 1DT2A 1RS0A 5EQSA 3SV6A 1GJBB 1O2SA 1GBCA 2O8LA 2VB0A 2W3KA 3LGUA 4I8LA 1WSSH 1ELDE 2VGCC 3P70B 2P3UB 1F5RA 4AFZA 4K2YA 1HUTH 1QBVH 4KTCA 3TJOA 1V2PT 1DFPA 5E0JA 3E16B 4ZKNU 1JWTA 1SMFE 3RM2H 7LPRA 1QA7A 2ALPA 1ELAA 1GBLA 4BTIB 3M35A 8LPRA 1SBWA 9ESTA 3RC5A 1NFUA 3TGKE 1BT7A 3T2NA 1CU1A 2RA0A 4X8SH 5A0BA 4OS4A 1UTNA 1MU8B 3C27B 1E0FD 2IOTA 3EA8A 1YPGH 4Y0ZE 4MPVA 1G2MA 1AVWA 1DWCH 3A7TA 3SI3H 3UTUH 1GHXH 4AFQA 1OWEA 2ZFPH 1IQFA 1C5VA 1TX8A 3P8GA 4YESB 3UOUA 4ABJA 2VIPA 1DSUA 2ZFRH 4AORA 1W13U 1UVPA 4HGCA 2Z3DA 2ZU4A 1LKAA 2JETB 1WBGB 2BHGA 3SJIA 3ZVFA 1O3DA 5L2YH 2PGBB 2AGGX 1ZPBA 4XFQA 1C1UH 2PUXB 1SLXB 1TPAE 3KQCA 4X6NA 1KXCA 2FOMB 5PTPA 1QRWA 1EZXC 2EEKA 1LVOA 1GHWH 2XXLA 4YOIA 2DUCA 1GJCB 1AQ7A 5EPNA 1UTQA 4JYTA 4Y11E 2EC9H 2PTNA 3O8CA 4CBNA 6GCHG 1H8IH 1U6QA 1C4Y2 1W8BH 2GX4A 1B5GH 2BTCE 4HI3A 5E2OA 3Q77A 2G52A 1V2TT 5GDSH 1TNJA 3Q76A 1CT2E 2FOFA 1C2HA 1RIWC 1O2TA 1O3AA 1VITH 1LMWB 3A7VA 1DX5M 1ZHRA 1W14U 1V2UT 3VGCC 2TPIZ 4B2BA 4B74A 1MCVA 1YPKH 3RLWH 2H9TH 1PYTD 2QXIA 2B0FA 4I32A 5A0CA 3BIVH 4OS2A 1TE0A 4NSYA 8ESTE 2ZFSA 2THFB 1TONA 2Y81A 4CHAC 1KXEA 2GDEH 3EGKH 1QJ6B 4XE4A 1H9HE 2Z9JA 1LO6A 1MQ6A 2P8OC 3PYHA 1QL7A 3ZZBA 3MWIU 3SU0A 1CBWB 1OPHB 2FTMA 2I6QA 5FCKA 3RXAA 3SO3A 1IQNA 1GI6A 3SGAE 2V35A 3RXKA 1XXDA 3MO9A 3UQOA 1QNJA 1ACBE 1GI5A 1Y5AT 3RXSA 3URCA 1HNEE 1G30B 3Q3YA 4D7FA 1MTNC 2ULLA 3ZVAA 1A46H 2UUKB 3BSQA 3SQHE 2P16A 4CRDA 1AN1E 1T8MA 1UTMA 1JRSA 4WMFA 1LQDB 1O2UA 2WPMS 1C5XB 1VGCB 2OCVB 1HRTH 2IN2A 1W7GH 2CV3A 1TGTA 3BTME 1O2QA 2GZ9A 3SV8A 1HIAB 2A5AA 3NCLA 4ABEA 3GDSA 3RXJA 4AOQA 1F0RA 1GHZA 1HJAC 3H5CB 1ELVA 1CGIE 5C5OA 4E06H 1O5EH 3EA7A 2M5TA 1ZPZA 1OP0A 1SLVB 2EI8A 4XBDA 2F3CE 1DUEA 1SHYA 2JH6D 2SNWA 4YLUA 3M3VA 4BAKB 1C9PA 2PKAB 1TGSZ 2HWLB 1T8LA 1W12U 1OWIA 1SFIA 3S7KB 5T6FA 1A5GH 1TPPA 2Z3CA 4WXVA 3STJA 1HYLA 3RXIA 2B5TB 2Y5FA 2UWPA 4KGAA 1O3KA 4DY7B 1HAVB 4B76A 1TB6H 2HALA 3KQDA 1UMAH 1Z7KA 4WH6A 1AMHA 4MG3A 3EAJA 3URDA 2PV9B 1C5SA 4HZHA 4NIVA 1C2JA 3QO6A 4NCYA 1UK4A 1UVUH 2TGTA 1RTFB 4U32A 1X7AC 2OC7A 4CRAA 2SGFE 3GCHB 1PQ8A 2IJOB 2VWNA 3RXFA 3A86A 1L0ZA 2C8XB 3DD2H 1QQ4A 2HNTF 2HPQH 3E3TA 3ZZCA 2WV5A 1G3EA 3PWCA 4DJZB 5FX5A 1AO5A 3MOCA 3FAOA 1K21H 1GBFA 2BD5A 2YOLA 1FXYA 2WPKS 3ATLA 1IQEA 2FMJA 1Z6JH 3NUMA 1AGJA 3A7ZA 3LJOA 2G00A 5GPIB 1W3CA 3V7TA 1O34A 4A1XA 2QYIA 2XBYA 3RXUA 4Z0KA 3OSYA 1BMMH 2VH6A 4K8YA 4ABDA 1SG8B 1K1OA 6LPRA 3D49H 1GI1A 1ELEE 1THPB 2FOEA 1O5BB 1G2LA 2XBVA 1TNIA 5J4QA 1HFDA 4OS7A 1BHXF 3IWMA 1K1MA 2Y7XA 3M3SA 5SGAE 1K22H 2XC4A 3PTBA 1GDNA 2OLGA 4H4FA 1YPLH 3M7TA 1A5HA 1YM0A 4YZUA 2ZQ1A 2GMTB 5HMAA 4ABIA 2VIVA 3A7XA 3CS0A 3SI4H 1BUIA 1HJ9A 3ATKA 3HK3B 1P01A 1TYNA 5JYIA 3RM0H 1E35B 1UTOA 2OTVA 3VXEH 1GBMA 1WAYB 1ZMNA 1MKWH 2D2DA 1A2CH 2H1UA 3SU4A 2VJ1A 1TBRH 5A2MH 3NWUA 3SUDA 1V2WT 1YLCA 2O9QA 1GBKA 3VB4A 1YBWA 2BQ6B 2A45B 1DM4B 1C1WH 1QB1A 3ELAH 1SR5C 2FODA 1P8VC 3PMBB 4CR9A 3UR6A 4CREA 4X8VH 3TVJB 2F9PA 4H42U 1HJ8A 2WUBA 3LH1A 5F6MA 1EB2A 2FO9A 1ZHMA 2B7DH 1XKBC 1NC6A 4YOGA 3P8OA 2QC2A 1CA0B 2PKSB 2WV4A 6CHAB 3TPIZ 1OSSA 5GCHG 3ZVEA 3MU5A 1E38B 2W5EA 4ZAEA 5A8ZA 4YT6H 2FS9A 1ELBA 5CMXH 1KXDA 5AHGH 1TAWA 3RMMH 1DVAH 2V6NA 3ZVBA 2BM2A 3GYMA 2SNVA 1EUFA 4JZIA 1L1NA 1YPJH 4NWLA 5EU8A 2VWMA 1GI8B 3U98H 4BNRA 6GCHF 2FLBH 4FU7A 2B9LA 1IQIA 2BD8A 2ALVA 4ZKOU 3UUZA 2ANYA 4TWYA 2KAIB 3SZNA 3HATH 2BY6X 1GBDA 1ELFA 2EA3A 3GY8A 3QX5H 4E7RG 4GUXA 2Q1JA 1K2I1 2TGPZ 3PM3A 4Y7AA 1BHXB 1EJMA 4F4OC 1Y3VA 3OTJE 1DDJA 2BX3A 2FLRH 4A92A 1FDPA 2F9BH 1ZYOA 1D9IA 5ESTE 4D9RA 1EATA 1IQHA 4ZH8A 7KMEH 2ZCKP 3V0XA 1P3EA 2A4GA 3NZIA 1P2IA 1HXEH 1MCTA 1C5YB 3ZVDA 1A5IA 4JZFH 3T5FH 1ARCA 4JZ1A 1MU6B 2ZGXH 1AUTC 2C8WB 3P8FA 1ANCA 3P17H 4SGBE 1VITF 3U1JB 1P9UA 5EQRA 3SGQE 1F92A 2FPZA 3GY2A 5AFYH 1NFYA 1ZPCA 2OBQA 2OXSA 3AVZA 2FWWA 1GMCG 4A5TS 4CH8B 2G81E 3U69H 1H1BA 2BDYA 3JZ1B 5EW2H 1C1MA 1DY9A 3SJKA 2J92A 1C1QA 1GL0E 4A1TA 4X2VA 2A7HA 3A8DA 2BY7X 1SB1H 1D3DB 2ZPQA 1MTWA 1OYTH 1O31A 1RTLA 2QA9E 1EB1H 4TWWA 3QN7A 4B2CA 4YOJA 3DFJA 3QLPH 1YPMH 1PPFE 3TJNA 4BAQB 1CGHA 3L6PA 1NO9H 3PMAB 3MYWA 3STIA 5LGOA 1MKWK 4Z6AH 5DK1A 2V0BA 1GDUA 5GIBA 2ZNKH 2F9VA 1A3BH 2JH0D 3K65B 2QY0B 1SPJA 2HNTE 1HGTH 2W7UA 4HFPB 1CT4E 3RMNH 1A61H 2GCTC 3E0PB 3PWBA 3NK8A 1QRZA 1HV7A 1G9IE 3Q3XA 3Q00A 3RUOA 2FX6A 4Y0YE 3UIRA 1KLTA 2OP9A 3UFAA 3LJJA 1EZSC 1LHFH 2Y5HA 2FOCA 1EASA 1KYNA 1KTTB 3ENSB 3P92A 1N8OC 2GGVB 3DFLA 2ZGJA 1ETRH 3AAVA 1OOKB 2QXHA 1GG6B 1A1RA 1QR3E 4BAOB 2CMYA 1SQTA 1O3IA 3OYPA 1XUKA 1BBRE 1A0HB 1V2RT 1CHOG 3FP8E 3CS7A 3TJUA 4CRGA 1ESAA 1HAZB 1NPMA 2W7SA 1ELGA 1TNKA 1MD7A 4E7NA 1T4VH 1TNGA 5E0HA 1K1LA 1MAXA 4I8KA 1EPTA 2BDIA 5E0GA 4MDSA 3HKJB 3SUGA 1V2KT 3SJOA 1BBRH 2OQUA 3ZZ4A 2GCHF 3AW0A 1V2LT 4YTAA 1XM1A 3E0NB 1TGNA 3I78A 1G3CA 4ABBA 1O36A 2HGTH 1TOCB 3ESTA 5GXPA 1C2DA 4KELA 3DT0H 2G8TA 4AYVB 1UVTH 4YO9A 3S9CA 3B9FH 2P94A 2RDLA 4GCHG 4VGCC 1O2NA 1S6HA 4JK6A 4MNVA 1ZGVA 3PTNA 5FHTA 3TJVA 1O5GH 4ISLA 5FX6A 2ZDVH 4BTUB 3SNDA 1C2LA 1FUJA 2ZFFH 1BB0B 4BXWA 2BVRH 3GY4A 1FV9A 2H6MA 2PW8H 1TRNA 1GBEA 1ZSKA 3QTOH 1AIXH 1FPHH 4X8UH 1XX9A 3VFEA 1V2VT 1WQSA 1O3MA 4XBBA 1CO7E 4JCNA 2ZA5A 5LH8A 4Y76A 4DURA 5A09A 4QT8C 2BVXH 1O2LA 3S69A 1O3GA 2ZO3H 5IDKA 1LVMA 3TLOA 2WPLS 5F8ZA 1K1JA 2R2MB 4ESTE 2H5DA 1GHYH 2G51A 1E36B 1H4WA 3NPSA 2ZHDA 2ZPSA 5T3HA 1KTSB 1F0UA 1FAXA 1GI3A 5FCRA 1Y3WA 5JBTA 5HYOA 4J1YA 1QTFA 4NSVA 1D3QB 4AGJA 2O8TA 1PPBH 1C1TA 1QURH 7GCHG 1YP9A 4NWKA 1UHBA 1P2OA 2P59A 2ANMH 1FY4A 4BXSA 3GISB 3M3TA 2GMTC 3A87A 1O30A 1TRYA 3SU3A 3VB7A 4I8JA 3F9FA 4TYDA 3MI4A 2TIOA 2A2QH 1ZJKA 1ANBA 1EPTC 1OWJA 2V3HH 3TITA 4ABAA 2ZWLH 1FMGA 1BCUH 3TK9A 1QL9A 2ZU1A 2H5CA 4X0WU 4Y79A 2WINI 2GKVE 4IMQA 4Q80A 2C8ZB 5C67A 1P9SA 4X1PU 1GHBF 1KXBA 5DKMA 3QTVH 3KHVA 4NGAH 5DP8A 5A8XA 1K1NA 1G36A 5EOKA 2ZFTA 1BRBE 1BMLA 1SSXA 1O38A 1GBIA 3TGIE 1TNLA 1O2ZA 1YKTA 2HNTC 4UFEH 1EJAA 5C2ZA 3UWJH 3MU8A 2Z7FE 1BBRK 3A84A 2LNCA 1CA0C 3M7UA 6CHAC 1H9IE 3MTYA 1UVOA 4A7IB 3GCTG 4LZ4B 1V6DA 4GPGA 1FQ3A 3SORA 1LHEH 3KL6A 2ZZUH 2BYAX 2WPHS 3I29A 4AGKA 1C1RA 3O8BA 1SGEE 1QB6A 2Y82A 1GMHG 4UDWH 3SV9A 3RXLA 1GJDB 1GDQA 2ZG0H 1ELCA 3FP6E 3A88A 4X2WA 1L1GA 4NFEA 3SQEE 4DW2U 1DICA 5ETXA 3BG4B 4ISOA 1GBTA 3LGVA 2C93B 3M36A 4ISHH 4WMEA 4ZHAA 4U2WA 1QBNA 1EXFA 1LHDH 3M5OA 1GMCF 1AB9B 4MTBA 2G55A 1Z8RA 3MNBA 1QRXA 4AYYB 4K69A 4AN7A 3KGPA 2SGQE 3ATWA 3A8AA 3HK6B 1INCA 4TY6A 1VCPA 3BF6H 2ZDMA 1NROH 4XOJA 2RG3A 3BTDE 4LXBH 4NFFA 3SOSA 5BPEA 1KDQB 4YLQH 2Z3EA 3PO1C 2ZHFH 4ZKRU 2BXUH 2A2XH 3GYLB 4Y6DA 5HM9A 5DP3A 1QGFA 1T4UH 1O5DH 4GSOA 1LPKB 1WQVH 4K5ZA 1CSOE 1EX3A 1YF4A 3SNBA 4AG2A 1EAUA 1VJAU 1VJ9U 1F0SA 1DANH 2ZGCA 1H8DH 3SU2A 1P12E 1SGQE 3FANA 1NU7B 1ZMJA 1S81A 2YNAA 3M5NA 1C5MD 2FYQA 2AMPA 3RU4E 3BIUH 1OYQA 2BDCA 5LPEA 1D6RA 4NIWA 2NU3E 2FTLE 4X6PA 3A83A 1ZGIA 1P03A 3V3MA 1GHAG 1LCYA 4YT7H 2STAE 5ESBA 1Q31A 1XUHA 1J9CH 1LDTT 1O2MA 2VIDA 1AZZA 4Y7BA 1P2JA 1BJUA 1P10A 2YNBA 1BZXE 1S83A 1GVKB 3FFGA 4R0IA 4R8TB 3F9EA 1AFQB 1CHOF 2C8YB 2Z9LA 1NS3A 2AMQA 1NRRH 3TIUA 4BANB 1LTOA 1THRH 3QUMP 1RRKA 1VCQA 2CXVA 3RXEA 3KF2A 1YGCH 4OGXA 5DJ7A 4Y10E 2ODPA 2P95A 3KQEA 2TBSA 4IN1A 4DVAU 2XC0A 4K1TA 2BZ6H 2A0QB 1ESTA 2VWOA 1TBZH 4MPXA 5FXLA 5CHAB 1HXFH 4I8HA 2BY9X 2FP7B 2UUYA 3HKIB 1GJ4H 3ATMA 1KXFA 1A4WH 1XMNB 2GDDA 3T25A 3F9GA 1GMDF 1NN6A 1GG6C 3TH2H 4GCHF 2OC1A 4D8NA 4INHA 4XSKU 1Y8TA 2PR3A 1C2IA 1FPCH 1SOTA 4TY7A 2OBOA 2UUFB 3ZZ9A 1C2GA 3HGPA 3SNEA 1SC8U 4MPUA 4DCDA 4I31A 1IQJA 1O3OA 4FUHA 3UR9A 3LONA 3A8CA 4X1RU 2UUJB 4O03A 1O32A 3F9HA 3TNSA 3RXDA 3UREA 1QY6A 4FU9A 4K1SA 1XUIA 1BQYA 4ISIH 4D76A 4U30A 4Y8ZA 3LGYA 2ZDLA 1JIMA 2F91A 1TBQH 1DLKB 1UO6A 4ZROA 1C5PA 1D3PB 1D3TB 4IGDA 4FUJA 1GJ7B 2HVXA 3CP7A 1MD8A 3T27A 2ANKH 3RXRA 1MZDA 1SGTA 1MBQA 1IQMA 4OGYA 3JZ2B 1T7CA 3U1IB 1TIOA 1YC0A 2O8WA 3OY6U 3BEFB 2GV6A 4MQAA 1O3FA 2C3SA 4RKJB 2ZDAH 2Z6BD 1B0FA 1GGDB 4FUEA 2STBE 2AIQA 1NM6A 1O0DH 4B71A 1W0YH 3MNSA 2AS9A 3SN8A 1ZR0A 4WJG2 4AFUA 4NA7A 2ZCHP 1F5KU 1AZ8A 7GCHF 1K1IA 1ZRKA 1EOJA 2Z94A 4BAHB 1WV7H 1BMAA 3LC5A 1TQ7B 4B75A 2ZQ2A 2FYRA 3BN9A 1QFKH 3RLYH 3VEQB 4FUCA 1ZSLA 4IW4E 3E91A 4FUDA 2P3TB 1DPOA 5J4SA 3BEIB 2BY5X 1HAIH 4WH8A 1SGYE 4A1VA 1BTPA 1V3XA 2Q6FA 1KLIH 2ZC9H 2ZGBH 3S0NA 1S6FA 2ZHEH 1DITH 5I46H 2A1DB 2A7JA 1RIWB 3KN2A 3ZZ7A 1J16A 4MNWA 1FN6A 3F68H 2A7CA 3VGCB 4ZUHA 4JYUH 2ZKSA 1AD8H 4FUBA 1RXPA 4J2YB 3SUEA 1LVBA 3LGIA 4GHTA 2G5NA 2QF0A 4IC6A 2R9PA 2FXRA 2SGAA 1P2NA 2AH4X 2VWLA 5EPYA 1EP6A 1MTSA 1HIAA 3E8LA 4K60A 5F8TA 1OP2A 4CHAB 2EI6A 3ZYEA 2VIWA 1MUEB 3GDVA 4LZ1H 2FM2A 5A8YA 2QGRA 2BX4A 2PGQB 3WY8A 2JETC 2ILNA 1THSH 1GCTB 1C2EA 2AGEX 2XTTB 2F9NA 1PFXC 2CF8H 1TGCA 2R3YA 2F83A 2PKAA 1TPOA 1GMHF 1W10U 5EQQA 4ZXYH 2AIPA 2ODQA 2JH5D 1MTNB 3MH5A 1QQUA 2OD3B 1PPCE 5T6GA 4KTSA 2UWLA 1RGQA 1HAVA 3ZZ8A 3SUFA 2BD9A 4B2AA 3LPRA 1G3BA 4FUGA 3MO3A 3ITIA 3HGNA 4CRFA 1GJ5H 1C1OA 2CN0H 2XWAA 4D9QA 3T62A 4X2XA 1Z71A 1HJAB 1O2RA 1TFXA 3SW2B 1O3BA 1S85A 2ZU5A 4IBLH 4WVPE 1AY6H 1ABJH 1L2EA 2SGEE 3A81A 1FN8A 1O2KA 1UK2A 3LGTA 4NZQA 1D4PB 2GT7A 1GJ6A 3BV9B 3C1KA 3NXPA 1T8OA 2AGIX 1KY9A 5L30H 1Z6EA 2ZU2A 4OS1A 1Z8GA 2H2ZA 3A85A 3ODFA 3ZV8A 3SHCH 4FU8A 4X6OA 2VINA 3PLKA 4K3JA 1HAPH 4NIYA 5L2ZH 2DE9A 1CBWC 1NY22 1N1LA 3FP7E 3BG4C 2BLQA 6ESTA 1RJXB 1WUNH 5GJ4B 4X2YA 1OXGA 1AB9C 3OX7U 3U8RH 3MHWU 1EAXA 5K0HA 1F5LA 1FY5A 5EXNA 3BTWE 1GVLA 2FIRH 2NU1E 4IC5A 1GBHA 2PUQH 5LPRA 5F8XA 3P8NA 1SHHB 3A7WA 2D8WA 3MH4A 1GHAF 4K8BA 1VGCC 2O8UA 1HLTH 1PPGE 1UTLM 4I8GA 3SV7A 3IITA 1A0JA 2BD7A 1Y3UA 2W3IA 1ORFA 1SGRE 1HDTH 1ETTH 4ISNA 2OC0A 3HPTB 3UQVA 1AUJA 3G01A 5HGGA 5JBCS 1C1NA 1CHGA 4NA9H 1HPGA 1GPZA 3RMOH 2G4UA 4ZHLU 2OQ5A 3P95A 4B73A 4I7YH 2V3OH 5DG6A 1FJSA 3TK5A 1DLEA 2GZ8A 4UFFH 4NA8A 4KP0A 1EZUC 1WCZA 2GZ7A 3S7HB 3M61U 2QIQA 1V2MT 2AEIH 5DP5A 4IS5A 1Q2WA 1BA8B 1TNHA 2BY8X 2QAAA 1TX6A 2D1JA 5EG4A 1JBUH 4B1TA 3ZZAA 1UJ1A 3UY9A 3I77A 2PWXA 1HB0B 2ZPRA 2FDAA 1IHTH 1A0LA 3D23A 1TGBA 3E90B 1GI7B 4UEHH 1T8NA 2FOHA 2TGAA 1AFQC 2EI7A 2LPRA 1EJNA 3GCHC 3SU5A 1C5UA 2QV1A 3LDXH 2J38A 1LPGB 1MMJN 2XBWA 1PPZA 2ODYB 1C2FA 4BAMB 1MTUA 3SHAH 1FONA 4I33A 3T29A 4CBOA 1SVPA 1C1VH 1JOUB 4X1NU 1TMBH 1OWDA 1OS8A 1LPZB 1CVWH 2Z9KA 5JPMH 4INKA 4INLA 3TK6A 4ZHMU 1SGFA 3EA9A 2AFQB 4FUIA 3TU7H 2KAIA 1C5WB 4O3UA 1AE5A 3RU4T 1UTPA 4XDEA 1L1JA 1GHVH 3MNXA 1ZLRA 3RXMA 3E1XB 3T26A 1BTZA 1SL3A 5LPFA 3U8TH 5C20A 1AKSA 4THNH 2VVCA 5BRRE 5H4IB 3MH7A 1BJVA 2ZIQH 3KEEA 1O2PA 3M5LA 1GBJA 1GVZA 3RDZA 3DA9B 2JKHA 1QHRB 3D65E 1QA0A 4LOYH 3GCNA 1K9OE
chains in the Genus database with same CATH superfamily
1TRMA 5GCHF 3U9AH 5HXFA 5AVDA 2NU4E 3ZVCA 2RA3A 1MKXH 1YPHE 2R0LA 3BG8A 4H6SB 3RXOA 4DT7B 1AWHB 1Y5BT 3A82A 1BRCE 2XRCA 4ZKSU 2YMSB 3TH3H 5EXLA 1ESBA 3M37A 1O35A 2QCYA 1O3HA 2GP9B 2KCYA 1K28D 2ZI2H 3RXQA 1VZQH 1WDIA 4F48B 4BTTB 1IOEA 1GGDC 5C3NA 1O2WA 5TCAA 4MVNA 2OUAA 2XYAA 1NFXA 5TJXA 1FIWA 2TRMA 1TABE 2FOGA 8KME2 2FZZA 2PLXA 1O33A 1YWUA 5JBAS 3PMHB 3MMGA 1V2OT 3MO6A 1TQ0B 1P11E 1AWFH 5DN6D 2WPIS 2JIZD 5I25A 2ZEBA 5JB8S 1IQLA 3PRBA 1NFWA 1O2JA 1FY1A 1UTJA 1UCYE 2PKSC 1C1PA 3MU1A 4ZXXH 4MLFB 1CGJE 4RSPA 1XKAC 2WYJA 2CJIA 2A5KA 1AVXA 1BTUA 2BVSH 2SGDE 4AFSA 1Y5UT 4O97A 2BDBA 2FOAA 1ZMLA 1Y3XA 2PHBA 2SGPE 2C4FH 1W2KH 2ZP0H 4SGAE 4AB8A 1UCYH 2A31A 2OINA 5G4BA 1FAKH 1NU9A 1V2JT 4WF8A 1ZSJA 1F0TA 2F4LA 1Q3XA 2EQNA 2VNTA 2WPJS 3KCGH 1Y3YA 3FZDA 1ZOMA 4UFGH 2OK5A 3A89A 3RMLH 3QWCH 4UONA 1YCPH 3TGJE 3MU0A 3VXFH 2A4RA 2XW9A 1BITA 5B6LA 2LP6A 4O9VA 3ZZ3A 3SU6A 1O5FH 3DHKH 1HAHH 3TNTA 3LIWA 4DIHH 4MPWA 1V2NT 1QCPA 1AE8H 3SNAA 2J34A 2KR7A 3MFJA 3RXPA 2BLVA 1GCTC 1ZZZA 1VITG 1SGIB 2NU2E 1NESE 4GLYA 5GNDA 3SU1A 5C1XA 3RXCA 2GV7A 1BTYA 1GI4A 1T31A 2GCTB 2PSXA 2VVUA 3KIDU 1OP8A 5EJLA 1C5RA 1W7XH 1BOQA 1XUJA 1AU8A 1J14A 1ELTA 4JK5A 3LT3A 5A0AE 4XD7D 1DY8A 1OWKA 1P06A 2NWNA 3RXHA 1NTPA 2ZHWH 4E05H 1O2XA 1P57B 5EGMA 2CF9H 1DWBH 1TMTH 1XVOA 3GY6A 5EODA 3S9BA 4F55A 5EXMA 4X8TH 1N8OB 2W6JD 2ZECA 3VB5A 3LOXA 2IPHA 5E2PA 4IN2A 3BEUA 3GY5A 3O8RA 2FI5E 1JMOH 1J8AA 2BD3A 3LH3A 5CE1A 3E6PH 3RU4D 2ZGHA 5FAHA 3VPKA 1C2KA 1BMNH 3BTGE 1G3DA 3V12A 1BIOA 1MH0A 2ZTZA 2FI3E 1TALA 2Z9GA 1ABIH 3PLPA 1TOMH 1GCDA 1WTHD 1O37A 3FN8A 2XCFA 8GCHG 5AF9H 1MKXK 2XWBI 2Z9IA 1DXWA 1Z8JB 1DUAA 2CHAB 3ZYDA 3N7OA 5DP7A 1DWDH 2ZF0H 2R3UA 4WXIA 5FBEA 1XXFA 2ZHQH 1ZTKA 4KKDA 2QE7D 1W0ZU 1EZQA 2W26A 3A8BA 4NG9H 4FUFA 2VIQA 3L3TA 4Q7XA 3RXGA 4VGCB 4U01A 1N6XA 4RT1A 1YYY1 1P3CA 3BTTE 3F1SB 4JZEH 4Y8YA 1SFQB 1BRAA 1ZTLA 3QK1A 2BXTH 2G5VA 1OX1A 5JDUB 4WY3A 1C5ZB 1XVMA 2BOHB 1EAWA 1YY3A 3VG8A 1O2OA 1WYKA 5DPAA 1S6LA 1XUFA 2WUCA 1ZHPA 3CNRA 3LKWA 1V2ST 3D62A 1E37B 1OHHD 2GCHG 1HAOH 2F9OA 4Y8XA 2D26C 4WMDA 2Y7ZA 1P2QA 1TPSA 1BTHH 1UCYK 1YPHC 1ZJDA 1SQAA 1OWHA 2VGCB 1HAYB 1S84A 1O3JA 2HVYB 3PB1E 3K9XB 2P3FH 1SLWB 4JZDH 3UNSA 2K0QA 1NRQH 1ZTJA 1H9LB 1NRPH 5TCCA 3ATIA 2J9NA 1YCPK 1GWAA 2QN5T 1E34B 3F6UH 3OU0A 1EKBB 1ETSH 1HAXB 2ZU3A 4GAWA 3BTQE 3SV2H 2A32A 4XBCA 1GBAA 1LHCH 4GHQA 5KGOA 1S0QA 2BD2A 1GJAB 4AB9A 1IQGA 2J94A 3L33A 1UVSH 1P09A 3T28A 3MH6A 3U8OH 1C5NH 2XNDD 5FPSA 2ZDKA 3WW7A 4NIXA 2VH0A 9LPRA 3SJ8A 1P0SH 3GY7A 2XBXA 2ZDNA 1SGNE 4O3TA 1GI2A 2FOBA 2VVVA 1QJ1B 3QZRA 3QGNB 2GD4B 5C1UA 1SGPE 2Y6TA 4FVBA 3SJ9A 2ZTXA 3DSOA 1F7ZA 3A7YA 2BLWA 2BMGB 4M7GA 1FI8A 2OC8A 4DOQA 3UWIA 1EPTB 4RI0A 1PYTC 5DP6A 3RXTA 4UFDH 4H6TA 4ABHA 1CT0E 2SFAA 1RFNA 1ANDA 4F49A 5DP9A 4A6LA 1TLDA 2J2UA 1OKXA 1QIXB 4X1SU 3W94A 1KSNA 1RD3B 1TWXB 4TPYA 1BTWA 1O5AB 4JMYA 3WWBA 4OS6A 4BOHA 1EOLA 1PQ5A 4RKOB 5DO4H 3SGBE 1O2IA 3RP2A 5K7RA 1BRUP 1C1SA 1C9TA 1EP5A 1Z1JA 2ANWA 3H7OA 2CGAA 2J5UA 2G4TA 1C4U2 3UNQA 1SGCA 2Q6GA 4DG4A 1SI5H 1Z8IB 1IHSH 1UTKA 2ASUB 1QJ7B 2NU0E 2Q6DA 5B6OA 2A4QA 2DE8A 3F2HA 3BTEE 4RN6A 5KEDA 3RC4A 4X6MA 1AVGH 1NBME 1O2HA 1P2MA 4XRNA 1PQAA 3ZIAD 1SOZA 3BTHE 1FY3A 2XC5A 3KNXA 4WWYA 4JYVH 2H9HA 1KDQA 1P2KA 4YXWD 5F03A 3GCOA 5HIYA 2PFEA 2HRVA 1TA2A 4ZMAH 3TH4H 2JJ1D 3GY3A 5DGJA 1LQEA 3MQKC 1HBTH 2B8OH 2C90B 3Q3KA 3BTFE 5IYTA 1GHBG 2P8OB 2HPPH 4X1QU 3GCTF 5AFZH 2Y5GA 3QGJA 2FEQH 1S0RA 2VIOA 4OS5A 1TX7A 2YMSC 3AASA 1AFEH 3ZV9A 2HOBA 1XUGA 3M5MA 3SNCA 1SQRA 5FPTA 4DGJA 4TPIZ 1O3PB 4ABFA 4LK4A 1O3CA 1J15A 2BLOA 2GVFA 5JBBS 1VR1H 1A3EH 2I6SA 1C4V2 2FESH 3LU9B 3UOPA 1NRSH 1T32A 1AHTH 3KQBA 1AKSB 1PQ7A 5DP4A 1W11U 5EIYA 1GI0A 1CQQA 1NT1A 2BDGA 4ASHA 1O3LA 1O2YA 1S82A 4FXGH 4MNXA 5E8EH 1K1PA 2HLDD 3PO1B 2FI4E 1UHBB 3K6ZA 4FVDA 2BOKA 2FS8A 3V13A 1MQ5A 3FZZA 1KXAA 1SLUB 3MU4A 1CA8B 1QL8A 1KIGH 1DOJA 3EQ0H 3DUXH 2TGDA 2A4OA 2UWOA 1F2SE 4K1EA 2A5IA 3RC6A 2AYWA 1ID5H 1GBBA 1C5OH 3GDUA 3CENA 2LELA 1KLJH 7ESTE 1P04A 5L6NH 5HM2A 3ZZ5A 4Y71A 1ANEA 4Q7ZA 1GI9B 4GVUA 1V2QT 2WYGA 2BQWB 2QF3A 3NKKA 3UNRA 3H09A 3GOVB 1DWEH 2XCNA 1IQKA 3AAUA 1L4ZA 1SQOA 3K2UA 4KTUA 5FBIA 1ZRBA 2P93A 1VCWA 1C5TA 1G37A 2BDHA 1BTXA 1O2VA 1QBOA 3EYDA 1B7XB 2VBCA 1NRNH 3BTKE 1O3EA 2O8MA 1MBMA 1WTGH 3SBKA 3VB3A 2BZAA 4UD9H 1N6YA 5T6DA 1GJ9B 4IMZA 4CRCA 1HAGE 1O39A 3R3GB 1FX0B 3W95A 1C2MA 8GCHF 2FX4A 1J17T 1FIZA 4CH2B 3K6YA 1WU1A 1Y59T 3ODDA 5ABWA 4AG1A 1MTVA 1PPEE 1YLDA 3B8JA 1Z1IA 3RXBA 4HTCH 5JB9S 3R0FA 2VU8E 2PSYA 5FPYA 4CR5A 2QXJA 3LC3A 3OAAD 1AI8H 3SYJA 2ESTE 2GT8A 2J4IA 1DS2E 1P02A 1SGDE 3GICB 1A7SA 4B6FA 5CHBA 1NZQH 1RTKA 1C5LH 1CE5A 1TMUH 3KQ5A 1L4DA 1EQ9A 3QZQA 1G32B 1HCGA 2BB4A 2K1QA 1GL1A 1DXPA 2BD4A 3O8DA 3UPEA 1FY8E 3A80A 1MAYA 3S9AA 2R0KA 3QDZB 3MNCA 2Y80A 3ZVGA 2ZFQH 1TA6A 2F9UA 2J95A 5C5NA 3AW1A 3ZZDA 5EW1H 1D6WA 1LVYA 1UK3A 1LHGH 2BDAA 2XNIA 3FVFB 3P6ZB 1O3NA 4UE7H 1O5CB 3OY5U 1YCPM 1EAIA 3RXVA 3H7TA 1FNIA 1MZAA 3LGWA 2CHAC 2AERH 3PROA 2QXGA 1C5QA 1FZZA 2GTBA 3M7QA 1B0EA 1S5SA 3VB6A 3ZZ6A 1GJ8B 1KMHB 4DIIH 1FLEE 4OM9A 1O2GH 5C1YA 3B23B 3PMJA 4Q2KA 4D7GA 4AX9H 2ZCLP 1GMDG 1DE7H 1ARBA 3PV4A 1IAUA 4CRBA 1MABB 3EE0B 1M9UA 3EDXB 3IG6B 4NZLA 2ZTYA 5CHAC 2PTCE 4Q63A 1DSTA 1WOFA 4YM9A 2AMDA 1YPEH 1JIRA 2HLCA 2RCEA 4Q7YA 2H9EH 1JRTA 1PPHE 1LKBA 1SGFG 2R2WU 1JXPA 3PLBA 1P05A 2JDID 4AZ2B 1BDAA 1PJPA 4PROA 4MNYA 4B6EA 4ABGA 5EJ1A 2BQ7B 1QB9A 5GWZA 1DT2A 1RS0A 2KX4A 5EQSA 3SV6A 1GJBB 1O2SA 1GBCA 2O8LA 2VB0A 2W3KA 3LGUA 4I8LA 1WSSH 1ELDE 2VGCC 3P70B 2P3UB 1F5RA 4AFZA 4K2YA 1HUTH 1QBVH 4KTCA 3TJOA 1V2PT 3N99A 1DFPA 1YLNA 5E0JA 3E16B 4ZKNU 1JWTA 1SMFE 3RM2H 7LPRA 1QA7A 2ALPA 1ELAA 1GBLA 4BTIB 3M35A 8LPRA 1SBWA 9ESTA 3RC5A 1NFUA 3TGKE 1BT7A 3T2NA 1CU1A 2RA0A 4X8SH 5A0BA 4OS4A 1UTNA 1MU8B 3C27B 1E0FD 2IOTA 3EA8A 1YPGH 4Y0ZE 4MPVA 1G2MA 1AVWA 1DWCH 3A7TA 3SI3H 3UTUH 1GHXH 4AFQA 1OWEA 2ZFPH 1IQFA 1C5VA 1TX8A 3P8GA 1E1QD 4YESB 3UOUA 4ABJA 2VIPA 1DSUA 2ZFRH 4AORA 1W13U 1UVPA 4HGCA 2Z3DA 2ZU4A 1LKAA 2JETB 1WBGB 2BHGA 3SJIA 3ZVFA 1O3DA 5L2YH 2PGBB 2AGGX 1ZPBA 4XFQA 1C1UH 2PUXB 1SLXB 1TPAE 3KQCA 4X6NA 1KXCA 2FOMB 5PTPA 1QRWA 1EZXC 2EEKA 1LVOA 1GHWH 2XXLA 4YOIA 2DUCA 1GJCB 1AQ7A 5EPNA 1UTQA 4JYTA 4Y11E 2EC9H 2PTNA 3O8CA 4CBNA 6GCHG 3OFND 2WHXA 1H8IH 1EFRD 1U6QA 1C4Y2 1W8BH 2GX4A 1B5GH 2BTCE 4HI3A 5E2OA 3Q77A 2G52A 1V2TT 5GDSH 1TNJA 3Q76A 1CT2E 2FOFA 1C2HA 1RIWC 1O2TA 1O3AA 1VITH 1LMWB 3A7VA 1DX5M 1ZHRA 1W14U 1V2UT 3VGCC 2TPIZ 4B2BA 4B74A 1MCVA 1YPKH 3RLWH 2H9TH 1PYTD 2QXIA 2B0FA 4I32A 5A0CA 3BIVH 3FKSD 4OS2A 1TE0A 4NSYA 8ESTE 2ZFSA 2THFB 1TONA 2Y81A 4CHAC 1KXEA 2GDEH 3EGKH 1QJ6B 4XE4A 1H9HE 2Z9JA 1LO6A 1MQ6A 2P8OC 3PYHA 1QL7A 3ZZBA 3MWIU 3SU0A 5C94A 1CBWB 1OPHB 2FTMA 2I6QA 5FCKA 3RXAA 3SO3A 1IQNA 1GI6A 3SGAE 2V35A 3RXKA 1XXDA 3MO9A 3UQOA 1QNJA 1SKYE 1ACBE 1GI5A 1Y5AT 3RXSA 3URCA 1HNEE 1G30B 3Q3YA 4D7FA 1MTNC 2ULLA 3ZVAA 1A46H 2UUKB 3BSQA 3SQHE 2P16A 4CRDA 1AN1E 1T8MA 1UTMA 1JRSA 4WMFA 1LQDB 1O2UA 5C17A 2WPMS 1C5XB 1VGCB 2OCVB 1HRTH 2IN2A 1W7GH 2CV3A 1TGTA 3BTME 1O2QA 2GZ9A 3SV8A 1HIAB 2A5AA 3NCLA 4ABEA 3GDSA 3RXJA 4AOQA 1F0RA 1GHZA 1HJAC 3H5CB 1ELVA 1CGIE 5C5OA 4E06H 1O5EH 3EA7A 2M5TA 1ZPZA 1OP0A 1SLVB 2EI8A 4XBDA 2F3CE 1DUEA 1SHYA 2JH6D 2SNWA 4YLUA 3M3VA 4BAKB 2YMSD 1C9PA 2WV9A 2PKAB 1TGSZ 2HWLB 1T8LA 1H8ED 1OWIA 1W12U 1SFIA 3S7KB 5T6FA 3EE7A 1A5GH 1TPPA 2Z3CA 4WXVA 3STJA 1HYLA 3RXIA 2B5TB 2Y5FA 2UWPA 4KGAA 1O3KA 4DY7B 1HAVB 4B76A 3F2GA 1TB6H 2KCOA 2HALA 3KQDA 2WPDD 2J98A 1UMAH 1Z7KA 4WH6A 1AMHA 4MG3A 3EAJA 3URDA 2PV9B 1C5SA 4HZHA 4NIVA 1C2JA 3QO6A 4NCYA 1UK4A 1UVUH 2TGTA 1RTFB 4U32A 1X7AC 3F0OA 2OC7A 4CRAA 2SGFE 3GCHB 1PQ8A 2IJOB 2VWNA 3RXFA 3A86A 3OTPA 1L0ZA 2C8XB 3DD2H 1QQ4A 2HNTF 2HPQH 3E3TA 3ZZCA 2WV5A 1G3EA 3PWCA 4DJZB 5FX5A 1AO5A 3MOCA 3FAOA 1K21H 4I86A 1GBFA 2BD5A 2YOLA 1FXYA 2WPKS 3KYFA 3ATLA 1IQEA 2FMJA 1Z6JH 3NUMA 1AGJA 3A7ZA 3LJOA 2G00A 5GPIB 1W3CA 5DSFA 3V7TA 1O34A 4A1XA 2QYIA 2XBYA 3RXUA 4Z0KA 3OSYA 1BMMH 2VH6A 4K8YA 4ABDA 1SG8B 1K1OA 6LPRA 3D49H 1GI1A 1ELEE 1THPB 2QF4A 2FOEA 2V3MA 1O5BB 1G2LA 2XBVA 1TNIA 5J4QA 1HFDA 4OS7A 1BHXF 3IWMA 4AC9A 1K1MA 2Y7XA 3M3SA 5SGAE 1K22H 2XC4A 3PTBA 1GDNA 2OLGA 4H4FA 1YPLH 3M7TA 1A5HA 1YM0A 4YZUA 2ZQ1A 2GMTB 5HMAA 4ABIA 2VIVA 3A7XA 2QF5A 3CS0A 3SI4H 1BUIA 1HJ9A 3ATKA 3HK3B 1P01A 1TYNA 5JYIA 3RM0H 1E35B 3DSPA 1UTOA 2JJ2D 2OTVA 3KYGA 3VXEH 1GBMA 1WAYB 1ZMNA 1MKWH 2D2DA 1A2CH 2H1UA 3SU4A 2VJ1A 1TBRH 5HKKD 5A2MH 3NWUA 3SUDA 1V2WT 1YLCA 2O9QA 1GBKA 3VB4A 1YBWA 2BQ6B 2A45B 1DM4B 1C1WH 1QB1A 3ELAH 1SR5C 2FODA 1P8VC 3PMBB 4CR9A 3UR6A 4CREA 4X8VH 5C0TA 3TVJB 2F9PA 4H42U 1HJ8A 2WUBA 3LH1A 5F6MA 1EB2A 2FO9A 1ZHMA 2B7DH 1XKBC 4HG6A 1NC6A 4YOGA 3P8OA 2QC2A 1CA0B 2PKSB 2WV4A 6CHAB 3TPIZ 1OSSA 2CK3D 5GCHG 3ZVEA 3MU5A 1E38B 2W5EA 4ZAEA 5A8ZA 4YT6H 2FS9A 1ELBA 5CMXH 1KXDA 5AHGH 1NBMD 1TAWA 3RMMH 1DVAH 2V6NA 5EJZA 3ZVBA 2BM2A 3GYMA 2SNVA 1EUFA 4JZIA 1L1NA 1YPJH 4NWLA 5EU8A 2VWMA 1GI8B 3U98H 4BNRA 6GCHF 2FLBH 4FU7A 2B9LA 1IQIA 2BD8A 2ALVA 2XOKD 4ZKOU 3UUZA 2ANYA 4TWYA 2KAIB 3SZNA 3HATH 2BY6X 1GBDA 1ELFA 2EA3A 3GY8A 3QX5H 4E7RG 4GUXA 2Q1JA 1K2I1 2TGPZ 3PM3A 4Y7AA 1BHXB 1EJMA 4F4OC 1Y3VA 2F43B 3OTJE 1DDJA 2BX3A 2FLRH 4A92A 1FDPA 2F9BH 1ZYOA 1D9IA 3PV2A 5ESTE 4D9RA 1EATA 1IQHA 4ZH8A 7KMEH 2ZCKP 3V0XA 1P3EA 2A4GA 3NZIA 1P2IA 1HXEH 1MCTA 1C5YB 3ZVDA 1A5IA 4JZFH 3T5FH 2K8IA 1ARCA 4JZ1A 1MU6B 2ZGXH 1AUTC 2C8WB 3P8FA 1ANCA 3P17H 4SGBE 1VITF 3U1JB 1P9UA 5EQRA 3OEED 3SGQE 1F92A 2FPZA 3GY2A 5AFYH 1NFYA 1ZPCA 2OBQA 2OXSA 3AVZA 2FWWA 1GMCG 4A5TS 4CH8B 2G81E 3U69H 1H1BA 2BDYA 3JZ1B 5EW2H 1C1MA 2V7QD 5KECA 1DY9A 3SJKA 2J92A 1C1QA 1GL0E 4A1TA 4X2VA 2A7HA 3A8DA 2BY7X 3F3BA 1SB1H 4Q4LA 1D3DB 2ZPQA 1MTWA 1OYTH 1O31A 1RTLA 2QA9E 1EB1H 1H8HD 4TWWA 3QN7A 4B2CA 5IK2D 4YOJA 3DFJA 3QLPH 1YPMH 1PPFE 3TJNA 4BAQB 1CGHA 3L6PA 1NO9H 3PMAB 3MYWA 3STIA 5LGOA 1MKWK 4Z6AH 5DK1A 2V0BA 1GDUA 3PRDA 5GIBA 2ZNKH 2F9VA 1A3BH 2JH0D 3K65B 2QY0B 1SPJA 2HNTE 1HGTH 2W7UA 4HFPB 1CT4E 3RMNH 1A61H 2GCTC 3E0PB 3PWBA 3NK8A 1QRZA 1HV7A 1G9IE 3Q3XA 3Q00A 3RUOA 2FX6A 4Y0YE 3UIRA 1KLTA 2OP9A 3UFAA 3LJJA 1EZSC 1LHFH 2Y5HA 2FOCA 1EASA 1KYNA 1KTTB 3ENSB 3P92A 1N8OC 2GGVB 3DFLA 2ZGJA 1WXRA 1ETRH 3AAVA 1OOKB 2QXHA 1GG6B 1A1RA 1QR3E 4BAOB 2CMYA 1SQTA 1O3IA 3OYPA 1XUKA 1BBRE 1A0HB 1V2RT 1CHOG 3FP8E 3CS7A 3TJUA 3W1EA 4CRGA 1ESAA 1HAZB 1NPMA 2W7SA 1ELGA 1TNKA 1MD7A 4E7NA 1T4VH 1TNGA 5E0HA 1K1LA 4ASUD 1MAXA 4I8KA 1EPTA 2BDIA 5E0GA 4MDSA 3HKJB 3SUGA 4ZCNA 1V2KT 3SJOA 1BBRH 2OQUA 3ZZ4A 2GCHF 3AW0A 1V2LT 5T1VA 4YTAA 2KCAA 1XM1A 3E0NB 1TGNA 3I78A 1G3CA 4FETA 2IPQX 4ABBA 1O36A 2HGTH 1TOCB 1E1RD 3ESTA 5GXPA 1C2DA 4KELA 3DT0H 2G8TA 4AYVB 1UVTH 4YO9A 3S9CA 3B9FH 2P94A 2RDLA 4GCHG 4VGCC 1O2NA 1S6HA 4JK6A 4MNVA 1W0KD 1E79D 1ZGVA 3PTNA 5FHTA 3TJVA 1O5GH 4ISLA 5FX6A 2ZDVH 4BTUB 3SNDA 1C2LA 1FUJA 2ZFFH 1BB0B 4BXWA 2BVRH 3GY4A 1FV9A 2H6MA 2PW8H 1TRNA 1VKYA 1GBEA 1ZSKA 3QTOH 1AIXH 1FPHH 4X8UH 1XX9A 3VFEA 1V2VT 1WQSA 1O3MA 4XBBA 1CO7E 4JCNA 2ZA5A 4Z1MD 5LH8A 4Y76A 4DURA 5A09A 5HIZA 4QT8C 2BVXH 1O2LA 3S69A 1O3GA 2ZO3H 5IDKA 1LVMA 3TLOA 2WPLS 5F8ZA 1K1JA 2R2MB 2J98B 4ESTE 2H5DA 1GHYH 2G51A 3AK5A 1E36B 1H4WA 3NPSA 2ZHDA 2ZPSA 5T3HA 1KTSB 1F0UA 1FAXA 3NRLA 1GI3A 5FCRA 1Y3WA 5JBTA 5HYOA 4J1YA 1QTFA 4NSVA 1D3QB 4AGJA 2O8TA 1PPBH 1C1TA 1QURH 7GCHG 1YP9A 4NWKA 1UHBA 1P2OA 2P59A 2ANMH 1FY4A 4BXSA 3GISB 3M3TA 2GMTC 3A87A 1O30A 1TRYA 3SU3A 3VB7A 4I8JA 3F9FA 4TYDA 3MI4A 2TIOA 2A2QH 1ZJKA 1ANBA 1EPTC 1OWJA 2V3HH 3TITA 4ABAA 2ZWLH 1FMGA 4P00A 1BCUH 3TK9A 1QL9A 2ZU1A 2H5CA 4X0WU 4Y79A 2WINI 2GKVE 4IMQA 4Q80A 2C8ZB 5C67A 1P9SA 4X1PU 1GHBF 1KXBA 5DKMA 3QTVH 3KHVA 4NGAH 5DP8A 5A8XA 1K1NA 1G36A 5EOKA 2ZFTA 1BRBE 1BMLA 1SSXA 1O38A 1GBIA 3TGIE 1TNLA 1O2ZA 1YKTA 2HNTC 4UFEH 1EJAA 5C2ZA 3UWJH 3MU8A 2Z7FE 1BBRK 3A84A 2LNCA 1CA0C 3M7UA 6CHAC 1H9IE 2RDEA 3MTYA 1UVOA 2J97A 4A7IB 3GCTG 4LZ4B 1V6DA 4GPGA 1FQ3A 3SORA 1LHEH 3KL6A 2ZZUH 2BYAX 2WPHS 3I29A 4AGKA 1C1RA 3O8BA 1SGEE 1QB6A 2Y82A 1GMHG 4UDWH 3SV9A 3RXLA 1GJDB 1GDQA 2ZG0H 1ELCA 3FP6E 3A88A 4RT0A 4X2WA 4TT3D 1L1GA 4NFEA 3SQEE 4DW2U 1DICA 5ETXA 3BG4B 4ISOA 1GBTA 3UB0A 3LGVA 2C93B 3M36A 4ISHH 4WMEA 4ZHAA 4U2WA 1QBNA 1EXFA 1LHDH 3M5OA 3N7DA 1GMCF 1AB9B 4MTBA 2G55A 1Z8RA 3MNBA 2WZQA 1QRXA 4AYYB 4K69A 2L6OA 4AN7A 3KGPA 2SGQE 3ATWA 3A8AA 3HK6B 1INCA 4TY6A 1VCPA 3BF6H 2ZDMA 1NROH 4XOJA 2RG3A 3BTDE 3FOAA 4ACAA 4LXBH 4NFFA 3SOSA 5BPEA 1KDQB 4YLQH 2Z3EA 3PO1C 2ZHFH 4ZKRU 2BXUH 2A2XH 3GYLB 4TSFD 4Y6DA 5HM9A 5DP3A 1QGFA 1T4UH 1O5DH 4GSOA 1LPKB 1WQVH 4K5ZA 1CSOE 1EX3A 5FL7D 1YF4A 3SNBA 4AG2A 1EAUA 1VJAU 1VJ9U 1F0SA 1DANH 2ZGCA 1H8DH 3SU2A 1P12E 1SGQE 3FANA 1NU7B 1ZMJA 1S81A 2YNAA 3M5NA 1C5MD 2FYQA 2AMPA 3RU4E 3BIUH 1OYQA 2BDCA 5LPEA 1D6RA 4NIWA 2NU3E 2FTLE 4X6PA 3A83A 1ZGIA 1P03A 3V3MA 1GHAG 1LCYA 4YT7H 2STAE 5ESBA 1Q31A 1XUHA 1J9CH 1LDTT 1O2MA 2VIDA 1AZZA 2KM0A 4Y7BA 1P2JA 1BJUA 1P10A 2YNBA 1BZXE 1S83A 1GVKB 3FFGA 4R0IA 4R8TB 3F9EA 1AFQB 1CHOF 2C8YB 2Z9LA 1NS3A 2AMQA 1NRRH 3TIUA 4BANB 1LTOA 1THRH 3QUMP 1RRKA 1VCQA 2CXVA 3RXEA 3KF2A 1YGCH 3OEHD 4OGXA 5DJ7A 4Y10E 2ODPA 2P95A 1QZ8A 3KQEA 2TBSA 4IN1A 4DVAU 2XC0A 4K1TA 2BZ6H 2A0QB 2M2AA 1ESTA 2VWOA 1TBZH 4MPXA 5FXLA 5CHAB 1HXFH 4I8HA 2BY9X 2FP7B 2UUYA 3HKIB 1GJ4H 3ATMA 1KXFA 1A4WH 1XMNB 2EY4C 2GDDA 3T25A 3F9GA 1GMDF 1NN6A 1GG6C 3TH2H 4GCHF 2OC1A 4D8NA 3SZEA 4INHA 4XSKU 1Y8TA 2PR3A 1C2IA 1FPCH 1SOTA 4TY7A 2OBOA 2UUFB 3ZZ9A 1C2GA 3HGPA 3SNEA 1SC8U 4MPUA 4DCDA 4I31A 1IQJA 4FOUC 1O3OA 4FUHA 3UR9A 3LONA 3A8CA 4X1RU 2UUJB 4O03A 1O32A 3F9HA 3TNSA 3RXDA 3U28C 3UREA 1QY6A 4FU9A 4K1SA 1XUIA 1BQYA 4ISIH 4D76A 4U30A 4Y8ZA 3LGYA 2ZDLA 1JIMA 2F91A 1TBQH 1DLKB 1UO6A 4ZROA 1C5PA 1D3PB 1D3TB 4IGDA 4FUJA 1GJ7B 2HVXA 3CP7A 1MD8A 3T27A 2ANKH 3RXRA 1MZDA 1SGTA 1MBQA 1IQMA 4OGYA 3JZ2B 1T7CA 3U1IB 1TIOA 1YC0A 2O8WA 3OY6U 3BEFB 2GV6A 4MQAA 1O3FA 2KZ4A 2C3SA 4RKJB 2ZDAH 2Z6BD 1B0FA 1GGDB 4FUEA 2STBE 2AIQA 1NM6A 1O0DH 4B71A 1W0YH 3DSGA 3MNSA 2AS9A 3SN8A 1ZR0A 4WJG2 2PP6A 4AFUA 4NA7A 3OE7D 2ZCHP 3WWFA 1F5KU 1AZ8A 7GCHF 1K1IA 1ZRKA 1EOJA 2Z94A 4BAHB 1WV7H 1BMAA 3LC5A 1TQ7B 4B75A 2ZQ2A 2FYRA 3BN9A 1QFKH 3RLYH 3VEQB 4FUCA 1ZSLA 4IW4E 3E91A 1K0HA 4FUDA 2P3TB 1DPOA 5J4SA 3BEIB 2BY5X 1HAIH 4WH8A 1SGYE 4A1VA 1BTPA 1V3XA 2Q6FA 1KLIH 2ZC9H 3F0PA 2ZGBH 3S0NA 1S6FA 2ZHEH 1DITH 5I46H 2A1DB 2A7JA 3PV5A 4DT4A 1RIWB 3KN2A 3ZZ7A 1J16A 4MNWA 1FN6A 3F68H 2A7CA 3VGCB 4ZUHA 4JYUH 2ZKSA 1AD8H 4FUBA 1RXPA 4J2YB 3SUEA 1LVBA 2KCPA 3LGIA 4GHTA 2G5NA 2QF0A 4IC6A 2R9PA 2FXRA 2SGAA 1P2NA 2AH4X 2VWLA 5EPYA 1EP6A 1MTSA 1HIAA 3E8LA 4K60A 2WSSD 1OP2A 5F8TA 4ACBA 4CHAB 2EI6A 3ZYEA 2VIWA 1MUEB 3GDVA 4LZ1H 2FM2A 5A8YA 2QGRA 2BX4A 2PGQB 3WY8A 2JETC 2ILNA 1THSH 1COWD 1GCTB 1C2EA 2AGEX 2XTTB 2F9NA 1PFXC 2CF8H 1TGCA 3F2FA 2R3YA 2F83A 2PKAA 1TPOA 1GMHF 1W10U 5EQQA 4ZXYH 2AIPA 2ODQA 2JH5D 2W6ID 1MTNB 3MH5A 1QQUA 2RFKC 2OD3B 1PPCE 5F53A 5T6GA 4KTSA 2UWLA 1RGQA 1HAVA 4M9FA 3ZZ8A 2AHME 3SUFA 2BD9A 4B2AA 3LPRA 1G3BA 4FUGA 3MO3A 3ITIA 3HGNA 4CRFA 1GJ5H 1C1OA 2CN0H 2XWAA 4D9QA 3T62A 4X2XA 1Z71A 1HJAB 1O2RA 1TFXA 3SW2B 1O3BA 1S85A 2ZU5A 4IBLH 4WVPE 5C0UA 1AY6H 1ABJH 1L2EA 2SGEE 3A81A 1FN8A 1O2KA 1UK2A 3LGTA 4NZQA 1D4PB 2GT7A 1GJ6A 3BV9B 3C1KA 3NXPA 1T8OA 2GJGA 2AGIX 1KY9A 5L30H 1Z6EA 2ZU2A 4OS1A 1Z8GA 2H2ZA 3A85A 3ODFA 3ZV8A 3SHCH 4FU8A 4X6OA 2VINA 3PLKA 4K3JA 1HAPH 4NIYA 5L2ZH 2DE9A 1CBWC 1NY22 1N1LA 3FP7E 3BG4C 2BLQA 6ESTA 1RJXB 4P02A 1WUNH 5GJ4B 4X2YA 1OXGA 3GS9A 1AB9C 3OX7U 3U8RH 3MHWU 1EAXA 5K0HA 1F5LA 1FY5A 5EXNA 3BTWE 1GVLA 2FIRH 2NU1E 4IC5A 1GBHA 2PUQH 5LPRA 5F8XA 3P8NA 1SHHB 3A7WA 2D8WA 3MH4A 1GHAF 4K8BA 1VGCC 2O8UA 1HLTH 1PPGE 1UTLM 4I8GA 3SV7A 3IITA 1A0JA 2BD7A 1W0JD 1Y3UA 2W3IA 1ORFA 1SGRE 1HDTH 1ETTH 4ISNA 2OC0A 3HPTB 3UQVA 1AUJA 3G01A 5HGGA 3FO8D 3N7EA 5JBCS 1C1NA 1CHGA 4NA9H 1HPGA 1GPZA 3RMOH 2G4UA 4ZHLU 2OQ5A 3P95A 4B73A 4I7YH 2V3OH 5DG6A 1FJSA 3TK5A 1DLEA 2GZ8A 4UFFH 4NA8A 4KP0A 1EZUC 1WCZA 2GZ7A 3S7HB 3M61U 2QIQA 2L74A 1V2MT 2AEIH 5DP5A 4IS5A 1Q2WA 1BA8B 1TNHA 2BY8X 2QAAA 1TX6A 1UW7A 2D1JA 5EG4A 1JBUH 4B1TA 3ZZAA 1BMFD 1UJ1A 3UY9A 3I77A 2PWXA 1HB0B 2ZPRA 2FDAA 2KFWA 1IHTH 1A0LA 3D23A 1TGBA 3E90B 1GI7B 4UEHH 1T8NA 2FOHA 2TGAA 1AFQC 5CDFE 2EI7A 2LPRA 1EJNA 3GCHC 3SU5A 1C5UA 2QV1A 3LDXH 2J38A 1LPGB 1MMJN 2XBWA 1PPZA 2ODYB 1C2FA 4BAMB 1MTUA 3SHAH 1FONA 4I33A 3T29A 4CBOA 1SVPA 1C1VH 1JOUB 4X1NU 1TMBH 1OWDA 1OS8A 1LPZB 1CVWH 2Z9KA 5JPMH 4INKA 4INLA 3TK6A 4ZHMU 1SGFA 3EA9A 2AFQB 4FUIA 3TU7H 2KAIA 1C5WB 4O3UA 1AE5A 3RU4T 1UTPA 4XDEA 1L1JA 1GHVH 3MNXA 3DCLA 1ZLRA 3RXMA 3E1XB 3T26A 1BTZA 1SL3A 5LPFA 3U8TH 5C20A 1AKSA 4THNH 2VVCA 3UAIC 5BRRE 5H4IB 3MH7A 1BJVA 2ZIQH 3KEEA 1O2PA 3M5LA 1GBJA 1GVZA 3RDZA 3DA9B 2JKHA 1QHRB 3D65E 2IJD1 1QA0A 4LOYH 3GCNA 1K9OE
chains in the Genus database with same CATH topology
1TRMA 5GCHF 3U9AH 5HXFA 5AVDA 2NU4E 3ZVCA 2RA3A 1MKXH 1YPHE 2R0LA 3BG8A 4H6SB 3RXOA 4DT7B 1AWHB 1Y5BT 3A82A 1BRCE 2XRCA 4ZKSU 3TH3H 5EXLA 1ESBA 3M37A 1O35A 2QCYA 1O3HA 2GP9B 1K28D 2ZI2H 3RXQA 1VZQH 4BTTB 1IOEA 1GGDC 5C3NA 1O2WA 5TCAA 4MVNA 2OUAA 2XYAA 1NFXA 5TJXA 1FIWA 2TRMA 1TABE 2FOGA 8KME2 2FZZA 2PLXA 1O33A 5JBAS 3PMHB 3MMGA 1V2OT 3MO6A 1TQ0B 1P11E 1AWFH 2WPIS 5I25A 2ZEBA 5JB8S 1IQLA 1NFWA 1O2JA 1FY1A 1UTJA 1UCYE 2PKSC 1C1PA 3MU1A 4ZXXH 4MLFB 1CGJE 4RSPA 1XKAC 2WYJA 2CJIA 2A5KA 1AVXA 1BTUA 2BVSH 2SGDE 4AFSA 1Y5UT 4O97A 2BDBA 2FOAA 1ZMLA 1Y3XA 2PHBA 2SGPE 2C4FH 1W2KH 2ZP0H 4SGAE 4AB8A 1UCYH 2A31A 2OINA 5G4BA 1FAKH 1NU9A 1V2JT 4WF8A 1ZSJA 1F0TA 1Q3XA 2VNTA 2WPJS 3KCGH 1Y3YA 3FZDA 1ZOMA 4UFGH 3A89A 3RMLH 3QWCH 4UONA 1YCPH 3TGJE 3MU0A 3VXFH 2A4RA 2XW9A 1BITA 4O9VA 3ZZ3A 3SU6A 1O5FH 3DHKH 1HAHH 3TNTA 3LIWA 4DIHH 4MPWA 1V2NT 1QCPA 1AE8H 3SNAA 2J34A 3MFJA 3RXPA 2BLVA 1GCTC 1ZZZA 1VITG 1SGIB 2NU2E 1NESE 4GLYA 3SU1A 5C1XA 3RXCA 2GV7A 1BTYA 1GI4A 1T31A 2GCTB 2PSXA 2VVUA 3KIDU 1OP8A 1C5RA 1W7XH 1BOQA 1XUJA 1AU8A 1J14A 1ELTA 4JK5A 3LT3A 5A0AE 1DY8A 1OWKA 1P06A 2NWNA 3RXHA 1NTPA 2ZHWH 4E05H 1O2XA 1P57B 5EGMA 2CF9H 1DWBH 1TMTH 1XVOA 3GY6A 5EODA 3S9BA 5EXMA 4X8TH 1N8OB 2ZECA 3VB5A 3LOXA 2IPHA 5E2PA 4IN2A 3BEUA 3GY5A 3O8RA 2FI5E 1JMOH 1J8AA 2BD3A 3LH3A 5CE1A 3E6PH 3RU4D 2ZGHA 5FAHA 3VPKA 1C2KA 1BMNH 3BTGE 1G3DA 3V12A 1BIOA 1MH0A 2ZTZA 2FI3E 1TALA 2Z9GA 1ABIH 3PLPA 1TOMH 1GCDA 1WTHD 1O37A 8GCHG 2XCFA 5AF9H 1MKXK 2XWBI 2Z9IA 1DXWA 1Z8JB 1DUAA 2CHAB 3ZYDA 3N7OA 5DP7A 1DWDH 2ZF0H 2R3UA 4WXIA 5FBEA 1XXFA 2ZHQH 1ZTKA 4KKDA 1W0ZU 1EZQA 2W26A 3A8BA 4NG9H 4FUFA 2VIQA 3L3TA 4Q7XA 3RXGA 4VGCB 4U01A 1N6XA 1YYY1 1P3CA 3BTTE 3F1SB 4JZEH 4Y8YA 1SFQB 1BRAA 1ZTLA 3QK1A 2BXTH 2G5VA 1OX1A 5JDUB 4WY3A 1C5ZB 1XVMA 2BOHB 1EAWA 1O2OA 1WYKA 5DPAA 1XUFA 2WUCA 1ZHPA 3LKWA 1V2ST 3D62A 1E37B 2GCHG 1HAOH 2F9OA 4Y8XA 2D26C 4WMDA 2Y7ZA 1P2QA 1TPSA 1BTHH 1UCYK 1YPHC 1ZJDA 1SQAA 1OWHA 2VGCB 1HAYB 1S84A 1O3JA 3PB1E 3K9XB 2P3FH 1SLWB 4JZDH 3UNSA 1NRQH 1ZTJA 1H9LB 1NRPH 5TCCA 3ATIA 1YCPK 2J9NA 1GWAA 2QN5T 1E34B 3F6UH 3OU0A 1EKBB 1ETSH 1HAXB 2ZU3A 4GAWA 3BTQE 3SV2H 2A32A 4XBCA 1GBAA 1LHCH 4GHQA 1S0QA 2BD2A 1GJAB 4AB9A 1IQGA 2J94A 3L33A 1UVSH 1P09A 3T28A 3MH6A 3U8OH 1C5NH 5FPSA 2ZDKA 4NIXA 2VH0A 9LPRA 3SJ8A 1P0SH 3GY7A 2XBXA 2ZDNA 1SGNE 4O3TA 1GI2A 2FOBA 2VVVA 1QJ1B 3QZRA 3QGNB 2GD4B 5C1UA 1SGPE 2Y6TA 4FVBA 3SJ9A 2ZTXA 1F7ZA 3A7YA 2BLWA 2BMGB 4M7GA 1FI8A 2OC8A 4DOQA 3UWIA 1EPTB 3RXTA 1PYTC 5DP6A 4UFDH 4H6TA 4ABHA 1CT0E 2SFAA 1RFNA 1ANDA 4F49A 5DP9A 4A6LA 1TLDA 2J2UA 1OKXA 1QIXB 4X1SU 3W94A 1KSNA 1RD3B 1TWXB 4TPYA 1BTWA 1O5AB 4JMYA 4BOHA 4OS6A 1EOLA 1PQ5A 4RKOB 5DO4H 3SGBE 1O2IA 3RP2A 5K7RA 1BRUP 1C1SA 1C9TA 1EP5A 1Z1JA 2ANWA 3H7OA 2CGAA 2G4TA 1C4U2 3UNQA 1SGCA 2Q6GA 4DG4A 1SI5H 1Z8IB 1IHSH 1UTKA 2ASUB 1QJ7B 2NU0E 2Q6DA 5B6OA 2A4QA 2DE8A 3BTEE 4RN6A 3RC4A 4X6MA 1AVGH 1O2HA 1P2MA 1PQAA 1SOZA 3BTHE 1FY3A 2XC5A 3KNXA 4WWYA 4JYVH 2H9HA 1KDQA 1P2KA 5F03A 3GCOA 2PFEA 2HRVA 1TA2A 4ZMAH 3TH4H 3GY3A 5DGJA 1LQEA 1HBTH 2B8OH 2C90B 3Q3KA 3BTFE 5IYTA 1GHBG 2P8OB 2HPPH 4X1QU 3GCTF 5AFZH 2Y5GA 3QGJA 2FEQH 1S0RA 2VIOA 4OS5A 1TX7A 3AASA 1AFEH 3ZV9A 2HOBA 1XUGA 3M5MA 3SNCA 4DGJA 5FPTA 4TPIZ 1O3PB 4ABFA 4LK4A 1O3CA 1J15A 2BLOA 2GVFA 5JBBS 1VR1H 1A3EH 2I6SA 1C4V2 2FESH 3LU9B 3UOPA 1NRSH 1T32A 1AHTH 3KQBA 1AKSB 1PQ7A 5DP4A 1W11U 1GI0A 1CQQA 1NT1A 2BDGA 4ASHA 1O3LA 1O2YA 1S82A 4FXGH 4MNXA 5E8EH 1K1PA 3PO1B 2FI4E 1UHBB 3K6ZA 4FVDA 2BOKA 2FS8A 3V13A 1MQ5A 3FZZA 1KXAA 1SLUB 3MU4A 1CA8B 1QL8A 1KIGH 1DOJA 3EQ0H 3DUXH 2TGDA 2A4OA 2UWOA 1F2SE 4K1EA 2A5IA 3RC6A 2AYWA 1ID5H 1GBBA 1C5OH 3GDUA 3CENA 1KLJH 7ESTE 1P04A 5L6NH 5HM2A 3ZZ5A 4Y71A 1ANEA 4Q7ZA 1GI9B 4GVUA 1V2QT 2WYGA 2BQWB 2QF3A 3NKKA 3UNRA 3GOVB 1DWEH 2XCNA 1IQKA 3AAUA 1L4ZA 1SQOA 3K2UA 4KTUA 5FBIA 1ZRBA 2P93A 1VCWA 1C5TA 1G37A 2BDHA 1BTXA 1O2VA 1QBOA 3EYDA 1B7XB 1NRNH 3BTKE 1O3EA 2O8MA 1MBMA 1WTGH 3SBKA 3VB3A 2BZAA 4UD9H 1N6YA 5T6DA 1GJ9B 4IMZA 4CRCA 1HAGE 1O39A 3R3GB 3W95A 1C2MA 8GCHF 2FX4A 1J17T 1FIZA 4CH2B 3K6YA 1WU1A 1Y59T 3ODDA 5ABWA 4AG1A 1MTVA 1PPEE 1YLDA 3B8JA 1Z1IA 3RXBA 4HTCH 5JB9S 3R0FA 2VU8E 2PSYA 5FPYA 4CR5A 2QXJA 3LC3A 1AI8H 2ESTE 2GT8A 2J4IA 1DS2E 1P02A 1SGDE 3GICB 1A7SA 1NZQH 1RTKA 1C5LH 1CE5A 1TMUH 1L4DA 1EQ9A 3QZQA 1G32B 1HCGA 2BB4A 2K1QA 1GL1A 1DXPA 2BD4A 3O8DA 3UPEA 1FY8E 3A80A 1MAYA 3S9AA 2R0KA 3QDZB 3MNCA 2Y80A 3ZVGA 2ZFQH 1TA6A 2F9UA 2J95A 5C5NA 3AW1A 3ZZDA 5EW1H 1D6WA 1LVYA 1UK3A 1LHGH 2BDAA 2XNIA 3FVFB 3P6ZB 1O3NA 4UE7H 1O5CB 3OY5U 1YCPM 1EAIA 3RXVA 3H7TA 1FNIA 1MZAA 3LGWA 2CHAC 2AERH 3PROA 2QXGA 1C5QA 1FZZA 2GTBA 3M7QA 1B0EA 1S5SA 3VB6A 3ZZ6A 1GJ8B 4DIIH 1FLEE 1O2GH 5C1YA 3B23B 3PMJA 4Q2KA 4D7GA 4AX9H 2ZCLP 1GMDG 1DE7H 1ARBA 3PV4A 1IAUA 4CRBA 3EE0B 1M9UA 3EDXB 3IG6B 4NZLA 2ZTYA 5CHAC 2PTCE 1DSTA 1WOFA 4YM9A 2AMDA 1YPEH 1JIRA 2HLCA 2RCEA 4Q7YA 2H9EH 1JRTA 1PPHE 1LKBA 1SGFG 2R2WU 1JXPA 3PLBA 1P05A 4AZ2B 1BDAA 1PJPA 4PROA 4MNYA 4ABGA 2BQ7B 1QB9A 5GWZA 1DT2A 1RS0A 5EQSA 3SV6A 1GJBB 1O2SA 1GBCA 2O8LA 2VB0A 2W3KA 3LGUA 4I8LA 1WSSH 1ELDE 2VGCC 3P70B 2P3UB 1F5RA 4AFZA 4K2YA 1HUTH 1QBVH 4KTCA 3TJOA 1V2PT 1DFPA 5E0JA 3E16B 4ZKNU 1JWTA 1SMFE 3RM2H 7LPRA 1QA7A 2ALPA 1ELAA 1GBLA 4BTIB 3M35A 8LPRA 1SBWA 9ESTA 3RC5A 1NFUA 3TGKE 1BT7A 3T2NA 1CU1A 2RA0A 4X8SH 5A0BA 4OS4A 1UTNA 1MU8B 3C27B 1E0FD 2IOTA 3EA8A 1YPGH 4Y0ZE 4MPVA 1G2MA 1AVWA 1DWCH 3A7TA 3SI3H 3UTUH 1GHXH 4AFQA 1OWEA 2ZFPH 1IQFA 1C5VA 1TX8A 3P8GA 4YESB 3UOUA 4ABJA 2VIPA 1DSUA 2ZFRH 4AORA 1W13U 1UVPA 4HGCA 2Z3DA 2ZU4A 1LKAA 2JETB 1WBGB 2BHGA 3SJIA 3ZVFA 1O3DA 5L2YH 2PGBB 2AGGX 1ZPBA 4XFQA 1C1UH 2PUXB 1SLXB 1TPAE 3KQCA 4X6NA 1KXCA 2FOMB 5PTPA 1QRWA 1EZXC 2EEKA 1LVOA 1GHWH 2XXLA 4YOIA 2DUCA 1GJCB 1AQ7A 5EPNA 1UTQA 4JYTA 4Y11E 2EC9H 2PTNA 3O8CA 4CBNA 6GCHG 1H8IH 1U6QA 1C4Y2 1W8BH 2GX4A 1B5GH 2BTCE 4HI3A 5E2OA 3Q77A 2G52A 1V2TT 5GDSH 1TNJA 3Q76A 1CT2E 2FOFA 1C2HA 1RIWC 1O2TA 1O3AA 1VITH 1LMWB 3A7VA 1DX5M 1ZHRA 1W14U 1V2UT 3VGCC 2TPIZ 4B2BA 4B74A 1MCVA 1YPKH 3RLWH 2H9TH 1PYTD 2QXIA 2B0FA 4I32A 5A0CA 3BIVH 4OS2A 1TE0A 4NSYA 8ESTE 2ZFSA 2THFB 1TONA 2Y81A 4CHAC 1KXEA 2GDEH 3EGKH 1QJ6B 4XE4A 1H9HE 2Z9JA 1LO6A 1MQ6A 2P8OC 3PYHA 1QL7A 3ZZBA 3MWIU 3SU0A 1CBWB 1OPHB 2FTMA 2I6QA 5FCKA 3RXAA 3SO3A 1IQNA 1GI6A 3SGAE 2V35A 3RXKA 1XXDA 3MO9A 3UQOA 1QNJA 1ACBE 1GI5A 1Y5AT 3RXSA 3URCA 1HNEE 1G30B 3Q3YA 4D7FA 1MTNC 2ULLA 3ZVAA 1A46H 2UUKB 3BSQA 3SQHE 2P16A 4CRDA 1AN1E 1T8MA 1UTMA 1JRSA 4WMFA 1LQDB 1O2UA 2WPMS 1C5XB 1VGCB 2OCVB 1HRTH 2IN2A 1W7GH 2CV3A 1TGTA 3BTME 1O2QA 2GZ9A 3SV8A 1HIAB 2A5AA 3NCLA 4ABEA 3GDSA 3RXJA 4AOQA 1F0RA 1GHZA 1HJAC 3H5CB 1ELVA 1CGIE 5C5OA 4E06H 1O5EH 3EA7A 2M5TA 1ZPZA 1OP0A 1SLVB 2EI8A 4XBDA 2F3CE 1DUEA 1SHYA 2JH6D 2SNWA 4YLUA 3M3VA 4BAKB 1C9PA 2PKAB 1TGSZ 2HWLB 1T8LA 1W12U 1OWIA 1SFIA 3S7KB 5T6FA 1A5GH 1TPPA 2Z3CA 4WXVA 3STJA 1HYLA 3RXIA 2B5TB 2Y5FA 2UWPA 4KGAA 1O3KA 4DY7B 1HAVB 4B76A 1TB6H 2HALA 3KQDA 1UMAH 1Z7KA 4WH6A 1AMHA 4MG3A 3EAJA 3URDA 2PV9B 1C5SA 4HZHA 4NIVA 1C2JA 3QO6A 4NCYA 1UK4A 1UVUH 2TGTA 1RTFB 4U32A 1X7AC 2OC7A 4CRAA 2SGFE 3GCHB 1PQ8A 2IJOB 2VWNA 3RXFA 3A86A 1L0ZA 2C8XB 3DD2H 1QQ4A 2HNTF 2HPQH 3E3TA 3ZZCA 2WV5A 1G3EA 3PWCA 4DJZB 5FX5A 1AO5A 3MOCA 3FAOA 1K21H 1GBFA 2BD5A 2YOLA 1FXYA 2WPKS 3ATLA 1IQEA 2FMJA 1Z6JH 3NUMA 1AGJA 3A7ZA 3LJOA 2G00A 5GPIB 1W3CA 3V7TA 1O34A 4A1XA 2QYIA 2XBYA 3RXUA 4Z0KA 3OSYA 1BMMH 2VH6A 4K8YA 4ABDA 1SG8B 1K1OA 6LPRA 3D49H 1GI1A 1ELEE 1THPB 2FOEA 1O5BB 1G2LA 2XBVA 1TNIA 5J4QA 1HFDA 4OS7A 1BHXF 3IWMA 1K1MA 2Y7XA 3M3SA 5SGAE 1K22H 2XC4A 3PTBA 1GDNA 2OLGA 4H4FA 1YPLH 3M7TA 1A5HA 1YM0A 4YZUA 2ZQ1A 2GMTB 5HMAA 4ABIA 2VIVA 3A7XA 3CS0A 3SI4H 1BUIA 1HJ9A 3ATKA 3HK3B 1P01A 1TYNA 5JYIA 3RM0H 1E35B 1UTOA 2OTVA 3VXEH 1GBMA 1WAYB 1ZMNA 1MKWH 2D2DA 1A2CH 2H1UA 3SU4A 2VJ1A 1TBRH 5A2MH 3NWUA 3SUDA 1V2WT 1YLCA 2O9QA 1GBKA 3VB4A 1YBWA 2BQ6B 2A45B 1DM4B 1C1WH 1QB1A 3ELAH 1SR5C 2FODA 1P8VC 3PMBB