3K2UA

Crystal structure of hgfa in complex with the allosteric inhibitory antibody fab40
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
239
structure length
233
Chain Sequence
b'IIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISWGCLHKPGVYTRVANYVDWINDRIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor activator long chain
publication title Unraveling the allosteric mechanism of serine protease inhibition by an antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 50
structure length 233
sequence length 239
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3k2uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3k2uA01
1HXFH 1C2IA 1C1QA 4KELA 2Z9GA 1T7CA 2GMTC 3UOPA 3AAVA 2HGTH 1GI6A 4K2YA 2FX6A 1DSTA 1UK2A 5E0JA 3RC5A 3K6ZA 2JETC 2ZHDA 1GPZA 2PSYA 2SGAA 1W3CA 1MBMA 2BX4A 1V6DA 1P2JA 2CJIA 4H42U 2J34A 2O8UA 2ZU3A 4I31A 1EZQA 4Y0YE 3TJNA 8ESTE 2QXJA 4MDSA 1QURH 1SGEE 5GWZA 1TIOA 1ZPZA 1AFQB 2B8OH 3HATH 1BHXB 1ETSH 1TPOA 3LPRA 4ABDA 4MNXA 1W12U 5F8TA 4WMFA 1GJBB 1BRAA 1EJNA 4CRGA 2FYQA 1VZQH 4LZ1H 3A87A 4A1TA 2PKAB 1EB1H 1C9PA 1C5PA 1YPGH 4NIXA 2WPKS 2J38A 2UUFB 1JXPA 3MU4A 4NWLA 3MH5A 3K2UA 4KP0A 3MNCA 3M3TA 2FOFA 4RN6A 2WPJS 3H5CB 3BSQA 1KXAA 2BOKA 1IQIA 1GI1A 1G2LA 4AG1A 3S0NA 3V12A 4NWKA 5K7RA 2G4UA 1O2YA 1E36B 4E05H 1C1MA 1YCPK 3WY8A 1Q2WA 1G9IE 4BOHA 1BTWA 1JOUB 1HNEE 1G32B 2VJ1A 4X8TH 1TQ7B 5C5NA 4CH8B 2QY0B 1GBIA 1NFYA 4FUIA 1LVBA 4FXGH 3E91A 3JZ1B 1G30B 3FP8E 2FI3E 2TGPZ 2KAIA 1UCYH 1Y3VA 4X6OA 1GJ5H 1CA8B 1YPLH 1DLEA 3M61U 3RXBA 3QGNB 1SHYA 1DWCH 2AGGX 2XBYA 4INHA 3UQOA 3UWIA 3SQHE 4WJG2 2FOGA 1A61H 1XM1A 2SFAA 2FOHA 4Y76A 2BD7A 2OUAA 2BY7X 1XUHA 3MO3A 2GCTB 5IYTA 3UPEA 3HPTB 4MPXA 1Q3XA 3N7OA 1O3JA 3PMBB 4YO9A 3VPKA 4QT8C 1YM0A 3ZZCA 4JK6A 3QZRA 3K9XB 1BTUA 1QBVH 4AFZA 1OWDA 3BTFE 1HJ9A 1AVXA 2AMQA 1V2RT 4FUEA 5LPFA 2VGCB 2BVSH 1TGSZ 1Z8IB 1EAXA 2UWLA 3MU1A 5I46H 1NS3A 4JYTA 2VINA 4NFEA 4ABJA 1FY3A 1C2JA 2ULLA 4XSKU 3KCGH 4Y11E 1C5SA 3SUDA 4ABIA 1W7XH 1O2KA 4FUDA 1WAYB 1XUJA 1Y59T 1A4WH 1F92A 3RC4A 1O2WA 2AERH 4YLQH 2ALVA 1TFXA 1QBOA 3URDA 4WH6A 1V2TT 5B6OA 3GY2A 1J8AA 1TGCA 1E38B 3MH6A 1O5CB 1PQ5A 2ZHQH 2Q6FA 1WOFA 2OD3B 3FVFB 4CBOA 2XBWA 3HGPA 5A09A 4THNH 1Z7KA 1FXYA 4CRAA 1ZHRA 3LDXH 2A1DB 2A5IA 3OY5U 4ISOA 1N8OC 2ANWA 3ITIA 1UHBA 3RMLH 1EQ9A 1CGJE 2FLBH 4GHTA 1QCPA 3F9FA 2BD9A 2HOBA 4K8YA 1C5VA 1KTTB 2BY8X 5EGMA 7GCHG 4OS1A 4Q2KA 2Y6TA 1FAXA 3SV8A 1FJSA 1HUTH 1EASA 1GBEA 2C8ZB 1ESBA 2FM2A 1VGCC 5SGAE 2J4IA 1UCYE 4D7FA 1GBAA 1F0RA 2A4GA 2GDDA 1O3FA 3NKKA 2Z3CA 1BTHH 2IOTA 1AO5A 1FIWA 1AN1E 1Z1IA 2Y82A 7GCHF 3RXQA 1GJ4H 1ZLRA 2A7CA 3RU4T 3TH2H 2ZTZA 3LC5A 1HLTH 5AF9H 5DP6A 4HFPB 4NG9H 4BAQB 2BD5A 3DHKH 3V7TA 4LXBH 3KEEA 1E0FD 2ZC9H 1MKWK 1YPHC 5EW1H 1FONA 1G3DA 4R8TB 2Y7XA 1ZYOA 1EATA 1ZMNA 3ZV9A 1EAUA 5E0HA 3T5FH 2GD4B 4K1TA 3TIUA 4Q7XA 2M5TA 3RXVA 3DD2H 1A5HA 4X8UH 3E8LA 1IQEA 1MAXA 1VR1H 1AKSA 1BMNH 1C2LA 3GCOA 1UCYK 2AGEX 3I77A 4XBBA 3ZZ4A 2XCNA 4Y8ZA 4FUFA 2ZFTA 1HAOH 2R2WU 1H1BA 1ZRBA 4WY3A 4DJZB 3URCA 2G5NA 1ACBE 3ZVDA 1GHYH 1THRH 1YPKH 6ESTA 2BM2A 1S85A 5JBTA 1SGTA 4B1TA 2ZA5A 4SGAE 2CF9H 1HJAC 4A92A 4ZUHA 1KLJH 2TGDA 4AB9A 2OQUA 5GPIB 3H7TA 1NFWA 1WBGB 1E37B 4AB8A 2SNWA 1ZGVA 1NRNH 3GDUA 2QXIA 1C5RA 1O2QA 3SUGA 1O2MA 1T8NA 2G81E 2ZCLP 1H4WA 4CREA 5DO4H 3ZZ7A 1XXDA 4NIVA 5A8YA 3RXPA 1EXFA 1V2LT 3RLWH 4O3TA 1SGDE 3SV2H 3ZZ6A 2BDCA 4X6PA 5CMXH 1L1GA 1UTNA 4UFEH 1NO9H 3L33A 3TH4H 3F9HA 2H9EH 3A7YA 3ZVGA 1C1OA 3SU4A 2ZGBH 5DP7A 3KQDA 7LPRA 1GI8B 1V2QT 1Z71A 3KNXA 1AIXH 1EPTA 1GJDB 1MTNB 3EQ0H 2FOBA 2PTNA 2ZEBA 3PMHB 1BTYA 1EKBB 1C5OH 3LH3A 1O3HA 1W2KH 1FN8A 7KMEH 4NSYA 1F5KU 4NA7A 1GVKB 3MHWU 1ZMJA 3OY6U 3SGAE 1L0ZA 2QIQA 3MH7A 2XC4A 1JWTA 2GCHG 4X1NU 4KKDA 2OBQA 1P06A 2WINI 4H6SB 5GJ4B 1GGDB 1O2SA 2QC2A 3KHVA 1KTSB 1C5WB 4ISHH 1GHVH 3CS0A 1O33A 1EP5A 2CF8H 1DXPA 2SNVA 2VWNA 4I8LA 2BMGB 1CBWB 2G00A 1LHFH 3LGVA 1HCGA 3T26A 3MNXA 4KTCA 3MWIU 1C1PA 3FP6E 4ABBA 3ZZ8A 3P70B 2GZ8A 2GCHF 1OWEA 2W26A 3PROA 2H1UA 2ODPA 4FUCA 5LH8A 3TNTA 3U98H 4NGAH 2PGQB 1DOJA 2GDEH 2BD8A 3U8OH 1W8BH 1MD7A 3LT3A 1BZXE 1ABIH 4BTIB 1G2MA 2JKHA 1QA7A 2BXTH 3B9FH 1OP2A 1MAYA 3QO6A 3SU1A 3A88A 3TITA 3W95A 5EODA 2HPPH 1RS0A 2QF3A 3T29A 4XBDA 1S6HA 3M35A 3A8BA 3S9AA 1EOLA 5F8ZA 1A0LA 1AQ7A 3SHAH 1GBMA 4D9QA 1HIAA 4YOJA 1O5EH 2BLOA 4ZMAH 3SNEA 1AMHA 2ZHEH 3GDSA 3RU4E 3F9GA 3A7TA 5E8EH 4UFFH 4ZKSU 1PQ7A 1AI8H 2C8XB 1P10A 1HAPH 1TNIA 3HK3B 5EG4A 3L3TA 2BY9X 4FUHA 4WMDA 1DM4B 5DG6A 2C8WB 1GBJA 5DKMA 1O3IA 3F1SB 3Q00A 3PLKA 1NESE 2D8WA 4AFUA 4E7NA 1CA0C 1TGTA 1JRTA 4JYVH 2H2ZA 2V35A 4F4OC 2ZFRH 1C1NA 2ODYB 2BX3A 4A6LA 1GHXH 5TCAA 3VB6A 1YLDA 3DA9B 3U8RH 5G4BA 1S83A 1NPMA 4ZKRU 5A8XA 1GG6C 3RXEA 2SGDE 1UTJA 1AFEH 2HPQH 2XBVA 1J17T 3F68H 2PKSB 3SJKA 2HWLB 2A5AA 2HNTE 3E16B 1MKXK 2F9UA 6LPRA 1Y8TA 2BY6X 2I6SA 3PWCA 4LZ4B 4WH8A 4YOIA 1ELDE 1FPHH 1V2VT 3S7KB 2R3YA 1P09A 2FTMA 3RXGA 4YM9A 1HBTH 1XKBC 3M3VA 1P11E 1DY8A 3UFAA 4HGCA 2IJOB 1VJAU 3SW2B 3LGUA 1SI5H 1SOTA 1A5GH 1SR5C 4XDEA 1E34B 1TX6A 2FS8A 1IQNA 1BB0B 1O2HA 2A5KA 3GOVB 1O2ZA 4CR9A 2OTVA 1DT2A 1C2DA 1F5LA 4TYDA 5AFZH 2AS9A 5AVDA 1EOJA 5EW2H 1UMAH 1AFQC 3LKWA 1ZTLA 1VCPA 5FHTA 2LNCA 7ESTE 1C2HA 2FI5E 2ZFSA 2OQ5A 1TMBH 3PTNA 2ZGHA 5BPEA 2FZZA 1W13U 1PPHE 1P02A 1C1SA 1UVSH 3O8DA 1LHGH 3S9BA 3PYHA 2R9PA 2ZFQH 1DLKB 2WPLS 3GCHB 2TPIZ 3RC6A 1MQ5A 2AIQA 1O2JA 2GV7A 4ZKNU 2VIOA 5LPEA 5JPMH 4Y79A 1AB9B 1Z1JA 2NU0E 5L2ZH 2Z9JA 3UNSA 2VU8E 4DIHH 2ZI2H 1Z6JH 4JCNA 4BAHB 3P92A 1MMJN 3FZDA 1ID5H 1RTKA 4MQAA 1TWXB 1HXEH 2BD3A 1O3CA 2FO9A 3SJOA 2GZ7A 1TA6A 1QL9A 3RM2H 4HTCH 1OPHB 1CA0B 1DE7H 1QQ4A 1INCA 2AYWA 1MH0A 1NC6A 1VITH 3VB3A 1UO6A 1OKXA 1V2WT 1MU8B 1WUNH 1TNLA 1SG8B 3M7UA 1TMTH 2WPHS 4UEHH 2NU3E 1MUEB 1FY4A 1LHCH 4RKOB 1QA0A 3TNSA 1UTPA 1O2UA 3BIUH 1GMHG 4TPYA 3UTUH 4BAOB 3VFEA 3BEUA 1BMMH 4Y7BA 1LCYA 1HPGA 3H7OA 2RG3A 1OSSA 2GCTC 3ESTA 2TIOA 2ZDMA 3A8CA 3LU9B 1TGNA 4GAWA 3DUXH 2WYJA 1C1RA 6GCHG 1NRSH 3HK6B 4U32A 3ATWA 3SNDA 3A7ZA 1ZJDA 2VIVA 2WUCA 1BHXF 4WXIA 1O3EA 4X2WA 1E35B 3TU7H 1A46H 1O2VA 4IGDA 4D9RA 1A2CH 3OYPA 2F9NA 2I6QA 1GMHF 2R0LA 3BIVH 1XX9A 1N1LA 2ANYA 1GBBA 1IQHA 1LKBA 2VGCC 3EDXB 1CHGA 2PUXB 3QUMP 1KDQB 1O2TA 2QA9E 4CH2B 4Z0KA 3P8GA 1QL7A 1LQEA 1MD8A 1P9UA 3SU6A 1TRNA 1P2IA 2V6NA 1C2FA 1KXBA 5FX5A 6GCHF 1PQ8A 1ZRKA 1C2KA 2STAE 5LPRA 1J16A 4FUJA 4YTAA 1NT1A 2Z9KA 3AW0A 3ZZ9A 4UONA 1T4UH 1QB1A 4VGCB 4TY6A 2OC0A 4I8GA 1C5QA 4Q7YA 3DT0H 1NU9A 1SGNE 4Y71A 2F9OA 3CS7A 1DFPA 1CSOE 5EOKA 1CGHA 3ENSB 3GISB 1O2GH 2C4FH 1K1NA 2XBXA 2VIDA 5T6FA 2FOCA 2G51A 3TPIZ 1GJ9B 1GI5A 1K1PA 3GDVA 3UREA 2Z9LA 4NZLA 3RXMA 3LIWA 1V2OT 4UE7H 2YNAA 3A85A 3RM0H 3TK9A 3TJUA 3SZNA 1C5LH 2ZIQH 2PGBB 1BQYA 1ZMLA 1RGQA 1ZTKA 1BOQA 2WUBA 1S0QA 2FESH 3VXEH 1O34A 3RDZA 4B2CA 2A2QH 1TB6H 3V13A 2ZCHP 1TYNA 1V2JT 1FNIA 1LPGB 1NTPA 1BTZA 2J92A 2R3UA 4DVAU 1PPBH 1Z8RA 2BDBA 3GY5A 1S6FA 8LPRA 4FU7A 3BG4B 2PTCE 4BAKB 1J9CH 5TJXA 2P94A 1GBHA 1VITG 1YLCA 5ESTE 3OSYA 3ZZBA 1GHZA 1C2MA 1BT7A 2BZ6H 4ZROA 1O3NA 3A7WA 1QJ7B 2G8TA 3LGTA 2R0KA 1TALA 3ZZAA 1QQUA 3GICB 2AFQB 5GXPA 3TJVA 2OC1A 1ZGIA 3QK1A 2OP9A 2UUKB 1FI8A 3E1XB 4GUXA 4YESB 2V3HH 1P2NA 2H9HA 4NFFA 3RU4D 5DP5A 1Y3XA 5FPTA 1VITF 2FLRH 2VWOA 2RA0A 1P12E 1YKTA 1DWDH 5AFYH 1ABJH 2DE9A 4F49A 1GHBG 4DW2U 3RMMH 2SGQE 2BD4A 1W0ZU 3ATMA 4GHQA 3SO3A 2PV9B 2UUYA 2OC7A 2P93A 2CHAC 5C1YA 5BRRE 1HYLA 1P2OA 2QAAA 2ANKH 1WTHD 4FVBA 3TGIE 1Z8GA 2GP9B 1D4PB 1ZPCA 2BHGA 1O2XA 1DVAH 4ZKOU 2FOEA 5A0CA 3PMAB 4TWWA 1MTSA 3GYMA 4YZUA 3SU5A 2BZAA 1C4Y2 2JH6D 1HAGE 1DX5M 1GHBF 3A83A 1O3PB 4TPIZ 1WU1A 3CP7A 1PYTD 1P04A 1GJ6A 1SLXB 1FPCH 1SLWB 4ZAEA 5FCKA 4I8HA 4IS5A 1LO6A 1C2GA 2VH6A 1EP6A 3IITA 5EQQA 1EUFA 4WMEA 1HJ8A 3FFGA 1F5RA 1ORFA 2C8YB 1O39A 2WV5A 1PQAA 1QRXA 3RXKA 2C90B 2GV6A 1MTUA 3BTTE 2WPIS 2QXHA 2BQ6B 3SNAA 3STJA 5C67A 5C20A 1MTNC 5T6GA 2F3CE 2QN5T 1RD3B 4Y6DA 3A86A 1OYQA 4FU9A 3T28A 4E06H 1C1UH 3M5MA 3P8OA 4KTSA 3TGKE 1O5BB 5A8ZA 2VWLA 2FMJA 1ESTA 1HAVB 1O5DH 4B76A 1K1MA 2ZO3H 2BTCE 4DG4A 2Z94A 3QDZB 3S7HB 2A32A 5I25A 1GGDC 3ZVBA 2ZU2A 4ISLA 1UHBB 1GBCA 1HAIH 1SGQE 1IQLA 3A84A 2VVUA 4BANB 5C3NA 1ELFA 1YBWA 1EJMA 1BTXA 3C1KA 3Q3YA 1FY8E 1SGCA 4Y0ZE 1CBWC 1LHDH 4B74A 4YT6H 1FN6A 3HGNA 2H9TH 3F9EA 1YPHE 5EXNA 1TPPA 1PJPA 4E7RG 1BITA 2A0QB 5E2OA 3I78A 4XOJA 1TQ0B 4U2WA 1SGIB 1CGIE 4O97A 1NRQH 3D62A 1F0TA 1HAZB 2ZPRA 1ELTA 3ODFA 1EZUC 1GBDA 1TNKA 2UWPA 1NN6A 1MZDA 2CHAB 2GTBA 2UUJB 1GBTA 3PB1E 1KIGH 2C3SA 3SQEE 4DIIH 1J14A 4K60A 2GVFA 3QLPH 3BTEE 1ELVA 3SU3A 5DGJA 4IW4E 3SUFA 3SJ9A 4O3UA 2D1JA 4MNWA 1UVUH 1ZSLA 3M5OA 3MI4A 4CRFA 3FZZA 2Q6GA 3ZZ3A 2F9BH 1W0YH 2OXSA 4XE4A 1LVOA 3RXCA 2ZGCA 3O8BA 1D3TB 1C4V2 2WPMS 3RXLA 3P95A 2ZU1A 5J4SA 1LHEH 1BRBE 1BUIA 1AE8H 4MNYA 1KLIH 3QZQA 1V2KT 4YOGA 2JH5D 1DICA 1H8IH 3ZVFA 1AKSB 1AZ8A 1PPGE 3K6YA 5JBCS 1AE5A 2QGRA 1W14U 1RXPA 4R0IA 2FEQH 2ILNA 2A7JA 4UDWH 1BA8B 2EEKA 3MO9A 4MLFB 1KLTA 2BLQA 1WSSH 1O2LA 2EI7A 2CGAA 4M7GA 1BBRH 2XWAA 3RXJA 3SU2A 5T6DA 4IC5A 1TPSA 1GMCG 1Y3WA 4K69A 1A0JA 2EC9H 2V0BA 5HXFA 2VIWA 1XUIA 1DSUA 2PKSC 4NZQA 1D6WA 1SGFG 1DUAA 1D9IA 1SLVB 4Q7ZA 1QJ6B 5T3HA 2D26C 5A2MH 3QGJA 1TBRH 1PPCE 2G52A 2SGEE 4J2YB 1A0HB 2ZG0H 2BOHB 1GMCF 1H9LB 3FANA 1DUEA 4JZ1A 1GWAA 1C4U2 2VWMA 3U1JB 1SFIA 3GY4A 1TMUH 4RKJB 1SL3A 4O9VA 2AEIH 4YLUA 2ZDLA 1P01A 1YGCH 1OX1A 3VGCB 1ZSKA 5HMAA 2ZQ1A 4IC6A 2BB4A 2ZGXH 1G3BA 2XC5A 1EAWA 1P9SA 1KXEA 3KGPA 1HRTH 1N6YA 1TBQH 4ABAA 4SGBE 1UTLM 4I32A 1NRPH 3LOXA 3GCHC 2SGFE 2OLGA 1IQMA 1BMAA 1EPTB 1L4ZA 1M9UA 2F83A 4U30A 3M37A 1J15A 2PLXA 2ZF0H 5A0AE 1AB9C 2VVVA 5CE1A 4PROA 1ARCA 1T8OA 4X0WU 1HB0B 3JZ2B 3LGWA 4B71A 3SV9A 3MOCA 2VIPA 1CU1A 3BTKE 4AGKA 3OX7U 4CRDA 1OWKA 3AVZA 1O2OA 3A8AA 2ZTXA 1A5IA 1GI7B 4ESTE 3BTWE 1C5UA 2BLWA 2D2DA 3M7QA 2O8WA 3LC3A 2QF0A 5CHAB 2Z3EA 1GL0E 5JBBS 1GI9B 1GI2A 2FDAA 4X6NA 3W94A 1GL1A 3RXAA 6CHAB 2GT8A 4A1VA 2VH0A 1YPMH 2PSXA 3NK8A 4AYVB 3SNBA 2YOLA 1QHRB 1BBRE 3K65B 4NA8A 2PW8H 3RMOH 3U1IB 3U8TH 4BAMB 4JZEH 1JRSA 3T2NA 1FY5A 1QR3E 4OS7A 1OWHA 1WV7H 3BTHE 1DXWA 3E6PH 1G36A 1NROH 4X8SH 5FBEA 4MPUA 3D65E 1XUGA 1FZZA 1LDTT 1YC0A 3LONA 2ODQA 1ELAA 1K9OE 4B75A 4ZH8A 3PTBA 1OOKB 3P8FA 1U6QA 4AFSA 2W7UA 1SPJA 3OTJE 4H6TA 1QJ1B 1AVGH 1HIAB 5FX6A 4FUGA 1IQGA 4H4FA 1RIWB 3RXOA 1Z6EA 3RXFA 2O8TA 4UFDH 2ESTE 1AD8H 4RSPA 3MNSA 3STIA 1ELEE 1PPFE 1K28D 2Q1JA 4X1QU 2BDAA 3ZYEA 4MNVA 1AUJA 2A45B 1WTGH 2ZP0H 4NA9H 4K1SA 1MCVA 2W3IA 2O8LA 1YPJH 4XBCA 4X6MA 1BBRK 4INLA 4FU8A 1K1JA 1FV9A 3EE0B 4NIWA 4UFGH 4B2BA 1FLEE 2B9LA 3UY9A 1ELBA 2XTTB 4BTTB 1YCPH 3GY7A 1GBKA 3BTDE 4DGJA 2UWOA 1O5AB 3SJIA 1UK4A 2IPHA 3KL6A 3L6PA 1OYTH 4VGCC 5DP3A 5FPYA 3UOUA 2FODA 1C5YB 1YYY1 4LK4A 3NCLA 3UWJH 3UNRA 1T32A 3MMGA 2GGVB 2OINA 4FUBA 3A89A 1BCUH 1TGBA 1CQQA 1EB2A 4WVPE 1WQSA 1YPEH 5GDSH 2Z3DA 3MU0A 5HM9A 3NZIA 1UTQA 4GPGA 1MCTA 4DURA 1Y3YA 1O2RA 1HDTH 2GT7A 3ZVCA 1O5GH 1SQTA 3A7VA 1QRZA 1WYKA 1MZAA 3KQEA 2QXGA 3SGQE 5EQRA 3ATLA 2P3FH 5JB9S 4I8KA 1GDQA 3M5LA 3TVJB 3VB5A 1CT2E 1KYNA 3M5NA 3UR6A 1TRMA 2HLCA 8KME2 4ASHA 4K1EA 3HKIB 2ZECA 1ZJKA 2A4OA 2GKVE 3SV6A 1G3EA 5TCCA 3A8DA 1DPOA 4ISNA 3ZVEA 2P3UB 2Z6BD 3EAJA 1A1RA 1KXDA 3GY8A 2F9VA 1CT0E 3P6ZB 2VNTA 4WWYA 2ZHWH 3GYLB 1KY9A 1XVOA 4NSVA 2AMPA 1W11U 2ZFFH 1L4DA 3OU0A 1O2PA 2AMDA 2ZDNA 3ZV8A 2PKAA 3BG4C 3RXRA 1C5XB 1DWBH 3LJOA 1XMNB 4AX9H 1T8LA 2G5VA 1GVLA 4BTUB 3Q3XA 1HFDA 2NU2E 1GCDA 1ZR0A 1K1OA 4JMYA 4GCHG 4IMZA 3TH3H 1UTOA 5F03A 1BRUP 1EZXC 2QYIA 5GIBA 1AGJA 5DPAA 4CBNA 1K1LA 1V2UT 4Y10E 3MO6A 4CRBA 1MBQA 2XYAA 1L1JA 2ZU5A 1V2MT 1Y5BT 3SV7A 5PTPA 3GCTG 1SQAA 2R2MB 2NU4E 1C9TA 1KSNA 3IG6B 1BRCE 5FAHA 1SC8U 5JDUB 4Y8XA 2AH4X 4GCHF 3NXPA 3B8JA 2ALPA 5EXLA 2FTLE 5C1XA 4TWYA 1DDJA 4B2AA 1GMDG 1FY1A 1O2IA 3MU8A 4MG3A 1GHAG 1HAYB 1C5NH 1Q31A 1AY6H 4ZHLU 2FP7B 1YCPM 1K21H 1D3QB 3D23A 2ZPQA 2J94A 3GCTF 4X2YA 2BY5X 1PPZA 3U69H 1T8MA 3Q3KA 5FPSA 3HKJB 1SSXA 2AGIX 2OBOA 2PR3A 2ANMH 1FIZA 1NY22 2NU1E 1QBNA 3QWCH 1LMWB 1MTWA 2Q6DA 3V3MA 1GMDF 1ELGA 3BV9B 4A5TS 2H5CA 3PV4A 4K8BA 4JYUH 1GHAF 5E0GA 1MKWH 3M36A 9LPRA 1S82A 1KXFA 3PLBA 1IHSH 1IQKA 1QB6A 4U01A 3KN2A 5F8XA 1HV7A 4ZXYH 1TOCB 1GBFA 3RXUA 2G4TA 1C5TA 9ESTA 5GCHG 2Y5FA 3EGKH 1FQ3A 1C5MD 3GY3A 1UTKA 2XNIA 1C1VH 3PO1B 1P2MA 2A4RA 1O37A 3VXFH 1PFXC 2Y80A 2PWXA 1FAKH 3A82A 3RUOA 2Y7ZA 1Z8JB 2GMTB 1DS2E 1O35A 4GSOA 1EX3A 2BDGA 5A0BA 2ZTYA 1B7XB 3MNBA 3ZZ5A 1WQVH 5GCHF 2JETB 4OS4A 4AORA 2TGAA 1P57B 3LJJA 4OS2A 1OWIA 2ZGJA 1AHTH 5ABWA 1QB9A 1GCTC 1FUJA 4O03A 2V3OH 1O30A 5DP9A 3Q77A 1LPZB 2KAIB 5DP4A 4D7GA 2FI4E 1GI0A 3LH1A 2H5DA 1ARBA 4OGYA 3TGJE 1A3BH 1F0UA 3R3GB 1O3DA 1RFNA 2ZDKA 4X2VA 2W3KA 4GVUA 1ESAA 4AG2A 1QGFA 1GJ8B 1QIXB 3PWBA 1P3EA 1TX7A 3NPSA 3B23B 1UTMA 4WF8A 2GZ9A 1P8VC 2WV4A 2ASUB 1MTVA 2O8MA 1YP9A 5HM2A 3AAUA 3CENA 5H4IB 2DE8A 2ZU4A 3TK5A 2QV1A 2ZNKH 3SJ8A 1VJ9U 5EPNA 1SLUB 2Y81A 2VB0A 4IMQA 1CHOG 8GCHG 3SOSA 2P3TB 4JZDH 3UR9A 1HAVA 4NIYA 4AGJA 4OS5A 3RXSA 1T4VH 1BJUA 4MPVA 1K2I1 1IOEA 1OXGA 1ANCA 3QX5H 4BXWA 3NWUA 1THSH 1TBZH 1DITH 1IHTH 1TNJA 3P17H 3P8NA 1FDPA 5DK1A 1O38A 4MPWA 1AVWA 2XCFA 1O3LA 1NRRH 1CHOF 8GCHF 1UVOA 3UQVA 3FP7E 4X2XA 5EXMA 1TA2A 1Y5AT 1O2NA 5EU8A 1P03A 1LVMA 2CXVA 3GY6A 4JK5A 3E0PB 1XXFA 2BXUH 2K1QA 1A7SA 2ZQ2A 3I29A 1DANH 4JZFH 4Q80A 1QL8A 2EI8A 4AN7A 1GBLA 1IQFA 4AYYB 3BEFB 1GI3A 3AW1A 1DY9A 1UJ1A 3RXIA 3TLOA 3V0XA 1S84A 1ZSJA 1DWEH 2B7DH 3TK6A 1SVPA 2LPRA 1GCTB 4D76A 1TABE 2TRMA 3ZYDA 2TGTA 1ZZZA 2BDIA 2XRCA 1O3KA 3VGCC 2H6MA 1JIRA 3UUZA 2QCYA 1P2QA 2BVXH 5J4QA 1GHWH 1F2SE 1QNJA 1A3EH 3PLPA 2EA3A 3MYWA 2Y5HA 3R0FA 1OP8A 4AOQA 1OP0A 1O5FH 4DY7B 2XXLA 3RP2A 4CHAC 4BXSA 1UK3A 1BJVA 1EPTC 1V2PT 2CMYA 2XW9A 1L2EA 3KF2A 1TOMH 1QTFA 1ZHMA 2BQWB 3EA7A 1EJAA 1TNGA 2BVRH 4ZHAA 1HAXB 5ETXA 1AWHB 1KXCA 1NU7B 2FYRA 2P59A 2XC0A 3GCNA 3S69A 2FXRA 3IWMA 4BNRA 2B5TB 1JMOH 3VB7A 5JBAS 1TLDA 5C2ZA 1C5ZB 4CR5A 3BTQE 1MKXH 3BF6H 1BIOA 5DJ7A 1ANDA 5CHAC 1Y3UA 2PHBA 1N8OB 1EZSC 2BYAX 1D6RA 4DOQA 6CHAC 2VIQA 5EQSA 4MVNA 3SNCA 1SOZA 1OWJA 1ZOMA 3SUEA 3BG8A 1UVTH 1JBUH 2ZZUH 2W7SA 1VGCB 2WYGA 1RJXB 2SGPE 2W5EA 2HALA 1ZPBA 1SGRE 2NWNA 1IQJA 4MTBA 1RRKA 5FBIA 1GJCB 3KQCA 2IN2A 4DCDA 4A1XA 3A80A 1SGFA 5L30H 1TONA 5HYOA 1F7ZA 1GDUA 5HGGA 4K3JA 4GLYA 3Q76A 1QRWA 4KGAA 1SMFE 5K0HA 2A31A 4ABGA 1RIWC 1SHHB 4JZIA 5E2PA 5L2YH 3T62A 2P8OC 1W7GH 1LVYA 2CV3A 3M7TA 3SORA 1PPEE 1ANEA 1S0RA 3TJOA 3DFLA 2Y5GA 3M3SA 1BMLA 3A81A 3D49H 2O9QA 4ABEA 2C93B 1B0EA 2FX4A 2HRVA 1AU8A 1AZZA 1O3OA 1YF4A 3RMNH 5AHGH 1EAIA 1O0DH 3SU0A 1TPAE 1CVWH 1S81A 2TBSA 2A2XH 2A4QA 5L6NH 4CHAB 3RXHA 1GVZA 4OS6A 3BTGE 1THPB 1VCQA 1ETTH 5C1UA 1C1WH 2P95A 3SBKA 1G3CA 1P3CA 1SFQB 4DT7B 2XWBI 4D8NA 1MU6B 2FPZA 2ZHFH 5DP8A 1BTPA 1GJ7B 1L1NA 3DFJA 2ZPSA 1ETRH 1Y5UT 2STBE 1RTLA 3VB4A 2PFEA 3MFJA 4Y7AA 1O32A 3BEIB 3PMJA 1HJAB 5IDKA 2RCEA 1V2NT 1D3PB 1OS8A 1UVPA 3EYDA 1XKAC 4X1SU 3UIRA 3AASA 1N6XA 1AWFH 3ZZDA 4CRCA 1JIMA 3BTME 1O31A 1XUKA 1CE5A 4INKA 2OC8A 1NFUA 2BD2A 2BDYA 4J1YA 4NCYA 4Y8YA 2J9NA 1GDNA 1RTFB 2VVCA 5LGOA 3E3TA 3ATIA 1NM6A 1G37A 1P05A 3SI3H 5F6MA 2HNTC 3RXDA 2J2UA 2THFB 2FIRH 4HI3A 1PYTC 2GX4A 1LPKB 2HVXA 2A7HA 2FS9A 4LOYH 1LQDB 1CO7E 2ZFPH 4I33A 2J95A 3EA8A 3MH4A 1C1TA 3G01A 1QY6A 1HAHH 2OCVB 3UNQA 1O36A 2FOMB 5FCRA 5ESBA 3S9CA 1GJAB 4OGXA 4ISIH 1SGYE 4I7YH 1QFKH 2ZWLH 4IBLH 2P8OB 1O3BA 1SQOA 3SN8A 1S5SA 4Z6AH 4K5ZA 1TRYA 1ANBA 4HZHA 3SGBE 3SHCH 3T25A 1LKAA 2RDLA 3QN7A 3QTOH 1T31A 1XUFA 4X1PU 3SI4H 1SGPE 4X8VH 1FMGA 2Z9IA 3MU5A 3ODDA 1XVMA 4TY7A 2DUCA 4ZXXH 1GI4A 4FVDA 1D3DB 3E0NB 4A7IB 2F9PA 5FXLA 4XFQA 3U9AH 1H9HE 2EI6A 1P2KA 1TAWA 3MTYA 2B0FA 4AZ2B 1IAUA 3A7XA 2Z7FE 1X7AC 1ELCA 1C2EA 4ABHA 2BDHA 1K22H 1HGTH 3VEQB 4WXVA 4I8JA 2G55A 5JB8S 3LGYA 1V2ST 2P16A 1SBWA 2FWWA 3E90B 5EPYA 4B73A 1WCZA 2BQ7B 2ZCKP 1AUTC 3KQBA 4KTUA 5C5OA 1K1IA 3PM3A 4ABFA 2YNBA 1B5GH 1CT4E 3F6UH 1VCWA 2HNTF 3O8RA 4ZHMU 2RA3A 1H8DH 4IN1A 1O3GA 3ELAH 1O3AA 1O3MA 3RXTA 5JYIA 3LGIA 1LTOA 1H9IE 1NFXA 3EA9A 1SB1H 3C27B 1P0SH 3T27A 1TE0A 2JH0D 1ZTJA 2ZKSA 3QTVH 1TX8A 2FOAA 3O8CA 1KDQA 2ZDAH 3NUMA 1NZQH 2BLVA 1V3XA 4X1RU 1B0FA 3RLYH 1ZHPA 1BDAA 3ZVAA 1TNHA 4IN2A 3KIDU 4YT7H 1W10U 2F91A 3FAOA 4UD9H 1F0SA 2ZDVH 3BN9A 3ATKA 3PO1C 4AFQA 2AIPA 2CN0H 1MQ6A 1GG6B 2PUQH
chains in the Genus database with same CATH superfamily
1HXFH 1C2IA 1C1QA 4KELA 2Z9GA 1T7CA 2GMTC 3UOPA 3AAVA 2HGTH 1GI6A 4K2YA 2FX6A 1DSTA 1UK2A 5E0JA 3RC5A 3K6ZA 2JETC 2ZHDA 1GPZA 2PSYA 2SGAA 1W3CA 1MBMA 2BX4A 1V6DA 1P2JA 2CJIA 4H42U 2J34A 2O8UA 2ZU3A 4I31A 1EZQA 4Y0YE 3TJNA 8ESTE 4B6EA 2QXJA 4MDSA 1QURH 1SGEE 5GWZA 1TIOA 1ZPZA 1AFQB 2B8OH 3HATH 5CDFE 1BHXB 1ETSH 1TPOA 3LPRA 4ABDA 4MNXA 1W12U 5F8TA 4WMFA 1GJBB 1BRAA 1EJNA 4CRGA 2FYQA 1VZQH 4LZ1H 3A87A 4A1TA 2PKAB 1EB1H 1C9PA 1C5PA 1YPGH 1UW7A 4NIXA 3F2GA 2WPKS 2J38A 2UUFB 1JXPA 3MU4A 4NWLA 3MH5A 3K2UA 4KP0A 3MNCA 3M3TA 2FOFA 4RN6A 2WPJS 3H5CB 3BSQA 1KXAA 2BOKA 1IQIA 1GI1A 1G2LA 4AG1A 3S0NA 3V12A 4NWKA 5K7RA 2G4UA 1O2YA 1E36B 4E05H 1C1MA 1YCPK 3WY8A 1Q2WA 1G9IE 4BOHA 1BTWA 1JOUB 1HNEE 1G32B 2VJ1A 4X8TH 1TQ7B 5C5NA 4CH8B 2QY0B 1GBIA 1NFYA 4FUIA 1LVBA 4FETA 4FXGH 3E91A 3JZ1B 1G30B 3FP8E 2FI3E 2V3MA 2TGPZ 2KAIA 1UCYH 1Y3VA 4X6OA 1GJ5H 1CA8B 1YPLH 1WDIA 1DLEA 3M61U 3RXBA 3QGNB 1SHYA 1DWCH 2AGGX 2XBYA 4INHA 3UQOA 3UWIA 3SQHE 4WJG2 2FOGA 1A61H 1XM1A 2SFAA 2FOHA 4Y76A 2BD7A 2OUAA 2BY7X 1XUHA 3MO3A 2GCTB 5IYTA 3UPEA 3HPTB 4MPXA 1Q3XA 3N7OA 1O3JA 3PMBB 4YO9A 3VPKA 4QT8C 1YM0A 3ZZCA 4JK6A 3QZRA 3K9XB 1BTUA 1QBVH 4AFZA 1OWDA 3BTFE 1HJ9A 1AVXA 2AMQA 1V2RT 4FUEA 5LPFA 2VGCB 2BVSH 1TGSZ 1Z8IB 1EAXA 2UWLA 3MU1A 5I46H 1NS3A 4JYTA 2VINA 4NFEA 4ABJA 1FY3A 1C2JA 2ULLA 4XSKU 2CK3D 3KCGH 1C5SA 4Y11E 3SUDA 4ACBA 4ABIA 1W7XH 1O2KA 4FUDA 1WAYB 1XUJA 1Y59T 1A4WH 1F92A 3RC4A 1O2WA 2AERH 4YLQH 2ALVA 1TFXA 1QBOA 3URDA 4WH6A 3F3BA 1V2TT 5B6OA 3GY2A 1J8AA 1TGCA 1E38B 3MH6A 1O5CB 1PQ5A 2ZHQH 2Q6FA 1WOFA 2OD3B 3FVFB 4CBOA 2XBWA 3HGPA 5A09A 4THNH 1Z7KA 1FXYA 2IJD1 4CRAA 1ZHRA 3LDXH 2A1DB 2A5IA 3OY5U 4ISOA 1N8OC 2ANWA 3ITIA 2KX4A 1UHBA 3RMLH 1EQ9A 1CGJE 2FLBH 4GHTA 1QCPA 3F9FA 2BD9A 2HOBA 4K8YA 1C5VA 1KTTB 2BY8X 4XRNA 5EGMA 7GCHG 4OS1A 4Q2KA 2Y6TA 1FAXA 3SV8A 1FJSA 1HUTH 1EASA 1GBEA 2C8ZB 1ESBA 2FM2A 1VGCC 5SGAE 2J4IA 1UCYE 4D7FA 1GBAA 1F0RA 2A4GA 2GDDA 1O3FA 3NKKA 2Z3CA 1BTHH 2IOTA 1AO5A 1FIWA 1AN1E 1Z1IA 3VG8A 2Y82A 7GCHF 3RXQA 1GJ4H 1ZLRA 2A7CA 3RU4T 5F53A 3TH2H 2ZTZA 3LC5A 1HLTH 5AF9H 5DP6A 1NBME 4HFPB 4NG9H 4BAQB 2BD5A 3DHKH 4I86A 3V7TA 4LXBH 3PRBA 3KEEA 1E0FD 2ZC9H 1MKWK 1YPHC 5EW1H 1FONA 1G3DA 4R8TB 2Y7XA 1ZYOA 1EATA 1ZMNA 3ZV9A 1EAUA 5E0HA 3T5FH 2GD4B 4K1TA 3TIUA 4Q7XA 2M5TA 3RXVA 3DD2H 1A5HA 4X8UH 3E8LA 1IQEA 1MAXA 1VR1H 1AKSA 1BMNH 1C2LA 3GCOA 1UCYK 2AGEX 3I77A 4XBBA 3ZZ4A 5HIYA 2XCNA 4Y8ZA 4FUFA 2ZFTA 1HAOH 2R2WU 1H1BA 1ZRBA 4WY3A 4DJZB 3URCA 2G5NA 1ACBE 3ZVDA 1GHYH 1THRH 1YPKH 6ESTA 2BM2A 1S85A 5JBTA 1SGTA 4B1TA 2KR7A 2ZA5A 4SGAE 2CF9H 1HJAC 4A92A 4ZUHA 1KLJH 2TGDA 4AB9A 2OQUA 5GPIB 3H7TA 1NFWA 1WBGB 1E37B 4AB8A 2SNWA 1ZGVA 1NRNH 3GDUA 2QXIA 1C5RA 1O2QA 3SUGA 1O2MA 1T8NA 2G81E 4ACAA 2ZCLP 1H4WA 4CREA 5DO4H 3ZZ7A 1XXDA 4NIVA 2J98A 5A8YA 3RXPA 1EXFA 1V2LT 3RLWH 4O3TA 1SGDE 3SV2H 3ZZ6A 2BDCA 4X6PA 5CMXH 1L1GA 1UTNA 4UFEH 1NO9H 3L33A 3TH4H 3F9HA 2H9EH 3A7YA 3ZVGA 1C1OA 3SU4A 2ZGBH 5DP7A 3KQDA 7LPRA 1GI8B 1Z71A 1V2QT 3KNXA 1AIXH 1EPTA 1GJDB 1MTNB 3EQ0H 2FOBA 2PTNA 2WV9A 2ZEBA 3PMHB 1BTYA 1EKBB 1C5OH 3LH3A 1O3HA 1W2KH 1FN8A 7KMEH 4NSYA 1F5KU 4NA7A 1GVKB 3MHWU 1ZMJA 3OY6U 3SGAE 1L0ZA 2QIQA 3F2FA 3MH7A 2XC4A 1JWTA 2GCHG 4X1NU 4F55A 4KKDA 2OBQA 1P06A 2WINI 4H6SB 5GJ4B 1GGDB 1O2SA 2QC2A 3KHVA 1KTSB 1C5WB 4ISHH 1GHVH 3CS0A 1E1RD 1O33A 1EP5A 2CF8H 3FN8A 1DXPA 2SNVA 2VWNA 4I8LA 2BMGB 1CBWB 2G00A 1LHFH 3LGVA 1HCGA 3T26A 3MNXA 4KTCA 3MWIU 1C1PA 3FP6E 3F0PA 4ABBA 3ZZ8A 3P70B 2GZ8A 2GCHF 1OWEA 2W26A 3PROA 2H1UA 1H8HD 2ODPA 4FUCA 5LH8A 3TNTA 3U98H 4NGAH 2PGQB 2PP6A 1DOJA 2GDEH 2BD8A 3U8OH 1W8BH 1MD7A 3LT3A 1BZXE 1ABIH 4BTIB 1G2MA 2JKHA 1QA7A 2BXTH 3B9FH 1OP2A 1MAYA 3DSOA 3QO6A 3A88A 3SU1A 3TITA 3W95A 5EODA 2HPPH 1RS0A 5EJZA 2QF3A 3T29A 4XBDA 1S6HA 2V7QD 3M35A 3A8BA 3S9AA 1EOLA 5F8ZA 1A0LA 1AQ7A 3SHAH 1GBMA 4D9QA 1HIAA 4YOJA 1O5EH 2BLOA 4ZMAH 3SNEA 1AMHA 2ZHEH 3GDSA 3RU4E 3F9GA 3A7TA 5E8EH 4UFFH 4ZKSU 1PQ7A 1AI8H 2C8XB 1P10A 1HAPH 1TNIA 3HK3B 5EG4A 3L3TA 2BY9X 4FUHA 4WMDA 1DM4B 5DG6A 2C8WB 1GBJA 5DKMA 1O3IA 3F1SB 3Q00A 3PLKA 1NESE 2D8WA 4AFUA 4E7NA 1CA0C 1TGTA 1JRTA 4JYVH 2H2ZA 2V35A 4F4OC 2ZFRH 1C1NA 2ODYB 1BMFD 2BX3A 4A6LA 1GHXH 5TCAA 3VB6A 1YLDA 3DA9B 3U8RH 5G4BA 1S83A 1NPMA 4ZKRU 5A8XA 1GG6C 3RXEA 2SGDE 2KCAA 1UTJA 1AFEH 2HPQH 2XBVA 1J17T 3F68H 1YY3A 2PKSB 3SJKA 2HWLB 2A5AA 2HNTE 3E16B 1MKXK 2F9UA 2M2AA 6LPRA 1Y8TA 2BY6X 2I6SA 3PWCA 4LZ4B 4WH8A 1H8ED 4YOIA 1ELDE 1FPHH 1V2VT 3EE7A 3S7KB 2R3YA 1P09A 2FTMA 3RXGA 4YM9A 1HBTH 1XKBC 3M3VA 1W0KD 1P11E 1DY8A 3UFAA 4HGCA 2IJOB 1VJAU 3SW2B 3LGUA 1SI5H 1SOTA 1A5GH 1SR5C 4XDEA 1E34B 1TX6A 2FS8A 1IQNA 1BB0B 1O2HA 2A5KA 3GOVB 1O2ZA 4CR9A 2OTVA 1DT2A 1C2DA 1F5LA 4TYDA 5AFZH 2AS9A 1YLNA 1EOJA 5AVDA 1UMAH 1AFQC 3LKWA 3UAIC 1ZTLA 1VCPA 5FHTA 3N7EA 2LNCA 7ESTE 1C2HA 2FI5E 2QF4A 2ZFSA 2OQ5A 1TMBH 3PTNA 2ZGHA 5BPEA 2FZZA 1W13U 1PPHE 1P02A 1C1SA 1UVSH 2RFKC 3O8DA 1LHGH 3S9BA 3PYHA 2R9PA 2ZFQH 1DLKB 2WPLS 3GCHB 2TPIZ 3RC6A 1MQ5A 2AIQA 1O2JA 2GV7A 4ZKNU 2VIOA 5LPEA 5JPMH 4Y79A 1AB9B 1Z1JA 2NU0E 5L2ZH 2Z9JA 3UNSA 2VU8E 4DIHH 2ZI2H 1Z6JH 4JCNA 4BAHB 3P92A 1MMJN 3FZDA 1ID5H 1RTKA 4MQAA 1TWXB 1HXEH 2BD3A 1O3CA 2FO9A 3SJOA 2GZ7A 1TA6A 1QL9A 3RM2H 4HTCH 1OPHB 1CA0B 1DE7H 1QQ4A 3OEED 1INCA 2AYWA 1MH0A 1NC6A 1VITH 3VB3A 1UO6A 1OKXA 1V2WT 1MU8B 1WUNH 1TNLA 1YWUA 1SG8B 3M7UA 1TMTH 2WPHS 4UEHH 2NU3E 1MUEB 1FY4A 1LHCH 4RKOB 1QA0A 3TNSA 1UTPA 1O2UA 3BIUH 1GMHG 4TPYA 3UTUH 4BAOB 3VFEA 3BEUA 1BMMH 4Y7BA 1LCYA 1HPGA 3H7OA 2RG3A 3OEHD 1OSSA 2GCTC 3ESTA 2TIOA 2ZDMA 3A8CA 3LU9B 1TGNA 4GAWA 4Q4LA 3DUXH 2WYJA 1C1RA 6GCHG 1NRSH 2EY4C 3HK6B 4U32A 3ATWA 3SNDA 3A7ZA 1ZJDA 2VIVA 2WUCA 1BHXF 4WXIA 1O3EA 4X2WA 1E35B 3TU7H 1A46H 1O2VA 4IGDA 3SZEA 1A2CH 2W6ID 3OYPA 2F9NA 4D9RA 4RT0A 2I6QA 1GMHF 2R0LA 3BIVH 1XX9A 1N1LA 2ANYA 1GBBA 1IQHA 1LKBA 2VGCC 3EDXB 1CHGA 2PUXB 3QUMP 1KDQB 1O2TA 2QA9E 4CH2B 4Z0KA 3P8GA 1QL7A 1LQEA 1MD8A 1P9UA 3SU6A 1TRNA 1E1QD 1P2IA 2V6NA 1C2FA 1KXBA 5FX5A 6GCHF 1PQ8A 1ZRKA 1C2KA 2STAE 5LPRA 1J16A 4FUJA 4YTAA 1NT1A 2Z9KA 3AW0A 3ZZ9A 4UONA 1T4UH 1QB1A 4VGCB 2LELA 4ASUD 4TY6A 2OC0A 3N7DA 4I8GA 1C5QA 4Q7YA 5HIZA 2WZQA 3DT0H 1NU9A 1SGNE 4Y71A 2F9OA 3CS7A 1DFPA 1CSOE 5EOKA 1CGHA 3ENSB 2RDEA 3GISB 1O2GH 2C4FH 1K1NA 2XBXA 2VIDA 5T6FA 2FOCA 2G51A 3TPIZ 1GJ9B 1GI5A 1K1PA 3GDVA 3UREA 2Z9LA 4NZLA 3RXMA 3LIWA 1V2OT 4UE7H 2YNAA 3A85A 3RM0H 3TK9A 3TJUA 3SZNA 1C5LH 2ZIQH 2PGBB 1BQYA 1ZMLA 1RGQA 1ZTKA 1FX0B 1BOQA 2WUBA 2YMSD 1S0QA 2FESH 3VXEH 1O34A 3RDZA 4B2CA 2A2QH 1TB6H 3V13A 2ZCHP 1TYNA 3WWBA 1V2JT 1FNIA 1LPGB 1NTPA 1BTZA 2J92A 2R3UA 4DVAU 1PPBH 1Z8RA 2BDBA 3GY5A 1S6FA 8LPRA 4FU7A 3BG4B 2PTCE 4BAKB 3MQKC 1J9CH 5TJXA 2P94A 1GBHA 1VITG 1YLCA 5ESTE 3OSYA 3ZZBA 1GHZA 1C2MA 1BT7A 2BZ6H 4ZROA 1O3NA 3A7WA 1QJ7B 2G8TA 3LGTA 2R0KA 1TALA 3ZZAA 1QQUA 3GICB 2AFQB 5GXPA 3TJVA 2OC1A 1ZGIA 3QK1A 1SQRA 2OP9A 2UUKB 1FI8A 3E1XB 4GUXA 4YESB 2V3HH 3CNRA 1P2NA 2H9HA 4NFFA 3RU4D 5DP5A 1Y3XA 5FPTA 1VITF 2FLRH 2VWOA 2RA0A 1P12E 1YKTA 1DWDH 5AFYH 1COWD 1ABJH 2DE9A 4F49A 1GHBG 4DW2U 3RMMH 2SGQE 2BD4A 1W0ZU 3ATMA 4GHQA 3SO3A 2PV9B 2UUYA 2OC7A 2P93A 2CHAC 5C1YA 5BRRE 1HYLA 1P2OA 2QAAA 3KYFA 2ANKH 1WTHD 4FVBA 3TGIE 1Z8GA 2GP9B 1D4PB 1ZPCA 2BHGA 1O2XA 1DVAH 4ZKOU 2FOEA 4XD7D 5A0CA 3PMAB 4TWWA 1MTSA 3GYMA 4YZUA 3SU5A 2BZAA 1C4Y2 2JH6D 1HAGE 1DX5M 1GHBF 3A83A 1O3PB 4TPIZ 1WU1A 3CP7A 1PYTD 1P04A 1GJ6A 1SLXB 1FPCH 1SLWB 2VBCA 4ZAEA 5FCKA 4I8HA 4IS5A 3ZIAD 1LO6A 1C2GA 2VH6A 1EP6A 3IITA 5EQQA 1EUFA 4WMEA 1HJ8A 3FFGA 1F5RA 1ORFA 2C8YB 1O39A 2WV5A 2W6JD 1PQAA 2KCYA 1QRXA 3RXKA 2C90B 2GV6A 1MTUA 3BTTE 2WPIS 2QXHA 2BQ6B 3SNAA 3STJA 5C67A 5C20A 1MTNC 5T6GA 2F3CE 2QN5T 1RD3B 4Y6DA 3PRDA 3A86A 1OYQA 4FU9A 3T28A 4E06H 1C1UH 3M5MA 3P8OA 4KTSA 3TGKE 1O5BB 5A8ZA 2VWLA 2FMJA 1ESTA 1HAVB 1O5DH 4B76A 1K1MA 2ZO3H 2BTCE 4DG4A 2Z94A 3QDZB 3S7HB 2A32A 5I25A 1GGDC 3ZVBA 2ZU2A 4ISLA 1UHBB 1GBCA 1HAIH 1SGQE 1IQLA 3A84A 2VVUA 3PV2A 5T1VA 4BANB 5C3NA 1WXRA 1ELFA 1YBWA 1EJMA 1BTXA 3C1KA 3Q3YA 1FY8E 1SGCA 4Y0ZE 1CBWC 1LHDH 4B74A 4YT6H 3H09A 3FKSD 1FN6A 3HGNA 2H9TH 3F9EA 1YPHE 2WHXA 1TPPA 5EXNA 1PJPA 4E7RG 1BITA 2A0QB 5E2OA 3I78A 4XOJA 1TQ0B 2XNDD 4U2WA 1SGIB 1CGIE 4O97A 1NRQH 3D62A 1F0TA 1HAZB 2ZPRA 1ELTA 3ODFA 1EZUC 1GBDA 1TNKA 2UWPA 1NN6A 1MZDA 2CHAB 2GTBA 2UUJB 1GBTA 3PB1E 1KIGH 2C3SA 3SQEE 4DIIH 5EJLA 1J14A 4K60A 2GVFA 3QLPH 3BTEE 1ELVA 3SU3A 5DGJA 4IW4E 3SUFA 3SJ9A 4O3UA 2D1JA 4MNWA 1UVUH 1ZSLA 3DSPA 5EJ1A 3M5OA 3MI4A 4CRFA 3FZZA 2Q6GA 3ZZ3A 2F9BH 1W0YH 2OXSA 4XE4A 1LVOA 3RXCA 2ZGCA 3O8BA 1D3TB 1C4V2 2WPMS 3RXLA 3P95A 2ZU1A 5J4SA 1LHEH 1BRBE 1BUIA 1AE8H 4MNYA 1KLIH 3AK5A 3QZQA 1V2KT 4YOGA 2JH5D 1DICA 1H8IH 3ZVFA 1AKSB 1AZ8A 1PPGE 3K6YA 5JBCS 1AE5A 2QGRA 1W14U 1RXPA 4R0IA 2FEQH 2ILNA 2A7JA 4UDWH 1BA8B 2EEKA 3MO9A 4MLFB 1KLTA 2BLQA 1WSSH 1O2LA 2EI7A 2CGAA 4M7GA 1BBRH 2XWAA 3RXJA 3SU2A 5T6DA 4IC5A 1TPSA 1GMCG 1Y3WA 4K69A 1A0JA 2EC9H 2V0BA 5HXFA 2VIWA 1XUIA 1DSUA 2PKSC 4NZQA 1D6WA 1SGFG 1DUAA 1D9IA 1SLVB 4Q7ZA 1QJ6B 5T3HA 2D26C 5A2MH 2OK5A 3QGJA 1TBRH 1PPCE 2G52A 2SGEE 4J2YB 1A0HB 2ZG0H 2BOHB 1GMCF 1H9LB 3FANA 1DUEA 4JZ1A 1GWAA 1C4U2 2VWMA 3U1JB 1SFIA 3GY4A 1TMUH 2J98B 4RKJB 1SL3A 4O9VA 2AEIH 4YLUA 2ZDLA 2F4LA 1P01A 1YGCH 1OX1A 3VGCB 1ZSKA 5HMAA 2ZQ1A 4IC6A 2BB4A 2ZGXH 1G3BA 2XC5A 1EAWA 1P9SA 3GS9A 5C0TA 2JIZD 1KXEA 3KGPA 1HRTH 1N6YA 1E79D 1TBQH 4ABAA 4SGBE 1UTLM 2KZ4A 4I32A 1NRPH 3LOXA 3GCHC 2SGFE 2OLGA 1IQMA 4P00A 1BMAA 1EPTB 1L4ZA 1M9UA 2F83A 4U30A 3M37A 1J15A 2PLXA 2ZF0H 5A0AE 1AB9C 2J97A 2VVVA 3OE7D 5CE1A 4PROA 1ARCA 1T8OA 4X0WU 1HB0B 3JZ2B 3LGWA 4B71A 3SV9A 3MOCA 2VIPA 1CU1A 3BTKE 4AGKA 2GJGA 3OX7U 4CRDA 1OWKA 3AVZA 1O2OA 2WPDD 3A8AA 2ZTXA 1A5IA 1GI7B 4RT1A 3BTWE 4ESTE 1C5UA 4Q63A 2BLWA 2D2DA 3M7QA 2O8WA 3LC3A 2QF0A 5CHAB 2Z3EA 1GL0E 5JBBS 1GI9B 1GI2A 2FDAA 4X6NA 3W94A 1GL1A 3RXAA 6CHAB 2GT8A 4OM9A 2VH0A 4A1VA 1YPMH 2PSXA 3NK8A 4AYVB 3OFND 3SNBA 2YOLA 1QHRB 1BBRE 3K65B 4NA8A 2PW8H 3RMOH 3U1IB 3U8TH 4BAMB 4JZEH 1JRSA 3T2NA 1FY5A 1QR3E 4OS7A 1OWHA 1WV7H 3BTHE 1DXWA 3F2HA 3E6PH 1G36A 1NROH 4X8SH 5FBEA 4MPUA 3D65E 1XUGA 1FZZA 1LDTT 1YC0A 3LONA 2ODQA 1ELAA 1K9OE 4B75A 4ZH8A 3PTBA 1OOKB 3P8FA 1U6QA 3OAAD 4AFSA 2W7UA 1SPJA 3OTJE 4H6TA 1QJ1B 1AVGH 1HIAB 4ZCNA 2YMSB 5FX6A 4FUGA 1IQGA 4H4FA 1RIWB 3RXOA 1Z6EA 3RXFA 2O8TA 4UFDH 2ESTE 2HVYB 1AD8H 2KM0A 4RSPA 3MNSA 3STIA 1ELEE 1PPFE 1K28D 2Q1JA 4X1QU 2BDAA 3ZYEA 2F43B 4MNVA 1AUJA 2A45B 1WTGH 2ZP0H 4NA9H 4K1SA 1MCVA 2W3IA 2JDID 2O8LA 1YPJH 4XBCA 4X6MA 1BBRK 4INLA 4FU8A 1K1JA 1FV9A 3EE0B 4NIWA 4UFGH 3WWFA 4B2BA 1FLEE 2B9LA 3UY9A 1ELBA 2XTTB 4BTTB 2QE7D 5EW2H 1YCPH 3GY7A 1GBKA 3BTDE 4DGJA 2UWOA 1O5AB 3SJIA 1UK4A 2IPHA 3KL6A 3L6PA 1OYTH 4VGCC 5DP3A 5FPYA 3UOUA 2FODA 1C5YB 1YYY1 4LK4A 3NCLA 3UWJH 4P02A 3UNRA 1T32A 3MMGA 2GGVB 2OINA 4FUBA 1SKYE 1BCUH 3A89A 1TGBA 1CQQA 1EB2A 4WVPE 1WQSA 1YPEH 5GDSH 1K0HA 2Z3DA 3MU0A 5HM9A 3NZIA 1UTQA 4GPGA 1OHHD 1MCTA 1NBMD 4DURA 1Y3YA 1O2RA 1S6LA 1HDTH 2GT7A 3ZVCA 3N99A 1O5GH 1SQTA 3A7VA 1QRZA 1WYKA 1MZAA 3KQEA 2QXGA 3SGQE 5EQRA 3ATLA 2P3FH 5JB9S 4I8KA 1GDQA 3M5LA 3TVJB 3VB5A 1CT2E 1KYNA 3M5NA 3UR6A 1TRMA 2HLCA 8KME2 4ASHA 4K1EA 3HKIB 2ZECA 1ZJKA 2A4OA 2GKVE 3SV6A 1G3EA 5TCCA 3A8DA 1DPOA 2KCPA 4ISNA 3ZVEA 2P3UB 2Z6BD 3EAJA 1A1RA 3PV5A 1KXDA 3GY8A 2F9VA 1CT0E 3P6ZB 2VNTA 4WWYA 2ZHWH 3GYLB 1KY9A 1XVOA 4NSVA 2AMPA 1W11U 2ZFFH 1L4DA 3OU0A 1O2PA 2AMDA 2ZDNA 3ZV8A 2PKAA 3BG4C 3RXRA 1C5XB 1DWBH 3LJOA 1XMNB 4AX9H 1T8LA 2G5VA 1GVLA 4Z1MD 4BTUB 3Q3XA 1HFDA 2NU2E 5KGOA 1GCDA 1ZR0A 1K1OA 4JMYA 4GCHG 4IMZA 3TH3H 1UTOA 5F03A 1BRUP 1EZXC 2QYIA 4TSFD 5GIBA 1AGJA 5DPAA 4CBNA 1K1LA 1V2UT 4RI0A 4Y10E 3MO6A 4CRBA 1MBQA 3W1EA 2XYAA 1L1JA 2ZU5A 1V2MT 1Y5BT 3SV7A 5PTPA 3GCTG 1SQAA 2R2MB 2NU4E 1C9TA 1KSNA 3IG6B 1BRCE 5FAHA 1SC8U 5JDUB 4Y8XA 2AH4X 4GCHF 3NXPA 1EFRD 3B8JA 2ALPA 5EXLA 2FTLE 5C1XA 4TWYA 1DDJA 4B2AA 1GMDG 1FY1A 1KMHB 1O2IA 3MU8A 4MG3A 1GHAG 1HAYB 1C5NH 1Q31A 1AY6H 4ZHLU 3FO8D 2FP7B 1YCPM 1K21H 1D3QB 3D23A 2ZPQA 2J94A 3GCTF 4X2YA 2BY5X 1PPZA 3U69H 1T8MA 3Q3KA 5FPSA 3HKJB 1SSXA 2AGIX 2OBOA 2PR3A 2ANMH 1FIZA 1NY22 2NU1E 1QBNA 3QWCH 1LMWB 1MTWA 2Q6DA 3V3MA 1GMDF 1ELGA 3BV9B 4A5TS 2H5CA 3PV4A 4K8BA 4JYUH 1GHAF 5E0GA 1MKWH 1QZ8A 3M36A 9LPRA 1S82A 1KXFA 3PLBA 1IHSH 1IQKA 1QB6A 4U01A 3KN2A 5F8XA 1HV7A 4ZXYH 1TOCB 1GBFA 3RXUA 2G4TA 1C5TA 9ESTA 5GCHG 2Y5FA 3EGKH 1FQ3A 1C5MD 3GY3A 1UTKA 2XNIA 1C1VH 3PO1B 1P2MA 2A4RA 1O37A 5C17A 3VXFH 1PFXC 2Y80A 2PWXA 1FAKH 3A82A 3RUOA 2Y7ZA 1Z8JB 2GMTB 1DS2E 1O35A 3FOAA 4GSOA 1EX3A 1VKYA 2BDGA 5A0BA 2ZTYA 1B7XB 3MNBA 3ZZ5A 1WQVH 5GCHF 2JETB 4OS4A 4AORA 2TGAA 1P57B 3LJJA 4OS2A 1OWIA 2ZGJA 1AHTH 5ABWA 1QB9A 1GCTC 1FUJA 5GNDA 4O03A 3U28C 2V3OH 3F0OA 1O30A 5DP9A 3Q77A 1LPZB 2KAIB 5DP4A 4D7GA 2FI4E 1GI0A 3LH1A 2H5DA 1ARBA 2KCOA 4OGYA 3TGJE 1A3BH 3OTPA 1F0UA 3R3GB 1O3DA 1RFNA 2ZDKA 4X2VA 2EQNA 2W3KA 4GVUA 1ESAA 5DN6D 4AG2A 1QGFA 1GJ8B 1QIXB 3PWBA 1P3EA 1TX7A 3NPSA 3B23B 1UTMA 4WF8A 2GZ9A 2QF5A 1P8VC 2WV4A 2ASUB 1MTVA 2O8MA 1YP9A 1MABB 5HM2A 3AAUA 3CENA 5H4IB 2DE8A 2ZU4A 3TK5A 2QV1A 2ZNKH 3SJ8A 1VJ9U 5EPNA 3WW7A 1SLUB 2Y81A 2VB0A 4IMQA 1CHOG 8GCHG 3SOSA 2IPQX 2P3TB 4JZDH 3UR9A 1HAVA 4NIYA 4AGJA 4OS5A 2LP6A 3RXSA 1T4VH 1BJUA 4MPVA 1K2I1 1IOEA 1OXGA 1ANCA 3QX5H 4BXWA 3NWUA 1THSH 3UB0A 1TBZH 3KQ5A 1DITH 1IHTH 1TNJA 3P17H 3P8NA 1FDPA 5DK1A 1O38A 4MPWA 1AVWA 2XCFA 1O3LA 1NRRH 1CHOF 8GCHF 1UVOA 3UQVA 3FP7E 4X2XA 5EXMA 1TA2A 1Y5AT 1O2NA 5EU8A 1P03A 1LVMA 2CXVA 3GY6A 4JK5A 3E0PB 1XXFA 5KEDA 3NRLA 2BXUH 5DSFA 2K1QA 1A7SA 2ZQ2A 3I29A 1DANH 4JZFH 4Q80A 2WSSD 1QL8A 4F48B 2EI8A 4AN7A 1GBLA 1IQFA 4AYYB 3BEFB 1GI3A 3AW1A 1DY9A 1UJ1A 3RXIA 3TLOA 3V0XA 1S84A 1ZSJA 1DWEH 2B7DH 3TK6A 1SVPA 2L6OA 2LPRA 1GCTB 4D76A 1TABE 2TRMA 3ZYDA 2TGTA 1ZZZA 2BDIA 2XRCA 1O3KA 3VGCC 2H6MA 1JIRA 3UUZA 2QCYA 2AHME 1P2QA 2BVXH 5J4QA 1GHWH 1F2SE 1QNJA 1A3EH 3PLPA 2EA3A 3MYWA 2Y5HA 3R0FA 1OP8A 4AOQA 1OP0A 1O5FH 4DY7B 2XXLA 3RP2A 4CHAC 4BXSA 1UK3A 1BJVA 1EPTC 1V2PT 2CMYA 2XW9A 1L2EA 3KF2A 1TOMH 1QTFA 1ZHMA 2BQWB 3EA7A 1EJAA 1TNGA 2BVRH 5B6LA 4ZHAA 5FL7D 1HAXB 5ETXA 1AWHB 1KXCA 1NU7B 2FYRA 2P59A 2XC0A 3GCNA 3S69A 2FXRA 3IWMA 4BNRA 2B5TB 1JMOH 3VB7A 5JBAS 1TLDA 5C2ZA 1C5ZB 4CR5A 3BTQE 1MKXH 3BF6H 1BIOA 5DJ7A 1ANDA 5CHAC 1Y3UA 1N8OB 1EZSC 2PHBA 1W0JD 2BYAX 1D6RA 4DOQA 6CHAC 2VIQA 5EQSA 4MVNA 3SNCA 2JJ2D 1SOZA 1OWJA 1ZOMA 3SUEA 3BG8A 1UVTH 1JBUH 2ZZUH 2W7SA 1VGCB 2WYGA 1RJXB 2SGPE 2W5EA 2HALA 1ZPBA 1SGRE 2NWNA 1IQJA 4MTBA 1RRKA 5FBIA 1GJCB 3SYJA 3KQCA 2IN2A 4DCDA 4A1XA 4HG6A 5KECA 3A80A 1SGFA 5L30H 1TONA 5HYOA 1F7ZA 1GDUA 5HGGA 4K3JA 4GLYA 3Q76A 1QRWA 4KGAA 1SMFE 5K0HA 2A31A 5HKKD 2YMSC 4ABGA 1RIWC 1SHHB 4JZIA 5E2PA 5L2YH 3T62A 2P8OC 1W7GH 1LVYA 2CV3A 3M7TA 3SORA 1PPEE 1ANEA 1S0RA 3TJOA 2K0QA 3DFLA 2Y5GA 3M3SA 1BMLA 3A81A 3D49H 2O9QA 4ABEA 2C93B 1B0EA 2FX4A 2HRVA 2JJ1D 1AU8A 1AZZA 1O3OA 2J5UA 1YF4A 3RMNH 5AHGH 1EAIA 1O0DH 3SU0A 1TPAE 1CVWH 1S81A 2TBSA 5CHBA 2A2XH 2A4QA 5L6NH 4CHAB 3RXHA 1GVZA 4OS6A 3BTGE 1THPB 1VCQA 1ETTH 5C1UA 1C1WH 2P95A 3SBKA 1G3CA 1P3CA 1SFQB 4DT7B 2XWBI 4D8NA 1MU6B 2FPZA 2ZHFH 5DP8A 1BTPA 1GJ7B 1L1NA 3DFJA 2ZPSA 1ETRH 1Y5UT 2STBE 1RTLA 3VB4A 2PFEA 3MFJA 4Y7AA 1O32A 3BEIB 3PMJA 1HJAB 5IDKA 2RCEA 1V2NT 2HLDD 1D3PB 1OS8A 1UVPA 3EYDA 1XKAC 4X1SU 3UIRA 3AASA 2XOKD 1N6XA 1AWFH 3ZZDA 4CRCA 1JIMA 3BTME 1O31A 1XUKA 1CE5A 4INKA 2OC8A 1NFUA 2BD2A 2BDYA 4J1YA 4NCYA 4Y8YA 2J9NA 1GDNA 4FOUC 1RTFB 2VVCA 5LGOA 3E3TA 3ATIA 1NM6A 1G37A 1P05A 3SI3H 5F6MA 2HNTC 3RXDA 2J2UA 2THFB 2FIRH 4HI3A 1PYTC 2GX4A 1LPKB 2HVXA 2A7HA 2FS9A 4LOYH 1LQDB 2L74A 1CO7E 2ZFPH 4I33A 2J95A 3EA8A 3MH4A 1C1TA 3G01A 1QY6A 1HAHH 2OCVB 3UNQA 1O36A 2FOMB 5FCRA 2K8IA 5ESBA 3S9CA 1GJAB 4OGXA 4ISIH 1SGYE 4I7YH 1QFKH 2ZWLH 4IBLH 2P8OB 1O3BA 1SQOA 3SN8A 1S5SA 4Z6AH 4K5ZA 1TRYA 1ANBA 4HZHA 3SGBE 3SHCH 3T25A 1LKAA 2RDLA 3QN7A 3KYGA 3QTOH 1T31A 1XUFA 4X1PU 3SI4H 1SGPE 4X8VH 1FMGA 5IK2D 2Z9IA 3MU5A 3ODDA 1XVMA 4TY7A 2DUCA 4ZXXH 1GI4A 4FVDA 1D3DB 3E0NB 3DCLA 4A7IB 2F9PA 5FXLA 4XFQA 3U9AH 1H9HE 2EI6A 1P2KA 1TAWA 3MTYA 2B0FA 4AZ2B 1IAUA 3A7XA 2Z7FE 1X7AC 1ELCA 1C2EA 4ABHA 2BDHA 1K22H 4AC9A 1HGTH 3VEQB 4WXVA 4I8JA 2G55A 5JB8S 3LGYA 1V2ST 5C94A 2P16A 1SBWA 2FWWA 3E90B 4DT4A 5EPYA 4B73A 1WCZA 2BQ7B 2ZCKP 1AUTC 3KQBA 4KTUA 5C5OA 5EIYA 1K1IA 3PM3A 4ABFA 4B6FA 2YNBA 1B5GH 1CT4E 3F6UH 1VCWA 2HNTF 3O8RA 4ZHMU 2RA3A 1H8DH 4IN1A 1O3GA 3ELAH 1O3AA 1O3MA 4YXWD 3RXTA 5JYIA 3DSGA 4M9FA 3LGIA 1LTOA 1H9IE 1NFXA 3EA9A 1SB1H 3C27B 1P0SH 3T27A 1TE0A 2JH0D 1ZTJA 2ZKSA 3QTVH 1TX8A 2FOAA 3O8CA 1KDQA 2ZDAH 3NUMA 1NZQH 2BLVA 1V3XA 5C0UA 4X1RU 1B0FA 3RLYH 1ZHPA 1BDAA 3ZVAA 1TNHA 4IN2A 3KIDU 4YT7H 1W10U 2F91A 3FAOA 2KFWA 4UD9H 1F0SA 2ZDVH 3BN9A 3ATKA 3PO1C 4AFQA 2AIPA 2CN0H 1MQ6A 1GG6B 4TT3D 2PUQH
chains in the Genus database with same CATH topology
1HXFH 1C2IA 1C1QA 4KELA 2Z9GA 1T7CA 2GMTC 3UOPA 3AAVA 2HGTH 1GI6A 4K2YA 2FX6A 1DSTA 1UK2A 5E0JA 3RC5A 3K6ZA 2JETC 2ZHDA 1GPZA 2PSYA 2SGAA 1W3CA 1MBMA 2BX4A 1V6DA 1P2JA 2CJIA 4H42U 2J34A 2O8UA 2ZU3A 4I31A 1EZQA 4Y0YE 3TJNA 8ESTE 2QXJA 4MDSA 1QURH 1SGEE 5GWZA 1TIOA 1ZPZA 1AFQB 2B8OH 3HATH 1BHXB 1ETSH 1TPOA 3LPRA 4ABDA 4MNXA 1W12U 5F8TA 4WMFA 1GJBB 1BRAA 1EJNA 4CRGA 2FYQA 1VZQH 4LZ1H 3A87A 4A1TA 2PKAB 1EB1H 1C9PA 1C5PA 1YPGH 4NIXA 2WPKS 2J38A 2UUFB 1JXPA 3MU4A 4NWLA 3MH5A 3K2UA 4KP0A 3MNCA 3M3TA 2FOFA 4RN6A 2WPJS 3H5CB 3BSQA 1KXAA 2BOKA 1IQIA 1GI1A 1G2LA 4AG1A 3S0NA 3V12A 4NWKA 5K7RA 2G4UA 1O2YA 1E36B 4E05H 1C1MA 1YCPK 3WY8A 1Q2WA 1G9IE 4BOHA 1BTWA 1JOUB 1HNEE 1G32B 2VJ1A 4X8TH 1TQ7B 5C5NA 4CH8B 2QY0B 1GBIA 1NFYA 4FUIA 1LVBA 4FXGH 3E91A 3JZ1B 1G30B 3FP8E 2FI3E 2TGPZ 2KAIA 1UCYH 1Y3VA 4X6OA 1GJ5H 1CA8B 1YPLH 1DLEA 3M61U 3RXBA 3QGNB 1SHYA 1DWCH 2AGGX 2XBYA 4INHA 3UQOA 3UWIA 3SQHE 4WJG2 2FOGA 1A61H 1XM1A 2SFAA 2FOHA 4Y76A 2BD7A 2OUAA 2BY7X 1XUHA 3MO3A 2GCTB 5IYTA 3UPEA 3HPTB 4MPXA 1Q3XA 3N7OA 1O3JA 3PMBB 4YO9A 3VPKA 4QT8C 1YM0A 3ZZCA 4JK6A 3QZRA 3K9XB 1BTUA 1QBVH 4AFZA 1OWDA 3BTFE 1HJ9A 1AVXA 2AMQA 1V2RT 4FUEA 5LPFA 2VGCB 2BVSH 1TGSZ 1Z8IB 1EAXA 2UWLA 3MU1A 5I46H 1NS3A 4JYTA 2VINA 4NFEA 4ABJA 1FY3A 1C2JA 2ULLA 4XSKU 3KCGH 4Y11E 1C5SA 3SUDA 4ABIA 1W7XH 1O2KA 4FUDA 1WAYB 1XUJA 1Y59T 1A4WH 1F92A 3RC4A 1O2WA 2AERH 4YLQH 2ALVA 1TFXA 1QBOA 3URDA 4WH6A 1V2TT 5B6OA 3GY2A 1J8AA 1TGCA 1E38B 3MH6A 1O5CB 1PQ5A 2ZHQH 2Q6FA 1WOFA 2OD3B 3FVFB 4CBOA 2XBWA 3HGPA 5A09A 4THNH 1Z7KA 1FXYA 4CRAA 1ZHRA 3LDXH 2A1DB 2A5IA 3OY5U 4ISOA 1N8OC 2ANWA 3ITIA 1UHBA 3RMLH 1EQ9A 1CGJE 2FLBH 4GHTA 1QCPA 3F9FA 2BD9A 2HOBA 4K8YA 1C5VA 1KTTB 2BY8X 5EGMA 7GCHG 4OS1A 4Q2KA 2Y6TA 1FAXA 3SV8A 1FJSA 1HUTH 1EASA 1GBEA 2C8ZB 1ESBA 2FM2A 1VGCC 5SGAE 2J4IA 1UCYE 4D7FA 1GBAA 1F0RA 2A4GA 2GDDA 1O3FA 3NKKA 2Z3CA 1BTHH 2IOTA 1AO5A 1FIWA 1AN1E 1Z1IA 2Y82A 7GCHF 3RXQA 1GJ4H 1ZLRA 2A7CA 3RU4T 3TH2H 2ZTZA 3LC5A 1HLTH 5AF9H 5DP6A 4HFPB 4NG9H 4BAQB 2BD5A 3DHKH 3V7TA 4LXBH 3KEEA 1E0FD 2ZC9H 1MKWK 1YPHC 5EW1H 1FONA 1G3DA 4R8TB 2Y7XA 1ZYOA 1EATA 1ZMNA 3ZV9A 1EAUA 5E0HA 3T5FH 2GD4B 4K1TA 3TIUA 4Q7XA 2M5TA 3RXVA 3DD2H 1A5HA 4X8UH 3E8LA 1IQEA 1MAXA 1VR1H 1AKSA 1BMNH 1C2LA 3GCOA 1UCYK 2AGEX 3I77A 4XBBA 3ZZ4A 2XCNA 4Y8ZA 4FUFA 2ZFTA 1HAOH 2R2WU 1H1BA 1ZRBA 4WY3A 4DJZB 3URCA 2G5NA 1ACBE 3ZVDA 1GHYH 1THRH 1YPKH 6ESTA 2BM2A 1S85A 5JBTA 1SGTA 4B1TA 2ZA5A 4SGAE 2CF9H 1HJAC 4A92A 4ZUHA 1KLJH 2TGDA 4AB9A 2OQUA 5GPIB 3H7TA 1NFWA 1WBGB 1E37B 4AB8A 2SNWA 1ZGVA 1NRNH 3GDUA 2QXIA 1C5RA 1O2QA 3SUGA 1O2MA 1T8NA 2G81E 2ZCLP 1H4WA 4CREA 5DO4H 3ZZ7A 1XXDA 4NIVA 5A8YA 3RXPA 1EXFA 1V2LT 3RLWH 4O3TA 1SGDE 3SV2H 3ZZ6A 2BDCA 4X6PA 5CMXH 1L1GA 1UTNA 4UFEH 1NO9H 3L33A 3TH4H 3F9HA 2H9EH 3A7YA 3ZVGA 1C1OA 3SU4A 2ZGBH 5DP7A 3KQDA 7LPRA 1GI8B 1V2QT 1Z71A 3KNXA 1AIXH 1EPTA 1GJDB 1MTNB 3EQ0H 2FOBA 2PTNA 2ZEBA 3PMHB 1BTYA 1EKBB 1C5OH 3LH3A 1O3HA 1W2KH 1FN8A 7KMEH 4NSYA 1F5KU 4NA7A 1GVKB 3MHWU 1ZMJA 3OY6U 3SGAE 1L0ZA 2QIQA 3MH7A 2XC4A 1JWTA 2GCHG 4X1NU 4KKDA 2OBQA 1P06A 2WINI 4H6SB 5GJ4B 1GGDB 1O2SA 2QC2A 3KHVA 1KTSB 1C5WB 4ISHH 1GHVH 3CS0A 1O33A 1EP5A 2CF8H 1DXPA 2SNVA 2VWNA 4I8LA 2BMGB 1CBWB 2G00A 1LHFH 3LGVA 1HCGA 3T26A 3MNXA 4KTCA 3MWIU 1C1PA 3FP6E 4ABBA 3ZZ8A 3P70B 2GZ8A 2GCHF 1OWEA 2W26A 3PROA 2H1UA 2ODPA 4FUCA 5LH8A 3TNTA 3U98H 4NGAH 2PGQB 1DOJA 2GDEH 2BD8A 3U8OH 1W8BH 1MD7A 3LT3A 1BZXE 1ABIH 4BTIB 1G2MA 2JKHA 1QA7A 2BXTH 3B9FH 1OP2A 1MAYA 3QO6A 3SU1A 3A88A 3TITA 3W95A 5EODA 2HPPH 1RS0A 2QF3A 3T29A 4XBDA 1S6HA 3M35A 3A8BA 3S9AA 1EOLA 5F8ZA 1A0LA 1AQ7A 3SHAH 1GBMA 4D9QA 1HIAA 4YOJA 1O5EH 2BLOA 4ZMAH 3SNEA 1AMHA 2ZHEH 3GDSA 3RU4E 3F9GA 3A7TA 5E8EH 4UFFH 4ZKSU 1PQ7A 1AI8H 2C8XB 1P10A 1HAPH 1TNIA 3HK3B 5EG4A 3L3TA 2BY9X 4FUHA 4WMDA 1DM4B 5DG6A 2C8WB 1GBJA 5DKMA 1O3IA 3F1SB 3Q00A 3PLKA 1NESE 2D8WA 4AFUA 4E7NA 1CA0C 1TGTA 1JRTA 4JYVH 2H2ZA 2V35A 4F4OC 2ZFRH 1C1NA 2ODYB 2BX3A 4A6LA 1GHXH 5TCAA 3VB6A 1YLDA 3DA9B 3U8RH 5G4BA 1S83A 1NPMA 4ZKRU 5A8XA 1GG6C 3RXEA 2SGDE 1UTJA 1AFEH 2HPQH 2XBVA 1J17T 3F68H 2PKSB 3SJKA 2HWLB 2A5AA 2HNTE 3E16B 1MKXK 2F9UA 6LPRA 1Y8TA 2BY6X 2I6SA 3PWCA 4LZ4B 4WH8A 4YOIA 1ELDE 1FPHH 1V2VT 3S7KB 2R3YA 1P09A 2FTMA 3RXGA 4YM9A 1HBTH 1XKBC 3M3VA 1P11E 1DY8A 3UFAA 4HGCA 2IJOB 1VJAU 3SW2B 3LGUA 1SI5H 1SOTA 1A5GH 1SR5C 4XDEA 1E34B 1TX6A 2FS8A 1IQNA 1BB0B 1O2HA 2A5KA 3GOVB 1O2ZA 4CR9A 2OTVA 1DT2A 1C2DA 1F5LA 4TYDA 5AFZH 2AS9A 5AVDA 1EOJA 5EW2H 1UMAH 1AFQC 3LKWA 1ZTLA 1VCPA 5FHTA 2LNCA 7ESTE 1C2HA 2FI5E 2ZFSA 2OQ5A 1TMBH 3PTNA 2ZGHA 5BPEA 2FZZA 1W13U 1PPHE 1P02A 1C1SA 1UVSH 3O8DA 1LHGH 3S9BA 3PYHA 2R9PA 2ZFQH 1DLKB 2WPLS 3GCHB 2TPIZ 3RC6A 1MQ5A 2AIQA 1O2JA 2GV7A 4ZKNU 2VIOA 5LPEA 5JPMH 4Y79A 1AB9B 1Z1JA 2NU0E 5L2ZH 2Z9JA 3UNSA 2VU8E 4DIHH 2ZI2H 1Z6JH 4JCNA 4BAHB 3P92A 1MMJN 3FZDA 1ID5H 1RTKA 4MQAA 1TWXB 1HXEH 2BD3A 1O3CA 2FO9A 3SJOA 2GZ7A 1TA6A 1QL9A 3RM2H 4HTCH 1OPHB 1CA0B 1DE7H 1QQ4A 1INCA 2AYWA 1MH0A 1NC6A 1VITH 3VB3A 1UO6A 1OKXA 1V2WT 1MU8B 1WUNH 1TNLA 1SG8B 3M7UA 1TMTH 2WPHS 4UEHH 2NU3E 1MUEB 1FY4A 1LHCH 4RKOB 1QA0A 3TNSA 1UTPA 1O2UA 3BIUH 1GMHG 4TPYA 3UTUH 4BAOB 3VFEA 3BEUA 1BMMH 4Y7BA 1LCYA 1HPGA 3H7OA 2RG3A 1OSSA 2GCTC 3ESTA 2TIOA 2ZDMA 3A8CA 3LU9B 1TGNA 4GAWA 3DUXH 2WYJA 1C1RA 6GCHG 1NRSH 3HK6B 4U32A 3ATWA 3SNDA 3A7ZA 1ZJDA 2VIVA 2WUCA 1BHXF 4WXIA 1O3EA 4X2WA 1E35B 3TU7H 1A46H 1O2VA 4IGDA 4D9RA 1A2CH 3OYPA 2F9NA 2I6QA 1GMHF 2R0LA 3BIVH 1XX9A 1N1LA 2ANYA 1GBBA 1IQHA 1LKBA 2VGCC 3EDXB 1CHGA 2PUXB 3QUMP 1KDQB 1O2TA 2QA9E 4CH2B 4Z0KA 3P8GA 1QL7A 1LQEA 1MD8A 1P9UA 3SU6A 1TRNA 1P2IA 2V6NA 1C2FA 1KXBA 5FX5A 6GCHF 1PQ8A 1ZRKA 1C2KA 2STAE 5LPRA 1J16A 4FUJA 4YTAA 1NT1A 2Z9KA 3AW0A 3ZZ9A 4UONA 1T4UH 1QB1A 4VGCB 4TY6A 2OC0A 4I8GA 1C5QA 4Q7YA 3DT0H 1NU9A 1SGNE 4Y71A 2F9OA 3CS7A 1DFPA 1CSOE 5EOKA 1CGHA 3ENSB 3GISB 1O2GH 2C4FH 1K1NA 2XBXA 2VIDA 5T6FA 2FOCA 2G51A 3TPIZ 1GJ9B 1GI5A 1K1PA 3GDVA 3UREA 2Z9LA 4NZLA 3RXMA 3LIWA 1V2OT 4UE7H 2YNAA 3A85A 3RM0H 3TK9A 3TJUA 3SZNA 1C5LH 2ZIQH 2PGBB 1BQYA 1ZMLA 1RGQA 1ZTKA 1BOQA 2WUBA 1S0QA 2FESH 3VXEH 1O34A 3RDZA 4B2CA 2A2QH 1TB6H 3V13A 2ZCHP 1TYNA 1V2JT 1FNIA 1LPGB 1NTPA 1BTZA 2J92A 2R3UA 4DVAU 1PPBH 1Z8RA 2BDBA 3GY5A 1S6FA 8LPRA 4FU7A 3BG4B 2PTCE 4BAKB 1J9CH 5TJXA 2P94A 1GBHA 1VITG 1YLCA 5ESTE 3OSYA 3ZZBA 1GHZA 1C2MA 1BT7A 2BZ6H 4ZROA 1O3NA 3A7WA 1QJ7B 2G8TA 3LGTA 2R0KA 1TALA 3ZZAA 1QQUA 3GICB 2AFQB 5GXPA 3TJVA 2OC1A 1ZGIA 3QK1A 2OP9A 2UUKB 1FI8A 3E1XB 4GUXA 4YESB 2V3HH 1P2NA 2H9HA 4NFFA 3RU4D 5DP5A 1Y3XA 5FPTA 1VITF 2FLRH 2VWOA 2RA0A 1P12E 1YKTA 1DWDH 5AFYH 1ABJH 2DE9A 4F49A 1GHBG 4DW2U 3RMMH 2SGQE 2BD4A 1W0ZU 3ATMA 4GHQA 3SO3A 2PV9B 2UUYA 2OC7A 2P93A 2CHAC 5C1YA 5BRRE 1HYLA 1P2OA 2QAAA 2ANKH 1WTHD 4FVBA 3TGIE 1Z8GA 2GP9B 1D4PB 1ZPCA 2BHGA 1O2XA 1DVAH 4ZKOU 2FOEA 5A0CA 3PMAB 4TWWA 1MTSA 3GYMA 4YZUA 3SU5A 2BZAA 1C4Y2 2JH6D 1HAGE 1DX5M 1GHBF 3A83A 1O3PB 4TPIZ 1WU1A 3CP7A 1PYTD 1P04A 1GJ6A 1SLXB 1FPCH 1SLWB 4ZAEA 5FCKA 4I8HA 4IS5A 1LO6A 1C2GA 2VH6A 1EP6A 3IITA 5EQQA 1EUFA 4WMEA 1HJ8A 3FFGA 1F5RA 1ORFA 2C8YB 1O39A 2WV5A 1PQAA 1QRXA 3RXKA 2C90B 2GV6A 1MTUA 3BTTE 2WPIS 2QXHA 2BQ6B 3SNAA 3STJA 5C67A 5C20A 1MTNC 5T6GA 2F3CE 2QN5T 1RD3B 4Y6DA 3A86A 1OYQA 4FU9A 3T28A 4E06H 1C1UH 3M5MA 3P8OA 4KTSA 3TGKE 1O5BB 5A8ZA 2VWLA 2FMJA 1ESTA 1HAVB 1O5DH 4B76A 1K1MA 2ZO3H 2BTCE 4DG4A 2Z94A 3QDZB 3S7HB 2A32A 5I25A 1GGDC 3ZVBA 2ZU2A 4ISLA 1UHBB 1GBCA 1HAIH 1SGQE 1IQLA 3A84A 2VVUA 4BANB 5C3NA 1ELFA 1YBWA 1EJMA 1BTXA 3C1KA 3Q3YA 1FY8E 1SGCA 4Y0ZE 1CBWC 1LHDH 4B74A 4YT6H 1FN6A 3HGNA 2H9TH 3F9EA 1YPHE 5EXNA 1TPPA 1PJPA 4E7RG 1BITA 2A0QB 5E2OA 3I78A 4XOJA 1TQ0B 4U2WA 1SGIB 1CGIE 4O97A 1NRQH 3D62A 1F0TA 1HAZB 2ZPRA 1ELTA 3ODFA 1EZUC 1GBDA 1TNKA 2UWPA 1NN6A 1MZDA 2CHAB 2GTBA 2UUJB 1GBTA 3PB1E 1KIGH 2C3SA 3SQEE 4DIIH 1J14A 4K60A 2GVFA 3QLPH 3BTEE 1ELVA 3SU3A 5DGJA 4IW4E 3SUFA 3SJ9A 4O3UA 2D1JA 4MNWA 1UVUH 1ZSLA 3M5OA 3MI4A 4CRFA