3K2UA

Crystal structure of hgfa in complex with the allosteric inhibitory antibody fab40
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
239
structure length
233
Chain Sequence
IIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISWGCLHKPGVYTRVANYVDWINDRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor activator long chain
publication title Unraveling the allosteric mechanism of serine protease inhibition by an antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 50
structure length 233
sequence length 239
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3k2uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3k2uA01
3GDVA 2R2WU 3V13A 1VITF 4UFGH 4MVNA 4AN7A 3SU3A 4GHQA 3RXJA 1QTFA 1ZPBA 5GCHG 1YPJH 3STIA 3T26A 5JB9S 1BTUA 4NGAH 4Y7BA 1H9LB 1MTUA 2WPJS 4D9RA 4ZKSU 2BOKA 8GCHF 1TX7A 3ZZDA 3RXIA 1TNKA 1LPZB 3LOXA 5EQSA 2A7CA 2B0FA 1P2NA 3BSQA 2FM2A 2FZZA 3UIRA 1P2QA 2ZHQH 1TGNA 1V6DA 1BOQA 6GCHF 5J4QA 1KDQA 4X8UH 3RXSA 1P9SA 1ESTA 1F0TA 3GCHB 1TGSZ 2SNVA 3Q77A 4FUCA 3A81A 1QCPA 4CHAC 1E37B 5C3NA 2QXJA 4HTCH 2BY5X 1EB2A 1FY5A 4HFPB 1V2QT 5IYTA 4H42U 2BTCE 3QZRA 1C5VA 1C2MA 3PMBB 2LNCA 1LKAA 1OYQA 3M5OA 5JDUB 3SU0A 3NCLA 4X2XA 1KLJH 4BTTB 4ISNA 5CE1A 2ZKSA 3DT0H 1TGBA 5E0JA 2FMJA 1TMBH 1ZZZA 3SQEE 1V2ST 1UO6A 2A2XH 1DITH 1MH0A 4I32A 2BOHB 4CH8B 5ESTE 5EPNA 2AGEX 1MZAA 2FP7B 1LPGB 1O3IA 3Q76A 4XBBA 2F83A 5BPEA 5LPRA 2G5NA 3E8LA 4NA7A 4CREA 4D8NA 1TNLA 1VZQH 1XKBC 4U30A 1J15A 1T7CA 1C5PA 3QK1A 1DUEA 4D7GA 1HRTH 5DK1A 1ZJKA 2JETB 1F7ZA 1O2OA 1W0YH 1VR1H 3SBKA 1CGIE 4NFFA 1P06A 1C5TA 5DP7A 3SUEA 4WMFA 4MPVA 4B2BA 2ZU1A 1UHBB 1AUTC 1BIOA 1ETRH 1L2EA 1WYKA 2WUBA 1O2HA 1QBOA 1C5MD 1K1PA 3TNSA 2CJIA 1SLXB 4Y0ZE 4IN2A 1FNIA 3O8RA 1S81A 1DWEH 2M5TA 3GCTF 3S69A 3FZZA 3DA9B 1TOCB 4MPXA 3C1KA 4U2WA 4X2YA 1L1NA 4WMDA 2BD7A 1Y3YA 3TK6A 2UWPA 1XKAC 3S9AA 1TNHA 3NPSA 1YLDA 1P0SH 1TBRH 3BEUA 2I6SA 1Y3VA 3TJUA 3V0XA 4Q2KA 3EAJA 4FUIA 2QF3A 1O2JA 1BHXB 2WINI 1C5XB 4FUFA 3GCHC 3ZVCA 4K1TA 3M35A 1AZ8A 1CBWB 2VH0A 4MNWA 1W0ZU 3O8BA 1PPBH 2H9TH 1UK4A 2OBQA 2ZECA 1NS3A 5EQRA 2EA3A 5DKMA 3QWCH 1H9IE 2G8TA 1KXDA 3BTWE 4ZXYH 3PMJA 1TWXB 3A7ZA 2FOFA 5FBIA 1P09A 1Y3UA 1TAWA 2BHGA 1IAUA 1GCTB 3ZVAA 1QA0A 1TA2A 2D8WA 2Z7FE 3M3VA 1TGCA 1ZSJA 1XVMA 3K2UA 2PV9B 4Y8ZA 2H2ZA 3MNSA 4VGCB 2CV3A 1SGFG 1UTPA 3SV2H 1CE5A 2ZPQA 5IDKA 1IQLA 1XUJA 1GHXH 1PPEE 1LPKB 3VB5A 3RXRA 2AGGX 1MBQA 1MCVA 1PYTD 2JH5D 3M7QA 1OP8A 3MHWU 2PLXA 1Z6EA 2ZGCA 1C5NH 4LOYH 1K1LA 4AFQA 3S9BA 1SFIA 1QL9A 1E38B 1DY9A 2C3SA 2JETC 1A5GH 1SGRE 2VIQA 4UFDH 3DFJA 1GBFA 3MYWA 3QN7A 3SO3A 4D9QA 2A4OA 3UR9A 4ABFA 2Z9LA 1GL0E 3ATKA 4CR5A 3H7OA 2SGPE 1MUEB 3ZZ7A 1W2KH 3SU6A 5C1XA 1VCQA 2KAIA 4GPGA 2TGTA 3E91A 1O3BA 1O37A 4XSKU 3TVJB 4OS7A 1ELBA 1AQ7A 2EI8A 3G01A 4MG3A 2Y7XA 1G2MA 2IN2A 1UCYH 1G32B 1AGJA 1L4ZA 2GT8A 1GBCA 1MAYA 1V2NT 1DWCH 3RXGA 1C2HA 1BQYA 1KY9A 1UMAH 1T8LA 2B9LA 4XE4A 4AG2A 3RU4E 1NRPH 1KSNA 2P59A 1IQJA 1PJPA 2H1UA 1SGPE 1YCPM 3EQ0H 3QLPH 3Q3YA 3UQVA 1S0QA 1YP9A 4A1TA 2AEIH 1QB1A 1P3CA 2SGDE 4B2AA 1IQMA 2ANWA 5GDSH 1GMCG 1KXBA 1J16A 4I8KA 1SGTA 3F68H 2QY0B 4YO9A 1HXFH 1O2IA 3RU4T 3MH4A 1K21H 1BJVA 1S5SA 2A2QH 1O3NA 3UNRA 2ZEBA 1EJNA 3ODDA 2JH6D 3FZDA 3TPIZ 2BDBA 3RC4A 1DXWA 2ZHDA 1BA8B 3RXLA 1JWTA 5B6OA 2ZTYA 4Y7AA 1ANEA 1WSSH 3AVZA 1QQ4A 1A1RA 1C1VH 1GJDB 3PO1B 2GDEH 6ESTA 2DUCA 1TIOA 1KTTB 3WY8A 2CF8H 2OXSA 4KTCA 1WQSA 1PQ5A 1ZOMA 1BZXE 2BQ7B 4ABDA 4DY7B 1UCYK 1AB9B 1YPHC 2OUAA 4UFEH 1S84A 1GJ7B 4IC5A 1RFNA 1GG6B 1HIAB 3FP7E 5DGJA 1GMCF 4CRFA 3MO9A 1WV7H 3TK5A 1LQDB 1SFQB 1O5EH 3OX7U 5GPIB 3URDA 1GDQA 3KGPA 3FVFB 4AGJA 1UVSH 5BRRE 1WAYB 5C2ZA 1EP5A 2OINA 1DT2A 3B9FH 2NU1E 3HKJB 4CBOA 1SPJA 2STAE 2J9NA 4OS1A 2ZDVH 2ZU4A 4MNXA 4K3JA 1LVMA 2PWXA 1TBQH 1GJ6A 3K6YA 4O3UA 2VU8E 3RLWH 1EAIA 4ABGA 1AMHA 1A2CH 3ZZ6A 4D76A 3SU4A 1O33A 4KTUA 3GICB 3E0PB 1UK3A 1GVLA 3RP2A 2BDAA 2BQWB 2V0BA 2ZFQH 4TWWA 1G3BA 1DWDH 4YESB 1P04A 1G9IE 2PTCE 1GWAA 2GVFA 1CA0B 3A7TA 2R3UA 5DG6A 3TJVA 2GCTB 3RXTA 2G52A 2WPMS 1LMWB 3VXFH 1ORFA 4FUBA 2FTLE 1O3KA 1RGQA 3NUMA 7ESTE 1O2GH 1PPGE 3T2NA 3ZZCA 1KIGH 2PUXB 1C1RA 2QXGA 2XBXA 3A86A 3HGPA 3SQHE 3T62A 1O3AA 1A7SA 1O2XA 4PROA 2IOTA 1QQUA 2P95A 3SGBE 4FUHA 1RXPA 1TBZH 1T8NA 1TGTA 1H8DH 4TPYA 5GIBA 1QURH 3HK6B 1U6QA 1PPZA 1TPSA 2P8OC 5LPFA 1HJ9A 3F9FA 1BMLA 2AMQA 1O36A 1GBMA 3M37A 3BEIB 1EASA 1F2SE 3KQDA 2OCVB 4WVPE 3RC5A 2BY6X 1KXAA 2BVSH 2HNTE 2VH6A 3RXQA 1XUIA 3TITA 4INLA 2BD9A 3A7YA 2ZCKP 4DW2U 4A6LA 2FX4A 1CT0E 3U8OH 1AB9C 2BX3A 1JXPA 1N6YA 1E0FD 3A84A 3KQBA 3PM3A 3GY4A 1O2KA 1C1PA 4CRAA 1ID5H 2C8ZB 4ISIH 2GD4B 2PSYA 1UCYE 4RKJB 1P2OA 1UTMA 3STJA 1ANDA 1WOFA 2FEQH 3ZVFA 3A8AA 3V3MA 4JZFH 2QXIA 3CS0A 5DJ7A 4UE7H 4E05H 1IQNA 1K1OA 5JBTA 1P02A 2ZHFH 1P9UA 5PTPA 1V2WT 3BTHE 4ZAEA 1NO9H 1F0RA 2H9HA 2HNTF 2ZDNA 3RXFA 3BG4C 7GCHG 1DICA 2J94A 3MH7A 4I33A 3FP6E 1GI1A 1BTXA 1HPGA 1BMAA 1P2MA 1NFUA 3LGWA 3HGNA 3TNTA 2W5EA 3PROA 4CR9A 2ALPA 1XX9A 2R9PA 1GI0A 2C8YB 2ZGXH 1AFQB 1KXEA 2C4FH 2TPIZ 1GBDA 5T6DA 1SGNE 2ANYA 3SV8A 1BRAA 1DX5M 1WTHD 2GCTC 2PGQB 3QGNB 1OXGA 1HAZB 5C5NA 4GSOA 2ZTXA 5CHAB 2OC8A 1O32A 2IPHA 1FV9A 1IOEA 3A8CA 5A8YA 4DG4A 1A0LA 2D1JA 4DIHH 4CH2B 1ETSH 1QRWA 3M7TA 3SJOA 4QT8C 3RM2H 2NWNA 2AFQB 3QZQA 1E34B 1BUIA 1QRZA 2FI4E 2AGIX 1ZRBA 1GI9B 1ZTKA 2RG3A 1CO7E 1NC6A 1ZJDA 2ZFTA 3TGKE 4YT7H 5FAHA 3O8DA 1EZUC 4Q7XA 1G36A 1ELFA 3N7OA 4YOGA 1GHBG 2O9QA 4DOQA 1CGHA 1J8AA 2O8WA 2YOLA 2BDCA 5SGAE 5A09A 1NN6A 1MU6B 2ANMH 2J38A 4UFFH 4JZ1A 1FONA 4YOIA 1V2PT 1C1MA 3GY3A 3GDSA 4RKOB 1AIXH 4ZHLU 2FOAA 1ETTH 1SLUB 4A1XA 1BRCE 5AVDA 1QJ1B 2Y80A 3SNBA 2PSXA 1TALA 1RS0A 3BIUH 1A0HB 1CSOE 1TPPA 3BEFB 1J9CH 3IITA 2BZ6H 1QJ7B 9ESTA 3BTQE 4SGAE 5C20A 1TRYA 1N8OB 1YGCH 1V2MT 4BAKB 2P3UB 1XUFA 4YM9A 2CN0H 4Q7YA 3E16B 1EAWA 3P8OA 4NZQA 2B5TB 2F9VA 4O03A 1LTOA 1JBUH 1HJAC 5DP8A 3SHCH 3BIVH 3T29A 1GPZA 1GDUA 3ZZ5A 1GCDA 1HAHH 3F6UH 1GHBF 1TOMH 1SSXA 3GY6A 1SGYE 1KLIH 4HGCA 1LCYA 1ELTA 3GYMA 3SU5A 3MU0A 3SN8A 1B0EA 2FI5E 3RUOA 3Q3XA 4FXGH 4NWLA 2P3TB 1P2JA 5FXLA 1W13U 3KN2A 1JMOH 1TQ0B 2VIVA 3PV4A 5F8ZA 1AFQC 1MCTA 2A4RA 1AVGH 1EPTB 1LHDH 2VNTA 1MAXA 4X2WA 5T6GA 1DOJA 1HAVB 2BLWA 2ZPSA 3P92A 4JMYA 2G00A 3T28A 8LPRA 3UOPA 2VIWA 2FDAA 2B8OH 3GCOA 5CHAC 1EOLA 2ZFPH 1O2WA 5FPTA 5JB8S 2ZFRH 1MTNB 4AX9H 1J17T 2B7DH 3SI3H 5GCHF 1ZLRA 2R3YA 2UUJB 2HPQH 3JZ2B 1AI8H 2A7HA 3VB6A 1Z8GA 1AWFH 4YLQH 2HOBA 1VJ9U 1GI3A 1SI5H 2QN5T 2SGAA 2WPHS 1F5KU 5EGMA 2Q6DA 1L0ZA 2Z3CA 4X8TH 1YPLH 5JBBS 3SW2B 3BTFE 3GDUA 1ELAA 5HMAA 1TPOA 2OQ5A 4K1EA 2BLOA 4Y76A 3CENA 3RXOA 1UTKA 3RXMA 1OWKA 2GTBA 4K2YA 1MMJN 1FI8A 3SGAE 4K8YA 1Q2WA 1TNGA 3SHAH 1BRUP 4ZMAH 2W3IA 1GHAG 3KL6A 1LQEA 2H6MA 2QV1A 1OP0A 3I77A 1AKSB 1W3CA 4E06H 3AAVA 5L2ZH 5F8TA 1ABIH 2O8MA 1YPGH 4OS5A 2AMPA 3RXVA 1N8OC 5C1YA 2FLRH 1MD7A 1W7XH 3DUXH 1RTKA 1GJ4H 2BXTH 1C5UA 1DVAH 4AFZA 3GOVB 1GI8B 4ABHA 3S9CA 1O2RA 4YOJA 3DD2H 3K9XB 1EAUA 4UDWH 4ZKOU 2OC7A 2G81E 1Q31A 3DFLA 1HYLA 4WF8A 1KXFA 4H4FA 3TK9A 3NWUA 1K1IA 1PPHE 3UNQA 5DP9A 2A45B 2FPZA 1O2YA 1NZQH 4XBDA 4D7FA 3H5CB 1HJ8A 1H9HE 1EPTC 2VWMA 3E90B 5I25A 1KLTA 1EXFA 4JZIA 1K1NA 4GUXA 4X1RU 2GT7A 3H7TA 4TYDA 4INKA 2ALVA 2ILNA 1OKXA 4J1YA 3MH5A 3PMHB 1RRKA 3RMMH 2F9UA 4X6PA 2XCFA 3SORA 4AYYB 4B71A 1P3EA 5A8XA 3M61U 1MTNC 2PKAA 1WBGB 3D23A 4I8HA 4XBCA 1NFYA 2HRVA 4GCHG 1C9TA 5HM2A 1XVOA 1JIMA 2HALA 1Z8RA 1WUNH 4BNRA 1HUTH 1FXYA 4J2YB 2GZ9A 3SNEA 2XWBI 3VFEA 2ZU2A 4R8TB 2FOHA 1K1JA 5E0GA 2XRCA 3RLYH 1C2IA 3RU4D 1GMDG 2STBE 2Z94A 3PB1E 3P95A 2AIQA 3HK3B 4FVDA 3TH3H 4FUEA 1P2KA 2GDDA 4NSVA 1QHRB 2VJ1A 4NA8A 1DE7H 1T31A 3LT3A 4NIXA 1W7GH 3VXEH 1V2RT 5T6FA 3OU0A 1HDTH 1GHVH 2XW9A 1EP6A 1JRTA 2H5CA 3A89A 5FHTA 2VVUA 1ZSKA 2BD3A 4CBNA 3EA9A 4ZROA 1O3CA 3ZZ8A 1MQ6A 1UVOA 1C9PA 3OY6U 2FTMA 1TONA 1C2EA 2A0QB 3PWBA 3BTTE 2GZ8A 3IG6B 1DUAA 1LVYA 2SNWA 4WXIA 3PLBA 1P10A 1C2GA 1GMDF 3ITIA 1O3DA 4TY6A 3BTEE 1KDQB 1W14U 2PGBB 1P03A 2PKSC 1SGFA 3T27A 1NESE 1TE0A 1V3XA 1Y5UT 1AVWA 1SOZA 4IS5A 4ZKRU 1O31A 2ZIQH 3LU9B 3PMAB 1RTFB 2BLVA 1C1OA 1FAKH 4AYVB 3M3TA 5C67A 3SUGA 1QR3E 3BTDE 3ZZAA 1ZGVA 1THPB 5ETXA 3OTJE 5ESBA 3U8TH 2G4TA 4K1SA 1C1QA 3I29A 3RXUA 1AO5A 4CRGA 3QDZB 2BDGA 4KTSA 3A7WA 1PQ8A 2ZGBH 2AH4X 1O2LA 3A80A 1FN8A 5CMXH 5AF9H 2EI6A 4IMQA 4GVUA 1C5QA 1F0SA 1GBLA 2AS9A 4RN6A 1TA6A 5JBCS 3TGIE 4XDEA 3MNXA 1Y3WA 1MBMA 1SGCA 1SL3A 4IW4E 3BV9B 1V2OT 1DFPA 2P8OB 1C2DA 1FY1A 1G37A 5A0BA 4X6MA 5EOKA 5FX6A 2WV4A 1ARCA 1GJ9B 3IWMA 1O5GH 1TNJA 3A8DA 5H4IB 1ELGA 4ZHMU 3U1IB 3NZIA 3SJ9A 2H9EH 3UREA 2BX4A 1DM4B 3M36A 4BAOB 5GWZA 4NFEA 1AN1E 1BRBE 1Z8JB 1HFDA 4DIIH 1DWBH 2OC1A 1GGDB 1P57B 4NIWA 5HYOA 1AE8H 2NU2E 3BTME 5E8EH 1CVWH 1ZPCA 4HI3A 1GMHG 1O3PB 2BY7X 1GL1A 2ANKH 3UUZA 1DANH 1GI4A 1W10U 3SJ8A 1RIWB 3VB4A 1CQQA 1O38A 1GBAA 2ZF0H 1HXEH 1GJBB 3SOSA 1S6HA 1SGEE 3BG4B 1TB6H 2XBYA 4AB9A 1M9UA 2ZFFH 1QBNA 5FPYA 2CF9H 4JCNA 1W12U 1T4VH 3S0NA 2TGPZ 2BD8A 2Y7ZA 1F5RA 1BTWA 5LPEA 2Y82A 2BXUH 2W3KA 4WJG2 3OYPA 4X6OA 1SGDE 1XUKA 1GJAB 2ZG0H 4BXSA 1C1SA 2ZI2H 5TCAA 2C8XB 1AU8A 2BD4A 1O2TA 2DE8A 4IC6A 2Z6BD 5DP6A 2K1QA 4FU9A 2ZQ2A 4IMZA 4A92A 3AW1A 2V3OH 4K5ZA 5JBAS 1S82A 1OWDA 1S83A 3ZV9A 4LK4A 3SNCA 1TPAE 1BBRE 4AORA 2BB4A 1O30A 3M5LA 1VCWA 2ZU5A 2ZCLP 2ZDMA 1IQFA 1L1GA 1MKXH 2VVVA 1EKBB 2P93A 3RMLH 2J2UA 1S6FA 4DGJA 1YPKH 2XCNA 2WYJA 2WUCA 1AD8H 1CHOG 4JYUH 1HV7A 1TNIA 3ESTA 4MLFB 3HATH 4FVBA 3A7XA 3LJOA 5E2OA 3RMOH 1IHSH 1LHFH 3SI4H 2FODA 4JK5A 3KEEA 2BZAA 4X8SH 1A4WH 2XYAA 1D3DB 1HAVA 1GJ8B 1K22H 1O3FA 2Z3EA 1DPOA 4NG9H 1NFXA 3SZNA 2VVCA 4X1SU 1QNJA 3LH3A 3I78A 3KNXA 1LKBA 2CHAB 4K69A 4A1VA 2AIPA 1GBBA 1C5WB 1F5LA 4LZ1H 3ATLA 4B75A 1GGDC 3PYHA 4BTUB 1O2NA 2KAIB 2Z9JA 1P01A 3MNBA 1TX8A 3SUDA 1A46H 1FIZA 2PTNA 3E0NB 2FOMB 3V12A 1ZSLA 3BTGE 3ZZ4A 3RXBA 1C1NA 1GI2A 2R0LA 1CHOF 2ZHEH 2A4QA 1W8BH 2ZO3H 1HJAB 1RIWC 2ULLA 4YT6H 1SC8U 1TLDA 1MD8A 1YLCA 2A32A 2BDIA 4IN1A 4BAMB 1S0RA 1ZYOA 2HGTH 3RXDA 4O3TA 4CRBA 1FMGA 5JPMH 1V2JT 2QGRA 2CXVA 4AOQA 4ZHAA 1OWEA 1F0UA 1MKXK 1JIRA 3QO6A 5A2MH 2PUQH 1CGJE 2PHBA 1ARBA 1PFXC 1C2KA 4MNVA 4BANB 3P6ZB 2TGAA 4NIYA 1GHYH 2OP9A 3W95A 2F91A 4FUDA 1THRH 2ZQ1A 1TRMA 5A0CA 4YLUA 1HAOH 1UHBA 3M5NA 2SFAA 4JK6A 4X1PU 3MTYA 2UUKB 1K9OE 1TMUH 3MI4A 1P05A 5FCRA 1ABJH 2EC9H 1S85A 4E7NA 1AHTH 2H5DA 4H6SB 1THSH 5FPSA 1WTGH 1N1LA 1YCPH 1Y5BT 4IBLH 4ABAA 4ABIA 1F92A 4THNH 5TCCA 1QIXB 4X8VH 1AWHB 2SGEE 4Z0KA 3URCA 4MNYA 7GCHF 3LPRA 2HLCA 4DVAU 1MTVA 1BMNH 1ANCA 1ELEE 2BVRH 3LDXH 3B23B 2XC5A 1YPHE 3M7UA 1KXCA 6LPRA 1PQAA 3U69H 1BHXF 2GCHG 2GMTC 1Y3XA 3BTKE 4MDSA 1B5GH 3FP8E 1G30B 1UVTH 1RJXB 2QIQA 5GJ4B 1O2SA 9LPRA 1QB9A 3ZVDA 1GI5A 4WH6A 3A83A 2Y5HA 4LZ4B 3GYLB 3CP7A 4DURA 1VITG 2W26A 2JKHA 3P8FA 1Z6JH 4ISOA 3UOUA 2CHAC 4XFQA 2W7SA 1P8VC 4M7GA 4BOHA 3A88A 4A7IB 3U98H 2TRMA 1BTHH 3ATMA 1BCUH 2F9NA 1C2JA 3UNSA 1UVPA 1MU8B 2F9OA 4INHA 3TJOA 3SV9A 4K60A 1EATA 1QGFA 3EYDA 5F03A 1TABE 1MQ5A 4B76A 2TBSA 1ZRKA 2VGCC 1EJMA 3E6PH 1UVUH 4MQAA 4NA9H 1FN6A 3SU1A 4AFUA 3QX5H 1YCPK 2QA9E 2GZ7A 1UTNA 1C2LA 3ATIA 1GI6A 2WYGA 4ABJA 2GCHF 2EEKA 1A5HA 2BMGB 3BN9A 3ZZ3A 5LH8A 1XMNB 1YYY1 4DT7B 1E36B 1NU9A 1GHZA 1ZTJA 1BT7A 2XTTB 1HCGA 3MU1A 3TJNA 4OS2A 5L2YH 1SR5C 2QXHA 1OYTH 4YTAA 1C5LH 2WV5A 2G5VA 2PFEA 4FUJA 4AGKA 3MO3A 1EOJA 2VB0A 3AAUA 4KKDA 4WWYA 1LVBA 2ZDAH 1LDTT 1P12E 3QGJA 3F9EA 2ZP0H 1D6RA 1D9IA 5AFYH 5EXLA 2XNIA 1RD3B 2FIRH 2ZHWH 3HKIB 3RDZA 1A5IA 2VINA 2WPIS 2HVXA 5E2PA 3NXPA 1LHCH 4U01A 3SU2A 1HB0B 2FYQA 3MFJA 3MU5A 1ZHPA 2V6NA 2FOCA 5AHGH 2ODQA 1ZMLA 1ESAA 2A5KA 2J92A 2ZTZA 3DHKH 2FX6A 1MZDA 5TJXA 1MKWH 1ZTLA 3F9GA 1C5SA 1DSTA 1A3BH 1T4UH 7KMEH 2DE9A 4LXBH 2RA3A 4ASHA 5EQQA 4KELA 4MTBA 6CHAB 3D62A 1UTOA 1PYTC 3OY5U 1ZGIA 4Y6DA 3RXEA 1H1BA 5EU8A 1ZPZA 4OS4A 1FAXA 2G51A 2FESH 1G3CA 2FOGA 3RXCA 1DLKB 3FAOA 5FCKA 1NU7B 2ZC9H 3EE0B 2WPKS 4TY7A 1QL8A 4BXWA 3GCTG 3LC3A 1EQ9A 2BQ6B 3E1XB 3GY7A 1FLEE 1QBVH 2LPRA 3GCNA 3PLKA 1XUGA 5AFZH 5ABWA 4ZKNU 2F9BH 2A4GA 1G3EA 2C93B 2ZGHA 2BDYA 1TFXA 1SBWA 1SGIB 3K6ZA 4ZUHA 4U32A 4HZHA 1V2TT 3SNDA 2SGQE 3U1JB 4I8JA 4Q7ZA 4UD9H 3R3GB 2PKSB 3LIWA 2J4IA 4AZ2B 1BMMH 2GGVB 2A5AA 3LKWA 1MKWK 4NZLA 1O3JA 1QRXA 7LPRA 2TIOA 1HIAA 1NRSH 3S7KB 4WY3A 2Z9IA 1P2IA 4O97A 1C4Y2 1J14A 1NPMA 3VB3A 1AE5A 1V2VT 1SVPA 5C1UA 1RTLA 2AYWA 3L6PA 4X1NU 5A8ZA 3VB7A 1QA7A 1GHAF 1EZQA 4CRDA 4Y0YE 3QTOH 1UTJA 1Y5AT 1O5DH 2OD3B 3VEQB 1ZHRA 3PTBA 3RMNH 5I46H 2F3CE 1O5BB 2ODPA 3KF2A 3L33A 3RM0H 4I7YH 1Z1IA 1VGCB 1NY22 2Y81A 3A85A 1LVOA 3F1SB 1DLEA 1OSSA 1SOTA 4H6TA 3TU7H 5L30H 2P94A 2OQUA 1OPHB 2CMYA 4X6NA 2THFB 2XC4A 1ZMJA 1CA8B 2FS9A 2R2MB 1TYNA 4OGXA 5A0AE 1Q3XA 2FS8A 2OTVA 2ODYB 3EDXB 1EZXC 5K7RA 1HAIH 1SLWB 3E3TA 1DXPA 3L3TA 5HGGA 1TMTH 1HAYB 3UFAA 3SNAA 1JRSA 3D65E 6CHAC 1EB1H 1O5CB 1O3HA 1BBRH 2GV6A 1QB6A 4AFSA 4MPUA 3ZVBA 1BJUA 1WQVH 5DP3A 3LGUA 1ELDE 4F4OC 1B7XB 2XC0A 2A1DB 5DP4A 4IGDA 1PPFE 3LJJA 3A7VA 4NWKA 1AZZA 3U9AH 3PWCA 1QJ6B 2UUYA 1VJAU 4WXVA 2NU4E 1SHHB 1O3LA 3UTUH 2ZFSA 3UWJH 3LGYA 1ELCA 4GCHF 1TX6A 1CU1A 1BB0B 1LHGH 2Y5FA 2VWNA 1YPMH 3LONA 1C5RA 3KCGH 3LGVA 4XOJA 1D3TB 2QAAA 1UJ1A 3F9HA 2HNTC 1SG8B 1D3PB 2ZGJA 1GBKA 2AERH 4F49A 2Z9KA 1CT4E 1SLVB 1DSUA 2UUFB 2ZPRA 1BTYA 2FYRA 2ZA5A 1C2FA 3A8BA 5FBEA 2XWAA 1BDAA 4OGYA 2Q6FA 1OOKB 1BTPA 5T3HA 4OS6A 1FY4A 3LC5A 1G2LA 2O8TA 2V3HH 3M5MA 3ZZBA 2OC0A 1NTPA 1BBRK 3KHVA 1QL7A 4WMEA 1JOUB 1T32A 3JZ1B 2BD2A 4CRCA 5EW1H 3TH2H 2YNBA 1QY6A 2A5IA 4B1TA 5HM9A 1SMFE 1VGCC 1GBHA 2ZWLH 2VIOA 1O5FH 1UTQA 1YC0A 3SV6A 4TWYA 4ESTE 1HLTH 2J95A 1Y8TA 1IQEA 1FDPA 4Y79A 1DDJA 2FLBH 1B0FA 1IQGA 1O2PA 4BAQB 1YM0A 1OX1A 1GDNA 1O0DH 1SHYA 3ELAH 3ATWA 1CBWC 1SQOA 2FI3E 3T5FH 1FPCH 1T8OA 3P70B 1OWJA 3UR6A 1GJCB 2Z3DA 3EGKH 1C1TA 2HPPH 1NRQH 2G4UA 4I8LA 3M3SA 4JYVH 2V35A 1MTSA 2C90B 1HAXB 1Z1JA 1TRNA 1ZHMA 5DPAA 3UWIA 4KGAA 1K1MA 3VPKA 1GCTC 2O8LA 1YF4A 3C27B 1SB1H 5E0HA 1FQ3A 1V2UT 1BITA 2BY8X 4MPWA 5LGOA 3RXKA 4ZH8A 1KYNA 1FZZA 3ZYEA 4O9VA 3KIDU 2RCEA 3SUFA 4VGCC 1ELVA 3ZVGA 1NFWA 4DCDA 3SV7A 3CS7A 1HNEE 1O34A 1MTWA 1W11U 2QYIA 1VITH 1SQTA 4AB8A 2NU3E 3MU8A 1CT2E 1A3EH 3B8JA 1LHEH 1NT1A 1FJSA 1XXFA 2BDHA 1K2I1 2FOEA 1AUJA 3KQCA 5EG4A 5F6MA 4JZDH 2O8UA 2FO9A 3EA7A 4UEHH 1GVZA 3ZV8A 4WH8A 3MOCA 2ZDLA 3P17H 1IHTH 3MO6A 3BG8A 2SGFE 3A82A 5HXFA 1PPCE 1TQ7B 3Q00A 2PKAB 1GMHF 2ASUB 2W7UA 3AASA 2GX4A 2HWLB 3QTVH 1Z71A 3SGQE 3VGCB 3RC6A 5GXPA 3NKKA 2VIPA 4K8BA 1O2MA 1UK2A 4I31A 1O2QA 4ABBA 3K65B 2FOBA 3RXHA 2FXRA 2AMDA 3BF6H 3MWIU 2BY9X 3EA8A 4Y8YA 1O2UA 2XXLA 2G55A 2PR3A 1O2ZA 3NK8A 3RXPA 1DS2E 1FPHH 2P16A 2C8WB 2NU0E 2BVXH 2UWOA 1C1WH 1IQKA 3KQEA 1V2KT 1HGTH 3GY2A 1EPTA 1XM1A 2GMTB 1HAPH 4RSPA 4YZUA 1WU1A 3Q3KA 2ZU3A 2UWLA 3GISB 1OWHA 4AG1A 8ESTE 2Y5GA 4GHTA 2GKVE 1P11E 3ZYDA 2WPLS 3MH6A 2Q6GA 1NROH 1GBJA 1C4U2 1EZSC 5L6NH 4FU7A 1LO6A 1X7AC 3UPEA 1GBTA 1EAXA 2QC2A 1NRRH 2XBVA 1XXDA 4FU8A 2VWOA 3LGIA 3PTNA 2OLGA 3W94A 1O5AB 3HPTB 3ODFA 3PO1C 3TIUA 3MU4A 1ESBA 1HAGE 3S7HB 1D6WA 2YNAA 3MNCA 1ZMNA 1YBWA 2EI7A 3MMGA 3TH4H 8KME2 1N6XA 2VGCB 3A87A 4Q80A 4JYTA 3T25A 3P8GA 1YPEH 1D3QB 1OS8A 1GG6C 3RXAA 3AW0A 1AFEH 5EPYA 1O39A 2RA0A 4Y8XA 3V7TA 5EW2H 1PQ7A 1SGQE 4TPIZ 2Y6TA 1Z7KA 2Z9GA 4NIVA 4X0WU 3SJIA 3UQOA 4JZEH 2ZNKH 2BYAX 1CHGA 3U8RH 1HBTH 1C5OH 1NM6A 2CGAA 1L4DA 1GVKB 3SJKA 3ENSB 3ZZ9A 1INCA 1L1JA 1O35A 1AKSA 1UTLM 5K0HA 1EX3A 1O3MA 1O3EA 1C5YB 3GY5A 1XUHA 1GBIA 3FFGA 3ZVEA 2BLQA 1D4PB 4GAWA 3VGCC 1QFKH 1O2VA 1C1UH 1FY3A 4B73A 2QF0A 5FX5A 1A61H 3R0FA 1KTSB 2BD5A 4SGBE 4ISLA 2PW8H 2P3FH 2D26C 5DP5A 2F9PA 4ABEA 2ESTE 2R0KA 1CA0C 1Y59T 2J34A 4NCYA 4NSYA 3FANA 1K28D 4Y71A 4CHAB 1IQIA 1GBEA 2OBOA 3UY9A 5C5OA 1Z8IB 2ZDKA 2VIDA 1V2LT 3GY8A 5EXMA 3LH1A 2JH0D 4BAHB 1C5ZB 1E35B 5JYIA 1AY6H 4Z6AH 2RDLA 1O3OA 1VCPA 1SQAA 4R0IA 4X2VA 2D2DA 4Y10E 4X1QU 1DY8A 2VWLA 4I8GA 2A7JA 4E7RG 1FY8E 1GJ5H 2Q1JA 1OWIA 1ACBE 1C4V2 1NRNH 1OP2A 3OSYA 5EODA 2GP9B 4FUGA 4ZXXH 1GHWH 1H4WA 2GV7A 1GI7B 1IQHA 4UONA 1EJAA 4Y11E 5EXNA 3D49H 1A0JA 3QUMP 3LGTA 2QCYA 5G4BA 5J4SA 1WCZA 1BTZA 8GCHG 5DO4H 3PLPA 2FWWA 1T8MA 2ZZUH 1EUFA 1O3GA 2BM2A 2I6QA 1AVXA 4B74A 1FUJA 2XBWA 1G3DA 1H8IH 3TGJE 1ZR0A 4A5TS 2ZCHP 3P8NA 4GLYA 6GCHG 1FIWA 4KP0A 5F8XA 3TLOA 4DJZB 3O8CA 2IJOB 4BTIB 1ANBA 4B2CA 1YKTA 4ISHH 2TGDA 2A31A
chains in the Genus database with same CATH superfamily
3GDVA 2R2WU 3V13A 1VITF 4UFGH 4MVNA 4AN7A 3SU3A 4GHQA 3RXJA 1QTFA 1ZPBA 5GCHG 1YPJH 3STIA 3T26A 5JB9S 1BTUA 4NGAH 4Y7BA 2F43B 2KCPA 1H9LB 1MTUA 2WPJS 4D9RA 3FOAA 4ZKSU 2BOKA 2JJ2D 8GCHF 1TX7A 3ZZDA 3RXIA 1TNKA 1LPZB 3LOXA 5EQSA 2J97A 2A7CA 2B0FA 1P2NA 3BSQA 2FM2A 2JJ1D 2FZZA 3UIRA 1P2QA 2ZHQH 1TGNA 1V6DA 1BOQA 6GCHF 5J4QA 1KDQA 4X8UH 3RXSA 1P9SA 1ESTA 1F0TA 3GCHB 1TGSZ 2SNVA 3Q77A 4FUCA 3A81A 1QCPA 4CHAC 1E37B 5C3NA 2QXJA 4HTCH 2BY5X 1EB2A 1FY5A 4HFPB 1V2QT 5IYTA 4H42U 2BTCE 3QZRA 1C5VA 1C2MA 3PMBB 2LNCA 1LKAA 1OYQA 3M5OA 5JDUB 3SU0A 3NCLA 4X2XA 1KLJH 4BTTB 4ISNA 5CHBA 5CE1A 2ZKSA 3DT0H 1TGBA 5E0JA 2FMJA 1TMBH 1BMFD 1ZZZA 3SQEE 1V2ST 1UO6A 2A2XH 1DITH 1MH0A 4I32A 2BOHB 3DSGA 4CH8B 5ESTE 5EPNA 2AGEX 5KGOA 1MZAA 2FP7B 1LPGB 1O3IA 3Q76A 4XBBA 2F83A 5BPEA 5LPRA 2G5NA 3E8LA 4NA7A 4CREA 4D8NA 1TNLA 1VZQH 1XKBC 4U30A 1J15A 1T7CA 1C5PA 3QK1A 1DUEA 4D7GA 1HRTH 5DK1A 1ZJKA 2JETB 1F7ZA 1O2OA 1W0YH 1VR1H 3SBKA 1CGIE 2KFWA 4NFFA 2K0QA 1P06A 1C5TA 5DP7A 3SUEA 4WMFA 4MPVA 4B2BA 2ZU1A 1UHBB 1AUTC 1BIOA 1ETRH 1L2EA 1WYKA 2WUBA 1O2HA 1QBOA 1C5MD 1K1PA 3TNSA 2CJIA 1SLXB 4Y0ZE 4IN2A 1FNIA 3O8RA 1S81A 1DWEH 2M5TA 3GCTF 3OAAD 3S69A 3FZZA 3DA9B 1TOCB 4MPXA 3C1KA 3NRLA 4U2WA 4X2YA 1L1NA 1YLNA 4WMDA 2BD7A 1Y3YA 3TK6A 2UWPA 2QF5A 1XKAC 3S9AA 1TNHA 3NPSA 1YLDA 1P0SH 1TBRH 3BEUA 2I6SA 1Y3VA 3TJUA 3V0XA 4Q2KA 3EAJA 4FUIA 2QF3A 1O2JA 1BHXB 2WINI 1C5XB 4FUFA 3GCHC 3ZVCA 4K1TA 3M35A 1AZ8A 1CBWB 2VH0A 4MNWA 1W0ZU 3O8BA 1PPBH 2H9TH 1UK4A 2OBQA 2ZECA 1NS3A 5EQRA 2EA3A 5DKMA 3QWCH 1H9IE 2G8TA 1KXDA 3BTWE 4ZXYH 3PMJA 1TWXB 3A7ZA 2FOFA 5FBIA 1P09A 1Y3UA 1TAWA 2BHGA 1IAUA 1GCTB 1FX0B 3ZVAA 1QA0A 1TA2A 2D8WA 2Z7FE 3M3VA 1TGCA 2WZQA 4XRNA 1ZSJA 1XVMA 3K2UA 2PV9B 4Y8ZA 2H2ZA 3MNSA 4VGCB 2CV3A 1SGFG 1UTPA 3SV2H 1CE5A 2ZPQA 5IDKA 1IQLA 1XUJA 1GHXH 1PPEE 1LPKB 3VB5A 3RXRA 2AGGX 1MBQA 1MCVA 1PYTD 2JH5D 2WPDD 3M7QA 1OP8A 3MHWU 2PLXA 1Z6EA 2ZGCA 1C5NH 4LOYH 1K1LA 4AFQA 3S9BA 1SFIA 1QL9A 1E38B 1DY9A 2C3SA 2JETC 4AC9A 1A5GH 1SGRE 2VIQA 4UFDH 3DFJA 1GBFA 3MYWA 3QN7A 3SO3A 4D9QA 2A4OA 4B6EA 3UR9A 4ABFA 2Z9LA 1GL0E 3ATKA 4CR5A 3H7OA 2SGPE 1MUEB 3ZZ7A 1W2KH 3SU6A 5C1XA 1VCQA 2KAIA 4GPGA 2TGTA 3E91A 1O3BA 2IPQX 1O37A 4XSKU 3TVJB 4OS7A 1ELBA 1AQ7A 2EI8A 4P00A 3G01A 4MG3A 2Y7XA 1G2MA 2IN2A 1UCYH 1G32B 1AGJA 1L4ZA 2XOKD 2GT8A 1GBCA 1MAYA 1V2NT 1DWCH 3RXGA 1C2HA 1BQYA 1KY9A 1UMAH 1T8LA 2B9LA 4XE4A 4AG2A 3RU4E 1NRPH 1KSNA 2P59A 1IQJA 1PJPA 2H1UA 1SGPE 1YCPM 3EQ0H 3QLPH 2M2AA 3Q3YA 3UQVA 1S0QA 1YP9A 4A1TA 2AEIH 1QB1A 1P3CA 2SGDE 1E79D 4B2AA 1IQMA 2ANWA 5GDSH 1GMCG 1KXBA 3PV2A 1J16A 4I8KA 1SGTA 3F68H 2QY0B 4YO9A 1HXFH 1O2IA 3RU4T 3MH4A 1K21H 1BJVA 1S5SA 2A2QH 1O3NA 3UNRA 2ZEBA 1EJNA 3ODDA 2JH6D 3FZDA 3TPIZ 2BDBA 3RC4A 1DXWA 2ZHDA 1BA8B 3RXLA 1JWTA 2VBCA 5B6OA 2ZTYA 4Y7AA 1ANEA 1WSSH 3AVZA 1QQ4A 1A1RA 1C1VH 1GJDB 2V3MA 3PO1B 2GDEH 6ESTA 2DUCA 1TIOA 1KTTB 3WY8A 4RT0A 2CF8H 2OXSA 4KTCA 1WQSA 1PQ5A 1ZOMA 3OTPA 1BZXE 2BQ7B 4ABDA 4DY7B 1UCYK 1AB9B 1YPHC 2OUAA 4UFEH 1S84A 1GJ7B 4IC5A 1RFNA 1GG6B 1HIAB 3FP7E 5DGJA 1GMCF 4CRFA 3MO9A 1WV7H 3TK5A 1LQDB 1SFQB 1O5EH 3OX7U 5GPIB 3URDA 1GDQA 3KGPA 3FVFB 4AGJA 1UVSH 5BRRE 1WAYB 5C2ZA 1EP5A 2OINA 1DT2A 3B9FH 2NU1E 3HKJB 4CBOA 4ACBA 1SPJA 2STAE 2J9NA 4OS1A 2ZDVH 2ZU4A 4MNXA 4K3JA 1LVMA 2PWXA 1TBQH 1GJ6A 3K6YA 4O3UA 2VU8E 3RLWH 1EAIA 4ABGA 1AMHA 1A2CH 3ZZ6A 4D76A 3SU4A 3FN8A 1O33A 4KTUA 3GICB 3E0PB 1UK3A 1GVLA 2YMSD 3RP2A 3PV5A 2BDAA 2BQWB 2V0BA 2ZFQH 4TWWA 1G3BA 1DWDH 4YESB 1P04A 1G9IE 2PTCE 1GWAA 2GVFA 1CA0B 3A7TA 2R3UA 5DG6A 3TJVA 2GCTB 3RXTA 2G52A 2WPMS 1LMWB 3VXFH 1ORFA 4B6FA 4FUBA 2FTLE 1O3KA 2KCAA 1RGQA 3NUMA 7ESTE 1O2GH 1PPGE 3T2NA 3ZZCA 1KIGH 2WHXA 2PUXB 1C1RA 2QXGA 2XBXA 3A86A 3HGPA 3SQHE 3T62A 1O3AA 1A7SA 1O2XA 4PROA 2IOTA 1QQUA 2P95A 3SGBE 4FUHA 1RXPA 1TBZH 1T8NA 2KM0A 1TGTA 1H8DH 4TPYA 5GIBA 1QURH 3HK6B 1U6QA 1PPZA 1TPSA 2P8OC 5LPFA 1HJ9A 3F9FA 1BMLA 2AMQA 1O36A 1GBMA 3M37A 3BEIB 1EASA 1F2SE 3KQDA 2OCVB 4WVPE 3RC5A 2BY6X 1KXAA 2BVSH 2HNTE 2VH6A 3RXQA 1XUIA 3F2HA 2V7QD 3TITA 4INLA 2BD9A 3A7YA 2ZCKP 4DW2U 4A6LA 2F4LA 2FX4A 1CT0E 3UAIC 3U8OH 1AB9C 2BX3A 5DN6D 1JXPA 1N6YA 1E0FD 3A84A 3KQBA 3PM3A 3GY4A 1O2KA 1C1PA 3F0OA 4CRAA 1ID5H 2C8ZB 4ISIH 2GD4B 2PSYA 1UCYE 4RKJB 1P2OA 1UTMA 3STJA 1ANDA 1WOFA 2FEQH 3ZVFA 3A8AA 3V3MA 3F3BA 4OM9A 4JZFH 2QXIA 3CS0A 5DJ7A 4UE7H 5C17A 4E05H 1IQNA 1K1OA 5JBTA 1P02A 2ZHFH 1P9UA 5PTPA 1V2WT 3BTHE 4ZAEA 5FL7D 1NO9H 1F0RA 2H9HA 2HNTF 2ZDNA 3RXFA 3BG4C 7GCHG 1DICA 2J94A 3MH7A 4I33A 3FP6E 1GI1A 1BTXA 1HPGA 1BMAA 1P2MA 1NFUA 3LGWA 3HGNA 3TNTA 2W5EA 3PROA 4CR9A 2ALPA 1XX9A 2R9PA 1GI0A 3PRDA 2C8YB 2ZGXH 1AFQB 1KXEA 2C4FH 3AK5A 2TPIZ 1GBDA 5T6DA 1SGNE 2ANYA 3SV8A 1BRAA 1DX5M 1WTHD 2GCTC 2PGQB 3QGNB 1OXGA 1HAZB 5C5NA 4GSOA 2ZTXA 5CHAB 2OC8A 1O32A 2IPHA 1FV9A 1IOEA 3A8CA 5A8YA 4DG4A 1A0LA 2D1JA 4DIHH 4CH2B 1ETSH 1QRWA 3M7TA 3SJOA 4QT8C 3RM2H 2NWNA 2AFQB 3QZQA 1E34B 1BUIA 1QRZA 2FI4E 2AGIX 1ZRBA 1GI9B 1ZTKA 2RG3A 1CO7E 1NC6A 1ZJDA 2ZFTA 3TGKE 4YT7H 2KCYA 5FAHA 3O8DA 1EZUC 4Q7XA 1G36A 1ELFA 3N7OA 4YOGA 1GHBG 2O9QA 4DOQA 1CGHA 1J8AA 2O8WA 2YOLA 2BDCA 5SGAE 5A09A 1NN6A 1MU6B 2ANMH 2J38A 4Q4LA 4UFFH 4JZ1A 1FONA 4YOIA 1V2PT 1C1MA 2LELA 3GY3A 3GDSA 4RKOB 1AIXH 4ZHLU 2FOAA 1ETTH 1SLUB 4A1XA 1BRCE 5AVDA 1QJ1B 2Y80A 3SNBA 1COWD 2PSXA 1TALA 1RS0A 3BIUH 1A0HB 1CSOE 1TPPA 3BEFB 1J9CH 3IITA 2BZ6H 1QJ7B 9ESTA 3BTQE 4SGAE 5C20A 1TRYA 1N8OB 1YGCH 1V2MT 4BAKB 2P3UB 1XUFA 4YM9A 2CN0H 3OEED 4Q7YA 3E16B 1EAWA 3P8OA 4NZQA 2B5TB 2F9VA 4O03A 1LTOA 1JBUH 1HJAC 5DP8A 3SHCH 3BIVH 3T29A 1GPZA 1GDUA 1MABB 3ZZ5A 4F55A 1GCDA 1HAHH 3F6UH 1GHBF 1TOMH 1SSXA 3GY6A 1SGYE 1KLIH 4HGCA 1LCYA 1ELTA 3GYMA 3SU5A 3MU0A 3SN8A 1B0EA 2FI5E 3RUOA 3Q3XA 4FXGH 4NWLA 2P3TB 4ASUD 1P2JA 5FXLA 1W13U 3KN2A 1JMOH 1TQ0B 2VIVA 3PV4A 5F8ZA 1AFQC 1MCTA 2A4RA 1AVGH 1EPTB 1LHDH 2VNTA 1MAXA 4X2WA 5T6GA 2JIZD 1DOJA 1HAVB 2BLWA 2ZPSA 3P92A 4JMYA 2G00A 4RI0A 3T28A 8LPRA 3UOPA 2VIWA 2FDAA 2B8OH 3GCOA 5CHAC 1EOLA 2ZFPH 1O2WA 5FPTA 5JB8S 2ZFRH 1MTNB 4AX9H 1J17T 2B7DH 3SI3H 5GCHF 1ZLRA 2R3YA 2UUJB 2HPQH 3JZ2B 1AI8H 2A7HA 1SQRA 3VB6A 1Z8GA 1AWFH 4YLQH 2HOBA 1VJ9U 5HKKD 1GI3A 1SI5H 2QN5T 2SGAA 2WPHS 1F5KU 5EGMA 2Q6DA 1L0ZA 2Z3CA 4X8TH 1YPLH 5JBBS 3SW2B 3BTFE 3GDUA 1ELAA 5HMAA 1TPOA 2OQ5A 4K1EA 2BLOA 4Y76A 3CENA 3RXOA 2KX4A 1UTKA 3RXMA 1OWKA 2GTBA 4K2YA 2HVYB 3SZEA 1MMJN 1FI8A 3SGAE 4K8YA 1Q2WA 1TNGA 3SHAH 1BRUP 4ZMAH 2W3IA 1GHAG 3KL6A 1LQEA 2H6MA 2QV1A 1OP0A 3H09A 4Z1MD 3I77A 1AKSB 5KEDA 1W3CA 4E06H 3AAVA 5L2ZH 5F8TA 1ABIH 2O8MA 1YPGH 4OS5A 2AMPA 3RXVA 1N8OC 5C1YA 2FLRH 1MD7A 1W7XH 3DUXH 1RTKA 1GJ4H 2BXTH 1C5UA 1DVAH 4AFZA 3GOVB 1GI8B 4ABHA 2XNDD 3S9CA 1O2RA 4YOJA 3DD2H 1QZ8A 3K9XB 1EAUA 4UDWH 4ZKOU 2OC7A 2G81E 1Q31A 3DFLA 1HYLA 4WF8A 1KXFA 4H4FA 3TK9A 3NWUA 1K1IA 1PPHE 3UNQA 5DP9A 2A45B 2FPZA 1O2YA 1NZQH 4XBDA 4D7FA 3H5CB 1HJ8A 1SKYE 1H9HE 1EPTC 2VWMA 3E90B 5I25A 1KLTA 1EXFA 4JZIA 1K1NA 4GUXA 4X1RU 2GT7A 3H7TA 4TYDA 4INKA 2ALVA 2ILNA 1OKXA 4J1YA 3MH5A 3PMHB 1RRKA 3RMMH 2F9UA 4X6PA 2XCFA 3SORA 4AYYB 4B71A 1P3EA 5A8XA 3M61U 1MTNC 2PKAA 1WBGB 3D23A 4I8HA 4XBCA 1NFYA 2HRVA 4GCHG 1C9TA 5HM2A 1XVOA 1JIMA 2HALA 1Z8RA 1WUNH 4BNRA 1HUTH 1FXYA 4J2YB 2GZ9A 3SNEA 2XWBI 5EJ1A 3VFEA 2ZU2A 4R8TB 2FOHA 5DSFA 1K1JA 5E0GA 2XRCA 3PRBA 3RLYH 1C2IA 3RU4D 1GMDG 2STBE 5T1VA 2Z94A 3PB1E 3P95A 2AIQA 3HK3B 4FVDA 3TH3H 4FUEA 1P2KA 2GDDA 4NSVA 2J98A 1QHRB 2VJ1A 4NA8A 5C0UA 1DE7H 1T31A 3LT3A 4NIXA 4TT3D 1W7GH 3VXEH 1V2RT 5T6FA 3OU0A 1HDTH 1GHVH 2XW9A 1EP6A 3VG8A 1JRTA 2H5CA 3A89A 5FHTA 2VVUA 1ZSKA 2BD3A 4CBNA 3EA9A 4ZROA 1O3CA 3ZZ8A 1MQ6A 1UVOA 1C9PA 3OY6U 2FTMA 3OFND 1TONA 1C2EA 2A0QB 3PWBA 3BTTE 2GZ8A 3IG6B 1DUAA 1LVYA 2SNWA 4WXIA 3PLBA 1P10A 1C2GA 1GMDF 3ITIA 1O3DA 1EFRD 4TY6A 3BTEE 1KDQB 1W14U 2PGBB 1P03A 2PKSC 1SGFA 3T27A 1NESE 1TE0A 1V3XA 1Y5UT 1AVWA 1SOZA 4IS5A 4ZKRU 1O31A 2ZIQH 3LU9B 5EJLA 3PMAB 1RTFB 2BLVA 1C1OA 1FAKH 4AYVB 5KECA 3M3TA 5C67A 3SUGA 1QR3E 3BTDE 3ZZAA 1ZGVA 1THPB 5ETXA 3OTJE 5ESBA 3U8TH 2G4TA 4K1SA 1C1QA 3I29A 3RXUA 1AO5A 4CRGA 3QDZB 2BDGA 4KTSA 3A7WA 1PQ8A 2ZGBH 2AH4X 1O2LA 3A80A 1FN8A 5CMXH 5AF9H 2EI6A 4IMQA 4GVUA 1C5QA 1F0SA 1GBLA 2AS9A 4RN6A 1TA6A 5JBCS 3TGIE 4XDEA 3MNXA 1Y3WA 1MBMA 1SGCA 1SL3A 4IW4E 3BV9B 1V2OT 1DFPA 2P8OB 1C2DA 1FY1A 5F53A 1G37A 5A0BA 4X6MA 5EOKA 5FX6A 2WV4A 2KZ4A 1ARCA 1GJ9B 3IWMA 1O5GH 1TNJA 3A8DA 5H4IB 1ELGA 4ZHMU 3U1IB 3NZIA 3SJ9A 2H9EH 3UREA 2BX4A 1DM4B 3M36A 4BAOB 1NBMD 5GWZA 4NFEA 1AN1E 1BRBE 1Z8JB 1HFDA 4DIIH 1DWBH 2OC1A 1GGDB 1P57B 4NIWA 5HYOA 1K0HA 1AE8H 2NU2E 3BTME 5E8EH 1CVWH 1ZPCA 4HI3A 1GMHG 1O3PB 3OEHD 2BY7X 1GL1A 2ANKH 3UUZA 1DANH 3WW7A 3OE7D 1GI4A 1W10U 3SJ8A 1RIWB 3VB4A 1CQQA 1O38A 1GBAA 2ZF0H 2OK5A 1HXEH 3W1EA 1GJBB 3SOSA 3DSPA 2WV9A 1S6HA 1SGEE 3BG4B 1TB6H 2XBYA 4P02A 4AB9A 1M9UA 2ZFFH 1QBNA 5FPYA 2CF9H 4JCNA 1W12U 1T4VH 3S0NA 2TGPZ 2BD8A 2Y7ZA 1F5RA 1BTWA 5LPEA 2Y82A 2BXUH 2W3KA 4WJG2 3OYPA 4X6OA 1SGDE 1XUKA 1GJAB 2ZG0H 4BXSA 1C1SA 2ZI2H 5TCAA 2C8XB 1AU8A 2BD4A 1O2TA 2DE8A 1NBME 2Z6BD 1KMHB 4IC6A 5DP6A 2K1QA 4FU9A 2ZQ2A 4IMZA 4A92A 3AW1A 2V3OH 4K5ZA 5JBAS 1S82A 1OWDA 1S83A 3ZV9A 4LK4A 3SNCA 1TPAE 1BBRE 4AORA 4F48B 2BB4A 1O30A 2L74A 3M5LA 1VCWA 4M9FA 4FOUC 2ZU5A 2ZCLP 2ZDMA 1IQFA 1L1GA 1MKXH 2VVVA 1EKBB 2P93A 3RMLH 2J2UA 1S6FA 4DGJA 1YPKH 2XCNA 2WYJA 2WUCA 1AD8H 1CHOG 4JYUH 1HV7A 1TNIA 3ESTA 4MLFB 3HATH 3U28C 4FVBA 3A7XA 3LJOA 5E2OA 3RMOH 1IHSH 1LHFH 3SI4H 2FODA 4JK5A 3KEEA 2BZAA 4X8SH 1A4WH 2XYAA 1D3DB 1HAVA 1GJ8B 1K22H 1O3FA 1H8ED 2Z3EA 1DPOA 4NG9H 1NFXA 3SZNA 2VVCA 4X1SU 1QNJA 3LH3A 3I78A 3KNXA 1LKBA 2CHAB 4K69A 4A1VA 2AIPA 1GBBA 1C5WB 1F5LA 4LZ1H 3ATLA 4B75A 1GGDC 3PYHA 4BTUB 1O2NA 2KAIB 2Z9JA 3UB0A 1P01A 3MNBA 1TX8A 3SUDA 1A46H 1FIZA 2PTNA 3E0NB 2FOMB 3V12A 1ZSLA 3BTGE 3ZZ4A 3RXBA 1C1NA 1GI2A 2R0LA 1CHOF 2ZHEH 2A4QA 1W8BH 2ZO3H 1HJAB 1RIWC 2ULLA 3FO8D 3MQKC 4YT6H 1SC8U 1TLDA 1MD8A 1YLCA 2A32A 2BDIA 4IN1A 4BAMB 1S0RA 2L6OA 1VKYA 1ZYOA 2HGTH 3RXDA 4O3TA 4CRBA 1FMGA 5JPMH 1V2JT 2QGRA 2CXVA 4AOQA 4ZHAA 1OWEA 1F0UA 1MKXK 1JIRA 3QO6A 5A2MH 2PUQH 1CGJE 1W0JD 2PHBA 1ARBA 1PFXC 1C2KA 4MNVA 4BANB 3P6ZB 2TGAA 4NIYA 1GHYH 2OP9A 2HLDD 3W95A 2F91A 4FUDA 1THRH 2ZQ1A 1TRMA 5A0CA 1E1RD 4YLUA 1HAOH 1UHBA 3M5NA 2SFAA 4JK6A 4X1PU 3MTYA 2UUKB 1K9OE 1TMUH 3MI4A 1P05A 5FCRA 1ABJH 2EC9H 1S85A 4E7NA 1AHTH 2H5DA 4H6SB 1THSH 5FPSA 1WTGH 1N1LA 4XD7D 1YCPH 1Y5BT 4IBLH 4ABAA 4ABIA 1F92A 3KYGA 4THNH 5TCCA 1QIXB 4X8VH 1AWHB 3N7DA 2SGEE 4Z0KA 3URCA 1E1QD 4MNYA 7GCHF 3LPRA 2HLCA 4DVAU 1MTVA 1BMNH 1ANCA 1ELEE 2BVRH 3LDXH 3B23B 2XC5A 1YPHE 3M7UA 1KXCA 6LPRA 1PQAA 2W6JD 3U69H 1BHXF 2GCHG 2GMTC 1Y3XA 3BTKE 4MDSA 1B5GH 3FP8E 1G30B 1UVTH 1RJXB 2QIQA 5GJ4B 1O2SA 9LPRA 1QB9A 3ZVDA 1GI5A 4WH6A 3A83A 2Y5HA 4LZ4B 3GYLB 3CP7A 4DURA 1VITG 1YWUA 2JKHA 2W26A 3P8FA 1Z6JH 4ISOA 3UOUA 2CHAC 4XFQA 2W7SA 1P8VC 4M7GA 4BOHA 3A88A 4A7IB 3U98H 2TRMA 1BTHH 3ATMA 1BCUH 2F9NA 1C2JA 3UNSA 1UVPA 1MU8B 2F9OA 4INHA 3TJOA 3SV9A 4K60A 1EATA 1QGFA 3EYDA 5F03A 1TABE 5IK2D 2EQNA 1MQ5A 4B76A 2TBSA 1ZRKA 2VGCC 5C94A 1EJMA 3E6PH 1UVUH 4MQAA 4NA9H 1FN6A 3SU1A 4AFUA 3QX5H 1YCPK 2QA9E 2GZ7A 3FKSD 1UTNA 2EY4C 1C2LA 4ZCNA 3ATIA 1GI6A 2WYGA 4ABJA 2GCHF 2EEKA 1A5HA 2BMGB 3BN9A 3ZZ3A 5LH8A 1XMNB 1YYY1 4DT7B 1E36B 1NU9A 1GHZA 1ZTJA 1BT7A 2XTTB 1HCGA 3MU1A 3TJNA 4OS2A 5L2YH 1SR5C 2QXHA 1OYTH 4YTAA 1C5LH 2WV5A 2G5VA 2PFEA 4FUJA 4AGKA 3MO3A 1EOJA 2VB0A 3AAUA 4KKDA 4WWYA 1LVBA 2ZDAH 1LDTT 1P12E 3QGJA 3F9EA 2ZP0H 1D6RA 1D9IA 5AFYH 5EXLA 2XNIA 1RD3B 2FIRH 2ZHWH 5B6LA 3HKIB 3RDZA 1A5IA 2VINA 2WPIS 2HVXA 5E2PA 3NXPA 1LHCH 4U01A 3SU2A 1HB0B 2FYQA 3MFJA 3MU5A 1ZHPA 2V6NA 2FOCA 5AHGH 2J92A 1ZMLA 1ESAA 2A5KA 2ODQA 2ZTZA 3DHKH 4Q63A 2FX6A 1MZDA 5TJXA 1S6LA 1MKWH 1ZTLA 3F9GA 4FETA 1C5SA 1DSTA 1A3BH 1T4UH 7KMEH 2DE9A 4LXBH 2RA3A 4ASHA 5EQQA 4KELA 2W6ID 4MTBA 6CHAB 3D62A 1UTOA 1PYTC 3OY5U 1ZGIA 4Y6DA 3RXEA 1H1BA 5EU8A 1ZPZA 4OS4A 1FAXA 2G51A 2FESH 1G3CA 2FOGA 3RXCA 1DLKB 3FAOA 5FCKA 1NU7B 2ZC9H 3EE0B 2WPKS 4TY7A 1QL8A 4BXWA 3GCTG 3LC3A 1EQ9A 2BQ6B 3E1XB 3GY7A 1FLEE 1QBVH 2LPRA 3GCNA 3PLKA 1XUGA 5AFZH 5ABWA 4ZKNU 2F9BH 2A4GA 1G3EA 2C93B 2ZGHA 2BDYA 1TFXA 1SBWA 1SGIB 2YMSB 3K6ZA 4ZUHA 4U32A 4HZHA 1V2TT 2PP6A 2SGQE 3SNDA 4I8JA 3U1JB 4Q7ZA 4UD9H 3R3GB 2PKSB 3LIWA 2J5UA 2J4IA 4AZ2B 1BMMH 2GGVB 2A5AA 3LKWA 1MKWK 4NZLA 1O3JA 1QRXA 7LPRA 2TIOA 1HIAA 1NRSH 3S7KB 4WY3A 2Z9IA 1P2IA 4O97A 1C4Y2 1J14A 1NPMA 3VB3A 4HG6A 1AE5A 1V2VT 1SVPA 5C1UA 1RTLA 2AYWA 3L6PA 4X1NU 5A8ZA 3VB7A 1QA7A 1GHAF 1EZQA 4CRDA 4Y0YE 3QTOH 1UTJA 1Y5AT 1O5DH 2OD3B 3VEQB 1ZHRA 3PTBA 3RMNH 5I46H 2F3CE 1O5BB 2ODPA 3KF2A 3L33A 3RM0H 4I7YH 1Z1IA 1VGCB 1NY22 2Y81A 3CNRA 3A85A 1LVOA 3F1SB 1DLEA 3F0PA 1OSSA 3KYFA 1SOTA 4H6TA 3TU7H 5L30H 2P94A 2OQUA 1OPHB 2CMYA 2QF4A 4X6NA 2THFB 2XC4A 1ZMJA 1UW7A 1CA8B 2FS9A 2R2MB 1TYNA 4OGXA 5A0AE 1Q3XA 2FS8A 2OTVA 2ODYB 3EDXB 1EZXC 5K7RA 1HAIH 1SLWB 3E3TA 1DXPA 3L3TA 5HGGA 1TMTH 1HAYB 3UFAA 3SNAA 1JRSA 3D65E 4YXWD 6CHAC 1EB1H 1O5CB 1O3HA 3N99A 1BBRH 2GV6A 1QB6A 4AFSA 4MPUA 3ZVBA 1BJUA 1WQVH 5DP3A 3LGUA 1ELDE 4F4OC 1B7XB 2XC0A 2A1DB 5DP4A 4IGDA 1PPFE 3LJJA 3A7VA 4NWKA 1WDIA 2GJGA 1AZZA 3U9AH 3PWCA 1QJ6B 2UUYA 1VJAU 4WXVA 2NU4E 1SHHB 1O3LA 3UTUH 2ZFSA 3UWJH 3LGYA 1ELCA 4GCHF 1TX6A 1CU1A 1BB0B 1LHGH 2Y5FA 2VWNA 1YPMH 3LONA 1C5RA 3WWFA 3KCGH 3LGVA 4XOJA 1D3TB 2QAAA 1UJ1A 3F9HA 2HNTC 1SG8B 1D3PB 2CK3D 2ZGJA 1GBKA 2AERH 2YMSC 4F49A 2Z9KA 1CT4E 1SLVB 1DSUA 2UUFB 2ZPRA 1BTYA 2FYRA 2ZA5A 1C2FA 3A8BA 5FBEA 2XWAA 4I86A 1BDAA 4OGYA 2Q6FA 1OOKB 1BTPA 5T3HA 4OS6A 1FY4A 3LC5A 1G2LA 5HIZA 2O8TA 2V3HH 3M5MA 3DSOA 3ZZBA 2OC0A 1NTPA 1BBRK 3KHVA 1QL7A 4WMEA 5CDFE 1JOUB 1T32A 3JZ1B 2BD2A 4CRCA 5EW1H 3TH2H 2YNBA 1QY6A 2A5IA 4B1TA 5HM9A 2WSSD 1SMFE 1VGCC 1GBHA 2ZWLH 2VIOA 3KQ5A 1O5FH 1UTQA 1YC0A 3SV6A 4TWYA 4ESTE 1HLTH 2J95A 1Y8TA 1IQEA 1FDPA 4Y79A 1YY3A 1DDJA 2FLBH 1B0FA 1IQGA 1O2PA 5C0TA 4BAQB 1YM0A 1OX1A 1GDNA 1O0DH 1SHYA 3ELAH 3ATWA 1CBWC 1SQOA 2FI3E 3T5FH 1FPCH 1T8OA 3P70B 1OWJA 3UR6A 1GJCB 2Z3DA 3EGKH 4DT4A 1C1TA 2HPPH 1NRQH 2G4UA 4I8LA 3M3SA 4JYVH 2K8IA 2V35A 1MTSA 2C90B 1HAXB 1Z1JA 2JDID 1TRNA 1ZHMA 5DPAA 3UWIA 4KGAA 1K1MA 3VPKA 1GCTC 2O8LA 1YF4A 3C27B 1SB1H 5E0HA 1FQ3A 1V2UT 1BITA 2BY8X 4MPWA 5LGOA 3RXKA 4ZH8A 3SYJA 1KYNA 1FZZA 3ZYEA 4O9VA 3KIDU 2RCEA 3SUFA 4VGCC 1ELVA 3ZVGA 1NFWA 4DCDA 3SV7A 3CS7A 1HNEE 1O34A 1MTWA 1W11U 5HIYA 2QYIA 1VITH 1SQTA 4AB8A 2NU3E 3MU8A 1CT2E 1A3EH 3B8JA 1LHEH 1NT1A 1FJSA 1XXFA 2BDHA 1K2I1 2FOEA 2KR7A 1AUJA 3KQCA 4TSFD 3N7EA 5EG4A 5F6MA 4JZDH 2O8UA 4RT1A 2FO9A 3EA7A 4UEHH 1GVZA 3ZV8A 4WH8A 3MOCA 2ZDLA 2LP6A 3P17H 1IHTH 3MO6A 3BG8A 2SGFE 3A82A 5HXFA 1PPCE 1TQ7B 3Q00A 2PKAB 1GMHF 2ASUB 2W7UA 3AASA 2GX4A 2HWLB 3QTVH 1Z71A 3SGQE 3VGCB 3RC6A 5GXPA 3NKKA 2VIPA 2QE7D 4K8BA 1O2MA 1UK2A 4I31A 1O2QA 4ABBA 3K65B 2FOBA 3RXHA 2FXRA 2AMDA 3BF6H 3MWIU 1H8HD 2BY9X 1WXRA 3EA8A 4Y8YA 1O2UA 2XXLA 2G55A 5EJZA 2PR3A 1O2ZA 3NK8A 3RXPA 1DS2E 1FPHH 2C8WB 2P16A 2NU0E 2BVXH 2UWOA 2J98B 1C1WH 1IQKA 3KQEA 1V2KT 1HGTH 3GY2A 3F2GA 1EPTA 1XM1A 2GMTB 1HAPH 4RSPA 4YZUA 1WU1A 3Q3KA 2ZU3A 2UWLA 3GISB 1OWHA 4AG1A 8ESTE 2Y5GA 4GHTA 2GKVE 1P11E 3ZYDA 4ACAA 2WPLS 3MH6A 2Q6GA 1NROH 1GBJA 1C4U2 1EZSC 5L6NH 4FU7A 1LO6A 1X7AC 3UPEA 1GBTA 1EAXA 2QC2A 1NRRH 2XBVA 1XXDA 4FU8A 2VWOA 3LGIA 3PTNA 2OLGA 3W94A 1O5AB 3HPTB 3ODFA 3PO1C 3TIUA 3MU4A 1ESBA 1HAGE 3S7HB 1D6WA 2YNAA 3MNCA 1ZMNA 1YBWA 2EI7A 3MMGA 1OHHD 3TH4H 8KME2 1N6XA 2VGCB 3A87A 4Q80A 5GNDA 4JYTA 3DCLA 3T25A 3P8GA 1YPEH 1D3QB 1OS8A 1GG6C 3RXAA 3AW0A 1AFEH 5EPYA 1O39A 2RA0A 4Y8XA 2IJD1 3V7TA 1PQ7A 2KCOA 5EW2H 1SGQE 3WWBA 4TPIZ 2Y6TA 1Z7KA 2Z9GA 4NIVA 4X0WU 3SJIA 3UQOA 4JZEH 2ZNKH 2BYAX 1CHGA 3U8RH 1HBTH 3EE7A 1C5OH 1NM6A 2CGAA 1L4DA 1GVKB 3SJKA 3ENSB 3ZZ9A 1INCA 1L1JA 1O35A 1AKSA 1UTLM 5K0HA 1EX3A 1O3MA 1O3EA 1C5YB 3GY5A 1XUHA 1GBIA 3FFGA 3ZVEA 2BLQA 1D4PB 4GAWA 3VGCC 1QFKH 1O2VA 1C1UH 1FY3A 4B73A 2RDEA 2QF0A 5FX5A 1A61H 3R0FA 1KTSB 2BD5A 4SGBE 4ISLA 2PW8H 2P3FH 2D26C 5DP5A 2F9PA 4ABEA 2ESTE 2R0KA 1CA0C 1Y59T 2J34A 4NCYA 4NSYA 3FANA 1K28D 4Y71A 4CHAB 1IQIA 1GBEA 2OBOA 3UY9A 5C5OA 1Z8IB 2ZDKA 2VIDA 1V2LT 3GY8A 5EXMA 3LH1A 3F2FA 2JH0D 4BAHB 1C5ZB 1E35B 5EIYA 5JYIA 1AY6H 4Z6AH 2RDLA 1O3OA 1VCPA 1SQAA 4R0IA 4X2VA 2D2DA 4Y10E 4X1QU 1DY8A 2VWLA 4I8GA 2A7JA 4E7RG 1FY8E 1GJ5H 2Q1JA 1OWIA 1ACBE 1C4V2 1NRNH 1OP2A 3OSYA 5EODA 2GP9B 4FUGA 4ZXXH 1GHWH 1H4WA 2GV7A 1GI7B 1IQHA 4UONA 1EJAA 4Y11E 5EXNA 3D49H 1A0JA 3QUMP 3LGTA 2QCYA 5G4BA 5J4SA 1WCZA 1BTZA 8GCHG 3GS9A 5DO4H 3PLPA 2FWWA 1T8MA 2ZZUH 1EUFA 1O3GA 2BM2A 2I6QA 1AVXA 4B74A 1FUJA 2XBWA 1G3DA 1H8IH 3TGJE 1ZR0A 4A5TS 2AHME 2ZCHP 3P8NA 4GLYA 6GCHG 1FIWA 2RFKC 4KP0A 5F8XA 3TLOA 1W0KD 3ZIAD 4DJZB 3O8CA 2IJOB 4BTIB 1ANBA 4B2CA 1YKTA 4ISHH 2TGDA 2A31A
chains in the Genus database with same CATH topology
3GDVA 2R2WU 3V13A 1VITF 4UFGH 4MVNA 4AN7A 3SU3A 4GHQA 3RXJA 1QTFA 1ZPBA 5GCHG 1YPJH 3STIA 3T26A 5JB9S 1BTUA 4NGAH 4Y7BA 1H9LB 1MTUA 2WPJS 4D9RA 4ZKSU 2BOKA 8GCHF 1TX7A 3ZZDA 3RXIA 1TNKA 1LPZB 3LOXA 5EQSA 2A7CA 2B0FA 1P2NA 3BSQA 2FM2A 2FZZA 3UIRA 1P2QA 2ZHQH 1TGNA 1V6DA 1BOQA 6GCHF 5J4QA 1KDQA 4X8UH 3RXSA 1P9SA 1ESTA 1F0TA 3GCHB 1TGSZ 2SNVA 3Q77A 4FUCA 3A81A 1QCPA 4CHAC 1E37B 5C3NA 2QXJA 4HTCH 2BY5X 1EB2A 1FY5A 4HFPB 1V2QT 5IYTA 4H42U 2BTCE 3QZRA 1C5VA 1C2MA 3PMBB 2LNCA 1LKAA 1OYQA 3M5OA 5JDUB 3SU0A 3NCLA 4X2XA 1KLJH 4BTTB 4ISNA 5CE1A 2ZKSA 3DT0H 1TGBA 5E0JA 2FMJA 1TMBH 1ZZZA 3SQEE 1V2ST 1UO6A 2A2XH 1DITH 1MH0A 4I32A 2BOHB 4CH8B 5ESTE 5EPNA 2AGEX 1MZAA 2FP7B 1LPGB 1O3IA 3Q76A 4XBBA 2F83A 5BPEA 5LPRA 2G5NA 3E8LA 4NA7A 4CREA 4D8NA 1TNLA 1VZQH 1XKBC 4U30A 1J15A 1T7CA 1C5PA 3QK1A 1DUEA 4D7GA 1HRTH 5DK1A 1ZJKA 2JETB 1F7ZA 1O2OA 1W0YH 1VR1H 3SBKA 1CGIE 4NFFA 1P06A 1C5TA 5DP7A 3SUEA 4WMFA 4MPVA 4B2BA 2ZU1A 1UHBB 1AUTC 1BIOA 1ETRH 1L2EA 1WYKA 2WUBA 1O2HA 1QBOA 1C5MD 1K1PA 3TNSA 2CJIA 1SLXB 4Y0ZE 4IN2A 1FNIA 3O8RA 1S81A 1DWEH 2M5TA 3GCTF 3S69A 3FZZA 3DA9B 1TOCB 4MPXA 3C1KA 4U2WA 4X2YA 1L1NA 4WMDA 2BD7A 1Y3YA 3TK6A 2UWPA 1XKAC 3S9AA 1TNHA 3NPSA 1YLDA 1P0SH 1TBRH 3BEUA 2I6SA 1Y3VA 3TJUA 3V0XA 4Q2KA 3EAJA 4FUIA 2QF3A 1O2JA 1BHXB 2WINI 1C5XB 4FUFA 3GCHC 3ZVCA 4K1TA 3M35A 1AZ8A 1CBWB 2VH0A 4MNWA 1W0ZU 3O8BA 1PPBH 2H9TH 1UK4A 2OBQA 2ZECA 1NS3A 5EQRA 2EA3A 5DKMA 3QWCH 1H9IE 2G8TA 1KXDA 3BTWE 4ZXYH 3PMJA 1TWXB 3A7ZA 2FOFA 5FBIA 1P09A 1Y3UA 1TAWA 2BHGA 1IAUA 1GCTB 3ZVAA 1QA0A 1TA2A 2D8WA 2Z7FE 3M3VA 1TGCA 1ZSJA 1XVMA 3K2UA 2PV9B 4Y8ZA 2H2ZA 3MNSA 4VGCB 2CV3A 1SGFG 1UTPA 3SV2H 1CE5A 2ZPQA 5IDKA 1IQLA 1XUJA 1GHXH 1PPEE 1LPKB 3VB5A 3RXRA 2AGGX 1MBQA 1MCVA 1PYTD 2JH5D 3M7QA 1OP8A 3MHWU 2PLXA 1Z6EA 2ZGCA 1C5NH 4LOYH 1K1LA 4AFQA 3S9BA 1SFIA 1QL9A 1E38B 1DY9A 2C3SA 2JETC 1A5GH 1SGRE 2VIQA 4UFDH 3DFJA 1GBFA 3MYWA 3QN7A 3SO3A 4D9QA 2A4OA 3UR9A 4ABFA 2Z9LA 1GL0E 3ATKA 4CR5A 3H7OA 2SGPE 1MUEB 3ZZ7A 1W2KH 3SU6A 5C1XA 1VCQA 2KAIA 4GPGA 2TGTA 3E91A 1O3BA 1O37A 4XSKU 3TVJB 4OS7A 1ELBA 1AQ7A 2EI8A 3G01A 4MG3A 2Y7XA 1G2MA 2IN2A 1UCYH 1G32B 1AGJA 1L4ZA 2GT8A 1GBCA 1MAYA 1V2NT 1DWCH 3RXGA 1C2HA 1BQYA 1KY9A 1UMAH 1T8LA 2B9LA 4XE4A 4AG2A 3RU4E 1NRPH 1KSNA 2P59A 1IQJA 1PJPA 2H1UA 1SGPE 1YCPM 3EQ0H 3QLPH 3Q3YA 3UQVA 1S0QA 1YP9A 4A1TA 2AEIH 1QB1A 1P3CA 2SGDE 4B2AA 1IQMA 2ANWA 5GDSH 1GMCG 1KXBA 1J16A 4I8KA 1SGTA 3F68H 2QY0B 4YO9A 1HXFH 1O2IA 3RU4T 3MH4A 1K21H 1BJVA 1S5SA 2A2QH 1O3NA 3UNRA 2ZEBA 1EJNA 3ODDA 2JH6D 3FZDA 3TPIZ 2BDBA 3RC4A 1DXWA 2ZHDA 1BA8B 3RXLA 1JWTA 5B6OA 2ZTYA 4Y7AA 1ANEA 1WSSH 3AVZA 1QQ4A 1A1RA 1C1VH 1GJDB 3PO1B 2GDEH 6ESTA 2DUCA 1TIOA 1KTTB 3WY8A 2CF8H 2OXSA 4KTCA 1WQSA 1PQ5A 1ZOMA 1BZXE 2BQ7B 4ABDA 4DY7B 1UCYK 1AB9B 1YPHC 2OUAA 4UFEH 1S84A 1GJ7B 4IC5A 1RFNA 1GG6B 1HIAB 3FP7E 5DGJA 1GMCF 4CRFA 3MO9A 1WV7H 3TK5A 1LQDB 1SFQB 1O5EH 3OX7U 5GPIB 3URDA 1GDQA 3KGPA 3FVFB 4AGJA 1UVSH 5BRRE 1WAYB 5C2ZA 1EP5A 2OINA 1DT2A 3B9FH 2NU1E 3HKJB 4CBOA 1SPJA 2STAE 2J9NA 4OS1A 2ZDVH 2ZU4A 4MNXA 4K3JA 1LVMA 2PWXA 1TBQH 1GJ6A 3K6YA 4O3UA 2VU8E 3RLWH 1EAIA 4ABGA 1AMHA 1A2CH 3ZZ6A 4D76A 3SU4A 1O33A 4KTUA 3GICB 3E0PB 1UK3A 1GVLA 3RP2A 2BDAA 2BQWB 2V0BA 2ZFQH 4TWWA 1G3BA 1DWDH 4YESB 1P04A 1G9IE 2PTCE 1GWAA 2GVFA 1CA0B 3A7TA 2R3UA 5DG6A 3TJVA 2GCTB 3RXTA 2G52A 2WPMS 1LMWB 3VXFH 1ORFA 4FUBA 2FTLE 1O3KA 1RGQA 3NUMA 7ESTE 1O2GH 1PPGE 3T2NA 3ZZCA 1KIGH 2PUXB 1C1RA 2QXGA 2XBXA 3A86A 3HGPA 3SQHE 3T62A 1O3AA 1A7SA 1O2XA 4PROA 2IOTA 1QQUA 2P95A 3SGBE 4FUHA 1RXPA 1TBZH 1T8NA 1TGTA 1H8DH 4TPYA 5GIBA 1QURH 3HK6B 1U6QA 1PPZA 1TPSA 2P8OC 5LPFA 1HJ9A 3F9FA 1BMLA 2AMQA 1O36A 1GBMA 3M37A 3BEIB 1EASA 1F2SE 3KQDA 2OCVB 4WVPE 3RC5A 2BY6X 1KXAA 2BVSH 2HNTE 2VH6A 3RXQA 1XUIA 3TITA 4INLA 2BD9A 3A7YA 2ZCKP 4DW2U 4A6LA 2FX4A 1CT0E 3U8OH 1AB9C 2BX3A 1JXPA 1N6YA 1E0FD 3A84A 3KQBA 3PM3A 3GY4A 1O2KA 1C1PA 4CRAA 1ID5H 2C8ZB 4ISIH 2GD4B 2PSYA 1UCYE 4RKJB 1P2OA 1UTMA 3STJA 1ANDA 1WOFA 2FEQH 3ZVFA 3A8AA 3V3MA 4JZFH 2QXIA 3CS0A 5DJ7A 4UE7H 4E05H 1IQNA 1K1OA 5JBTA 1P02A 2ZHFH 1P9UA 5PTPA 1V2WT 3BTHE 4ZAEA 1NO9H 1F0RA 2H9HA 2HNTF 2ZDNA 3RXFA 3BG4C 7GCHG 1DICA 2J94A 3MH7A 4I33A 3FP6E 1GI1A 1BTXA 1HPGA 1BMAA 1P2MA 1NFUA 3LGWA 3HGNA 3TNTA 2W5EA 3PROA 4CR9A 2ALPA 1XX9A 2R9PA 1GI0A 2C8YB 2ZGXH 1AFQB 1KXEA 2C4FH 2TPIZ 1GBDA 5T6DA 1SGNE 2ANYA 3SV8A 1BRAA 1DX5M 1WTHD 2GCTC 2PGQB 3QGNB 1OXGA 1HAZB 5C5NA 4GSOA 2ZTXA 5CHAB 2OC8A 1O32A 2IPHA 1FV9A 1IOEA 3A8CA 5A8YA 4DG4A 1A0LA 2D1JA 4DIHH 4CH2B 1ETSH 1QRWA 3M7TA 3SJOA 4QT8C 3RM2H 2NWNA 2AFQB 3QZQA 1E34B 1BUIA 1QRZA 2FI4E 2AGIX 1ZRBA 1GI9B 1ZTKA 2RG3A 1CO7E 1NC6A 1ZJDA 2ZFTA 3TGKE 4YT7H 5FAHA 3O8DA 1EZUC 4Q7XA 1G36A 1ELFA 3N7OA 4YOGA 1GHBG 2O9QA 4DOQA 1CGHA 1J8AA 2O8WA 2YOLA 2BDCA 5SGAE 5A09A 1NN6A 1MU6B 2ANMH 2J38A 4UFFH 4JZ1A 1FONA 4YOIA 1V2PT 1C1MA 3GY3A 3GDSA 4RKOB 1AIXH 4ZHLU 2FOAA 1ETTH 1SLUB 4A1XA 1BRCE 5AVDA 1QJ1B 2Y80A 3SNBA 2PSXA 1TALA 1RS0A 3BIUH 1A0HB 1CSOE 1TPPA 3BEFB 1J9CH 3IITA 2BZ6H 1QJ7B 9ESTA 3BTQE 4SGAE 5C20A 1TRYA 1N8OB 1YGCH 1V2MT 4BAKB 2P3UB 1XUFA 4YM9A 2CN0H 4Q7YA 3E16B 1EAWA 3P8OA 4NZQA 2B5TB 2F9VA 4O03A 1LTOA 1JBUH 1HJAC 5DP8A 3SHCH 3BIVH 3T29A 1GPZA 1GDUA 3ZZ5A 1GCDA 1HAHH 3F6UH 1GHBF 1TOMH 1SSXA 3GY6A 1SGYE 1KLIH 4HGCA 1LCYA 1ELTA 3GYMA 3SU5A 3MU0A 3SN8A 1B0EA 2FI5E 3RUOA 3Q3XA 4FXGH 4NWLA 2P3TB 1P2JA 5FXLA 1W13U 3KN2A 1JMOH 1TQ0B 2VIVA 3PV4A 5F8ZA 1AFQC 1MCTA 2A4RA 1AVGH 1EPTB 1LHDH 2VNTA 1MAXA 4X2WA 5T6GA 1DOJA 1HAVB 2BLWA 2ZPSA 3P92A 4JMYA 2G00A 3T28A 8LPRA 3UOPA 2VIWA 2FDAA 2B8OH 3GCOA 5CHAC 1EOLA 2ZFPH 1O2WA 5FPTA 5JB8S 2ZFRH 1MTNB 4AX9H 1J17T 2B7DH 3SI3H 5GCHF 1ZLRA 2R3YA 2UUJB 2HPQH 3JZ2B 1AI8H 2A7HA 3VB6A 1Z8GA 1AWFH 4YLQH 2HOBA 1VJ9U 1GI3A 1SI5H 2QN5T 2SGAA 2WPHS 1F5KU 5EGMA 2Q6DA 1L0ZA 2Z3CA 4X8TH 1YPLH 5JBBS 3SW2B 3BTFE 3GDUA 1ELAA 5HMAA 1TPOA 2OQ5A 4K1EA 2BLOA 4Y76A 3CENA 3RXOA 1UTKA 3RXMA 1OWKA 2GTBA 4K2YA 1MMJN 1FI8A 3SGAE 4K8YA 1Q2WA 1TNGA 3SHAH 1BRUP 4ZMAH 2W3IA 1GHAG 3KL6A 1LQEA 2H6MA 2QV1A 1OP0A 3I77A 1AKSB 1W3CA 4E06H 3AAVA 5L2ZH 5F8TA 1ABIH 2O8MA 1YPGH 4OS5A 2AMPA 3RXVA 1N8OC 5C1YA 2FLRH 1MD7A 1W7XH 3DUXH 1RTKA 1GJ4H 2BXTH 1C5UA 1DVAH 4AFZA 3GOVB 1GI8B 4ABHA 3S9CA 1O2RA 4YOJA 3DD2H 3K9XB 1EAUA 4UDWH 4ZKOU 2OC7A 2G81E 1Q31A 3DFLA 1HYLA 4WF8A 1KXFA 4H4FA 3TK9A 3NWUA 1K1IA 1PPHE 3UNQA 5DP9A 2A45B 2FPZA 1O2YA 1NZQH 4XBDA 4D7FA 3H5CB 1HJ8A 1H9HE 1EPTC 2VWMA 3E90B 5I25A 1KLTA 1EXFA 4JZIA 1K1NA 4GUXA 4X1RU 2GT7A 3H7TA 4TYDA 4INKA 2ALVA 2ILNA 1OKXA 4J1YA 3MH5A 3PMHB 1RRKA 3RMMH 2F9UA 4X6PA 2XCFA 3SORA 4AYYB 4B71A 1P3EA 5A8XA 3M61U 1MTNC 2PKAA 1WBGB 3D23A 4I8HA 4XBCA 1NFYA 2HRVA 4GCHG 1C9TA 5HM2A 1XVOA 1JIMA 2HALA 1Z8RA 1WUNH 4BNRA 1HUTH 1FXYA 4J2YB 2GZ9A 3SNEA 2XWBI 3VFEA 2ZU2A 4R8TB 2FOHA 1K1JA 5E0GA 2XRCA 3RLYH 1C2IA 3RU4D 1GMDG 2STBE 2Z94A 3PB1E 3P95A 2AIQA 3HK3B 4FVDA 3TH3H 4FUEA 1P2KA 2GDDA 4NSVA 1QHRB 2VJ1A 4NA8A 1DE7H 1T31A 3LT3A 4NIXA 1W7GH 3VXEH 1V2RT 5T6FA 3OU0A 1HDTH 1GHVH 2XW9A 1EP6A 1JRTA 2H5CA 3A89A 5FHTA 2VVUA 1ZSKA 2BD3A 4CBNA 3EA9A 4ZROA 1O3CA 3ZZ8A 1MQ6A 1UVOA 1C9PA 3OY6U 2FTMA 1TONA 1C2EA 2A0QB 3PWBA 3BTTE 2GZ8A 3IG6B 1DUAA 1LVYA 2SNWA 4WXIA 3PLBA 1P10A 1C2GA 1GMDF 3ITIA 1O3DA 4TY6A 3BTEE 1KDQB 1W14U 2PGBB 1P03A 2PKSC 1SGFA 3T27A 1NESE 1TE0A 1V3XA 1Y5UT 1AVWA 1SOZA 4IS5A 4ZKRU 1O31A 2ZIQH 3LU9B 3PMAB 1RTFB 2BLVA 1C1OA 1FAKH 4AYVB 3M3TA 5C67A 3SUGA 1QR3E 3BTDE 3ZZAA 1ZGVA 1THPB 5ETXA 3OTJE 5ESBA 3U8TH 2G4TA 4K1SA 1C1QA 3I29A 3RXUA 1AO5A 4CRGA 3QDZB 2BDGA 4KTSA 3A7WA 1PQ8A 2ZGBH 2AH4X 1O2LA 3A80A 1FN8A 5CMXH 5AF9H 2EI6A 4IMQA 4GVUA 1C5QA 1F0SA 1GBLA 2AS9A 4RN6A 1TA6A 5JBCS 3TGIE 4XDEA 3MNXA 1Y3WA 1MBMA 1SGCA 1SL3A 4IW4E 3BV9B 1V2OT 1DFPA 2P8OB 1C2DA 1FY1A 1G37A 5A0BA 4X6MA 5EOKA 5FX6A 2WV4A 1ARCA 1GJ9B 3IWMA 1O5GH 1TNJA 3A8DA 5H4IB 1ELGA 4ZHMU 3U1IB 3NZIA 3SJ9A 2H9EH 3UREA 2BX4A 1DM4B 3M36A 4BAOB 5GWZA 4NFEA 1AN1E 1BRBE 1Z8JB 1HFDA 4DIIH