3K2UA

Crystal structure of hgfa in complex with the allosteric inhibitory antibody fab40
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
239
structure length
233
Chain Sequence
IIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISWGCLHKPGVYTRVANYVDWINDRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor activator long chain
publication title Unraveling the allosteric mechanism of serine protease inhibition by an antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 50
structure length 233
sequence length 239
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3k2uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3k2uA01
3H7OA 2P3FH 4U2WA 3U1JB 3ATMA 1GL1A 2M5TA 2ODPA 2FI4E 3HPTB 1LVMA 4BXSA 1E37B 1GMDF 1DY9A 3P92A 3SI3H 3VGCB 1YF4A 2P93A 2JH0D 3ELAH 1LHDH 3E1XB 1DLKB 4K8YA 1BHXF 1VCQA 1C2GA 2PFEA 1G30B 3SHCH 2Z94A 1GMCG 4ABBA 1O2QA 3RXEA 1T4UH 1L1JA 3P70B 3E90B 3URDA 4ISNA 4KELA 4Y8XA 1LHGH 5A0AE 3RMLH 3MU1A 1SC8U 4NIWA 3RMNH 3A7VA 3TGIE 3Q3YA 4YOGA 1W7GH 2Y7ZA 1NN6A 5GCHG 4WH6A 2FPZA 1TQ7B 1UK2A 1KXAA 2QAAA 1YM0A 3A82A 4R8TB 1SGEE 1WQSA 1GHBF 4ZXXH 1DUEA 2Z9KA 1EAXA 2TRMA 2XBXA 3S69A 1BUIA 5JBBS 3A89A 1RIWC 1EAIA 1JMOH 1O31A 4THNH 5C67A 2VWMA 5TCCA 3ZYDA 1NESE 3PTNA 1H8DH 1ETTH 3VB4A 1JRTA 4I7YH 1TX7A 4GVUA 3BEIB 2ALVA 1ANCA 1GI2A 3M3VA 4D7FA 1O33A 5GIBA 3RXPA 1O38A 2H5CA 2QXIA 3VB7A 3UIRA 1XX9A 2A4GA 4FU8A 4ABEA 4XBCA 1KXEA 2STAE 2VH0A 2DE9A 2BDHA 1MAYA 2G52A 1Q31A 4INHA 1C5MD 5T6DA 4FUHA 1N8OB 1P2KA 2NWNA 4BOHA 3M5NA 3V12A 1FUJA 1IOEA 1GBFA 1KSNA 2BXUH 4E7NA 2BQ7B 2BLOA 1EX3A 1QQ4A 4CHAB 2F91A 1TPOA 1AWHB 2JETC 3RXKA 1SGFG 3T29A 3ZV8A 5JPMH 3MI4A 2B8OH 4UE7H 1CHOF 4DURA 4K2YA 1K9OE 2VB0A 4ZKOU 4A1XA 3ATWA 1E35B 1AFQC 4UFDH 2AH4X 3B9FH 4ZXYH 2ZIQH 1J15A 3DD2H 5EODA 1B0FA 1DSUA 1P9SA 1ELGA 1SGPE 1BBRH 3C27B 3LH3A 4H42U 1MQ5A 5BPEA 5C1YA 1E0FD 2P8OB 3BTFE 1UTNA 1Z6EA 2STBE 3FP6E 1WQVH 1V2PT 3SJIA 1SSXA 1PJPA 5AFYH 4ZKSU 1BBRK 1GGDB 4NIYA 3KQBA 5GJ4B 1AI8H 2ILNA 2D1JA 5F6MA 1F0UA 2QCYA 4O3TA 2Z9GA 5EXMA 4F4OC 2FM2A 1BRUP 1ZYOA 1XM1A 3PMJA 4O03A 4ISIH 5CHAB 3TJOA 4WMDA 2D2DA 1AQ7A 3LDXH 4IS5A 1B7XB 1TNIA 2QV1A 5FPSA 1DE7H 2TGPZ 2CF8H 1QB6A 1LVYA 1AVXA 2ZP0H 1JWTA 1ZSLA 3BG8A 1W11U 1GBBA 1MU8B 3BTDE 1BMMH 3GCTF 2RG3A 2ZHDA 2G4TA 2YOLA 1UVPA 3OTJE 1W3CA 2XC4A 1KXDA 2BD8A 1A2CH 2BDAA 3LGVA 1S5SA 1GBTA 1V2WT 4X0WU 1IQNA 4JYTA 2J34A 3SOSA 3M5MA 1O3NA 3M3TA 3UNQA 3U98H 3E16B 3UOPA 1IQEA 2BY8X 1FPCH 2VWNA 4RKOB 2O8TA 2FO9A 2SNVA 4GLYA 5AVDA 5HYOA 6GCHG 3ZVCA 3F9EA 2ZCLP 2OC8A 2GTBA 1FMGA 1BOQA 1UVUH 1T8OA 1SFQB 4DG4A 2BY5X 2GV6A 1G32B 2BD7A 4I31A 3SJ8A 4I8KA 2WUBA 2AGIX 1VCWA 3KQDA 1BTZA 1KLTA 2UUYA 4JZFH 1C5NH 1UMAH 4Y0ZE 3TK9A 4DCDA 3T26A 1HAHH 3E8LA 3ZVEA 3ZVAA 1Y3XA 4B2CA 1HYLA 3L33A 4CH2B 1GJ5H 2QIQA 1OWKA 1MZDA 1PPFE 1H4WA 2Z3DA 3SV9A 1AWFH 4E7RG 1O3BA 4A92A 2BX4A 2HRVA 2H6MA 3GY5A 1SHHB 1QCPA 2G5NA 2H5DA 3FP8E 2WPKS 1CQQA 1KLJH 3GCOA 4M7GA 2SGFE 2P59A 1QJ1B 4IC6A 4Q7YA 4IN1A 3RXFA 2EEKA 4J2YB 1X7AC 2KAIA 1D6RA 1HFDA 2AGGX 3JZ2B 2AERH 4X6OA 1ELVA 2FOHA 1S81A 1RTKA 2A2QH 2P3UB 1C5TA 1CHOG 2GMTB 1O2RA 3M35A 3PLPA 1YPHE 1GBEA 1F92A 1J14A 1O2HA 2YNBA 1AY6H 2VVUA 4A1TA 1CT4E 8KME2 2FZZA 2ZFQH 4JYUH 2QGRA 1ZRKA 1O36A 4UEHH 5C2ZA 4WMFA 4D76A 5PTPA 1YPMH 1Q2WA 1MTWA 2BYAX 3TK5A 2B9LA 4MVNA 4Y8YA 3RC6A 5A8YA 4ABGA 1C1RA 3DT0H 2J38A 2Z3CA 4X2XA 4BXWA 3S9CA 4BTTB 4YZUA 1GHAG 2GKVE 3T27A 4CH8B 2W3KA 1K1JA 4WWYA 5E2PA 4XBBA 1S84A 1O34A 2BDIA 3KHVA 5F8ZA 1GHXH 1O2KA 1DWEH 1RJXB 2B7DH 3L6PA 1DY8A 2A7CA 2WPJS 3BTGE 4X6MA 1WOFA 1FI8A 1BITA 2V35A 2Y80A 2BY7X 3UNRA 2O8MA 2RA0A 1V2MT 4HI3A 1GCTC 2XWBI 2AS9A 4MLFB 3SJKA 3OU0A 2PWXA 1NZQH 1C2FA 5C20A 1OP0A 3DFLA 3TJUA 1ELDE 1ZJDA 3UY9A 1WV7H 2NU0E 2G81E 1CT2E 1QRXA 3LGYA 1ZGVA 1LQEA 1S6FA 4MNYA 3MNSA 4UFGH 1Z6JH 1AO5A 1AZZA 3LH1A 1DFPA 1ZMLA 1FZZA 1AVWA 3QGNB 4OS1A 5C5OA 3QUMP 1Y5AT 1BMNH 1TONA 3CENA 3I78A 2VVVA 3UNSA 2GCTC 2CXVA 3HK6B 3VB5A 1T32A 5FHTA 4TWWA 4BAHB 1ELFA 2XCFA 5L2ZH 2A45B 2BHGA 2ZFRH 2FOCA 1Y3YA 1P2IA 2ZWLH 2A4RA 1FDPA 4ISOA 5CMXH 1NFYA 1A5HA 1P11E 4B73A 1EZUC 1HAZB 1W7XH 4FUDA 1UHBA 2XBWA 1CA0B 3FZDA 4TYDA 1GDQA 2F9PA 4I8GA 3B23B 1H9LB 3RXMA 3RP2A 5A0CA 1W14U 1RFNA 4B71A 3SV6A 1FV9A 1ZHPA 2ZDNA 3RXGA 3LGIA 1O2WA 2ZG0H 2ZFTA 3FAOA 1SFIA 1T7CA 3VEQB 1TA6A 4YTAA 1P9UA 3DFJA 1EAWA 1KLIH 4FU7A 4BANB 1VGCC 4Y79A 1DPOA 3UPEA 3ENSB 1D3QB 1SLWB 3EAJA 4TPYA 1CT0E 4K1SA 2C93B 4AB9A 2Z9JA 1Z71A 1ELBA 1NTPA 4WXVA 1SI5H 2VJ1A 1O3GA 1YPHC 4MQAA 1Q3XA 3A8AA 1AHTH 1D9IA 1SGYE 1G2LA 1B5GH 1BBRE 1SL3A 5AFZH 1P2JA 3PM3A 1C4V2 5EW1H 1TOMH 1NU7B 1CHGA 2AIQA 4UD9H 3IWMA 4X8UH 3ZZ5A 1DT2A 4AB8A 4Y6DA 5E0HA 1W0YH 2ZU2A 3FZZA 2BD3A 4XE4A 1C2LA 3EGKH 2ZO3H 1OWEA 3ZZ4A 1QA0A 2TGDA 4JZIA 1V2JT 1GHWH 4MDSA 1LDTT 1A0HB 2ZNKH 4JK6A 1C2EA 4BAKB 2F9OA 1MTNC 4CBOA 2PUXB 1K22H 3M5LA 1DITH 3CP7A 1O5AB 2W5EA 3TJNA 2ZGHA 1MMJN 2ODYB 4TWYA 1C5PA 4ISLA 4X1RU 2A4OA 2BTCE 4X8VH 3A7TA 1MH0A 1K1IA 4OGYA 4IBLH 5FPTA 2GZ8A 1CGJE 1JIRA 1GI4A 1O0DH 4K1EA 4ZHLU 1Z1IA 3D65E 1F0TA 1LCYA 3TU7H 3S7HB 4GHQA 3LJOA 1QBVH 4WVPE 3SU5A 1YKTA 2LPRA 2GZ7A 1SOTA 1VJ9U 3A8DA 1DX5M 3A7YA 3KL6A 2FODA 3MTYA 4CRCA 3GYLB 1BQYA 1Z8JB 2D8WA 2I6QA 3I29A 1GDUA 3P8OA 3RXBA 4I32A 2A1DB 2WV5A 3ZZAA 1P10A 1XUKA 3MH4A 1TGCA 3NPSA 4KTUA 5DP3A 3SV7A 4JZEH 3ZYEA 1O3CA 3AAUA 3F9GA 4MTBA 1UHBB 2ZGJA 3ATLA 1RTLA 2BQ6B 2NU4E 1LKAA 2GD4B 2BD2A 4NZLA 1FIZA 1QA7A 1O3KA 3ZVDA 2GX4A 2QN5T 3A86A 2C8YB 1O2YA 1FY8E 3PWBA 3RXVA 2GCHF 1HAIH 2ZTZA 3DA9B 1NC6A 1C5LH 1MKWK 2OLGA 1ZRBA 1SR5C 1VITG 3A88A 1GBLA 4BTIB 3SJ9A 1GI7B 3I77A 2J92A 1ANBA 1L1NA 1OWIA 3F1SB 3PV4A 3SUGA 4ZUHA 5CE1A 1P2QA 1GG6B 1OXGA 2Y5GA 4AYYB 5L2YH 4XBDA 1V2QT 3KEEA 4Y76A 2GV7A 4KTCA 2P94A 4DW2U 2NU1E 3SNBA 2Y6TA 4D8NA 1V2OT 1ZHRA 3BF6H 3JZ1B 5HMAA 2FLBH 1SBWA 2BDCA 2ZC9H 3F6UH 1UVOA 2AEIH 2FTMA 2CGAA 4O97A 1QL9A 1H1BA 3E0NB 4B76A 1XUGA 5A2MH 2XTTB 1O5DH 1QRWA 3GY3A 1JRSA 3KQEA 1NRPH 4NCYA 2OBQA 4BTUB 4BAOB 4X2YA 2ZHQH 2GDEH 1TB6H 3RXHA 1AB9B 5ETXA 4DT7B 2ZDMA 3R0FA 4CRFA 1UVSH 2ZQ1A 1DOJA 1GCDA 2VINA 5JBCS 2ZFPH 3SNEA 1T8LA 2OD3B 4ABHA 2FYRA 1QTFA 3OY5U 1GMHG 1HNEE 4X2VA 2V3HH 1DM4B 5LPFA 1SGTA 4MPVA 2ANYA 5L6NH 1C5WB 1TGBA 7LPRA 4LZ1H 1HPGA 3SN8A 5DJ7A 1PPHE 3QDZB 1HB0B 3PO1C 3PROA 1XMNB 1WSSH 1O5EH 2J94A 1ORFA 1EZXC 1TABE 4ZAEA 1C2HA 4X1QU 1GPZA 2ZGXH 4Q7ZA 3RM2H 2ZFFH 1MQ6A 1TX8A 5EQQA 1HJAC 3SV8A 2PKAA 4KTSA 5JYIA 1TFXA 2BLWA 1MCVA 1P2OA 1K1NA 3TPIZ 1ETSH 1A0JA 1JXPA 4OS4A 5CHAC 5IDKA 8ESTE 3K9XB 5T3HA 3SUEA 4MNXA 3U8TH 3SQEE 2TIOA 3U8OH 1P2MA 3KCGH 2VIPA 1EJAA 3M7TA 1GVKB 3BTME 4XFQA 1ZTKA 5EW2H 3A7XA 1LKBA 4BNRA 3SO3A 1OYQA 2ZDKA 4YLUA 1O2ZA 1Y3WA 1OPHB 2ZDVH 4NWLA 1TBQH 3NWUA 3A83A 1EPTB 1TQ0B 2BD4A 2OUAA 2R0LA 1OOKB 1C1WH 1QGFA 1SGIB 1Z8IB 3QWCH 3HK3B 4Q2KA 4Y7BA 3ZVGA 1CGIE 1TNHA 4VGCC 1L0ZA 3RXSA 1SGNE 3TNSA 3H7TA 3QLPH 3PWCA 1OWJA 4CRGA 5GXPA 1ZOMA 3GISB 4X8SH 4JCNA 3MU5A 3TIUA 3V13A 4Q7XA 9LPRA 1P57B 5FPYA 3KNXA 1GVLA 1O3LA 1C1MA 1D4PB 3EDXB 5L30H 1DWBH 4F49A 1MU6B 1F0RA 1XUHA 3QTVH 4X8TH 1PPEE 1YPJH 4PROA 5IYTA 1A5IA 3L3TA 2R0KA 2ZKSA 1C5ZB 1BT7A 1SHYA 1QL7A 3ZZ9A 2H2ZA 4H6TA 5FCKA 3ZZ8A 2AMPA 2BM2A 3QGJA 3ZVFA 2V6NA 3QK1A 2H1UA 4IW4E 3SQHE 1ZR0A 4FU9A 2PKSB 1GMDG 4K69A 3EA8A 1ZSKA 1WTGH 1G3BA 1AVGH 3WY8A 2K1QA 2FS8A 4OS6A 2BMGB 4Y8ZA 1SGQE 2ZCHP 1GJBB 3T2NA 1IQGA 1BMAA 4IGDA 1DWCH 2OQ5A 2O9QA 4YT6H 4K1TA 4KGAA 1AD8H 1VR1H 2ZPSA 3ATIA 4SGAE 2W7UA 4IMQA 4CRBA 5GWZA 2UWPA 5E0JA 2ZFSA 1EXFA 3GCHB 4NSYA 1ZHMA 2QF3A 2VGCC 4B1TA 3RU4E 3M5OA 5GPIB 1MTUA 1OP8A 3ZZBA 1F5LA 3D49H 2HLCA 3RXAA 1K1LA 4DIIH 1SLVB 2VIWA 3MU8A 2ZHEH 1HDTH 4YLQH 1QIXB 1AFQB 2CV3A 2PKAB 1AMHA 1QNJA 1PQ8A 2THFB 4B2BA 1KIGH 1GHBG 3SGQE 4E06H 1ZTJA 3H5CB 4X2WA 3SU3A 1Z7KA 3KQCA 1CU1A 1DDJA 4JYVH 1P8VC 1J9CH 2UUJB 2PW8H 3A81A 1YBWA 1EZSC 4HFPB 2FXRA 4ABAA 1RD3B 1OWDA 1IQHA 4NFEA 1EJMA 1K1MA 3S9AA 1FY1A 2AYWA 1GI5A 2GP9B 3Q00A 1BTXA 5DK1A 1ZGIA 3T5FH 1D6WA 4OS7A 3ZZ7A 1MAXA 1N6YA 5LH8A 1P09A 1TNJA 4NSVA 1SLUB 4MPWA 4ASHA 2F9BH 1QQUA 3M37A 1HV7A 3RXIA 4WF8A 1TGNA 2FI3E 1GVZA 2FEQH 1MD7A 3BG4C 1UTOA 2H9EH 1P06A 3ZZ6A 6CHAC 1DANH 2C90B 1HAGE 1HJ9A 3RU4D 4NA8A 1T8NA 4INLA 2WYGA 2Y82A 3T62A 4WMEA 1A7SA 1OS8A 4MNVA 2FX6A 2RDLA 1BB0B 3LOXA 1YYY1 1CBWC 4A1VA 4FVDA 1AFEH 4FUGA 4OS5A 3GY7A 2CF9H 2XCNA 3SORA 4H6SB 4UFEH 3M36A 4K5ZA 5FBEA 5F03A 1MCTA 1QB1A 1O2LA 1O5FH 2XC5A 4Y71A 5I46H 4IC5A 1Y3UA 1NFUA 3R3GB 2HNTE 1SQAA 1NT1A 1TMTH 1N6XA 2DE8A 1TRMA 2ZCKP 4CRAA 1AE5A 1GI8B 1GJ4H 2EI6A 2OP9A 1CA0C 5T6FA 3Q77A 1GBHA 2V3OH 5EQRA 2AGEX 3RLWH 1F0SA 1C2IA 4FUEA 1O5BB 4I8JA 1KXBA 1TNLA 3BTTE 2FWWA 2VNTA 1QBOA 2TGTA 1O3AA 2ZZUH 1IQFA 3MOCA 4MNWA 2C4FH 4AFZA 1NPMA 3S7KB 1A1RA 2J2UA 2A5KA 1O3HA 5FX6A 3E91A 4YOJA 1FJSA 2B5TB 2J95A 4CRDA 3SNDA 2ZA5A 4AORA 3GCTG 2PSXA 3ZVBA 1QB9A 3SZNA 4X6PA 1ESBA 3VB3A 1QRZA 4DVAU 3HKJB 1HJ8A 1GBMA 4IN2A 2CHAC 1VZQH 1CGHA 1LO6A 2UWLA 3Q3XA 3TGJE 2EI8A 3PLKA 1DWDH 1LPKB 3EE0B 1TBRH 1FN6A 2NU3E 1INCA 1O3MA 3LJJA 1GBKA 1QFKH 2SNWA 1O2PA 2J4IA 4DJZB 1NY22 2ZQ2A 1G9IE 1Y59T 2W3IA 1O39A 1WTHD 2BLVA 6LPRA 1WU1A 3UREA 2RCEA 3SW2B 2XW9A 1UTJA 2WPIS 1Z1JA 1GHVH 1TX6A 1LTOA 3OSYA 1XXDA 3TH2H 2VIOA 2ALPA 4GUXA 2PTCE 1P0SH 1JIMA 4FUIA 2OC0A 4GCHF 4GAWA 1A3EH 2VU8E 1TA2A 1S0QA 2VWLA 3LONA 2CN0H 2KAIB 4HTCH 3TH3H 3LGUA 5DPAA 8GCHF 1K21H 1TRNA 2FX4A 3ODDA 1O3PB 1F2SE 2HWLB 1SG8B 3O8BA 1EZQA 3ESTA 3RC4A 6ESTA 1LPZB 1E38B 1GMCF 1SQOA 2FP7B 3MO3A 3GDVA 4Y11E 1A4WH 3CS7A 1LHEH 2HGTH 1O30A 3E6PH 5DP8A 1O3DA 1B0EA 1V2ST 5EU8A 2R2MB 4KKDA 2Q6GA 1GCTB 3FP7E 4DOQA 3SU6A 5B6OA 1XVMA 2R2WU 1EKBB 2H9HA 1V2KT 2A31A 4GHTA 1KY9A 2ANKH 3M7UA 4ZHAA 1C1VH 5GCHF 2HNTC 3CS0A 1UTLM 1BTUA 3SGBE 1TIOA 1XKAC 1ZMJA 1O2IA 1GI0A 1UTPA 1FLEE 1EQ9A 1MKXH 1O2UA 2UUKB 1EP5A 1GHZA 1V2UT 2VIVA 4AOQA 4INKA 2GCTB 2SFAA 4WJG2 5J4QA 1BRBE 1PPBH 1DLEA 1DSTA 1KDQA 1MKXK 1V3XA 1P04A 4CBNA 5DP9A 4AFSA 2F3CE 4Y7AA 3EA9A 1DXPA 3P6ZB 2XNIA 4I8LA 1F5RA 2G4UA 3LGWA 3MNXA 2BD5A 2VIDA 2PR3A 3VGCC 2BOHB 1FPHH 2XBYA 2ZEBA 3MH7A 1AIXH 1EOLA 4O9VA 1TYNA 1FN8A 3QZRA 1UTQA 2A32A 3V7TA 1PQ5A 2XYAA 4GPGA 3MHWU 5C1XA 4LK4A 1F7ZA 3OY6U 2Y5FA 3ODFA 7GCHF 5EXNA 4ZKRU 2QXJA 1C5YB 1HBTH 1EAUA 2ZPQA 1O2GH 1C5UA 2FDAA 1P3CA 4NIVA 3S9BA 3RDZA 2QC2A 1C4Y2 1NRNH 1KYNA 5DP4A 4JZ1A 3B8JA 1VGCB 1NM6A 3LU9B 3A85A 1ABJH 1EB2A 1Z8GA 1BHXB 1UO6A 1CA8B 1IHSH 2BZ6H 3FANA 3NZIA 1SB1H 2F9VA 3U8RH 2C8ZB 2R3YA 2G51A 4CR9A 2SGAA 2ZU1A 4AN7A 1W2KH 1EUFA 5TJXA 1P05A 2PGBB 1S82A 5HXFA 1RXPA 1GI6A 3MU0A 1C1SA 4UDWH 1FIWA 1OX1A 3LGTA 1A0LA 5T6GA 1YCPM 3RXQA 1SGCA 2UUFB 2SGQE 3D23A 1ABIH 2PLXA 5EXLA 4Y0YE 1S85A 4J1YA 2NU2E 3GDSA 4XOJA 2XXLA 2ZHWH 2F83A 3A8BA 1AU8A 1ETRH 2QA9E 1BTPA 1BMLA 3U1IB 4AX9H 3PMHB 3A7ZA 1MTNB 5DGJA 2RA3A 4ZMAH 3MMGA 1TNKA 2A4QA 5FAHA 1N8OC 5C1UA 4GCHG 1OSSA 3A87A 3NCLA 1QJ7B 3STIA 4D9RA 2XRCA 4FXGH 4Q80A 4U32A 8GCHG 3T28A 4CHAC 3TGKE 4I33A 2VVCA 1PPCE 2EA3A 3RXCA 2CJIA 1SMFE 2VH6A 2ANWA 2P16A 3NUMA 1A3BH 2BLQA 1C2JA 1PQ7A 3UR9A 2ZGBH 3ITIA 4LZ4B 1TNGA 3EQ0H 2PHBA 3KIDU 1FNIA 3MH5A 1EPTC 3MNBA 2OQUA 2EI7A 1QJ6B 2HNTF 5FCRA 3MWIU 5F8TA 1KXCA 2ZDAH 1YLDA 4X6NA 3TLOA 1C2DA 4HZHA 2P95A 2BOKA 2EC9H 4AFQA 3PTBA 1NFXA 3GY2A 1KDQB 3LC5A 2P8OC 3KGPA 1ARBA 4UFFH 9ESTA 1GJ9B 2FOEA 3P95A 3SHAH 1K28D 1P01A 3EA7A 1SPJA 1AGJA 1GGDC 1BDAA 1G3CA 3GCNA 1BRCE 3UWIA 6GCHF 1O5GH 3FFGA 1IQLA 3MO9A 4RSPA 1MBQA 5DP5A 1SVPA 1BRAA 3BEFB 3LKWA 2W7SA 2HVXA 1LVOA 2JH5D 5FBIA 5C3NA 4K3JA 1EASA 2XC0A 1MTVA 4DIHH 1XKBC 2OBOA 3F9FA 3VXEH 1GBIA 4O3UA 1RTFB 5AHGH 3NXPA 2ZU4A 3SU4A 1IAUA 5EPYA 1V2VT 2C8XB 1C5RA 4HGCA 5EOKA 3RXTA 3SUDA 1HAXB 2A5AA 4I8HA 2PKSC 2FS9A 4ZKNU 2GGVB 4ABIA 4AGKA 2ZDLA 3P8GA 1FXYA 3RXLA 2Z9LA 1TPSA 3HGPA 1IHTH 1RS0A 1YPLH 1YP9A 4IMZA 1ZTLA 1HAOH 7KMEH 4TPIZ 2ZTXA 4FUBA 2J9NA 5DKMA 3UQOA 2ZTYA 1J17T 2VIQA 3DUXH 1G36A 7GCHG 3QO6A 1WAYB 3T25A 1S83A 3RU4T 1TBZH 2R3UA 2IPHA 5C5NA 3OX7U 1ZLRA 5E2OA 1GDNA 1QL8A 1C5VA 2I6SA 1ELCA 4AFUA 2V0BA 1C5OH 1P2NA 2PUQH 3GCHC 4K60A 1NRSH 1C5QA 1C9TA 1GBCA 2WYJA 4ESTE 2SGPE 2O8UA 2GT8A 1A61H 2WPLS 1TPAE 4E05H 1AUJA 5FXLA 3E0PB 2W26A 3FVFB 1NRRH 3MO6A 2P3TB 4GSOA 1YPEH 3PLBA 1DS2E 4MG3A 1QBNA 2XBVA 2FLRH 3LT3A 3PB1E 2Y5HA 3BTEE 3AVZA 1ELTA 3GYMA 3KF2A 3EYDA 4NIXA 3A8CA 2ZHFH 3A7WA 1O2OA 1D3TB 4YOIA 1GJDB 1H8IH 1RIWB 2H9TH 2O8WA 2R9PA 1LHFH 3BEUA 2GCHG 1HCGA 3BTQE 3RXUA 3PO1B 1O37A 1GHAF 1K2I1 3BTWE 1TGTA 3QX5H 1DXWA 2A0QB 3M7QA 1HJAB 1SOZA 4NA7A 1EATA 4YESB 2ZPRA 1GL0E 8LPRA 1FY5A 5LPEA 1O2SA 2ZF0H 2Z6BD 1HIAA 1W10U 1SLXB 3SGAE 2TGAA 1HAPH 1ESAA 3STJA 1VCPA 3LPRA 3UUZA 2AFQB 4YM9A 3W94A 1DUAA 1O3OA 1VJAU 3M3SA 1T8MA 1JOUB 2G00A 3P17H 5K7RA 5TCAA 1O2MA 1WBGB 1HLTH 2IN2A 1D3DB 2Y7XA 3RLYH 2JETB 1ELEE 3D62A 1SQTA 2GMTC 1P3EA 2BDGA 1TAWA 4WH8A 2Q1JA 2A7HA 1WYKA 1NROH 3HATH 1QY6A 1IQIA 1LQDB 2C8WB 4QT8C 3K6ZA 1GBDA 1ZJKA 1TPPA 2OC7A 4VGCB 4NGAH 1THPB 5BRRE 5DP7A 5SGAE 1MZAA 1NFWA 1C1TA 1P02A 1GBJA 4ABDA 4B74A 3ZZDA 1K1OA 1MUEB 3AAVA 4AG1A 5A0BA 1THRH 1WUNH 2OTVA 1LHCH 1UK4A 2OCVB 5G4BA 2CMYA 3NKKA 2C3SA 3SU2A 1AN1E 1O5CB 1CVWH 4NA9H 5EG4A 1CE5A 4B2AA 4YO9A 4JMYA 3C1KA 4X1PU 1UCYH 4UONA 2IOTA 2BB4A 1ACBE 3W95A 1FAKH 2ASUB 1BZXE 1ELAA 4NG9H 2TBSA 3HKIB 5EGMA 2BVSH 2Z3EA 4RN6A 4FVBA 5DP6A 1V2LT 2A2XH 3RC5A 2FMJA 1UCYK 4AYVB 3QTOH 1TALA 1YCPH 2FOFA 1G2MA 1CSOE 1JBUH 3MH6A 2YNAA 3NK8A 1EP6A 1C1NA 1W12U 2FOBA 3BIVH 1BCUH 2BY9X 1GWAA 1KTSB 3BN9A 3A80A 4U01A 1QR3E 3QN7A 1FY3A 1YCPK 1Z8RA 2JH6D 2F9NA 3VPKA 1AKSA 1UK3A 1HAYB 1GI1A 1J8AA 1O3JA 4NZQA 2DUCA 2G8TA 2WV4A 3SU1A 2TPIZ 3SNAA 1ZPCA 3AW1A 4A5TS 2UWOA 3VXFH 1LPGB 1XUFA 1SGDE 2Z9IA 2ANMH 5A09A 4D7GA 2OC1A 4ISHH 3GDUA 2BVXH 1BA8B 1NS3A 1TMBH 2VGCB 2ZI2H 4K8BA 3BTKE 1V2TT 3MU4A 4R0IA 4FUCA 4BAQB 1QURH 5K0HA 3GY6A 1XXFA 5ESBA 3K2UA 3TVJB 1LVBA 2HALA 1BJUA 1GI3A 3V0XA 2ZU3A 2ZGCA 4LXBH 2XWAA 2FTLE 2HPPH 3UTUH 1HIAB 1TLDA 2A5IA 1EOJA 3TH4H 5JBTA 2HOBA 1SGFA 4OGXA 2QXHA 1UTMA 2ULLA 4TY6A 3O8DA 1O2JA 2HPQH 5A8XA 1Y8TA 5DO4H 3O8CA 2AMQA 1N1LA 2Q6DA 3M61U 2AMDA 4Z0KA 3LC3A 2WINI 4DGJA 3BV9B 1GHYH 3RXDA 3IG6B 1AZ8A 3O8RA 1O32A 1G37A 1C9PA 1GJAB 5HM2A 2BY6X 3GY8A 3RMOH 2G55A 3SV2H 4DY7B 3G01A 5JB9S 4A6LA 1IQMA 3TITA 1GJ8B 1DVAH 1FQ3A 1BIOA 1NO9H 1HXEH 4Z6AH 1W0ZU 2BDBA 5EPNA 5ESTE 1V6DA 2GVFA 3BG4B 1HXFH 2GT7A 4MPUA 1O3IA 1VITH 5E8EH 1UVTH 4WXIA 4LOYH 1C1PA 1O3FA 2B0FA 3QZQA 1G3DA 5HM9A 5LGOA 1IQKA 6CHAB 2FOGA 3MYWA 2VWOA 1O3EA 3SI4H 5DG6A 1AE8H 1UTKA 5J4SA 1C5XB 1C5SA 1CBWB 1ZZZA 5LPRA 1D3PB 4FUJA 5A8ZA 4Y10E 3URCA 1W13U 2PTNA 1ANEA 3S0NA 2FOMB 1IQJA 1H9HE 4CR5A 3K6YA 3SNCA 2SGEE 3MFJA 1UJ1A 2Q6FA 3TNTA 2ESTE 5GDSH 1GJ7B 3GICB 4H4FA 4XSKU 3SBKA 1G3EA 3A84A 4ZROA 3PMBB 2BZAA 1V2NT 2BXTH 3DHKH 1C1UH 1KTTB 4SGBE 4WY3A 1S0RA 4RKJB 2ZU5A 1EB1H 1HAVA 3U69H 3N7OA 3ZZCA 2Z7FE 1VITF 3SJOA 2F9UA 3RXJA 2O8LA 3UWJH 1HUTH 1AKSB 1U6QA 1ZSJA 1GI9B 3GOVB 1K1PA 3RXRA 2BD9A 1LMWB 1A5GH 1YPGH 1EJNA 1BTHH 3F68H 3BSQA 3LIWA 1A46H 2D26C 3Q76A 4D9QA 1PPGE 1O2XA 1FONA 1MD8A 1TRYA 2GZ9A 1L4ZA 4KP0A 5HGGA 1PQAA 4ZHMU 4ZH8A 2FESH 1ESTA 3Q3KA 1PPZA 1P12E 1TOCB 1RRKA 1WCZA 1TMUH 4U30A 2OXSA 5JBAS 3ZV9A 2BVRH 1RGQA 4X1SU 1ZPZA 3ZZ3A 1YPKH 1FY4A 4BAMB 3U9AH 1F5KU 5JB8S 2QF0A 1PYTD 4CREA 1YC0A 1C4U2 3KN2A 1P03A 2WPMS 1O2TA 3AASA 3ATKA 3P8NA 2OINA 2CHAB 2FOAA 1TGSZ 2PSYA 5ABWA 1W8BH 3AW0A 1GMHF 2Y81A 3P8FA 1ZMNA 1AUTC 2ODQA 1MTSA 4OS2A 2FYQA 4TY7A 2LNCA 5E0GA 1T4VH 1S6HA 2WPHS 5EQSA 3RXOA 4FUFA 3RMMH 2WUCA 1L1GA 1SGRE 3PYHA 3VB6A 3RM0H 1C2KA 1Y5BT 2PGQB 3IITA 4XDEA 1GG6C 4YT7H 1E36B 1ARCA 1HGTH 2BQWB 5I25A 1O35A 1MBMA 1PFXC 3RUOA 2IJOB 1C1OA 1O2NA 2JKHA 1L4DA 1OWHA 2GDDA 3HGNA 1M9UA 1J16A 1XUIA 1ANDA 2QXGA 1C1QA 2BDYA 4NFFA 1YLCA 1HRTH 3BIUH 3GY4A 1GJCB 1H9IE 1TE0A 5FX5A 1O2VA 4NWKA 3K65B 3PMAB 3MNCA 3OYPA 3TJVA 4JZDH 1CO7E 2FIRH 2PV9B 1YGCH 3BTHE 1V2RT 1C2MA 2SGDE 1AB9C 5JDUB 1OYTH 1OP2A 1BJVA 1NRQH 4JK5A 3SUFA 4A7IB 1PYTC 2G5VA 4AGJA 1THSH 1NU9A 2FI5E 4AZ2B 3VFEA 3F9HA 1GJ6A 2BX3A 1BTWA 1Y5UT 3E3TA 4B75A 5H4IB 1OKXA 2QY0B 4ABJA 1ID5H 1XUJA 3UFAA 3UQVA 1BTYA 1DICA 2AIPA 1QHRB 1HAVB 1XVOA 3V3MA 3SU0A 1T31A 7ESTE 3UR6A 1GBAA 1EPTA 1E34B 5AF9H 1UCYE 5F8XA 1KXFA 4AG2A 4MPXA 2A7JA 3UOUA 1TWXB 1L2EA 1MKWH 1ZPBA 4X1NU 3TK6A 2ZECA 4ABFA 1FAXA 2QYIA 1Y3VA
chains in the Genus database with same CATH superfamily
3H7OA 3DSGA 2P3FH 4U2WA 3U1JB 3ATMA 1GL1A 2M5TA 2ODPA 2FI4E 3HPTB 1LVMA 4BXSA 1E37B 1GMDF 1DY9A 3P92A 3SI3H 3VGCB 1YF4A 2P93A 2JH0D 2WV9A 3ELAH 1LHDH 3E1XB 1DLKB 4K8YA 3KQ5A 1BHXF 1VCQA 1C2GA 2PFEA 1G30B 3SHCH 2Z94A 1GMCG 4ABBA 1O2QA 3RXEA 1T4UH 1L1JA 3P70B 3E90B 3URDA 4ISNA 4KELA 4Y8XA 3EE7A 1LHGH 5A0AE 3RMLH 5FL7D 3F2GA 3MU1A 1SC8U 4NIWA 3RMNH 3A7VA 3TGIE 3Q3YA 4YOGA 1W7GH 2Y7ZA 1NN6A 5GCHG 4WH6A 2FPZA 1TQ7B 1UK2A 1KXAA 2QAAA 1YM0A 3A82A 4R8TB 1SGEE 1WQSA 1GHBF 4ZXXH 1DUEA 2Z9KA 1EAXA 2TRMA 2XBXA 3S69A 1BUIA 1H8HD 5JBBS 3A89A 1RIWC 1EAIA 1JMOH 1O31A 4THNH 5C67A 2VWMA 5TCCA 3ZYDA 1NESE 3PTNA 1H8DH 1ETTH 3VB4A 1JRTA 4I7YH 1TX7A 4GVUA 3BEIB 2ALVA 1ANCA 1GI2A 3M3VA 4D7FA 1E1QD 1O33A 5GIBA 3RXPA 1O38A 2H5CA 2QXIA 3VB7A 3UIRA 1XX9A 4RT1A 2A4GA 4FU8A 4ABEA 4XBCA 1KXEA 2KR7A 2STAE 2DE9A 2VH0A 2BDHA 1MAYA 2G52A 1Q31A 4INHA 1C5MD 5T6DA 4FUHA 1N8OB 1P2KA 2NWNA 4BOHA 3M5NA 3V12A 1FUJA 1IOEA 1GBFA 2IPQX 1KSNA 2BXUH 4E7NA 2BQ7B 2BLOA 1EX3A 1QQ4A 4CHAB 2F91A 1TPOA 1AWHB 2JETC 3RXKA 1SGFG 3T29A 3ZV8A 5JPMH 3MI4A 2B8OH 4UE7H 1CHOF 4DURA 1NBME 4K2YA 1K9OE 2VB0A 4ZKOU 4A1XA 3ATWA 1E35B 1AFQC 4UFDH 2AH4X 3B9FH 4ZXYH 2ZIQH 1J15A 3DD2H 5EODA 1B0FA 1DSUA 1P9SA 1ELGA 3PRDA 1SGPE 1BBRH 3C27B 3LH3A 4H42U 1MQ5A 5BPEA 5C1YA 1E0FD 2P8OB 3BTFE 1UTNA 1Z6EA 2STBE 3FP6E 1WQVH 1V2PT 3SJIA 1SSXA 1PJPA 5AFYH 4ZKSU 1BBRK 1OHHD 1GGDB 4NIYA 3KQBA 5GJ4B 1AI8H 2ILNA 2D1JA 5F6MA 1F0UA 2QCYA 3F0OA 4O3TA 2Z9GA 4TSFD 5EXMA 3DSOA 4F4OC 2XOKD 2FM2A 1BRUP 1ZYOA 1XM1A 1WDIA 3PMJA 4O03A 4ISIH 5CHAB 3TJOA 4WMDA 5C0TA 3F2FA 2D2DA 1AQ7A 2WPDD 3LDXH 4IS5A 1B7XB 1TNIA 2QV1A 5FPSA 1DE7H 2TGPZ 2CF8H 1QB6A 1LVYA 1AVXA 2VBCA 2ZP0H 1JWTA 1ZSLA 3BG8A 1W11U 1GBBA 1MU8B 3BTDE 1BMMH 3GCTF 2RG3A 2ZHDA 2G4TA 2YOLA 1UVPA 3OTJE 1W3CA 2XC4A 1KXDA 2BD8A 1A2CH 2BDAA 3LGVA 1S5SA 3PV2A 1GBTA 1V2WT 4X0WU 1IQNA 4JYTA 2J34A 3SOSA 3M5MA 1O3NA 3M3TA 3UNQA 3U98H 3E16B 3UOPA 1IQEA 2BY8X 1FPCH 2VWNA 4RKOB 2O8TA 2FO9A 2SNVA 4GLYA 5AVDA 5HYOA 6GCHG 3ZVCA 3F9EA 2ZCLP 2OC8A 2GTBA 1FMGA 5C94A 1BOQA 1UVUH 1T8OA 1SFQB 4DG4A 2BY5X 2GV6A 2L74A 1G32B 2BD7A 4I31A 3SJ8A 4I8KA 2WUBA 2AGIX 1VCWA 3KQDA 1BTZA 1KLTA 2UUYA 4JZFH 1C5NH 1UMAH 4Y0ZE 3TK9A 4DCDA 3T26A 1HAHH 3E8LA 3F0PA 3ZVEA 3ZVAA 1Y3XA 4B2CA 1HYLA 3L33A 4CH2B 1GJ5H 2QIQA 1OWKA 1MZDA 1PPFE 1H4WA 2Z3DA 3SV9A 1AWFH 4E7RG 1O3BA 4A92A 2BX4A 2HRVA 2H6MA 3GY5A 1SHHB 1QCPA 2G5NA 2H5DA 3FP8E 2WPKS 1CQQA 2YMSB 1KLJH 3GCOA 4M7GA 2SGFE 2P59A 1QJ1B 4IC6A 4Q7YA 4IN1A 3RXFA 4Q63A 2EEKA 4J2YB 1X7AC 2KAIA 1D6RA 1HFDA 2AGGX 3JZ2B 2AERH 4X6OA 1ELVA 2FOHA 1S81A 1FX0B 1RTKA 2A2QH 2P3UB 1C5TA 1CHOG 2GMTB 1O2RA 3M35A 3PLPA 1YPHE 1GBEA 1F92A 1J14A 1O2HA 2YNBA 1AY6H 2VVUA 4Q4LA 4A1TA 1CT4E 2WZQA 5DSFA 8KME2 2FZZA 2ZFQH 4JYUH 2QGRA 1ZRKA 1O36A 4UEHH 5C2ZA 4WMFA 4D76A 5PTPA 1YPMH 1Q2WA 1MTWA 2BYAX 3TK5A 2B9LA 4MVNA 4Y8YA 3RC6A 5A8YA 4ABGA 1C1RA 3DT0H 2J38A 2Z3CA 3OFND 4X2XA 4BXWA 3S9CA 4BTTB 4YZUA 1GHAG 2GKVE 3T27A 4CH8B 2W3KA 1K1JA 4WWYA 5E2PA 4XBBA 1S84A 1O34A 4RI0A 2BDIA 3KHVA 5KGOA 5F8ZA 2QF4A 1GHXH 1O2KA 1DWEH 1RJXB 2B7DH 3L6PA 1DY8A 2A7CA 2WPJS 3BTGE 4X6MA 1WOFA 1FI8A 1BITA 2V35A 2Y80A 2BY7X 3UNRA 2O8MA 2RA0A 1V2MT 4HI3A 1GCTC 2XWBI 2AS9A 4MLFB 3SJKA 3OU0A 2PWXA 1NZQH 1C2FA 5C20A 1OP0A 3DFLA 3TJUA 1ELDE 1ZJDA 3UY9A 1WV7H 2NU0E 3F3BA 2G81E 1CT2E 1QRXA 3LGYA 1ZGVA 1LQEA 1S6FA 4MNYA 3MNSA 4UFGH 1Z6JH 1AO5A 1AZZA 3LH1A 1DFPA 1ZMLA 1FZZA 1AVWA 3QGNB 4OS1A 5C5OA 3QUMP 1Y5AT 1BMNH 1TONA 3CENA 3I78A 2VVVA 3UNSA 2GCTC 2CXVA 3HK6B 3VB5A 1T32A 5FHTA 4TWWA 4BAHB 1ELFA 2XCFA 5L2ZH 2A45B 2BHGA 2ZFRH 2FOCA 1Y3YA 1P2IA 2ZWLH 2A4RA 2QE7D 1FDPA 2KCYA 4ISOA 5CMXH 1NFYA 1A5HA 1P11E 4B73A 1EZUC 1HAZB 1W7XH 3PV5A 1UHBA 4FUDA 2XBWA 1CA0B 3FZDA 4TYDA 1GDQA 2F9PA 4I8GA 3B23B 1H9LB 3RXMA 5CHBA 3RP2A 5A0CA 1W14U 1RFNA 4B71A 3SV6A 1FV9A 1ZHPA 2ZDNA 4FETA 3RXGA 3LGIA 1O2WA 2ZG0H 2ZFTA 3FAOA 1SFIA 3N7EA 1T7CA 3VEQB 1TA6A 2KX4A 4YTAA 1P9UA 3DFJA 1EAWA 1KLIH 4FU7A 4BANB 1VGCC 4Y79A 1DPOA 3UPEA 3ENSB 3N7DA 1D3QB 1SLWB 3EAJA 4TPYA 1CT0E 4K1SA 2C93B 4AB9A 4TT3D 2Z9JA 1Z71A 1ELBA 1NTPA 4WXVA 1SI5H 2VJ1A 1O3GA 1YPHC 4MQAA 1Q3XA 4Z1MD 3A8AA 1AHTH 1D9IA 1SGYE 1G2LA 1B5GH 1BBRE 1SL3A 5AFZH 1P2JA 5HKKD 3PM3A 5GNDA 1C4V2 5EW1H 1K0HA 1TOMH 1NU7B 1CHGA 2AIQA 4UD9H 3IWMA 4X8UH 3ZZ5A 1DT2A 4AB8A 4Y6DA 5E0HA 1W0YH 2ZU2A 3FZZA 2BD3A 4XE4A 1C2LA 2HVYB 1MABB 3EGKH 2ZO3H 1OWEA 3ZZ4A 1QA0A 2TGDA 4JZIA 1V2JT 1GHWH 4MDSA 1LDTT 1A0HB 2ZNKH 4JK6A 1C2EA 1W0JD 4BAKB 2F9OA 1MTNC 4M9FA 4CBOA 3OE7D 2PUXB 1K22H 3M5LA 1DITH 3CP7A 1O5AB 2W5EA 3TJNA 2ZGHA 1MMJN 2ODYB 4TWYA 1C5PA 4ISLA 4X1RU 2A4OA 4F48B 2BTCE 4X8VH 3A7TA 1MH0A 1K1IA 4OGYA 4IBLH 5FPTA 2GZ8A 1CGJE 1JIRA 1GI4A 1O0DH 1UW7A 4K1EA 4ZHLU 1Z1IA 3D65E 1F0TA 1LCYA 3TU7H 3S7HB 4GHQA 3LJOA 1QBVH 4WVPE 3SU5A 5EIYA 1YKTA 2LPRA 2GZ7A 1SOTA 1BMFD 1VJ9U 3A8DA 1DX5M 3A7YA 3KL6A 2FODA 3MTYA 4CRCA 3GYLB 1BQYA 1Z8JB 2D8WA 2I6QA 3I29A 1GDUA 3P8OA 3RXBA 4I32A 2A1DB 2WV5A 3ZZAA 1P10A 1XUKA 3MH4A 1TGCA 3NPSA 4KTUA 5DP3A 3SV7A 4JZEH 3ZYEA 1O3CA 3AAUA 3DSPA 1H8ED 3F9GA 4MTBA 1UHBB 2ZGJA 4FOUC 3ATLA 1RTLA 2BQ6B 2NU4E 4ASUD 1LKAA 2GD4B 2BD2A 4NZLA 4HG6A 3NRLA 1FIZA 1QA7A 1O3KA 3ZVDA 2GX4A 2QN5T 3A86A 2C8YB 3AK5A 2KCAA 1O2YA 1FY8E 3PWBA 3RXVA 2GCHF 1HAIH 2ZTZA 3DA9B 1NC6A 1C5LH 1MKWK 2J5UA 2OLGA 1ZRBA 1SR5C 1VITG 3A88A 1GBLA 4BTIB 3SJ9A 1GI7B 3I77A 2J92A 1ANBA 1L1NA 1OWIA 3F1SB 3PV4A 3SUGA 4ZUHA 4ACBA 5CE1A 1P2QA 1GG6B 1OXGA 2Y5GA 4AYYB 5L2YH 4XBDA 1V2QT 3KEEA 3SYJA 4Y76A 2GV7A 4KTCA 2P94A 4DW2U 2NU1E 3SNBA 2Y6TA 4D8NA 1V2OT 1ZHRA 3BF6H 3JZ1B 5HMAA 2FLBH 1SBWA 2BDCA 2ZC9H 3FKSD 3F6UH 1UVOA 2AEIH 2FTMA 2CGAA 4O97A 1QL9A 1H1BA 3E0NB 4B76A 1XUGA 5A2MH 2XTTB 1O5DH 1QRWA 3GY3A 1JRSA 3KQEA 1NRPH 3KYGA 4NCYA 2OBQA 4BTUB 4BAOB 4X2YA 2ZHQH 2GDEH 1TB6H 3RXHA 1AB9B 5ETXA 4DT7B 2ZDMA 3R0FA 4CRFA 1UVSH 2ZQ1A 1DOJA 1GCDA 2VINA 5JBCS 2ZFPH 3SNEA 1T8LA 2OD3B 4ABHA 2FYRA 1QTFA 3OY5U 1GMHG 1HNEE 4X2VA 2LP6A 2V3HH 1DM4B 5LPFA 1SGTA 4MPVA 2ANYA 5L6NH 1C5WB 1TGBA 7LPRA 4LZ1H 1HPGA 3SN8A 5DJ7A 1PPHE 1VKYA 3QDZB 1HB0B 3PO1C 3PROA 1XMNB 1WSSH 1O5EH 2J94A 1ORFA 2F4LA 1EZXC 1TABE 4ZAEA 1C2HA 4X1QU 1GPZA 2ZGXH 4Q7ZA 3RM2H 2ZFFH 1MQ6A 1TX8A 5EQQA 1HJAC 3SV8A 2PKAA 4KTSA 5JYIA 1TFXA 2BLWA 1MCVA 1P2OA 1K1NA 3TPIZ 1ETSH 2V7QD 1A0JA 1JXPA 4OS4A 5CHAC 5IDKA 8ESTE 3WWBA 3K9XB 4DT4A 5T3HA 3SUEA 4MNXA 3U8TH 3SQEE 2TIOA 3U8OH 1P2MA 3KCGH 2VIPA 1EJAA 3M7TA 1GVKB 3BTME 1E1RD 4XFQA 1ZTKA 2YMSD 5EW2H 3A7XA 1LKBA 4BNRA 3SO3A 1OYQA 2ZDKA 4YLUA 1O2ZA 1Y3WA 1OPHB 2ZDVH 4NWLA 1TBQH 3NWUA 3A83A 1EPTB 1TQ0B 2BD4A 2OUAA 2R0LA 1OOKB 1C1WH 1QGFA 1SGIB 1Z8IB 3QWCH 3HK3B 4Q2KA 4Y7BA 3ZVGA 1CGIE 1TNHA 4VGCC 1L0ZA 4F55A 3RXSA 1SGNE 3TNSA 4XRNA 3H7TA 3QLPH 3PWCA 1OWJA 4CRGA 5GXPA 1ZOMA 3GISB 4X8SH 4JCNA 3DCLA 1KMHB 3MU5A 3TIUA 3V13A 2K0QA 4Q7XA 9LPRA 1P57B 5FPYA 3KNXA 1GVLA 1O3LA 1C1MA 1D4PB 3EDXB 5L30H 1DWBH 4F49A 1MU6B 1F0RA 1XUHA 3QTVH 2J97A 1PPEE 1YPJH 4X8TH 2IJD1 4PROA 5IYTA 3CNRA 1A5IA 3L3TA 2R0KA 2ZKSA 1C5ZB 1BT7A 1SHYA 1QL7A 3ZZ9A 2H2ZA 4H6TA 5FCKA 3ZZ8A 2AMPA 2BM2A 3QGJA 3ZVFA 2V6NA 3QK1A 2H1UA 4IW4E 3SQHE 2W6JD 1ZR0A 4FU9A 2PKSB 1GMDG 4K69A 3EA8A 1ZSKA 1WTGH 1G3BA 1AVGH 3WY8A 2K1QA 2FS8A 4OS6A 2BMGB 4Y8ZA 1SGQE 2ZCHP 1GJBB 3T2NA 1QZ8A 1IQGA 1BMAA 4IGDA 1DWCH 2YMSC 2V3MA 2OQ5A 2O9QA 4YT6H 4K1TA 4KGAA 1AD8H 1VR1H 2ZPSA 3ATIA 4SGAE 2W7UA 4IMQA 4CRBA 5GWZA 2HLDD 2UWPA 5E0JA 2ZFSA 1EXFA 3GCHB 4NSYA 1ZHMA 2QF3A 2VGCC 4B1TA 3RU4E 4ZCNA 3M5OA 5GPIB 1MTUA 1OP8A 3ZZBA 1F5LA 3D49H 2HLCA 3RXAA 1K1LA 4DIIH 1SLVB 2VIWA 5KEDA 3MU8A 1SKYE 2ZHEH 1HDTH 4YLQH 1QIXB 1AFQB 2CV3A 1AMHA 1QNJA 2PKAB 1PQ8A 2THFB 4B2BA 2RDEA 1KIGH 1GHBG 3SGQE 4E06H 1ZTJA 3H5CB 4X2WA 3SU3A 1Z7KA 3KQCA 1CU1A 1DDJA 4JYVH 2L6OA 1P8VC 1J9CH 2UUJB 2PW8H 3A81A 1YBWA 1EZSC 4HFPB 2FXRA 4ABAA 3FN8A 1RD3B 1OWDA 1IQHA 4NFEA 3OTPA 1EJMA 1K1MA 3S9AA 1FY1A 2AYWA 1GI5A 2GP9B 3FOAA 3Q00A 1BTXA 5DK1A 1ZGIA 3T5FH 1D6WA 4OS7A 5HIZA 3ZZ7A 1MAXA 1N6YA 5LH8A 1P09A 1TNJA 4NSVA 1SLUB 4MPWA 4ASHA 2F9BH 1QQUA 3M37A 1HV7A 3RXIA 4WF8A 1TGNA 2FI3E 1GVZA 2FEQH 1MD7A 3BG4C 1UTOA 2H9EH 1P06A 3ZZ6A 6CHAC 1DANH 2C90B 1HAGE 1HJ9A 3RU4D 4NA8A 1T8NA 4INLA 2WYGA 2Y82A 3T62A 2OK5A 4WMEA 1A7SA 1OS8A 4MNVA 2FX6A 2RDLA 1BB0B 3LOXA 1YYY1 1CBWC 4A1VA 4FVDA 1AFEH 4FUGA 4OS5A 3GY7A 5KECA 2CF9H 2XCNA 3SORA 4H6SB 4UFEH 3M36A 4K5ZA 5FBEA 5EJ1A 5F03A 1MCTA 1QB1A 1O2LA 1O5FH 4YXWD 2XC5A 4Y71A 5I46H 4IC5A 1Y3UA 1NFUA 3R3GB 2HNTE 1SQAA 1NT1A 1TMTH 1N6XA 2DE8A 1TRMA 2ZCKP 3MQKC 4CRAA 1AE5A 1GI8B 1GJ4H 2EI6A 2OP9A 1CA0C 5T6FA 3WW7A 3Q77A 1GBHA 2V3OH 5EQRA 2JDID 2AGEX 3RLWH 1F0SA 1C2IA 3OEHD 4FUEA 3VG8A 1O5BB 4I8JA 1KXBA 1TNLA 3BTTE 2FWWA 2VNTA 1QBOA 2TGTA 1O3AA 2ZZUH 1IQFA 3MOCA 4MNWA 2C4FH 4AFZA 1NPMA 3S7KB 1A1RA 2J2UA 2A5KA 1O3HA 5FX6A 3E91A 4YOJA 1FJSA 3OEED 2B5TB 2J95A 4CRDA 3SNDA 2ZA5A 4AORA 3GCTG 2PSXA 3ZVBA 2JJ2D 1QB9A 3SZNA 4X6PA 1ESBA 3VB3A 1QRZA 4DVAU 3HKJB 1HJ8A 1GBMA 4IN2A 2CHAC 1VZQH 1CGHA 1LO6A 2UWLA 3Q3XA 3TGJE 2EI8A 3PLKA 1DWDH 1LPKB 3EE0B 1TBRH 1FN6A 2NU3E 1INCA 1O3MA 3LJJA 1GBKA 4B6EA 1QFKH 2SNWA 1O2PA 2J4IA 3UAIC 4DJZB 1NY22 2ZQ2A 1G9IE 1COWD 1Y59T 2W3IA 1O39A 1WTHD 2BLVA 2CK3D 6LPRA 1WU1A 3UREA 2RCEA 3SW2B 2XW9A 1UTJA 2WPIS 1Z1JA 1GHVH 1TX6A 5F53A 1LTOA 3OSYA 1XXDA 3TH2H 2VIOA 2ALPA 4GUXA 2PTCE 1P0SH 1JIMA 4FUIA 2OC0A 4GCHF 4GAWA 1A3EH 2VU8E 1TA2A 1S0QA 2VWLA 3LONA 2CN0H 2KAIB 4HTCH 3TH3H 3LGUA 5DPAA 8GCHF 1K21H 3OAAD 1TRNA 2FX4A 3ODDA 1O3PB 1F2SE 2HWLB 1SG8B 3O8BA 1EZQA 2KM0A 3ESTA 3RC4A 6ESTA 1LPZB 1E38B 1GMCF 1SQOA 2FP7B 3MO3A 3GDVA 4Y11E 1A4WH 3CS7A 1LHEH 2HGTH 1O30A 3E6PH 5DP8A 1O3DA 1B0EA 1V2ST 5EJLA 5EU8A 2R2MB 2RFKC 4KKDA 2Q6GA 1GCTB 3FP7E 4DOQA 3SU6A 5B6OA 1XVMA 2R2WU 2LELA 1EKBB 2H9HA 1V2KT 2A31A 1W0KD 4GHTA 1KY9A 2ANKH 3M7UA 4ZHAA 1C1VH 5GCHF 2HNTC 3CS0A 1UTLM 1BTUA 3SGBE 1TIOA 1XKAC 1ZMJA 1O2IA 1GI0A 1UTPA 1FLEE 1EQ9A 1MKXH 1O2UA 2UUKB 1EP5A 1GHZA 1V2UT 2VIVA 4AOQA 4INKA 2GCTB 2SFAA 4WJG2 5J4QA 1BRBE 1PPBH 2WHXA 1DLEA 1DSTA 1KDQA 1MKXK 1V3XA 1P04A 4CBNA 2KZ4A 5DP9A 4AFSA 4P00A 2F3CE 4Y7AA 3EA9A 1DXPA 3P6ZB 2XNIA 4I8LA 1F5RA 2K8IA 2G4UA 3LGWA 3MNXA 2BD5A 2VIDA 2PR3A 3VGCC 2BOHB 1FPHH 2XBYA 2ZEBA 3MH7A 1AIXH 1EOLA 4O9VA 1TYNA 1FN8A 3QZRA 1UTQA 5CDFE 2A32A 3V7TA 1PQ5A 2XYAA 4GPGA 4P02A 3MHWU 5C1XA 4LK4A 3FO8D 1F7ZA 3OY6U 2Y5FA 1S6LA 3ODFA 7GCHF 5EXNA 4ZKRU 2QXJA 1C5YB 1HBTH 1EAUA 2ZPQA 1O2GH 1C5UA 2FDAA 1P3CA 4NIVA 3S9BA 3RDZA 2QC2A 1C4Y2 1NRNH 1KYNA 5DP4A 4JZ1A 3B8JA 1VGCB 1NM6A 3LU9B 3A85A 1ABJH 3SZEA 1EB2A 1Z8GA 1BHXB 1UO6A 1CA8B 4AC9A 1IHSH 2BZ6H 3FANA 3NZIA 1SB1H 2F9VA 3U8RH 2C8ZB 2R3YA 2G51A 4CR9A 2SGAA 2ZU1A 4AN7A 1W2KH 1EUFA 5TJXA 1P05A 2PGBB 1S82A 5HXFA 1RXPA 1GI6A 3MU0A 1C1SA 4UDWH 5EJZA 1FIWA 1OX1A 3LGTA 1A0LA 5T6GA 1YCPM 3RXQA 1SGCA 4I86A 2UUFB 2SGQE 3D23A 1ABIH 2PLXA 5EXLA 4Y0YE 1S85A 4J1YA 2NU2E 3GDSA 4XOJA 2XXLA 2ZHWH 2F83A 3ZIAD 3A8BA 1AU8A 1ETRH 2QA9E 1BTPA 1BMLA 3U1IB 4AX9H 3PMHB 3A7ZA 1MTNB 5DGJA 2RA3A 4ZMAH 1EFRD 3MMGA 1TNKA 2A4QA 5FAHA 1N8OC 5C1UA 4GCHG 1OSSA 3A87A 3NCLA 1QJ7B 3STIA 4D9RA 2XRCA 4FXGH 4Q80A 4U32A 8GCHG 3T28A 4CHAC 3TGKE 4I33A 2VVCA 1PPCE 2EA3A 3RXCA 2CJIA 1SMFE 2VH6A 2ANWA 3H09A 2P16A 3N99A 3NUMA 1A3BH 2BLQA 1C2JA 1PQ7A 3UR9A 2ZGBH 3ITIA 4LZ4B 1TNGA 3EQ0H 4RT0A 2PHBA 3KIDU 1FNIA 3MH5A 1EPTC 3MNBA 2OQUA 2EI7A 1QJ6B 2HNTF 5FCRA 3MWIU 5F8TA 1KXCA 2ZDAH 1YLDA 4X6NA 3TLOA 1C2DA 4HZHA 2P95A 2BOKA 2EC9H 4AFQA 3PTBA 1NFXA 3GY2A 1KDQB 3LC5A 2P8OC 3KGPA 1ARBA 4UFFH 9ESTA 1GJ9B 2FOEA 3P95A 3SHAH 1K28D 1P01A 3EA7A 1SPJA 1AGJA 1GGDC 1BDAA 1G3CA 3GCNA 1BRCE 3UWIA 6GCHF 1O5GH 3FFGA 1IQLA 1YWUA 3MO9A 4RSPA 1MBQA 5DP5A 1SVPA 1BRAA 3BEFB 3LKWA 2W7SA 2HVXA 1LVOA 2JH5D 5FBIA 5C3NA 4K3JA 1EASA 2XC0A 1MTVA 4DIHH 1XKBC 2OBOA 3F9FA 3VXEH 1GBIA 4O3UA 1RTFB 5AHGH 5C0UA 3NXPA 2ZU4A 3SU4A 1IAUA 5EPYA 1V2VT 2C8XB 1C5RA 4HGCA 5EOKA 3RXTA 3SUDA 1HAXB 2A5AA 4I8HA 2PKSC 2FS9A 2KFWA 4ZKNU 2GGVB 4ABIA 4AGKA 2ZDLA 3P8GA 1FXYA 3RXLA 2Z9LA 1TPSA 3HGPA 1IHTH 1RS0A 1YPLH 1YP9A 4IMZA 1ZTLA 1HAOH 7KMEH 4TPIZ 2ZTXA 4FUBA 2J9NA 5DKMA 3UQOA 2ZTYA 1J17T 2VIQA 3DUXH 1G36A 7GCHG 3QO6A 1WAYB 3T25A 1S83A 3RU4T 1TBZH 2R3UA 2IPHA 5C5NA 3OX7U 1ZLRA 5E2OA 5C17A 1YY3A 1GDNA 1QL8A 1C5VA 2I6SA 1ELCA 4AFUA 2V0BA 1C5OH 1P2NA 2PUQH 3GCHC 4K60A 1NRSH 1C5QA 1C9TA 1GBCA 2WYJA 4ESTE 3W1EA 2SGPE 2GT8A 2O8UA 1A61H 2WPLS 1TPAE 4E05H 1AUJA 5FXLA 3E0PB 2W26A 3FVFB 1NRRH 3MO6A 2P3TB 4GSOA 1YPEH 3PLBA 1DS2E 4MG3A 1QBNA 2XBVA 2FLRH 3LT3A 3PB1E 2Y5HA 3BTEE 3AVZA 1ELTA 3GYMA 3KF2A 3EYDA 4NIXA 3A8CA 2ZHFH 3A7WA 1O2OA 1D3TB 4YOIA 1GJDB 2EQNA 1H8IH 1RIWB 2H9TH 2O8WA 2R9PA 1LHFH 3BEUA 2GCHG 1HCGA 3BTQE 3RXUA 3PO1B 1O37A 1GHAF 1K2I1 3BTWE 1TGTA 3QX5H 1DXWA 2A0QB 3M7QA 1HJAB 1SOZA 4NA7A 1EATA 4YESB 2ZPRA 1GL0E 8LPRA 1FY5A 5LPEA 1O2SA 2ZF0H 2Z6BD 1HIAA 1W10U 1SLXB 3SGAE 2TGAA 1HAPH 1ESAA 3STJA 1VCPA 3LPRA 3UUZA 2AFQB 4YM9A 3W94A 1DUAA 1O3OA 1VJAU 3M3SA 1T8MA 1JOUB 2G00A 3P17H 5K7RA 5TCAA 1O2MA 1WBGB 1HLTH 2IN2A 1D3DB 2Y7XA 3RLYH 2JETB 1ELEE 3D62A 1SQTA 4B6FA 2GMTC 1P3EA 1NBMD 1TAWA 2BDGA 4WH8A 2Q1JA 2A7HA 1WYKA 1NROH 3HATH 1QY6A 1IQIA 1LQDB 2C8WB 4QT8C 3K6ZA 1GBDA 1ZJKA 1TPPA 2OC7A 2KCOA 4VGCB 4NGAH 1THPB 5BRRE 5DP7A 5SGAE 1MZAA 1NFWA 1C1TA 1P02A 1GBJA 4ABDA 4B74A 3ZZDA 1K1OA 1MUEB 3AAVA 4AG1A 5A0BA 1THRH 1WUNH 2OTVA 1LHCH 1UK4A 2OCVB 5G4BA 2CMYA 3NKKA 2C3SA 3SU2A 1AN1E 1O5CB 1CVWH 4NA9H 5EG4A 1CE5A 4B2AA 4YO9A 4JMYA 3C1KA 2PP6A 4X1PU 1UCYH 4UONA 2IOTA 2BB4A 1ACBE 3W95A 5HIYA 1FAKH 2ASUB 1BZXE 1ELAA 4NG9H 2TBSA 3HKIB 5EGMA 2BVSH 2M2AA 2Z3EA 4RN6A 4FVBA 3PRBA 5DP6A 1V2LT 2A2XH 2WSSD 3RC5A 2FMJA 1UCYK 4AYVB 3QTOH 1TALA 1YCPH 2FOFA 1G2MA 1CSOE 1JBUH 3MH6A 2YNAA 3NK8A 1EP6A 1C1NA 1W12U 2FOBA 3BIVH 1BCUH 2BY9X 1GWAA 1KTSB 3BN9A 3A80A 4U01A 1QR3E 3QN7A 1FY3A 1YCPK 1Z8RA 2JH6D 2F9NA 3VPKA 1AKSA 1UK3A 1HAYB 1GI1A 1J8AA 1O3JA 4NZQA 2DUCA 2G8TA 2WV4A 2EY4C 3SU1A 2TPIZ 3SNAA 1ZPCA 3AW1A 4A5TS 2UWOA 3VXFH 1LPGB 1XUFA 1SGDE 2Z9IA 2ANMH 5A09A 4D7GA 2OC1A 4ISHH 3GDUA 2BVXH 1BA8B 1NS3A 1TMBH 2VGCB 2ZI2H 4K8BA 3BTKE 1V2TT 3MU4A 4R0IA 4FUCA 4BAQB 1QURH 5K0HA 3GY6A 1XXFA 5ESBA 3K2UA 3TVJB 2XNDD 5B6LA 1LVBA 2HALA 1BJUA 1GI3A 3V0XA 2ZU3A 2ZGCA 3WWFA 4LXBH 2XWAA 2FTLE 2HPPH 3UTUH 1HIAB 1TLDA 2A5IA 1EOJA 3TH4H 5JBTA 2HOBA 1SGFA 4OGXA 2QXHA 1UTMA 2ULLA 4TY6A 3O8DA 1O2JA 2HPQH 1SQRA 1Y8TA 5A8XA 5DO4H 3O8CA 2AMQA 1N1LA 2Q6DA 3M61U 2AMDA 4Z0KA 2F43B 3LC3A 2WINI 4DGJA 3BV9B 1GHYH 3RXDA 3IG6B 1AZ8A 3O8RA 1O32A 1G37A 1C9PA 1GJAB 5HM2A 2BY6X 3GY8A 3RMOH 2G55A 3SV2H 4DY7B 3G01A 5JB9S 4A6LA 1IQMA 2GJGA 1GJ8B 3TITA 1DVAH 1FQ3A 1BIOA 1NO9H 1HXEH 4Z6AH 1W0ZU 2BDBA 5EPNA 5ESTE 1V6DA 2GVFA 3U28C 3BG4B 1HXFH 2GT7A 4MPUA 1O3IA 1VITH 5E8EH 1UVTH 4WXIA 4LOYH 1C1PA 1O3FA 2B0FA 3QZQA 1G3DA 5HM9A 5LGOA 1IQKA 6CHAB 2JJ1D 2FOGA 3MYWA 2VWOA 1O3EA 3SI4H 5DG6A 1AE8H 1UTKA 2AHME 5J4SA 1C5XB 3F2HA 1C5SA 1CBWB 1ZZZA 5LPRA 1D3PB 4FUJA 5A8ZA 4Y10E 3URCA 1W13U 2PTNA 1ANEA 3S0NA 2FOMB 1IQJA 1H9HE 4CR5A 3K6YA 3SNCA 2SGEE 3MFJA 1UJ1A 2Q6FA 3TNTA 2ESTE 5GDSH 1GJ7B 3GICB 4H4FA 2J98A 4XSKU 3SBKA 1G3EA 3A84A 4ZROA 3PMBB 2BZAA 1V2NT 2BXTH 3DHKH 1C1UH 1KTTB 4SGBE 4WY3A 1S0RA 4RKJB 2ZU5A 1EB1H 1HAVA 3U69H 3N7OA 3ZZCA 2Z7FE 1VITF 2W6ID 3SJOA 2F9UA 3RXJA 2O8LA 5DN6D 3UWJH 1HUTH 1AKSB 1U6QA 1ZSJA 1GI9B 1WXRA 3GOVB 1K1PA 2QF5A 3RXRA 2BD9A 1LMWB 1A5GH 1YPGH 1EJNA 1BTHH 3F68H 3BSQA 3LIWA 1A46H 2D26C 3Q76A 4D9QA 1PPGE 1O2XA 1FONA 1MD8A 1TRYA 2GZ9A 1L4ZA 4KP0A 5HGGA 1PQAA 4ZHMU 4ZH8A 2FESH 1ESTA 3Q3KA 1YLNA 1PPZA 1P12E 1TOCB 1RRKA 1WCZA 1TMUH 4U30A 2OXSA 5JBAS 3ZV9A 2BVRH 1RGQA 4X1SU 1ZPZA 3ZZ3A 1YPKH 1FY4A 4BAMB 3U9AH 1F5KU 5JB8S 2QF0A 1PYTD 4CREA 1YC0A 1C4U2 3KN2A 1P03A 2WPMS 1O2TA 3AASA 3ATKA 3P8NA 2KCPA 2OINA 2CHAB 2FOAA 1TGSZ 2PSYA 5ABWA 1W8BH 3AW0A 1GMHF 2Y81A 3P8FA 1ZMNA 1AUTC 2ODQA 1MTSA 4OS2A 2FYQA 4TY7A 2LNCA 5E0GA 1T4VH 1S6HA 3GS9A 2WPHS 5EQSA 3RXOA 4FUFA 3RMMH 2WUCA 1L1GA 1SGRE 3PYHA 3VB6A 3RM0H 1C2KA 1Y5BT 2PGQB 3IITA 4XDEA 1GG6C 4YT7H 2JIZD 1E36B 1ARCA 1HGTH 2BQWB 5I25A 1O35A 1MBMA 1PFXC 3RUOA 2IJOB 1C1OA 1O2NA 2JKHA 1L4DA 1OWHA 2GDDA 4XD7D 3HGNA 1M9UA 1J16A 1XUIA 1ANDA 2QXGA 1C1QA 2BDYA 4NFFA 1YLCA 1HRTH 3BIUH 3GY4A 1GJCB 1H9IE 1TE0A 5FX5A 1O2VA 4NWKA 3K65B 3PMAB 3MNCA 4ACAA 3OYPA 3TJVA 4JZDH 1CO7E 2FIRH 2PV9B 1YGCH 3BTHE 1V2RT 1C2MA 2SGDE 1AB9C 5JDUB 1OYTH 1OP2A 1BJVA 1NRQH 4JK5A 3SUFA 4A7IB 1PYTC 2G5VA 4AGJA 1THSH 1NU9A 2FI5E 3UB0A 3VFEA 4AZ2B 2J98B 3F9HA 1GJ6A 2BX3A 1BTWA 1Y5UT 3KYFA 3E3TA 4B75A 5H4IB 1OKXA 2QY0B 4ABJA 1ID5H 1XUJA 3UFAA 3UQVA 1BTYA 1DICA 2AIPA 1QHRB 1HAVB 1XVOA 5T1VA 3V3MA 3SU0A 1T31A 7ESTE 3UR6A 1GBAA 1EPTA 1E34B 5IK2D 5AF9H 1UCYE 5F8XA 1KXFA 4AG2A 4MPXA 2A7JA 3UOUA 1TWXB 1L2EA 4OM9A 1MKWH 1ZPBA 4X1NU 3TK6A 1E79D 2ZECA 4ABFA 1FAXA 2QYIA 1Y3VA
chains in the Genus database with same CATH topology
3H7OA 2P3FH 4U2WA 3U1JB 3ATMA 1GL1A 2M5TA 2ODPA 2FI4E 3HPTB 1LVMA 4BXSA 1E37B 1GMDF 1DY9A 3P92A 3SI3H 3VGCB 1YF4A 2P93A 2JH0D 3ELAH 1LHDH 3E1XB 1DLKB 4K8YA 1BHXF 1VCQA 1C2GA 2PFEA 1G30B 3SHCH 2Z94A 1GMCG 4ABBA 1O2QA 3RXEA 1T4UH 1L1JA 3P70B 3E90B 3URDA 4ISNA 4KELA 4Y8XA 1LHGH 5A0AE 3RMLH 3MU1A 1SC8U 4NIWA 3RMNH 3A7VA 3TGIE 3Q3YA 4YOGA 1W7GH 2Y7ZA 1NN6A 5GCHG 4WH6A 2FPZA 1TQ7B 1UK2A 1KXAA 2QAAA 1YM0A 3A82A 4R8TB 1SGEE 1WQSA 1GHBF 4ZXXH 1DUEA 2Z9KA 1EAXA 2TRMA 2XBXA 3S69A 1BUIA 5JBBS 3A89A 1RIWC 1EAIA 1JMOH 1O31A 4THNH 5C67A 2VWMA 5TCCA 3ZYDA 1NESE 3PTNA 1H8DH 1ETTH 3VB4A 1JRTA 4I7YH 1TX7A 4GVUA 3BEIB 2ALVA 1ANCA 1GI2A 3M3VA 4D7FA 1O33A 5GIBA 3RXPA 1O38A 2H5CA 2QXIA 3VB7A 3UIRA 1XX9A 2A4GA 4FU8A 4ABEA 4XBCA 1KXEA 2STAE 2VH0A 2DE9A 2BDHA 1MAYA 2G52A 1Q31A 4INHA 1C5MD 5T6DA 4FUHA 1N8OB 1P2KA 2NWNA 4BOHA 3M5NA 3V12A 1FUJA 1IOEA 1GBFA 1KSNA 2BXUH 4E7NA 2BQ7B 2BLOA 1EX3A 1QQ4A 4CHAB 2F91A 1TPOA 1AWHB 2JETC 3RXKA 1SGFG 3T29A 3ZV8A 5JPMH 3MI4A 2B8OH 4UE7H 1CHOF 4DURA 4K2YA 1K9OE 2VB0A 4ZKOU 4A1XA 3ATWA 1E35B 1AFQC 4UFDH 2AH4X 3B9FH 4ZXYH 2ZIQH 1J15A 3DD2H 5EODA 1B0FA 1DSUA 1P9SA 1ELGA 1SGPE 1BBRH 3C27B 3LH3A 4H42U 1MQ5A 5BPEA 5C1YA 1E0FD 2P8OB 3BTFE 1UTNA 1Z6EA 2STBE 3FP6E 1WQVH 1V2PT 3SJIA 1SSXA 1PJPA 5AFYH 4ZKSU 1BBRK 1GGDB 4NIYA 3KQBA 5GJ4B 1AI8H 2ILNA 2D1JA 5F6MA 1F0UA 2QCYA 4O3TA 2Z9GA 5EXMA 4F4OC 2FM2A 1BRUP 1ZYOA 1XM1A 3PMJA 4O03A 4ISIH 5CHAB 3TJOA 4WMDA 2D2DA 1AQ7A 3LDXH 4IS5A 1B7XB 1TNIA 2QV1A 5FPSA 1DE7H 2TGPZ 2CF8H 1QB6A 1LVYA 1AVXA 2ZP0H 1JWTA 1ZSLA 3BG8A 1W11U 1GBBA 1MU8B 3BTDE 1BMMH 3GCTF 2RG3A 2ZHDA 2G4TA 2YOLA 1UVPA 3OTJE 1W3CA 2XC4A 1KXDA 2BD8A 1A2CH 2BDAA 3LGVA 1S5SA 1GBTA 1V2WT 4X0WU 1IQNA 4JYTA 2J34A 3SOSA 3M5MA 1O3NA 3M3TA 3UNQA 3U98H 3E16B 3UOPA 1IQEA 2BY8X 1FPCH 2VWNA 4RKOB 2O8TA 2FO9A 2SNVA 4GLYA 5AVDA 5HYOA 6GCHG 3ZVCA 3F9EA 2ZCLP 2OC8A 2GTBA 1FMGA 1BOQA 1UVUH 1T8OA 1SFQB 4DG4A 2BY5X 2GV6A 1G32B 2BD7A 4I31A 3SJ8A 4I8KA 2WUBA 2AGIX 1VCWA 3KQDA 1BTZA 1KLTA 2UUYA 4JZFH 1C5NH 1UMAH 4Y0ZE 3TK9A 4DCDA 3T26A 1HAHH 3E8LA 3ZVEA 3ZVAA 1Y3XA 4B2CA 1HYLA 3L33A 4CH2B 1GJ5H 2QIQA 1OWKA 1MZDA 1PPFE 1H4WA 2Z3DA 3SV9A 1AWFH 4E7RG 1O3BA 4A92A 2BX4A 2HRVA 2H6MA 3GY5A 1SHHB 1QCPA 2G5NA 2H5DA 3FP8E 2WPKS 1CQQA 1KLJH 3GCOA 4M7GA 2SGFE 2P59A 1QJ1B 4IC6A 4Q7YA 4IN1A 3RXFA 2EEKA 4J2YB 1X7AC 2KAIA 1D6RA 1HFDA 2AGGX 3JZ2B 2AERH 4X6OA 1ELVA 2FOHA 1S81A 1RTKA 2A2QH 2P3UB 1C5TA 1CHOG 2GMTB 1O2RA 3M35A 3PLPA 1YPHE 1GBEA 1F92A 1J14A 1O2HA 2YNBA 1AY6H 2VVUA 4A1TA 1CT4E 8KME2 2FZZA 2ZFQH 4JYUH 2QGRA 1ZRKA 1O36A 4UEHH 5C2ZA 4WMFA 4D76A 5PTPA 1YPMH 1Q2WA 1MTWA 2BYAX 3TK5A 2B9LA 4MVNA 4Y8YA 3RC6A 5A8YA 4ABGA 1C1RA 3DT0H 2J38A 2Z3CA 4X2XA 4BXWA 3S9CA 4BTTB 4YZUA 1GHAG 2GKVE 3T27A 4CH8B 2W3KA 1K1JA 4WWYA 5E2PA 4XBBA 1S84A 1O34A 2BDIA 3KHVA 5F8ZA 1GHXH 1O2KA 1DWEH 1RJXB 2B7DH 3L6PA 1DY8A 2A7CA 2WPJS 3BTGE 4X6MA 1WOFA 1FI8A 1BITA 2V35A 2Y80A 2BY7X 3UNRA 2O8MA 2RA0A 1V2MT 4HI3A 1GCTC 2XWBI 2AS9A 4MLFB 3SJKA 3OU0A 2PWXA 1NZQH 1C2FA 5C20A 1OP0A 3DFLA 3TJUA 1ELDE 1ZJDA 3UY9A 1WV7H 2NU0E 2G81E 1CT2E 1QRXA 3LGYA 1ZGVA 1LQEA 1S6FA 4MNYA 3MNSA 4UFGH 1Z6JH 1AO5A 1AZZA 3LH1A 1DFPA 1ZMLA 1FZZA 1AVWA 3QGNB 4OS1A 5C5OA 3QUMP 1Y5AT 1BMNH 1TONA 3CENA 3I78A 2VVVA 3UNSA 2GCTC 2CXVA 3HK6B 3VB5A 1T32A 5FHTA 4TWWA 4BAHB 1ELFA 2XCFA 5L2ZH 2A45B 2BHGA 2ZFRH 2FOCA 1Y3YA 1P2IA 2ZWLH 2A4RA 1FDPA 4ISOA 5CMXH 1NFYA 1A5HA 1P11E 4B73A 1EZUC 1HAZB 1W7XH 4FUDA 1UHBA 2XBWA 1CA0B 3FZDA 4TYDA 1GDQA 2F9PA 4I8GA 3B23B 1H9LB 3RXMA 3RP2A 5A0CA 1W14U 1RFNA 4B71A 3SV6A 1FV9A 1ZHPA 2ZDNA 3RXGA 3LGIA 1O2WA 2ZG0H 2ZFTA 3FAOA 1SFIA 1T7CA 3VEQB 1TA6A 4YTAA 1P9UA 3DFJA 1EAWA 1KLIH 4FU7A 4BANB 1VGCC 4Y79A 1DPOA 3UPEA 3ENSB 1D3QB 1SLWB 3EAJA 4TPYA 1CT0E 4K1SA 2C93B 4AB9A 2Z9JA 1Z71A 1ELBA 1NTPA 4WXVA 1SI5H 2VJ1A 1O3GA 1YPHC 4MQAA 1Q3XA 3A8AA 1AHTH 1D9IA 1SGYE 1G2LA 1B5GH 1BBRE 1SL3A 5AFZH 1P2JA 3PM3A 1C4V2 5EW1H 1TOMH 1NU7B 1CHGA 2AIQA 4UD9H 3IWMA 4X8UH 3ZZ5A 1DT2A 4AB8A 4Y6DA 5E0HA 1W0YH 2ZU2A 3FZZA 2BD3A 4XE4A 1C2LA 3EGKH 2ZO3H 1OWEA 3ZZ4A 1QA0A 2TGDA 4JZIA 1V2JT 1GHWH 4MDSA 1LDTT 1A0HB 2ZNKH 4JK6A 1C2EA 4BAKB 2F9OA 1MTNC 4CBOA 2PUXB 1K22H 3M5LA 1DITH 3CP7A 1O5AB 2W5EA 3TJNA 2ZGHA 1MMJN 2ODYB 4TWYA 1C5PA 4ISLA 4X1RU 2A4OA 2BTCE 4X8VH 3A7TA 1MH0A 1K1IA 4OGYA 4IBLH 5FPTA 2GZ8A 1CGJE 1JIRA 1GI4A 1O0DH 4K1EA 4ZHLU 1Z1IA 3D65E 1F0TA 1LCYA 3TU7H 3S7HB 4GHQA 3LJOA 1QBVH 4WVPE 3SU5A 1YKTA 2LPRA 2GZ7A 1SOTA 1VJ9U 3A8DA 1DX5M 3A7YA 3KL6A 2FODA 3MTYA 4CRCA 3GYLB 1BQYA 1Z8JB 2D8WA 2I6QA 3I29A 1GDUA 3P8OA 3RXBA 4I32A 2A1DB 2WV5A 3ZZAA 1P10A 1XUKA 3MH4A 1TGCA 3NPSA 4KTUA 5DP3A 3SV7A 4JZEH 3ZYEA 1O3CA 3AAUA 3F9GA 4MTBA 1UHBB 2ZGJA 3ATLA 1RTLA 2BQ6B 2NU4E 1LKAA 2GD4B 2BD2A 4NZLA 1FIZA 1QA7A 1O3KA 3ZVDA 2GX4A 2QN5T 3A86A 2C8YB 1O2YA 1FY8E 3PWBA 3RXVA 2GCHF 1HAIH 2ZTZA 3DA9B 1NC6A 1C5LH 1MKWK 2OLGA 1ZRBA 1SR5C 1VITG 3A88A 1GBLA 4BTIB 3SJ9A 1GI7B 3I77A 2J92A 1ANBA 1L1NA 1OWIA 3F1SB 3PV4A 3SUGA 4ZUHA 5CE1A 1P2QA 1GG6B 1OXGA 2Y5GA 4AYYB 5L2YH 4XBDA 1V2QT 3KEEA 4Y76A 2GV7A 4KTCA 2P94A 4DW2U 2NU1E 3SNBA 2Y6TA 4D8NA 1V2OT 1ZHRA 3BF6H 3JZ1B 5HMAA 2FLBH 1SBWA 2BDCA 2ZC9H 3F6UH 1UVOA 2AEIH 2FTMA 2CGAA 4O97A 1QL9A 1H1BA 3E0NB 4B76A 1XUGA 5A2MH 2XTTB 1O5DH 1QRWA 3GY3A 1JRSA 3KQEA 1NRPH 4NCYA 2OBQA 4BTUB 4BAOB 4X2YA 2ZHQH 2GDEH 1TB6H 3RXHA 1AB9B 5ETXA 4DT7B 2ZDMA 3R0FA 4CRFA 1UVSH 2ZQ1A 1DOJA 1GCDA 2VINA 5JBCS 2ZFPH 3SNEA 1T8LA 2OD3B 4ABHA 2FYRA 1QTFA 3OY5U 1GMHG 1HNEE 4X2VA 2V3HH 1DM4B 5LPFA 1SGTA 4MPVA 2ANYA 5L6NH 1C5WB 1TGBA 7LPRA 4LZ1H 1HPGA 3SN8A 5DJ7A 1PPHE 3QDZB 1HB0B 3PO1C 3PROA 1XMNB 1WSSH 1O5EH 2J94A 1ORFA 1EZXC 1TABE 4ZAEA 1C2HA 4X1QU 1GPZA 2ZGXH 4Q7ZA 3RM2H 2ZFFH 1MQ6A 1TX8A 5EQQA 1HJAC 3SV8A 2PKAA 4KTSA 5JYIA 1TFXA 2BLWA 1MCVA 1P2OA 1K1NA 3TPIZ 1ETSH 1A0JA 1JXPA 4OS4A 5CHAC 5IDKA 8ESTE 3K9XB 5T3HA 3SUEA 4MNXA 3U8TH 3SQEE 2TIOA 3U8OH 1P2MA 3KCGH 2VIPA 1EJAA 3M7TA 1GVKB 3BTME 4XFQA 1ZTKA 5EW2H 3A7XA 1LKBA 4BNRA 3SO3A 1OYQA 2ZDKA 4YLUA 1O2ZA 1Y3WA 1OPHB 2ZDVH 4NWLA 1TBQH 3NWUA 3A83A 1EPTB 1TQ0B 2BD4A 2OUAA 2R0LA 1OOKB 1C1WH 1QGFA 1SGIB 1Z8IB 3QWCH 3HK3B 4Q2KA 4Y7BA 3ZVGA 1CGIE 1TNHA 4VGCC 1L0ZA 3RXSA 1SGNE 3TNSA 3H7TA 3QLPH 3PWCA 1OWJA 4CRGA 5GXPA 1ZOMA 3GISB 4X8SH 4JCNA 3MU5A 3TIUA 3V13A 4Q7XA 9LPRA 1P57B 5FPYA 3KNXA 1GVLA 1O3LA 1C1MA 1D4PB 3EDXB 5L30H 1DWBH 4F49A 1MU6B 1F0RA 1XUHA 3QTVH 4X8TH 1PPEE 1YPJH 4PROA 5IYTA 1A5IA 3L3TA 2R0KA 2ZKSA 1C5ZB 1BT7A 1SHYA 1QL7A 3ZZ9A 2H2ZA 4H6TA 5FCKA 3ZZ8A 2AMPA 2BM2A 3QGJA 3ZVFA 2V6NA 3QK1A 2H1UA 4IW4E 3SQHE 1ZR0A 4FU9A 2PKSB 1GMDG 4K69A 3EA8A 1ZSKA 1WTGH 1G3BA 1AVGH 3WY8A 2K1QA 2FS8A 4OS6A 2BMGB 4Y8ZA 1SGQE 2ZCHP 1GJBB 3T2NA 1IQGA 1BMAA 4IGDA 1DWCH 2OQ5A 2O9QA 4YT6H 4K1TA 4KGAA 1AD8H 1VR1H 2ZPSA 3ATIA 4SGAE 2W7UA 4IMQA 4CRBA 5GWZA 2UWPA 5E0JA 2ZFSA 1EXFA 3GCHB 4NSYA 1ZHMA 2QF3A 2VGCC 4B1TA 3RU4E 3M5OA 5GPIB 1MTUA 1OP8A 3ZZBA 1F5LA 3D49H 2HLCA 3RXAA 1K1LA 4DIIH 1SLVB 2VIWA 3MU8A 2ZHEH 1HDTH 4YLQH 1QIXB 1AFQB 2CV3A 2PKAB 1AMHA 1QNJA 1PQ8A 2THFB 4B2BA 1KIGH 1GHBG 3SGQE 4E06H 1ZTJA 3H5CB 4X2WA 3SU3A 1Z7KA 3KQCA 1CU1A 1DDJA 4JYVH 1P8VC 1J9CH 2UUJB 2PW8H 3A81A 1YBWA 1EZSC 4HFPB 2FXRA 4ABAA 1RD3B 1OWDA 1IQHA 4NFEA 1EJMA 1K1MA 3S9AA 1FY1A 2AYWA 1GI5A 2GP9B 3Q00A 1BTXA 5DK1A 1ZGIA 3T5FH 1D6WA 4OS7A 3ZZ7A 1MAXA 1N6YA 5LH8A 1P09A 1TNJA 4NSVA 1SLUB 4MPWA 4ASHA 2F9BH 1QQUA 3M37A 1HV7A 3RXIA 4WF8A 1TGNA 2FI3E 1GVZA 2FEQH 1MD7A 3BG4C 1UTOA 2H9EH 1P06A 3ZZ6A 6CHAC 1DANH 2C90B 1HAGE 1HJ9A 3RU4D 4NA8A 1T8NA 4INLA 2WYGA 2Y82A 3T62A 4WMEA 1A7SA 1OS8A 4MNVA 2FX6A 2RDLA 1BB0B 3LOXA 1YYY1 1CBWC 4A1VA 4FVDA 1AFEH 4FUGA 4OS5A 3GY7A 2CF9H 2XCNA 3SORA 4H6SB 4UFEH 3M36A 4K5ZA 5FBEA 5F03A 1MCTA 1QB1A 1O2LA 1O5FH 2XC5A 4Y71A 5I46H 4IC5A 1Y3UA 1NFUA 3R3GB 2HNTE 1SQAA 1NT1A 1TMTH 1N6XA 2DE8A 1TRMA 2ZCKP 4CRAA 1AE5A 1GI8B 1GJ4H 2EI6A 2OP9A 1CA0C 5T6FA 3Q77A 1GBHA 2V3OH 5EQRA 2AGEX 3RLWH 1F0SA 1C2IA 4FUEA 1O5BB 4I8JA 1KXBA 1TNLA