3K2UA

Crystal structure of hgfa in complex with the allosteric inhibitory antibody fab40
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
239
structure length
233
Chain Sequence
IIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISWGCLHKPGVYTRVANYVDWINDRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unraveling the allosteric mechanism of serine protease inhibition by an antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
molecule keywords Hepatocyte growth factor activator long chain
total genus 50
structure length 233
sequence length 239
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3k2uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3k2uA01
1LVYA 1MU8B 1EOJA 2ULLA 1QNJA 4K69A 4DURA 1JOUB 1P2IA 3GCTG 1C1RA 1XUIA 1E35B 1VJ9U 1GBJA 1O37A 3VXEH 3IG6B 2HNTE 3SUFA 2V3OH 3DFJA 3D62A 5JB9S 3U8TH 4JYVH 2I6SA 2UWPA 2H9TH 2PV9B 3QWCH 1ZYOA 1QIXB 6CHAC 5JBTA 5C5NA 1W0YH 3MO6A 2BX3A 1MKXH 2SFAA 3BTEE 4JZDH 1HV7A 3GY5A 5ABWA 1TIOA 2BVSH 1LQDB 2PUXB 1PFXC 2OC0A 4IMQA 3QZQA 4O3TA 1FJSA 1N1LA 1TX7A 5GWZA 2GT8A 5FX5A 3NXPA 1BIOA 3L3TA 1IQIA 2R3UA 4H6TA 2OCVB 4WF8A 2EI7A 1HAXB 2FTMA 1L4DA 2G4TA 3D23A 4KELA 2VIQA 2XWAA 1QA0A 1P02A 1Z8GA 1O31A 2LPRA 1C4U2 2Z6BD 2JETB 3T2NA 3ZVBA 3OY5U 1C1PA 4DG4A 9LPRA 2PKSC 3QN7A 1W13U 2BLVA 1GDQA 3T29A 3SU3A 1BTPA 1HJAC 2C4FH 2FP7B 2GP9B 4D7FA 1GI4A 1DOJA 1HXEH 1O2YA 1V3XA 1ANBA 1EPTB 1V2OT 1D4PB 4INHA 3RC4A 2QYIA 1LHGH 4TPIZ 2IJOB 1AUTC 1AKSB 1FY5A 2ZCHP 3Q3KA 2FIRH 1Z1IA 1QRWA 4B2BA 4GCHF 4UD9H 4XFQA 3ZZ9A 2QY0B 2XXLA 1FUJA 1BCUH 2ZGCA 1UTPA 1ZHPA 1O2ZA 1MTWA 3ESTA 3F68H 1C5RA 4AGKA 3C27B 3ZVEA 2SNWA 2PR3A 3M3TA 5FPYA 1UVOA 3A87A 1ZMJA 2BMGB 2HALA 2QIQA 1VITH 2Y5HA 3STJA 1C2EA 1O0DH 3A7YA 2A0QB 5FHTA 3SGQE 4O97A 1EJNA 2J4IA 3I77A 1C4Y2 1FAKH 1RXPA 1CHOG 1BRAA 3Q77A 3DT0H 1V2WT 4LOYH 3OYPA 3T26A 4VGCB 3C1KA 4YOJA 1C5SA 1ZPBA 3M7TA 4BTUB 3E8LA 3TK6A 3UR9A 1AKSA 1ZRKA 4FUIA 4F49A 1UCYE 3SORA 4M7GA 3TH4H 3UY9A 1TGCA 5E2OA 2XC0A 1NU9A 3PWCA 5T6DA 2GCHF 1GI6A 2ZEBA 3P8GA 3Q00A 5E2PA 2G55A 1HAVA 5EQRA 4I8JA 2BHGA 2FOFA 4LK4A 2VWOA 4NIVA 5K0HA 1MCVA 1SGRE 5HYOA 1EZXC 4I8LA 5F8ZA 3ZVDA 2I6QA 3SU4A 3LJJA 1YPHE 4MPVA 1HAYB 2AIQA 1NO9H 5EXLA 3TGKE 2PTNA 7KMEH 1GJ9B 2ZFSA 1CT2E 1ESTA 3K65B 3F9FA 3BN9A 3URDA 2O8LA 1AD8H 2PW8H 3SU5A 4FUBA 5FBEA 1DS2E 5K7RA 5EU8A 3PTNA 4AORA 1A4WH 1LCYA 2HNTF 1KIGH 2A5AA 2R3YA 4X1RU 4ZXYH 1FNIA 1BITA 3SU1A 1A2CH 1BTUA 4A1TA 3M5OA 1A0HB 1GDNA 2GX4A 1AWFH 1SR5C 4Y7AA 2ZQ1A 5DKMA 1A3EH 1TPOA 2SGPE 3TNSA 3RDZA 1C1OA 3UOPA 1GJ4H 1KXCA 1DT2A 1OPHB 1KTTB 3FZZA 3P17H 4TY6A 2A1DB 2XBVA 2FX4A 5EPNA 8KME2 2HOBA 4CH8B 1DLEA 3SI3H 1IQLA 5EW1H 1TA6A 4B73A 4CRCA 1BJVA 3QK1A 1P2KA 3A7VA 3PO1C 2NWNA 2BZ6H 2ZU2A 2XC5A 3ZZBA 3FZDA 3MU0A 3TITA 2ZHWH 3GY8A 4DIHH 2Y5GA 5FBIA 3KQBA 3AW1A 3GCTF 1AVGH 1ZZZA 3SZNA 1S82A 3RU4T 1IQNA 1K1MA 1ELBA 2EC9H 1FY8E 6LPRA 1Y59T 1O3OA 1DUAA 1WUNH 2CN0H 2VINA 4NFEA 1BBRE 1BMLA 2PGQB 3UIRA 4IC5A 5GJ4B 4AG1A 2Y6TA 2GZ9A 1SGEE 1GJ7B 3T5FH 4NSYA 3UOUA 2GDEH 2VIVA 1C2GA 1CT4E 5J4QA 3AW0A 3EA9A 1C1VH 5GIBA 3TH2H 1M9UA 2VH6A 1CGIE 3QGNB 2O8MA 1AFEH 2A2QH 4YOGA 1DWBH 1Y5AT 2VIWA 2VIPA 1FZZA 2JH6D 2ZU1A 5A0AE 4CRBA 5EODA 1GI9B 1O2WA 3UNSA 5HXFA 1PJPA 3P95A 1QGFA 5DP3A 1C2HA 5A8YA 4U30A 5I25A 4DGJA 1JRSA 1P09A 3BEFB 1MBMA 1TRMA 2JKHA 2ZTZA 4NA9H 5LGOA 3ZZ6A 2BD2A 2OTVA 1L1JA 1HPGA 2ZIQH 1HGTH 1ELDE 2PTCE 4U32A 1Q31A 1A0JA 2H2ZA 2OINA 3RLWH 4JK5A 4NA7A 4NFFA 3KQEA 1O2SA 1ELTA 3GISB 1PPHE 4NSVA 2O8TA 3MHWU 4B75A 5JDUB 1NFYA 2OC7A 2FLRH 1SFIA 1AO5A 2BQ7B 3E91A 3RXJA 4K60A 3RXHA 4I7YH 3S9BA 4LZ1H 4BAMB 4UONA 4YO9A 1T31A 2FI4E 3UQOA 1VITF 1B0EA 2XCNA 1G2MA 1C1SA 1NC6A 3RXOA 1PPEE 1RJXB 2A5KA 3ZV8A 1TB6H 1W0ZU 2OBOA 1BA8B 3MU5A 3TU7H 4K5ZA 1C1NA 2Y7ZA 3PM3A 2FI5E 2ZU5A 1SC8U 2FI3E 2P59A 4DCDA 3EDXB 4AGJA 1AE5A 1LVBA 1NFUA 2DE9A 3FANA 2UUFB 2BY7X 4FXGH 4ISLA 1GBHA 2Q6FA 3GY4A 5F8XA 1GBTA 3RXEA 4ABGA 1WQSA 1UHBB 3S69A 1IQKA 1JWTA 1G2LA 1TPPA 1H8IH 1KXBA 3V12A 2FM2A 2HVXA 1UK4A 1CBWC 4Q80A 1ZJKA 1H9HE 1W7XH 2Z9KA 1LHDH 1K1LA 4UDWH 3EYDA 4OGYA 1TAWA 1UK2A 4FUGA 1X7AC 1D6WA 4IGDA 2IPHA 4F4OC 4WY3A 2O8UA 1AB9C 1JIRA 1SGNE 4KTCA 3RXVA 2UUYA 4JYUH 2A7JA 1EKBB 1F7ZA 1TOCB 3HKJB 3RXTA 1Y5BT 1G9IE 1HUTH 1RFNA 1O5AB 2Z3DA 2V35A 5JBAS 1A0LA 2XC4A 1C2LA 1GI3A 2VWLA 1ABJH 2GD4B 2LNCA 2BZAA 3EE0B 2BY6X 2IN2A 1J16A 1P57B 2C8ZB 5C20A 4RKJB 4ZHMU 3T28A 4XSKU 2BQWB 3SU2A 1OWJA 1O3GA 1S0QA 1HB0B 3OTJE 8GCHG 3KF2A 4UFGH 1MH0A 1RRKA 4FUCA 3A82A 2Y81A 2ZHDA 3S0NA 1GGDB 2TPIZ 1GI0A 3BTFE 3SQEE 3SNEA 2PKAA 2WPKS 1W11U 2BDCA 2SGQE 2VVVA 2Y5FA 1NRNH 1O39A 2WPMS 1ELCA 2BY9X 1LKBA 3TJNA 3ZVAA 3A89A 3HK3B 4Y8ZA 3R3GB 5I46H 4RKOB 5C2ZA 1ZSJA 1NM6A 1TPSA 4AFSA 2G00A 4OS2A 1S6FA 1AN1E 2CXVA 1EAUA 3EAJA 1S0RA 4ISHH 1C2KA 5A0CA 1LPZB 3STIA 5JB8S 1P05A 3SNDA 1XVMA 3GCNA 1OX1A 1VGCC 1ELAA 3M36A 1C2MA 3TNTA 2A32A 1C5MD 3QUMP 1YPHC 2GMTB 2PFEA 1Z8IB 3ATLA 1ESAA 3RLYH 1OS8A 1EB1H 1O3FA 4KP0A 2BY8X 5DP7A 4Y71A 1JMOH 1C5UA 2AMDA 1Y8TA 5L2YH 1ZRBA 2FPZA 1KLTA 5FXLA 2Z94A 1HJ9A 1O3BA 1CE5A 1QL9A 2OC8A 4AOQA 1DWCH 4X6OA 5EW2H 1GPZA 1JBUH 1QB9A 3I29A 3W95A 4CRAA 1GBDA 1QURH 5PTPA 3ZVCA 2G52A 3MH7A 3GDUA 1XKAC 3A7XA 3D65E 1O2TA 1ABIH 4CRDA 1YPGH 2GKVE 1U6QA 1UTOA 1WTGH 2ZTXA 3MI4A 3ZYEA 5F03A 4IBLH 1PPZA 4KGAA 1FDPA 1ZHRA 1BTXA 1VR1H 3ZV9A 4JYTA 4Y11E 1EX3A 2XRCA 3H7OA 1FY1A 1HDTH 3ZZCA 2PSXA 4DOQA 1MD8A 1EPTC 4D9RA 2VIDA 3ENSB 3PYHA 1HJAB 4AFQA 2PSYA 4YZUA 5DK1A 1BUIA 1SG8B 2ESTE 1J14A 5E0HA 5C1XA 1AZ8A 7ESTE 2BVXH 4FU9A 7LPRA 4ZMAH 1PPGE 1NN6A 3BIUH 1TOMH 1AZZA 4BNRA 1PYTC 1E36B 2BLOA 3LONA 2QXJA 7GCHF 1O3CA 2R2WU 3MMGA 1YPJH 1L4ZA 1UTQA 2TIOA 3MFJA 1LMWB 1TRYA 3UUZA 1P11E 3R0FA 4LZ4B 3E0NB 2Y80A 4CREA 3EA8A 4ASHA 2ZGXH 1XXFA 5EXNA 3SN8A 2YOLA 2BY5X 5GCHF 1Z8RA 5E0GA 1O5FH 1UVSH 1BRUP 2OQ5A 3LU9B 2CMYA 2W3KA 1B7XB 3ATIA 1GCDA 4X2YA 1IHTH 2ODPA 2EI8A 3LH1A 2A7CA 3BTHE 3MH6A 4JZFH 3O8DA 1EP5A 3A81A 1EJMA 1F0TA 5H4IB 3SV8A 5LH8A 1ZPCA 3I78A 4K1TA 3GCHC 2BD7A 1DFPA 5T6GA 1T4UH 1WTHD 2F9VA 2AGGX 2ZNKH 1GI8B 3SI4H 2A7HA 2XNIA 1OKXA 3KL6A 1GVLA 4CRFA 3FFGA 3S7HB 2FOAA 1YPEH 2V6NA 3RXUA 1TGTA 1HRTH 1GVKB 5JBBS 2NU0E 1Z71A 1C1WH 4JK6A 5IDKA 1O2QA 3JZ2B 2M5TA 2QXGA 2BLWA 4CR5A 1MCTA 3ZZDA 3UFAA 3P70B 3UREA 4DVAU 2ANYA 3RU4D 1QBNA 1OWEA 1L1NA 2EA3A 3B23B 3OSYA 2GCTC 3VB3A 2HNTC 2GZ8A 3SHAH 1RGQA 3UPEA 3BTWE 1WU1A 4X1PU 1SL3A 1MTNB 2QGRA 2TBSA 3F1SB 1O2GH 1BMAA 3A80A 4HI3A 5TCAA 1GHZA 1SHHB 3RXLA 1TGNA 3Q76A 1J15A 3PROA 4DW2U 8GCHF 3MU8A 1GHYH 1MTVA 1DXPA 5DJ7A 1E37B 1GBMA 3JZ1B 2QA9E 3KIDU 5HMAA 1TNJA 3UNQA 5E8EH 2STBE 1EXFA 4BOHA 1MD7A 2ALPA 4X1SU 4AG2A 1ELEE 2BD4A 1C9TA 3BTKE 2ZU4A 5EXMA 3NWUA 4D8NA 1ANDA 2PLXA 4FUEA 1SGFA 2FEQH 1QB6A 1C9PA 2V3HH 4INLA 3ZZ8A 1YCPK 1GI1A 1W7GH 5C67A 4KTUA 1NS3A 1IQEA 3A8AA 2P3TB 2WPJS 1CHOF 2ALVA 1DSTA 1P10A 2XTTB 4FUFA 1FIWA 3ATKA 3U69H 2C93B 2BDBA 2J2UA 2ZHFH 1MMJN 2C8WB 3S9AA 5GDSH 4R8TB 4O9VA 2G51A 1ZPZA 1SGYE 2EEKA 1ZMLA 2DUCA 4BXSA 3K9XB 3A8DA 2DE8A 4NIWA 1HBTH 1A7SA 3MU1A 1WV7H 2ODYB 2FOGA 1ZJDA 1O3AA 2RG3A 1FLEE 1V2RT 1J17T 4YESB 1INCA 3RXSA 1BJUA 5JBCS 1PYTD 1GMDG 1EAWA 1XKBC 3DHKH 1TGSZ 4GAWA 3E0PB 2OD3B 1GJCB 3ITIA 4Q7XA 3DA9B 1UMAH 1SGQE 4OS5A 2BDAA 1GI7B 4ZHAA 3NCLA 1A5IA 1QTFA 1Y3VA 2G81E 2D1JA 3L6PA 1GCTC 5DGJA 2F91A 3P8OA 3NKKA 2FDAA 4GPGA 2O9QA 3QTOH 1DM4B 1QBVH 2KAIA 1O32A 1Y5UT 1O5BB 2ZFPH 1OYQA 3ATMA 2FX6A 3TLOA 3M35A 1MKXK 1EJAA 1W14U 2CF9H 4GSOA 1GMCG 2FYQA 3KEEA 4Z6AH 1QBOA 3SJOA 1RIWB 4GUXA 1BRBE 1UCYK 2TGPZ 4AB8A 3KCGH 2OC1A 1FAXA 2V0BA 1SQAA 3LJOA 4X8SH 5EGMA 3RMLH 1EASA 1C5OH 1UTMA 1ZGVA 4ZXXH 1LQEA 4X6PA 1BT7A 3SUGA 2ZCKP 3DFLA 4TWYA 4YT6H 3RUOA 4DJZB 1L0ZA 2A4RA 1DXWA 4I8KA 3MNCA 2OBQA 1ARCA 4KKDA 1ZSLA 4BAOB 4ESTE 2PUQH 1D3DB 1JXPA 2QV1A 3SOSA 3SU0A 2F3CE 3TH3H 1SLXB 3BEIB 1W10U 2GZ7A 5AHGH 2Z3EA 3N7OA 1V2JT 4DY7B 1J8AA 1O2NA 3GY2A 1MZAA 3RXDA 3U1IB 2H5DA 1OOKB 1EB2A 1VCWA 3VB5A 2A31A 3TPIZ 1GBLA 1QHRB 2C90B 3ODFA 5A2MH 2ZI2H 2K1QA 4B76A 3RXPA 1O3NA 1TBQH 4D9QA 7GCHG 2WYGA 3TJUA 1GCTB 2WYJA 4OGXA 4DT7B 3P6ZB 4K8YA 5TJXA 1FPHH 4OS7A 2ILNA 2HPQH 1EQ9A 1ZR0A 1P12E 1C5WB 3MNXA 4NIYA 5DP5A 4WMEA 3F9EA 1T32A 2QF0A 2P8OC 3BTQE 1KTSB 2B7DH 4TWWA 1SGIB 2Z7FE 2ANKH 3RXAA 2F9PA 4MVNA 3BTDE 5F6MA 1ELVA 2R9PA 4UEHH 1SGFG 1G3BA 1ORFA 3FP6E 1IQMA 1MU6B 2G5VA 1GHAG 1MTUA 3EQ0H 3LC5A 1AFQC 3U8RH 4UFFH 1AGJA 1W12U 1XM1A 2ZFQH 2OLGA 1C5PA 1TNIA 1KXAA 4I8HA 2BXUH 4BAHB 2D2DA 4MTBA 4ISNA 2OUAA 3B9FH 4Q7ZA 4AYYB 2BVRH 4MNVA 1OWHA 2ZDNA 2AMPA 2Z9JA 1GI2A 2FODA 3P8NA 3HGNA 1HAZB 3SV7A 2CF8H 1O5CB 2P8OB 1GBAA 3KN2A 1FN8A 4MPUA 3TK9A 2XBXA 4ZHLU 1F2SE 1SLVB 1AU8A 3U8OH 3TJVA 4A1XA 3VFEA 1FMGA 1HIAA 5JYIA 1LHCH 1CHGA 2GTBA 2Z3CA 1BDAA 5LPFA 4XBCA 3M61U 3SJ8A 1T8NA 4A5TS 3MO9A 1FY3A 4AYVB 1Z6EA 1LHFH 4NWLA 3BTTE 2B9LA 1XUHA 4AN7A 1KDQA 1IQGA 1MTNC 1GBIA 4X0WU 3SGAE 1OWDA 2CHAC 2QXHA 3UNRA 4ZAEA 1K2I1 3BG4C 2JH0D 3SHCH 4E05H 2AERH 4GHTA 2J92A 1ZHMA 1C2JA 4NGAH 1YPLH 4E7RG 1WCZA 3V0XA 1SLWB 2AFQB 2ZGHA 1MZDA 1MQ6A 1ZOMA 1DY8A 3MO3A 4Y10E 4BANB 1K1NA 3F9HA 4FU8A 2ZHQH 2NU4E 2C8XB 1TMUH 2BM2A 1Q2WA 1L2EA 4UE7H 1Y3XA 1YKTA 1HAHH 1O3MA 1RIWC 2J38A 1TPAE 2PGBB 2W7SA 1GBFA 3K6YA 1G3DA 2A5IA 2W7UA 2TRMA 3ZZ4A 3LGIA 1ESBA 1SI5H 4WWYA 4IN1A 3VEQB 2ZHEH 3KNXA 3SU6A 1WYKA 1SVPA 6ESTA 1WQVH 1AWHB 3QGJA 1YC0A 2RDLA 3E1XB 1G30B 1TONA 1AMHA 1HXFH 2P94A 1LKAA 4AFZA 1C5VA 3RC6A 4O03A 2SNVA 4Y8YA 2P3UB 3ELAH 1AIXH 3F6UH 3LT3A 5EQSA 3RMNH 1V2UT 2ZPSA 5J4SA 4CHAB 1TE0A 2CGAA 4Y0ZE 2G4UA 4WJG2 5DP8A 5LPEA 1VZQH 1GHWH 1ACBE 1KSNA 3OY6U 1AVWA 2GT7A 4AZ2B 2CJIA 2VH0A 1O2UA 1YYY1 4NIXA 1XX9A 2BD5A 5FPTA 2TGAA 3ZZ5A 1TALA 2VVUA 3GICB 2QC2A 2WV5A 5EPYA 1MKWK 3RXCA 3D49H 2VNTA 5DG6A 3U1JB 1C1MA 2HGTH 2GVFA 3QX5H 2XYAA 2XW9A 5GPIB 5LPRA 2TGTA 3GY6A 1GHVH 3S7KB 4Y8XA 2F9NA 1CQQA 2C8YB 3S9CA 4JMYA 3KQDA 1N8OC 4ZROA 1TMTH 1BRCE 2BD8A 2ZFTA 2OQUA 1TA2A 3CP7A 4YM9A 2FOHA 2ZQ2A 3GYMA 1GHBF 1N6XA 2ZTYA 1AHTH 1O2LA 1MQ5A 1FXYA 2FOCA 1W3CA 3SQHE 1C2IA 4KTSA 2J95A 1PPFE 2YNAA 5HM2A 2AIPA 4NA8A 5JPMH 3SV9A 2C3SA 1FN6A 3HK6B 5HGGA 3KHVA 4QT8C 1LPKB 1DDJA 1DITH 1SBWA 4GCHG 1FV9A 1SOTA 1DICA 4IW4E 1ID5H 1MTSA 1O2KA 4I31A 3SW2B 1BMMH 1TGBA 1KY9A 1K28D 4MG3A 4JZIA 3QTVH 1MAYA 2H1UA 3QZRA 3DD2H 3E6PH 1A61H 1RS0A 2GMTC 1AE8H 2AGIX 1UTJA 4UFEH 3HPTB 1XXDA 1GMHG 3GOVB 2UWLA 4WH8A 1GBBA 1VGCB 3RP2A 1P2JA 3IITA 1HYLA 2GCTB 4Y0YE 2GGVB 1DUEA 1P04A 5CHAB 1Q3XA 1V2KT 1TQ7B 3GCOA 3PMAB 3EGKH 5FCKA 2G8TA 3ZVFA 1DWDH 5A8ZA 4DIIH 4MNYA 2THFB 4BAKB 1O5EH 4FUDA 1D3TB 3H7TA 2AYWA 3PLPA 3BV9B 2RA3A 2XBWA 1UTKA 4Q7YA 1FY4A 1CT0E 1OXGA 2QN5T 3VB4A 1LPGB 1BTZA 2HWLB 1O2PA 4THNH 3T25A 3RMOH 3TGJE 2J34A 4ABFA 4TPYA 3QDZB 5A0BA 1GGDC 2ZG0H 4X6MA 2H9EH 3T62A 5A8XA 1GJDB 1O2OA 4XDEA 3GCHB 4ZKRU 3V13A 3QLPH 3FP8E 4FVDA 1S81A 3LIWA 1O3HA 4WVPE 4WXIA 3SJ9A 1TWXB 3HGPA 4ABBA 4J2YB 1NU7B 1P2QA 1FI8A 1AVXA 4IS5A 2VGCC 4X1QU 2AEIH 3MNBA 2ZKSA 1AUJA 1HNEE 4I8GA 4JZEH 2AS9A 4MQAA 2WV4A 1MUEB 2W3IA 4CBNA 1RTKA 1CVWH 4X1NU 1WOFA 4XOJA 4K1EA 5ESTE 1ZTLA 2PWXA 3PV4A 1F5LA 1GJ5H 2BOHB 1XVOA 3CENA 1GG6B 1TYNA 3PMJA 1FONA 4UFDH 1O3DA 2R0KA 1NRSH 4CH2B 1YGCH 1EOLA 1A3BH 1YLDA 2D8WA 4INKA 1O3EA 4X2VA 1TBZH 3NPSA 3ZZ7A 4CRGA 4H6SB 2WINI 1IQJA 3LGUA 2B0FA 2AH4X 1UCYH 1LHEH 3FAOA 4FUJA 1QJ1B 1BB0B 1Y3WA 2ZO3H 1MBQA 3K6ZA 6GCHG 1C1UH 2BB4A 1EP6A 2ZC9H 2RCEA 4I32A 1O3PB 1JIMA 1H9LB 2B8OH 3PTBA 2VGCB 2FOEA 1F0UA 2GV6A 4ISIH 1G3CA 3SO3A 2WPHS 1BZXE 2J9NA 3NZIA 1NRQH 1O33A 4WMDA 1SPJA 2ZGJA 1YF4A 3L33A 1YPMH 4MNXA 2FTLE 4YOIA 2A2XH 3P8FA 4NCYA 4Y7BA 8LPRA 2ASUB 3UWIA 1F92A 1O34A 1EATA 1WBGB 4K1SA 3SBKA 1QFKH 1K1OA 4ZUHA 5C5OA 1AQ7A 2D26C 3VGCC 3SV2H 1CA0B 1TNKA 3ODDA 1V2NT 2ZDKA 1D9IA 1A5GH 4BAQB 1IOEA 1SQTA 2B5TB 5T6FA 1YCPH 4NG9H 1P2MA 1B0FA 4OS6A 2FO9A 1HFDA 5DP9A 1UTLM 3GYLB 5E0JA 5A09A 3SNAA 1D3QB 1YBWA 3M7QA 2ZDAH 1GMHF 1VCPA 2FXRA 2P93A 4B74A 3ZVGA 5ESBA 4BTIB 1P01A 1D3PB 1ZGIA 4SGBE 5AFYH 1O3JA 9ESTA 2FOMB 1YM0A 1OP8A 4ZKOU 2NU2E 1QJ7B 3VB6A 3LGVA 1QB1A 3LKWA 3UR6A 3URCA 1GHBG 4X2WA 3VPKA 2GV7A 3EA7A 2SGFE 1PPBH 1C2FA 1T8LA 4Y76A 2Y82A 2AGEX 1CA0C 1SOZA 1K21H 2QF3A 3VGCB 3U98H 4HGCA 1P0SH 1BOQA 3TIUA 3FVFB 4B1TA 2H6MA 2ZU3A 1HAGE 2HLCA 1KLJH 1FIZA 1GMDF 1V2VT 4GHQA 3MTYA 4MDSA 4SGAE 1LDTT 1XUFA 1O2MA 3WY8A 5L6NH 3Q3YA 1LVOA 1O2HA 1KXEA 2OXSA 3MNSA 1P2NA 4R0IA 1OP0A 1N8OB 1NTPA 1ZSKA 1PQAA 4ISOA 1F5KU 3SNBA 3E90B 1H4WA 2RA0A 1O38A 3RXGA 1OSSA 3RC5A 2F9UA 3ZZ3A 4B2CA 1AB9B 1C5TA 3M5MA 1SQOA 4FVBA 2FS8A 4IN2A 2WUCA 3LH3A 3NK8A 3PMBB 4HFPB 4RSPA 1E38B 3MH4A 5DP6A 5CMXH 1QY6A 2ZZUH 4A6LA 2SGDE 1V2MT 3HKIB 1CBWB 4K3JA 1SLUB 3LC3A 1NROH 1GG6C 5HM9A 3AAVA 4A1VA 1BTHH 4Q2KA 4U01A 4X8UH 4WH6A 1G37A 2ANWA 1C1QA 3W94A 1UVTH 1YLCA 1P3EA 1GL1A 2WUBA 1SFQB 5C1YA 1LO6A 2ZCLP 4ABJA 1TNGA 1GBCA 2NU1E 4MLFB 1RTFB 2A4GA 3LOXA 3RXKA 1BTYA 2H9HA 1DY9A 1XUJA 2BQ6B 1GJBB 1BBRH 3AVZA 3RXIA 1Y3YA 1DANH 2VB0A 4ABHA 5AF9H 3G01A 1EZSC 3BTME 2BTCE 1H1BA 4FUHA 1J9CH 1QR3E 1V2ST 3A7WA 4ABAA 1L1GA 1MAXA 3OU0A 3BG8A 8ESTE 1Z6JH 1DX5M 1GJ6A 1H9IE 1BQYA 1ANCA 2ANMH 2HPPH 5CE1A 1TQ0B 1V2PT 2F9BH 1GL0E 1DWEH 1KXDA 2UUKB 1OWIA 2J94A 2P95A 1DPOA 3Q3XA 2VIOA 1K1PA 3RXBA 3PLBA 3MWIU 2ZECA 1SHYA 1ETTH 3P92A 1VITG 2P16A 1QJ6B 3M3VA 1LVMA 1TFXA 3H5CB 5CHAC 2W5EA 1HJ8A 1TLDA 4H4FA 1S84A 6GCHF 2XCFA 4JCNA 3M5LA 5FX6A 1C5ZB 3HATH 1DVAH 1GMCF 1TABE 1UJ1A 2CHAB 3ZZAA 1S6HA 3BF6H 4ZKSU 1HAOH 2SGEE 1CU1A 2F83A 3A84A 1THSH 3UQVA 1O3LA 2FS9A 1AY6H 3RXRA 3IWMA 4IC6A 4A92A 2OP9A 1B5GH 5SGAE 5EQQA 1EAIA 2ZFRH 4BTTB 3A88A 4NWKA 2Z9IA 3A86A 3B8JA 1QRXA 4D7GA 1SB1H 2ZPQA 5DP4A 5L2ZH 2BYAX 1KLIH 1EZUC 3BIVH 1BHXF 3QO6A 5ETXA 4Z0KA 1TNHA 5F8TA 4X8VH 5AFZH 2FZZA 3U9AH 4RN6A 5BPEA 3CS0A 2PHBA 4YT7H 1QL8A 1F0SA 1A5HA 1HAIH 4J1YA 1G36A 1PQ7A 1NZQH 1K9OE 3M7UA 5C1UA 1IQFA 1NRRH 1PQ8A 4XBDA 1HAVB 3M5NA 1CGJE 5FAHA 1NRPH 2ZF0H 4XBBA 4AX9H 1E34B 4GLYA 1EUFA 2HRVA 3TGIE 1T4VH 3BSQA 1GBKA 4JZ1A 1NPMA 3ZYDA 1UTNA 1SSXA 3TK5A 1O36A 2PKSB 4ABEA 1P8VC 1DLKB 2QAAA 1C1TA 1O5GH 1O2JA 2JETC 1RTLA 1A46H 4U2WA 1UVPA 1TX6A 4CR9A 1IAUA 3M37A 3PMHB 2BOKA 5EOKA 3RXMA 4GVUA 1XUGA 3GDVA 1ZTJA 4Y79A 1IQHA 3PO1B 1O2IA 1IHSH 2SGAA 1W8BH 3A85A 5C3NA 1PPCE 1UK3A 2XBYA 1P3CA 1V2QT 1P2OA 1ELGA 4XE4A 1WAYB 3BEUA 1HLTH 3DUXH 2ZDMA 1P9UA 1DSUA 1KYNA 1BTWA 4Y6DA 4CHAC 2BD9A 1S85A 1VCQA 3A7ZA 3LGWA 1EZQA 1C5XB 1SGDE 3GDSA 3LDXH 2PKAB 2H5CA 1UVUH 4X8TH 1HCGA 1QCPA 2UWOA 1GJAB 1K1IA 4B2AA 3GY3A 2QXIA 1YP9A 1SGCA 1T8MA 1V2LT 4I33A 1NFXA 2ZDLA 3PLKA 1KDQB 3ATWA 1EPTA 3RXFA 3RXQA 3A8BA 3PWBA 4YLQH 3O8BA 5FCRA 1O3KA 2Q1JA 1AI8H 3E3TA 3A7TA 1GHXH 3SNCA 2ZFFH 1CGHA 4AFUA 5BRRE 1JRTA 2AMQA 3CS7A 1FQ3A 4OS4A 2ODQA 2FMJA 3K2UA 3UWJH 3FP7E 1BMNH 4K8BA 1GVZA 3RU4E 4E06H 1P06A 2ZDVH 2VWMA 4OS1A 1A1RA 4HTCH 1ZLRA 3SJKA 1OWKA 3AAUA 3RMMH 1OYTH 1S5SA 1Y3UA 3KQCA 3VXFH 1THRH 1UO6A 5L30H 2BDGA 1ZTKA 4NZQA 2W26A 1OP2A 2FOBA 1TBRH 1UHBA 1D6RA 4HZHA 2ZPRA 1EAXA 4X6NA 2FWWA 1C5NH 3MOCA 4MPWA 4WXVA 1O3IA 1C5QA 1CSOE 1GHAF 3O8CA 3BG4B 2BDIA 4X2XA 1QQUA 1TRNA 1TMBH 4YLUA 2A45B 2STAE 4VGCC 1O35A 1TX8A 3MU4A 3LPRA 2FLBH 2ZWLH 1MKWH 3VB7A 4PROA 1K22H 3SUEA 4TY7A 2Q6GA 3OX7U 2Z9LA 4CBOA 3A8CA 2EI6A 1BBRK 4FU7A 1RD3B 1T8OA 1WSSH 3RM2H 2O8WA 2BLQA 1XMNB 2GCHG 2BX4A 2KAIB 1O2RA 2QCYA 2ZGBH 3TJOA 1PQ5A 4WMFA 5IYTA 5T3HA 3F9GA 5FPSA 3UTUH 1E0FD 2IOTA 1Z8JB 1HIAB 2VU8E 1SGPE 5GXPA 1F0RA 2WPIS 4IMZA 4ABDA 1NFWA 1V6DA 1P9SA 1LTOA 2GDDA 2R0LA 2Y7XA 2TGDA 1CA8B 1C5LH 4ABIA 4E7NA 3E16B 3KGPA 2UUJB 4D76A 1NY22 1C4V2 2BXTH 1GDUA 4BXWA 2FYRA 3BTGE 1C5YB 3MYWA 2NU3E 1V2TT 1ELFA 2BD3A 4A7IB 3MH5A 1GJ8B 2JH5D 2YNBA 3M3SA 1K1JA 1TNLA 1AFQB 2FESH 1THPB 1XUKA 3TVJB 2A4OA 1HAPH 2CV3A 1SMFE 2G5NA 4AB9A 1ANEA 4B71A 4K2YA 1ETRH 1FPCH 3O8RA 5TCCA 3LGYA 2VWNA 1CO7E 1P03A 1G32B 4TYDA 1KXFA 2Q6DA 1N6YA 1O2VA 1NT1A 3SJIA 2A4QA 2Z9GA 1NESE 3AASA 1T7CA 2VJ1A 3RM0H 5AVDA 4NZLA 1C2DA 1QA7A 1ETSH 2BDHA 1VJAU 4H42U 2R2MB 3SV6A 1QL7A 3T27A 2VVCA 1H8DH 2BDYA 6CHAB 5B6OA 1ZMNA 1S83A 3V3MA 3LGTA 1O5DH 4ZKNU 2P3FH 1SGTA 1O2XA 5EG4A 3SUDA 3A83A 4MPXA 3GY7A 1G3EA 2ZP0H 1YPKH 1BHXB 1Z7KA 1GWAA 4LXBH 1QRZA 5G4BA 5DO4H 4MNWA 5DPAA 4YTAA 1DE7H 3NUMA 1O30A 1YCPM 3V7TA 1QQ4A 1GBEA 2XWBI 1W2KH 3SGBE 1F5RA 4ZH8A 2ZA5A 2F9OA 4O3UA 5GCHG 1GI5A 1ARBA 2WPLS 1Z1JA 3PB1E
chains in the Genus database with same CATH superfamily
1LVYA 1MU8B 1EOJA 3PV5A 2ULLA 1QNJA 4K69A 4DURA 1JOUB 1P2IA 3GCTG 1C1RA 1XUIA 2WHXA 1E35B 1VJ9U 1GBJA 1O37A 3VXEH 3IG6B 2HNTE 3SUFA 2V3OH 2KR7A 3DFJA 3D62A 5JB9S 3U8TH 4JYVH 2I6SA 2UWPA 2H9TH 2PV9B 3QWCH 2OK5A 1ZYOA 1QIXB 6CHAC 5JBTA 5C5NA 1W0YH 3MO6A 2BX3A 1MKXH 2SFAA 3BTEE 4JZDH 1HV7A 3GY5A 5ABWA 1TIOA 1EFRD 2BVSH 1LQDB 2PUXB 2KZ4A 1PFXC 2OC0A 4IMQA 3QZQA 4O3TA 1FJSA 1N1LA 1TX7A 5GWZA 2GT8A 5FX5A 3FO8D 3NXPA 1BIOA 3L3TA 2JDID 1IQIA 2R3UA 4H6TA 2OCVB 4WF8A 2EI7A 1HAXB 2FTMA 1L4DA 2G4TA 3D23A 4KELA 2VIQA 2XWAA 1QA0A 1P02A 1Z8GA 1O31A 2LPRA 1C4U2 2Z6BD 2JETB 3T2NA 3ZVBA 3OY5U 1C1PA 4DG4A 9LPRA 2PKSC 3QN7A 1W13U 2BLVA 1GDQA 3T29A 3SU3A 1BTPA 1HJAC 2C4FH 2FP7B 2GP9B 4D7FA 1GI4A 1DOJA 2CK3D 1HXEH 1O2YA 1V3XA 1ANBA 1EPTB 1V2OT 1D4PB 4INHA 3RC4A 2QYIA 1LHGH 4TPIZ 2IJOB 1AUTC 1AKSB 1FY5A 2ZCHP 3Q3KA 2FIRH 1Z1IA 1QRWA 4B2BA 4GCHF 4UD9H 2QF5A 4XFQA 3ZZ9A 2QY0B 2XXLA 1FUJA 1BCUH 2ZGCA 1UTPA 1ZHPA 1O2ZA 1MTWA 3ESTA 5C0UA 3F68H 1C5RA 4AGKA 3C27B 3ZVEA 2SNWA 2PR3A 3M3TA 5FPYA 1UVOA 3A87A 1ZMJA 2BMGB 2HALA 2QIQA 1VITH 2Y5HA 3STJA 1C2EA 1O0DH 3A7YA 2A0QB 5FHTA 3SGQE 4O97A 1EJNA 2J4IA 3I77A 1C4Y2 1FAKH 1RXPA 1CHOG 1BRAA 3Q77A 3DT0H 1V2WT 4LOYH 3OYPA 3T26A 4VGCB 3C1KA 4YOJA 1C5SA 1ZPBA 3M7TA 4BTUB 3E8LA 3TK6A 3UR9A 1AKSA 1ZRKA 4FUIA 4F49A 1UCYE 3SORA 4M7GA 3TH4H 3UY9A 1TGCA 5E2OA 2XC0A 2QF4A 1NU9A 3PWCA 5T6DA 2GCHF 1GI6A 2ZEBA 3P8GA 3Q00A 5E2PA 2G55A 1HAVA 5EQRA 4I8JA 2BHGA 2FOFA 4LK4A 2VWOA 4NIVA 5K0HA 1MCVA 1SGRE 4FETA 1EZXC 4I8LA 5F8ZA 5HYOA 3ZVDA 2I6QA 3SU4A 3LJJA 1YPHE 4MPVA 1HAYB 2AIQA 1NO9H 5EXLA 3TGKE 2PTNA 5DSFA 7KMEH 1GJ9B 2ZFSA 1CT2E 2RFKC 1ESTA 3K65B 3F9FA 3BN9A 3URDA 2O8LA 1AD8H 2PW8H 3SU5A 4FUBA 5FBEA 1DS2E 5K7RA 5EU8A 3PTNA 4AORA 1A4WH 1LCYA 2HNTF 1KIGH 2A5AA 2R3YA 4X1RU 4ZXYH 1FNIA 1BITA 3SU1A 1A2CH 1BTUA 4RT1A 3F0OA 4A1TA 3M5OA 1A0HB 1GDNA 2GX4A 1AWFH 1SR5C 4Y7AA 2ZQ1A 5DKMA 3F2GA 1A3EH 1TPOA 2SGPE 3TNSA 3RDZA 1C1OA 2JJ2D 3UOPA 1GJ4H 1KXCA 1DT2A 1OPHB 1KTTB 3FZZA 3P17H 2EQNA 4TY6A 2A1DB 2XBVA 3OE7D 2FX4A 5EPNA 8KME2 2HOBA 4CH8B 1DLEA 3SI3H 1IQLA 5EW1H 1TA6A 4B73A 4CRCA 1BJVA 3QK1A 1P2KA 3A7VA 3PO1C 2NWNA 2BZ6H 2ZU2A 2KFWA 2XC5A 4TT3D 3ZZBA 3FZDA 3MU0A 3TITA 2ZHWH 3GY8A 4DIHH 2Y5GA 5FBIA 3KQBA 3AW1A 2WPDD 3GCTF 1AVGH 1ZZZA 3SZNA 1S82A 3RU4T 1IQNA 1K1MA 1ELBA 2EC9H 3DSOA 1FY8E 3FN8A 6LPRA 1Y59T 1O3OA 1DUAA 1WUNH 2CN0H 5HIZA 2HVYB 2VINA 4NFEA 1BBRE 1BMLA 2PGQB 2VBCA 3UIRA 4IC5A 5GJ4B 4AG1A 2Y6TA 2GZ9A 1SGEE 1GJ7B 3T5FH 4NSYA 3UOUA 2GDEH 2VIVA 1C2GA 1CT4E 5J4QA 3AW0A 3EA9A 1C1VH 4B6EA 4B6FA 5GIBA 3TH2H 1M9UA 2VH6A 1CGIE 3QGNB 2O8MA 1AFEH 2V7QD 2A2QH 4YOGA 1DWBH 1Y5AT 2VIWA 2VIPA 1FZZA 2JH6D 2ZU1A 5A0AE 4CRBA 5EODA 2J98A 1GI9B 1O2WA 3UNSA 3W1EA 5HXFA 1PJPA 3P95A 1QGFA 5DP3A 1C2HA 5A8YA 4U30A 5I25A 3OAAD 4DGJA 1JRSA 1P09A 3BEFB 1MBMA 1TRMA 2JKHA 2ZTZA 4NA9H 5LGOA 3ZZ6A 2BD2A 2OTVA 1L1JA 1HPGA 2ZIQH 1HGTH 1ELDE 2PTCE 4U32A 4ACBA 1Q31A 1A0JA 2H2ZA 2OINA 3RLWH 4JK5A 4NA7A 4NFFA 3KQEA 1O2SA 1ELTA 3GISB 2EY4C 1PPHE 4NSVA 4OM9A 2O8TA 3MHWU 4B75A 5JDUB 1NFYA 2OC7A 2FLRH 1SFIA 1AO5A 2BQ7B 3E91A 1H8ED 2F43B 3RXJA 4K60A 3RXHA 4I7YH 3S9BA 4LZ1H 4BAMB 4UONA 4YO9A 1T31A 2FI4E 3UQOA 1VITF 1B0EA 2XCNA 1G2MA 1C1SA 1NC6A 3RXOA 1PPEE 1RJXB 2A5KA 3ZV8A 1TB6H 1W0ZU 2OBOA 1BA8B 3MU5A 3TU7H 4K5ZA 1C1NA 2Y7ZA 3PM3A 2FI5E 2ZU5A 1SC8U 2FI3E 2P59A 4DCDA 2WV9A 3EDXB 4AGJA 1AE5A 1LVBA 1NFUA 2DE9A 3FANA 2UUFB 2BY7X 4FXGH 4ISLA 1GBHA 2Q6FA 3GY4A 5F8XA 1GBTA 3RXEA 4ABGA 1WQSA 1UHBB 3S69A 1IQKA 1JWTA 1G2LA 1TPPA 1H8IH 1KXBA 3V12A 2FM2A 2HVXA 1UK4A 1CBWC 4Q80A 1ZJKA 1H9HE 1W7XH 2Z9KA 1LHDH 2W6JD 5EJZA 1K1LA 4UDWH 3EYDA 4OGYA 1TAWA 1UK2A 4FUGA 1X7AC 1D6WA 4IGDA 2IPHA 4F4OC 4WY3A 2O8UA 1AB9C 1JIRA 1SGNE 4KTCA 3RXVA 2UUYA 4JYUH 2A7JA 1EKBB 1F7ZA 1TOCB 4RI0A 3HKJB 3RXTA 1Y5BT 1G9IE 1HUTH 1RFNA 1O5AB 2Z3DA 2V35A 5JBAS 1A0LA 2XC4A 1C2LA 1GI3A 2VWLA 1ABJH 2GD4B 5EJ1A 2LNCA 2BZAA 3EE0B 2BY6X 2IN2A 5KGOA 1J16A 1P57B 2C8ZB 5C20A 4RKJB 4ZHMU 3T28A 4XSKU 2BQWB 3SU2A 1OWJA 1O3GA 1S0QA 1HB0B 3OTJE 8GCHG 3KF2A 4UFGH 1MH0A 2WSSD 1RRKA 4FUCA 3A82A 2Y81A 3DSPA 2ZHDA 3S0NA 1GGDB 2TPIZ 1GI0A 3BTFE 3SQEE 3SNEA 2PKAA 2WPKS 1W11U 2BDCA 2SGQE 2VVVA 2Y5FA 1NRNH 1O39A 2WPMS 1ELCA 2BY9X 1LKBA 3TJNA 3ZVAA 3A89A 3HK3B 4Y8ZA 3R3GB 5I46H 4RKOB 5C2ZA 1ZSJA 1NM6A 1TPSA 4AFSA 2G00A 4OS2A 1S6FA 1AN1E 2CXVA 1EAUA 3EAJA 1S0RA 4ISHH 5B6LA 2JIZD 1C2KA 5A0CA 1LPZB 3STIA 5JB8S 1P05A 3SNDA 1XVMA 3GCNA 2L74A 1OX1A 1VGCC 1ELAA 3M36A 1C2MA 3TNTA 2A32A 1C5MD 3QUMP 1YPHC 2GMTB 2PFEA 1Z8IB 3ATLA 1ESAA 3RLYH 1OS8A 1EB1H 1O3FA 4KP0A 2BY8X 5DP7A 4Y71A 1JMOH 1C5UA 2AMDA 1Y8TA 5L2YH 1ZRBA 2FPZA 1KLTA 5FXLA 2Z94A 3GS9A 1HJ9A 1O3BA 1CE5A 1QL9A 2OC8A 2QE7D 4AOQA 1DWCH 4X6OA 5EW2H 1GPZA 1JBUH 1QB9A 3I29A 3W95A 4CRAA 1GBDA 1H8HD 1QURH 5PTPA 3ZVCA 2G52A 3MH7A 3GDUA 1XKAC 3A7XA 3D65E 1O2TA 1ABIH 4CRDA 1YPGH 2GKVE 1U6QA 1UTOA 1WTGH 2ZTXA 3MI4A 3ZYEA 5F03A 4IBLH 1PPZA 4KGAA 1FDPA 1ZHRA 1BTXA 3PRBA 1VR1H 3ZV9A 4JYTA 4Y11E 1EX3A 2XRCA 3H7OA 1FY1A 1HDTH 3ZZCA 2PSXA 4DOQA 1MD8A 1EPTC 4D9RA 2VIDA 3ENSB 3PYHA 1HJAB 4AFQA 2PSYA 4YZUA 5DK1A 1BUIA 1SG8B 2KCAA 2ESTE 1J14A 5E0HA 5C1XA 1AZ8A 7ESTE 2BVXH 4FU9A 7LPRA 4ZMAH 1PPGE 1NN6A 3BIUH 1TOMH 1AZZA 4BNRA 1PYTC 1E36B 2BLOA 3LONA 2QXJA 7GCHF 1O3CA 2R2WU 3MMGA 1YPJH 1L4ZA 1UTQA 2TIOA 3MFJA 1LMWB 1TRYA 3UUZA 1P11E 3R0FA 4LZ4B 3E0NB 2Y80A 5CHBA 4CREA 3EA8A 4ASHA 2ZGXH 1XXFA 5EXNA 3SN8A 2YOLA 2BY5X 5GCHF 1Z8RA 5E0GA 1O5FH 1UVSH 1BRUP 2OQ5A 4P00A 3LU9B 2CMYA 2W3KA 1B7XB 3ATIA 1GCDA 4X2YA 1IHTH 2ODPA 2EI8A 3LH1A 3SZEA 2YMSB 2A7CA 3BTHE 3MH6A 4JZFH 3O8DA 1EP5A 3A81A 1EJMA 1F0TA 5HIYA 5H4IB 3SV8A 5LH8A 1ZPCA 3I78A 4K1TA 3GCHC 2BD7A 1DFPA 5T6GA 1T4UH 1WTHD 2F9VA 2AGGX 2ZNKH 1GI8B 3SI4H 2A7HA 3UB0A 2XNIA 1OKXA 3KL6A 1GVLA 4CRFA 3FFGA 3S7HB 2FOAA 1YPEH 2V6NA 3RXUA 1TGTA 1HRTH 1GVKB 5JBBS 2NU0E 1Z71A 1C1WH 4JK6A 5IDKA 1E79D 1O2QA 3JZ2B 2M5TA 2QXGA 2BLWA 4CR5A 1MCTA 3ZZDA 3UFAA 3P70B 3UREA 4DVAU 2ANYA 2LP6A 3RU4D 1QBNA 1OWEA 1L1NA 2EA3A 3B23B 3OSYA 2GCTC 3VB3A 2HNTC 2GZ8A 3SHAH 1RGQA 3UPEA 3BTWE 1WU1A 4X1PU 1SL3A 1MTNB 2QGRA 2TBSA 3F1SB 1O2GH 1BMAA 3A80A 4M9FA 4HI3A 5TCAA 1GHZA 1SHHB 3RXLA 1TGNA 3Q76A 1J15A 3PROA 4DW2U 8GCHF 3MU8A 1GHYH 1KMHB 1MTVA 1DXPA 5DJ7A 1E37B 1GBMA 3JZ1B 4F55A 2QA9E 3KIDU 5HMAA 1TNJA 3UNQA 5E8EH 2STBE 1EXFA 4BOHA 4ACAA 1MD7A 2ALPA 4X1SU 4AG2A 1ELEE 2BD4A 1C9TA 3BTKE 2ZU4A 3SYJA 5EXMA 3NWUA 4D8NA 1ANDA 2PLXA 4FUEA 1SGFA 2FEQH 1QB6A 1C9PA 2V3HH 4INLA 3ZZ8A 5EIYA 1YCPK 1GI1A 1W7GH 5C67A 4KTUA 4DT4A 1NS3A 1IQEA 3OEHD 3A8AA 2P3TB 2WPJS 1CHOF 2ALVA 1DSTA 1P10A 2XTTB 4FUFA 1FIWA 3ATKA 3U69H 2C93B 2BDBA 2J2UA 2ZHFH 1MMJN 2C8WB 3S9AA 5GDSH 2AHME 4R8TB 3DSGA 4O9VA 2G51A 1ZPZA 1SGYE 2EEKA 1ZMLA 2DUCA 4BXSA 3K9XB 3A8DA 2DE8A 4NIWA 1HBTH 1A7SA 3PRDA 3MU1A 1WV7H 2ODYB 2FOGA 1ZJDA 1O3AA 2RG3A 1FLEE 4HG6A 1V2RT 1J17T 4YESB 1INCA 3RXSA 1BJUA 5JBCS 1PYTD 1GMDG 1EAWA 1XKBC 3DHKH 1TGSZ 4GAWA 3E0PB 2OD3B 1GJCB 3ITIA 4Q7XA 3DA9B 1UMAH 1SGQE 4OS5A 2BDAA 1GI7B 4ZHAA 3NCLA 1A5IA 1QTFA 1Y3VA 2G81E 2D1JA 3L6PA 1GCTC 5DGJA 2F91A 3P8OA 3NKKA 2FDAA 4GPGA 2O9QA 3QTOH 1DM4B 1QBVH 2KAIA 1O32A 1Y5UT 1O5BB 2ZFPH 1OYQA 3ATMA 2FX6A 3TLOA 3M35A 1MKXK 1EJAA 1W14U 2CF9H 4GSOA 1GMCG 2FYQA 3KEEA 4Z6AH 1QBOA 3SJOA 1RIWB 4GUXA 1BRBE 1UCYK 2TGPZ 4AB8A 3KCGH 2OC1A 1FAXA 2V0BA 1SQAA 3LJOA 4X8SH 5EGMA 3RMLH 5GNDA 1EASA 1C5OH 1UTMA 1ZGVA 4ZXXH 1LQEA 4X6PA 1BT7A 3SUGA 2ZCKP 3DFLA 4TWYA 4YT6H 3RUOA 4DJZB 1L0ZA 2A4RA 1DXWA 4I8KA 4P02A 3MNCA 2OBQA 1ARCA 4KKDA 1ZSLA 4BAOB 2IPQX 4ESTE 2PUQH 1D3DB 1JXPA 2QV1A 3SOSA 3SU0A 2F3CE 3TH3H 1SLXB 3BEIB 2YMSD 1W10U 2GZ7A 5AHGH 2Z3EA 3N7OA 1V2JT 4DY7B 1J8AA 1O2NA 3GY2A 1MZAA 3RXDA 3U1IB 2H5DA 1OOKB 1EB2A 1VCWA 3VB5A 2A31A 3TPIZ 1GBLA 1QHRB 2C90B 3ODFA 5A2MH 2ZI2H 2K1QA 4B76A 3RXPA 1O3NA 1TBQH 4D9QA 7GCHG 2WYGA 3TJUA 1GCTB 2WYJA 4OGXA 4DT7B 3P6ZB 4K8YA 5TJXA 1FPHH 4OS7A 2ILNA 2HPQH 1EQ9A 1ZR0A 1P12E 1C5WB 3MNXA 4NIYA 5DP5A 4WMEA 3F9EA 1T32A 2QF0A 2P8OC 3BTQE 1KTSB 2KCYA 2B7DH 4TWWA 1SGIB 2Z7FE 2ANKH 3RXAA 2F9PA 4MVNA 3BTDE 5F6MA 1ELVA 2R9PA 4UEHH 1SGFG 1G3BA 3WWFA 1WDIA 1ORFA 3FP6E 1IQMA 1MU6B 2G5VA 1GHAG 1MTUA 3EQ0H 3LC5A 1AFQC 3U8RH 4UFFH 1AGJA 1W12U 1XM1A 2ZFQH 2OLGA 1C5PA 1TNIA 1KXAA 4I8HA 2BXUH 4BAHB 2D2DA 4MTBA 4ISNA 2OUAA 3B9FH 4Q7ZA 4AYYB 2BVRH 4MNVA 1OWHA 2ZDNA 2AMPA 2Z9JA 1GI2A 2FODA 3P8NA 1VKYA 3HGNA 1HAZB 3SV7A 2CF8H 1O5CB 3F0PA 2P8OB 1GBAA 3KN2A 1FN8A 4MPUA 3TK9A 2XBXA 4ZHLU 1F2SE 1SLVB 1AU8A 3U8OH 3TJVA 4A1XA 3VFEA 1FMGA 1HIAA 5JYIA 1LHCH 1CHGA 2GTBA 2Z3CA 1BDAA 5LPFA 4XBCA 3M61U 3SJ8A 1T8NA 4A5TS 3MO9A 1FY3A 4XD7D 4AYVB 1Z6EA 1LHFH 4NWLA 3BTTE 2B9LA 1XUHA 4AN7A 1KDQA 1IQGA 1MTNC 1GBIA 4X0WU 3SGAE 1OWDA 2CHAC 2QXHA 3UNRA 4XRNA 1K2I1 3BG4C 4ZAEA 2JH0D 3SHCH 3WWBA 4E05H 2AERH 4GHTA 2J92A 1ZHMA 1C2JA 4NGAH 1YPLH 4E7RG 1WCZA 3V0XA 1SLWB 2AFQB 2ZGHA 1MZDA 1MQ6A 1ZOMA 5CDFE 1DY8A 3MO3A 4Y10E 4BANB 1K1NA 3F9HA 4FU8A 2ZHQH 3VG8A 1SKYE 2NU4E 5HKKD 2C8XB 1TMUH 2BM2A 1Q2WA 1L2EA 4UE7H 1Y3XA 1YKTA 1HAHH 1S6LA 1O3MA 1RIWC 2J38A 1TPAE 2PGBB 2W7SA 1GBFA 3K6YA 1G3DA 2A5IA 2W7UA 2TRMA 3ZZ4A 3LGIA 1ESBA 1SI5H 4WWYA 4IN1A 3VEQB 2ZHEH 3KNXA 3SU6A 1WYKA 1SVPA 6ESTA 1WQVH 1AWHB 3QGJA 2YMSC 1YC0A 2RDLA 3E1XB 1G30B 1TONA 3UAIC 1AMHA 1HXFH 2P94A 1LKAA 4AFZA 1C5VA 3RC6A 4O03A 2SNVA 4Y8YA 2P3UB 3ELAH 1AIXH 3F6UH 3LT3A 5EQSA 3RMNH 5C94A 1V2UT 2ZPSA 5J4SA 4CHAB 1TE0A 2CGAA 4Y0ZE 2G4UA 2KCOA 4WJG2 5DP8A 5LPEA 1VZQH 1GHWH 1ACBE 1KSNA 2J5UA 3OY6U 1AVWA 2GT7A 4AZ2B 2CJIA 2VH0A 1O2UA 1YYY1 4NIXA 1XX9A 2BD5A 5FPTA 2TGAA 3ZZ5A 1TALA 2VVUA 3GICB 2QC2A 2WV5A 5EPYA 1MKWK 3RXCA 3D49H 2VNTA 5DG6A 3U1JB 1C1MA 2HGTH 2GVFA 3QX5H 2XYAA 2XW9A 5GPIB 5LPRA 2TGTA 3GY6A 1GHVH 3S7KB 4Y8XA 2F9NA 1CQQA 2C8YB 3S9CA 4JMYA 3KQDA 5T1VA 1N8OC 4ZROA 1TMTH 1BRCE 2BD8A 2ZFTA 2OQUA 1TA2A 3CP7A 4YM9A 2FOHA 2ZQ2A 3GYMA 1GHBF 1N6XA 2ZTYA 1AHTH 1O2LA 1MQ5A 1FXYA 2FOCA 1W3CA 3SQHE 1C2IA 4KTSA 2J95A 1PPFE 2YNAA 5HM2A 2AIPA 1NBME 4NA8A 5JPMH 3SV9A 2C3SA 1FN6A 2HLDD 2V3MA 3HK6B 5HGGA 3KHVA 4QT8C 1LPKB 1DDJA 1DITH 1SBWA 4GCHG 1FV9A 1SOTA 1DICA 4IW4E 1ID5H 1MTSA 1O2KA 4I31A 3SW2B 1BMMH 1TGBA 1KY9A 1K28D 4MG3A 4JZIA 3QTVH 1MAYA 2H1UA 3QZRA 3DD2H 3E6PH 1A61H 1RS0A 2GMTC 1AE8H 2AGIX 1UTJA 4UFEH 3HPTB 1XXDA 1GMHG 3GOVB 2UWLA 4WH8A 1GBBA 1VGCB 3RP2A 1P2JA 3IITA 1HYLA 2GCTB 4Y0YE 2GGVB 1DUEA 1P04A 5CHAB 1Q3XA 1V2KT 1TQ7B 4ZCNA 3GCOA 3PMAB 3EGKH 5FCKA 2G8TA 3ZVFA 1DWDH 5A8ZA 4DIIH 4MNYA 2THFB 4BAKB 1O5EH 4FUDA 1D3TB 3H7TA 2AYWA 3PLPA 2KM0A 3BV9B 2RA3A 2XBWA 1UTKA 4Q7YA 1FY4A 1CT0E 1OXGA 2W6ID 2QN5T 3VB4A 1COWD 1BTZA 1LPGB 2HWLB 1O2PA 2PP6A 1YY3A 4THNH 3T25A 4FOUC 3RMOH 3TGJE 2J34A 4ABFA 4TPYA 3QDZB 5A0BA 1GGDC 2ZG0H 4X6MA 2H9EH 3T62A 4YXWD 5A8XA 1GJDB 1O2OA 4XDEA 3GCHB 4ZKRU 3V13A 3QLPH 3FP8E 4FVDA 1S81A 3LIWA 1O3HA 4WVPE 4WXIA 2XNDD 3SJ9A 1TWXB 3HGPA 3KYGA 4ABBA 4J2YB 1NU7B 1P2QA 1FI8A 1AVXA 4IS5A 2VGCC 4X1QU 2AEIH 3MNBA 2ZKSA 1AUJA 1HNEE 1QZ8A 4I8GA 4JZEH 2AS9A 4MQAA 2WV4A 1MUEB 2W3IA 4CBNA 1RTKA 1CVWH 4X1NU 1WOFA 4XOJA 4K1EA 5ESTE 1ZTLA 2PWXA 3PV4A 1F5LA 1GJ5H 2BOHB 1XVOA 3CENA 1GG6B 1TYNA 3PMJA 1FONA 4UFDH 1O3DA 2R0KA 1NRSH 1W0JD 3OTPA 4CH2B 1YGCH 1EOLA 1A3BH 1YLDA 2IJD1 1NBMD 2D8WA 4INKA 1O3EA 1E1RD 1TBZH 4X2VA 3NPSA 3ZZ7A 4CRGA 4H6SB 2WINI 1IQJA 3LGUA 2B0FA 2AH4X 1UCYH 1LHEH 3FAOA 4FUJA 1QJ1B 1BB0B 1Y3WA 2ZO3H 1MBQA 3K6ZA 6GCHG 1C1UH 2BB4A 1EP6A 2ZC9H 2RCEA 4I32A 1O3PB 1JIMA 1H9LB 2B8OH 3N7EA 3PTBA 2VGCB 2FOEA 1F0UA 2GV6A 3DCLA 4ISIH 1G3CA 2KCPA 3F3BA 3SO3A 2WPHS 1BZXE 2J9NA 3NZIA 1NRQH 1O33A 5F53A 4WMDA 1SPJA 2ZGJA 1YF4A 3L33A 1YPMH 4MNXA 2FTLE 4YOIA 2A2XH 3P8FA 4NCYA 4Y7BA 8LPRA 2ASUB 3UWIA 1F92A 1O34A 1EATA 1WBGB 4K1SA 3SBKA 1QFKH 1K1OA 4ZUHA 5C5OA 1AQ7A 2D26C 3VGCC 3SV2H 1CA0B 1TNKA 3ODDA 1V2NT 2ZDKA 1D9IA 1UW7A 1A5GH 4BAQB 1IOEA 1SQTA 2B5TB 5T6FA 1YCPH 4NG9H 1P2MA 1B0FA 3F2HA 4OS6A 2FO9A 1HFDA 5DP9A 1UTLM 3GYLB 5E0JA 5A09A 3SNAA 1D3QB 1YBWA 3M7QA 2ZDAH 2GJGA 1GMHF 1VCPA 2FXRA 2P93A 4B74A 3ZVGA 5ESBA 4BTIB 1P01A 3KQ5A 1D3PB 1ZGIA 4SGBE 5AFYH 1O3JA 9ESTA 2FOMB 1YM0A 1OP8A 4ZKOU 2NU2E 1QJ7B 3VB6A 3LGVA 1QB1A 3LKWA 3UR6A 3URCA 4F48B 1GHBG 4X2WA 3VPKA 2GV7A 3EA7A 2SGFE 1PPBH 1C2FA 1T8LA 4Y76A 2Y82A 2AGEX 4RT0A 1CA0C 1SOZA 1K21H 2QF3A 3VGCB 3U98H 4HGCA 1P0SH 1BOQA 3TIUA 3FVFB 4B1TA 2H6MA 2ZU3A 5C17A 1HAGE 2HLCA 1KLJH 1FIZA 1GMDF 1V2VT 4GHQA 3MTYA 4MDSA 4SGAE 1LDTT 1XUFA 1O2MA 3WY8A 5L6NH 3Q3YA 1LVOA 1O2HA 5FL7D 1KXEA 2OXSA 4I86A 3MNSA 1BMFD 1P2NA 4ASUD 4R0IA 5KEDA 1OP0A 1N8OB 1NTPA 1ZSKA 1PQAA 4ISOA 1F5KU 3SNBA 3E90B 1H4WA 2RA0A 1O38A 3RXGA 1OSSA 3RC5A 2F9UA 3ZZ3A 4B2CA 1AB9B 2XOKD 1C5TA 1WXRA 3M5MA 1SQOA 3KYFA 4FVBA 2FS8A 4IN2A 2WUCA 3LH3A 3NK8A 3PMBB 4HFPB 4RSPA 1E38B 3MH4A 5DP6A 5CMXH 1QY6A 2ZZUH 4A6LA 2SGDE 3EE7A 1V2MT 3HKIB 1CBWB 4K3JA 1SLUB 3LC3A 1NROH 1GG6C 5HM9A 3AAVA 4A1VA 1BTHH 4Q2KA 4U01A 4X8UH 4WH6A 1G37A 2ANWA 1C1QA 3W94A 1UVTH 1YLCA 1P3EA 2LELA 1GL1A 2WUBA 1SFQB 5C1YA 1LO6A 2ZCLP 4ABJA 1TNGA 1GBCA 2NU1E 4MLFB 1RTFB 2A4GA 3LOXA 3RXKA 1BTYA 2H9HA 1DY9A 1XUJA 2BQ6B 1GJBB 1BBRH 3AVZA 3CNRA 3RXIA 5DN6D 1Y3YA 1DANH 2VB0A 4ABHA 5AF9H 3G01A 1EZSC 3BTME 2BTCE 1H1BA 4FUHA 5IK2D 1J9CH 2M2AA 1QR3E 1V2ST 3A7WA 4ABAA 3ZIAD 1L1GA 1MAXA 3OU0A 3BG8A 4Q63A 8ESTE 1Z6JH 1DX5M 1GJ6A 1H9IE 1BQYA 3H09A 1ANCA 2ANMH 2HPPH 5CE1A 1TQ0B 1V2PT 2F9BH 1GL0E 1DWEH 1KXDA 2UUKB 1OWIA 2J94A 2P95A 1DPOA 3Q3XA 2VIOA 1K1PA 3RXBA 3PLBA 3MWIU 2ZECA 1SHYA 1ETTH 3P92A 1VITG 2P16A 1QJ6B 5C0TA 3M3VA 1LVMA 1TFXA 3H5CB 5CHAC 2W5EA 1HJ8A 1TLDA 4H4FA 1S84A 3MQKC 6GCHF 2XCFA 4JCNA 3M5LA 5FX6A 1C5ZB 3HATH 3OFND 1DVAH 1GMCF 1TABE 1UJ1A 2CHAB 3ZZAA 1S6HA 3BF6H 4ZKSU 1HAOH 2SGEE 1CU1A 2F83A 3A84A 1THSH 3UQVA 1O3LA 2FS9A 1AY6H 3RXRA 3IWMA 4IC6A 4A92A 2OP9A 1B5GH 5SGAE 5EQQA 1EAIA 2ZFRH 4BTTB 3A88A 4NWKA 2Z9IA 3A86A 3B8JA 1QRXA 4D7GA 1SB1H 2ZPQA 5DP4A 5L2ZH 2BYAX 1KLIH 1EZUC 3BIVH 1BHXF 3QO6A 5ETXA 4Z0KA 1TNHA 5F8TA 4X8VH 5AFZH 2FZZA 1E1QD 3U9AH 4RN6A 5BPEA 3CS0A 2PHBA 4YT7H 1QL8A 1F0SA 1A5HA 1HAIH 4J1YA 1G36A 1PQ7A 1NZQH 1K9OE 3M7UA 5C1UA 1IQFA 1NRRH 1SQRA 1PQ8A 4XBDA 1HAVB 4Z1MD 3M5NA 1CGJE 5FAHA 1NRPH 2ZF0H 4XBBA 4AX9H 1E34B 4GLYA 1EUFA 2HRVA 3TGIE 1T4VH 3BSQA 1GBKA 4JZ1A 1NPMA 3ZYDA 1UTNA 1SSXA 3TK5A 1O36A 2PKSB 4ABEA 1P8VC 1DLKB 1OHHD 2QAAA 1C1TA 1O5GH 1O2JA 2JETC 1RTLA 1A46H 4U2WA 1UVPA 1TX6A 4CR9A 1IAUA 3M37A 1YWUA 3PMHB 2BOKA 5EOKA 3RXMA 4GVUA 1XUGA 3GDVA 1ZTJA 4Y79A 1IQHA 3PO1B 1O2IA 1IHSH 2SGAA 1W8BH 3A85A 3NRLA 5C3NA 1PPCE 1UK3A 2XBYA 1P3CA 1V2QT 1P2OA 1ELGA 4XE4A 1WAYB 3BEUA 1HLTH 3DUXH 2ZDMA 1P9UA 1DSUA 1KYNA 2F4LA 1BTWA 4Y6DA 4CHAC 2BD9A 1S85A 1VCQA 3A7ZA 3LGWA 1EZQA 1C5XB 1SGDE 3GDSA 3LDXH 2PKAB 2H5CA 1UVUH 4X8TH 1HCGA 1QCPA 2UWOA 1GJAB 1K1IA 4B2AA 3GY3A 2QXIA 1YP9A 1SGCA 1T8MA 1V2LT 4I33A 1NFXA 2ZDLA 3PLKA 1KDQB 3ATWA 1EPTA 3RXFA 3RXQA 3A8BA 3PWBA 4YLQH 3O8BA 5FCRA 1O3KA 2Q1JA 1AI8H 3E3TA 3A7TA 1GHXH 3SNCA 2ZFFH 1CGHA 4AFUA 5BRRE 1JRTA 2AMQA 3CS7A 1FQ3A 4OS4A 2ODQA 4AC9A 2FMJA 3K2UA 3UWJH 3FP7E 1BMNH 4K8BA 1GVZA 3RU4E 4E06H 1P06A 2ZDVH 2VWMA 5EJLA 4OS1A 1A1RA 2JJ1D 4HTCH 1ZLRA 3SJKA 1OWKA 3AAUA 3RMMH 1OYTH 1S5SA 1Y3UA 3F2FA 3KQCA 3VXFH 1THRH 1UO6A 5L30H 2BDGA 1ZTKA 4NZQA 2W26A 1OP2A 2FOBA 1TBRH 1UHBA 1D6RA 4HZHA 2ZPRA 1EAXA 4X6NA 2FWWA 1C5NH 3MOCA 4MPWA 4WXVA 1O3IA 1C5QA 1CSOE 1GHAF 3O8CA 3N99A 3BG4B 2BDIA 4X2XA 1K0HA 1QQUA 1TRNA 1TMBH 4YLUA 2A45B 3N7DA 3FKSD 2STAE 4VGCC 1O35A 1TX8A 3MU4A 3LPRA 3PV2A 2FLBH 2ZWLH 1MKWH 3VB7A 4PROA 1K22H 3SUEA 4TY7A 2Q6GA 3OX7U 2Z9LA 4CBOA 3A8CA 2EI6A 1BBRK 4FU7A 1RD3B 1T8OA 1WSSH 3RM2H 2O8WA 2BLQA 1XMNB 2QCYA 2GCHG 2BX4A 2KAIB 1O2RA 2ZGBH 2K0QA 3TJOA 1PQ5A 4WMFA 5IYTA 5T3HA 3F9GA 5FPSA 2K8IA 3UTUH 1E0FD 2IOTA 1Z8JB 1HIAB 3WW7A 2L6OA 2VU8E 1SGPE 5GXPA 1F0RA 2WPIS 4IMZA 4ABDA 1NFWA 1V6DA 1P9SA 1LTOA 2GDDA 2R0LA 2Y7XA 2TGDA 1CA8B 1C5LH 4ABIA 4E7NA 3E16B 3KGPA 2UUJB 4D76A 3FOAA 1NY22 1C4V2 2BXTH 1GDUA 4BXWA 3AK5A 1MABB 2FYRA 3BTGE 1C5YB 1YLNA 3MYWA 2NU3E 1V2TT 1ELFA 2BD3A 4A7IB 3MH5A 1GJ8B 2JH5D 2YNBA 3M3SA 1K1JA 1TNLA 1AFQB 2FESH 1THPB 1XUKA 2WZQA 1W0KD 3TVJB 2A4OA 1HAPH 2CV3A 1SMFE 2G5NA 4AB9A 1ANEA 4B71A 4K2YA 1ETRH 1FPCH 3O8RA 5TCCA 3LGYA 2VWNA 1CO7E 3U28C 1P03A 1G32B 4TYDA 1KXFA 2Q6DA 1N6YA 1O2VA 4Q4LA 2J98B 1NT1A 3SJIA 4TSFD 1FX0B 2A4QA 2Z9GA 1NESE 3AASA 1T7CA 2VJ1A 3RM0H 5AVDA 4NZLA 1C2DA 1QA7A 1ETSH 2BDHA 3OEED 1VJAU 2KX4A 4H42U 2R2MB 3SV6A 1QL7A 3T27A 2VVCA 1H8DH 2BDYA 6CHAB 5B6OA 1ZMNA 1S83A 3V3MA 3LGTA 1O5DH 4ZKNU 2P3FH 1SGTA 1O2XA 5EG4A 3SUDA 3A83A 4MPXA 2J97A 3GY7A 1G3EA 2ZP0H 1YPKH 5KECA 1BHXB 1Z7KA 1GWAA 4LXBH 1QRZA 5G4BA 2RDEA 5DO4H 4MNWA 5DPAA 4YTAA 1DE7H 3NUMA 1O30A 1YCPM 3V7TA 1QQ4A 1GBEA 2XWBI 1W2KH 3SGBE 1F5RA 4ZH8A 2ZA5A 2F9OA 4O3UA 5GCHG 1GI5A 1ARBA 2WPLS 1Z1JA 3PB1E
chains in the Genus database with same CATH topology
1LVYA 1MU8B 1EOJA 2ULLA 1QNJA 4K69A 4DURA 1JOUB 1P2IA 3GCTG 1C1RA 1XUIA 1E35B 1VJ9U 1GBJA 1O37A 3VXEH 3IG6B 2HNTE 3SUFA 2V3OH 3DFJA 3D62A 5JB9S 3U8TH 4JYVH 2I6SA 2UWPA 2H9TH 2PV9B 3QWCH 1ZYOA 1QIXB 6CHAC 5JBTA 5C5NA 1W0YH 3MO6A 2BX3A 1MKXH 2SFAA 3BTEE 4JZDH 1HV7A 3GY5A 5ABWA 1TIOA 2BVSH 1LQDB 2PUXB 1PFXC 2OC0A 4IMQA 3QZQA 4O3TA 1FJSA 1N1LA 1TX7A 5GWZA 2GT8A 5FX5A 3NXPA 1BIOA 3L3TA 1IQIA 2R3UA 4H6TA 2OCVB 4WF8A 2EI7A 1HAXB 2FTMA 1L4DA 2G4TA 3D23A 4KELA 2VIQA 2XWAA 1QA0A 1P02A 1Z8GA 1O31A 2LPRA 1C4U2 2Z6BD 2JETB 3T2NA 3ZVBA 3OY5U 1C1PA 4DG4A 9LPRA 2PKSC 3QN7A 1W13U 2BLVA 1GDQA 3T29A 3SU3A 1BTPA 1HJAC 2C4FH 2FP7B 2GP9B 4D7FA 1GI4A 1DOJA 1HXEH 1O2YA 1V3XA 1ANBA 1EPTB 1V2OT 1D4PB 4INHA 3RC4A 2QYIA 1LHGH 4TPIZ 2IJOB 1AUTC 1AKSB 1FY5A 2ZCHP 3Q3KA 2FIRH 1Z1IA 1QRWA 4B2BA 4GCHF 4UD9H 4XFQA 3ZZ9A 2QY0B 2XXLA 1FUJA 1BCUH 2ZGCA 1UTPA 1ZHPA 1O2ZA 1MTWA 3ESTA 3F68H 1C5RA 4AGKA 3C27B 3ZVEA 2SNWA 2PR3A 3M3TA 5FPYA 1UVOA 3A87A 1ZMJA 2BMGB 2HALA 2QIQA 1VITH 2Y5HA 3STJA 1C2EA 1O0DH 3A7YA 2A0QB 5FHTA 3SGQE 4O97A 1EJNA 2J4IA 3I77A 1C4Y2 1FAKH 1RXPA 1CHOG 1BRAA 3Q77A 3DT0H 1V2WT 4LOYH 3OYPA 3T26A 4VGCB 3C1KA 4YOJA 1C5SA 1ZPBA 3M7TA 4BTUB 3E8LA 3TK6A 3UR9A 1AKSA 1ZRKA 4FUIA 4F49A 1UCYE 3SORA 4M7GA 3TH4H 3UY9A 1TGCA 5E2OA 2XC0A 1NU9A 3PWCA 5T6DA 2GCHF 1GI6A 2ZEBA 3P8GA 3Q00A 5E2PA 2G55A 1HAVA 5EQRA 4I8JA 2BHGA 2FOFA 4LK4A 2VWOA 4NIVA 5K0HA 1MCVA 1SGRE 5HYOA 1EZXC 4I8LA 5F8ZA 3ZVDA 2I6QA 3SU4A 3LJJA 1YPHE 4MPVA 1HAYB 2AIQA 1NO9H 5EXLA 3TGKE 2PTNA 7KMEH 1GJ9B 2ZFSA 1CT2E 1ESTA 3K65B 3F9FA 3BN9A 3URDA 2O8LA 1AD8H 2PW8H 3SU5A 4FUBA 5FBEA 1DS2E 5K7RA 5EU8A 3PTNA 4AORA 1A4WH 1LCYA 2HNTF 1KIGH 2A5AA 2R3YA 4X1RU 4ZXYH 1FNIA 1BITA 3SU1A 1A2CH 1BTUA 4A1TA 3M5OA 1A0HB 1GDNA 2GX4A 1AWFH 1SR5C 4Y7AA 2ZQ1A 5DKMA 1A3EH 1TPOA 2SGPE 3TNSA 3RDZA 1C1OA 3UOPA 1GJ4H 1KXCA 1DT2A 1OPHB 1KTTB 3FZZA 3P17H 4TY6A 2A1DB 2XBVA 2FX4A 5EPNA 8KME2 2HOBA 4CH8B 1DLEA 3SI3H 1IQLA 5EW1H 1TA6A 4B73A 4CRCA 1BJVA 3QK1A 1P2KA 3A7VA 3PO1C 2NWNA 2BZ6H 2ZU2A 2XC5A 3ZZBA 3FZDA 3MU0A 3TITA 2ZHWH 3GY8A 4DIHH 2Y5GA 5FBIA 3KQBA 3AW1A 3GCTF 1AVGH 1ZZZA 3SZNA 1S82A 3RU4T 1IQNA 1K1MA 1ELBA 2EC9H 1FY8E 6LPRA 1Y59T 1O3OA 1DUAA 1WUNH 2CN0H 2VINA 4NFEA 1BBRE 1BMLA 2PGQB 3UIRA 4IC5A 5GJ4B 4AG1A 2Y6TA 2GZ9A 1SGEE 1GJ7B 3T5FH 4NSYA 3UOUA 2GDEH 2VIVA 1C2GA 1CT4E 5J4QA 3AW0A 3EA9A 1C1VH 5GIBA 3TH2H 1M9UA 2VH6A 1CGIE 3QGNB 2O8MA 1AFEH 2A2QH 4YOGA 1DWBH 1Y5AT 2VIWA 2VIPA 1FZZA 2JH6D 2ZU1A 5A0AE 4CRBA 5EODA 1GI9B 1O2WA 3UNSA 5HXFA 1PJPA 3P95A 1QGFA 5DP3A 1C2HA 5A8YA 4U30A 5I25A 4DGJA 1JRSA 1P09A 3BEFB 1MBMA 1TRMA 2JKHA 2ZTZA 4NA9H 5LGOA 3ZZ6A 2BD2A 2OTVA 1L1JA 1HPGA 2ZIQH 1HGTH 1ELDE 2PTCE 4U32A 1Q31A 1A0JA 2H2ZA 2OINA 3RLWH 4JK5A 4NA7A 4NFFA 3KQEA 1O2SA 1ELTA 3GISB 1PPHE 4NSVA 2O8TA 3MHWU 4B75A 5JDUB 1NFYA 2OC7A 2FLRH 1SFIA 1AO5A 2BQ7B 3E91A 3RXJA 4K60A 3RXHA 4I7YH 3S9BA 4LZ1H 4BAMB 4UONA 4YO9A 1T31A 2FI4E 3UQOA 1VITF 1B0EA 2XCNA 1G2MA 1C1SA 1NC6A 3RXOA 1PPEE 1RJXB 2A5KA 3ZV8A 1TB6H 1W0ZU 2OBOA 1BA8B 3MU5A 3TU7H 4K5ZA 1C1NA 2Y7ZA 3PM3A 2FI5E 2ZU5A 1SC8U 2FI3E 2P59A 4DCDA 3EDXB 4AGJA 1AE5A 1LVBA 1NFUA 2DE9A 3FANA 2UUFB 2BY7X 4FXGH 4ISLA 1GBHA 2Q6FA 3GY4A 5F8XA 1GBTA 3RXEA 4ABGA 1WQSA 1UHBB 3S69A 1IQKA 1JWTA 1G2LA 1TPPA 1H8IH 1KXBA 3V12A 2FM2A 2HVXA 1UK4A 1CBWC 4Q80A 1ZJKA 1H9HE 1W7XH 2Z9KA 1LHDH 1K1LA 4UDWH 3EYDA 4OGYA 1TAWA 1UK2A 4FUGA 1X7AC 1D6WA 4IGDA 2IPHA 4F4OC 4WY3A 2O8UA 1AB9C 1JIRA 1SGNE 4KTCA 3RXVA 2UUYA 4JYUH 2A7JA 1EKBB 1F7ZA 1TOCB 3HKJB 3RXTA 1Y5BT 1G9IE 1HUTH 1RFNA 1O5AB 2Z3DA 2V35A 5JBAS 1A0LA 2XC4A 1C2LA 1GI3A 2VWLA 1ABJH 2GD4B 2LNCA 2BZAA 3EE0B 2BY6X 2IN2A 1J16A 1P57B 2C8ZB 5C20A 4RKJB 4ZHMU 3T28A 4XSKU 2BQWB 3SU2A 1OWJA 1O3GA 1S0QA 1HB0B 3OTJE 8GCHG 3KF2A 4UFGH 1MH0A 1RRKA 4FUCA 3A82A 2Y81A 2ZHDA 3S0NA 1GGDB 2TPIZ 1GI0A 3BTFE 3SQEE 3SNEA 2PKAA 2WPKS 1W11U 2BDCA 2SGQE 2VVVA 2Y5FA 1NRNH 1O39A 2WPMS 1ELCA 2BY9X 1LKBA 3TJNA 3ZVAA 3A89A 3HK3B 4Y8ZA 3R3GB 5I46H 4RKOB 5C2ZA 1ZSJA 1NM6A 1TPSA 4AFSA 2G00A 4OS2A 1S6FA 1AN1E 2CXVA 1EAUA 3EAJA 1S0RA 4ISHH 1C2KA 5A0CA 1LPZB 3STIA 5JB8S 1P05A 3SNDA 1XVMA 3GCNA 1OX1A 1VGCC 1ELAA 3M36A 1C2MA 3TNTA 2A32A 1C5MD 3QUMP 1YPHC 2GMTB 2PFEA 1Z8IB 3ATLA 1ESAA 3RLYH 1OS8A 1EB1H 1O3FA 4KP0A 2BY8X 5DP7A 4Y71A 1JMOH 1C5UA 2AMDA 1Y8TA 5L2YH 1ZRBA 2FPZA 1KLTA 5FXLA 2Z94A 1HJ9A 1O3BA 1CE5A 1QL9A 2OC8A 4AOQA 1DWCH 4X6OA 5EW2H 1GPZA 1JBUH 1QB9A 3I29A 3W95A 4CRAA 1GBDA 1QURH 5PTPA 3ZVCA 2G52A 3MH7A 3GDUA 1XKAC 3A7XA 3D65E 1O2TA 1ABIH 4CRDA 1YPGH 2GKVE 1U6QA 1UTOA 1WTGH 2ZTXA 3MI4A 3ZYEA 5F03A 4IBLH 1PPZA 4KGAA 1FDPA 1ZHRA 1BTXA 1VR1H 3ZV9A 4JYTA 4Y11E 1EX3A 2XRCA 3H7OA 1FY1A 1HDTH 3ZZCA 2PSXA 4DOQA 1MD8A 1EPTC 4D9RA 2VIDA 3ENSB 3PYHA 1HJAB 4AFQA 2PSYA 4YZUA 5DK1A 1BUIA 1SG8B 2ESTE 1J14A 5E0HA 5C1XA 1AZ8A 7ESTE 2BVXH 4FU9A 7LPRA 4ZMAH 1PPGE 1NN6A 3BIUH 1TOMH 1AZZA 4BNRA 1PYTC 1E36B 2BLOA 3LONA 2QXJA 7GCHF 1O3CA 2R2WU 3MMGA 1YPJH 1L4ZA 1UTQA 2TIOA 3MFJA 1LMWB 1TRYA 3UUZA 1P11E 3R0FA 4LZ4B 3E0NB 2Y80A 4CREA 3EA8A 4ASHA 2ZGXH 1XXFA 5EXNA 3SN8A 2YOLA 2BY5X 5GCHF 1Z8RA 5E0GA 1O5FH 1UVSH 1BRUP 2OQ5A 3LU9B 2CMYA 2W3KA 1B7XB 3ATIA 1GCDA 4X2YA 1IHTH 2ODPA 2EI8A 3LH1A 2A7CA 3BTHE 3MH6A 4JZFH 3O8DA 1EP5A 3A81A 1EJMA 1F0TA 5H4IB 3SV8A 5LH8A 1ZPCA 3I78A 4K1TA 3GCHC 2BD7A 1DFPA 5T6GA 1T4UH 1WTHD 2F9VA 2AGGX 2ZNKH 1GI8B 3SI4H 2A7HA 2XNIA 1OKXA 3KL6A 1GVLA 4CRFA 3FFGA 3S7HB 2FOAA 1YPEH 2V6NA 3RXUA 1TGTA 1HRTH 1GVKB 5JBBS 2NU0E 1Z71A 1C1WH 4JK6A 5IDKA 1O2QA 3JZ2B 2M5TA 2QXGA 2BLWA 4CR5A 1MCTA 3ZZDA 3UFAA 3P70B 3UREA 4DVAU 2ANYA 3RU4D 1QBNA 1OWEA 1L1NA 2EA3A 3B23B 3OSYA 2GCTC 3VB3A 2HNTC 2GZ8A 3SHAH 1RGQA 3UPEA 3BTWE 1WU1A 4X1PU 1SL3A 1MTNB 2QGRA 2TBSA 3F1SB 1O2GH 1BMAA 3A80A 4HI3A 5TCAA 1GHZA 1SHHB 3RXLA 1TGNA 3Q76A 1J15A 3PROA 4DW2U 8GCHF 3MU8A 1GHYH 1MTVA 1DXPA 5DJ7A 1E37B 1GBMA 3JZ1B 2QA9E 3KIDU 5HMAA 1TNJA 3UNQA 5E8EH 2STBE 1EXFA 4BOHA 1MD7A 2ALPA 4X1SU 4AG2A 1ELEE 2BD4A 1C9TA 3BTKE 2ZU4A 5EXMA 3NWUA 4D8NA 1ANDA 2PLXA 4FUEA 1SGFA 2FEQH 1QB6A 1C9PA 2V3HH 4INLA 3ZZ8A 1YCPK 1GI1A 1W7GH 5C67A 4KTUA 1NS3A 1IQEA 3A8AA 2P3TB 2WPJS 1CHOF 2ALVA 1DSTA 1P10A 2XTTB 4FUFA 1FIWA 3ATKA 3U69H 2C93B 2BDBA 2J2UA 2ZHFH 1MMJN 2C8WB 3S9AA 5GDSH 4R8TB 4O9VA 2G51A 1ZPZA 1SGYE 2EEKA 1ZMLA 2DUCA 4BXSA 3K9XB 3A8DA 2DE8A 4NIWA 1HBTH 1A7SA 3MU1A 1WV7H 2ODYB 2FOGA 1ZJDA 1O3AA 2RG3A 1FLEE 1V2RT 1J17T 4YESB 1INCA 3RXSA 1BJUA 5JBCS 1PYTD 1GMDG 1EAWA 1XKBC 3DHKH 1TGSZ 4GAWA 3E0PB 2OD3B 1GJCB 3ITIA 4Q7XA 3DA9B 1UMAH 1SGQE 4OS5A 2BDAA 1GI7B 4ZHAA 3NCLA 1A5IA 1QTFA 1Y3VA 2G81E 2D1JA 3L6PA 1GCTC 5DGJA 2F91A 3P8OA 3NKKA 2FDAA 4GPGA 2O9QA 3QTOH 1DM4B 1QBVH 2KAIA 1O32A 1Y5UT 1O5BB 2ZFPH 1OYQA 3ATMA 2FX6A 3TLOA 3M35A 1MKXK 1EJAA 1W14U 2CF9H 4GSOA 1GMCG 2FYQA 3KEEA 4Z6AH 1QBOA 3SJOA 1RIWB 4GUXA 1BRBE 1UCYK 2TGPZ 4AB8A 3KCGH 2OC1A 1FAXA 2V0BA 1SQAA 3LJOA 4X8SH 5EGMA 3RMLH 1EASA 1C5OH 1UTMA 1ZGVA 4ZXXH 1LQEA 4X6PA 1BT7A 3SUGA 2ZCKP 3DFLA 4TWYA 4YT6H 3RUOA 4DJZB 1L0ZA 2A4RA 1DXWA 4I8KA 3MNCA 2OBQA 1ARCA 4KKDA 1ZSLA 4BAOB 4ESTE 2PUQH 1D3DB 1JXPA 2QV1A 3SOSA 3SU0A 2F3CE 3TH3H 1SLXB 3BEIB 1W10U 2GZ7A 5AHGH 2Z3EA 3N7OA 1V2JT 4DY7B 1J8AA 1O2NA 3GY2A 1MZAA 3RXDA 3U1IB 2H5DA 1OOKB 1EB2A 1VCWA 3VB5A 2A31A 3TPIZ 1GBLA 1QHRB 2C90B 3ODFA 5A2MH 2ZI2H 2K1QA 4B76A 3RXPA 1O3NA 1TBQH 4D9QA 7GCHG 2WYGA 3TJUA 1GCTB 2WYJA 4OGXA 4DT7B 3P6ZB 4K8YA 5TJXA 1FPHH 4OS7A 2ILNA 2HPQH 1EQ9A 1ZR0A 1P12E 1C5WB 3MNXA 4NIYA 5DP5A 4WMEA 3F9EA 1T32A 2QF0A 2P8OC 3BTQE 1KTSB 2B7DH 4TWWA 1SGIB 2Z7FE 2ANKH 3RXAA 2F9PA 4MVNA 3BTDE 5F6MA 1ELVA 2R9PA 4UEHH 1SGFG 1G3BA 1ORFA 3FP6E 1IQMA 1MU6B 2G5VA 1GHAG 1MTUA 3EQ0H 3LC5A 1AFQC 3U8RH 4UFFH 1AGJA 1W12U 1XM1A 2ZFQH 2OLGA 1C5PA 1TNIA 1KXAA 4I8HA 2BXUH 4BAHB 2D2DA 4MTBA 4ISNA 2OUAA 3B9FH 4Q7ZA 4AYYB 2BVRH 4MNVA 1OWHA 2ZDNA 2AMPA 2Z9JA 1GI2A 2FODA 3P8NA 3HGNA 1HAZB 3SV7A 2CF8H 1O5CB 2P8OB 1GBAA 3KN2A 1FN8A 4MPUA 3TK9A 2XBXA 4ZHLU 1F2SE 1SLVB 1AU8A 3U8OH 3T