1K0HA

Solution structure of bacteriophage lambda gpfii
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
117
structure length
117
Chain Sequence
MADFDNLFDAAIARADETIRGYMGTSATITSGEQSGAVIRGVFDDPENISYAGQGVRVEGSSPSLFVRTDEVRQLRRGDTLTIGEENFWVDRVSPDDGGSCHLWLGRGVPPAVNRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords gpFII
publication title The solution structure of the bacteriophage lambda head-tail joining protein, gpFII.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Viral protein
total genus 10
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2001-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05354 Phage_attach Phage Head-Tail Attachment
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.180 Mainly Beta Beta Barrel Thrombin, subunit H Phage tail proteins 1k0hA00
2KX4A 1K0HA
chains in the Genus database with same CATH superfamily
3RU4D 4XOJA 4M7GA 3FZZA 1CQQA 3PRDA 4Y7BA 3AW0A 2G5NA 3E1XB 4UFFH 1YCPM 2FOCA 4UDWH 4BTUB 2PUXB 1O2LA 3BTDE 2WPHS 1BDAA 4P02A 1FX0B 1TB6H 1PPCE 2FOFA 2C8XB 2P95A 3SV2H 2BDBA 4K2YA 1D3QB 4GCHF 1QA0A 1QRZA 1O5EH 1GI3A 3JZ2B 4K3JA 1BJVA 3EDXB 2CN0H 3M5MA 2NU0E 4TPYA 3A7XA 1E79D 1SI5H 1ANEA 3ZZ7A 2Q6DA 1RD3B 2BQ7B 1MU8B 2C3SA 2Z9IA 3URDA 1TBRH 1C2GA 3KN2A 3PO1C 1AU8A 1MTNC 2XBYA 2FESH 3RXUA 1AFQC 4YT7H 2BY5X 1XKBC 4BAMB 3MH7A 2K0QA 1SQAA 1P02A 1SQOA 4NA8A 5B6LA 5B6OA 3ZZ4A 2ZFPH 3VB6A 2W6ID 3QGNB 3T29A 1W7XH 3PMBB 1RTLA 3OSYA 3RUOA 4AFUA 2FOHA 3SOSA 1TMBH 1AFEH 2HRVA 3HGNA 4WMEA 3BTGE 3PV2A 5JBCS 2A32A 1HYLA 2R0LA 2Z9JA 5CE1A 1UTJA 5CHAB 1ANDA 3A7ZA 1P0SH 2WSSD 1GHAG 3FFGA 3QX5H 1O3PB 2G4TA 1GG6C 1HDTH 1C1OA 3ATIA 4AGKA 1O3DA 5DP6A 2JH6D 1AE5A 2VIVA 3PM3A 1UK4A 1C2EA 1O5BB 3TVJB 3ZZDA 1GHZA 2BOHB 1CHOF 2J4IA 1ANBA 1C2FA 3HATH 3MNCA 2ZTYA 4X8VH 1MCTA 2R0KA 3LIWA 3TGIE 1GWAA 1BRCE 2P3UB 4YM9A 1GMCG 2FLRH 4AGJA 4ACBA 3IG6B 3SYJA 3RMLH 3M7UA 4I8LA 2QF4A 1GBCA 1O3CA 3PV4A 2ZCKP 3LJOA 2GV6A 2H6MA 5FCKA 1AN1E 4AZ2B 2C4FH 2IJOB 1DLKB 2BVXH 1QBVH 3A87A 2DE8A 3AASA 5EW2H 5GPIB 3E0NB 3F0OA 4FU9A 2PW8H 3NCLA 4H42U 1W2KH 2BOKA 3VGCC 2BYAX 4ZHAA 5IYTA 5HIYA 2TIOA 1HAGE 3ZZAA 1J15A 1ZRBA 4JZIA 4Q4LA 1BTUA 1TPOA 1O2RA 5LPEA 3VB3A 1TIOA 2QXIA 1FUJA 1O2QA 1GBLA 2F83A 3NK8A 2XW9A 5F8ZA 2WUBA 2G4UA 2Z7FE 1MCVA 1A3EH 4X1NU 4OGXA 1XXFA 4Z1MD 1BTPA 1YCPK 3SHCH 4HI3A 3FAOA 1T4VH 2QF5A 5DSFA 3OE7D 3EA9A 4DVAU 3OTPA 4TYDA 5JB9S 3E91A 1P03A 2AYWA 3A7WA 1IAUA 3FP8E 3A80A 1AKSB 2AGEX 2BDHA 3MI4A 1OP8A 2O8MA 2JH5D 2UWOA 2KZ4A 3TGJE 1MTUA 1CT0E 1P12E 2FOAA 1GMDG 2BX4A 5DP7A 1AD8H 1O39A 1A0LA 4NSVA 1TGBA 3LGIA 2W7SA 4XBBA 3V0XA 1NFYA 3DFJA 1LKAA 1NBME 1LKBA 5I25A 4LK4A 3SJIA 2J2UA 1GI0A 4AFQA 3DSPA 4DCDA 3U8RH 4FUJA 1D3PB 4CRDA 3JZ1B 1FMGA 1VCQA 2O8LA 1F5RA 2DE9A 1HCGA 1PQ5A 1O34A 1QTFA 2BHGA 5C1UA 1LCYA 4RT1A 5GDSH 5SGAE 1TNHA 1Y3VA 1GCTB 1V2TT 2BY8X 5DP9A 1C5OH 1SPJA 4DIIH 1S5SA 2HGTH 3TK5A 1RIWC 4M9FA 3RXAA 4FUGA 3OEED 2SGDE 2H2ZA 3F2FA 1P2QA 5J4SA 1E1QD 1UTMA 5EPNA 3P95A 4B1TA 3Q76A 3L6PA 4X1RU 4IN2A 3S9CA 2ZDLA 4B71A 3NRLA 1GDNA 1NY22 1NZQH 5L2YH 2J95A 1IHTH 2CF9H 2KX4A 3MQKC 2XWAA 1UTOA 3I78A 4IC6A 2VINA 1S84A 1NT1A 3KYGA 3TIUA 2ZG0H 4B76A 2IJD1 3S69A 1X7AC 1O35A 2VIDA 1DUAA 5DP4A 2PSXA 2WV5A 1T8MA 2Y5GA 1UTNA 1Z1JA 1GMCF 1C9TA 1DT2A 4RKJB 3GY5A 2FWWA 1HUTH 1EX3A 4K1SA 2G5VA 2RA0A 1K22H 5CHBA 2J98B 1NU9A 1V3XA 2LNCA 1NC6A 3RXDA 1OWIA 2A2XH 2AEIH 2OTVA 1XUJA 3CNRA 5T6FA 3GDSA 4Y6DA 1SGCA 2GD4B 1ZPZA 1TAWA 1C5YB 3VB4A 4I86A 1SFIA 3SNEA 1GL1A 5JBTA 1ZPBA 3PO1B 4FUHA 1K0HA 4X6NA 3ZV9A 1P2MA 1P2JA 2OINA 1MBQA 3PWCA 4IGDA 3RXTA 4F48B 3DHKH 3BTQE 1GBJA 2VIOA 1A7SA 3MMGA 1SGRE 1W8BH 2IPQX 1NU7B 4XBDA 4YO9A 3TH3H 4AC9A 1SQTA 2Y7ZA 1EJAA 4K8BA 1K9OE 4A6LA 1GHBG 1TNGA 2BD5A 2WZQA 1AMHA 1QL7A 1ZTJA 1YWUA 1UTQA 2XBXA 2Y80A 2ZFSA 2HPQH 2A0QB 1AVGH 1YC0A 2VWOA 3EE7A 3Q77A 3BTEE 1PYTC 4Q2KA 1E37B 3T26A 1C5WB 3BF6H 3SU2A 1T8OA 1WXRA 3UWJH 4JYVH 4ABGA 1C1MA 4ZROA 1J14A 1Y5BT 3NPSA 1V6DA 4TSFD 2WPKS 1TRMA 1NS3A 5GIBA 1XUGA 2HALA 3TGKE 1GMDF 1IOEA 4WXIA 4CR9A 2GZ9A 1H8ED 3KQ5A 1FY3A 1ZGVA 3ESTA 2GZ7A 2B9LA 1YKTA 4X2VA 3RXQA 4I7YH 4MPUA 4K60A 5JB8S 4B74A 3W1EA 1QQ4A 3QN7A 5FBIA 2I6SA 2V7QD 1IQNA 2FS9A 2BD4A 3RXLA 2BD3A 2QE7D 4DURA 1GMHG 5L6NH 4Z6AH 2PTNA 2WYGA 2AIQA 1JWTA 1S0QA 1SGFG 3E0PB 2SNVA 1K1LA 1AY6H 2G51A 5T3HA 1SGYE 4WF8A 1AZ8A 2D1JA 2HPPH 2SFAA 4JYUH 1C5XB 4XE4A 2OP9A 4XDEA 1E36B 2IOTA 1A61H 1TGCA 2A31A 4MNVA 3SV6A 3ZYEA 3M36A 1O37A 1YCPH 4AB8A 3S7HB 2C8ZB 3A8DA 1S6LA 1A3BH 2EI7A 3KQDA 1BMAA 1BTYA 1F5LA 1HAPH 1MABB 1BT7A 3TJUA 1NROH 3DFLA 5E8EH 3H5CB 3LH3A 5FXLA 4JMYA 2ZDVH 4Y10E 5HKKD 1Q2WA 3QZRA 2WPMS 3NZIA 1MAYA 2THFB 1GJAB 5FPSA 1FDPA 1FI8A 2V35A 1OSSA 1MZAA 1SLVB 2ZHEH 5GNDA 2VIPA 1DDJA 1TOMH 1QCPA 1QIXB 4AG2A 5FL7D 1DPOA 4MDSA 4UE7H 2O8WA 5CHAC 2BXTH 3GY7A 1DX5M 1O3MA 2BY7X 2ASUB 4U2WA 3M35A 1TA2A 1KMHB 1SC8U 3ITIA 1H8IH 1O3LA 3PV5A 4QT8C 1O2VA 2FXRA 4B6EA 3ZVEA 2ZWLH 1UTLM 1C4V2 5A0BA 3KYFA 2A5AA 2BD9A 1AWHB 2Z94A 2BLOA 1YGCH 1L2EA 3MU1A 1HIAB 2FTMA 1JRSA 2OC1A 3MH4A 1RIWB 1MMJN 3FZDA 2R9PA 1AQ7A 1O33A 1G3CA 1J16A 1U6QA 1LDTT 1QJ1B 5L30H 3GY4A 4ISOA 3SUGA 4U01A 2BDAA 7LPRA 2VVUA 2NWNA 3SQHE 3TPIZ 1YPJH 1D9IA 2QV1A 1ANCA 3SJKA 1ID5H 1P9SA 1SKYE 2HLDD 4UONA 5IDKA 2C90B 1W0YH 2F9PA 2TGTA 3RM0H 4WWYA 1J17T 1E34B 2D2DA 2ZDNA 1Q3XA 2XC0A 1W0ZU 4NFEA 3SUFA 2NU4E 4U30A 3A85A 2Z9GA 2WPDD 1T8NA 2VWNA 3ZZ8A 2FO9A 1OPHB 1UCYE 3DUXH 2QIQA 3V3MA 1O5CB 1W7GH 2ZP0H 4NA9H 4Y79A 3S9AA 2BDYA 4WVPE 4GUXA 2OC8A 4A7IB 3M3SA 3R3GB 1Z1IA 4GHQA 1TQ7B 4SGAE 4SGBE 4ISIH 4BAHB 4OS5A 1LVMA 1TWXB 1OS8A 1V2MT 2FM2A 1VKYA 1TOCB 1O2OA 2EY4C 1B7XB 1TNJA 1QURH 2XC5A 5ESBA 1HAYB 3P70B 5H4IB 4BAKB 3EGKH 1ESAA 3CS7A 2HLCA 5LPFA 1AUTC 4MQAA 2AMDA 1UCYK 2ZCHP 4J2YB 1HJAB 1IQGA 1F0RA 1O38A 1TNLA 2BXUH 3UR9A 4DT4A 3GCOA 1HBTH 4TT3D 3RC4A 1UK2A 2OBQA 5DK1A 1OWHA 3ZVDA 4FVDA 3M61U 3H7TA 3RC5A 3RM2H 1K2I1 4GPGA 1H9LB 4FUDA 4B75A 1T31A 1ZRKA 1NRSH 1WUNH 4INHA 6LPRA 2QXHA 3GCHB 1A2CH 2J94A 4TY6A 1GJCB 5C3NA 1SG8B 2CGAA 3M37A 3MFJA 2BMGB 5EG4A 1VCWA 4ACAA 3RXPA 1NRQH 3LC5A 1Y3WA 1YM0A 4CRFA 3PLBA 1J8AA 2PUQH 1FZZA 3BIUH 3UNQA 2PLXA 3WW7A 1XKAC 2Q1JA 5E0JA 1ZJDA 2UUFB 4K1EA 1ORFA 2FDAA 1GJDB 1W13U 1XX9A 2GV7A 1C5QA 1GGDB 1O2KA 2WPJS 4GAWA 1O3GA 3M3TA 1C5LH 2ZGBH 1UTPA 1RJXB 3OU0A 4YTAA 2RDLA 1JMOH 1NESE 1HRTH 1VITG 3T25A 1DFPA 1SGDE 4AORA 3HKIB 1FN8A 4YXWD 1A5HA 3A8CA 3B23B 5FPTA 1EOJA 1GJ8B 3V7TA 4IBLH 4FU8A 2FI5E 2ZFFH 1EPTA 1PPZA 2XNDD 3PYHA 1JXPA 1VGCB 2L6OA 1G9IE 4IN1A 1PQ7A 2KM0A 2YMSD 1NN6A 4A92A 1FY8E 2EI6A 2ZHFH 3UTUH 2F91A 1ZSLA 3WWBA 2Q6GA 1J9CH 3BIVH 3QK1A 3M3VA 2AGGX 3UPEA 1ZHPA 2HVYB 4TY7A 1C2KA 2XTTB 3N7DA 1HXFH 3A8BA 5DGJA 3BEUA 5HM9A 1NRNH 1OKXA 1KTSB 3SNBA 3FOAA 3UNSA 3GCTG 1DSUA 1L1GA 1O3OA 4AX9H 2BD2A 2CXVA 1PPEE 3CENA 1ARCA 1P11E 1WYKA 1K1OA 3OX7U 1ZMJA 2ANMH 3F0PA 1QBNA 1UHBB 5JYIA 1P9UA 3UWIA 1H8DH 1QQUA 1GBEA 1BTWA 4B73A 2P94A 1RFNA 2Y81A 2XXLA 2SNWA 3GCNA 1HJ9A 3SGBE 2PGQB 3QLPH 1NBMD 3MTYA 2LELA 2ANYA 2BM2A 1AB9B 2Z6BD 1QJ6B 1EPTB 1O2YA 5E2PA 1V2WT 4KGAA 1K1MA 1QY6A 5G4BA 3OY5U 4JK6A 4ISHH 1O3FA 2BDCA 2W5EA 1SL3A 1Z6EA 2WPLS 1CSOE 3HPTB 2FI4E 1P05A 2VVCA 4DIHH 1A46H 2ALPA 3T27A 1C2JA 2Z9KA 1S85A 5AVDA 3T2NA 3KQBA 1O3NA 5C94A 3ZVFA 1ARBA 4I33A 3LGTA 5AHGH 1IQJA 1IQLA 1O2SA 3A8AA 1WV7H 5EIYA 1AUJA 1DY9A 5F03A 1O5GH 5FPYA 4ZHMU 1B0EA 1L1NA 4AG1A 3AK5A 1YPHE 5JBBS 2R2MB 3FO8D 1C9PA 2OC7A 4ZCNA 3SU3A 2OD3B 2L74A 4E06H 2ZEBA 3R0FA 1TGNA 3CP7A 3U8TH 1AWFH 1NO9H 3PLKA 5KGOA 1UVSH 3LGVA 8KME2 1P06A 1TRNA 1ELBA 4X8SH 1QL9A 2J5UA 5HIZA 5C20A 3RXEA 1E1RD 5EW1H 4RI0A 1C2DA 3E3TA 4IW4E 2ODQA 2R3YA 1Y3XA 2Y5FA 3RLWH 1P3CA 4K8YA 4I8KA 1DWEH 1VITF 1ELAA 3GOVB 1V2UT 2ZU1A 2VB0A 4ABHA 1ETSH 1DY8A 1Y3UA 3A82A 3UFAA 2PTCE 2TGDA 1GI7B 4UFDH 3SU1A 8GCHG 4E7NA 3GY3A 5DG6A 1Z71A 1B0FA 2AHME 2ZECA 1CE5A 1N6XA 3P6ZB 5K0HA 4D76A 1C5SA 1UCYH 3SNAA 4FUCA 4YLUA 5TCCA 4ZXXH 1OX1A 3LGYA 1SBWA 8LPRA 4AYYB 3K65B 1Z6JH 2H5DA 1ELCA 1TBQH 4JYTA 2PV9B 1EAWA 1FIWA 1ZSKA 3A88A 1KXEA 2YMSB 4O9VA 3UAIC 2BX3A 1OWEA 5JPMH 3RLYH 1C5RA 2BZ6H 3K2UA 1VCPA 2OUAA 5ETXA 1G30B 1QHRB 1BZXE 2BVRH 3SI3H 4I32A 4X1PU 1OYTH 3MU5A 3GCTF 1XUFA 2FOGA 5A8YA 2ANKH 1O2NA 1C1UH 5FX6A 3VB7A 4B2AA 1GBBA 1HGTH 3GYLB 1XMNB 2VBCA 4R0IA 4XRNA 5C17A 1S0RA 2GP9B 3T62A 2TBSA 5CDFE 1ZMLA 2H5CA 1F2SE 1BTZA 1KXFA 2ZZUH 4AFSA 2W26A 2C93B 1YLNA 2V3HH 2ZHWH 1C5NH 2SGPE 5AFZH 1GHAF 1VZQH 4MNYA 4X2WA 1QGFA 1COWD 7ESTE 1S83A 4NG9H 2BQWB 3SUEA 1CT2E 2FX4A 2EI8A 4OS4A 1HAZB 4CH8B 3W94A 1YPKH 3MH6A 7KMEH 3D49H 5FAHA 3OEHD 1AVXA 3HGPA 2KCOA 1Y8TA 1RRKA 1NRRH 4AN7A 2VWMA 2DUCA 1Y5AT 1ZMNA 1NFWA 4A1XA 1Z8RA 4OM9A 1H9HE 2ZTZA 1WQSA 4DT7B 1LQEA 1JBUH 1T32A 5TJXA 2W3KA 4NIYA 1SOZA 1TABE 5EXNA 3SORA 3ZZ3A 1A5IA 2ZFRH 2ULLA 3M7QA 3BTHE 1YBWA 3SUDA 4FVBA 2FX6A 1TBZH 1DSTA 2HWLB 2P3FH 1O2IA 3V12A 1LHEH 1AGJA 2F9BH 1TONA 2QCYA 4I31A 5BRRE 4D7FA 3TJNA 2CK3D 2FS8A 1XXDA 5HYOA 3BTWE 3EQ0H 1WQVH 2PP6A 1ZR0A 2ZQ2A 2OBOA 4D9RA 2ZHDA 1IQMA 4Y8XA 4OGYA 1ZYOA 3A84A 3IWMA 1SGPE 1ZTKA 4F4OC 5JDUB 3SBKA 1FY4A 3UNRA 3RXKA 1TRYA 3K9XB 1KIGH 1BB0B 3IITA 4ISNA 4A1VA 3P92A 4OS7A 1EKBB 1FONA 9LPRA 2QXJA 1O2PA 1KLJH 1THPB 2A5KA 2ZTXA 3NUMA 2ZU3A 5EJZA 1HJAC 2GCHG 3BG8A 1D4PB 3ENSB 1MTSA 4YZUA 3ZV8A 2A45B 3UOPA 4BANB 1CGJE 4BXSA 3OY6U 3AAUA 2ODYB 1GJ7B 1V2RT 3PB1E 3E90B 4LZ4B 8GCHF 2ILNA 2OLGA 3Q3KA 3GCHC 3SJ8A 1AIXH 5FHTA 1SGNE 4U32A 1DXWA 2K1QA 2WINI 1P2IA 2BY6X 2FYRA 3F9EA 1ZTLA 3B9FH 2AERH 3RXRA 1YPLH 2UUKB 1LHDH 1W10U 2VWLA 1YY3A 2HNTC 1S6FA 4JK5A 2BDIA 4KP0A 4B2CA 2Y82A 4DJZB 1PQ8A 3P8FA 3LGWA 2QXGA 3UIRA 5FX5A 1GGDC 2XCNA 3PLPA 1C2IA 3T28A 1MU6B 3MNXA 4JZ1A 5T6GA 4FUBA 2PR3A 1BBRE 3P8GA 3KEEA 1GI4A 1SLUB 9ESTA 3DA9B 2Z3EA 3EA8A 3TITA 2GT7A 3LONA 1EZXC 1UO6A 1MH0A 2PWXA 5GCHG 3NWUA 3UR6A 3ZZ9A 2BDGA 1PJPA 6CHAB 3U9AH 2VNTA 1PPHE 4I8HA 1VGCC 3F68H 3M7TA 1A0JA 3ZZ6A 2K8IA 3PROA 1SHYA 1MQ5A 1G2MA 3BEIB 1LTOA 2FOMB 1BBRK 2IPHA 1XUKA 1BITA 1KXAA 2FEQH 3KL6A 3A89A 4TPIZ 4ZKSU 1GJ5H 2NU3E 1KSNA 2ZI2H 1ELFA 1QJ7B 2BY9X 1GBAA 4CREA 1HAVA 3GISB 2RCEA 1TPPA 2PKSB 2UWPA 3D62A 1KLTA 5EU8A 1GVKB 1HJ8A 1RS0A 1LPGB 2QAAA 1QA7A 3SJ9A 2TGAA 2TPIZ 5KECA 2VIQA 3TH4H 1WSSH 3ZZBA 1SSXA 2BLVA 1OP2A 2GCTC 3E6PH 4NIVA 1BJUA 2SGQE 1ZSJA 1GI5A 1BQYA 1S6HA 3A7TA 4NA7A 3VEQB 1SFQB 4CH2B 4BAOB 4Y76A 1KTTB 1HAOH 4RSPA 1GCDA 1CO7E 5TCAA 2F9NA 4NGAH 2CHAB 1TNKA 4CBOA 1AB9C 1GDUA 1N8OB 3G01A 5HXFA 4Y71A 1EPTC 3VG8A 2C8YB 1B5GH 5F8TA 1P2KA 1UMAH 3DD2H 1LVBA 1RXPA 4D8NA 3RXMA 2KCAA 3HK6B 1GHBF 2JKHA 1H9IE 2YNAA 2EEKA 6ESTA 4UFGH 1C1NA 4JZFH 4ABFA 1HAIH 1C4Y2 4GSOA 1FIZA 2LP6A 4YT6H 3TNSA 3C27B 1GHYH 4KTSA 3P17H 1KXCA 1HAXB 1XM1A 2ZGHA 1TFXA 4IMQA 2ZGCA 3W95A 4ESTE 2KCYA 3Q00A 1DICA 1KYNA 2F9OA 1G2LA 1TE0A 1UTKA 1GBIA 2W7UA 4GVUA 1ACBE 1EZQA 3SNDA 4LZ1H 1FAXA 2KR7A 3RDZA 1O5FH 2ZFQH 3ATWA 1EASA 3DT0H 1O2UA 2CJIA 4BXWA 4UFEH 1GBTA 3TK9A 3T5FH 4JZEH 4HGCA 1BMMH 5DP3A 3FANA 1UJ1A 1JRTA 1L4DA 1MD7A 1UVTH 2P3TB 2GZ8A 1C5MD 1CGIE 3Q3XA 2VH6A 1SQRA 5LH8A 1GI9B 1GMHF 4FU7A 4FOUC 1C5ZB 4OS2A 2G52A 3ZVBA 2OCVB 1TGTA 1O2WA 2UUJB 1TQ0B 1KDQA 1SGIB 4AYVB 1O3JA 1GI6A 1INCA 4X8TH 3MU4A 4FXGH 2ZGJA 3QO6A 1OWDA 2ZGXH 3ELAH 4NCYA 1C1TA 1F7ZA 2ZDKA 3ODDA 1PFXC 4I8GA 1O3BA 1LQDB 1QFKH 5GXPA 1ZOMA 1DS2E 2W3IA 4X2XA 5C0UA 1D3DB 5T1VA 2G00A 5GJ4B 3SZEA 3URCA 4HFPB 1V2KT 4B6FA 3EA7A 1EATA 1V2JT 4Q80A 1F5KU 2YMSC 3QZQA 3O8BA 4WMDA 1WOFA 4ZUHA 5F53A 1V2LT 5EPYA 2JJ1D 1QB9A 4X6MA 1O2MA 3K6ZA 5DPAA 3MO3A 3NKKA 1XVOA 3H09A 3RXOA 3S7KB 1O36A 3GDUA 5A09A 5HM2A 2TRMA 1MKWK 4YOJA 3SV8A 3BN9A 2JETB 4ABJA 2B0FA 4CHAC 1QBOA 2GDEH 2ZIQH 3UREA 1D6RA 2CMYA 4INKA 2BLQA 2XBVA 2XCFA 1GBKA 7GCHG 4RT0A 2JJ2D 2LPRA 2A7HA 4NZQA 3SHAH 1O31A 5A8XA 2ESTE 1KDQB 2WPIS 1OOKB 5K7RA 3S0NA 2O8UA 3UQOA 1K1JA 1ESBA 4Q7XA 1K1IA 1C1PA 3F9HA 1DWBH 1FY1A 3BSQA 1C5UA 4FETA 4Y0ZE 1C1QA 1SGQE 1GBMA 1YF4A 2FMJA 1S82A 5C0TA 1C2HA 3AW1A 1CT4E 3KGPA 1SLWB 1ZHRA 4ZAEA 5ESTE 4AFZA 3KIDU 1A1RA 3KF2A 1W14U 1TA6A 1SR5C 2FI3E 3UOUA 4LOYH 1G3BA 3QDZB 1BBRH 3TLOA 2RDEA 1FNIA 4ABEA 1G3EA 1WTHD 2ZHQH 2FOEA 1LHGH 1TX8A 2ZKSA 5IK2D 2VH0A 3ZZ5A 5HGGA 4ABBA 3U98H 4ABDA 1YYY1 1CHGA 4DGJA 1Z8JB 2BD8A 3SV9A 2JDID 1ZPCA 3E16B 3SO3A 3F1SB 2CV3A 5DO4H 2B7DH 3BTME 2A4GA 2ANWA 4B2BA 1ETRH 3VB5A 4KELA 3KCGH 3N99A 2AMPA 2V3OH 3SN8A 1ZHMA 3VXEH 4D9QA 4O97A 1DUEA 1CVWH 1HAHH 1S81A 1YLDA 1SVPA 1HNEE 1DLEA 2GCTB 3MH5A 3U1JB 2ZPRA 4WMFA 2QF3A 4R8TB 2AMQA 2BD7A 2G8TA 3BTTE 1KXDA 3BV9B 2WUCA 1TNIA 2BQ6B 4X6PA 5DP5A 2QGRA 1N1LA 5LPRA 2Y7XA 1TPSA 3FN8A 2QC2A 1MTVA 4YESB 5C1YA 1O2XA 2PSYA 4HG6A 5AF9H 5C5OA 1K28D 5F6MA 1TYNA 1SHHB 1K1NA 5L2ZH 2A5IA 1MQ6A 1C1RA 2CF8H 2TGPZ 3BG4B 3STIA 4HZHA 2G55A 1THRH 1AZZA 1BRUP 4OS1A 1DE7H 4H4FA 2BTCE 5EQSA 2GDDA 2R2WU 3FKSD 4GLYA 1YPMH 1HLTH 1OWJA 4IS5A 2FZZA 1V2NT 1SGEE 1DVAH 4XFQA 2OK5A 1V2VT 1PPBH 1BOQA 2GKVE 5I46H 2GT8A 2F43B 1P01A 3UY9A 1T7CA 4ABIA 3RXFA 1ELGA 3P8NA 3ATLA 2VGCB 2XOKD 1ELVA 3UUZA 1AKSA 2D26C 1G37A 3EE0B 4X1SU 3VXFH 1LPZB 3I29A 3RU4E 1EOLA 1IQKA 1WDIA 3F9FA 3LGUA 2FOBA 3TH2H 6CHAC 1V2QT 3DSOA 4BTTB 1GJ9B 3TNTA 4XD7D 3FVFB 1JOUB 2EA3A 1BTHH 1BIOA 3GYMA 7GCHF 1EP6A 2ZPSA 1OP0A 1UK3A 4MTBA 3F2HA 1P57B 2GMTB 3GY8A 4CRCA 1WBGB 2J38A 2HNTF 1KLIH 1CA8B 2A7JA 4ASUD 2VVVA 4CBNA 3O8RA 1NPMA 3RU4T 1O2HA 1MKXK 4RKOB 1UW7A 1D3TB 1KXBA 2J92A 2UUYA 4X1QU 2SGFE 4YOGA 3AAVA 5F8XA 2PKSC 1FY5A 4ZMAH 2QY0B 2OC0A 2B8OH 1RTFB 1EAXA 4ABAA 3A83A 1UVOA 2AFQB 4Y8ZA 1SOTA 1CA0C 1O3KA 4MNWA 3CS0A 2GJGA 3RXSA 1QR3E 4I8JA 4X0WU 1BMNH 2RG3A 2A4QA 2FLBH 4X2YA 2FIRH 1TALA 5EXMA 4P00A 2RFKC 1NFXA 2UWLA 1F0UA 1LO6A 1SGTA 1AHTH 1EAIA 2V0BA 1DITH 2R3UA 1W0JD 3Q3YA 2CHAC 4ZKRU 1P04A 4A5TS 4DG4A 4O3TA 1MKWH 5LGOA 2JIZD 1WU1A 3LPRA 1IHSH 1N8OC 3N7EA 2G81E 1DXPA 2EQNA 1W0KD 4OS6A 1A0HB 1EXFA 1VITH 2SGEE 3SNCA 3QTOH 4NWLA 2J98A 1L0ZA 1M9UA 2PFEA 1QRXA 1L1JA 2BB4A 4O3UA 4CRAA 4CHAB 4J1YA 1N6YA 1TMUH 1E0FD 4Y7AA 1C4U2 2H9TH 1O3HA 1RGQA 1TLDA 1Y3YA 1YLCA 2PHBA 2XYAA 2YOLA 4GHTA 4A1TA 4Q7ZA 2A1DB 4Y0YE 2OQ5A 3A81A 2BZAA 4VGCB 3BTKE 3PRBA 1GPZA 1OHHD 1C5TA 1LHCH 1HXEH 2JH0D 5C2ZA 1WTGH 3N7OA 2QA9E 1O2TA 3TJVA 2AH4X 4Q63A 1LHFH 3PWBA 1EJMA 1IQHA 1QNJA 3RXBA 4KTUA 2P8OB 1PPGE 3SU4A 2GTBA 3AVZA 3F2GA 3I77A 1QB1A 1GHVH 5FCRA 3VPKA 1HB0B 3SU6A 1EQ9A 1OYQA 4INLA 4O03A 1G32B 2ZQ1A 1MAXA 2GGVB 3B8JA 2AGIX 4KTCA 2KCPA 1UVPA 2FP7B 1AE8H 2Z3DA 3QUMP 1C1WH 1GHXH 3H7OA 2ZO3H 4NFFA 4UD9H 5C5NA 2WYJA 2V3MA 1BA8B 3MU8A 3PTBA 3QTVH 3O8CA 1Q31A 4D7GA 1GVLA 2WV9A 5EQQA 3VFEA 3GS9A 1C5PA 2XBWA 4IC5A 1LVYA 1FV9A 3PMAB 1O5DH 1ABJH 4ZKNU 2V6NA 1GI1A 2C8WB 2A4RA 2H1UA 1QRWA 1SGFA 3A7VA 1MUEB 1E35B 1A4WH 1H8HD 3M5LA 4CRGA 1GBFA 3F3BA 1YPEH 3ZVGA 1ABIH 1PPFE 1TPAE 2Q6FA 3MWIU 3PTNA 2ZNKH 1P2NA 3RMMH 1MTNB 3GY6A 3F9GA 1AFQB 4MPVA 3O8DA 5A8ZA 4XBCA 2AIPA 3KQEA 3ZVCA 3MNBA 1HFDA 1CU1A 1L4ZA 2M5TA 1YPGH 4DW2U 5JBAS 2OXSA 2P16A 2Y6TA 5EOKA 3L33A 4WXVA 2STAE 3SGQE 4ISLA 4Y11E 3RMOH 5E0HA 1TMTH 1HPGA 1GJBB 2BLWA 2ZDMA 1EAUA 3D65E 3A86A 2HOBA 1GI8B 2EC9H 1JIMA 1O3AA 1TX7A 3RMNH 1CBWC 1E38B 3LU9B 1V2PT 5BPEA 1FPHH 3OYPA 1DOJA 3GY2A 2JETC 1GG6B 2FYQA 1LMWB 3RXIA 4UEHH 3RXHA 1CGHA 1ZZZA 4MLFB 3U1IB 2D8WA 3QWCH 1IQFA 3RXCA 1H4WA 1LPKB 4YOIA 1P09A 1G3DA 1XUHA 5EXLA 2GX4A 1KY9A 2RA3A 2A4OA 5EGMA 2ZDAH 3NXPA 2VU8E 1C1SA 2B5TB 1C2LA 1VJ9U 3M5OA 1GI2A 4X6OA 4NIXA 2FODA 2A7CA 3MU0A 1HV7A 3KQCA 5ABWA 4IMZA 4Q7YA 3D23A 4ZHLU 1EB1H 4DY7B 2XWBI 3QGJA 4Y8YA 4FUIA 2PKAA 1NTPA 2WHXA 1MTWA 2ALVA 1OWKA 2Y5HA 1MKXH 4FUFA 2F4LA 2ZFTA 4DOQA 4F55A 1GVZA 3OAAD 3SU5A 2J9NA 5C67A 1C5VA 3SJOA 3VGCB 4NSYA 1ESTA 1FPCH 2ODPA 2XNIA 6GCHG 4MNXA 2I6QA 3V13A 1W11U 4H6SB 3ATKA 3PMHB 4HTCH 1FXYA 3WY8A 1WAYB 1PYTD 1HIAA 1IQEA 1EZSC 5E2OA 3RXVA 4RN6A 4H6TA 3KHVA 1XVMA 2FTLE 1ZJKA 3LT3A 4LXBH 5DP8A 1CA0B 1DWDH 3UB0A 1GHWH 5A0AE 3MNSA 1K1PA 3M5NA 3LDXH 4ZH8A 1G36A 1C2MA 3E8LA 2XC4A 1C1VH 3SZNA 1O3IA 1W12U 4THNH 3ZIAD 3RC6A 4WH6A 1AO5A 1DANH 1NM6A 1AVWA 1FAKH 1Z7KA 2ZC9H 1BHXB 4BTIB 5AFYH 3S9BA 1ELEE 2HVXA 1IQIA 2KAIA 1OXGA 1F0SA 1XUIA 3TK6A 1SB1H 2PKAB 3BG4C 4FUEA 1P3EA 2VJ1A 3HK3B 1BRBE 3RXJA 2XRCA 1BUIA 3ATMA 3MYWA 1MD8A 4BNRA 5KEDA 2GCHF 1V2ST 1W3CA 4ZKOU 1O32A 3ZYDA 3SQEE 2OQUA 1T8LA 1VR1H 1LVOA 3LKWA 1FLEE 3LH1A 4NIWA 1F0TA 5PTPA 3GDVA 3DCLA 1FQ3A 1Y5UT 1SLXB 1MBMA 1ZGIA 3EYDA 2M2AA 2O9QA 1HAVB 2ZU5A 4K5ZA 1F92A 1QB6A 1DWCH 2VGCC 1ETTH 3HKJB 5A0CA 3C1KA 3SV7A 1H1BA 2ZPQA 5EJ1A 1Z8IB 2F9UA 3FP6E 1RTKA 4MG3A 4WY3A 2AS9A 1GBDA 4TWYA 4GCHG 5EODA 1O0DH 4AB9A 1Y59T 3SU0A 3LC3A 1O5AB 2SGAA 1P10A 1GJ4H 3RP2A 4ZXYH 3UQVA 4MPXA 1O2ZA 5EQRA 1ZLRA 2ZU2A 1A5GH 3FP7E 4CRBA 3ODFA 3P8OA 2GMTC 4TWWA 1DM4B 3BEFB 1BMLA 2NU1E 1GJ6A 4F49A 5T6DA 2KAIB 1YP9A 8ESTE 4CR5A 5J4QA 3L3TA 4BAQB 3GICB 1AI8H 1O3EA 2W6JD 3U69H 1TX6A 5GCHF 1MZDA 1Z8GA 1ELTA 1QL8A 2F3CE 4NWKA 1GBHA 2O8TA 2VIWA 1WCZA 4NZLA 3ZVAA 3TU7H 3EAJA 2NU2E 2FPZA 2H9EH 4WH8A 4XSKU 4YLQH 1UVUH 3PMJA 4K69A 2HNTE 1FN6A 1NRPH 4KKDA 3A7YA 3MO9A 1ELDE 1BTXA 2ZF0H 3STJA 2J34A 3BTFE 3U28C 5GWZA 5E0GA 1JIRA 1YPHC 5DKMA 4WJG2 2QYIA 3LOXA 4BOHA 2WV4A 2P93A 5CMXH 1CHOG 3TJOA 1EFRD 6GCHF 2BVSH 2Z3CA 5EJLA 1QZ8A 2ZA5A 3WWFA 2PGBB 4MVNA 4MPWA 3LJJA 3DSGA 1BMFD 4JCNA 3MO6A 1GL0E 1O30A 3KNXA 1P8VC 4E7RG 2J97A 3ZZCA 1T4UH 4AOQA 1CBWB 3OFND 2IN2A 4E05H 5A2MH 2H9HA 1NFUA 1FJSA 4Z0KA 3F6UH 3K6YA 5HMAA 2ZU4A 4PROA 2QN5T 5C1XA 1THSH 1D6WA 1EJNA 1P2OA 2GVFA 3SGAE 1O2GH 1BRAA 4VGCC 3MHWU 4X8UH 1GCTC 1V2OT 2P59A 2QF0A 2STBE 2ZCLP 5FBEA 2YNBA 1EP5A 1VJAU 3OTJE 2F9VA 1TGSZ 5DJ7A 3MOCA 2KFWA 4JZDH 2Z9LA 3U8OH 4ASHA 2P8OC 3RXGA 1BHXF 3SW2B 1O2JA 2A2QH 1BCUH 5DN6D 4K1TA 1EB2A 1SMFE 1K21H 1EUFA 1GDQA 3SI4H 1EZUC 1UHBA 1PQAA
chains in the Genus database with same CATH topology
2KX4A 1K0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KX4 A;  1K0H A; 
#chains in the Genus database with same CATH topology
 3RU4 D;  4XOJ A;  4M7G A;  3FZZ A;  1CQQ A;  3PRD A;  4Y7B A;  3AW0 A;  2G5N A;  3E1X B;  4UFF H;  1YCP M;  2FOC A;  4UDW H;  4BTU B;  2PUX B;  1O2L A;  3BTD E;  2WPH S;  1BDA A;  4P02 A;  1FX0 B;  1TB6 H;  1PPC E;  2FOF A;  2C8X B;  2P95 A;  3SV2 H;  2BDB A;  4K2Y A;  1D3Q B;  4GCH F;  1QA0 A;  1QRZ A;  1O5E H;  1GI3 A;  3JZ2 B;  4K3J A;  1BJV A;  3EDX B;  2CN0 H;  3M5M A;  2NU0 E;  4TPY A;  3A7X A;  1E79 D;  1SI5 H;  1ANE A;  3ZZ7 A;  2Q6D A;  1RD3 B;  2BQ7 B;  1MU8 B;  2C3S A;  2Z9I A;  3URD A;  1TBR H;  1C2G A;  3KN2 A;  3PO1 C;  1AU8 A;  1MTN C;  2XBY A;  2FES H;  3RXU A;  1AFQ C;  4YT7 H;  2BY5 X;  1XKB C;  4BAM B;  3MH7 A;  2K0Q A;  1SQA A;  1P02 A;  1SQO A;  4NA8 A;  5B6L A;  5B6O A;  3ZZ4 A;  2ZFP H;  3VB6 A;  2W6I D;  3QGN B;  3T29 A;  1W7X H;  3PMB B;  1RTL A;  3OSY A;  3RUO A;  4AFU A;  2FOH A;  3SOS A;  1TMB H;  1AFE H;  2HRV A;  3HGN A;  4WME A;  3BTG E;  3PV2 A;  5JBC S;  2A32 A;  1HYL A;  2R0L A;  2Z9J A;  5CE1 A;  1UTJ A;  5CHA B;  1AND A;  3A7Z A;  1P0S H;  2WSS D;  1GHA G;  3FFG A;  3QX5 H;  1O3P B;  2G4T A;  1GG6 C;  1HDT H;  1C1O A;  3ATI A;  4AGK A;  1O3D A;  5DP6 A;  2JH6 D;  1AE5 A;  2VIV A;  3PM3 A;  1UK4 A;  1C2E A;  1O5B B;  3TVJ B;  3ZZD A;  1GHZ A;  2BOH B;  1CHO F;  2J4I A;  1ANB A;  1C2F A;  3HAT H;  3MNC A;  2ZTY A;  4X8V H;  1MCT A;  2R0K A;  3LIW A;  3TGI E;  1GWA A;  1BRC E;  2P3U B;  4YM9 A;  1GMC G;  2FLR H;  4AGJ A;  4ACB A;  3IG6 B;  3SYJ A;  3RML H;  3M7U A;  4I8L A;  2QF4 A;  1GBC A;  1O3C A;  3PV4 A;  2ZCK P;  3LJO A;  2GV6 A;  2H6M A;  5FCK A;  1AN1 E;  4AZ2 B;  2C4F H;  2IJO B;  1DLK B;  2BVX H;  1QBV H;  3A87 A;  2DE8 A;  3AAS A;  5EW2 H;  5GPI B;  3E0N B;  3F0O A;  4FU9 A;  2PW8 H;  3NCL A;  4H42 U;  1W2K H;  2BOK A;  3VGC C;  2BYA X;  4ZHA A;  5IYT A;  5HIY A;  2TIO A;  1HAG E;  3ZZA A;  1J15 A;  1ZRB A;  4JZI A;  4Q4L A;  1BTU A;  1TPO A;  1O2R A;  5LPE A;  3VB3 A;  1TIO A;  2QXI A;  1FUJ A;  1O2Q A;  1GBL A;  2F83 A;  3NK8 A;  2XW9 A;  5F8Z A;  2WUB A;  2G4U A;  2Z7F E;  1MCV A;  1A3E H;  4X1N U;  4OGX A;  1XXF A;  4Z1M D;  1BTP A;  1YCP K;  3SHC H;  4HI3 A;  3FAO A;  1T4V H;  2QF5 A;  5DSF A;  3OE7 D;  3EA9 A;  4DVA U;  3OTP A;  4TYD A;  5JB9 S;  3E91 A;  1P03 A;  2AYW A;  3A7W A;  1IAU A;  3FP8 E;  3A80 A;  1AKS B;  2AGE X;  2BDH A;  3MI4 A;  1OP8 A;  2O8M A;  2JH5 D;  2UWO A;  2KZ4 A;  3TGJ E;  1MTU A;  1CT0 E;  1P12 E;  2FOA A;  1GMD G;  2BX4 A;  5DP7 A;  1AD8 H;  1O39 A;  1A0L A;  4NSV A;  1TGB A;  3LGI A;  2W7S A;  4XBB A;  3V0X A;  1NFY A;  3DFJ A;  1LKA A;  1NBM E;  1LKB A;  5I25 A;  4LK4 A;  3SJI A;  2J2U A;  1GI0 A;  4AFQ A;  3DSP A;  4DCD A;  3U8R H;  4FUJ A;  1D3P B;  4CRD A;  3JZ1 B;  1FMG A;  1VCQ A;  2O8L A;  1F5R A;  2DE9 A;  1HCG A;  1PQ5 A;  1O34 A;  1QTF A;  2BHG A;  5C1U A;  1LCY A;  4RT1 A;  5GDS H;  5SGA E;  1TNH A;  1Y3V A;  1GCT B;  1V2T T;  2BY8 X;  5DP9 A;  1C5O H;  1SPJ A;  4DII H;  1S5S A;  2HGT H;  3TK5 A;  1RIW C;  4M9F A;  3RXA A;  4FUG A;  3OEE D;  2SGD E;  2H2Z A;  3F2F A;  1P2Q A;  5J4S A;  1E1Q D;  1UTM A;  5EPN A;  3P95 A;  4B1T A;  3Q76 A;  3L6P A;  4X1R U;  4IN2 A;  3S9C A;  2ZDL A;  4B71 A;  3NRL A;  1GDN A;  1NY2 2;  1NZQ H;  5L2Y H;  2J95 A;  1IHT H;  2CF9 H;  2KX4 A;  3MQK C;  2XWA A;  1UTO A;  3I78 A;  4IC6 A;  2VIN A;  1S84 A;  1NT1 A;  3KYG A;  3TIU A;  2ZG0 H;  4B76 A;  2IJD 1;  3S69 A;  1X7A C;  1O35 A;  2VID A;  1DUA A;  5DP4 A;  2PSX A;  2WV5 A;  1T8M A;  2Y5G A;  1UTN A;  1Z1J A;  1GMC F;  1C9T A;  1DT2 A;  4RKJ B;  3GY5 A;  2FWW A;  1HUT H;  1EX3 A;  4K1S A;  2G5V A;  2RA0 A;  1K22 H;  5CHB A;  2J98 B;  1NU9 A;  1V3X A;  2LNC A;  1NC6 A;  3RXD A;  1OWI A;  2A2X H;  2AEI H;  2OTV A;  1XUJ A;  3CNR A;  5T6F A;  3GDS A;  4Y6D A;  1SGC A;  2GD4 B;  1ZPZ A;  1TAW A;  1C5Y B;  3VB4 A;  4I86 A;  1SFI A;  3SNE A;  1GL1 A;  5JBT A;  1ZPB A;  3PO1 B;  4FUH A;  1K0H A;  4X6N A;  3ZV9 A;  1P2M A;  1P2J A;  2OIN A;  1MBQ A;  3PWC A;  4IGD A;  3RXT A;  4F48 B;  3DHK H;  3BTQ E;  1GBJ A;  2VIO A;  1A7S A;  3MMG A;  1SGR E;  1W8B H;  2IPQ X;  1NU7 B;  4XBD A;  4YO9 A;  3TH3 H;  4AC9 A;  1SQT A;  2Y7Z A;  1EJA A;  4K8B A;  1K9O E;  4A6L A;  1GHB G;  1TNG A;  2BD5 A;  2WZQ A;  1AMH A;  1QL7 A;  1ZTJ A;  1YWU A;  1UTQ A;  2XBX A;  2Y80 A;  2ZFS A;  2HPQ H;  2A0Q B;  1AVG H;  1YC0 A;  2VWO A;  3EE7 A;  3Q77 A;  3BTE E;  1PYT C;  4Q2K A;  1E37 B;  3T26 A;  1C5W B;  3BF6 H;  3SU2 A;  1T8O A;  1WXR A;  3UWJ H;  4JYV H;  4ABG A;  1C1M A;  4ZRO A;  1J14 A;  1Y5B T;  3NPS A;  1V6D A;  4TSF D;  2WPK S;  1TRM A;  1NS3 A;  5GIB A;  1XUG A;  2HAL A;  3TGK E;  1GMD F;  1IOE A;  4WXI A;  4CR9 A;  2GZ9 A;  1H8E D;  3KQ5 A;  1FY3 A;  1ZGV A;  3EST A;  2GZ7 A;  2B9L A;  1YKT A;  4X2V A;  3RXQ A;  4I7Y H;  4MPU A;  4K60 A;  5JB8 S;  4B74 A;  3W1E A;  1QQ4 A;  3QN7 A;  5FBI A;  2I6S A;  2V7Q D;  1IQN A;  2FS9 A;  2BD4 A;  3RXL A;  2BD3 A;  2QE7 D;  4DUR A;  1GMH G;  5L6N H;  4Z6A H;  2PTN A;  2WYG A;  2AIQ A;  1JWT A;  1S0Q A;  1SGF G;  3E0P B;  2SNV A;  1K1L A;  1AY6 H;  2G51 A;  5T3H A;  1SGY E;  4WF8 A;  1AZ8 A;  2D1J A;  2HPP H;  2SFA A;  4JYU H;  1C5X B;  4XE4 A;  2OP9 A;  4XDE A;  1E36 B;  2IOT A;  1A61 H;  1TGC A;  2A31 A;  4MNV A;  3SV6 A;  3ZYE A;  3M36 A;  1O37 A;  1YCP H;  4AB8 A;  3S7H B;  2C8Z B;  3A8D A;  1S6L A;  1A3B H;  2EI7 A;  3KQD A;  1BMA A;  1BTY A;  1F5L A;  1HAP H;  1MAB B;  1BT7 A;  3TJU A;  1NRO H;  3DFL A;  5E8E H;  3H5C B;  3LH3 A;  5FXL A;  4JMY A;  2ZDV H;  4Y10 E;  5HKK D;  1Q2W A;  3QZR A;  2WPM S;  3NZI A;  1MAY A;  2THF B;  1GJA B;  5FPS A;  1FDP A;  1FI8 A;  2V35 A;  1OSS A;  1MZA A;  1SLV B;  2ZHE H;  5GND A;  2VIP A;  1DDJ A;  1TOM H;  1QCP A;  1QIX B;  4AG2 A;  5FL7 D;  1DPO A;  4MDS A;  4UE7 H;  2O8W A;  5CHA C;  2BXT H;  3GY7 A;  1DX5 M;  1O3M A;  2BY7 X;  2ASU B;  4U2W A;  3M35 A;  1TA2 A;  1KMH B;  1SC8 U;  3ITI A;  1H8I H;  1O3L A;  3PV5 A;  4QT8 C;  1O2V A;  2FXR A;  4B6E A;  3ZVE A;  2ZWL H;  1UTL M;  1C4V 2;  5A0B A;  3KYF A;  2A5A A;  2BD9 A;  1AWH B;  2Z94 A;  2BLO A;  1YGC H;  1L2E A;  3MU1 A;  1HIA B;  2FTM A;  1JRS A;  2OC1 A;  3MH4 A;  1RIW B;  1MMJ N;  3FZD A;  2R9P A;  1AQ7 A;  1O33 A;  1G3C A;  1J16 A;  1U6Q A;  1LDT T;  1QJ1 B;  5L30 H;  3GY4 A;  4ISO A;  3SUG A;  4U01 A;  2BDA A;  7LPR A;  2VVU A;  2NWN A;  3SQH E;  3TPI Z;  1YPJ H;  1D9I A;  2QV1 A;  1ANC A;  3SJK A;  1ID5 H;  1P9S A;  1SKY E;  2HLD D;  4UON A;  5IDK A;  2C90 B;  1W0Y H;  2F9P A;  2TGT A;  3RM0 H;  4WWY A;  1J17 T;  1E34 B;  2D2D A;  2ZDN A;  1Q3X A;  2XC0 A;  1W0Z U;  4NFE A;  3SUF A;  2NU4 E;  4U30 A;  3A85 A;  2Z9G A;  2WPD D;  1T8N A;  2VWN A;  3ZZ8 A;  2FO9 A;  1OPH B;  1UCY E;  3DUX H;  2QIQ A;  3V3M A;  1O5C B;  1W7G H;  2ZP0 H;  4NA9 H;  4Y79 A;  3S9A A;  2BDY A;  4WVP E;  4GUX A;  2OC8 A;  4A7I B;  3M3S A;  3R3G B;  1Z1I A;  4GHQ A;  1TQ7 B;  4SGA E;  4SGB E;  4ISI H;  4BAH B;  4OS5 A;  1LVM A;  1TWX B;  1OS8 A;  1V2M T;  2FM2 A;  1VKY A;  1TOC B;  1O2O A;  2EY4 C;  1B7X B;  1TNJ A;  1QUR H;  2XC5 A;  5ESB A;  1HAY B;  3P70 B;  5H4I B;  4BAK B;  3EGK H;  1ESA A;  3CS7 A;  2HLC A;  5LPF A;  1AUT C;  4MQA A;  2AMD A;  1UCY K;  2ZCH P;  4J2Y B;  1HJA B;  1IQG A;  1F0R A;  1O38 A;  1TNL A;  2BXU H;  3UR9 A;  4DT4 A;  3GCO A;  1HBT H;  4TT3 D;  3RC4 A;  1UK2 A;  2OBQ A;  5DK1 A;  1OWH A;  3ZVD A;  4FVD A;  3M61 U;  3H7T A;  3RC5 A;  3RM2 H;  1K2I 1;  4GPG A;  1H9L B;  4FUD A;  4B75 A;  1T31 A;  1ZRK A;  1NRS H;  1WUN H;  4INH A;  6LPR A;  2QXH A;  3GCH B;  1A2C H;  2J94 A;  4TY6 A;  1GJC B;  5C3N A;  1SG8 B;  2CGA A;  3M37 A;  3MFJ A;  2BMG B;  5EG4 A;  1VCW A;  4ACA A;  3RXP A;  1NRQ H;  3LC5 A;  1Y3W A;  1YM0 A;  4CRF A;  3PLB A;  1J8A A;  2PUQ H;  1FZZ A;  3BIU H;  3UNQ A;  2PLX A;  3WW7 A;  1XKA C;  2Q1J A;  5E0J A;  1ZJD A;  2UUF B;  4K1E A;  1ORF A;  2FDA A;  1GJD B;  1W13 U;  1XX9 A;  2GV7 A;  1C5Q A;  1GGD B;  1O2K A;  2WPJ S;  4GAW A;  1O3G A;  3M3T A;  1C5L H;  2ZGB H;  1UTP A;  1RJX B;  3OU0 A;  4YTA A;  2RDL A;  1JMO H;  1NES E;  1HRT H;  1VIT G;  3T25 A;  1DFP A;  1SGD E;  4AOR A;  3HKI B;  1FN8 A;  4YXW D;  1A5H A;  3A8C A;  3B23 B;  5FPT A;  1EOJ A;  1GJ8 B;  3V7T A;  4IBL H;  4FU8 A;  2FI5 E;  2ZFF H;  1EPT A;  1PPZ A;  2XND D;  3PYH A;  1JXP A;  1VGC B;  2L6O A;  1G9I E;  4IN1 A;  1PQ7 A;  2KM0 A;  2YMS D;  1NN6 A;  4A92 A;  1FY8 E;  2EI6 A;  2ZHF H;  3UTU H;  2F91 A;  1ZSL A;  3WWB A;  2Q6G A;  1J9C H;  3BIV H;  3QK1 A;  3M3V A;  2AGG X;  3UPE A;  1ZHP A;  2HVY B;  4TY7 A;  1C2K A;  2XTT B;  3N7D A;  1HXF H;  3A8B A;  5DGJ A;  3BEU A;  5HM9 A;  1NRN H;  1OKX A;  1KTS B;  3SNB A;  3FOA A;  3UNS A;  3GCT G;  1DSU A;  1L1G A;  1O3O A;  4AX9 H;  2BD2 A;  2CXV A;  1PPE E;  3CEN A;  1ARC A;  1P11 E;  1WYK A;  1K1O A;  3OX7 U;  1ZMJ A;  2ANM H;  3F0P A;  1QBN A;  1UHB B;  5JYI A;  1P9U A;  3UWI A;  1H8D H;  1QQU A;  1GBE A;  1BTW A;  4B73 A;  2P94 A;  1RFN A;  2Y81 A;  2XXL A;  2SNW A;  3GCN A;  1HJ9 A;  3SGB E;  2PGQ B;  3QLP H;  1NBM D;  3MTY A;  2LEL A;  2ANY A;  2BM2 A;  1AB9 B;  2Z6B D;  1QJ6 B;  1EPT B;  1O2Y A;  5E2P A;  1V2W T;  4KGA A;  1K1M A;  1QY6 A;  5G4B A;  3OY5 U;  4JK6 A;  4ISH H;  1O3F A;  2BDC A;  2W5E A;  1SL3 A;  1Z6E A;  2WPL S;  1CSO E;  3HPT B;  2FI4 E;  1P05 A;  2VVC A;  4DIH H;  1A46 H;  2ALP A;  3T27 A;  1C2J A;  2Z9K A;  1S85 A;  5AVD A;  3T2N A;  3KQB A;  1O3N A;  5C94 A;  3ZVF A;  1ARB A;  4I33 A;  3LGT A;  5AHG H;  1IQJ A;  1IQL A;  1O2S A;  3A8A A;  1WV7 H;  5EIY A;  1AUJ A;  1DY9 A;  5F03 A;  1O5G H;  5FPY A;  4ZHM U;  1B0E A;  1L1N A;  4AG1 A;  3AK5 A;  1YPH E;  5JBB S;  2R2M B;  3FO8 D;  1C9P A;  2OC7 A;  4ZCN A;  3SU3 A;  2OD3 B;  2L74 A;  4E06 H;  2ZEB A;  3R0F A;  1TGN A;  3CP7 A;  3U8T H;  1AWF H;  1NO9 H;  3PLK A;  5KGO A;  1UVS H;  3LGV A;  8KME 2;  1P06 A;  1TRN A;  1ELB A;  4X8S H;  1QL9 A;  2J5U A;  5HIZ A;  5C20 A;  3RXE A;  1E1R D;  5EW1 H;  4RI0 A;  1C2D A;  3E3T A;  4IW4 E;  2ODQ A;  2R3Y A;  1Y3X A;  2Y5F A;  3RLW H;  1P3C A;  4K8Y A;  4I8K A;  1DWE H;  1VIT F;  1ELA A;  3GOV B;  1V2U T;  2ZU1 A;  2VB0 A;  4ABH A;  1ETS H;  1DY8 A;  1Y3U A;  3A82 A;  3UFA A;  2PTC E;  2TGD A;  1GI7 B;  4UFD H;  3SU1 A;  8GCH G;  4E7N A;  3GY3 A;  5DG6 A;  1Z71 A;  1B0F A;  2AHM E;  2ZEC A;  1CE5 A;  1N6X A;  3P6Z B;  5K0H A;  4D76 A;  1C5S A;  1UCY H;  3SNA A;  4FUC A;  4YLU A;  5TCC A;  4ZXX H;  1OX1 A;  3LGY A;  1SBW A;  8LPR A;  4AYY B;  3K65 B;  1Z6J H;  2H5D A;  1ELC A;  1TBQ H;  4JYT A;  2PV9 B;  1EAW A;  1FIW A;  1ZSK A;  3A88 A;  1KXE A;  2YMS B;  4O9V A;  3UAI C;  2BX3 A;  1OWE A;  5JPM H;  3RLY H;  1C5R A;  2BZ6 H;  3K2U A;  1VCP A;  2OUA A;  5ETX A;  1G30 B;  1QHR B;  1BZX E;  2BVR H;  3SI3 H;  4I32 A;  4X1P U;  1OYT H;  3MU5 A;  3GCT F;  1XUF A;  2FOG A;  5A8Y A;  2ANK H;  1O2N A;  1C1U H;  5FX6 A;  3VB7 A;  4B2A A;  1GBB A;  1HGT H;  3GYL B;  1XMN B;  2VBC A;  4R0I A;  4XRN A;  5C17 A;  1S0R A;  2GP9 B;  3T62 A;  2TBS A;  5CDF E;  1ZML A;  2H5C A;  1F2S E;  1BTZ A;  1KXF A;  2ZZU H;  4AFS A;  2W26 A;  2C93 B;  1YLN A;  2V3H H;  2ZHW H;  1C5N H;  2SGP E;  5AFZ H;  1GHA F;  1VZQ H;  4MNY A;  4X2W A;  1QGF A;  1COW D;  7EST E;  1S83 A;  4NG9 H;  2BQW B;  3SUE A;  1CT2 E;  2FX4 A;  2EI8 A;  4OS4 A;  1HAZ B;  4CH8 B;  3W94 A;  1YPK H;  3MH6 A;  7KME H;  3D49 H;  5FAH A;  3OEH D;  1AVX A;  3HGP A;  2KCO A;  1Y8T A;  1RRK A;  1NRR H;  4AN7 A;  2VWM A;  2DUC A;  1Y5A T;  1ZMN A;  1NFW A;  4A1X A;  1Z8R A;  4OM9 A;  1H9H E;  2ZTZ A;  1WQS A;  4DT7 B;  1LQE A;  1JBU H;  1T32 A;  5TJX A;  2W3K A;  4NIY A;  1SOZ A;  1TAB E;  5EXN A;  3SOR A;  3ZZ3 A;  1A5I A;  2ZFR H;  2ULL A;  3M7Q A;  3BTH E;  1YBW A;  3SUD A;  4FVB A;  2FX6 A;  1TBZ H;  1DST A;  2HWL B;  2P3F H;  1O2I A;  3V12 A;  1LHE H;  1AGJ A;  2F9B H;  1TON A;  2QCY A;  4I31 A;  5BRR E;  4D7F A;  3TJN A;  2CK3 D;  2FS8 A;  1XXD A;  5HYO A;  3BTW E;  3EQ0 H;  1WQV H;  2PP6 A;  1ZR0 A;  2ZQ2 A;  2OBO A;  4D9R A;  2ZHD A;  1IQM A;  4Y8X A;  4OGY A;  1ZYO A;  3A84 A;  3IWM A;  1SGP E;  1ZTK A;  4F4O C;  5JDU B;  3SBK A;  1FY4 A;  3UNR A;  3RXK A;  1TRY A;  3K9X B;  1KIG H;  1BB0 B;  3IIT A;  4ISN A;  4A1V A;  3P92 A;  4OS7 A;  1EKB B;  1FON A;  9LPR A;  2QXJ A;  1O2P A;  1KLJ H;  1THP B;  2A5K A;  2ZTX A;  3NUM A;  2ZU3 A;  5EJZ A;  1HJA C;  2GCH G;  3BG8 A;  1D4P B;  3ENS B;  1MTS A;  4YZU A;  3ZV8 A;  2A45 B;  3UOP A;  4BAN B;  1CGJ E;  4BXS A;  3OY6 U;  3AAU A;  2ODY B;  1GJ7 B;  1V2R T;  3PB1 E;  3E90 B;  4LZ4 B;  8GCH F;  2ILN A;  2OLG A;  3Q3K A;  3GCH C;  3SJ8 A;  1AIX H;  5FHT A;  1SGN E;  4U32 A;  1DXW A;  2K1Q A;  2WIN I;  1P2I A;  2BY6 X;  2FYR A;  3F9E A;  1ZTL A;  3B9F H;  2AER H;  3RXR A;  1YPL H;  2UUK B;  1LHD H;  1W10 U;  2VWL A;  1YY3 A;  2HNT C;  1S6F A;  4JK5 A;  2BDI A;  4KP0 A;  4B2C A;  2Y82 A;  4DJZ B;  1PQ8 A;  3P8F A;  3LGW A;  2QXG A;  3UIR A;  5FX5 A;  1GGD C;  2XCN A;  3PLP A;  1C2I A;  3T28 A;  1MU6 B;  3MNX A;  4JZ1 A;  5T6G A;  4FUB A;  2PR3 A;  1BBR E;  3P8G A;  3KEE A;  1GI4 A;  1SLU B;  9EST A;  3DA9 B;  2Z3E A;  3EA8 A;  3TIT A;  2GT7 A;  3LON A;  1EZX C;  1UO6 A;  1MH0 A;  2PWX A;  5GCH G;  3NWU A;  3UR6 A;  3ZZ9 A;  2BDG A;  1PJP A;  6CHA B;  3U9A H;  2VNT A;  1PPH E;  4I8H A;  1VGC C;  3F68 H;  3M7T A;  1A0J A;  3ZZ6 A;  2K8I A;  3PRO A;  1SHY A;  1MQ5 A;  1G2M A;  3BEI B;  1LTO A;  2FOM B;  1BBR K;  2IPH A;  1XUK A;  1BIT A;  1KXA A;  2FEQ H;  3KL6 A;  3A89 A;  4TPI Z;  4ZKS U;  1GJ5 H;  2NU3 E;  1KSN A;  2ZI2 H;  1ELF A;  1QJ7 B;  2BY9 X;  1GBA A;  4CRE A;  1HAV A;  3GIS B;  2RCE A;  1TPP A;  2PKS B;  2UWP A;  3D62 A;  1KLT A;  5EU8 A;  1GVK B;  1HJ8 A;  1RS0 A;  1LPG B;  2QAA A;  1QA7 A;  3SJ9 A;  2TGA A;  2TPI Z;  5KEC A;  2VIQ A;  3TH4 H;  1WSS H;  3ZZB A;  1SSX A;  2BLV A;  1OP2 A;  2GCT C;  3E6P H;  4NIV A;  1BJU A;  2SGQ E;  1ZSJ A;  1GI5 A;  1BQY A;  1S6H A;  3A7T A;  4NA7 A;  3VEQ B;  1SFQ B;  4CH2 B;  4BAO B;  4Y76 A;  1KTT B;  1HAO H;  4RSP A;  1GCD A;  1CO7 E;  5TCA A;  2F9N A;  4NGA H;  2CHA B;  1TNK A;  4CBO A;  1AB9 C;  1GDU A;  1N8O B;  3G01 A;  5HXF A;  4Y71 A;  1EPT C;  3VG8 A;  2C8Y B;  1B5G H;  5F8T A;  1P2K A;  1UMA H;  3DD2 H;  1LVB A;  1RXP A;  4D8N A;  3RXM A;  2KCA A;  3HK6 B;  1GHB F;  2JKH A;  1H9I E;  2YNA A;  2EEK A;  6EST A;  4UFG H;  1C1N A;  4JZF H;  4ABF A;  1HAI H;  1C4Y 2;  4GSO A;  1FIZ A;  2LP6 A;  4YT6 H;  3TNS A;  3C27 B;  1GHY H;  4KTS A;  3P17 H;  1KXC A;  1HAX B;  1XM1 A;  2ZGH A;  1TFX A;  4IMQ A;  2ZGC A;  3W95 A;  4EST E;  2KCY A;  3Q00 A;  1DIC A;  1KYN A;  2F9O A;  1G2L A;  1TE0 A;  1UTK A;  1GBI A;  2W7U A;  4GVU A;  1ACB E;  1EZQ A;  3SND A;  4LZ1 H;  1FAX A;  2KR7 A;  3RDZ A;  1O5F H;  2ZFQ H;  3ATW A;  1EAS A;  3DT0 H;  1O2U A;  2CJI A;  4BXW A;  4UFE H;  1GBT A;  3TK9 A;  3T5F H;  4JZE H;  4HGC A;  1BMM H;  5DP3 A;  3FAN A;  1UJ1 A;  1JRT A;  1L4D A;  1MD7 A;  1UVT H;  2P3T B;  2GZ8 A;  1C5M D;  1CGI E;  3Q3X A;  2VH6 A;  1SQR A;  5LH8 A;  1GI9 B;  1GMH F;  4FU7 A;  4FOU C;  1C5Z B;  4OS2 A;  2G52 A;  3ZVB A;  2OCV B;  1TGT A;  1O2W A;  2UUJ B;  1TQ0 B;  1KDQ A;  1SGI B;  4AYV B;  1O3J A;  1GI6 A;  1INC A;  4X8T H;  3MU4 A;  4FXG H;  2ZGJ A;  3QO6 A;  1OWD A;  2ZGX H;  3ELA H;  4NCY A;  1C1T A;  1F7Z A;  2ZDK A;  3ODD A;  1PFX C;  4I8G A;  1O3B A;  1LQD B;  1QFK H;  5GXP A;  1ZOM A;  1DS2 E;  2W3I A;  4X2X A;  5C0U A;  1D3D B;  5T1V A;  2G00 A;  5GJ4 B;  3SZE A;  3URC A;  4HFP B;  1V2K T;  4B6F A;  3EA7 A;  1EAT A;  1V2J T;  4Q80 A;  1F5K U;  2YMS C;  3QZQ A;  3O8B A;  4WMD A;  1WOF A;  4ZUH A;  5F53 A;  1V2L T;  5EPY A;  2JJ1 D;  1QB9 A;  4X6M A;  1O2M A;  3K6Z A;  5DPA A;  3MO3 A;  3NKK A;  1XVO A;  3H09 A;  3RXO A;  3S7K B;  1O36 A;  3GDU A;  5A09 A;  5HM2 A;  2TRM A;  1MKW K;  4YOJ A;  3SV8 A;  3BN9 A;  2JET B;  4ABJ A;  2B0F A;  4CHA C;  1QBO A;  2GDE H;  2ZIQ H;  3URE A;  1D6R A;  2CMY A;  4INK A;  2BLQ A;  2XBV A;  2XCF A;  1GBK A;  7GCH G;  4RT0 A;  2JJ2 D;  2LPR A;  2A7H A;  4NZQ A;  3SHA H;  1O31 A;  5A8X A;  2EST E;  1KDQ B;  2WPI S;  1OOK B;  5K7R A;  3S0N A;  2O8U A;  3UQO A;  1K1J A;  1ESB A;  4Q7X A;  1K1I A;  1C1P A;  3F9H A;  1DWB H;  1FY1 A;  3BSQ A;  1C5U A;  4FET A;  4Y0Z E;  1C1Q A;  1SGQ E;  1GBM A;  1YF4 A;  2FMJ A;  1S82 A;  5C0T A;  1C2H A;  3AW1 A;  1CT4 E;  3KGP A;  1SLW B;  1ZHR A;  4ZAE A;  5EST E;  4AFZ A;  3KID U;  1A1R A;  3KF2 A;  1W14 U;  1TA6 A;  1SR5 C;  2FI3 E;  3UOU A;  4LOY H;  1G3B A;  3QDZ B;  1BBR H;  3TLO A;  2RDE A;  1FNI A;  4ABE A;  1G3E A;  1WTH D;  2ZHQ H;  2FOE A;  1LHG H;  1TX8 A;  2ZKS A;  5IK2 D;  2VH0 A;  3ZZ5 A;  5HGG A;  4ABB A;  3U98 H;  4ABD A;  1YYY 1;  1CHG A;  4DGJ A;  1Z8J B;  2BD8 A;  3SV9 A;  2JDI D;  1ZPC A;  3E16 B;  3SO3 A;  3F1S B;  2CV3 A;  5DO4 H;  2B7D H;  3BTM E;  2A4G A;  2ANW A;  4B2B A;  1ETR H;  3VB5 A;  4KEL A;  3KCG H;  3N99 A;  2AMP A;  2V3O H;  3SN8 A;  1ZHM A;  3VXE H;  4D9Q A;  4O97 A;  1DUE A;  1CVW H;  1HAH H;  1S81 A;  1YLD A;  1SVP A;  1HNE E;  1DLE A;  2GCT B;  3MH5 A;  3U1J B;  2ZPR A;  4WMF A;  2QF3 A;  4R8T B;  2AMQ A;  2BD7 A;  2G8T A;  3BTT E;  1KXD A;  3BV9 B;  2WUC A;  1TNI A;  2BQ6 B;  4X6P A;  5DP5 A;  2QGR A;  1N1L A;  5LPR A;  2Y7X A;  1TPS A;  3FN8 A;  2QC2 A;  1MTV A;  4YES B;  5C1Y A;  1O2X A;  2PSY A;  4HG6 A;  5AF9 H;  5C5O A;  1K28 D;  5F6M A;  1TYN A;  1SHH B;  1K1N A;  5L2Z H;  2A5I A;  1MQ6 A;  1C1R A;  2CF8 H;  2TGP Z;  3BG4 B;  3STI A;  4HZH A;  2G55 A;  1THR H;  1AZZ A;  1BRU P;  4OS1 A;  1DE7 H;  4H4F A;  2BTC E;  5EQS A;  2GDD A;  2R2W U;  3FKS D;  4GLY A;  1YPM H;  1HLT H;  1OWJ A;  4IS5 A;  2FZZ A;  1V2N T;  1SGE E;  1DVA H;  4XFQ A;  2OK5 A;  1V2V T;  1PPB H;  1BOQ A;  2GKV E;  5I46 H;  2GT8 A;  2F43 B;  1P01 A;  3UY9 A;  1T7C A;  4ABI A;  3RXF A;  1ELG A;  3P8N A;  3ATL A;  2VGC B;  2XOK D;  1ELV A;  3UUZ A;  1AKS A;  2D26 C;  1G37 A;  3EE0 B;  4X1S U;  3VXF H;  1LPZ B;  3I29 A;  3RU4 E;  1EOL A;  1IQK A;  1WDI A;  3F9F A;  3LGU A;  2FOB A;  3TH2 H;  6CHA C;  1V2Q T;  3DSO A;  4BTT B;  1GJ9 B;  3TNT A;  4XD7 D;  3FVF B;  1JOU B;  2EA3 A;  1BTH H;  1BIO A;  3GYM A;  7GCH F;  1EP6 A;  2ZPS A;  1OP0 A;  1UK3 A;  4MTB A;  3F2H A;  1P57 B;  2GMT B;  3GY8 A;  4CRC A;  1WBG B;  2J38 A;  2HNT F;  1KLI H;  1CA8 B;  2A7J A;  4ASU D;  2VVV A;  4CBN A;  3O8R A;  1NPM A;  3RU4 T;  1O2H A;  1MKX K;  4RKO B;  1UW7 A;  1D3T B;  1KXB A;  2J92 A;  2UUY A;  4X1Q U;  2SGF E;  4YOG A;  3AAV A;  5F8X A;  2PKS C;  1FY5 A;  4ZMA H;  2QY0 B;  2OC0 A;  2B8O H;  1RTF B;  1EAX A;  4ABA A;  3A83 A;  1UVO A;  2AFQ B;  4Y8Z A;  1SOT A;  1CA0 C;  1O3K A;  4MNW A;  3CS0 A;  2GJG A;  3RXS A;  1QR3 E;  4I8J A;  4X0W U;  1BMN H;  2RG3 A;  2A4Q A;  2FLB H;  4X2Y A;  2FIR H;  1TAL A;  5EXM A;  4P00 A;  2RFK C;  1NFX A;  2UWL A;  1F0U A;  1LO6 A;  1SGT A;  1AHT H;  1EAI A;  2V0B A;  1DIT H;  2R3U A;  1W0J D;  3Q3Y A;  2CHA C;  4ZKR U;  1P04 A;  4A5T S;  4DG4 A;  4O3T A;  1MKW H;  5LGO A;  2JIZ D;  1WU1 A;  3LPR A;  1IHS H;  1N8O C;  3N7E A;  2G81 E;  1DXP A;  2EQN A;  1W0K D;  4OS6 A;  1A0H B;  1EXF A;  1VIT H;  2SGE E;  3SNC A;  3QTO H;  4NWL A;  2J98 A;  1L0Z A;  1M9U A;  2PFE A;  1QRX A;  1L1J A;  2BB4 A;  4O3U A;  4CRA A;  4CHA B;  4J1Y A;  1N6Y A;  1TMU H;  1E0F D;  4Y7A A;  1C4U 2;  2H9T H;  1O3H A;  1RGQ A;  1TLD A;  1Y3Y A;  1YLC A;  2PHB A;  2XYA A;  2YOL A;  4GHT A;  4A1T A;  4Q7Z A;  2A1D B;  4Y0Y E;  2OQ5 A;  3A81 A;  2BZA A;  4VGC B;  3BTK E;  3PRB A;  1GPZ A;  1OHH D;  1C5T A;  1LHC H;  1HXE H;  2JH0 D;  5C2Z A;  1WTG H;  3N7O A;  2QA9 E;  1O2T A;  3TJV A;  2AH4 X;  4Q63 A;  1LHF H;  3PWB A;  1EJM A;  1IQH A;  1QNJ A;  3RXB A;  4KTU A;  2P8O B;  1PPG E;  3SU4 A;  2GTB A;  3AVZ A;  3F2G A;  3I77 A;  1QB1 A;  1GHV H;  5FCR A;  3VPK A;  1HB0 B;  3SU6 A;  1EQ9 A;  1OYQ A;  4INL A;  4O03 A;  1G32 B;  2ZQ1 A;  1MAX A;  2GGV B;  3B8J A;  2AGI X;  4KTC A;  2KCP A;  1UVP A;  2FP7 B;  1AE8 H;  2Z3D A;  3QUM P;  1C1W H;  1GHX H;  3H7O A;  2ZO3 H;  4NFF A;  4UD9 H;  5C5N A;  2WYJ A;  2V3M A;  1BA8 B;  3MU8 A;  3PTB A;  3QTV H;  3O8C A;  1Q31 A;  4D7G A;  1GVL A;  2WV9 A;  5EQQ A;  3VFE A;  3GS9 A;  1C5P A;  2XBW A;  4IC5 A;  1LVY A;  1FV9 A;  3PMA B;  1O5D H;  1ABJ H;  4ZKN U;  2V6N A;  1GI1 A;  2C8W B;  2A4R A;  2H1U A;  1QRW A;  1SGF A;  3A7V A;  1MUE B;  1E35 B;  1A4W H;  1H8H D;  3M5L A;  4CRG A;  1GBF A;  3F3B A;  1YPE H;  3ZVG A;  1ABI H;  1PPF E;  1TPA E;  2Q6F A;  3MWI U;  3PTN A;  2ZNK H;  1P2N A;  3RMM H;  1MTN B;  3GY6 A;  3F9G A;  1AFQ B;  4MPV A;  3O8D A;  5A8Z A;  4XBC A;  2AIP A;  3KQE A;  3ZVC A;  3MNB A;  1HFD A;  1CU1 A;  1L4Z A;  2M5T A;  1YPG H;  4DW2 U;  5JBA S;  2OXS A;  2P16 A;  2Y6T A;  5EOK A;  3L33 A;  4WXV A;  2STA E;  3SGQ E;  4ISL A;  4Y11 E;  3RMO H;  5E0H A;  1TMT H;  1HPG A;  1GJB B;  2BLW A;  2ZDM A;  1EAU A;  3D65 E;  3A86 A;  2HOB A;  1GI8 B;  2EC9 H;  1JIM A;  1O3A A;  1TX7 A;  3RMN H;  1CBW C;  1E38 B;  3LU9 B;  1V2P T;  5BPE A;  1FPH H;  3OYP A;  1DOJ A;  3GY2 A;  2JET C;  1GG6 B;  2FYQ A;  1LMW B;  3RXI A;  4UEH H;  3RXH A;  1CGH A;  1ZZZ A;  4MLF B;  3U1I B;  2D8W A;  3QWC H;  1IQF A;  3RXC A;  1H4W A;  1LPK B;  4YOI A;  1P09 A;  1G3D A;  1XUH A;  5EXL A;  2GX4 A;  1KY9 A;  2RA3 A;  2A4O A;  5EGM A;  2ZDA H;  3NXP A;  2VU8 E;  1C1S A;  2B5T B;  1C2L A;  1VJ9 U;  3M5O A;  1GI2 A;  4X6O A;  4NIX A;  2FOD A;  2A7C A;  3MU0 A;  1HV7 A;  3KQC A;  5ABW A;  4IMZ A;  4Q7Y A;  3D23 A;  4ZHL U;  1EB1 H;  4DY7 B;  2XWB I;  3QGJ A;  4Y8Y A;  4FUI A;  2PKA A;  1NTP A;  2WHX A;  1MTW A;  2ALV A;  1OWK A;  2Y5H A;  1MKX H;  4FUF A;  2F4L A;  2ZFT A;  4DOQ A;  4F55 A;  1GVZ A;  3OAA D;  3SU5 A;  2J9N A;  5C67 A;  1C5V A;  3SJO A;  3VGC B;  4NSY A;  1EST A;  1FPC H;  2ODP A;  2XNI A;  6GCH G;  4MNX A;  2I6Q A;  3V13 A;  1W11 U;  4H6S B;  3ATK A;  3PMH B;  4HTC H;  1FXY A;  3WY8 A;  1WAY B;  1PYT D;  1HIA A;  1IQE A;  1EZS C;  5E2O A;  3RXV A;  4RN6 A;  4H6T A;  3KHV A;  1XVM A;  2FTL E;  1ZJK A;  3LT3 A;  4LXB H;  5DP8 A;  1CA0 B;  1DWD H;  3UB0 A;  1GHW H;  5A0A E;  3MNS A;  1K1P A;  3M5N A;  3LDX H;  4ZH8 A;  1G36 A;  1C2M A;  3E8L A;  2XC4 A;  1C1V H;  3SZN A;  1O3I A;  1W12 U;  4THN H;  3ZIA D;  3RC6 A;  4WH6 A;  1AO5 A;  1DAN H;  1NM6 A;  1AVW A;  1FAK H;  1Z7K A;  2ZC9 H;  1BHX B;  4BTI B;  5AFY H;  3S9B A;  1ELE E;  2HVX A;  1IQI A;  2KAI A;  1OXG A;  1F0S A;  1XUI A;  3TK6 A;  1SB1 H;  2PKA B;  3BG4 C;  4FUE A;  1P3E A;  2VJ1 A;  3HK3 B;  1BRB E;  3RXJ A;  2XRC A;  1BUI A;  3ATM A;  3MYW A;  1MD8 A;  4BNR A;  5KED A;  2GCH F;  1V2S T;  1W3C A;  4ZKO U;  1O32 A;  3ZYD A;  3SQE E;  2OQU A;  1T8L A;  1VR1 H;  1LVO A;  3LKW A;  1FLE E;  3LH1 A;  4NIW A;  1F0T A;  5PTP A;  3GDV A;  3DCL A;  1FQ3 A;  1Y5U T;  1SLX B;  1MBM A;  1ZGI A;  3EYD A;  2M2A A;  2O9Q A;  1HAV B;  2ZU5 A;  4K5Z A;  1F92 A;  1QB6 A;  1DWC H;  2VGC C;  1ETT H;  3HKJ B;  5A0C A;  3C1K A;  3SV7 A;  1H1B A;  2ZPQ A;  5EJ1 A;  1Z8I B;  2F9U A;  3FP6 E;  1RTK A;  4MG3 A;  4WY3 A;  2AS9 A;  1GBD A;  4TWY A;  4GCH G;  5EOD A;  1O0D H;  4AB9 A;  1Y59 T;  3SU0 A;  3LC3 A;  1O5A B;  2SGA A;  1P10 A;  1GJ4 H;  3RP2 A;  4ZXY H;  3UQV A;  4MPX A;  1O2Z A;  5EQR A;  1ZLR A;  2ZU2 A;  1A5G H;  3FP7 E;  4CRB A;  3ODF A;  3P8O A;  2GMT C;  4TWW A;  1DM4 B;  3BEF B;  1BML A;  2NU1 E;  1GJ6 A;  4F49 A;  5T6D A;  2KAI B;  1YP9 A;  8EST E;  4CR5 A;  5J4Q A;  3L3T A;  4BAQ B;  3GIC B;  1AI8 H;  1O3E A;  2W6J D;  3U69 H;  1TX6 A;  5GCH F;  1MZD A;  1Z8G A;  1ELT A;  1QL8 A;  2F3C E;  4NWK A;  1GBH A;  2O8T A;  2VIW A;  1WCZ A;  4NZL A;  3ZVA A;  3TU7 H;  3EAJ A;  2NU2 E;  2FPZ A;  2H9E H;  4WH8 A;  4XSK U;  4YLQ H;  1UVU H;  3PMJ A;  4K69 A;  2HNT E;  1FN6 A;  1NRP H;  4KKD A;  3A7Y A;  3MO9 A;  1ELD E;  1BTX A;  2ZF0 H;  3STJ A;  2J34 A;  3BTF E;  3U28 C;  5GWZ A;  5E0G A;  1JIR A;  1YPH C;  5DKM A;  4WJG 2;  2QYI A;  3LOX A;  4BOH A;  2WV4 A;  2P93 A;  5CMX H;  1CHO G;  3TJO A;  1EFR D;  6GCH F;  2BVS H;  2Z3C A;  5EJL A;  1QZ8 A;  2ZA5 A;  3WWF A;  2PGB B;  4MVN A;  4MPW A;  3LJJ A;  3DSG A;  1BMF D;  4JCN A;  3MO6 A;  1GL0 E;  1O30 A;  3KNX A;  1P8V C;  4E7R G;  2J97 A;  3ZZC A;  1T4U H;  4AOQ A;  1CBW B;  3OFN D;  2IN2 A;  4E05 H;  5A2M H;  2H9H A;  1NFU A;  1FJS A;  4Z0K A;  3F6U H;  3K6Y A;  5HMA A;  2ZU4 A;  4PRO A;  2QN5 T;  5C1X A;  1THS H;  1D6W A;  1EJN A;  1P2O A;  2GVF A;  3SGA E;  1O2G H;  1BRA A;  4VGC C;  3MHW U;  4X8U H;  1GCT C;  1V2O T;  2P59 A;  2QF0 A;  2STB E;  2ZCL P;  5FBE A;  2YNB A;  1EP5 A;  1VJA U;  3OTJ E;  2F9V A;  1TGS Z;  5DJ7 A;  3MOC A;  2KFW A;  4JZD H;  2Z9L A;  3U8O H;  4ASH A;  2P8O C;  3RXG A;  1BHX F;  3SW2 B;  1O2J A;  2A2Q H;  1BCU H;  5DN6 D;  4K1T A;  1EB2 A;  1SMF E;  1K21 H;  1EUF A;  1GDQ A;  3SI4 H;  1EZU C;  1UHB A;  1PQA A; 
#chains in the Genus database with same CATH homology
 2KX4 A;  1K0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...