1K0HA

Solution structure of bacteriophage lambda gpfii
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
117
structure length
117
Chain Sequence
MADFDNLFDAAIARADETIRGYMGTSATITSGEQSGAVIRGVFDDPENISYAGQGVRVEGSSPSLFVRTDEVRQLRRGDTLTIGEENFWVDRVSPDDGGSCHLWLGRGVPPAVNRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords gpFII
publication title The solution structure of the bacteriophage lambda head-tail joining protein, gpFII.
pubmed doi rcsb
source organism Enterobacteria phage lambda
total genus 10
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2001-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05354 Phage_attach Phage Head-Tail Attachment
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.180 Mainly Beta Beta Barrel Thrombin, subunit H Phage tail proteins 1k0hA00
1K0HA 2KX4A
chains in the Genus database with same CATH superfamily
4IS5A 2FLBH 2FZZA 4MPUA 1E1RD 3OEED 2BDBA 2G4UA 1SI5H 1J16A 2CXVA 4ZKRU 3UWIA 5DG6A 1GI3A 1EZQA 2OCVB 3EA7A 5AFZH 1O37A 1KXAA 7GCHF 5KEDA 2A4RA 1TBQH 5C5OA 1K2I1 3GCNA 1QNJA 1D6RA 3TK9A 2A2QH 4AFZA 1Y3WA 3OE7D 4MNYA 1QRWA 4A1XA 3ZV8A 4R8TB 4X6MA 1WDIA 2D8WA 1GBEA 2ZU2A 3KIDU 3UY9A 2FOFA 5CHAB 2Z9IA 2PKSC 2UUFB 4Y71A 1GBJA 1HAXB 2V3HH 2UWPA 4Q4LA 1AKSA 4FUEA 3S9AA 3MO3A 1C2FA 1GMCG 1A0LA 3RMLH 1THSH 3M3VA 1RJXB 4VGCC 5H4IB 1V2LT 3I78A 3GY7A 1O3BA 1WAYB 2JETB 4D9RA 4XRNA 2SNWA 1C2JA 3TITA 3VFEA 3F3BA 3UNQA 1O2LA 1GJDB 4MLFB 1F92A 1GDNA 1DXPA 2DE9A 1G3CA 1LPZB 3GYLB 3PTBA 4GHQA 5LH8A 1SG8B 1RTKA 1C2GA 3UB0A 1ETSH 5DP9A 3PLKA 2AERH 1IQLA 2FOAA 1ETRH 1O3OA 2F9OA 1C5LH 1BB0B 1V2QT 4YESB 1Z71A 3BG4C 4DT4A 1SQAA 1TBZH 4OGYA 1OS8A 1GJ7B 4A7IB 1B0EA 1BTXA 5C5NA 5DO4H 2IJD1 3F9HA 4K69A 1TOMH 3MU1A 1FN8A 1BTPA 3WY8A 4MPXA 1TAWA 4FUHA 2OTVA 1OXGA 3A8BA 1AE5A 5C0UA 4ISLA 3KQ5A 3O8BA 3K6YA 2WYJA 3PO1B 4ESTE 1E37B 2BDCA 2W26A 3I29A 1V2NT 3M35A 2ZU5A 1VJAU 1T8MA 3MH5A 1C5PA 1P01A 1MUEB 1NZQH 4P02A 4XFQA 5FPTA 4Z1MD 3B9FH 3SJOA 3STIA 4CREA 1MCTA 3PV2A 3N7DA 1MZAA 1PFXC 2ANWA 2BTCE 1ELAA 3KF2A 1WV7H 1YLCA 5BPEA 2WV5A 1L1GA 4JK6A 2IJOB 3PWCA 2V3OH 1DUEA 1O2SA 2Y81A 3MNXA 1EOLA 4TT3D 1DWEH 2AS9A 2J2UA 2BY5X 1C2LA 4ISOA 1W11U 3GOVB 2VWOA 3F6UH 1L0ZA 3EE7A 4O3UA 5CMXH 2LNCA 1P11E 3NUMA 3RXPA 1GMCF 5A0AE 2J97A 1HXFH 1BCUH 1OP2A 1G2LA 1QHRB 2D2DA 1ELVA 2ZA5A 4AX9H 2ZDVH 2UUKB 1EP6A 3OU0A 2J5UA 2W7UA 4VGCB 5CHBA 5T1VA 4IMQA 3S9CA 1EP5A 1HAOH 4WH6A 3BTEE 2FLRH 3LPRA 3M7TA 1FN6A 4AFSA 2L74A 1ZLRA 2WINI 1TIOA 1YKTA 3F2GA 1DWDH 1KTTB 2C90B 5EXNA 3RXJA 2G81E 2XWBI 1BZXE 2FM2A 1LO6A 3QTOH 3S69A 3C27B 1YYY1 4K1EA 3QK1A 1DPOA 4AFUA 2HLDD 1GI8B 1P05A 1MBMA 1GI5A 1AIXH 1HPGA 5TCCA 1QZ8A 2RG3A 1E79D 3HGNA 2XTTB 4AB9A 3BEUA 1AB9B 4XE4A 4SGBE 3L6PA 1XUGA 4E05H 4DURA 1W3CA 3HKIB 3RXKA 1W7XH 2V6NA 3TJNA 3VXFH 4Y76A 4IGDA 4ABGA 4TY7A 1BTYA 3P95A 3DSPA 3NK8A 3GCTG 3PRBA 3BN9A 5I25A 1J14A 3MH6A 3PMAB 4O03A 1QJ1B 1JXPA 3PRDA 5EJLA 5DPAA 3ATMA 1GBDA 1M9UA 4NWKA 5A8ZA 1AFQC 2A7JA 1BOQA 1NU7B 4RI0A 1C1RA 1SGIB 1C2EA 1RGQA 5FCRA 1SGEE 2CK3D 2FMJA 1KYNA 1T31A 3E0PB 5FAHA 3SN8A 4IC5A 5IYTA 3ITIA 1GI4A 1SGFA 1C2DA 1FXYA 3VB6A 2QYIA 1UK3A 2OINA 1SLXB 3LC5A 2SGEE 1IHSH 3OYPA 1DFPA 1Z6EA 4ABBA 1MKXK 1GBBA 3EA8A 4ACAA 2D1JA 3V7TA 3QX5H 3SV9A 1GJ6A 3V12A 3NPSA 3ZZ5A 1O5EH 3A8AA 2H9TH 1DICA 1X7AC 1DANH 2BD7A 2QCYA 3R0FA 1VZQH 4H6SB 2ZDLA 1GI1A 1W0ZU 3H09A 3DSOA 1HAHH 2A4OA 3WWBA 3ZYEA 3D49H 2ZDNA 1YPKH 2OC1A 2BY6X 4PROA 2JH0D 1G3EA 1PPZA 3W94A 4KGAA 2XC5A 1TX8A 5JPMH 4NA7A 5F53A 1TE0A 1LDTT 2OC7A 2I6QA 1HAVB 3B23B 1C2HA 2A5IA 2W3IA 3ODDA 2J95A 2IOTA 1LQEA 2F91A 4CR9A 1CBWB 1HJ9A 2GCTC 3E3TA 1BHXF 2ZCKP 5AF9H 2BX3A 3P8NA 3SUFA 1EAUA 1UTJA 1MCVA 1SOZA 1S84A 2WUCA 3PLBA 1K0HA 4ISIH 5T3HA 3U8OH 1JWTA 1K1PA 1DOJA 1L1NA 1IQJA 2P8OB 1ABIH 1BRAA 2AMDA 2ZPSA 2PLXA 5HM2A 1LHGH 1NN6A 1O2NA 3OTPA 4I31A 4LZ1H 2Q6FA 1PQAA 3UOPA 3TGJE 3GCTF 2SGAA 1C2IA 4K5ZA 2FX6A 1UW7A 2ZCHP 1KLIH 1YP9A 1O2MA 2A4GA 1P2IA 1GI0A 1ZHPA 1TPSA 4LOYH 1WSSH 4WMDA 1QY6A 2Z9GA 4GCHG 2V35A 3G01A 4ABEA 2BOHB 1P2KA 3SHAH 4CRDA 4K2YA 3KQDA 2Y82A 1ZSLA 5C2ZA 2GV6A 1A0HB 4INLA 2ZFSA 5AVDA 1SL3A 5E0HA 2AGGX 4OM9A 2Z7FE 1GJ5H 1ZGIA 4HFPB 1QL8A 3ZZ4A 1OPHB 6ESTA 1SB1H 4Y7BA 1A0JA 3N99A 4NFFA 1P9SA 1T4VH 3ENSB 3LGWA 4NIVA 3ZVFA 4B75A 1MKXH 1QJ7B 1WCZA 2P16A 2QIQA 2ZCLP 3U28C 2BD2A 3M5MA 4H4FA 4R0IA 1S82A 1GDUA 1PYTD 1S6FA 1C4U2 3A7WA 4XBCA 1EJNA 4AN7A 1G2MA 2V3MA 3LH3A 4DW2U 1XXFA 3LGYA 4XDEA 4INKA 1GJAB 1UVSH 1V2RT 3UOUA 2BVSH 3FN8A 2WV9A 1KXFA 1ELFA 2ZQ1A 3ZZAA 1PPHE 1GI2A 3GY4A 1P06A 4ZH8A 3SI3H 1QJ6B 3CENA 1FNIA 4JYUH 2Z9KA 3M3TA 4Y8ZA 5FBIA 4MPVA 1T8OA 1E38B 5EGMA 1O3JA 2KCOA 2XNDD 4X0WU 1OX1A 4NG9H 4SGAE 1ZRKA 2R0KA 1CU1A 1BMNH 4K1SA 2WHXA 2FO9A 1HXEH 3UTUH 5EW1H 1S83A 3RMNH 2F9VA 2ZWLH 2K0QA 1BT7A 5HIZA 3ZV9A 4JZEH 2HLCA 5K0HA 4TY6A 1TMUH 4GVUA 2YNBA 2VWMA 3BTFE 1ZPBA 4GCHF 1QCPA 3EGKH 3F9EA 2GDDA 4I8HA 3T2NA 1DY9A 1TPAE 1F5RA 1TMBH 3KQEA 5GIBA 1P09A 3SGBE 3UNSA 1TNLA 4CH8B 1EATA 2ZGBH 4CRFA 1C4V2 1HRTH 1GHAG 3SUDA 1KXDA 2H5DA 2Q6DA 1HDTH 4ABHA 3SNBA 1YLDA 3N7EA 4Q7XA 4ASHA 1O3MA 4BAMB 2KCAA 1BBRK 4AYYB 3P8GA 1QURH 3OY5U 3LU9B 3BTGE 1QQ4A 2Y7XA 5DP4A 2QA9E 3RC5A 1MAXA 1SGNE 4J2YB 4D8NA 2FEQH 4XBDA 6LPRA 5EQQA 1AO5A 5EJZA 4X2YA 4I32A 1PQ7A 1FLEE 2ZNKH 2BZ6H 3VB5A 1E1QD 1KLJH 2EY4C 2ZGJA 1BMFD 2ZI2H 4DG4A 3ATIA 1SGQE 2QXIA 1YPGH 3NRLA 1TGCA 2A31A 3RLYH 1DUAA 1O3NA 2TGAA 5GJ4B 2P3TB 1TALA 1QGFA 4CHAC 1ELGA 1VCWA 2VWLA 4Y79A 3M37A 1AWHB 3D65E 1KDQA 1P2JA 3BEIB 3VB3A 2CMYA 3SJ9A 4E7NA 2ZFTA 1SFQB 3E0NB 3T27A 1D9IA 1QRXA 1EZXC 1IQGA 5EQSA 1C1TA 1SGTA 1W12U 1ABJH 3U1JB 4OGXA 1EAXA 3UQVA 4CBNA 1ANCA 1KLTA 2ZU4A 2ILNA 4IBLH 4IMZA 4Z0KA 2G8TA 1CT2E 2BMGB 1AFEH 3N7OA 2G5VA 3TGIE 1UCYH 2FS8A 3F2HA 1LVOA 1OP8A 1T7CA 1F7ZA 5C20A 2Y7ZA 4CRBA 3SV8A 3EAJA 2GX4A 2G55A 2HGTH 4KKDA 4ZUHA 1G30B 3A8CA 4UFFH 1TPOA 2KZ4A 3GDSA 1GHAF 5HYOA 2DUCA 5DJ7A 3A87A 1FY3A 2EEKA 3MYWA 3PO1C 4FUGA 5C17A 1GHXH 2QGRA 2F4LA 3F68H 1BTUA 4FETA 4K1TA 1MD8A 1FY5A 2FYQA 2Y6TA 1JMOH 5ABWA 2OQUA 2F3CE 3RXHA 2VIQA 1O5CB 2SGQE 3ATKA 2P59A 5J4SA 4NSYA 2FI5E 1V2ST 1HAVA 3IITA 4WVPE 2WPIS 4E06H 1SLUB 1CGHA 3BTTE 3MU4A 2VH0A 3QLPH 1A3EH 2EA3A 1W14U 1J8AA 2RA0A 4NZLA 4A1VA 2BOKA 2V7QD 2ZZUH 2VNTA 1NU9A 1MTNB 3D62A 4DT7B 1K1IA 1FONA 5ESBA 4NFEA 2XCFA 1EXFA 2ZHEH 2QF5A 1SGDE 4DIHH 1NTPA 1VITG 3SV2H 1XKBC 1SKYE 2BDYA 4ZCNA 7ESTE 4ZHLU 2Q6GA 3GCHC 1RS0A 5F8ZA 2YMSB 5T6GA 3JZ2B 1C5OH 1OWKA 3MO6A 3SJ8A 5JYIA 1QTFA 2NU4E 3A85A 4CHAB 2R3YA 1XUHA 1DITH 2PV9B 1CA0B 3E91A 3LH1A 1GG6C 3TJOA 2WPJS 3RU4D 3SNEA 1SLWB 1UK2A 1XUFA 1C5SA 2KFWA 3A7ZA 1MTSA 4Y7AA 1GBLA 3JZ1B 4IN1A 3I77A 3SGQE 5JDUB 2QC2A 3T25A 4FU7A 4F48B 1G36A 1C5MD 1C2KA 2HOBA 4NCYA 1BRCE 3OTJE 2P3FH 1F5LA 1WXRA 1C1SA 2B8OH 1YBWA 1EUFA 1QIXB 3MH7A 4U32A 3IWMA 1S6HA 1BMMH 3M61U 4BTUB 2NU2E 1SSXA 1O2IA 1V2PT 2AGIX 2OP9A 4Y8XA 3RUOA 3E16B 4NA8A 1D3DB 1FAXA 1AE8H 1P03A 3MMGA 4F4OC 1ZHRA 3AASA 5EODA 1DSUA 3S7HB 2C8YB 1RXPA 1S5SA 3Q00A 4Q2KA 3RU4E 1AB9C 4X6PA 1W2KH 4M7GA 2BB4A 4LXBH 5TCAA 4MQAA 5HM9A 1PPEE 1O3KA 1WQVH 1YGCH 2VGCC 1WUNH 4M9FA 1GGDB 2FPZA 4ZKNU 2J38A 1EKBB 3UREA 3VGCB 1GWAA 3DUXH 3LDXH 2ZHFH 3NCLA 2GT8A 2ZIQH 1GBFA 2WPDD 4MVNA 3GDVA 2XYAA 1O34A 1HAIH 2BD8A 2QV1A 3PMBB 3M3SA 1A4WH 2F43B 1O3FA 1K28D 5A2MH 2XWAA 1NRRH 1UTMA 1O2OA 3SU4A 3SZEA 1CHOG 1TQ0B 2UWOA 1Q2WA 2H9EH 4I8LA 1VITF 3ZZ3A 5EIYA 3RXQA 1VR1H 1IQKA 4RKJB 1O2JA 4HI3A 1FZZA 2EI7A 1K1NA 2J4IA 1TRMA 1AD8H 1ESTA 1YLNA 1BRUP 2WV4A 3MWIU 1MTUA 2AIQA 4UONA 3ZZBA 4NSVA 1Y3XA 2P94A 5E0GA 3ZVDA 2GZ8A 2BLQA 3BTKE 4U2WA 5E0JA 1ESBA 3GCHB 3ZZDA 1MAYA 3UAIC 1NC6A 4AZ2B 1OHHD 1HAZB 3S7KB 5EJ1A 3HGPA 2FODA 3GISB 1UO6A 1PQ8A 1DLKB 4X8TH 2PR3A 1GG6B 3MU0A 1TGNA 2ZDAH 1O5AB 1UVUH 1BHXB 2FP7B 1B7XB 3LONA 2RA3A 5GWZA 1TOCB 1NRQH 2GDEH 1Z8JB 4NZQA 1GMHG 5FPSA 4DJZB 1N6YA 2O8MA 3M7QA 3SGAE 2OLGA 1J17T 1FMGA 3O8DA 3QWCH 1QA0A 3QTVH 2OUAA 1EZUC 3ZZ6A 2QXGA 4RN6A 2AH4X 2F9BH 1SOTA 1TGBA 1GHVH 1QB1A 2O9QA 3RXVA 2Z6BD 1IAUA 1A3BH 2PTNA 4YOGA 1O3DA 1P12E 1AU8A 4MNVA 3QZQA 2KAIB 4B6FA 2HNTC 1CBWC 1UTOA 1E34B 1D3TB 4NIYA 3P8OA 4KTSA 1S81A 1LHEH 1O5FH 3A8DA 1FIZA 1SQRA 3UUZA 2ZF0H 2XW9A 2P8OC 1TRNA 1C1NA 1C2MA 4ABIA 3DFLA 3UPEA 3FFGA 5DP6A 2SGFE 1UCYE 1QR3E 3UIRA 4JZFH 3GY8A 2VGCB 4O97A 1W10U 3LJOA 3SUEA 1MH0A 1MQ6A 5A0BA 3E8LA 2ZU1A 1G3DA 1G3BA 1A46H 1CE5A 1IQEA 2WYGA 5E2OA 4Q7YA 4XD7D 1O30A 5GNDA 1O38A 1CHOF 1BIOA 5L30H 4XOJA 1FI8A 4Y6DA 1QQUA 1NESE 1TX7A 1YPLH 5C3NA 1UTNA 4B1TA 3U8TH 3CS7A 4X2WA 3OSYA 2BM2A 3SJIA 5JBBS 5HIYA 3O8RA 4Q63A 3BTHE 1DXWA 1AGJA 2ZFFH 1AVGH 1BBRE 2Y5HA 1AUJA 1COWD 5LPRA 3PMJA 2NU1E 1RRKA 4E7RG 2WPKS 1A5HA 3K6ZA 4BANB 1P2OA 3QO6A 3F9FA 2ZEBA 2AYWA 5E8EH 4ZKSU 3FP6E 1NFUA 1GBTA 3FO8D 4K3JA 5IDKA 1C1UH 1EAWA 1RTLA 4D7GA 1Y8TA 4WXIA 1GMHF 2B5TB 1PQ5A 2SNVA 4BNRA 3B8JA 4B6EA 2BX4A 2H5CA 3GICB 1JIRA 3P6ZB 4WWYA 1TONA 1FY1A 4P00A 1K9OE 3RC4A 1NBMD 2Y5FA 3BSQA 3A82A 3M36A 4GLYA 1FY8E 1OWDA 1S85A 1OYTH 4FXGH 2ALPA 3PLPA 2VINA 6GCHG 2ZTYA 1O2XA 1AVXA 2G5NA 2RCEA 4AG1A 1F2SE 1O3PB 4I8JA 3SBKA 3HKJB 2VVVA 3SJKA 1P9UA 1UK4A 2GV7A 5AHGH 1N6XA 1HJAB 1D6WA 3A7YA 2ZP0H 3SHCH 1LVBA 7KMEH 2HPPH 3V3MA 1ZJDA 2BQ7B 4BAHB 2BVRH 1TB6H 3RXCA 4O3TA 1O2QA 1E36B 1TNJA 1T32A 3DT0H 3GY5A 4B2BA 3LGIA 1YF4A 3OY6U 3D23A 3ODFA 3E90B 3ZVCA 1GJ4H 1LHDH 1O2PA 1EPTC 1P04A 1TLDA 1O2UA 1GVLA 4BAQB 1NBME 1BQYA 1W7GH 4X1SU 1FAKH 2HNTE 1P2QA 3PROA 1WYKA 3MU8A 1ARCA 8KME2 4JYVH 3Q76A 3KL6A 2STAE 2B7DH 2ANYA 4LZ4B 3SQHE 3SUGA 2BZAA 9LPRA 3DHKH 3TH3H 2JH5D 1UTLM 1ZZZA 2ZG0H 1DSTA 1OOKB 1A5IA 1ZMLA 5GXPA 1O2WA 1OP0A 3HPTB 5ETXA 1C5TA 4UD9H 4I7YH 1ANDA 1NO9H 2F9NA 1CT4E 3H7OA 3QN7A 6CHAB 5DP8A 2H2ZA 1ELEE 1GCDA 1C5WB 4YZUA 3NXPA 2QN5T 1V2OT 1GJCB 1GCTB 1P8VC 1WTHD 2WSSD 1BJVA 1EJMA 3GY6A 4D9QA 1AKSB 2ZFQH 4YLQH 1GJ8B 5JB8S 3KEEA 1ANBA 1RIWB 2C8WB 2TBSA 3TPIZ 4ABAA 3DFJA 4UE7H 3DCLA 1O36A 1O3HA 3SNCA 1DT2A 1YPHC 1C9TA 2ZC9H 1F0TA 3MQKC 1O2KA 3LGTA 4B76A 3RC6A 1YCPH 2WPMS 1BJUA 1BTHH 3QGJA 4B73A 5EU8A 3EA9A 2ZECA 3ZVEA 5FX6A 1SGRE 1WU1A 1N1LA 6GCHF 1SFIA 1FPCH 3KYGA 1JRTA 1NRPH 2WZQA 3VB7A 3C1KA 3TGKE 1H9LB 3TIUA 1LHFH 3TH4H 2OBOA 3KYFA 2PHBA 2PGQB 4IW4E 1SQOA 2GCHG 2EC9H 4JZIA 3BIVH 4GSOA 1G32B 2HVXA 1FX0B 5F03A 4CRAA 4GHTA 2Z3CA 1DY8A 4UFGH 1A1RA 3OFND 1AZZA 1DM4B 3M5LA 3ZYDA 5F6MA 2G00A 3Q3XA 3RP2A 4ZXXH 3LIWA 4DGJA 3P17H 1HB0B 3V13A 1FQ3A 1CSOE 4MPWA 5DKMA 1XVMA 1CO7E 2H9HA 1WTGH 3A7XA 1K1OA 3LGVA 4F55A 2GVFA 2UWLA 1ORFA 2OXSA 2WPHS 4JZ1A 1UCYK 1EPTB 1VGCB 2BXTH 3QZRA 2JJ1D 4ZXYH 1O33A 1O31A 4FUIA 4X8VH 2QXHA 2SFAA 3FVFB 1A61H 2VIPA 1EX3A 1TNHA 2BXUH 3F1SB 3UQOA 3DD2H 2O8UA 2UUYA 3GY2A 5G4BA 1YM0A 3ZVBA 2FI3E 2ULLA 1O2ZA 5FPYA 1IHTH 5F8XA 2ZGHA 1AVWA 4CH2B 1BITA 1P57B 2ESTE 1EQ9A 3SYJA 1RD3B 4WY3A 1L2EA 3MU5A 2G52A 1C1WH 4KP0A 1TWXB 2CGAA 1KXCA 1OWHA 1PPBH 2PTCE 1IQHA 1C5XB 3UR9A 1J9CH 2ZFRH 3ZZ9A 5FL7D 2VIWA 1OWEA 1ZMNA 4ZHMU 2LP6A 4OS5A 2ZPRA 4AGKA 2PGBB 1CA8B 2AHME 2KAIA 5T6FA 4WMEA 5EW2H 4JK5A 2O8LA 4FOUC 2BHGA 1MTNC 3SI4H 2ODYB 1TBRH 4NIXA 1H1BA 4OS6A 3VB4A 1CQQA 2RFKC 2L6OA 1ZYOA 2OD3B 1C5UA 1O39A 1DS2E 2TGDA 1G37A 1V2JT 1IOEA 1O32A 1H8HD 2YMSC 3SU5A 1O5GH 1DWCH 5A8XA 3RXMA 4IN2A 1QL7A 1BA8B 2ANKH 2BYAX 1Z8RA 5F8TA 3U9AH 3RXDA 4A1TA 2ZGXH 3ATWA 3AW0A 3CS0A 1YPHE 2GCHF 1CA0C 1SPJA 2XBWA 1K1JA 1HV7A 2VU8E 3DA9B 3ESTA 3EYDA 2R3UA 4XSKU 3E1XB 8LPRA 2CF9H 1JBUH 2TIOA 4INHA 1CGIE 3A81A 3LKWA 5J4QA 1O2HA 2PWXA 1CVWH 1LTOA 1RTFB 2O8WA 3L3TA 1VCQA 1P0SH 1HAYB 1ELCA 2W5EA 3VEQB 2IPQX 1O35A 1QFKH 2C3SA 3U69H 3A7VA 4H6TA 4B71A 3RMOH 1ZTKA 2AGEX 5JBTA 2ZKSA 1Y5BT 3TJVA 1P3CA 1O2YA 3NKKA 1KTSB 1ZMJA 1XMNB 2AFQB 4FVBA 4DIIH 2BD9A 4H42U 1L1JA 4TYDA 1C5VA 2ZTZA 1FDPA 2BDIA 3TJUA 1A5GH 5A8YA 1PPGE 1GHZA 5AFYH 3PM3A 1GGDC 1GVKB 3TVJB 3VGCC 5K7RA 2HALA 2XBXA 2ZU3A 4FUJA 1C5YB 4WXVA 2A7HA 1G9IE 1SGYE 3VPKA 3T29A 3STJA 3BTQE 1HAGE 2HRVA 1THPB 2NU3E 1MZDA 1UHBB 3LGUA 2A7CA 5HKKD 1MMJN 2A5KA 3RXOA 4I86A 4ABFA 1EAIA 3GCOA 2SGDE 2B0FA 4TSFD 5C1YA 1Y5AT 2P3UB 3KN2A 1Q3XA 1LPGB 4I33A 2QF0A 1V2TT 3A89A 1NFYA 4AG2A 2Z9JA 1T4UH 1UVTH 8ESTE 4KELA 1BMLA 4THNH 1ACBE 3RXTA 2A4QA 3TNSA 3MNSA 1SGFG 1INCA 4OS7A 2A1DB 4CRGA 4IC6A 1EJAA 3LC3A 1BRBE 3K9XB 3PB1E 2XC4A 1XM1A 2XBYA 4X1RU 1P3EA 4A92A 9ESTA 1H4WA 3RM2H 1GHWH 3U8RH 3L33A 4YXWD 1TNIA 2XBVA 2J9NA 1AI8H 2FWWA 4ACBA 2QF3A 1UMAH 2RDEA 3FAOA 1W0YH 1ZR0A 1JOUB 1GBHA 2IPHA 4X2VA 2KM0A 4HG6A 1PJPA 1YY3A 1YWUA 1T8LA 2EQNA 1OWJA 2B9LA 1ID5H 3MOCA 1XUKA 1AY6H 1ZTJA 2W7SA 2CV3A 2XNIA 3SU1A 3LOXA 1NRSH 3U1IB 5PTPA 4ABDA 1BTWA 2J94A 5CDFE 4YOJA 4YO9A 1O0DH 3MHWU 1ZSKA 3SV6A 1GBIA 1OKXA 3ZZCA 1S0RA 1GMDG 4Q7ZA 1VCPA 1H8DH 3H5CB 2DE8A 1DDJA 1AQ7A 3RXEA 3LT3A 2ANMH 3RXRA 1MQ5A 1NS3A 4AGJA 4BTTB 2HVYB 2A45B 4K8YA 1F0SA 3V0XA 1FIWA 2BQ6B 1ZPCA 2CN0H 2OBQA 1V6DA 4X6NA 3MTYA 1P10A 5DP7A 2HWLB 5FXLA 2GT7A 3MNBA 5IK2D 1BDAA 5DN6D 5LGOA 4DOQA 5EXLA 1UTPA 5DK1A 4UEHH 4D7FA 4YT7H 2AMQA 2AMPA 4ZROA 4MDSA 5B6OA 3F2FA 4GAWA 3BF6H 5HGGA 3MO9A 3SNAA 1NT1A 4HZHA 1QBVH 1ANEA 2XC0A 3ZIAD 4YLUA 1PPFE 1TA6A 4JZDH 3SQEE 4Y0YE 3SOSA 1V2VT 2GTBA 1HIAB 3PV4A 4DCDA 3RXIA 2NU0E 4JYTA 1ZRBA 1A7SA 2JDID 1GBKA 3O8CA 1TX6A 1F0RA 3OAAD 1LQDB 1UVPA 2ZDKA 2ZFPH 1GHBG 3OEHD 4OS2A 1AZ8A 1EPTA 1SHHB 2GMTB 2PSYA 2BLVA 2THFB 1LCYA 1HYLA 1L4ZA 2J34A 2ZHDA 3AAUA 4U01A 5EXMA 2R2WU 4JMYA 3UNRA 3T62A 4AYVB 1TRYA 2Y80A 3UR6A 5L6NH 4TPYA 3AVZA 4JCNA 4RSPA 4DVAU 2JIZD 2PP6A 3FOAA 2NWNA 4TPIZ 2GP9B 1IQMA 1K21H 3F9GA 1Z8IB 2ZGCA 4YM9A 1F0UA 2F83A 4UFDH 5GDSH 2J98B 1E35B 3T5FH 4B2CA 5JBAS 1TGTA 1LPKB 4X8SH 1ZOMA 1EOJA 3OX7U 3LJJA 4BXSA 1YPMH 3UWJH 1JRSA 2W3KA 1L4DA 1O3CA 1Y3UA 2WPLS 5B6LA 3M5NA 2Z94A 5FBEA 1H9IE 1ZTLA 1IQFA 4ZMAH 1LHCH 4I8GA 3TU7H 1HFDA 2PKSB 1HJAC 1K22H 1OWIA 1NFXA 2O8TA 4NA9H 2BDAA 3F0PA 2PW8H 3BV9B 1TA2A 5LPFA 1TNGA 3GY3A 4BTIB 3EQ0H 5EPYA 2QY0B 3URDA 1EZSC 1GMDF 3BG8A 1SQTA 3SU6A 1GBAA 1C1PA 1XXDA 1CT0E 2G51A 5KECA 4NIWA 3PV5A 2FOGA 3CNRA 2ZPQA 3E6PH 1BUIA 3PWBA 2LELA 2HPQH 5EPNA 4Y8YA 2ZHWH 5DP5A 1K1MA 4ZKOU 1EB2A 1AHTH 3PYHA 5C67A 1QL9A 2BDHA 2FTMA 4UDWH 5C1UA 3QDZB 3BG4B 3KGPA 4OS1A 3RXFA 2BY8X 2QAAA 1O3LA 1OYQA 1TGSZ 5JBCS 2VIOA 1MU6B 6CHAC 1W13U 1XX9A 4FUCA 1XVOA 1Z7KA 2FXRA 2JKHA 2TGPZ 3TLOA 1ETTH 5A0CA 4K8BA 1GCTC 1GHBF 3FANA 2ODQA 1SGCA 1GL0E 1HLTH 1D4PB 1W0JD 2CF8H 1KDQB 1RIWC 5A09A 3MI4A 1PPCE 3BIUH 1SMFE 4BXWA 2W6JD 4GPGA 4MG3A 2H1UA 1D3QB 1ESAA 1U6QA 1GVZA 2OC0A 1TNKA 4U30A 3SO3A 5KGOA 2FX4A 2C8XB 1QBOA 1C1OA 3RXAA 4X6OA 2CJIA 1C5NH 1T8NA 4LK4A 5FHTA 3RXSA 3URCA 3SU3A 2K1QA 1H9HE 3A84A 1J15A 4B74A 1KIGH 1C9PA 2A2XH 1YCPK 3SZNA 1HGTH 2VIDA 1SVPA 3W1EA 3F0OA 2FDAA 3Q3YA 3AK5A 3VXEH 2K8IA 5EQRA 4BAKB 3A83A 4NGAH 1MABB 2FOBA 2PUXB 2G4TA 1GI6A 3GS9A 1UHBA 3T28A 1Q31A 2R0LA 4Z6AH 1TFXA 2AIPA 2WUBA 4X1NU 3SW2B 5EG4A 1DX5M 2F9PA 2XCNA 1V3XA 2PFEA 3ELAH 1KXEA 4WF8A 2RDLA 3FKSD 4XBBA 5C94A 3WW7A 3P8FA 1LMWB 2FI4E 2FYRA 5SGAE 4O9VA 5LPEA 3ZZ8A 2PKAB 1PYTC 3M5OA 5DP3A 1WBGB 2YOLA 3CP7A 3RDZA 4ASUD 1FUJA 1KSNA 3KQCA 1NROH 3GYMA 1VGCC 2OQ5A 5L2YH 2FIRH 5C0TA 4BOHA 1THRH 3BEFB 4FU9A 2FOMB 4ZHAA 3KNXA 1QB9A 4F49A 3SU2A 4RT1A 4AOQA 5TJXA 1K1LA 1C5RA 1O3GA 1HBTH 1KY9A 2TRMA 1VITH 2BQWB 2H6MA 4X8UH 2STBE 4Y0ZE 4NWLA 1XUJA 1LKAA 1W0KD 5FCKA 2A0QB 1TMTH 2EI8A 1GHYH 1IQIA 1XKAC 1HNEE 3MFJA 4WMFA 4Q80A 1MKWK 2KCYA 1BMAA 1MBQA 2Z3EA 5GCHG 3SORA 5L2ZH 1C5ZB 5EOKA 4MNXA 3ZVAA 1UJ1A 3A7TA 2VJ1A 1YPEH 2QXJA 2XXLA 4UFEH 3KQBA 3EDXB 4ABJA 2GKVE 1YPJH 4BAOB 1KMHB 3ZZ7A 3IG6B 3HK6B 3WWFA 2VB0A 4TWWA 3Q77A 5DSFA 1C1MA 1MU8B 1NM6A 2OC8A 1AFQB 1ARBA 2OK5A 1MTVA 1SHYA 4RT0A 4X1QU 2XRCA 2JJ2D 3KHVA 5E2PA 3SV7A 3A80A 3MH4A 2R2MB 1VJ9U 1GBMA 3M7UA 3BTME 3PMHB 1JIMA 2TPIZ 3KCGH 2C4FH 1AWFH 2J92A 3AAVA 5ESTE 4MTBA 3RXGA 3SNDA 4B2AA 1B0FA 1ELDE 2BDGA 2FOEA 3VG8A 1ELTA 1UVOA 4KTUA 3TK6A 8GCHG 1ZPZA 2C93B 2BY7X 1ZHMA 1GJ9B 2KCPA 1UTQA 5FX5A 4X2XA 1QRZA 3ZVGA 2GGVB 1V2UT 1Z1JA 2ZQ2A 3RXLA 2F9UA 1O2TA 2CHAC 1SR5C 1A2CH 3DSGA 2GJGA 2KR7A 1IQNA 4FVDA 3H7TA 1Y3VA 4DY7B 1NPMA 2VBCA 2FESH 1HIAA 1FJSA 1FY4A 1ELBA 2D26C 1UTKA 2BVXH 4A5TS 7LPRA 1SLVB 1HJ8A 1P2NA 2Y5GA 1NY22 5JB9S 2GD4B 3S0NA 5HXFA 4X1PU 4FUFA 2C8ZB 3RXUA 1E0FD 1C1VH 1Y5UT 1KXBA 2UUJB 1C5QA 2GZ7A 2BD5A 1GPZA 1V2KT 2R9PA 1LVYA 2P95A 1WOFA 1Y59T 3FZDA 3TNTA 1TYNA 1N8OC 2BD4A 2GCTB 2J98A 1V2WT 5T6DA 5GCHF 2TGTA 5BRRE 1Z6JH 1MKWH 3R3GB 3A88A 3QGNB 1Y3YA 3NWUA 4K60A 1SC8U 1YCPM 3RU4T 1Z1IA 1HCGA 2BLOA 4HTCH 4HGCA 1H8IH 5I46H 3P70B 4FUDA 2Z9LA 1VKYA 1CGJE 2HNTF 4A6LA 1DVAH 4ZAEA 2A5AA 1Z8GA 1GBCA 2YNAA 4QT8C 1YC0A 4WH8A 3MNCA 1NFWA 2M5TA 4CBOA 2VVUA 4MNWA 2FOCA 3NZIA 2XOKD 4ISNA 1HAPH 3S9BA 3RLWH 1RFNA 1GJBB 3K2UA 3Q3KA 1O2RA 1S6LA 4FUBA 1LKBA 2ODPA 3BTWE 1GDQA 1EB1H 2BD3A 1SGPE 8GCHF 2M2AA 2VIVA 1S0QA 1O3EA 2JH6D 1HUTH 1CHGA 1F5KU 2BLWA 2KX4A 1WQSA 1ZJKA 1DE7H 4WJG2 3GDUA 1MTWA 2ASUB 4OS4A 1DWBH 1O5DH 3PTNA 1EASA 2FTLE 5GPIB 1MD7A 1AUTC 3FP7E 3W95A 5CE1A 3HATH 3UFAA 2VH6A 4YTAA 1H8ED 7GCHG 2CHAB 4CRCA 4J1YA 2BY9X 5CHAC 5C1XA 1AN1E 1FPHH 1TPPA 5DGJA 1P2MA 1OSSA 2A32A 2PUQH 2JETC 3HK3B 4FU8A 1D3PB 3EE0B 3SU0A 2ALVA 2VWNA 5HMAA 3QUMP 3TK5A 3T26A 1O3IA 2V0BA 1SBWA 2GZ9A 1DLEA 2LPRA 2Q1JA 4CR5A 1N8OB 3RMMH 2VVCA 2IN2A 3K65B 4ISHH 3AW1A 4D76A 3RXBA 4RKOB 1V2MT 2SGPE 2ZO3H 1TABE 2ZTXA 1O2VA 1GL1A 2W6ID 1W8BH 1C4Y2 4TWYA 1XUIA 1EFRD 4I8KA 2I6SA 3ATLA 1AMHA 1NRNH 2PSXA 1GI9B 1QA7A 1QB6A 3A86A 1FV9A 3BTDE 3U98H 2ZDMA 2FOHA 1ZSJA 4AC9A 3FP8E 4AB8A 1GI7B 1LVMA 2ZHQH 1P02A 4Y10E 2YMSD 3P92A 4YOIA 4GUXA 1O2GH 1ZGVA 2Z3DA 4YT6H 4AORA 4Y11E 1O5BB 2P93A 2PKAA 1C1QA 2FS9A 3RM0H 2AEIH 3FZZA 2EI6A 1O3AA 1TQ7B 2QF4A 3TH2H 1BTZA 1B5GH 2GMTC 1BBRH 2QE7D 4KTCA 1QBNA 4AFQA
chains in the Genus database with same CATH topology
1K0HA 2KX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0H A;  2KX4 A; 
#chains in the Genus database with same CATH topology
 4IS5 A;  2FLB H;  2FZZ A;  4MPU A;  1E1R D;  3OEE D;  2BDB A;  2G4U A;  1SI5 H;  1J16 A;  2CXV A;  4ZKR U;  3UWI A;  5DG6 A;  1GI3 A;  1EZQ A;  2OCV B;  3EA7 A;  5AFZ H;  1O37 A;  1KXA A;  7GCH F;  5KED A;  2A4R A;  1TBQ H;  5C5O A;  1K2I 1;  3GCN A;  1QNJ A;  1D6R A;  3TK9 A;  2A2Q H;  4AFZ A;  1Y3W A;  3OE7 D;  4MNY A;  1QRW A;  4A1X A;  3ZV8 A;  4R8T B;  4X6M A;  1WDI A;  2D8W A;  1GBE A;  2ZU2 A;  3KID U;  3UY9 A;  2FOF A;  5CHA B;  2Z9I A;  2PKS C;  2UUF B;  4Y71 A;  1GBJ A;  1HAX B;  2V3H H;  2UWP A;  4Q4L A;  1AKS A;  4FUE A;  3S9A A;  3MO3 A;  1C2F A;  1GMC G;  1A0L A;  3RML H;  1THS H;  3M3V A;  1RJX B;  4VGC C;  5H4I B;  1V2L T;  3I78 A;  3GY7 A;  1O3B A;  1WAY B;  2JET B;  4D9R A;  4XRN A;  2SNW A;  1C2J A;  3TIT A;  3VFE A;  3F3B A;  3UNQ A;  1O2L A;  1GJD B;  4MLF B;  1F92 A;  1GDN A;  1DXP A;  2DE9 A;  1G3C A;  1LPZ B;  3GYL B;  3PTB A;  4GHQ A;  5LH8 A;  1SG8 B;  1RTK A;  1C2G A;  3UB0 A;  1ETS H;  5DP9 A;  3PLK A;  2AER H;  1IQL A;  2FOA A;  1ETR H;  1O3O A;  2F9O A;  1C5L H;  1BB0 B;  1V2Q T;  4YES B;  1Z71 A;  3BG4 C;  4DT4 A;  1SQA A;  1TBZ H;  4OGY A;  1OS8 A;  1GJ7 B;  4A7I B;  1B0E A;  1BTX A;  5C5N A;  5DO4 H;  2IJD 1;  3F9H A;  4K69 A;  1TOM H;  3MU1 A;  1FN8 A;  1BTP A;  3WY8 A;  4MPX A;  1TAW A;  4FUH A;  2OTV A;  1OXG A;  3A8B A;  1AE5 A;  5C0U A;  4ISL A;  3KQ5 A;  3O8B A;  3K6Y A;  2WYJ A;  3PO1 B;  4EST E;  1E37 B;  2BDC A;  2W26 A;  3I29 A;  1V2N T;  3M35 A;  2ZU5 A;  1VJA U;  1T8M A;  3MH5 A;  1C5P A;  1P01 A;  1MUE B;  1NZQ H;  4P02 A;  4XFQ A;  5FPT A;  4Z1M D;  3B9F H;  3SJO A;  3STI A;  4CRE A;  1MCT A;  3PV2 A;  3N7D A;  1MZA A;  1PFX C;  2ANW A;  2BTC E;  1ELA A;  3KF2 A;  1WV7 H;  1YLC A;  5BPE A;  2WV5 A;  1L1G A;  4JK6 A;  2IJO B;  3PWC A;  2V3O H;  1DUE A;  1O2S A;  2Y81 A;  3MNX A;  1EOL A;  4TT3 D;  1DWE H;  2AS9 A;  2J2U A;  2BY5 X;  1C2L A;  4ISO A;  1W11 U;  3GOV B;  2VWO A;  3F6U H;  1L0Z A;  3EE7 A;  4O3U A;  5CMX H;  2LNC A;  1P11 E;  3NUM A;  3RXP A;  1GMC F;  5A0A E;  2J97 A;  1HXF H;  1BCU H;  1OP2 A;  1G2L A;  1QHR B;  2D2D A;  1ELV A;  2ZA5 A;  4AX9 H;  2ZDV H;  2UUK B;  1EP6 A;  3OU0 A;  2J5U A;  2W7U A;  4VGC B;  5CHB A;  5T1V A;  4IMQ A;  3S9C A;  1EP5 A;  1HAO H;  4WH6 A;  3BTE E;  2FLR H;  3LPR A;  3M7T A;  1FN6 A;  4AFS A;  2L74 A;  1ZLR A;  2WIN I;  1TIO A;  1YKT A;  3F2G A;  1DWD H;  1KTT B;  2C90 B;  5EXN A;  3RXJ A;  2G81 E;  2XWB I;  1BZX E;  2FM2 A;  1LO6 A;  3QTO H;  3S69 A;  3C27 B;  1YYY 1;  4K1E A;  3QK1 A;  1DPO A;  4AFU A;  2HLD D;  1GI8 B;  1P05 A;  1MBM A;  1GI5 A;  1AIX H;  1HPG A;  5TCC A;  1QZ8 A;  2RG3 A;  1E79 D;  3HGN A;  2XTT B;  4AB9 A;  3BEU A;  1AB9 B;  4XE4 A;  4SGB E;  3L6P A;  1XUG A;  4E05 H;  4DUR A;  1W3C A;  3HKI B;  3RXK A;  1W7X H;  2V6N A;  3TJN A;  3VXF H;  4Y76 A;  4IGD A;  4ABG A;  4TY7 A;  1BTY A;  3P95 A;  3DSP A;  3NK8 A;  3GCT G;  3PRB A;  3BN9 A;  5I25 A;  1J14 A;  3MH6 A;  3PMA B;  4O03 A;  1QJ1 B;  1JXP A;  3PRD A;  5EJL A;  5DPA A;  3ATM A;  1GBD A;  1M9U A;  4NWK A;  5A8Z A;  1AFQ C;  2A7J A;  1BOQ A;  1NU7 B;  4RI0 A;  1C1R A;  1SGI B;  1C2E A;  1RGQ A;  5FCR A;  1SGE E;  2CK3 D;  2FMJ A;  1KYN A;  1T31 A;  3E0P B;  5FAH A;  3SN8 A;  4IC5 A;  5IYT A;  3ITI A;  1GI4 A;  1SGF A;  1C2D A;  1FXY A;  3VB6 A;  2QYI A;  1UK3 A;  2OIN A;  1SLX B;  3LC5 A;  2SGE E;  1IHS H;  3OYP A;  1DFP A;  1Z6E A;  4ABB A;  1MKX K;  1GBB A;  3EA8 A;  4ACA A;  2D1J A;  3V7T A;  3QX5 H;  3SV9 A;  1GJ6 A;  3V12 A;  3NPS A;  3ZZ5 A;  1O5E H;  3A8A A;  2H9T H;  1DIC A;  1X7A C;  1DAN H;  2BD7 A;  2QCY A;  3R0F A;  1VZQ H;  4H6S B;  2ZDL A;  1GI1 A;  1W0Z U;  3H09 A;  3DSO A;  1HAH H;  2A4O A;  3WWB A;  3ZYE A;  3D49 H;  2ZDN A;  1YPK H;  2OC1 A;  2BY6 X;  4PRO A;  2JH0 D;  1G3E A;  1PPZ A;  3W94 A;  4KGA A;  2XC5 A;  1TX8 A;  5JPM H;  4NA7 A;  5F53 A;  1TE0 A;  1LDT T;  2OC7 A;  2I6Q A;  1HAV B;  3B23 B;  1C2H A;  2A5I A;  2W3I A;  3ODD A;  2J95 A;  2IOT A;  1LQE A;  2F91 A;  4CR9 A;  1CBW B;  1HJ9 A;  2GCT C;  3E3T A;  1BHX F;  2ZCK P;  5AF9 H;  2BX3 A;  3P8N A;  3SUF A;  1EAU A;  1UTJ A;  1MCV A;  1SOZ A;  1S84 A;  2WUC A;  3PLB A;  1K0H A;  4ISI H;  5T3H A;  3U8O H;  1JWT A;  1K1P A;  1DOJ A;  1L1N A;  1IQJ A;  2P8O B;  1ABI H;  1BRA A;  2AMD A;  2ZPS A;  2PLX A;  5HM2 A;  1LHG H;  1NN6 A;  1O2N A;  3OTP A;  4I31 A;  4LZ1 H;  2Q6F A;  1PQA A;  3UOP A;  3TGJ E;  3GCT F;  2SGA A;  1C2I A;  4K5Z A;  2FX6 A;  1UW7 A;  2ZCH P;  1KLI H;  1YP9 A;  1O2M A;  2A4G A;  1P2I A;  1GI0 A;  1ZHP A;  1TPS A;  4LOY H;  1WSS H;  4WMD A;  1QY6 A;  2Z9G A;  4GCH G;  2V35 A;  3G01 A;  4ABE A;  2BOH B;  1P2K A;  3SHA H;  4CRD A;  4K2Y A;  3KQD A;  2Y82 A;  1ZSL A;  5C2Z A;  2GV6 A;  1A0H B;  4INL A;  2ZFS A;  5AVD A;  1SL3 A;  5E0H A;  2AGG X;  4OM9 A;  2Z7F E;  1GJ5 H;  1ZGI A;  4HFP B;  1QL8 A;  3ZZ4 A;  1OPH B;  6EST A;  1SB1 H;  4Y7B A;  1A0J A;  3N99 A;  4NFF A;  1P9S A;  1T4V H;  3ENS B;  3LGW A;  4NIV A;  3ZVF A;  4B75 A;  1MKX H;  1QJ7 B;  1WCZ A;  2P16 A;  2QIQ A;  2ZCL P;  3U28 C;  2BD2 A;  3M5M A;  4H4F A;  4R0I A;  1S82 A;  1GDU A;  1PYT D;  1S6F A;  1C4U 2;  3A7W A;  4XBC A;  1EJN A;  4AN7 A;  1G2M A;  2V3M A;  3LH3 A;  4DW2 U;  1XXF A;  3LGY A;  4XDE A;  4INK A;  1GJA B;  1UVS H;  1V2R T;  3UOU A;  2BVS H;  3FN8 A;  2WV9 A;  1KXF A;  1ELF A;  2ZQ1 A;  3ZZA A;  1PPH E;  1GI2 A;  3GY4 A;  1P06 A;  4ZH8 A;  3SI3 H;  1QJ6 B;  3CEN A;  1FNI A;  4JYU H;  2Z9K A;  3M3T A;  4Y8Z A;  5FBI A;  4MPV A;  1T8O A;  1E38 B;  5EGM A;  1O3J A;  2KCO A;  2XND D;  4X0W U;  1OX1 A;  4NG9 H;  4SGA E;  1ZRK A;  2R0K A;  1CU1 A;  1BMN H;  4K1S A;  2WHX A;  2FO9 A;  1HXE H;  3UTU H;  5EW1 H;  1S83 A;  3RMN H;  2F9V A;  2ZWL H;  2K0Q A;  1BT7 A;  5HIZ A;  3ZV9 A;  4JZE H;  2HLC A;  5K0H A;  4TY6 A;  1TMU H;  4GVU A;  2YNB A;  2VWM A;  3BTF E;  1ZPB A;  4GCH F;  1QCP A;  3EGK H;  3F9E A;  2GDD A;  4I8H A;  3T2N A;  1DY9 A;  1TPA E;  1F5R A;  1TMB H;  3KQE A;  5GIB A;  1P09 A;  3SGB E;  3UNS A;  1TNL A;  4CH8 B;  1EAT A;  2ZGB H;  4CRF A;  1C4V 2;  1HRT H;  1GHA G;  3SUD A;  1KXD A;  2H5D A;  2Q6D A;  1HDT H;  4ABH A;  3SNB A;  1YLD A;  3N7E A;  4Q7X A;  4ASH A;  1O3M A;  4BAM B;  2KCA A;  1BBR K;  4AYY B;  3P8G A;  1QUR H;  3OY5 U;  3LU9 B;  3BTG E;  1QQ4 A;  2Y7X A;  5DP4 A;  2QA9 E;  3RC5 A;  1MAX A;  1SGN E;  4J2Y B;  4D8N A;  2FEQ H;  4XBD A;  6LPR A;  5EQQ A;  1AO5 A;  5EJZ A;  4X2Y A;  4I32 A;  1PQ7 A;  1FLE E;  2ZNK H;  2BZ6 H;  3VB5 A;  1E1Q D;  1KLJ H;  2EY4 C;  2ZGJ A;  1BMF D;  2ZI2 H;  4DG4 A;  3ATI A;  1SGQ E;  2QXI A;  1YPG H;  3NRL A;  1TGC A;  2A31 A;  3RLY H;  1DUA A;  1O3N A;  2TGA A;  5GJ4 B;  2P3T B;  1TAL A;  1QGF A;  4CHA C;  1ELG A;  1VCW A;  2VWL A;  4Y79 A;  3M37 A;  1AWH B;  3D65 E;  1KDQ A;  1P2J A;  3BEI B;  3VB3 A;  2CMY A;  3SJ9 A;  4E7N A;  2ZFT A;  1SFQ B;  3E0N B;  3T27 A;  1D9I A;  1QRX A;  1EZX C;  1IQG A;  5EQS A;  1C1T A;  1SGT A;  1W12 U;  1ABJ H;  3U1J B;  4OGX A;  1EAX A;  3UQV A;  4CBN A;  1ANC A;  1KLT A;  2ZU4 A;  2ILN A;  4IBL H;  4IMZ A;  4Z0K A;  2G8T A;  1CT2 E;  2BMG B;  1AFE H;  3N7O A;  2G5V A;  3TGI E;  1UCY H;  2FS8 A;  3F2H A;  1LVO A;  1OP8 A;  1T7C A;  1F7Z A;  5C20 A;  2Y7Z A;  4CRB A;  3SV8 A;  3EAJ A;  2GX4 A;  2G55 A;  2HGT H;  4KKD A;  4ZUH A;  1G30 B;  3A8C A;  4UFF H;  1TPO A;  2KZ4 A;  3GDS A;  1GHA F;  5HYO A;  2DUC A;  5DJ7 A;  3A87 A;  1FY3 A;  2EEK A;  3MYW A;  3PO1 C;  4FUG A;  5C17 A;  1GHX H;  2QGR A;  2F4L A;  3F68 H;  1BTU A;  4FET A;  4K1T A;  1MD8 A;  1FY5 A;  2FYQ A;  2Y6T A;  1JMO H;  5ABW A;  2OQU A;  2F3C E;  3RXH A;  2VIQ A;  1O5C B;  2SGQ E;  3ATK A;  2P59 A;  5J4S A;  4NSY A;  2FI5 E;  1V2S T;  1HAV A;  3IIT A;  4WVP E;  2WPI S;  4E06 H;  1SLU B;  1CGH A;  3BTT E;  3MU4 A;  2VH0 A;  3QLP H;  1A3E H;  2EA3 A;  1W14 U;  1J8A A;  2RA0 A;  4NZL A;  4A1V A;  2BOK A;  2V7Q D;  2ZZU H;  2VNT A;  1NU9 A;  1MTN B;  3D62 A;  4DT7 B;  1K1I A;  1FON A;  5ESB A;  4NFE A;  2XCF A;  1EXF A;  2ZHE H;  2QF5 A;  1SGD E;  4DIH H;  1NTP A;  1VIT G;  3SV2 H;  1XKB C;  1SKY E;  2BDY A;  4ZCN A;  7EST E;  4ZHL U;  2Q6G A;  3GCH C;  1RS0 A;  5F8Z A;  2YMS B;  5T6G A;  3JZ2 B;  1C5O H;  1OWK A;  3MO6 A;  3SJ8 A;  5JYI A;  1QTF A;  2NU4 E;  3A85 A;  4CHA B;  2R3Y A;  1XUH A;  1DIT H;  2PV9 B;  1CA0 B;  3E91 A;  3LH1 A;  1GG6 C;  3TJO A;  2WPJ S;  3RU4 D;  3SNE A;  1SLW B;  1UK2 A;  1XUF A;  1C5S A;  2KFW A;  3A7Z A;  1MTS A;  4Y7A A;  1GBL A;  3JZ1 B;  4IN1 A;  3I77 A;  3SGQ E;  5JDU B;  2QC2 A;  3T25 A;  4FU7 A;  4F48 B;  1G36 A;  1C5M D;  1C2K A;  2HOB A;  4NCY A;  1BRC E;  3OTJ E;  2P3F H;  1F5L A;  1WXR A;  1C1S A;  2B8O H;  1YBW A;  1EUF A;  1QIX B;  3MH7 A;  4U32 A;  3IWM A;  1S6H A;  1BMM H;  3M61 U;  4BTU B;  2NU2 E;  1SSX A;  1O2I A;  1V2P T;  2AGI X;  2OP9 A;  4Y8X A;  3RUO A;  3E16 B;  4NA8 A;  1D3D B;  1FAX A;  1AE8 H;  1P03 A;  3MMG A;  4F4O C;  1ZHR A;  3AAS A;  5EOD A;  1DSU A;  3S7H B;  2C8Y B;  1RXP A;  1S5S A;  3Q00 A;  4Q2K A;  3RU4 E;  1AB9 C;  4X6P A;  1W2K H;  4M7G A;  2BB4 A;  4LXB H;  5TCA A;  4MQA A;  5HM9 A;  1PPE E;  1O3K A;  1WQV H;  1YGC H;  2VGC C;  1WUN H;  4M9F A;  1GGD B;  2FPZ A;  4ZKN U;  2J38 A;  1EKB B;  3URE A;  3VGC B;  1GWA A;  3DUX H;  3LDX H;  2ZHF H;  3NCL A;  2GT8 A;  2ZIQ H;  1GBF A;  2WPD D;  4MVN A;  3GDV A;  2XYA A;  1O34 A;  1HAI H;  2BD8 A;  2QV1 A;  3PMB B;  3M3S A;  1A4W H;  2F43 B;  1O3F A;  1K28 D;  5A2M H;  2XWA A;  1NRR H;  1UTM A;  1O2O A;  3SU4 A;  3SZE A;  1CHO G;  1TQ0 B;  2UWO A;  1Q2W A;  2H9E H;  4I8L A;  1VIT F;  3ZZ3 A;  5EIY A;  3RXQ A;  1VR1 H;  1IQK A;  4RKJ B;  1O2J A;  4HI3 A;  1FZZ A;  2EI7 A;  1K1N A;  2J4I A;  1TRM A;  1AD8 H;  1EST A;  1YLN A;  1BRU P;  2WV4 A;  3MWI U;  1MTU A;  2AIQ A;  4UON A;  3ZZB A;  4NSV A;  1Y3X A;  2P94 A;  5E0G A;  3ZVD A;  2GZ8 A;  2BLQ A;  3BTK E;  4U2W A;  5E0J A;  1ESB A;  3GCH B;  3ZZD A;  1MAY A;  3UAI C;  1NC6 A;  4AZ2 B;  1OHH D;  1HAZ B;  3S7K B;  5EJ1 A;  3HGP A;  2FOD A;  3GIS B;  1UO6 A;  1PQ8 A;  1DLK B;  4X8T H;  2PR3 A;  1GG6 B;  3MU0 A;  1TGN A;  2ZDA H;  1O5A B;  1UVU H;  1BHX B;  2FP7 B;  1B7X B;  3LON A;  2RA3 A;  5GWZ A;  1TOC B;  1NRQ H;  2GDE H;  1Z8J B;  4NZQ A;  1GMH G;  5FPS A;  4DJZ B;  1N6Y A;  2O8M A;  3M7Q A;  3SGA E;  2OLG A;  1J17 T;  1FMG A;  3O8D A;  3QWC H;  1QA0 A;  3QTV H;  2OUA A;  1EZU C;  3ZZ6 A;  2QXG A;  4RN6 A;  2AH4 X;  2F9B H;  1SOT A;  1TGB A;  1GHV H;  1QB1 A;  2O9Q A;  3RXV A;  2Z6B D;  1IAU A;  1A3B H;  2PTN A;  4YOG A;  1O3D A;  1P12 E;  1AU8 A;  4MNV A;  3QZQ A;  2KAI B;  4B6F A;  2HNT C;  1CBW C;  1UTO A;  1E34 B;  1D3T B;  4NIY A;  3P8O A;  4KTS A;  1S81 A;  1LHE H;  1O5F H;  3A8D A;  1FIZ A;  1SQR A;  3UUZ A;  2ZF0 H;  2XW9 A;  2P8O C;  1TRN A;  1C1N A;  1C2M A;  4ABI A;  3DFL A;  3UPE A;  3FFG A;  5DP6 A;  2SGF E;  1UCY E;  1QR3 E;  3UIR A;  4JZF H;  3GY8 A;  2VGC B;  4O97 A;  1W10 U;  3LJO A;  3SUE A;  1MH0 A;  1MQ6 A;  5A0B A;  3E8L A;  2ZU1 A;  1G3D A;  1G3B A;  1A46 H;  1CE5 A;  1IQE A;  2WYG A;  5E2O A;  4Q7Y A;  4XD7 D;  1O30 A;  5GND A;  1O38 A;  1CHO F;  1BIO A;  5L30 H;  4XOJ A;  1FI8 A;  4Y6D A;  1QQU A;  1NES E;  1TX7 A;  1YPL H;  5C3N A;  1UTN A;  4B1T A;  3U8T H;  3CS7 A;  4X2W A;  3OSY A;  2BM2 A;  3SJI A;  5JBB S;  5HIY A;  3O8R A;  4Q63 A;  3BTH E;  1DXW A;  1AGJ A;  2ZFF H;  1AVG H;  1BBR E;  2Y5H A;  1AUJ A;  1COW D;  5LPR A;  3PMJ A;  2NU1 E;  1RRK A;  4E7R G;  2WPK S;  1A5H A;  3K6Z A;  4BAN B;  1P2O A;  3QO6 A;  3F9F A;  2ZEB A;  2AYW A;  5E8E H;  4ZKS U;  3FP6 E;  1NFU A;  1GBT A;  3FO8 D;  4K3J A;  5IDK A;  1C1U H;  1EAW A;  1RTL A;  4D7G A;  1Y8T A;  4WXI A;  1GMH F;  2B5T B;  1PQ5 A;  2SNV A;  4BNR A;  3B8J A;  4B6E A;  2BX4 A;  2H5C A;  3GIC B;  1JIR A;  3P6Z B;  4WWY A;  1TON A;  1FY1 A;  4P00 A;  1K9O E;  3RC4 A;  1NBM D;  2Y5F A;  3BSQ A;  3A82 A;  3M36 A;  4GLY A;  1FY8 E;  1OWD A;  1S85 A;  1OYT H;  4FXG H;  2ALP A;  3PLP A;  2VIN A;  6GCH G;  2ZTY A;  1O2X A;  1AVX A;  2G5N A;  2RCE A;  4AG1 A;  1F2S E;  1O3P B;  4I8J A;  3SBK A;  3HKJ B;  2VVV A;  3SJK A;  1P9U A;  1UK4 A;  2GV7 A;  5AHG H;  1N6X A;  1HJA B;  1D6W A;  3A7Y A;  2ZP0 H;  3SHC H;  1LVB A;  7KME H;  2HPP H;  3V3M A;  1ZJD A;  2BQ7 B;  4BAH B;  2BVR H;  1TB6 H;  3RXC A;  4O3T A;  1O2Q A;  1E36 B;  1TNJ A;  1T32 A;  3DT0 H;  3GY5 A;  4B2B A;  3LGI A;  1YF4 A;  3OY6 U;  3D23 A;  3ODF A;  3E90 B;  3ZVC A;  1GJ4 H;  1LHD H;  1O2P A;  1EPT C;  1P04 A;  1TLD A;  1O2U A;  1GVL A;  4BAQ B;  1NBM E;  1BQY A;  1W7G H;  4X1S U;  1FAK H;  2HNT E;  1P2Q A;  3PRO A;  1WYK A;  3MU8 A;  1ARC A;  8KME 2;  4JYV H;  3Q76 A;  3KL6 A;  2STA E;  2B7D H;  2ANY A;  4LZ4 B;  3SQH E;  3SUG A;  2BZA A;  9LPR A;  3DHK H;  3TH3 H;  2JH5 D;  1UTL M;  1ZZZ A;  2ZG0 H;  1DST A;  1OOK B;  1A5I A;  1ZML A;  5GXP A;  1O2W A;  1OP0 A;  3HPT B;  5ETX A;  1C5T A;  4UD9 H;  4I7Y H;  1AND A;  1NO9 H;  2F9N A;  1CT4 E;  3H7O A;  3QN7 A;  6CHA B;  5DP8 A;  2H2Z A;  1ELE E;  1GCD A;  1C5W B;  4YZU A;  3NXP A;  2QN5 T;  1V2O T;  1GJC B;  1GCT B;  1P8V C;  1WTH D;  2WSS D;  1BJV A;  1EJM A;  3GY6 A;  4D9Q A;  1AKS B;  2ZFQ H;  4YLQ H;  1GJ8 B;  5JB8 S;  3KEE A;  1ANB A;  1RIW B;  2C8W B;  2TBS A;  3TPI Z;  4ABA A;  3DFJ A;  4UE7 H;  3DCL A;  1O36 A;  1O3H A;  3SNC A;  1DT2 A;  1YPH C;  1C9T A;  2ZC9 H;  1F0T A;  3MQK C;  1O2K A;  3LGT A;  4B76 A;  3RC6 A;  1YCP H;  2WPM S;  1BJU A;  1BTH H;  3QGJ A;  4B73 A;  5EU8 A;  3EA9 A;  2ZEC A;  3ZVE A;  5FX6 A;  1SGR E;  1WU1 A;  1N1L A;  6GCH F;  1SFI A;  1FPC H;  3KYG A;  1JRT A;  1NRP H;  2WZQ A;  3VB7 A;  3C1K A;  3TGK E;  1H9L B;  3TIU A;  1LHF H;  3TH4 H;  2OBO A;  3KYF A;  2PHB A;  2PGQ B;  4IW4 E;  1SQO A;  2GCH G;  2EC9 H;  4JZI A;  3BIV H;  4GSO A;  1G32 B;  2HVX A;  1FX0 B;  5F03 A;  4CRA A;  4GHT A;  2Z3C A;  1DY8 A;  4UFG H;  1A1R A;  3OFN D;  1AZZ A;  1DM4 B;  3M5L A;  3ZYD A;  5F6M A;  2G00 A;  3Q3X A;  3RP2 A;  4ZXX H;  3LIW A;  4DGJ A;  3P17 H;  1HB0 B;  3V13 A;  1FQ3 A;  1CSO E;  4MPW A;  5DKM A;  1XVM A;  1CO7 E;  2H9H A;  1WTG H;  3A7X A;  1K1O A;  3LGV A;  4F55 A;  2GVF A;  2UWL A;  1ORF A;  2OXS A;  2WPH S;  4JZ1 A;  1UCY K;  1EPT B;  1VGC B;  2BXT H;  3QZR A;  2JJ1 D;  4ZXY H;  1O33 A;  1O31 A;  4FUI A;  4X8V H;  2QXH A;  2SFA A;  3FVF B;  1A61 H;  2VIP A;  1EX3 A;  1TNH A;  2BXU H;  3F1S B;  3UQO A;  3DD2 H;  2O8U A;  2UUY A;  3GY2 A;  5G4B A;  1YM0 A;  3ZVB A;  2FI3 E;  2ULL A;  1O2Z A;  5FPY A;  1IHT H;  5F8X A;  2ZGH A;  1AVW A;  4CH2 B;  1BIT A;  1P57 B;  2EST E;  1EQ9 A;  3SYJ A;  1RD3 B;  4WY3 A;  1L2E A;  3MU5 A;  2G52 A;  1C1W H;  4KP0 A;  1TWX B;  2CGA A;  1KXC A;  1OWH A;  1PPB H;  2PTC E;  1IQH A;  1C5X B;  3UR9 A;  1J9C H;  2ZFR H;  3ZZ9 A;  5FL7 D;  2VIW A;  1OWE A;  1ZMN A;  4ZHM U;  2LP6 A;  4OS5 A;  2ZPR A;  4AGK A;  2PGB B;  1CA8 B;  2AHM E;  2KAI A;  5T6F A;  4WME A;  5EW2 H;  4JK5 A;  2O8L A;  4FOU C;  2BHG A;  1MTN C;  3SI4 H;  2ODY B;  1TBR H;  4NIX A;  1H1B A;  4OS6 A;  3VB4 A;  1CQQ A;  2RFK C;  2L6O A;  1ZYO A;  2OD3 B;  1C5U A;  1O39 A;  1DS2 E;  2TGD A;  1G37 A;  1V2J T;  1IOE A;  1O32 A;  1H8H D;  2YMS C;  3SU5 A;  1O5G H;  1DWC H;  5A8X A;  3RXM A;  4IN2 A;  1QL7 A;  1BA8 B;  2ANK H;  2BYA X;  1Z8R A;  5F8T A;  3U9A H;  3RXD A;  4A1T A;  2ZGX H;  3ATW A;  3AW0 A;  3CS0 A;  1YPH E;  2GCH F;  1CA0 C;  1SPJ A;  2XBW A;  1K1J A;  1HV7 A;  2VU8 E;  3DA9 B;  3EST A;  3EYD A;  2R3U A;  4XSK U;  3E1X B;  8LPR A;  2CF9 H;  1JBU H;  2TIO A;  4INH A;  1CGI E;  3A81 A;  3LKW A;  5J4Q A;  1O2H A;  2PWX A;  1CVW H;  1LTO A;  1RTF B;  2O8W A;  3L3T A;  1VCQ A;  1P0S H;  1HAY B;  1ELC A;  2W5E A;  3VEQ B;  2IPQ X;  1O35 A;  1QFK H;  2C3S A;  3U69 H;  3A7V A;  4H6T A;  4B71 A;  3RMO H;  1ZTK A;  2AGE X;  5JBT A;  2ZKS A;  1Y5B T;  3TJV A;  1P3C A;  1O2Y A;  3NKK A;  1KTS B;  1ZMJ A;  1XMN B;  2AFQ B;  4FVB A;  4DII H;  2BD9 A;  4H42 U;  1L1J A;  4TYD A;  1C5V A;  2ZTZ A;  1FDP A;  2BDI A;  3TJU A;  1A5G H;  5A8Y A;  1PPG E;  1GHZ A;  5AFY H;  3PM3 A;  1GGD C;  1GVK B;  3TVJ B;  3VGC C;  5K7R A;  2HAL A;  2XBX A;  2ZU3 A;  4FUJ A;  1C5Y B;  4WXV A;  2A7H A;  1G9I E;  1SGY E;  3VPK A;  3T29 A;  3STJ A;  3BTQ E;  1HAG E;  2HRV A;  1THP B;  2NU3 E;  1MZD A;  1UHB B;  3LGU A;  2A7C A;  5HKK D;  1MMJ N;  2A5K A;  3RXO A;  4I86 A;  4ABF A;  1EAI A;  3GCO A;  2SGD E;  2B0F A;  4TSF D;  5C1Y A;  1Y5A T;  2P3U B;  3KN2 A;  1Q3X A;  1LPG B;  4I33 A;  2QF0 A;  1V2T T;  3A89 A;  1NFY A;  4AG2 A;  2Z9J A;  1T4U H;  1UVT H;  8EST E;  4KEL A;  1BML A;  4THN H;  1ACB E;  3RXT A;  2A4Q A;  3TNS A;  3MNS A;  1SGF G;  1INC A;  4OS7 A;  2A1D B;  4CRG A;  4IC6 A;  1EJA A;  3LC3 A;  1BRB E;  3K9X B;  3PB1 E;  2XC4 A;  1XM1 A;  2XBY A;  4X1R U;  1P3E A;  4A92 A;  9EST A;  1H4W A;  3RM2 H;  1GHW H;  3U8R H;  3L33 A;  4YXW D;  1TNI A;  2XBV A;  2J9N A;  1AI8 H;  2FWW A;  4ACB A;  2QF3 A;  1UMA H;  2RDE A;  3FAO A;  1W0Y H;  1ZR0 A;  1JOU B;  1GBH A;  2IPH A;  4X2V A;  2KM0 A;  4HG6 A;  1PJP A;  1YY3 A;  1YWU A;  1T8L A;  2EQN A;  1OWJ A;  2B9L A;  1ID5 H;  3MOC A;  1XUK A;  1AY6 H;  1ZTJ A;  2W7S A;  2CV3 A;  2XNI A;  3SU1 A;  3LOX A;  1NRS H;  3U1I B;  5PTP A;  4ABD A;  1BTW A;  2J94 A;  5CDF E;  4YOJ A;  4YO9 A;  1O0D H;  3MHW U;  1ZSK A;  3SV6 A;  1GBI A;  1OKX A;  3ZZC A;  1S0R A;  1GMD G;  4Q7Z A;  1VCP A;  1H8D H;  3H5C B;  2DE8 A;  1DDJ A;  1AQ7 A;  3RXE A;  3LT3 A;  2ANM H;  3RXR A;  1MQ5 A;  1NS3 A;  4AGJ A;  4BTT B;  2HVY B;  2A45 B;  4K8Y A;  1F0S A;  3V0X A;  1FIW A;  2BQ6 B;  1ZPC A;  2CN0 H;  2OBQ A;  1V6D A;  4X6N A;  3MTY A;  1P10 A;  5DP7 A;  2HWL B;  5FXL A;  2GT7 A;  3MNB A;  5IK2 D;  1BDA A;  5DN6 D;  5LGO A;  4DOQ A;  5EXL A;  1UTP A;  5DK1 A;  4UEH H;  4D7F A;  4YT7 H;  2AMQ A;  2AMP A;  4ZRO A;  4MDS A;  5B6O A;  3F2F A;  4GAW A;  3BF6 H;  5HGG A;  3MO9 A;  3SNA A;  1NT1 A;  4HZH A;  1QBV H;  1ANE A;  2XC0 A;  3ZIA D;  4YLU A;  1PPF E;  1TA6 A;  4JZD H;  3SQE E;  4Y0Y E;  3SOS A;  1V2V T;  2GTB A;  1HIA B;  3PV4 A;  4DCD A;  3RXI A;  2NU0 E;  4JYT A;  1ZRB A;  1A7S A;  2JDI D;  1GBK A;  3O8C A;  1TX6 A;  1F0R A;  3OAA D;  1LQD B;  1UVP A;  2ZDK A;  2ZFP H;  1GHB G;  3OEH D;  4OS2 A;  1AZ8 A;  1EPT A;  1SHH B;  2GMT B;  2PSY A;  2BLV A;  2THF B;  1LCY A;  1HYL A;  1L4Z A;  2J34 A;  2ZHD A;  3AAU A;  4U01 A;  5EXM A;  2R2W U;  4JMY A;  3UNR A;  3T62 A;  4AYV B;  1TRY A;  2Y80 A;  3UR6 A;  5L6N H;  4TPY A;  3AVZ A;  4JCN A;  4RSP A;  4DVA U;  2JIZ D;  2PP6 A;  3FOA A;  2NWN A;  4TPI Z;  2GP9 B;  1IQM A;  1K21 H;  3F9G A;  1Z8I B;  2ZGC A;  4YM9 A;  1F0U A;  2F83 A;  4UFD H;  5GDS H;  2J98 B;  1E35 B;  3T5F H;  4B2C A;  5JBA S;  1TGT A;  1LPK B;  4X8S H;  1ZOM A;  1EOJ A;  3OX7 U;  3LJJ A;  4BXS A;  1YPM H;  3UWJ H;  1JRS A;  2W3K A;  1L4D A;  1O3C A;  1Y3U A;  2WPL S;  5B6L A;  3M5N A;  2Z94 A;  5FBE A;  1H9I E;  1ZTL A;  1IQF A;  4ZMA H;  1LHC H;  4I8G A;  3TU7 H;  1HFD A;  2PKS B;  1HJA C;  1K22 H;  1OWI A;  1NFX A;  2O8T A;  4NA9 H;  2BDA A;  3F0P A;  2PW8 H;  3BV9 B;  1TA2 A;  5LPF A;  1TNG A;  3GY3 A;  4BTI B;  3EQ0 H;  5EPY A;  2QY0 B;  3URD A;  1EZS C;  1GMD F;  3BG8 A;  1SQT A;  3SU6 A;  1GBA A;  1C1P A;  1XXD A;  1CT0 E;  2G51 A;  5KEC A;  4NIW A;  3PV5 A;  2FOG A;  3CNR A;  2ZPQ A;  3E6P H;  1BUI A;  3PWB A;  2LEL A;  2HPQ H;  5EPN A;  4Y8Y A;  2ZHW H;  5DP5 A;  1K1M A;  4ZKO U;  1EB2 A;  1AHT H;  3PYH A;  5C67 A;  1QL9 A;  2BDH A;  2FTM A;  4UDW H;  5C1U A;  3QDZ B;  3BG4 B;  3KGP A;  4OS1 A;  3RXF A;  2BY8 X;  2QAA A;  1O3L A;  1OYQ A;  1TGS Z;  5JBC S;  2VIO A;  1MU6 B;  6CHA C;  1W13 U;  1XX9 A;  4FUC A;  1XVO A;  1Z7K A;  2FXR A;  2JKH A;  2TGP Z;  3TLO A;  1ETT H;  5A0C A;  4K8B A;  1GCT C;  1GHB F;  3FAN A;  2ODQ A;  1SGC A;  1GL0 E;  1HLT H;  1D4P B;  1W0J D;  2CF8 H;  1KDQ B;  1RIW C;  5A09 A;  3MI4 A;  1PPC E;  3BIU H;  1SMF E;  4BXW A;  2W6J D;  4GPG A;  4MG3 A;  2H1U A;  1D3Q B;  1ESA A;  1U6Q A;  1GVZ A;  2OC0 A;  1TNK A;  4U30 A;  3SO3 A;  5KGO A;  2FX4 A;  2C8X B;  1QBO A;  1C1O A;  3RXA A;  4X6O A;  2CJI A;  1C5N H;  1T8N A;  4LK4 A;  5FHT A;  3RXS A;  3URC A;  3SU3 A;  2K1Q A;  1H9H E;  3A84 A;  1J15 A;  4B74 A;  1KIG H;  1C9P A;  2A2X H;  1YCP K;  3SZN A;  1HGT H;  2VID A;  1SVP A;  3W1E A;  3F0O A;  2FDA A;  3Q3Y A;  3AK5 A;  3VXE H;  2K8I A;  5EQR A;  4BAK B;  3A83 A;  4NGA H;  1MAB B;  2FOB A;  2PUX B;  2G4T A;  1GI6 A;  3GS9 A;  1UHB A;  3T28 A;  1Q31 A;  2R0L A;  4Z6A H;  1TFX A;  2AIP A;  2WUB A;  4X1N U;  3SW2 B;  5EG4 A;  1DX5 M;  2F9P A;  2XCN A;  1V3X A;  2PFE A;  3ELA H;  1KXE A;  4WF8 A;  2RDL A;  3FKS D;  4XBB A;  5C94 A;  3WW7 A;  3P8F A;  1LMW B;  2FI4 E;  2FYR A;  5SGA E;  4O9V A;  5LPE A;  3ZZ8 A;  2PKA B;  1PYT C;  3M5O A;  5DP3 A;  1WBG B;  2YOL A;  3CP7 A;  3RDZ A;  4ASU D;  1FUJ A;  1KSN A;  3KQC A;  1NRO H;  3GYM A;  1VGC C;  2OQ5 A;  5L2Y H;  2FIR H;  5C0T A;  4BOH A;  1THR H;  3BEF B;  4FU9 A;  2FOM B;  4ZHA A;  3KNX A;  1QB9 A;  4F49 A;  3SU2 A;  4RT1 A;  4AOQ A;  5TJX A;  1K1L A;  1C5R A;  1O3G A;  1HBT H;  1KY9 A;  2TRM A;  1VIT H;  2BQW B;  2H6M A;  4X8U H;  2STB E;  4Y0Z E;  4NWL A;  1XUJ A;  1LKA A;  1W0K D;  5FCK A;  2A0Q B;  1TMT H;  2EI8 A;  1GHY H;  1IQI A;  1XKA C;  1HNE E;  3MFJ A;  4WMF A;  4Q80 A;  1MKW K;  2KCY A;  1BMA A;  1MBQ A;  2Z3E A;  5GCH G;  3SOR A;  5L2Z H;  1C5Z B;  5EOK A;  4MNX A;  3ZVA A;  1UJ1 A;  3A7T A;  2VJ1 A;  1YPE H;  2QXJ A;  2XXL A;  4UFE H;  3KQB A;  3EDX B;  4ABJ A;  2GKV E;  1YPJ H;  4BAO B;  1KMH B;  3ZZ7 A;  3IG6 B;  3HK6 B;  3WWF A;  2VB0 A;  4TWW A;  3Q77 A;  5DSF A;  1C1M A;  1MU8 B;  1NM6 A;  2OC8 A;  1AFQ B;  1ARB A;  2OK5 A;  1MTV A;  1SHY A;  4RT0 A;  4X1Q U;  2XRC A;  2JJ2 D;  3KHV A;  5E2P A;  3SV7 A;  3A80 A;  3MH4 A;  2R2M B;  1VJ9 U;  1GBM A;  3M7U A;  3BTM E;  3PMH B;  1JIM A;  2TPI Z;  3KCG H;  2C4F H;  1AWF H;  2J92 A;  3AAV A;  5EST E;  4MTB A;  3RXG A;  3SND A;  4B2A A;  1B0F A;  1ELD E;  2BDG A;  2FOE A;  3VG8 A;  1ELT A;  1UVO A;  4KTU A;  3TK6 A;  8GCH G;  1ZPZ A;  2C93 B;  2BY7 X;  1ZHM A;  1GJ9 B;  2KCP A;  1UTQ A;  5FX5 A;  4X2X A;  1QRZ A;  3ZVG A;  2GGV B;  1V2U T;  1Z1J A;  2ZQ2 A;  3RXL A;  2F9U A;  1O2T A;  2CHA C;  1SR5 C;  1A2C H;  3DSG A;  2GJG A;  2KR7 A;  1IQN A;  4FVD A;  3H7T A;  1Y3V A;  4DY7 B;  1NPM A;  2VBC A;  2FES H;  1HIA A;  1FJS A;  1FY4 A;  1ELB A;  2D26 C;  1UTK A;  2BVX H;  4A5T S;  7LPR A;  1SLV B;  1HJ8 A;  1P2N A;  2Y5G A;  1NY2 2;  5JB9 S;  2GD4 B;  3S0N A;  5HXF A;  4X1P U;  4FUF A;  2C8Z B;  3RXU A;  1E0F D;  1C1V H;  1Y5U T;  1KXB A;  2UUJ B;  1C5Q A;  2GZ7 A;  2BD5 A;  1GPZ A;  1V2K T;  2R9P A;  1LVY A;  2P95 A;  1WOF A;  1Y59 T;  3FZD A;  3TNT A;  1TYN A;  1N8O C;  2BD4 A;  2GCT B;  2J98 A;  1V2W T;  5T6D A;  5GCH F;  2TGT A;  5BRR E;  1Z6J H;  1MKW H;  3R3G B;  3A88 A;  3QGN B;  1Y3Y A;  3NWU A;  4K60 A;  1SC8 U;  1YCP M;  3RU4 T;  1Z1I A;  1HCG A;  2BLO A;  4HTC H;  4HGC A;  1H8I H;  5I46 H;  3P70 B;  4FUD A;  2Z9L A;  1VKY A;  1CGJ E;  2HNT F;  4A6L A;  1DVA H;  4ZAE A;  2A5A A;  1Z8G A;  1GBC A;  2YNA A;  4QT8 C;  1YC0 A;  4WH8 A;  3MNC A;  1NFW A;  2M5T A;  4CBO A;  2VVU A;  4MNW A;  2FOC A;  3NZI A;  2XOK D;  4ISN A;  1HAP H;  3S9B A;  3RLW H;  1RFN A;  1GJB B;  3K2U A;  3Q3K A;  1O2R A;  1S6L A;  4FUB A;  1LKB A;  2ODP A;  3BTW E;  1GDQ A;  1EB1 H;  2BD3 A;  1SGP E;  8GCH F;  2M2A A;  2VIV A;  1S0Q A;  1O3E A;  2JH6 D;  1HUT H;  1CHG A;  1F5K U;  2BLW A;  2KX4 A;  1WQS A;  1ZJK A;  1DE7 H;  4WJG 2;  3GDU A;  1MTW A;  2ASU B;  4OS4 A;  1DWB H;  1O5D H;  3PTN A;  1EAS A;  2FTL E;  5GPI B;  1MD7 A;  1AUT C;  3FP7 E;  3W95 A;  5CE1 A;  3HAT H;  3UFA A;  2VH6 A;  4YTA A;  1H8E D;  7GCH G;  2CHA B;  4CRC A;  4J1Y A;  2BY9 X;  5CHA C;  5C1X A;  1AN1 E;  1FPH H;  1TPP A;  5DGJ A;  1P2M A;  1OSS A;  2A32 A;  2PUQ H;  2JET C;  3HK3 B;  4FU8 A;  1D3P B;  3EE0 B;  3SU0 A;  2ALV A;  2VWN A;  5HMA A;  3QUM P;  3TK5 A;  3T26 A;  1O3I A;  2V0B A;  1SBW A;  2GZ9 A;  1DLE A;  2LPR A;  2Q1J A;  4CR5 A;  1N8O B;  3RMM H;  2VVC A;  2IN2 A;  3K65 B;  4ISH H;  3AW1 A;  4D76 A;  3RXB A;  4RKO B;  1V2M T;  2SGP E;  2ZO3 H;  1TAB E;  2ZTX A;  1O2V A;  1GL1 A;  2W6I D;  1W8B H;  1C4Y 2;  4TWY A;  1XUI A;  1EFR D;  4I8K A;  2I6S A;  3ATL A;  1AMH A;  1NRN H;  2PSX A;  1GI9 B;  1QA7 A;  1QB6 A;  3A86 A;  1FV9 A;  3BTD E;  3U98 H;  2ZDM A;  2FOH A;  1ZSJ A;  4AC9 A;  3FP8 E;  4AB8 A;  1GI7 B;  1LVM A;  2ZHQ H;  1P02 A;  4Y10 E;  2YMS D;  3P92 A;  4YOI A;  4GUX A;  1O2G H;  1ZGV A;  2Z3D A;  4YT6 H;  4AOR A;  4Y11 E;  1O5B B;  2P93 A;  2PKA A;  1C1Q A;  2FS9 A;  3RM0 H;  2AEI H;  3FZZ A;  2EI6 A;  1O3A A;  1TQ7 B;  2QF4 A;  3TH2 H;  1BTZ A;  1B5G H;  2GMT C;  1BBR H;  2QE7 D;  4KTC A;  1QBN A;  4AFQ A; 
#chains in the Genus database with same CATH homology
 1K0H A;  2KX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...