1K0HA

Solution structure of bacteriophage lambda gpfii
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
117
structure length
117
Chain Sequence
b'MADFDNLFDAAIARADETIRGYMGTSATITSGEQSGAVIRGVFDDPENISYAGQGVRVEGSSPSLFVRTDEVRQLRRGDTLTIGEENFWVDRVSPDDGGSCHLWLGRGVPPAVNRRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords gpFII
publication title The solution structure of the bacteriophage lambda head-tail joining protein, gpFII.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Viral protein
total genus 10
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2001-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05354 Phage_attach Phage Head-Tail Attachment
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.180 Mainly Beta Beta Barrel Thrombin, subunit H Phage tail proteins 1k0hA00
1K0HA 2KX4A
chains in the Genus database with same CATH superfamily
3ZVAA 1V2QT 2C93B 2Y7ZA 4TPYA 2QIQA 3DHKH 4RT1A 2Z9JA 1BBRK 1OYQA 2Q6DA 3NCLA 2L6OA 3U8RH 1UVPA 3AASA 2ZHQH 4ABDA 4X1QU 4DVAU 4NIWA 4YT7H 3UNRA 2R2MB 1XM1A 2XNIA 3GY2A 1A0LA 3BSQA 1O2LA 1O2PA 4K1TA 2D2DA 2Y6TA 3GCOA 4DW2U 3MNCA 3PO1B 3OE7D 2GGVB 4AB8A 2ODYB 3KYGA 3SO3A 1H9LB 1TGCA 3TGJE 4X8SH 3HATH 1CA8B 1QURH 3P8NA 2XW9A 1YPEH 2ZU1A 3HK6B 4WH6A 2ZFTA 4F48B 2JETC 2Y82A 1CHOG 2NU2E 5ESBA 1GVLA 1FDPA 1UK3A 1DUEA 2UUKB 4P00A 2Z3CA 5AHGH 3UNQA 1V2PT 3A8AA 1NPMA 2AYWA 4DT4A 1YCPH 2V3HH 2K0QA 1TABE 3MMGA 2BLWA 4M9FA 1RTKA 3QN7A 3PB1E 4K1EA 3T27A 1Q31A 1ZHRA 1ELCA 2IN2A 2XOKD 1UCYE 4Q63A 3RXVA 1K21H 4YOJA 1DSUA 1LHCH 3TPIZ 5ESTE 3B9FH 1FPHH 5SGAE 2O8LA 3MNSA 1FPCH 1WDIA 3EA8A 1TE0A 4ZKRU 1GHAG 1Z1JA 3ATWA 1EAWA 4RT0A 3LT3A 2QAAA 1K1OA 3BTWE 1K1NA 3SNBA 1AO5A 4XBDA 3S69A 3D23A 4J2YB 3M3SA 1DE7H 1GJ6A 4ABGA 1YPMH 1J9CH 3PWBA 4JZIA 4BANB 2CK3D 1W13U 2QF5A 3GY7A 4Z1MD 5FBEA 5JBCS 3F6UH 3HGNA 3K65B 1ELFA 3F9FA 1SFQB 3SJKA 1YWUA 1O2MA 4LOYH 1ID5H 5FHTA 3FOAA 1DFPA 5EW1H 1HAOH 1ACBE 4O9VA 4BAMB 1AWHB 3MH6A 1CHGA 1XXFA 2TGDA 3GS9A 3MOCA 1BT7A 2HRVA 4OGYA 1QB1A 1HAZB 1FY4A 5C0TA 1RGQA 1NC6A 3DUXH 5K0HA 2ZCKP 3B23B 2GTBA 1MCTA 1LPKB 1BMNH 1GJ9B 1GL1A 2A7JA 3PTBA 3SHCH 3R3GB 3SV2H 1P10A 2VIDA 1VITH 2XCFA 3Q00A 1CA0B 1AE8H 1N6YA 1YC0A 1TLDA 2JH0D 5HXFA 1JIRA 3MU4A 2ZFFH 3RUOA 2BQ6B 3SGQE 2OC8A 1HRTH 1V2ST 5EJ1A 3PRDA 4IMQA 1MCVA 1EPTB 3ZZAA 1GCTB 1V6DA 1QJ1B 5C20A 1F7ZA 1AD8H 1G3DA 2V3MA 4I31A 2ANYA 2A5AA 2STAE 1FQ3A 4NA9H 3ATLA 1ESAA 2D26C 3UR6A 1O2YA 2PLXA 1ZPZA 1QJ7B 1WSSH 2OLGA 1MUEB 4X8TH 5IDKA 1GMHF 1O3LA 1IQNA 3P95A 3MH4A 1C1WH 3BEUA 4INKA 1EATA 1W8BH 2BTCE 4YTAA 5FPTA 2O8UA 3RXMA 3M36A 2SNWA 1T8OA 4X6OA 4F55A 1YLNA 1O0DH 1ELEE 1QNJA 5L6NH 2XNDD 1DOJA 4SGAE 1EP5A 2HNTC 3P92A 1YKTA 3H09A 5F03A 3HPTB 4CRDA 2TGAA 1FNIA 3M5NA 1HBTH 3M61U 2PKSB 1C2JA 1SPJA 1UCYH 2HOBA 3EAJA 4YLQH 5DPAA 1H1BA 6GCHF 1P12E 1F0TA 1MQ5A 5FCRA 4K8BA 2HNTE 1UTQA 1XUFA 1D4PB 3GYLB 4DIIH 3QUMP 2GV6A 3TK9A 4YT6H 1LCYA 3A88A 2QGRA 1XUKA 1KXDA 4XD7D 2BXUH 4O3UA 1HAGE 3W94A 2V3OH 4BTUB 1O3IA 2G4TA 2RDLA 2XC0A 3ZZBA 1DS2E 2EC9H 5TCAA 1CBWB 3UQOA 3WY8A 5ABWA 1SGDE 1FX0B 2ZPQA 5GCHG 2SFAA 1GJAB 1ZYOA 3RU4D 2DUCA 1KXAA 4IGDA 4YM9A 1EJNA 2TRMA 4DY7B 2EA3A 1CA0C 1QBVH 4BAKB 2ZI2H 3VB6A 1TX7A 1ARBA 3RXSA 1SI5H 1DVAH 1YLCA 2KAIB 2OINA 1O2SA 4Q7XA 1EPTC 1O39A 1GCTC 3KNXA 4MNWA 1KXBA 2TPIZ 4B1TA 1C2LA 1VITF 4MNXA 3T26A 2AHME 1CT4E 2PKAB 2ULLA 5LPEA 2Z94A 2Q6GA 2AGEX 3VPKA 3T2NA 2R0LA 1ZTKA 3RC6A 1GCDA 1TONA 4NFEA 1S0QA 4INHA 4UFEH 4Y7BA 1AUJA 1P03A 1C5OH 4WY3A 1LHFH 2PKSC 4INLA 1T8NA 5F8XA 2WPDD 1A1RA 1E34B 1C5TA 1UHBB 2H9TH 1GMDF 3A8BA 3M5OA 5B6LA 3DD2H 1GBIA 2B8OH 1DXWA 3S0NA 5JB8S 2BY8X 4JCNA 1TB6H 3H7OA 1NFWA 3BF6H 2ZDLA 5A2MH 4CH8B 3SN8A 5JB9S 3S9AA 1DITH 3MU0A 3PMAB 4B2AA 3OEHD 2W6JD 1CBWC 3BTTE 1UMAH 1AWFH 1ESTA 1VJAU 4Y11E 1HNEE 2WV5A 3PTNA 4R8TB 1O2RA 1GHYH 3PV4A 2JJ2D 3DSOA 1KIGH 4WMFA 1ETTH 1GJCB 2G55A 1K1LA 1P06A 2DE9A 2YNAA 3MHWU 1DWEH 3AAUA 5JPMH 4WF8A 3SZNA 1O3OA 3GCTG 2OC7A 1ZSJA 3UOUA 2B9LA 2HLDD 5F53A 2ALVA 5EJZA 1GI6A 5EOKA 3TU7H 4GAWA 2VWNA 1XUIA 4NG9H 1O5GH 4OGXA 2SGFE 4BAHB 1GJ5H 1C1QA 5J4SA 3E1XB 3E3TA 2H9EH 2A7CA 1YGCH 2FODA 1TOMH 2BY9X 2QCYA 5EQSA 2GT7A 2GP9B 1CGHA 1MMJN 1P2OA 3SU0A 1SSXA 3PV5A 2WUBA 3KQBA 1V2VT 3C27B 4ISNA 1CQQA 4ABHA 2LELA 5C5NA 1W7GH 1S6FA 4YZUA 1EASA 1SGCA 2Y80A 4TY7A 1V2MT 4XSKU 4OS6A 1F0RA 1C5VA 1BIOA 1JXPA 1NY22 1UVUH 1B7XB 1T4VH 3KQEA 1S84A 2OQUA 1AQ7A 1P57B 1NBMD 2P3FH 4AB9A 2A32A 4DURA 1SFIA 5C0UA 1MZAA 1OOKB 3MH7A 4BOHA 3BTDE 1K28D 2HPPH 3URCA 1GWAA 3AVZA 3Q3KA 4MPUA 3SNAA 2FOHA 3OYPA 3Q3XA 1O2OA 2SGPE 1C5RA 1PJPA 3TH2H 2FLRH 1H9IE 2CF9H 5FPYA 1BA8B 3PMJA 2ZDAH 3C1KA 2EI8A 4OM9A 1GMCG 1A5HA 3SORA 3RXIA 1N6XA 2GDEH 1HAPH 3QTVH 2A4QA 1QBOA 3VB5A 4JZFH 2FOEA 1S83A 2P3UB 1WTHD 3VFEA 3JZ1B 2G5VA 1HAHH 1RD3B 2W7SA 4CRBA 2JDID 1ZLRA 2CF8H 1W10U 2Z6BD 1QQ4A 1NS3A 3ZZDA 3E91A 2FMJA 1TRYA 2H6MA 2WYJA 2L74A 3RXHA 5LH8A 1O2UA 1QBNA 2A31A 4ABAA 1MTVA 1O3FA 2JIZD 3K2UA 4Y8XA 1SGFG 1FJSA 5E8EH 2VVUA 1GHWH 3GDSA 4GVUA 2O8TA 1HXFH 1INCA 3RXQA 5E0JA 5DGJA 4XBBA 2V6NA 1V2TT 3MU1A 5CDFE 3Q76A 5C17A 4A1VA 3K6YA 5EODA 1DY8A 1NO9H 3BN9A 3ATIA 2BQWB 4JMYA 1YPLH 4XFQA 3LJOA 1QB6A 2ZG0H 1EB2A 4D7GA 4AFUA 3P8GA 1EZSC 3ESTA 2A7HA 4ACBA 1D3QB 1KDQA 1S0RA 2ZZUH 2XYAA 1Y3VA 4TSFD 1O3BA 1EX3A 1FV9A 1CT0E 1AFQB 3PMBB 4GPGA 3SHAH 1D9IA 1QL9A 4ZXXH 3QGJA 1GI4A 3RXGA 2PSXA 3QZRA 1G3CA 4LZ4B 1XKBC 3V3MA 1O3AA 4D9RA 4WWYA 3ZZ7A 1F2SE 2P93A 1RTFB 3A89A 1Y3UA 1O31A 1NESE 2VWOA 3K9XB 4ACAA 3RU4E 1O3JA 3IG6B 1Z8IB 2QXIA 4Q7YA 3UWJH 1P0SH 3RXOA 3MFJA 1GDNA 1QCPA 1IQLA 2V7QD 4E7NA 5FBIA 4AGKA 1EZXC 2V0BA 4CR9A 4WJG2 1SGPE 4JZEH 1G2LA 1WOFA 2FI3E 2P16A 3D62A 2BX4A 5EXNA 1C5PA 2BXTH 2G52A 3MYWA 1ETSH 2ZU4A 5AF9H 1V2KT 2ZPSA 1XUGA 3VB7A 1P04A 4HG6A 1LHGH 1GBFA 1A3EH 1O5AB 1S81A 2TBSA 5EXLA 1F5LA 3GYMA 5PTPA 3RXPA 1A5GH 4B74A 1O36A 1EFRD 2PSYA 2VU8E 4I33A 3Q77A 4FOUC 4WMDA 1OWEA 4DG4A 1MU8B 1PQ5A 2WHXA 3T25A 5GIBA 1VGCC 4R0IA 1TYNA 2PW8H 4NCYA 5C1XA 2F91A 5C1UA 2XBYA 1VR1H 2RCEA 5DSFA 2BDYA 5HGGA 2VBCA 4UONA 3LIWA 1ZRBA 1GJDB 1UTJA 1UJ1A 1A0HB 2FO9A 3SUFA 2AEIH 3T28A 1RFNA 1AHTH 3URDA 1Z6EA 5GPIB 4ZHMU 3RP2A 1AFQC 1LQEA 5LPRA 3ZVBA 2PGBB 2H2ZA 1GHBF 4DGJA 6LPRA 1LKBA 2I6SA 3AK5A 2XC5A 4ASHA 2ZEBA 1TWXB 2WV9A 3OY5U 4U30A 3DA9B 4ZHLU 4Z0KA 5T6FA 3TK6A 3UUZA 2ZFRH 2ILNA 1YPKH 3U1JB 1HPGA 3O8DA 4I7YH 2PUQH 2EI7A 4ISIH 2G5NA 1GHVH 1ZMLA 4I8HA 3U8OH 1JBUH 1G3EA 4Q2KA 4X0WU 1K22H 1LHDH 1WBGB 3D49H 1KTTB 1O2WA 1ORFA 1OWJA 1S6HA 1EZQA 2P59A 2ZHFH 2Y5HA 4WH8A 2VIOA 1MH0A 2ZFQH 3I78A 1LHEH 1QQUA 2RFKC 1WXRA 2XTTB 1BBRH 2ANKH 5EQRA 4ZHAA 4TYDA 3SW2B 2WPHS 1KSNA 5EJLA 2G81E 2QY0B 3RC4A 1TPAE 1LO6A 1Y3YA 1UTMA 2SGEE 1YM0A 3F3BA 1CSOE 3TNTA 1O35A 1PYTD 1HIAA 3QO6A 4OS2A 4RSPA 1MU6B 1C1VH 2FOMB 1ZPBA 2QXJA 3V12A 1VCQA 5TCCA 4K69A 4MPWA 3PMHB 5GJ4B 1XMNB 1CVWH 4NSVA 2ZNKH 3AAVA 1V2UT 2YMSD 2B7DH 3VGCC 3BEFB 1ZJKA 1IQEA 2BX3A 3P8OA 1C2GA 3M5MA 1N1LA 4MQAA 1TA6A 4Y79A 3F2FA 1DDJA 4Z6AH 5T6DA 3UNSA 3BG4B 5FX6A 1FZZA 4M7GA 2XRCA 3FO8D 1NBME 3NPSA 1TMTH 1ZOMA 1CHOF 1Y59T 1SMFE 1TMUH 2VB0A 1O3GA 1WQVH 1O2VA 1MD7A 1GBBA 3TITA 2GVFA 3UREA 1L1NA 1Y5UT 3E0PB 2ZHDA 2EQNA 1QY6A 4UDWH 1MBMA 2ZFSA 3U8TH 2OC0A 2OQ5A 4ABEA 4AFZA 5DN6D 2AGIX 5E0GA 3P17H 2PP6A 1YP9A 1IQJA 1TX6A 2FOGA 1G9IE 3P70B 2ZTZA 3F2HA 1HLTH 2NU0E 3STIA 4ZKSU 5EQQA 1GHAF 2ZPRA 3BTME 1ZZZA 1V3XA 1LKAA 3F9EA 1D3DB 2R3UA 1F5RA 1AUTC 2BZ6H 4CRCA 3U69H 2GCHG 3ZV9A 2OK5A 2W3KA 4O3TA 4B2CA 1SLUB 3H7TA 4A7IB 2A1DB 1C2MA 2OBOA 1TGNA 1ZSKA 3TVJB 3BIUH 1TNLA 3ODFA 5AFYH 1T32A 4NZLA 3MO9A 2AIPA 1DSTA 1ELAA 5FXLA 1C5SA 1O2TA 1XVMA 3UTUH 3KIDU 2GMTB 1TNJA 5BRRE 4FU7A 1P2QA 4NIXA 1H8HD 4GCHG 1P9UA 1FIZA 1SC8U 2O8WA 1FLEE 3SJ8A 2P95A 3NUMA 8GCHG 4ASUD 1OS8A 1FUJA 4XDEA 3CENA 2A0QB 5A8ZA 1AY6H 3MH5A 4ZUHA 1L2EA 2ASUB 3EDXB 5L30H 2BMGB 1C2DA 3EE7A 5AFZH 3BG4C 4Q80A 1A0JA 3FZDA 1GHXH 2J98A 3RMOH 3SUDA 1HAYB 1C1TA 1KDQB 1O2GH 1UTKA 3SU1A 3SV9A 1E1RD 2M5TA 1SGIB 2A45B 4ABFA 1TQ7B 3SU5A 4AX9H 1EAXA 3SNCA 1AVWA 4D7FA 3SQHE 1HB0B 2FYRA 1P8VC 3MQKC 1ANCA 5KGOA 4B6FA 1ZRKA 4BTIB 2V35A 5GXPA 5C67A 1P2NA 1GGDB 1LVBA 1MQ6A 1GBEA 3SU4A 1WAYB 4X2WA 1QIXB 1Q3XA 2VNTA 1UTOA 1YCPM 3KGPA 3VG8A 1MZDA 3GDVA 2Z9IA 1A3BH 1AN1E 5DP9A 1TNIA 1GVZA 1RRKA 1HV7A 1ELVA 1O3NA 2BY7X 2WYGA 1F0UA 2FOBA 5G4BA 4O03A 1W12U 2F4LA 1LPZB 1SQTA 2YMSB 1L0ZA 2C3SA 4X2XA 2JKHA 1GBAA 3QWCH 5C5OA 4LXBH 1J8AA 4PROA 1GI3A 3LH3A 1DUAA 1NRSH 1O2ZA 1D3PB 1MBQA 1NU9A 3LGWA 1AVGH 3PYHA 1DT2A 1O2XA 2GMTC 1GI0A 4ZKNU 5C3NA 1KLJH 1O30A 3SBKA 2FTMA 7ESTE 2O9QA 2G8TA 5C1YA 1O3MA 4BNRA 5DG6A 2EEKA 4X2YA 4O97A 1QA7A 2GX4A 2J2UA 6ESTA 4DIHH 2XWBI 3SUGA 2ZCHP 1AFEH 1O5FH 1V2NT 2Q1JA 3RXFA 1NM6A 2HWLB 1C5WB 1W11U 2ESTE 3F9HA 5B6OA 2CXVA 3OY6U 3F0OA 3ZVCA 1YLDA 2QA9E 5GCHF 1GL0E 5FL7D 1QRXA 2CJIA 1L4DA 4UFFH 3E16B 2A4GA 1KLTA 1K1IA 5LGOA 3BTHE 1NROH 2H1UA 2WINI 2FIRH 3E8LA 4HTCH 4Y0ZE 3RXUA 2BDBA 1DPOA 1MAXA 5KECA 5DP6A 3ITIA 4MDSA 2XWAA 1AIXH 1N8OC 3SV7A 3NRLA 3KL6A 3ZZ4A 4YLUA 1GGDC 1BRCE 3TJVA 2J92A 4TWWA 2FP7B 3W1EA 1ZR0A 2ZA5A 1PYTC 1BB0B 3OAAD 2Z3DA 1SLWB 3ZZ9A 1AKSA 1K2I1 2W26A 1PPFE 1WCZA 3A86A 4XRNA 5HIYA 1Y3XA 2YMSC 1TPOA 5I46H 1TRNA 4TPIZ 2ZP0H 1BRUP 1GI1A 1V2RT 3A82A 3O8BA 5CHBA 1NFUA 2F9UA 2ZO3H 5GNDA 3ZVDA 4ZCNA 2UUFB 3WW7A 1SOZA 3QLPH 3HK3B 4A5TS 1XUHA 4YO9A 2ZWLH 4ISOA 4FXGH 2A5IA 1HIAB 1COWD 3BTEE 2ZHEH 2OD3B 3M7TA 3SZEA 5TJXA 1O33A 1GDQA 4UEHH 1PQ8A 4WVPE 1BJUA 3VEQB 4F49A 2FTLE 1GG6B 4ISHH 5T1VA 1C1UH 1ELTA 1WTGH 1B0EA 1OP8A 1P02A 4I8JA 4Q4LA 2HPQH 1FAXA 2BQ7B 2KCAA 1PPCE 3OTJE 4K2YA 3AW1A 1MTUA 1LPGB 4A6LA 1HYLA 4HGCA 1QZ8A 3EA7A 1THSH 3SGBE 4AGJA 3F2GA 2ZU3A 3RLYH 1OWIA 1RTLA 3S7HB 5AVDA 2ZGCA 3FVFB 3GCTF 2CHAB 2ODPA 1Z7KA 3RMLH 1Q2WA 1BUIA 1O38A 1O3KA 1IQGA 4TY6A 1WUNH 2OTVA 5DKMA 3R0FA 2W6ID 4Y76A 1MD8A 3M5LA 3F68H 2RA0A 1E36B 2GKVE 1O3HA 5HKKD 2VIVA 2QXHA 3KQ5A 1BZXE 1Y3WA 2FEQH 1OP0A 3M7QA 1A7SA 2JH6D 3EA9A 1TFXA 5H4IB 8ESTE 1W0JD 4FVBA 1S6LA 4FUFA 3ATMA 2W5EA 3QTOH 1SL3A 1OP2A 1VCPA 3LJJA 2BHGA 1FY5A 1ANDA 3A7XA 3LGTA 3A7ZA 4KP0A 3ELAH 2C8ZB 4FUEA 1NT1A 1HAXB 3L3TA 4Q7ZA 1SQAA 1D6WA 1QHRB 2CN0H 2FI4E 2WSSD 4ISLA 4X1NU 2H9HA 4WMEA 1MABB 3RU4T 3BTGE 3RDZA 3BV9B 4A1XA 2PUXB 1SGFA 1GBMA 1BRAA 2J9NA 5F8TA 3LKWA 2ZDVH 1S82A 2BDGA 2ZTYA 1GG6C 2C8WB 1H8DH 3TH3H 5CE1A 1TQ0B 1ABJH 2AMQA 1GMCF 1TGBA 2QXGA 2XBXA 4KTUA 1CO7E 2FOCA 3PM3A 2ZECA 2A5KA 2VVCA 2HVYB 1CT2E 5E0HA 2J98B 3HKJB 2UWLA 3N7EA 2CHAC 1DX5M 4MNYA 2FESH 1J15A 3A84A 1EKBB 1TALA 1KTSB 3RM2H 4X6NA 1TPSA 1VGCB 1O5BB 4JYUH 2UUJB 1FN8A 2C4FH 2Y81A 3IITA 3LH1A 1GI8B 1W3CA 1EAUA 5CHAB 3ODDA 5JYIA 3QX5H 2SGQE 2BD7A 7GCHG 2IPQX 1C4Y2 2BOHB 1GBLA 4JK6A 2B0FA 2UWPA 1GHZA 1O2HA 3LGVA 3RXKA 2JH5D 1E79D 3N99A 2DE8A 3BTQE 3E90B 3SGAE 1DM4B 2VINA 1NU7B 1EP6A 2ALPA 1XXDA 2QN5T 1UVSH 3NKKA 2KCOA 4FU9A 2STBE 3RLWH 2WPJS 1QGFA 5LPFA 4Y0YE 1BBRE 4Y71A 1SGEE 3KHVA 2IOTA 1NRNH 4X1PU 2BDHA 5E2OA 3SNEA 1QR3E 1A4WH 1O2KA 1TOCB 4UFDH 3A8CA 1EQ9A 5DP3A 3U98H 2R3YA 3IWMA 1YY3A 1PFXC 2BVXH 3PLKA 3DSPA 4Y10E 2LP6A 4AC9A 1OX1A 1K0HA 4BXSA 1MKXK 1C9TA 1KXEA 1BOQA 1W7XH 3L33A 3M7UA 2FDAA 3UIRA 1MKWK 1S5SA 2XCNA 1O2IA 2P94A 2KCPA 1S85A 5JBBS 1ZHMA 5JDUB 2KX4A 3DT0H 2ZDKA 2RA3A 2PHBA 1SHHB 3SNDA 1Z6JH 4OS4A 2F9BH 4B6EA 1A5IA 4K60A 3U1IB 2AMPA 2Z9GA 1TA2A 1HAVA 3LGUA 1RS0A 5HM9A 1WU1A 2NU3E 1AZ8A 3LGYA 2VGCB 2UUYA 5GWZA 1C2HA 4AORA 2G51A 3QZQA 1HXEH 4I8LA 4LZ1H 3W95A 2RDEA 2BOKA 1W14U 1ZHPA 3VGCB 4E06H 5IK2D 1W0YH 4FUGA 4B75A 2ODQA 4RKOB 5CHAC 3ZYDA 2VVVA 2W3IA 1H9HE 1D6RA 1BTXA 4OS5A 3PLPA 1QRZA 1C1SA 1E35B 1IQIA 3KYFA 1DLKB 4A1TA 3SQEE 1C5YB 2Q6FA 2NWNA 5JBAS 4RN6A 2OUAA 5KEDA 4X2VA 1W0ZU 4GUXA 2ZC9H 5EPNA 4FETA 9LPRA 1O2JA 3GISB 2XC4A 1SVPA 3TJOA 2J94A 1EAIA 2ZDNA 1LTOA 1LVOA 1C2KA 3U9AH 1FAKH 3DCLA 4U2WA 1AKSB 2OC1A 3LU9B 3DFJA 3VB4A 1L1JA 4FVDA 2VH6A 4Y6DA 1SGQE 1PQAA 1Z8GA 2QE7D 3ATKA 1ZMNA 3LDXH 1GBKA 2BD2A 1C5UA 4X8VH 3UR9A 5DP8A 4AN7A 2FS8A 2R0KA 1SGYE 1VKYA 3M35A 1TBRH 1O3EA 4SGBE 1ZTLA 1IQFA 1LQDB 2WPKS 1FY1A 3UQVA 1QRWA 1XKAC 2B5TB 1SBWA 3EE0B 1BRBE 1V2LT 4IN1A 1DICA 1JIMA 1D3TB 1O2NA 2QF3A 1KXFA 1XVOA 2FPZA 3GY8A 2BVRH 5A8YA 1RJXB 2BD9A 5CMXH 2A4OA 4THNH 3SYJA 2WPIS 1HDTH 2A2XH 1O32A 2VGCC 1AI8H 3MTYA 4JYVH 4DCDA 1C5QA 4DOQA 6CHAB 2BVSH 1YYY1 1ZGVA 1C9PA 2QV1A 1KY9A 2CV3A 3PWCA 1UTNA 1SB1H 3MNBA 1MTNB 2ZF0H 3SI4H 7KMEH 1NFYA 1P11E 1C2IA 1IHSH 2FX4A 2F9VA 5EG4A 5A8XA 1DWDH 1C5LH 1GJ7B 1AMHA 1RXPA 3RXAA 2YOLA 5K7RA 2UWOA 2FS9A 1TNGA 1P2KA 2ANWA 3FKSD 1BMMH 1OWDA 1ZTJA 1YCPK 3Q3YA 1QJ6B 1ANBA 2BM2A 1NRPH 1P3CA 3MO3A 4IMZA 2BDCA 2BLOA 2CGAA 1QTFA 2R9PA 2ZCLP 3DFLA 1F92A 4AYVB 3S9CA 3OX7U 1C4U2 4ESTE 3OSYA 3E0NB 2OP9A 1BTPA 3GY6A 1O3DA 4ZXYH 1NZQH 2TIOA 4FU8A 4IS5A 3A7WA 3RXTA 4TWYA 3NWUA 4MNVA 1TGSZ 1YF4A 3UY9A 1FXYA 5IYTA 4BAQB 1TAWA 2XBVA 2I6QA 4NIYA 1DXPA 4Y8ZA 3TK5A 5FAHA 1SG8B 1G37A 1KLIH 1TPPA 4ABJA 2GCHF 3FP6E 1BMLA 5C2ZA 3KF2A 2LPRA 1YPGH 3OFND 4YOIA 1LMWB 1CE5A 4MG3A 1OWHA 1AB9B 1G30B 1CGJE 1AGJA 1W2KH 3SU2A 3FFGA 4BTTB 1BHXF 1T8LA 3UAIC 2J95A 1C1RA 3ZIAD 1QB9A 6CHAC 1Z1IA 1PPEE 3UWIA 1IAUA 4CH2B 2FXRA 4CRFA 3OEED 1ELBA 4H4FA 3GY5A 2GJGA 3MNXA 3FANA 1JMOH 2XBWA 3T29A 1FONA 1VJ9U 4GCHF 2H5DA 3CNRA 1THPB 2Z9LA 5DJ7A 3TH4H 3ZVGA 1MTNC 3PO1C 3GCNA 4AOQA 4JYTA 4CREA 1HUTH 3MU8A 3RXRA 1DWBH 2BDAA 1BJVA 8GCHF 4NZQA 3ZVEA 2OXSA 4I8GA 5DP7A 1SQRA 1P2IA 1O3PB 1YBWA 3GICB 1GVKB 1O5CB 1GI2A 4YESB 4H6SB 3FAOA 2FZZA 4NIVA 3V0XA 2TGTA 2BY5X 4RI0A 3RMNH 3GCHB 2ZGHA 5HYOA 1N8OB 1K9OE 2KFWA 4IBLH 8KME2 4JZ1A 3GY4A 1GI5A 1GMHG 4BXWA 1C5ZB 3NXPA 1FN6A 1H8ED 3B8JA 1ANEA 1X7AC 3PV2A 2K1QA 1JRSA 4B71A 1C4V2 9ESTA 2AS9A 1YPHC 4E05H 3A81A 4ABBA 4D76A 3PRBA 1EOJA 4XOJA 6GCHG 1QL8A 4OS7A 1T31A 1KYNA 4Y8YA 1KMHB 1UTLM 1YPHE 3CP7A 3SJ9A 2BYAX 1AZZA 3ZZ3A 5C94A 1UVOA 1P09A 1P2JA 3WWFA 1FMGA 2GZ9A 3ZZ5A 3L6PA 4IC6A 2BZAA 1AB9C 1GDUA 3UB0A 1BMAA 1NFXA 4GSOA 1BTYA 2HGTH 1UCYK 1GI7B 1Z8JB 2AGGX 2ZKSA 1HAVB 1F5KU 4IN2A 2PFEA 3SJIA 2ZQ2A 2KM0A 2A4RA 2QC2A 3TJUA 1W0KD 2WPMS 1EZUC 5A0CA 2NU1E 2TGPZ 3EYDA 3I29A 2VIPA 1EUFA 3SU3A 3UFAA 1IQHA 3GY3A 2IPHA 4J1YA 5I25A 4KKDA 4U32A 1PPZA 3VXFH 1ELDE 2BD5A 3SJOA 2PR3A 1OYTH 2NU4E 2FOAA 2GDDA 2VJ1A 3SV8A 2AERH 3FZZA 2GZ7A 1P01A 3ZVFA 3NK8A 2M2AA 3GDUA 2ZU5A 1GBTA 4WXVA 1K1JA 2Z7FE 1VITG 5BPEA 3VB3A 2QF0A 3GCHC 3A8DA 5E2PA 1IQMA 1FI8A 1NTPA 1ZMJA 3BTKE 5A0AE 1IOEA 2PGQB 4GHTA 4MTBA 1NRQH 1EJAA 3MI4A 3T5FH 2VIWA 5EXMA 1LVYA 2W7UA 1T8MA 4CBOA 4XBCA 4KTSA 1HJAB 2VH0A 1MTWA 1NRRH 2J34A 1SGTA 4TT3D 4ZROA 1C2EA 3V7TA 4CR5A 1V2OT 3V13A 1GMDG 2PTCE 4WXIA 4CHAB 3N7DA 3QK1A 1DWCH 1PPHE 3P8FA 3LC5A 2OCVB 3CS7A 1CGIE 3RM0H 3SUEA 2C8YB 5FX5A 2RG3A 4ZAEA 3HGPA 2YNBA 1G3BA 1UTPA 3WWBA 2Z9KA 2HVXA 1TNKA 1E0FD 3OU0A 3UOPA 2FI5E 4QT8C 4RKJB 2C8XB 2ZGJA 8LPRA 2H5CA 1Y5AT 4DT7B 5DP4A 1JOUB 1GBJA 2SNVA 1C1OA 1ABIH 3BTFE 3EGKH 5HIZA 1EOLA 3KQCA 1TRMA 3D65E 3GOVB 1WV7H 2ZGXH 3LC3A 3QDZB 4MLFB 2K8IA 2KR7A 1A46H 4I8KA 1DLEA 4AG2A 1BITA 3DSGA 1CU1A 1Y5BT 3QGNB 2ZFPH 4OS1A 4GLYA 2PWXA 2C90B 3U28C 2F9OA 4NWLA 3E6PH 1P3EA 4MPVA 3RXJA 4X8UH 1ZGIA 2ANMH 3KEEA 1OPHB 4YXWD 2FOFA 3RXBA 1C1MA 1BHXB 3TGKE 2VWLA 1OHHD 3FN8A 4D8NA 1SQOA 5L2ZH 5A0BA 2F9PA 1HJAC 2ZGBH 1Z8RA 3ZYEA 4FUJA 1BTUA 3O8CA 2J97A 4NA8A 3KN2A 2D1JA 3ZZCA 4JZDH 5GDSH 3SU6A 2FYQA 3HKIB 3O8RA 1KXCA 2F43B 4CHAC 1O5EH 3MU5A 4E7RG 5EU8A 1GJBB 1SGRE 5L2YH 4NGAH 4VGCB 3M3VA 1OKXA 3LPRA 4U01A 4FUBA 3TIUA 2QYIA 4X6MA 1V2WT 3MWIU 4MVNA 2VIQA 1TBQH 2BDIA 2ZIQH 3F1SB 2PTNA 4UFGH 1SGNE 4KGAA 1G36A 3EQ0H 4ZH8A 3P6ZB 1TX8A 2P8OB 1GBDA 4DJZB 1UW7A 4FUCA 1BTWA 3UPEA 2EY4C 7LPRA 1FY3A 5ETXA 3TNSA 1H8IH 4CBNA 3SOSA 4XE4A 2JJ1D 1B5GH 3H5CB 1GI9B 3JZ2B 3TJNA 3G01A 3SI3H 2D8WA 1OSSA 1TMBH 1UK2A 3RXDA 4FUIA 3F0PA 2Y5FA 4HFPB 2PV9B 2QF4A 3ZV8A 1T7CA 1E37B 1HGTH 3OTPA 2WUCA 1J17T 1C2FA 3RXEA 2P3TB 1H4WA 1WQSA 2KZ4A 1O34A 2IJOB 2CMYA 4NWKA 4K8YA 1UO6A 2BY6X 4KTCA 4GHQA 1C1NA 1SHYA 4AYYB 3CS0A 4LK4A 3A85A 2J4IA 2R2WU 2F9NA 1ZPCA 1C5MD 4A92A 1HJ8A 1A2CH 2ZU2A 3T62A 1YPJH 3A83A 2HNTF 3VXEH 3SV6A 3S9BA 1GJ8B 1C1PA 2VWMA 1K1MA 3NZIA 4F4OC 1FY8E 3A7TA 2ZQ1A 3FP8E 1GPZA 3STJA 2HALA 4AG1A 1OXGA 7GCHF 1MAYA 1PQ7A 2KCYA 2WZQA 1EPTA 5HMAA 3I77A 3A7VA 3PROA 3MO6A 1FIWA 3ENSB 1HCGA 5F6MA 3LGIA 1AVXA 1TGTA 3BG8A 4VGCC 1RIWB 2FM2A 1IQKA 2F3CE 4ZMAH 1AU8A 1MKXH 4K5ZA 1MTSA 1DY9A 3TGIE 1O37A 3BEIB 3LONA 1SOTA 1ESBA 2P8OC 5HM2A 3BIVH 3RXLA 4I86A 1L1GA 1MKWH 3ZZ6A 4B76A 2HLCA 1VZQH 2FLBH 1BTZA 4B73A 2AH4X 1U6QA 1QL7A 4FUHA 5FCKA 2J38A 1GBHA 5FPSA 2SGAA 5DK1A 1SKYE 2AIQA 1O2QA 1P9SA 4AFQA 1EB1H 1ZSLA 2F83A 1SR5C 2IJD1 1BQYA 2FWWA 2GCTB 4KELA 5EPYA 4JK5A 4FUDA 1ETRH 3KCGH 3RXCA 3PLBA 3RC5A 1BCUH 2Y5GA 5EW2H 2WV4A 1PPBH 1J14A 1T4UH 4CRGA 2BLVA 4P02A 1HJ9A 4MPXA 1JRTA 1NN6A 3KQDA 1BMFD 4K1SA 4NA7A 1V2JT 3FP7E 1P2MA 5F8ZA 4UD9H 3TLOA 1K1PA 1PPGE 4AZ2B 3A7YA 4ZKOU 1UK4A 4Y7AA 2A2QH 2ZHWH 1ZJDA 3N7OA 4UE7H 4X6PA 1LVMA 1QA0A 1Y8TA 1QFKH 5DP5A 1DANH 3AW0A 1UVTH 1IHTH 4H42U 1BTHH 1C5XB 4IW4E 1GJ4H 1TIOA 3F9GA 2XXLA 5A09A 2BD3A 5J4QA 1HAIH 5DO4H 1P05A 2THFB 3M37A 2JETB 1VCWA 2FX6A 1A61H 4CRAA 1XX9A 4YOGA 1J16A 1LDTT 1SLXB 3A80A 3LOXA 4ABIA 3K6ZA 2ZDMA 2KAIA 1XUJA 2AFQB 1AE5A 1GHBG 4NFFA 2GV7A 4NSYA 1HFDA 2G00A 1RIWC 1ELGA 2BD8A 1F0SA 1M9UA 3S7KB 1EXFA 4K3JA 1OWKA 4X1RU 2SGDE 2PKAA 2WPLS 1O5DH 1SLVB 3A87A 1TNHA 1C5NH 2Y7XA 3ZZ8A 1JWTA 1Z71A 3RMMH 4AFSA 5EIYA 1G32B 2GZ8A 2BLQA 4H6TA 5EGMA 4B2BA 2EI6A 2Z3EA 1THRH 1E1QD 5T3HA 4HI3A 4HZHA 5T6GA 2BB4A 1GBCA 1G2MA 1EJMA 4I32A 1TBZH 1ARCA 5JBTA 4X1SU 2LNCA 2AMDA 4BAOB 1BDAA 2GCTC 2GT8A 2OBQA 1UHBA 1L4ZA 2BD4A 1E38B 2G4UA 1O3CA 1B0FA 2O8MA 2ZTXA 4D9QA 4IC5A 1WYKA 2GD4B 3M3TA 2J5UA
chains in the Genus database with same CATH topology
1K0HA 2KX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0H A;  2KX4 A; 
#chains in the Genus database with same CATH topology
 3ZVA A;  1V2Q T;  2C93 B;  2Y7Z A;  4TPY A;  2QIQ A;  3DHK H;  4RT1 A;  2Z9J A;  1BBR K;  1OYQ A;  2Q6D A;  3NCL A;  2L6O A;  3U8R H;  1UVP A;  3AAS A;  2ZHQ H;  4ABD A;  4X1Q U;  4DVA U;  4NIW A;  4YT7 H;  3UNR A;  2R2M B;  1XM1 A;  2XNI A;  3GY2 A;  1A0L A;  3BSQ A;  1O2L A;  1O2P A;  4K1T A;  2D2D A;  2Y6T A;  3GCO A;  4DW2 U;  3MNC A;  3PO1 B;  3OE7 D;  2GGV B;  4AB8 A;  2ODY B;  3KYG A;  3SO3 A;  1H9L B;  1TGC A;  3TGJ E;  4X8S H;  3HAT H;  1CA8 B;  1QUR H;  3P8N A;  2XW9 A;  1YPE H;  2ZU1 A;  3HK6 B;  4WH6 A;  2ZFT A;  4F48 B;  2JET C;  2Y82 A;  1CHO G;  2NU2 E;  5ESB A;  1GVL A;  1FDP A;  1UK3 A;  1DUE A;  2UUK B;  4P00 A;  2Z3C A;  5AHG H;  3UNQ A;  1V2P T;  3A8A A;  1NPM A;  2AYW A;  4DT4 A;  1YCP H;  2V3H H;  2K0Q A;  1TAB E;  3MMG A;  2BLW A;  4M9F A;  1RTK A;  3QN7 A;  3PB1 E;  4K1E A;  3T27 A;  1Q31 A;  1ZHR A;  1ELC A;  2IN2 A;  2XOK D;  1UCY E;  4Q63 A;  3RXV A;  1K21 H;  4YOJ A;  1DSU A;  1LHC H;  3TPI Z;  5EST E;  3B9F H;  1FPH H;  5SGA E;  2O8L A;  3MNS A;  1FPC H;  1WDI A;  3EA8 A;  1TE0 A;  4ZKR U;  1GHA G;  1Z1J A;  3ATW A;  1EAW A;  4RT0 A;  3LT3 A;  2QAA A;  1K1O A;  3BTW E;  1K1N A;  3SNB A;  1AO5 A;  4XBD A;  3S69 A;  3D23 A;  4J2Y B;  3M3S A;  1DE7 H;  1GJ6 A;  4ABG A;  1YPM H;  1J9C H;  3PWB A;  4JZI A;  4BAN B;  2CK3 D;  1W13 U;  2QF5 A;  3GY7 A;  4Z1M D;  5FBE A;  5JBC S;  3F6U H;  3HGN A;  3K65 B;  1ELF A;  3F9F A;  1SFQ B;  3SJK A;  1YWU A;  1O2M A;  4LOY H;  1ID5 H;  5FHT A;  3FOA A;  1DFP A;  5EW1 H;  1HAO H;  1ACB E;  4O9V A;  4BAM B;  1AWH B;  3MH6 A;  1CHG A;  1XXF A;  2TGD A;  3GS9 A;  3MOC A;  1BT7 A;  2HRV A;  4OGY A;  1QB1 A;  1HAZ B;  1FY4 A;  5C0T A;  1RGQ A;  1NC6 A;  3DUX H;  5K0H A;  2ZCK P;  3B23 B;  2GTB A;  1MCT A;  1LPK B;  1BMN H;  1GJ9 B;  1GL1 A;  2A7J A;  3PTB A;  3SHC H;  3R3G B;  3SV2 H;  1P10 A;  2VID A;  1VIT H;  2XCF A;  3Q00 A;  1CA0 B;  1AE8 H;  1N6Y A;  1YC0 A;  1TLD A;  2JH0 D;  5HXF A;  1JIR A;  3MU4 A;  2ZFF H;  3RUO A;  2BQ6 B;  3SGQ E;  2OC8 A;  1HRT H;  1V2S T;  5EJ1 A;  3PRD A;  4IMQ A;  1MCV A;  1EPT B;  3ZZA A;  1GCT B;  1V6D A;  1QJ1 B;  5C20 A;  1F7Z A;  1AD8 H;  1G3D A;  2V3M A;  4I31 A;  2ANY A;  2A5A A;  2STA E;  1FQ3 A;  4NA9 H;  3ATL A;  1ESA A;  2D26 C;  3UR6 A;  1O2Y A;  2PLX A;  1ZPZ A;  1QJ7 B;  1WSS H;  2OLG A;  1MUE B;  4X8T H;  5IDK A;  1GMH F;  1O3L A;  1IQN A;  3P95 A;  3MH4 A;  1C1W H;  3BEU A;  4INK A;  1EAT A;  1W8B H;  2BTC E;  4YTA A;  5FPT A;  2O8U A;  3RXM A;  3M36 A;  2SNW A;  1T8O A;  4X6O A;  4F55 A;  1YLN A;  1O0D H;  1ELE E;  1QNJ A;  5L6N H;  2XND D;  1DOJ A;  4SGA E;  1EP5 A;  2HNT C;  3P92 A;  1YKT A;  3H09 A;  5F03 A;  3HPT B;  4CRD A;  2TGA A;  1FNI A;  3M5N A;  1HBT H;  3M61 U;  2PKS B;  1C2J A;  1SPJ A;  1UCY H;  2HOB A;  3EAJ A;  4YLQ H;  5DPA A;  1H1B A;  6GCH F;  1P12 E;  1F0T A;  1MQ5 A;  5FCR A;  4K8B A;  2HNT E;  1UTQ A;  1XUF A;  1D4P B;  3GYL B;  4DII H;  3QUM P;  2GV6 A;  3TK9 A;  4YT6 H;  1LCY A;  3A88 A;  2QGR A;  1XUK A;  1KXD A;  4XD7 D;  2BXU H;  4O3U A;  1HAG E;  3W94 A;  2V3O H;  4BTU B;  1O3I A;  2G4T A;  2RDL A;  2XC0 A;  3ZZB A;  1DS2 E;  2EC9 H;  5TCA A;  1CBW B;  3UQO A;  3WY8 A;  5ABW A;  1SGD E;  1FX0 B;  2ZPQ A;  5GCH G;  2SFA A;  1GJA B;  1ZYO A;  3RU4 D;  2DUC A;  1KXA A;  4IGD A;  4YM9 A;  1EJN A;  2TRM A;  4DY7 B;  2EA3 A;  1CA0 C;  1QBV H;  4BAK B;  2ZI2 H;  3VB6 A;  1TX7 A;  1ARB A;  3RXS A;  1SI5 H;  1DVA H;  1YLC A;  2KAI B;  2OIN A;  1O2S A;  4Q7X A;  1EPT C;  1O39 A;  1GCT C;  3KNX A;  4MNW A;  1KXB A;  2TPI Z;  4B1T A;  1C2L A;  1VIT F;  4MNX A;  3T26 A;  2AHM E;  1CT4 E;  2PKA B;  2ULL A;  5LPE A;  2Z94 A;  2Q6G A;  2AGE X;  3VPK A;  3T2N A;  2R0L A;  1ZTK A;  3RC6 A;  1GCD A;  1TON A;  4NFE A;  1S0Q A;  4INH A;  4UFE H;  4Y7B A;  1AUJ A;  1P03 A;  1C5O H;  4WY3 A;  1LHF H;  2PKS C;  4INL A;  1T8N A;  5F8X A;  2WPD D;  1A1R A;  1E34 B;  1C5T A;  1UHB B;  2H9T H;  1GMD F;  3A8B A;  3M5O A;  5B6L A;  3DD2 H;  1GBI A;  2B8O H;  1DXW A;  3S0N A;  5JB8 S;  2BY8 X;  4JCN A;  1TB6 H;  3H7O A;  1NFW A;  3BF6 H;  2ZDL A;  5A2M H;  4CH8 B;  3SN8 A;  5JB9 S;  3S9A A;  1DIT H;  3MU0 A;  3PMA B;  4B2A A;  3OEH D;  2W6J D;  1CBW C;  3BTT E;  1UMA H;  1AWF H;  1EST A;  1VJA U;  4Y11 E;  1HNE E;  2WV5 A;  3PTN A;  4R8T B;  1O2R A;  1GHY H;  3PV4 A;  2JJ2 D;  3DSO A;  1KIG H;  4WMF A;  1ETT H;  1GJC B;  2G55 A;  1K1L A;  1P06 A;  2DE9 A;  2YNA A;  3MHW U;  1DWE H;  3AAU A;  5JPM H;  4WF8 A;  3SZN A;  1O3O A;  3GCT G;  2OC7 A;  1ZSJ A;  3UOU A;  2B9L A;  2HLD D;  5F53 A;  2ALV A;  5EJZ A;  1GI6 A;  5EOK A;  3TU7 H;  4GAW A;  2VWN A;  1XUI A;  4NG9 H;  1O5G H;  4OGX A;  2SGF E;  4BAH B;  1GJ5 H;  1C1Q A;  5J4S A;  3E1X B;  3E3T A;  2H9E H;  2A7C A;  1YGC H;  2FOD A;  1TOM H;  2BY9 X;  2QCY A;  5EQS A;  2GT7 A;  2GP9 B;  1CGH A;  1MMJ N;  1P2O A;  3SU0 A;  1SSX A;  3PV5 A;  2WUB A;  3KQB A;  1V2V T;  3C27 B;  4ISN A;  1CQQ A;  4ABH A;  2LEL A;  5C5N A;  1W7G H;  1S6F A;  4YZU A;  1EAS A;  1SGC A;  2Y80 A;  4TY7 A;  1V2M T;  4XSK U;  4OS6 A;  1F0R A;  1C5V A;  1BIO A;  1JXP A;  1NY2 2;  1UVU H;  1B7X B;  1T4V H;  3KQE A;  1S84 A;  2OQU A;  1AQ7 A;  1P57 B;  1NBM D;  2P3F H;  4AB9 A;  2A32 A;  4DUR A;  1SFI A;  5C0U A;  1MZA A;  1OOK B;  3MH7 A;  4BOH A;  3BTD E;  1K28 D;  2HPP H;  3URC A;  1GWA A;  3AVZ A;  3Q3K A;  4MPU A;  3SNA A;  2FOH A;  3OYP A;  3Q3X A;  1O2O A;  2SGP E;  1C5R A;  1PJP A;  3TH2 H;  2FLR H;  1H9I E;  2CF9 H;  5FPY A;  1BA8 B;  3PMJ A;  2ZDA H;  3C1K A;  2EI8 A;  4OM9 A;  1GMC G;  1A5H A;  3SOR A;  3RXI A;  1N6X A;  2GDE H;  1HAP H;  3QTV H;  2A4Q A;  1QBO A;  3VB5 A;  4JZF H;  2FOE A;  1S83 A;  2P3U B;  1WTH D;  3VFE A;  3JZ1 B;  2G5V A;  1HAH H;  1RD3 B;  2W7S A;  4CRB A;  2JDI D;  1ZLR A;  2CF8 H;  1W10 U;  2Z6B D;  1QQ4 A;  1NS3 A;  3ZZD A;  3E91 A;  2FMJ A;  1TRY A;  2H6M A;  2WYJ A;  2L74 A;  3RXH A;  5LH8 A;  1O2U A;  1QBN A;  2A31 A;  4ABA A;  1MTV A;  1O3F A;  2JIZ D;  3K2U A;  4Y8X A;  1SGF G;  1FJS A;  5E8E H;  2VVU A;  1GHW H;  3GDS A;  4GVU A;  2O8T A;  1HXF H;  1INC A;  3RXQ A;  5E0J A;  5DGJ A;  4XBB A;  2V6N A;  1V2T T;  3MU1 A;  5CDF E;  3Q76 A;  5C17 A;  4A1V A;  3K6Y A;  5EOD A;  1DY8 A;  1NO9 H;  3BN9 A;  3ATI A;  2BQW B;  4JMY A;  1YPL H;  4XFQ A;  3LJO A;  1QB6 A;  2ZG0 H;  1EB2 A;  4D7G A;  4AFU A;  3P8G A;  1EZS C;  3EST A;  2A7H A;  4ACB A;  1D3Q B;  1KDQ A;  1S0R A;  2ZZU H;  2XYA A;  1Y3V A;  4TSF D;  1O3B A;  1EX3 A;  1FV9 A;  1CT0 E;  1AFQ B;  3PMB B;  4GPG A;  3SHA H;  1D9I A;  1QL9 A;  4ZXX H;  3QGJ A;  1GI4 A;  3RXG A;  2PSX A;  3QZR A;  1G3C A;  4LZ4 B;  1XKB C;  3V3M A;  1O3A A;  4D9R A;  4WWY A;  3ZZ7 A;  1F2S E;  2P93 A;  1RTF B;  3A89 A;  1Y3U A;  1O31 A;  1NES E;  2VWO A;  3K9X B;  4ACA A;  3RU4 E;  1O3J A;  3IG6 B;  1Z8I B;  2QXI A;  4Q7Y A;  3UWJ H;  1P0S H;  3RXO A;  3MFJ A;  1GDN A;  1QCP A;  1IQL A;  2V7Q D;  4E7N A;  5FBI A;  4AGK A;  1EZX C;  2V0B A;  4CR9 A;  4WJG 2;  1SGP E;  4JZE H;  1G2L A;  1WOF A;  2FI3 E;  2P16 A;  3D62 A;  2BX4 A;  5EXN A;  1C5P A;  2BXT H;  2G52 A;  3MYW A;  1ETS H;  2ZU4 A;  5AF9 H;  1V2K T;  2ZPS A;  1XUG A;  3VB7 A;  1P04 A;  4HG6 A;  1LHG H;  1GBF A;  1A3E H;  1O5A B;  1S81 A;  2TBS A;  5EXL A;  1F5L A;  3GYM A;  5PTP A;  3RXP A;  1A5G H;  4B74 A;  1O36 A;  1EFR D;  2PSY A;  2VU8 E;  4I33 A;  3Q77 A;  4FOU C;  4WMD A;  1OWE A;  4DG4 A;  1MU8 B;  1PQ5 A;  2WHX A;  3T25 A;  5GIB A;  1VGC C;  4R0I A;  1TYN A;  2PW8 H;  4NCY A;  5C1X A;  2F91 A;  5C1U A;  2XBY A;  1VR1 H;  2RCE A;  5DSF A;  2BDY A;  5HGG A;  2VBC A;  4UON A;  3LIW A;  1ZRB A;  1GJD B;  1UTJ A;  1UJ1 A;  1A0H B;  2FO9 A;  3SUF A;  2AEI H;  3T28 A;  1RFN A;  1AHT H;  3URD A;  1Z6E A;  5GPI B;  4ZHM U;  3RP2 A;  1AFQ C;  1LQE A;  5LPR A;  3ZVB A;  2PGB B;  2H2Z A;  1GHB F;  4DGJ A;  6LPR A;  1LKB A;  2I6S A;  3AK5 A;  2XC5 A;  4ASH A;  2ZEB A;  1TWX B;  2WV9 A;  3OY5 U;  4U30 A;  3DA9 B;  4ZHL U;  4Z0K A;  5T6F A;  3TK6 A;  3UUZ A;  2ZFR H;  2ILN A;  1YPK H;  3U1J B;  1HPG A;  3O8D A;  4I7Y H;  2PUQ H;  2EI7 A;  4ISI H;  2G5N A;  1GHV H;  1ZML A;  4I8H A;  3U8O H;  1JBU H;  1G3E A;  4Q2K A;  4X0W U;  1K22 H;  1LHD H;  1WBG B;  3D49 H;  1KTT B;  1O2W A;  1ORF A;  1OWJ A;  1S6H A;  1EZQ A;  2P59 A;  2ZHF H;  2Y5H A;  4WH8 A;  2VIO A;  1MH0 A;  2ZFQ H;  3I78 A;  1LHE H;  1QQU A;  2RFK C;  1WXR A;  2XTT B;  1BBR H;  2ANK H;  5EQR A;  4ZHA A;  4TYD A;  3SW2 B;  2WPH S;  1KSN A;  5EJL A;  2G81 E;  2QY0 B;  3RC4 A;  1TPA E;  1LO6 A;  1Y3Y A;  1UTM A;  2SGE E;  1YM0 A;  3F3B A;  1CSO E;  3TNT A;  1O35 A;  1PYT D;  1HIA A;  3QO6 A;  4OS2 A;  4RSP A;  1MU6 B;  1C1V H;  2FOM B;  1ZPB A;  2QXJ A;  3V12 A;  1VCQ A;  5TCC A;  4K69 A;  4MPW A;  3PMH B;  5GJ4 B;  1XMN B;  1CVW H;  4NSV A;  2ZNK H;  3AAV A;  1V2U T;  2YMS D;  2B7D H;  3VGC C;  3BEF B;  1ZJK A;  1IQE A;  2BX3 A;  3P8O A;  1C2G A;  3M5M A;  1N1L A;  4MQA A;  1TA6 A;  4Y79 A;  3F2F A;  1DDJ A;  4Z6A H;  5T6D A;  3UNS A;  3BG4 B;  5FX6 A;  1FZZ A;  4M7G A;  2XRC A;  3FO8 D;  1NBM E;  3NPS A;  1TMT H;  1ZOM A;  1CHO F;  1Y59 T;  1SMF E;  1TMU H;  2VB0 A;  1O3G A;  1WQV H;  1O2V A;  1MD7 A;  1GBB A;  3TIT A;  2GVF A;  3URE A;  1L1N A;  1Y5U T;  3E0P B;  2ZHD A;  2EQN A;  1QY6 A;  4UDW H;  1MBM A;  2ZFS A;  3U8T H;  2OC0 A;  2OQ5 A;  4ABE A;  4AFZ A;  5DN6 D;  2AGI X;  5E0G A;  3P17 H;  2PP6 A;  1YP9 A;  1IQJ A;  1TX6 A;  2FOG A;  1G9I E;  3P70 B;  2ZTZ A;  3F2H A;  1HLT H;  2NU0 E;  3STI A;  4ZKS U;  5EQQ A;  1GHA F;  2ZPR A;  3BTM E;  1ZZZ A;  1V3X A;  1LKA A;  3F9E A;  1D3D B;  2R3U A;  1F5R A;  1AUT C;  2BZ6 H;  4CRC A;  3U69 H;  2GCH G;  3ZV9 A;  2OK5 A;  2W3K A;  4O3T A;  4B2C A;  1SLU B;  3H7T A;  4A7I B;  2A1D B;  1C2M A;  2OBO A;  1TGN A;  1ZSK A;  3TVJ B;  3BIU H;  1TNL A;  3ODF A;  5AFY H;  1T32 A;  4NZL A;  3MO9 A;  2AIP A;  1DST A;  1ELA A;  5FXL A;  1C5S A;  1O2T A;  1XVM A;  3UTU H;  3KID U;  2GMT B;  1TNJ A;  5BRR E;  4FU7 A;  1P2Q A;  4NIX A;  1H8H D;  4GCH G;  1P9U A;  1FIZ A;  1SC8 U;  2O8W A;  1FLE E;  3SJ8 A;  2P95 A;  3NUM A;  8GCH G;  4ASU D;  1OS8 A;  1FUJ A;  4XDE A;  3CEN A;  2A0Q B;  5A8Z A;  1AY6 H;  3MH5 A;  4ZUH A;  1L2E A;  2ASU B;  3EDX B;  5L30 H;  2BMG B;  1C2D A;  3EE7 A;  5AFZ H;  3BG4 C;  4Q80 A;  1A0J A;  3FZD A;  1GHX H;  2J98 A;  3RMO H;  3SUD A;  1HAY B;  1C1T A;  1KDQ B;  1O2G H;  1UTK A;  3SU1 A;  3SV9 A;  1E1R D;  2M5T A;  1SGI B;  2A45 B;  4ABF A;  1TQ7 B;  3SU5 A;  4AX9 H;  1EAX A;  3SNC A;  1AVW A;  4D7F A;  3SQH E;  1HB0 B;  2FYR A;  1P8V C;  3MQK C;  1ANC A;  5KGO A;  4B6F A;  1ZRK A;  4BTI B;  2V35 A;  5GXP A;  5C67 A;  1P2N A;  1GGD B;  1LVB A;  1MQ6 A;  1GBE A;  3SU4 A;  1WAY B;  4X2W A;  1QIX B;  1Q3X A;  2VNT A;  1UTO A;  1YCP M;  3KGP A;  3VG8 A;  1MZD A;  3GDV A;  2Z9I A;  1A3B H;  1AN1 E;  5DP9 A;  1TNI A;  1GVZ A;  1RRK A;  1HV7 A;  1ELV A;  1O3N A;  2BY7 X;  2WYG A;  1F0U A;  2FOB A;  5G4B A;  4O03 A;  1W12 U;  2F4L A;  1LPZ B;  1SQT A;  2YMS B;  1L0Z A;  2C3S A;  4X2X A;  2JKH A;  1GBA A;  3QWC H;  5C5O A;  4LXB H;  1J8A A;  4PRO A;  1GI3 A;  3LH3 A;  1DUA A;  1NRS H;  1O2Z A;  1D3P B;  1MBQ A;  1NU9 A;  3LGW A;  1AVG H;  3PYH A;  1DT2 A;  1O2X A;  2GMT C;  1GI0 A;  4ZKN U;  5C3N A;  1KLJ H;  1O30 A;  3SBK A;  2FTM A;  7EST E;  2O9Q A;  2G8T A;  5C1Y A;  1O3M A;  4BNR A;  5DG6 A;  2EEK A;  4X2Y A;  4O97 A;  1QA7 A;  2GX4 A;  2J2U A;  6EST A;  4DIH H;  2XWB I;  3SUG A;  2ZCH P;  1AFE H;  1O5F H;  1V2N T;  2Q1J A;  3RXF A;  1NM6 A;  2HWL B;  1C5W B;  1W11 U;  2EST E;  3F9H A;  5B6O A;  2CXV A;  3OY6 U;  3F0O A;  3ZVC A;  1YLD A;  2QA9 E;  5GCH F;  1GL0 E;  5FL7 D;  1QRX A;  2CJI A;  1L4D A;  4UFF H;  3E16 B;  2A4G A;  1KLT A;  1K1I A;  5LGO A;  3BTH E;  1NRO H;  2H1U A;  2WIN I;  2FIR H;  3E8L A;  4HTC H;  4Y0Z E;  3RXU A;  2BDB A;  1DPO A;  1MAX A;  5KEC A;  5DP6 A;  3ITI A;  4MDS A;  2XWA A;  1AIX H;  1N8O C;  3SV7 A;  3NRL A;  3KL6 A;  3ZZ4 A;  4YLU A;  1GGD C;  1BRC E;  3TJV A;  2J92 A;  4TWW A;  2FP7 B;  3W1E A;  1ZR0 A;  2ZA5 A;  1PYT C;  1BB0 B;  3OAA D;  2Z3D A;  1SLW B;  3ZZ9 A;  1AKS A;  1K2I 1;  2W26 A;  1PPF E;  1WCZ A;  3A86 A;  4XRN A;  5HIY A;  1Y3X A;  2YMS C;  1TPO A;  5I46 H;  1TRN A;  4TPI Z;  2ZP0 H;  1BRU P;  1GI1 A;  1V2R T;  3A82 A;  3O8B A;  5CHB A;  1NFU A;  2F9U A;  2ZO3 H;  5GND A;  3ZVD A;  4ZCN A;  2UUF B;  3WW7 A;  1SOZ A;  3QLP H;  3HK3 B;  4A5T S;  1XUH A;  4YO9 A;  2ZWL H;  4ISO A;  4FXG H;  2A5I A;  1HIA B;  1COW D;  3BTE E;  2ZHE H;  2OD3 B;  3M7T A;  3SZE A;  5TJX A;  1O33 A;  1GDQ A;  4UEH H;  1PQ8 A;  4WVP E;  1BJU A;  3VEQ B;  4F49 A;  2FTL E;  1GG6 B;  4ISH H;  5T1V A;  1C1U H;  1ELT A;  1WTG H;  1B0E A;  1OP8 A;  1P02 A;  4I8J A;  4Q4L A;  2HPQ H;  1FAX A;  2BQ7 B;  2KCA A;  1PPC E;  3OTJ E;  4K2Y A;  3AW1 A;  1MTU A;  1LPG B;  4A6L A;  1HYL A;  4HGC A;  1QZ8 A;  3EA7 A;  1THS H;  3SGB E;  4AGJ A;  3F2G A;  2ZU3 A;  3RLY H;  1OWI A;  1RTL A;  3S7H B;  5AVD A;  2ZGC A;  3FVF B;  3GCT F;  2CHA B;  2ODP A;  1Z7K A;  3RML H;  1Q2W A;  1BUI A;  1O38 A;  1O3K A;  1IQG A;  4TY6 A;  1WUN H;  2OTV A;  5DKM A;  3R0F A;  2W6I D;  4Y76 A;  1MD8 A;  3M5L A;  3F68 H;  2RA0 A;  1E36 B;  2GKV E;  1O3H A;  5HKK D;  2VIV A;  2QXH A;  3KQ5 A;  1BZX E;  1Y3W A;  2FEQ H;  1OP0 A;  3M7Q A;  1A7S A;  2JH6 D;  3EA9 A;  1TFX A;  5H4I B;  8EST E;  1W0J D;  4FVB A;  1S6L A;  4FUF A;  3ATM A;  2W5E A;  3QTO H;  1SL3 A;  1OP2 A;  1VCP A;  3LJJ A;  2BHG A;  1FY5 A;  1AND A;  3A7X A;  3LGT A;  3A7Z A;  4KP0 A;  3ELA H;  2C8Z B;  4FUE A;  1NT1 A;  1HAX B;  3L3T A;  4Q7Z A;  1SQA A;  1D6W A;  1QHR B;  2CN0 H;  2FI4 E;  2WSS D;  4ISL A;  4X1N U;  2H9H A;  4WME A;  1MAB B;  3RU4 T;  3BTG E;  3RDZ A;  3BV9 B;  4A1X A;  2PUX B;  1SGF A;  1GBM A;  1BRA A;  2J9N A;  5F8T A;  3LKW A;  2ZDV H;  1S82 A;  2BDG A;  2ZTY A;  1GG6 C;  2C8W B;  1H8D H;  3TH3 H;  5CE1 A;  1TQ0 B;  1ABJ H;  2AMQ A;  1GMC F;  1TGB A;  2QXG A;  2XBX A;  4KTU A;  1CO7 E;  2FOC A;  3PM3 A;  2ZEC A;  2A5K A;  2VVC A;  2HVY B;  1CT2 E;  5E0H A;  2J98 B;  3HKJ B;  2UWL A;  3N7E A;  2CHA C;  1DX5 M;  4MNY A;  2FES H;  1J15 A;  3A84 A;  1EKB B;  1TAL A;  1KTS B;  3RM2 H;  4X6N A;  1TPS A;  1VGC B;  1O5B B;  4JYU H;  2UUJ B;  1FN8 A;  2C4F H;  2Y81 A;  3IIT A;  3LH1 A;  1GI8 B;  1W3C A;  1EAU A;  5CHA B;  3ODD A;  5JYI A;  3QX5 H;  2SGQ E;  2BD7 A;  7GCH G;  2IPQ X;  1C4Y 2;  2BOH B;  1GBL A;  4JK6 A;  2B0F A;  2UWP A;  1GHZ A;  1O2H A;  3LGV A;  3RXK A;  2JH5 D;  1E79 D;  3N99 A;  2DE8 A;  3BTQ E;  3E90 B;  3SGA E;  1DM4 B;  2VIN A;  1NU7 B;  1EP6 A;  2ALP A;  1XXD A;  2QN5 T;  1UVS H;  3NKK A;  2KCO A;  4FU9 A;  2STB E;  3RLW H;  2WPJ S;  1QGF A;  5LPF A;  4Y0Y E;  1BBR E;  4Y71 A;  1SGE E;  3KHV A;  2IOT A;  1NRN H;  4X1P U;  2BDH A;  5E2O A;  3SNE A;  1QR3 E;  1A4W H;  1O2K A;  1TOC B;  4UFD H;  3A8C A;  1EQ9 A;  5DP3 A;  3U98 H;  2R3Y A;  3IWM A;  1YY3 A;  1PFX C;  2BVX H;  3PLK A;  3DSP A;  4Y10 E;  2LP6 A;  4AC9 A;  1OX1 A;  1K0H A;  4BXS A;  1MKX K;  1C9T A;  1KXE A;  1BOQ A;  1W7X H;  3L33 A;  3M7U A;  2FDA A;  3UIR A;  1MKW K;  1S5S A;  2XCN A;  1O2I A;  2P94 A;  2KCP A;  1S85 A;  5JBB S;  1ZHM A;  5JDU B;  2KX4 A;  3DT0 H;  2ZDK A;  2RA3 A;  2PHB A;  1SHH B;  3SND A;  1Z6J H;  4OS4 A;  2F9B H;  4B6E A;  1A5I A;  4K60 A;  3U1I B;  2AMP A;  2Z9G A;  1TA2 A;  1HAV A;  3LGU A;  1RS0 A;  5HM9 A;  1WU1 A;  2NU3 E;  1AZ8 A;  3LGY A;  2VGC B;  2UUY A;  5GWZ A;  1C2H A;  4AOR A;  2G51 A;  3QZQ A;  1HXE H;  4I8L A;  4LZ1 H;  3W95 A;  2RDE A;  2BOK A;  1W14 U;  1ZHP A;  3VGC B;  4E06 H;  5IK2 D;  1W0Y H;  4FUG A;  4B75 A;  2ODQ A;  4RKO B;  5CHA C;  3ZYD A;  2VVV A;  2W3I A;  1H9H E;  1D6R A;  1BTX A;  4OS5 A;  3PLP A;  1QRZ A;  1C1S A;  1E35 B;  1IQI A;  3KYF A;  1DLK B;  4A1T A;  3SQE E;  1C5Y B;  2Q6F A;  2NWN A;  5JBA S;  4RN6 A;  2OUA A;  5KED A;  4X2V A;  1W0Z U;  4GUX A;  2ZC9 H;  5EPN A;  4FET A;  9LPR A;  1O2J A;  3GIS B;  2XC4 A;  1SVP A;  3TJO A;  2J94 A;  1EAI A;  2ZDN A;  1LTO A;  1LVO A;  1C2K A;  3U9A H;  1FAK H;  3DCL A;  4U2W A;  1AKS B;  2OC1 A;  3LU9 B;  3DFJ A;  3VB4 A;  1L1J A;  4FVD A;  2VH6 A;  4Y6D A;  1SGQ E;  1PQA A;  1Z8G A;  2QE7 D;  3ATK A;  1ZMN A;  3LDX H;  1GBK A;  2BD2 A;  1C5U A;  4X8V H;  3UR9 A;  5DP8 A;  4AN7 A;  2FS8 A;  2R0K A;  1SGY E;  1VKY A;  3M35 A;  1TBR H;  1O3E A;  4SGB E;  1ZTL A;  1IQF A;  1LQD B;  2WPK S;  1FY1 A;  3UQV A;  1QRW A;  1XKA C;  2B5T B;  1SBW A;  3EE0 B;  1BRB E;  1V2L T;  4IN1 A;  1DIC A;  1JIM A;  1D3T B;  1O2N A;  2QF3 A;  1KXF A;  1XVO A;  2FPZ A;  3GY8 A;  2BVR H;  5A8Y A;  1RJX B;  2BD9 A;  5CMX H;  2A4O A;  4THN H;  3SYJ A;  2WPI S;  1HDT H;  2A2X H;  1O32 A;  2VGC C;  1AI8 H;  3MTY A;  4JYV H;  4DCD A;  1C5Q A;  4DOQ A;  6CHA B;  2BVS H;  1YYY 1;  1ZGV A;  1C9P A;  2QV1 A;  1KY9 A;  2CV3 A;  3PWC A;  1UTN A;  1SB1 H;  3MNB A;  1MTN B;  2ZF0 H;  3SI4 H;  7KME H;  1NFY A;  1P11 E;  1C2I A;  1IHS H;  2FX4 A;  2F9V A;  5EG4 A;  5A8X A;  1DWD H;  1C5L H;  1GJ7 B;  1AMH A;  1RXP A;  3RXA A;  2YOL A;  5K7R A;  2UWO A;  2FS9 A;  1TNG A;  1P2K A;  2ANW A;  3FKS D;  1BMM H;  1OWD A;  1ZTJ A;  1YCP K;  3Q3Y A;  1QJ6 B;  1ANB A;  2BM2 A;  1NRP H;  1P3C A;  3MO3 A;  4IMZ A;  2BDC A;  2BLO A;  2CGA A;  1QTF A;  2R9P A;  2ZCL P;  3DFL A;  1F92 A;  4AYV B;  3S9C A;  3OX7 U;  1C4U 2;  4EST E;  3OSY A;  3E0N B;  2OP9 A;  1BTP A;  3GY6 A;  1O3D A;  4ZXY H;  1NZQ H;  2TIO A;  4FU8 A;  4IS5 A;  3A7W A;  3RXT A;  4TWY A;  3NWU A;  4MNV A;  1TGS Z;  1YF4 A;  3UY9 A;  1FXY A;  5IYT A;  4BAQ B;  1TAW A;  2XBV A;  2I6Q A;  4NIY A;  1DXP A;  4Y8Z A;  3TK5 A;  5FAH A;  1SG8 B;  1G37 A;  1KLI H;  1TPP A;  4ABJ A;  2GCH F;  3FP6 E;  1BML A;  5C2Z A;  3KF2 A;  2LPR A;  1YPG H;  3OFN D;  4YOI A;  1LMW B;  1CE5 A;  4MG3 A;  1OWH A;  1AB9 B;  1G30 B;  1CGJ E;  1AGJ A;  1W2K H;  3SU2 A;  3FFG A;  4BTT B;  1BHX F;  1T8L A;  3UAI C;  2J95 A;  1C1R A;  3ZIA D;  1QB9 A;  6CHA C;  1Z1I A;  1PPE E;  3UWI A;  1IAU A;  4CH2 B;  2FXR A;  4CRF A;  3OEE D;  1ELB A;  4H4F A;  3GY5 A;  2GJG A;  3MNX A;  3FAN A;  1JMO H;  2XBW A;  3T29 A;  1FON A;  1VJ9 U;  4GCH F;  2H5D A;  3CNR A;  1THP B;  2Z9L A;  5DJ7 A;  3TH4 H;  3ZVG A;  1MTN C;  3PO1 C;  3GCN A;  4AOQ A;  4JYT A;  4CRE A;  1HUT H;  3MU8 A;  3RXR A;  1DWB H;  2BDA A;  1BJV A;  8GCH F;  4NZQ A;  3ZVE A;  2OXS A;  4I8G A;  5DP7 A;  1SQR A;  1P2I A;  1O3P B;  1YBW A;  3GIC B;  1GVK B;  1O5C B;  1GI2 A;  4YES B;  4H6S B;  3FAO A;  2FZZ A;  4NIV A;  3V0X A;  2TGT A;  2BY5 X;  4RI0 A;  3RMN H;  3GCH B;  2ZGH A;  5HYO A;  1N8O B;  1K9O E;  2KFW A;  4IBL H;  8KME 2;  4JZ1 A;  3GY4 A;  1GI5 A;  1GMH G;  4BXW A;  1C5Z B;  3NXP A;  1FN6 A;  1H8E D;  3B8J A;  1ANE A;  1X7A C;  3PV2 A;  2K1Q A;  1JRS A;  4B71 A;  1C4V 2;  9EST A;  2AS9 A;  1YPH C;  4E05 H;  3A81 A;  4ABB A;  4D76 A;  3PRB A;  1EOJ A;  4XOJ A;  6GCH G;  1QL8 A;  4OS7 A;  1T31 A;  1KYN A;  4Y8Y A;  1KMH B;  1UTL M;  1YPH E;  3CP7 A;  3SJ9 A;  2BYA X;  1AZZ A;  3ZZ3 A;  5C94 A;  1UVO A;  1P09 A;  1P2J A;  3WWF A;  1FMG A;  2GZ9 A;  3ZZ5 A;  3L6P A;  4IC6 A;  2BZA A;  1AB9 C;  1GDU A;  3UB0 A;  1BMA A;  1NFX A;  4GSO A;  1BTY A;  2HGT H;  1UCY K;  1GI7 B;  1Z8J B;  2AGG X;  2ZKS A;  1HAV B;  1F5K U;  4IN2 A;  2PFE A;  3SJI A;  2ZQ2 A;  2KM0 A;  2A4R A;  2QC2 A;  3TJU A;  1W0K D;  2WPM S;  1EZU C;  5A0C A;  2NU1 E;  2TGP Z;  3EYD A;  3I29 A;  2VIP A;  1EUF A;  3SU3 A;  3UFA A;  1IQH A;  3GY3 A;  2IPH A;  4J1Y A;  5I25 A;  4KKD A;  4U32 A;  1PPZ A;  3VXF H;  1ELD E;  2BD5 A;  3SJO A;  2PR3 A;  1OYT H;  2NU4 E;  2FOA A;  2GDD A;  2VJ1 A;  3SV8 A;  2AER H;  3FZZ A;  2GZ7 A;  1P01 A;  3ZVF A;  3NK8 A;  2M2A A;  3GDU A;  2ZU5 A;  1GBT A;  4WXV A;  1K1J A;  2Z7F E;  1VIT G;  5BPE A;  3VB3 A;  2QF0 A;  3GCH C;  3A8D A;  5E2P A;  1IQM A;  1FI8 A;  1NTP A;  1ZMJ A;  3BTK E;  5A0A E;  1IOE A;  2PGQ B;  4GHT A;  4MTB A;  1NRQ H;  1EJA A;  3MI4 A;  3T5F H;  2VIW A;  5EXM A;  1LVY A;  2W7U A;  1T8M A;  4CBO A;  4XBC A;  4KTS A;  1HJA B;  2VH0 A;  1MTW A;  1NRR H;  2J34 A;  1SGT A;  4TT3 D;  4ZRO A;  1C2E A;  3V7T A;  4CR5 A;  1V2O T;  3V13 A;  1GMD G;  2PTC E;  4WXI A;  4CHA B;  3N7D A;  3QK1 A;  1DWC H;  1PPH E;  3P8F A;  3LC5 A;  2OCV B;  3CS7 A;  1CGI E;  3RM0 H;  3SUE A;  2C8Y B;  5FX5 A;  2RG3 A;  4ZAE A;  3HGP A;  2YNB A;  1G3B A;  1UTP A;  3WWB A;  2Z9K A;  2HVX A;  1TNK A;  1E0F D;  3OU0 A;  3UOP A;  2FI5 E;  4QT8 C;  4RKJ B;  2C8X B;  2ZGJ A;  8LPR A;  2H5C A;  1Y5A T;  4DT7 B;  5DP4 A;  1JOU B;  1GBJ A;  2SNV A;  1C1O A;  1ABI H;  3BTF E;  3EGK H;  5HIZ A;  1EOL A;  3KQC A;  1TRM A;  3D65 E;  3GOV B;  1WV7 H;  2ZGX H;  3LC3 A;  3QDZ B;  4MLF B;  2K8I A;  2KR7 A;  1A46 H;  4I8K A;  1DLE A;  4AG2 A;  1BIT A;  3DSG A;  1CU1 A;  1Y5B T;  3QGN B;  2ZFP H;  4OS1 A;  4GLY A;  2PWX A;  2C90 B;  3U28 C;  2F9O A;  4NWL A;  3E6P H;  1P3E A;  4MPV A;  3RXJ A;  4X8U H;  1ZGI A;  2ANM H;  3KEE A;  1OPH B;  4YXW D;  2FOF A;  3RXB A;  1C1M A;  1BHX B;  3TGK E;  2VWL A;  1OHH D;  3FN8 A;  4D8N A;  1SQO A;  5L2Z H;  5A0B A;  2F9P A;  1HJA C;  2ZGB H;  1Z8R A;  3ZYE A;  4FUJ A;  1BTU A;  3O8C A;  2J97 A;  4NA8 A;  3KN2 A;  2D1J A;  3ZZC A;  4JZD H;  5GDS H;  3SU6 A;  2FYQ A;  3HKI B;  3O8R A;  1KXC A;  2F43 B;  4CHA C;  1O5E H;  3MU5 A;  4E7R G;  5EU8 A;  1GJB B;  1SGR E;  5L2Y H;  4NGA H;  4VGC B;  3M3V A;  1OKX A;  3LPR A;  4U01 A;  4FUB A;  3TIU A;  2QYI A;  4X6M A;  1V2W T;  3MWI U;  4MVN A;  2VIQ A;  1TBQ H;  2BDI A;  2ZIQ H;  3F1S B;  2PTN A;  4UFG H;  1SGN E;  4KGA A;  1G36 A;  3EQ0 H;  4ZH8 A;  3P6Z B;  1TX8 A;  2P8O B;  1GBD A;  4DJZ B;  1UW7 A;  4FUC A;  1BTW A;  3UPE A;  2EY4 C;  7LPR A;  1FY3 A;  5ETX A;  3TNS A;  1H8I H;  4CBN A;  3SOS A;  4XE4 A;  2JJ1 D;  1B5G H;  3H5C B;  1GI9 B;  3JZ2 B;  3TJN A;  3G01 A;  3SI3 H;  2D8W A;  1OSS A;  1TMB H;  1UK2 A;  3RXD A;  4FUI A;  3F0P A;  2Y5F A;  4HFP B;  2PV9 B;  2QF4 A;  3ZV8 A;  1T7C A;  1E37 B;  1HGT H;  3OTP A;  2WUC A;  1J17 T;  1C2F A;  3RXE A;  2P3T B;  1H4W A;  1WQS A;  2KZ4 A;  1O34 A;  2IJO B;  2CMY A;  4NWK A;  4K8Y A;  1UO6 A;  2BY6 X;  4KTC A;  4GHQ A;  1C1N A;  1SHY A;  4AYY B;  3CS0 A;  4LK4 A;  3A85 A;  2J4I A;  2R2W U;  2F9N A;  1ZPC A;  1C5M D;  4A92 A;  1HJ8 A;  1A2C H;  2ZU2 A;  3T62 A;  1YPJ H;  3A83 A;  2HNT F;  3VXE H;  3SV6 A;  3S9B A;  1GJ8 B;  1C1P A;  2VWM A;  1K1M A;  3NZI A;  4F4O C;  1FY8 E;  3A7T A;  2ZQ1 A;  3FP8 E;  1GPZ A;  3STJ A;  2HAL A;  4AG1 A;  1OXG A;  7GCH F;  1MAY A;  1PQ7 A;  2KCY A;  2WZQ A;  1EPT A;  5HMA A;  3I77 A;  3A7V A;  3PRO A;  3MO6 A;  1FIW A;  3ENS B;  1HCG A;  5F6M A;  3LGI A;  1AVX A;  1TGT A;  3BG8 A;  4VGC C;  1RIW B;  2FM2 A;  1IQK A;  2F3C E;  4ZMA H;  1AU8 A;  1MKX H;  4K5Z A;  1MTS A;  1DY9 A;  3TGI E;  1O37 A;  3BEI B;  3LON A;  1SOT A;  1ESB A;  2P8O C;  5HM2 A;  3BIV H;  3RXL A;  4I86 A;  1L1G A;  1MKW H;  3ZZ6 A;  4B76 A;  2HLC A;  1VZQ H;  2FLB H;  1BTZ A;  4B73 A;  2AH4 X;  1U6Q A;  1QL7 A;  4FUH A;  5FCK A;  2J38 A;  1GBH A;  5FPS A;  2SGA A;  5DK1 A;  1SKY E;  2AIQ A;  1O2Q A;  1P9S A;  4AFQ A;  1EB1 H;  1ZSL A;  2F83 A;  1SR5 C;  2IJD 1;  1BQY A;  2FWW A;  2GCT B;  4KEL A;  5EPY A;  4JK5 A;  4FUD A;  1ETR H;  3KCG H;  3RXC A;  3PLB A;  3RC5 A;  1BCU H;  2Y5G A;  5EW2 H;  2WV4 A;  1PPB H;  1J14 A;  1T4U H;  4CRG A;  2BLV A;  4P02 A;  1HJ9 A;  4MPX A;  1JRT A;  1NN6 A;  3KQD A;  1BMF D;  4K1S A;  4NA7 A;  1V2J T;  3FP7 E;  1P2M A;  5F8Z A;  4UD9 H;  3TLO A;  1K1P A;  1PPG E;  4AZ2 B;  3A7Y A;  4ZKO U;  1UK4 A;  4Y7A A;  2A2Q H;  2ZHW H;  1ZJD A;  3N7O A;  4UE7 H;  4X6P A;  1LVM A;  1QA0 A;  1Y8T A;  1QFK H;  5DP5 A;  1DAN H;  3AW0 A;  1UVT H;  1IHT H;  4H42 U;  1BTH H;  1C5X B;  4IW4 E;  1GJ4 H;  1TIO A;  3F9G A;  2XXL A;  5A09 A;  2BD3 A;  5J4Q A;  1HAI H;  5DO4 H;  1P05 A;  2THF B;  3M37 A;  2JET B;  1VCW A;  2FX6 A;  1A61 H;  4CRA A;  1XX9 A;  4YOG A;  1J16 A;  1LDT T;  1SLX B;  3A80 A;  3LOX A;  4ABI A;  3K6Z A;  2ZDM A;  2KAI A;  1XUJ A;  2AFQ B;  1AE5 A;  1GHB G;  4NFF A;  2GV7 A;  4NSY A;  1HFD A;  2G00 A;  1RIW C;  1ELG A;  2BD8 A;  1F0S A;  1M9U A;  3S7K B;  1EXF A;  4K3J A;  1OWK A;  4X1R U;  2SGD E;  2PKA A;  2WPL S;  1O5D H;  1SLV B;  3A87 A;  1TNH A;  1C5N H;  2Y7X A;  3ZZ8 A;  1JWT A;  1Z71 A;  3RMM H;  4AFS A;  5EIY A;  1G32 B;  2GZ8 A;  2BLQ A;  4H6T A;  5EGM A;  4B2B A;  2EI6 A;  2Z3E A;  1THR H;  1E1Q D;  5T3H A;  4HI3 A;  4HZH A;  5T6G A;  2BB4 A;  1GBC A;  1G2M A;  1EJM A;  4I32 A;  1TBZ H;  1ARC A;  5JBT A;  4X1S U;  2LNC A;  2AMD A;  4BAO B;  1BDA A;  2GCT C;  2GT8 A;  2OBQ A;  1UHB A;  1L4Z A;  2BD4 A;  1E38 B;  2G4U A;  1O3C A;  1B0F A;  2O8M A;  2ZTX A;  4D9Q A;  4IC5 A;  1WYK A;  2GD4 B;  3M3T A;  2J5U A; 
#chains in the Genus database with same CATH homology
 1K0H A;  2KX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...