1JIMA

Stereospecific reaction of 3-methoxy-4-chloro-7-aminoisocoumarin with crystalline porcine pancreatic elastase
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORCINE PANCREATIC ELASTASE
publication title Stereospecific Reaction of 3-Methoxy-4-Chloro-7-Aminoisocoumarin with Crystalline Porcine Pancreatic Elastase
pubmed rcsb
source organism Sus scrofa domestica
molecule tags Hydrolase(serine proteinase)
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1993-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1jimA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1jimA01
3MO9A 1DXPA 2YOLA 3ATWA 1O2IA 3KN2A 5JBBS 5GCHF 1YGCH 3Q3KA 1WQSA 1O2PA 1IHSH 3GY4A 5A0CA 5FX5A 4X2VA 3UWIA 3A81A 2VIPA 1C1SA 1WTGH 3UR6A 4AB9A 3LGWA 2PHBA 2XRCA 4NA9H 2VIDA 2RA0A 1BRUP 3Q3XA 3B23B 1KXCA 3LC5A 1LMWB 5HM9A 1PYTC 5L6NH 2WV4A 3ZZ8A 1UK4A 2FOHA 3K65B 1FV9A 4WMFA 1MTNC 1TGBA 2GP9B 3ITIA 1P12E 2C4FH 2ZFPH 1HDTH 3S7KB 2A4OA 5FPYA 2TIOA 2WYGA 1OSSA 3BV9B 1P0SH 1GI6A 2Z94A 4MTBA 5FCKA 4ZHLU 2ZU3A 3A89A 1V2NT 1ZZZA 2JKHA 2W3IA 5FBEA 3P8OA 3M61U 2NU4E 2C8XB 2GKVE 1LKBA 2AGIX 3T2NA 4IBLH 4A92A 4A5TS 1KLIH 2ZA5A 4I33A 3FP6E 1ZHPA 2JETC 1DDJA 1T32A 1W7XH 1E38B 5ABWA 3NZIA 3RDZA 2FOMB 2QF0A 1BDAA 3QUMP 3RMMH 4NZQA 2C90B 5C20A 4YT6H 5EODA 4UE7H 3SGQE 4CHAC 1YPJH 2I6SA 2VJ1A 4TWWA 3EA8A 5FX6A 3P8GA 1TRMA 2P95A 2UUJB 1Z7KA 2FP7B 2ZDKA 1NESE 4Y0ZE 4FU7A 5K7RA 2BM2A 1BOQA 4ZKOU 4Q7YA 4HTCH 4OS4A 1K1OA 2FEQH 3ZZDA 2RDLA 2WPJS 2SGDE 4R0IA 3MTYA 1ZGIA 4AZ2B 3A7TA 1U6QA 1ZMLA 4ZROA 2PKSB 2UUYA 3KL6A 1C5QA 1ELTA 3UFAA 4IMZA 6CHAB 1GBIA 5DP6A 2F9VA 1J9CH 2ZG0H 1DWBH 2A31A 1P11E 1SGCA 1HYLA 1GJ7B 1E34B 1QTFA 5JPMH 3ZVGA 3RMOH 1MAXA 1WSSH 2GZ7A 5A8YA 1LPGB 1GVLA 2ZQ1A 4FUCA 2GTBA 1ZYOA 2RCEA 2AS9A 2H5CA 2J95A 1O3NA 2GGVB 2EEKA 1D6WA 2J92A 2FOCA 5GDSH 4H6TA 1NO9H 1S81A 4CH2B 3LJJA 1QIXB 1K1MA 1XUFA 1Y3YA 3BEFB 3B9FH 1ELVA 1KXAA 1C1NA 1YBWA 2GVFA 3LU9B 1M9UA 1HAVB 2BLWA 4I8LA 4XBDA 3TJOA 1Z8RA 3MH4A 3NXPA 3GY7A 4GHQA 3QDZB 4NIYA 1AFQC 5FPTA 3F6UH 4NWKA 3RU4D 1A0LA 5L2YH 2FX4A 3MWIU 2HPQH 3PLKA 4LK4A 1ELEE 1SQTA 4BXWA 3L33A 4MNXA 5IDKA 5E2OA 2XW9A 2FWWA 1GJ9B 3V0XA 4XDEA 3STIA 5L2ZH 3U1JB 2AIQA 1ABJH 2XWAA 4AFQA 1DWCH 1O2WA 4K3JA 3LIWA 3ZVDA 1C4Y2 1PQ8A 3A8AA 1TNJA 5EPYA 1C1TA 1DY8A 4ZH8A 4M7GA 1OP8A 2P3TB 4ZKSU 1L0ZA 1TMBH 3RXJA 1V2TT 3ZVAA 1LQDB 3T5FH 2P8OB 3AW0A 3GY8A 1BRBE 1GBJA 1CHGA 6LPRA 3BEIB 3S9BA 1V2MT 3TITA 1F5LA 2ZGHA 1DSUA 1AVWA 1BTUA 1NPMA 4WF8A 1PPBH 1TQ0B 1F0RA 2OC7A 1JWTA 3FP7E 3VEQB 1EATA 2FLRH 1LHFH 4TY7A 1AGJA 1O32A 3RC6A 1CQQA 2BYAX 2V3HH 5E0JA 3M7TA 7GCHF 3TGJE 4CREA 4AORA 5G4BA 3FVFB 2AEIH 1G2LA 1Q3XA 3CS0A 1W0ZU 2ZPRA 1MD8A 2JH5D 3MNSA 1RIWB 3TK9A 2Z3EA 2C8YB 1DWDH 1NC6A 5I46H 1ZPBA 2A4RA 4YM9A 1XVOA 1S84A 3V12A 4DY7B 4NIXA 4BOHA 4CRGA 2ALVA 1JRTA 2BTCE 1C9TA 1AUTC 1BUIA 4CBOA 1UCYK 1IQHA 3HPTB 2I6QA 3MNBA 1E36B 1QB6A 4NSVA 3H7OA 1SOTA 2VVVA 3M3SA 3TNTA 4K1EA 1QJ7B 5DP3A 1O3EA 3H7TA 1JRSA 1MTVA 2OINA 1GHBF 3ATIA 2A7HA 1KTSB 3SI4H 2ZDMA 5JDUB 2SNVA 2TGPZ 2CHAC 1DANH 1AB9B 1QRZA 1TAWA 2WV5A 3RXRA 4INHA 1F2SE 2J34A 1CHOF 3GISB 4JK6A 5CHAB 1TNGA 3HK3B 3BIVH 1KLJH 3NCLA 3SUGA 5F8ZA 1IQEA 1O2VA 1P2NA 3RXCA 1UVUH 3G01A 3SI3H 2CV3A 4ABHA 5F03A 1SGYE 1O3DA 2BDCA 4GVUA 4X8TH 5J4SA 5C1XA 2WYJA 1GCTC 3A80A 5A8ZA 1A0HB 3FAOA 1ZJKA 2ZFQH 1GBAA 5T6DA 1MU8B 2OBOA 2DE8A 2EI7A 3PV4A 2W7UA 2NU1E 1YPKH 4LXBH 5AFZH 4KELA 1TABE 3L6PA 1P8VC 3SU4A 3A7YA 5AF9H 1RS0A 1ARBA 5T6FA 4AX9H 2P3UB 3QN7A 4F49A 2VH6A 3Q76A 4J2YB 4MNVA 3KIDU 1BHXF 5TCCA 1HAPH 2ZFFH 3SU2A 4ZAEA 1DLKB 1TPOA 3D65E 1DY9A 1K22H 1EOLA 1GBFA 1GDQA 5CE1A 1DFPA 1QHRB 2FLBH 1ORFA 1T8OA 4IN1A 1BITA 1P05A 4D76A 3A88A 4Q80A 1YPEH 1C9PA 3RC4A 1IHTH 3C1KA 3BTTE 1A4WH 2ZTXA 1O3CA 3H5CB 2WPLS 3MYWA 5JB8S 3B8JA 4NIVA 2Z9GA 3ZZ3A 3ODFA 2OTVA 3BTGE 2AERH 4TPYA 3M37A 4I8JA 2SGEE 3E8LA 1CO7E 2Q6GA 1P03A 2ODQA 1ACBE 1QQUA 4U32A 1O5GH 4I8GA 1C5NH 4H6SB 4Y76A 3VB4A 3W94A 2PKAA 2FOAA 4DGJA 3TJUA 5GIBA 3ZZBA 4YOGA 1DSTA 1BA8B 3NK8A 2F9OA 1G3EA 5L30H 1AWHB 2GMTC 2HWLB 1CVWH 2BOKA 3PMAB 4DOQA 3M36A 1EPTC 1EAWA 1OWEA 2UUKB 4JZFH 4I32A 4BNRA 3LGUA 2HNTC 1EKBB 8KME2 3OYPA 1OWDA 3VXEH 1FY3A 4B75A 2BX3A 3SQHE 1AI8H 3EGKH 1GBEA 3MI4A 1JBUH 1D3PB 4B76A 1ESTA 4CRFA 1Y3VA 1OWKA 4OS5A 4X8VH 4NA8A 5CHAC 1P57B 3PTBA 2DUCA 4BAMB 4X0WU 1P10A 1VR1H 2D26C 1BIOA 3MU4A 1DUEA 2H2ZA 1LVYA 2D1JA 4K2YA 4WMDA 1C2FA 5EXNA 4Y0YE 4E06H 2WPHS 1O2RA 2R3YA 1A5GH 2FTMA 4DURA 1ZLRA 2HOBA 3SV6A 3M5LA 4DG4A 5JBTA 1BBRE 1NT1A 1O3JA 1TONA 3P17H 3SNEA 5DP9A 2K1QA 1A3EH 1P2IA 3SORA 5GXPA 4GCHG 1F0SA 1C1VH 2A7JA 4HZHA 1OXGA 3KQDA 2FI5E 2H6MA 1ZPZA 2ZPQA 1W11U 4Y8ZA 1C5YB 1NN6A 3A82A 1MTNB 3L3TA 3GCHC 4X2YA 1DPOA 2CMYA 1C5XB 1QA7A 3E91A 2BY9X 1VCPA 1IQIA 2IJOB 1OWIA 4U30A 3SZNA 4I8KA 1V6DA 1MQ6A 3PB1E 1SBWA 1VZQH 2OQUA 1O35A 4KKDA 1N1LA 4X2XA 1PPHE 2O8WA 1Z6EA 1ZPCA 2ASUB 2FODA 1K1PA 1A5HA 1RGQA 2O8UA 4ABFA 1W10U 1UTKA 2VIVA 2F3CE 2B0FA 2QXIA 3AAUA 1DS2E 2Y6TA 1EASA 2JETB 9ESTA 2JH6D 1OX1A 2BDYA 2VVUA 3U9AH 1ARCA 4H42U 4CHAB 2V3OH 3ZVBA 3RXUA 3SUEA 4RKJB 4BAHB 4FUDA 3NWUA 3LONA 4YZUA 1C1WH 4D7FA 2F91A 2ZGJA 4ZXYH 2QXJA 4DJZB 1TYNA 3ZZ4A 3ZVFA 1CT2E 6GCHG 1GI7B 4X8SH 1ZSKA 5JB9S 1S0QA 1EZSC 1KLTA 2ZTZA 2G52A 2VIWA 2NWNA 3GDUA 4Z0KA 1C1OA 3MMGA 3SQEE 1G37A 5GCHG 1BMAA 1KDQB 2ZHQH 1O2GH 1GL0E 3UOUA 3JZ1B 1TA6A 3T62A 3M5OA 5F8XA 1EX3A 3MH6A 1K1LA 1ZTKA 1GJCB 3BTEE 2FOFA 2A45B 4ZHAA 1P2OA 3SW2B 2ZU4A 1IQGA 1FN6A 2AGGX 2J38A 1GI9B 2QYIA 1Y3UA 2HALA 5EGMA 1ZGVA 8ESTE 3A7VA 3K9XB 3ZZAA 1KXFA 3EA7A 2W7SA 2A7CA 2A5IA 1ANEA 4WH6A 2RA3A 1O5FH 3MNCA 4Q7XA 1C5MD 2TPIZ 2BD5A 1FI8A 3ZV8A 2QF3A 2QV1A 1V2RT 4KTSA 4GUXA 1GHVH 1OWHA 5AFYH 1YF4A 4AB8A 1P06A 7LPRA 3A8CA 1FQ3A 4UONA 2WINI 1AFQB 1RFNA 1N8OC 3K2UA 1THPB 1K28D 1SGFA 1PPFE 1KXDA 3A8DA 1KY9A 4QT8C 1O3BA 2BVXH 3SNDA 3UOPA 4CR5A 2KAIB 3M5MA 1AKSB 5FCRA 1JIRA 1S85A 1WTHD 2R0LA 2Z9IA 1XXFA 4LZ1H 1GJ6A 4MLFB 2HGTH 5GPIB 1QGFA 3KCGH 3HKIB 3E1XB 2BX4A 1D6RA 1V2LT 2J4IA 1ZSLA 2BDIA 3SHCH 4JYUH 3ZVEA 4WJG2 4U2WA 4HFPB 3HK6B 1P2QA 1UCYH 2O8LA 1VITG 1RTFB 1D9IA 4D7GA 1O3KA 3PROA 1C5SA 3VB5A 4Y71A 3K6YA 1VCWA 4X1RU 4IW4E 2EC9H 4RN6A 2ZFTA 1S5SA 4THNH 1VCQA 3FZZA 3MO6A 3TK6A 2BLOA 2OBQA 2W5EA 3M7QA 4ZXXH 4D8NA 1TMUH 1GJAB 2OCVB 3KEEA 2P16A 3DFJA 1O3HA 1MZAA 2LPRA 2XXLA 2SGPE 3ZVCA 1VITF 4B2BA 1GMCG 1C5PA 1CA8B 2H9TH 3MO3A 1KXBA 1QBNA 1QL9A 3HKJB 1LDTT 1RD3B 1H9HE 2B9LA 1BHXB 4BTIB 3ATKA 2XYAA 1WOFA 3RC5A 1V3XA 2R3UA 1FY4A 4GAWA 3UIRA 1O2SA 3CS7A 2C8WB 3N7OA 2FS9A 1WV7H 4FUIA 2ZDVH 2F9BH 1QA0A 2PTCE 1O2JA 1C4V2 2PGBB 5E0GA 2G00A 3TJVA 4XBCA 1GMCF 2GZ9A 3E3TA 2QY0B 1SHHB 1EQ9A 4OGYA 1GDUA 1LQEA 3NUMA 1PQ7A 2PWXA 1PFXC 5JBCS 1BRCE 1TGNA 2VB0A 5JYIA 2FX6A 1H8DH 1A5IA 3EA9A 5LPFA 1BTPA 1UVOA 3KNXA 1P04A 3QGNB 1ESAA 3SJ9A 1WAYB 5AVDA 2YNBA 1XUIA 2BXUH 4AYVB 2BQ7B 2OLGA 5DK1A 3TH4H 1TE0A 4FUBA 3LDXH 2G51A 1D3QB 2FYQA 2UUFB 2CHAB 3UQOA 1CSOE 2BDGA 2P94A 5ETXA 3RXQA 4E05H 1SLWB 3VB3A 3UR9A 1EZXC 5T3HA 4AN7A 2V0BA 3E0NB 3W95A 2G4UA 3U98H 1ELFA 5DKMA 3BG8A 4GPGA 5DGJA 4AG2A 2BHGA 1LHEH 1SGIB 1NFWA 2WPIS 3E0PB 5C1YA 3BN9A 1OYQA 1GCTB 2ILNA 2ZDAH 1OS8A 3PMHB 2OC1A 2Y7XA 1GI4A 3KQCA 1F5KU 1T7CA 1Z6JH 1FY5A 3M5NA 4MNWA 4KP0A 3URDA 4WH8A 3A7XA 1YLCA 3UNQA 4ABDA 3QTVH 1CT0E 5EQQA 1NU9A 4UD9H 1AN1E 3BTQE 1UTLM 2G81E 2GV7A 1C1UH 2C93B 4D9RA 2ESTE 2NU3E 1INCA 4AOQA 7GCHG 3F9EA 4AGJA 1HAHH 1N6XA 4VGCB 2O8MA 2BLQA 1LTOA 4NG9H 3LGVA 4B1TA 1EZQA 5DG6A 4YOJA 3GCNA 1KIGH 1AO5A 1A7SA 3SV7A 5SGAE 1DUAA 1L1JA 2VNTA 1QJ1B 1NFXA 3F9HA 1SGEE 4B74A 4GHTA 1O2OA 3KF2A 1O5CB 4WXIA 3O8CA 1L2EA 1YC0A 1UTOA 1AZ8A 7ESTE 5EW1H 1O2ZA 2XC4A 4NWLA 1TPSA 4WVPE 3TH2H 3OSYA 1GMHG 1EAUA 3S69A 3SU3A 4B73A 1G3BA 2XBXA 3GYLB 3SV2H 1GWAA 2FOBA 1V2JT 2UWLA 1GBLA 1EZUC 2BQWB 2WPKS 2TGAA 8LPRA 1IQNA 1KDQA 5EXLA 1GBHA 2GZ8A 1GHBG 4JK5A 2BD3A 3RXIA 1L1GA 3SV9A 1HXEH 2P93A 2GMTB 5BPEA 1C5RA 1HAZB 1O2UA 1CHOG 1NS3A 3PM3A 2BY8X 1EPTB 2VVCA 1SGRE 2ZIQH 1AE8H 2H5DA 4YOIA 1UHBB 5GJ4B 1GMHF 3UTUH 1HIAB 2FOEA 1ZMJA 3TGIE 1EB2A 2SGQE 1TQ7B 1DVAH 1SB1H 1YCPH 4UFGH 4FUGA 1TPAE 4IC5A 1PPEE 1YPHC 1G2MA 4ISNA 1SFQB 1T4VH 3BTME 1FNIA 1PYTD 2FPZA 3WY8A 3U1IB 1FDPA 4OS1A 1AU8A 1KXEA 4ABIA 4B71A 3SJKA 2BOHB 4CR9A 1DX5M 2O8TA 3S9AA 1E35B 5JBAS 3RXSA 1BJUA 4ISLA 4CRBA 1DT2A 2FXRA 2ANWA 2H1UA 3S7HB 4YTAA 1TPPA 4X1QU 1FONA 4INKA 4E7RG 1P9UA 3SJOA 2B7DH 3DA9B 3IWMA 1AKSA 1GHXH 3T26A 1F92A 4WWYA 3V3MA 3EDXB 3TGKE 3OY6U 2G8TA 2WUCA 1LVOA 2M5TA 1OPHB 2ZCKP 4DVAU 2J9NA 2UWPA 4MPVA 1UK3A 1BTYA 3T25A 3MU1A 4K8BA 1MKXK 2ZFSA 3T28A 2UWOA 1FUJA 3GCHB 4NGAH 3BTFE 4VGCC 1F5RA 3OU0A 3U8OH 1G3CA 1GG6C 1SGDE 1RTLA 2BVSH 3ZZ6A 2ZI2H 1GGDC 1O33A 3BIUH 1QRXA 2QA9E 4INLA 2GT7A 1P3EA 2A2XH 5DP4A 2A5AA 1Y5BT 2Y5HA 1C5LH 4Q2KA 1LPKB 1SGPE 1GJ5H 5F6MA 5LH8A 2CXVA 2QGRA 1H9LB 5HM2A 1QY6A 1P2JA 1GJ4H 2TGTA 1UMAH 3PWBA 4UFFH 4XFQA 2Y5GA 1DLEA 4CRAA 3CENA 3GCOA 2OQ5A 4B2AA 1LVBA 2BD7A 3SGBE 3TK5A 2Q6DA 2PV9B 3GDSA 3VPKA 3LGIA 1F0UA 3ZV9A 3LOXA 2WUBA 1BT7A 2XBVA 5DP5A 1DXWA 5HGGA 3RM2H 4ASHA 3MU5A 1J17T 2F9PA 5I25A 4CBNA 1MD7A 2ZHWH 3P8NA 2FMJA 4ISIH 2IPHA 3LKWA 5E8EH 5H4IB 2ULLA 2WPMS 2ZGBH 1XUHA 2G55A 1DWEH 2V35A 1SMFE 2XBYA 4JYTA 1YPLH 1AE5A 3PYHA 4TWYA 3VB7A 4FVBA 2FTLE 1MBMA 3A8BA 1G32B 1C1PA 2HNTE 2AYWA 2CJIA 1A1RA 2V6NA 3M3VA 2QIQA 1ZHRA 1B7XB 3SUFA 4BAOB 1KSNA 2GT8A 5EQRA 3UNSA 3RXLA 1EJAA 3DUXH 1GI8B 3KHVA 1VITH 1MTSA 1BMMH 2QC2A 4K1TA 1T8MA 2BDAA 2ZKSA 2Z3CA 3C27B 2STBE 1T8NA 3TJNA 1Y5AT 2GCTC 2DE9A 1QB9A 1WQVH 1CA0C 1HAVA 2BY6X 4X6MA 4UDWH 1BTXA 3RM0H 1QCPA 3V7TA 1FAKH 1FIWA 2G5VA 4X8UH 1O2LA 2EI6A 2CF9H 4FUFA 1UVPA 3DFLA 1C5UA 4BANB 1FXYA 1OOKB 1GCDA 1JOUB 3JZ2B 1EUFA 4Z6AH 1V2OT 1V2VT 1AHTH 1H1BA 9LPRA 1OP2A 3STJA 4I31A 5FHTA 1UK2A 1W14U 1KTTB 4E7NA 3SO3A 1LHDH 3ESTA 4UFDH 2OC8A 2XCNA 3A86A 1B0FA 2CF8H 1NRRH 3PLPA 2HLCA 5HYOA 3ZZ7A 2Z9LA 4DIHH 1S0RA 1N8OB 1FLEE 3E90B 2YNAA 4YESB 3P95A 3TPIZ 1W0YH 3ATLA 1NROH 1OWJA 1EJMA 2FI4E 1PJPA 4AGKA 1SPJA 3P70B 3RXKA 2G4TA 1PPCE 1EXFA 1QQ4A 2ZF0H 2CN0H 2AGEX 3RXVA 1YCPK 3E16B 2Z9JA 5DP8A 5K0HA 3ELAH 3SV8A 4OS2A 3ODDA 3E6PH 3F1SB 4ZKNU 4XBBA 2BD2A 1NRQH 1ZTLA 3GY6A 2AH4X 1NRNH 2AMPA 1MBQA 1ZJDA 4IMQA 3GY5A 2EA3A 1O37A 2XWBI 3P6ZB 1GBBA 3RXDA 2STAE 2ZCLP 4AG1A 1BBRK 3QTOH 1SL3A 1TGCA 1C2EA 2ZNKH 1NM6A 4JCNA 3RXMA 1MTUA 3URCA 1C2GA 2QN5T 1L4DA 4O3UA 1TNLA 2D2DA 1C1RA 2QXGA 3M7UA 4MPUA 2D8WA 4X1SU 2W26A 1SHYA 3Q00A 4NFFA 1P9SA 1GI3A 2GCHF 3GY2A 4MPXA 1V2QT 3U8RH 2BZ6H 2G5NA 2A5KA 4Y10E 1HAGE 3CP7A 1EPTA 3GY3A 1GMDG 2ZEBA 3MNXA 1D3TB 4JZDH 1UVTH 3SJIA 3GCTF 3UWJH 2PTNA 1N6YA 4Y8YA 1QB1A 4NA7A 1NU7B 4D9QA 3RXTA 2SFAA 2ZU1A 1SGFG 3BSQA 2GV6A 3SGAE 1A2CH 1XUGA 4OS6A 5C3NA 1GHAG 3AASA 2R2WU 3A85A 4KGAA 1ELDE 1Y59T 3ENSB 5FAHA 4O9VA 1QR3E 5F8TA 3P8FA 2Y7ZA 4WY3A 1GMDF 1TBRH 1W2KH 2VWLA 2Y80A 1OYTH 4XOJA 2J94A 1RXPA 2GDDA 1O34A 2XC0A 1XKBC 2ZCHP 1NY22 1UVSH 2PR3A 5FPSA 1VGCB 1Z8GA 4FU9A 2OUAA 3FFGA 1GHAF 2Z9KA 1NRPH 2SNWA 3SU5A 4BTTB 3DHKH 4MG3A 1O2QA 1BZXE 1YKTA 5EG4A 2FI3E 2ZP0H 1THRH 2FYRA 2R2MB 2SGFE 1CBWC 4BXSA 1VJAU 2P59A 1HLTH 1SLXB 1C5TA 1QNJA 2ZHEH 4ABAA 1AMHA 1GJ8B 3FP8E 3M3TA 4NSYA 1W7GH 1QURH 1TX6A 2QAAA 4MDSA 1E0FD 1O5EH 2ALPA 3GICB 1LVMA 1G3DA 1O2NA 5C2ZA 3RXGA 1P02A 1C5VA 3D62A 4JYVH 2VGCC 5A0BA 5HXFA 1DOJA 3I29A 1FAXA 1MAYA 4MNYA 4BAKB 1QL8A 3UREA 4IC6A 3RXPA 5LPEA 4DT7B 3I78A 1DE7H 4A1XA 1LO6A 1GJBB 1C1MA 1NZQH 4NZLA 3AAVA 4JZIA 1EOJA 1HRTH 3BG4C 2VWMA 4K60A 4Y11E 3LGTA 1HAXB 2ZU2A 1O3LA 4WXVA 3T27A 1K9OE 4K8YA 1P3CA 3GYMA 1J8AA 2FESH 5FBIA 1MMJN 1J15A 1TNHA 2ZHDA 1JMOH 4I8HA 1G30B 1K2I1 3R0FA 5E2PA 2F83A 4JZEH 3VGCB 2VU8E 1Q31A 1TIOA 4OS7A 2ZWLH 2PUQH 1DITH 2FM2A 1HUTH 1AZZA 4X6NA 2BD4A 5T6GA 2PLXA 1NFYA 5EPNA 1ESBA 4Y7AA 1QFKH 1Q2WA 1LCYA 3RXAA 3RMLH 4MQAA 5A0AE 4NCYA 5DP7A 1HAOH 1WBGB 3MFJA 5C5NA 4Q7ZA 1BTZA 1Z1IA 2SGAA 3R3GB 2XTTB 1V2ST 1FJSA 4MPWA 4X2WA 3GDVA 2A4GA 3RXOA 1TMTH 2BQ6B 3OY5U 2PW8H 2ZECA 2BB4A 1TNIA 1C5WB 3QGJA 4HI3A 4BAQB 2PKAB 1K1JA 4ISOA 1GBTA 3SUDA 4UFEH 1MKXH 2Y82A 2GD4B 2VIQA 5IYTA 3SJ8A 1GBKA 2ZHFH 1XVMA 2BLVA 1D4PB 4AYYB 1W12U 1VGCC 1MKWK 3V13A 1ZTJA 2A32A 1PQ5A 1GVKB 4WMEA 1TBZH 1SR5C 1OP0A 1C2LA 5CMXH 1XXDA 5EQSA 2CGAA 2AFQB 3BEUA 1ZRBA 1K1NA 3EYDA 2Y81A 2ZZUH 2Q6FA 1TRYA 3PO1B 1A0JA 3UUZA 3SHAH 3BF6H 3SU0A 3GOVB 5C1UA 1AD8H 4JMYA 1ANDA 1QRWA 1L1NA 3SBKA 3ZZ9A 1BMLA 1GPZA 2HVXA 1TNKA 1SGQE 3LT3A 3VXFH 4TPIZ 4LOYH 1P01A 1CGJE 1O2HA 1O2MA 2ZC9H 3TH3H 1O2KA 4LZ4B 1W8BH 1W3CA 3EE0B 4DIIH 6GCHF 2VWNA 1BQYA 1THSH 1S83A 3NKKA 1GL1A 1UTJA 5EOKA 1AIXH 1TRNA 2A2QH 1BRAA 2PSYA 3VB6A 1S82A 3MH7A 4RKOB 1V2WT 2ZQ2A 1HJAB 1WYKA 1AFEH 1HJ8A 1GG6B 4ZKRU 1EAIA 2AMDA 2QCYA 1QBVH 2OP9A 3F9FA 1GVZA 2LNCA 1GGDB 2A1DB 2FIRH 5E0HA 1P09A 5HMAA 1UTNA 1UCYE 2RG3A 4YT7H 1A61H 2THFB 3VGCC 1O0DH 3U69H 1TWXB 1FPCH 1O3IA 3RP2A 3Q3YA 1UTQA 4X6OA 1O5BB 2BXTH 7KMEH 1EJNA 4YO9A 3LC3A 3UNRA 1ELGA 1C2JA 1HAIH 1IQJA 3UY9A 4K1SA 3A83A 2Q1JA 1DICA 3LJOA 2GDEH 2TGDA 5BRRE 1MH0A 1O3FA 3SNCA 2VIOA 4A7IB 1YPGH 4A6LA 1TX8A 2R0KA 2PKSC 3I77A 4O03A 3TLOA 2O9QA 1G9IE 2EI8A 1C5ZB 1O2YA 1GHWH 6CHAC 1GHZA 1AVXA 1HPGA 5EU8A 1MU6B 1ZSJA 1O3PB 2B5TB 3O8DA 1ID5H 1LHGH 1CU1A 1YPMH 3FZDA 3ZYEA 1V2UT 4JZ1A 5A2MH 1SVPA 1TA2A 1X7AC 4GSOA 1GI0A 1XX9A 3HATH 1EAXA 4FXGH 2XC5A 1O31A 4SGAE 1V2KT 3K6ZA 1O2TA 1TLDA 1B5GH 1HXFH 4K5ZA 1TB6H 1BMNH 4GLYA 1FN8A 3RXFA 1ZOMA 4ABEA 3LH1A 5DO4H 1Z71A 1AY6H 3PMJA 1C5OH 3QX5H 4HGCA 1C4U2 2BDBA 2FS8A 3LPRA 1YPHE 1WU1A 1AWFH 1YLDA 1GI5A 2GCTB 1GDNA 1CA0B 1ETTH 1S6HA 3Q77A 4ZHMU 3PO1C 1UTMA 2PSXA 1O3MA 2AMQA 1ETRH 2BDHA 1CGHA 1PPGE 3MOCA 1SLVB 2NU2E 2ANYA 4TY6A 3PTNA 1BBRH 4KTUA 2F9UA 1Z8JB 3PLBA 1RTKA 2FZZA 1ELBA 1IQLA 2KAIA 3U8TH 3QO6A 1IQMA 4ESTE 1Y3XA 1LPZB 2IOTA 4O97A 4XSKU 2ZGCA 1MCTA 1C2KA 1O36A 1SFIA 1CGIE 3QK1A 4H4FA 8GCHG 1NTPA 1ELCA 1YP9A 1FY1A 1ANCA 1EP6A 5DJ7A 2ZPSA 1TALA 2Z6BD 1SLUB 1J16A 1AQ7A 3P92A 1A3BH 2VWOA 1HJAC 3D49H 3VFEA 3A87A 3SNAA 1ETSH 1HB0B 1HJ9A 2AIPA 5ESBA 1WUNH 4DW2U 3SNBA 1HAYB 1NRSH 1P2MA 3BTWE 4FUJA 2BZAA 4X1NU 4BTUB 1YM0A 1GBDA 1TX7A 1RJXB 2R9PA 1P2KA 4FVDA 4B2CA 1HCGA 4ZUHA 1C2MA 5PTPA 8GCHF 4A1VA 1YCPM 5EXMA 2OD3B 1IQFA 1XMNB 1IAUA 3KQBA 2P8OC 4YLQH 3BTHE 1VJ9U 3LGYA 3PMBB 3O8BA 4IS5A 2VINA 1JXPA 1SQOA 1HGTH 3NPSA 1TOMH 1TGTA 2TBSA 2BD8A 3RLWH 1ABIH 5LPRA 1MCVA 1O5DH 4FUHA 4X1PU 1GHYH 1H8IH 2VH0A 3S9CA 3UPEA 3MH5A 1IQKA 6ESTA 5C5OA 1XM1A 4YLUA 3DT0H 3ATMA 3TNSA 1OKXA 1SG8B 1QJ6B 1RIWC 1Z1JA 2F9NA 2Z3DA 1O39A 1FZZA 3ZZCA 3A84A 4TYDA 2BY5X 4R8TB 1FMGA 3AW1A 5FXLA 1W13U 4NIWA 2XCFA 1XUKA 4A1TA 2IN2A 1BTWA 3SN8A 1MQ5A 3RUOA 5A09A 3MU0A 1B0EA 5TJXA 1GI1A 1F0TA 3QZRA 2A0QB 3OX7U 3LH3A 4F4OC 1QL7A 1SQAA 3OTJE 1O38A 5C67A 3F68H 1Y5UT 2JH0D 2ODPA 1FY8E 1MZDA 4U01A 4I7YH 4ABJA 4CRCA 1T31A 4AFSA 2ZO3H 1UJ1A 5DPAA 3MU8A 2P3FH 2B8OH 3ZYDA 1AB9C 1O5AB 4NFEA 3TVJB 2FO9A 1HBTH 4AFZA 1HFDA 1O3OA 1SSXA 1O30A 3IG6B 1SC8U 2ANMH 4FU8A 1GBMA 1JIMA 1C1QA 3RMNH 4FUEA 4OGXA 3TU7H 1MUEB 4O3TA 1O2XA 1TBQH 2C8ZB 1UO6A 4Y6DA 1H9IE 1L4ZA 2ZDLA 2ZTYA 3RLYH 2HPPH 1LKAA 1H4WA 1ANBA 1HNEE 1QBOA 1NFUA 1ZRKA 4Y7BA 3BTDE 4CRDA 1EP5A 5AHGH 3PWCA 3QZQA 1CBWB 1T4UH 1BJVA 2J2UA 1MTWA 2ZFRH 4KTCA 3ZZ5A 1AVGH 1DM4B 1D3DB 4ABGA 1GJDB 4UEHH 4K69A 3RU4T 2BY7X 5B6OA 2FDAA 1EB1H 5A8XA 3A7WA 3KQEA 1HV7A 1RRKA 1SGTA 1Y3WA 1YYY1 2VGCB 3RU4E 2OC0A 3F9GA 3D23A 1FPHH 1V2PT 4IN2A 2ZDNA 1T8LA 1Z8IB 1ZHMA 2GCHG 2QXHA 3T29A 5EW2H 4DCDA 4ABBA 2Z7FE 1GBCA 1ZMNA 4MVNA 1LHCH 4GCHF 1K1IA 2OXSA 3HGPA 3BG4B 3FANA 4J1YA 3GCTG 1MKWH 2HNTF 4PROA 2W3KA 1KYNA 3SU1A 2ANKH 2Y5FA 4RSPA 4Y79A 3RXEA 3M35A 4XE4A 1IOEA 2NU0E 3DD2H 1WCZA 1PQAA 1AUJA 4ZMAH 2PUXB 1F7ZA 5J4QA 3HGNA 1SOZA 3AVZA 1A46H 1XKAC 2PGQB 1C2IA 5GWZA 5TCAA 1XUJA 2ZU5A 4SGBE 3QWCH 1Y8TA 1C2HA 1E37B 1UHBA 5ESTE 1ELAA 4X6PA 4ISHH 3IITA 1CE5A 1PPZA 3TIUA 3S0NA 3QLPH 1SGNE 1HIAA 3RXBA 1ZR0A 1C2DA 3RXHA 2ODYB 1CT4E 4CH8B 2PFEA 2XNIA 1GI2A 3UQVA 2A4QA 3MHWU 4AFUA 3SU6A 1BTHH 2GX4A 3O8RA 1TOCB 1J14A 1SI5H 3KGPA 2C3SA 1O3AA 4Y8XA 3SOSA 1BCUH 2HRVA 2FOGA 3A7ZA 4IGDA 5LGOA 1TFXA 1FIZA 2H9HA 3EAJA 2BVRH 1O3GA 1BB0B 1TGSZ 2XBWA 1K21H 2H9EH 2BD9A 1S6FA 2BMGB 1G36A 2ZGXH 2TRMA 1UTPA 3EQ0H 3BTKE
chains in the Genus database with same CATH superfamily
3MO9A 1DXPA 2YOLA 3ATWA 1O2IA 3KN2A 5JBBS 5GCHF 1YGCH 3Q3KA 1WQSA 1O2PA 1IHSH 3GY4A 5A0CA 5FX5A 4X2VA 3UWIA 3A81A 2VIPA 1C1SA 1WTGH 3UR6A 4AB9A 3LGWA 2PHBA 2XRCA 4NA9H 2VIDA 2RA0A 1BRUP 3Q3XA 4Z1MD 3B23B 1KXCA 3LC5A 1LMWB 5HM9A 1PYTC 5L6NH 2WV4A 3ZZ8A 1UK4A 2FOHA 3K65B 1FV9A 4WMFA 2HVYB 1MTNC 1TGBA 2WPDD 2GP9B 3ITIA 1P12E 2C4FH 2ZFPH 1HDTH 3S7KB 2A4OA 5FPYA 2TIOA 2EY4C 2WYGA 4Q4LA 1OSSA 3BV9B 1P0SH 2IJD1 3SYJA 1GI6A 2Z94A 4MTBA 2WZQA 5FCKA 4ZHLU 2ZU3A 3A89A 1V2NT 1ZZZA 2JKHA 2W3IA 5FBEA 5KGOA 3P8OA 3M61U 2NU4E 2C8XB 2GKVE 1LKBA 2AGIX 3T2NA 4IBLH 4A92A 4A5TS 1KLIH 2ZA5A 4I33A 3FP6E 2W6ID 1ZHPA 2JETC 1DDJA 1T32A 1W7XH 1E38B 5ABWA 3NZIA 3RDZA 2FOMB 2QF0A 1BDAA 3QUMP 3RMMH 4NZQA 2C90B 5C20A 4YT6H 5EODA 4UE7H 3SGQE 5EJZA 4CHAC 1YPJH 2I6SA 2VJ1A 4TWWA 3EA8A 5FX6A 3P8GA 1TRMA 2P95A 2UUJB 1Z7KA 2FP7B 2ZDKA 1NESE 4Y0ZE 4FU7A 5K7RA 2BM2A 1BOQA 4ZKOU 4Q7YA 4HTCH 4OS4A 1K1OA 2FEQH 3ZZDA 2RDLA 2WPJS 2SGDE 4R0IA 3MTYA 1ZGIA 4AZ2B 3A7TA 1U6QA 1ZMLA 4ZROA 3U28C 2PKSB 2UUYA 3KL6A 1C5QA 1ELTA 3OAAD 3UFAA 4IMZA 6CHAB 1GBIA 5DP6A 2F9VA 1J9CH 2ZG0H 1DWBH 2A31A 1P11E 1SGCA 1HYLA 1GJ7B 2YMSC 1E34B 1QTFA 5JPMH 3ZVGA 3RMOH 1MAXA 1WSSH 2GZ7A 5A8YA 1LPGB 1GVLA 2ZQ1A 4FUCA 2GTBA 1ZYOA 2RCEA 2AS9A 2H5CA 2QE7D 2J95A 1O3NA 2GGVB 2EEKA 1D6WA 2J92A 2KX4A 2FOCA 5GDSH 4H6TA 1NO9H 1S81A 4CH2B 3LJJA 1QIXB 1K1MA 1XUFA 1Y3YA 2EQNA 3B9FH 3BEFB 1ELVA 1KXAA 4TT3D 1C1NA 1YBWA 2GVFA 3LU9B 1M9UA 1HAVB 2BLWA 4I8LA 3DSOA 4XBDA 3TJOA 1FX0B 1Z8RA 3MH4A 3NXPA 3GY7A 4GHQA 3QDZB 4NIYA 1AFQC 5FPTA 3F6UH 4NWKA 3RU4D 1A0LA 5L2YH 4FETA 2FX4A 3DCLA 3MWIU 2HPQH 3PLKA 4LK4A 1ELEE 1SQTA 4BXWA 3L33A 4MNXA 5IDKA 5E2OA 2XW9A 2FWWA 1GJ9B 3V0XA 4XDEA 3STIA 5L2ZH 2KCYA 2HLDD 3U1JB 3N7DA 4ACBA 2AIQA 1ABJH 2XWAA 4AFQA 1DWCH 1SQRA 3OTPA 1O2WA 4K3JA 3FN8A 3LIWA 3ZVDA 1C4Y2 1PQ8A 3A8AA 1TNJA 3F2FA 5EPYA 1C1TA 1DY8A 4ZH8A 4M7GA 1OP8A 2P3TB 4ZKSU 1L0ZA 1TMBH 4ASUD 3RXJA 1V2TT 3ZVAA 1LQDB 3T5FH 2RFKC 2P8OB 3AW0A 2KFWA 3GY8A 1BRBE 1GBJA 1CHGA 6LPRA 3BEIB 3S9BA 1V2MT 3TITA 1F5LA 2ZGHA 1DSUA 1AVWA 1BTUA 1NPMA 4WF8A 1PPBH 1TQ0B 1F0RA 2OC7A 1JWTA 3FP7E 3VEQB 1EATA 2FLRH 1LHFH 4TY7A 1AGJA 1O32A 3RC6A 1CQQA 2BYAX 2V3HH 5E0JA 3M7TA 4F48B 7GCHF 3TGJE 4CREA 4AORA 5G4BA 3FVFB 5EJ1A 2AEIH 1G2LA 1Q3XA 3CS0A 1W0ZU 2ZPRA 1MD8A 2JH5D 3MNSA 1RIWB 3TK9A 2Z3EA 2C8YB 1DWDH 5C17A 1NC6A 5I46H 1ZPBA 2A4RA 4YM9A 1XVOA 1S84A 3V12A 1S6LA 4DY7B 4NIXA 4BOHA 4CRGA 2ALVA 1JRTA 2BTCE 1C9TA 1AUTC 1BUIA 4CBOA 1UCYK 1IQHA 3HPTB 2I6QA 3MNBA 1E36B 1QB6A 4NSVA 1H8HD 3H7OA 1SOTA 2VVVA 3M3SA 3TNTA 4K1EA 1QJ7B 5DP3A 1O3EA 3H7TA 1JRSA 1MTVA 2OINA 1GHBF 3ATIA 2A7HA 1KTSB 3SI4H 2ZDMA 5JDUB 1YWUA 2SNVA 2TGPZ 2CHAC 1DANH 1AB9B 1QRZA 1H8ED 1TAWA 2WV5A 3RXRA 4INHA 1F2SE 2J34A 1CHOF 3GISB 4JK6A 5CHAB 1TNGA 3HK3B 3BIVH 1KLJH 3NCLA 3SUGA 5F8ZA 1IQEA 1O2VA 1P2NA 3RXCA 1UVUH 3G01A 3SI3H 1E1RD 2CV3A 4ABHA 5F03A 1SGYE 1O3DA 2BDCA 4GVUA 4X8TH 5J4SA 5C1XA 2WYJA 1GCTC 3PV2A 3A80A 5A8ZA 1A0HB 3FAOA 1ZJKA 2ZFQH 1GBAA 5T6DA 1MU8B 2OBOA 2DE8A 2EI7A 3PV4A 2W7UA 2NU1E 1YPKH 4LXBH 5AFZH 4KELA 1TABE 3L6PA 1P8VC 3SU4A 3A7YA 5AF9H 1RS0A 1ARBA 5T6FA 4AX9H 2P3UB 3QN7A 4F49A 2VH6A 3Q76A 4J2YB 4MNVA 3KIDU 1BHXF 5TCCA 1HAPH 2ZFFH 3SU2A 4ZAEA 1DLKB 1TPOA 2J5UA 3D65E 1DY9A 1K22H 1EOLA 1GBFA 1GDQA 5CE1A 1DFPA 1QHRB 2FLBH 1ORFA 1T8OA 4IN1A 1BITA 1P05A 4D76A 3A88A 4Q80A 2KCOA 1YPEH 4F55A 1C9PA 1WDIA 3RC4A 1IHTH 3C1KA 3BTTE 1A4WH 2ZTXA 1O3CA 3H5CB 2WPLS 3MYWA 5JB8S 3B8JA 4NIVA 2Z9GA 3ZZ3A 3ODFA 2OTVA 3BTGE 2AERH 4TPYA 3M37A 4I8JA 2SGEE 3E8LA 1CO7E 2Q6GA 1P03A 2ODQA 1ACBE 1QQUA 2V7QD 4U32A 1O5GH 4I8GA 1C5NH 4H6SB 4Y76A 3VB4A 3W94A 2PKAA 2FOAA 4DGJA 3TJUA 5GIBA 3ZZBA 4YOGA 1DSTA 1BA8B 3NK8A 2F9OA 1G3EA 5L30H 1AWHB 2GMTC 2HWLB 1CVWH 4YXWD 2BOKA 3PMAB 4DOQA 2IPQX 3M36A 1EPTC 1EAWA 1OWEA 2UUKB 4JZFH 4I32A 4BNRA 3LGUA 2HNTC 1EKBB 8KME2 3OYPA 1OWDA 3VXEH 1FY3A 4B75A 2BX3A 3SQHE 1AI8H 3EGKH 1GBEA 3MI4A 1JBUH 1D3PB 2CK3D 4B76A 1ESTA 4CRFA 1Y3VA 1OWKA 4OS5A 4X8VH 4NA8A 5CHAC 1P57B 3PTBA 2DUCA 4BAMB 4X0WU 1P10A 1VR1H 2D26C 1BIOA 3MU4A 1DUEA 2H2ZA 1LVYA 2D1JA 4K2YA 4WMDA 1C2FA 2L74A 5EXNA 4Y0YE 4E06H 2WPHS 1O2RA 2R3YA 1A5GH 2FTMA 4DURA 1ZLRA 2HOBA 3SV6A 3M5LA 4DG4A 5JBTA 1BBRE 1NT1A 1O3JA 1TONA 3P17H 3SNEA 5DP9A 2K1QA 1A3EH 1P2IA 3SORA 5GXPA 4GCHG 1F0SA 1C1VH 2A7JA 1COWD 4HZHA 1OXGA 3KQDA 2FI5E 2H6MA 1ZPZA 2ZPQA 1W11U 4Y8ZA 1K0HA 1C5YB 1NN6A 3A82A 1MTNB 3L3TA 3GCHC 4X2YA 1DPOA 2CMYA 1C5XB 1QA7A 3E91A 2BY9X 1VCPA 1IQIA 2IJOB 1OWIA 4U30A 3SZNA 4I8KA 1V6DA 1MQ6A 3VG8A 3PB1E 1SBWA 1VZQH 2OQUA 1O35A 4KKDA 2JDID 1N1LA 4X2XA 1PPHE 2O8WA 1Z6EA 1ZPCA 2ASUB 2FODA 1K1PA 1A5HA 1RGQA 2O8UA 4ABFA 1W10U 1UTKA 2VIVA 2F3CE 2B0FA 2QXIA 3AAUA 2J98B 1DS2E 2Y6TA 1EASA 2JETB 9ESTA 2JH6D 1OX1A 2BDYA 2VVUA 3OE7D 3U9AH 1ARCA 4H42U 4CHAB 2V3OH 3ZVBA 1KMHB 3RXUA 3SUEA 4RKJB 4BAHB 4FUDA 3NWUA 3LONA 4YZUA 1C1WH 4D7FA 2F91A 2ZGJA 4ZXYH 2QXJA 4DJZB 1TYNA 2QF5A 3ZZ4A 3ZVFA 1CT2E 6GCHG 1GI7B 4X8SH 1ZSKA 5JB9S 1S0QA 1EZSC 1KLTA 2ZTZA 2G52A 2VIWA 2NWNA 3GDUA 4Z0KA 1C1OA 3PRDA 3MMGA 3SQEE 1G37A 5GCHG 1BMAA 1KDQB 2ZHQH 1O2GH 1GL0E 3UOUA 3JZ1B 2XOKD 1TA6A 3T62A 3M5OA 5F8XA 1EX3A 3MH6A 2YMSB 1K1LA 1ZTKA 1GJCB 3BTEE 2FOFA 2A45B 3FO8D 1P2OA 4ZHAA 2ZU4A 1IQGA 1FN6A 2AGGX 2J38A 1GI9B 2QYIA 1Y3UA 2HALA 5IK2D 5EGMA 1ZGVA 8ESTE 3A7VA 3K9XB 3ZZAA 1KXFA 3EA7A 2W7SA 2A7CA 2A5IA 1ANEA 3F0OA 4WH6A 2RA3A 1O5FH 3MNCA 4Q7XA 1C5MD 2TPIZ 2BD5A 1FI8A 3ZV8A 2QF3A 2QV1A 1V2RT 4KTSA 2KR7A 4GUXA 1GHVH 1OWHA 5AFYH 1YF4A 4AB8A 1P06A 7LPRA 3A8CA 3DSGA 1FQ3A 5KECA 4UONA 2WINI 1AFQB 1RFNA 1N8OC 3K2UA 1THPB 1K28D 1SGFA 3WWBA 1PPFE 1KXDA 3A8DA 1KY9A 4QT8C 1O3BA 2BVXH 3SNDA 3UOPA 4CR5A 2KAIB 3M5MA 1AKSB 5FCRA 1JIRA 1S85A 1WTHD 2R0LA 2Z9IA 1XXFA 4LZ1H 1GJ6A 4MLFB 2HGTH 5GPIB 2QF4A 1QGFA 3KCGH 3HKIB 3E1XB 2BX4A 1D6RA 1V2LT 2J4IA 1ZSLA 2BDIA 3SHCH 4JYUH 3ZVEA 4WJG2 4U2WA 4HFPB 4AC9A 3HK6B 1P2QA 1UCYH 2O8LA 1VITG 1RTFB 1D9IA 4D7GA 1O3KA 3PROA 1C5SA 3VB5A 4Y71A 3K6YA 1VCWA 4X1RU 4IW4E 2EC9H 4RN6A 2ZFTA 1S5SA 4THNH 1VCQA 3FZZA 3MO6A 3TK6A 2BLOA 2OBQA 2W5EA 3M7QA 4ZXXH 4D8NA 1TMUH 1GJAB 2OCVB 3KEEA 2P16A 3DFJA 2F43B 1O3HA 1MZAA 2LPRA 2XXLA 2SGPE 3ZVCA 1VITF 4B2BA 4TSFD 1GMCG 1C5PA 1CA8B 2H9TH 3MO3A 1KXBA 1QBNA 1QL9A 3HKJB 1LDTT 1RD3B 1H9HE 2B9LA 1BHXB 4BTIB 3ATKA 2XYAA 1WOFA 3RC5A 1V3XA 2R3UA 1FY4A 4GAWA 3UIRA 1O2SA 3CS7A 2C8WB 3N7OA 2FS9A 1WV7H 4FUIA 2ZDVH 2F9BH 2V3MA 1QA0A 2PTCE 1O2JA 1C4V2 2PGBB 5E0GA 2G00A 3TJVA 4XBCA 1GMCF 2GZ9A 3E3TA 3SW2B 2QY0B 1SHHB 1EQ9A 4OGYA 1GDUA 4M9FA 1LQEA 3NUMA 1PQ7A 2PWXA 1PFXC 5JBCS 1BRCE 1TGNA 2VB0A 5JYIA 2FX6A 1H8DH 1A5IA 3EA9A 5LPFA 1BTPA 1UVOA 3KNXA 1P04A 3QGNB 1ESAA 3SJ9A 1WAYB 5AVDA 2YNBA 1XUIA 2W6JD 2BXUH 2KM0A 4AYVB 2BQ7B 2OLGA 5DK1A 3TH4H 1TE0A 4FUBA 3LDXH 2G51A 1D3QB 1VKYA 2FYQA 2UUFB 2CHAB 3UQOA 1CSOE 2BDGA 2P94A 5ETXA 3RXQA 4E05H 1SLWB 3VB3A 3UR9A 1W0KD 1EZXC 5T3HA 4AN7A 2V0BA 3E0NB 3W95A 2G4UA 1BMFD 1ELFA 5DKMA 3U98H 3BG8A 4GPGA 5DGJA 4AG2A 2BHGA 1LHEH 1SGIB 1NFWA 2WPIS 3E0PB 5C1YA 3BN9A 1OYQA 1GCTB 2ILNA 2ZDAH 1OS8A 3PMHB 2OC1A 2Y7XA 1GI4A 3KQCA 1F5KU 1T7CA 1Z6JH 1FY5A 3M5NA 4MNWA 4KP0A 3URDA 4WH8A 3A7XA 1YLCA 3F2GA 3UNQA 4ABDA 3QTVH 4B6FA 1CT0E 5EQQA 1NU9A 4UD9H 1AN1E 3BTQE 1UTLM 2G81E 2GV7A 3UAIC 1C1UH 2C93B 4D9RA 2ESTE 2NU3E 1INCA 4AOQA 3F2HA 4HG6A 4XRNA 7GCHG 3F9EA 4AGJA 1HAHH 1N6XA 4VGCB 2O8MA 2BLQA 1LTOA 4NG9H 3LGVA 4B1TA 1EZQA 5DG6A 4YOJA 3GCNA 1KIGH 1AO5A 1A7SA 3SV7A 5SGAE 1DUAA 1L1JA 2LP6A 2VNTA 1QJ1B 1NFXA 3F9HA 1SGEE 4B74A 4GHTA 1O2OA 3KF2A 1O5CB 4WXIA 3O8CA 1L2EA 1YC0A 1UTOA 1AZ8A 1NBME 7ESTE 5EW1H 1O2ZA 2XC4A 4NWLA 1TPSA 4WVPE 3TH2H 3OSYA 1GMHG 1EAUA 3S69A 3SU3A 4B73A 1G3BA 2XBXA 3GYLB 3DSPA 3SV2H 1GWAA 2FOBA 1V2JT 2UWLA 1GBLA 1EZUC 2BQWB 2WPKS 2TGAA 8LPRA 1IQNA 1KDQA 5EXLA 1GBHA 2GZ8A 1GHBG 4JK5A 2BD3A 3RXIA 1L1GA 3SV9A 1HXEH 2P93A 2GMTB 5BPEA 1C5RA 1HAZB 1O2UA 1CHOG 3KYGA 1NS3A 3PM3A 2BY8X 1EPTB 2VVCA 1SGRE 2ZIQH 1AE8H 2H5DA 4YOIA 1UHBB 3SZEA 5GJ4B 1GMHF 3UTUH 3KQ5A 1HIAB 2FOEA 2KZ4A 1ZMJA 3TGIE 1EB2A 3UB0A 2SGQE 1TQ7B 1DVAH 1SB1H 1YCPH 4UFGH 4FUGA 1TPAE 4IC5A 1PPEE 1YPHC 1G2MA 4ISNA 1SFQB 1T4VH 3BTME 1FNIA 1PYTD 2FPZA 3WY8A 3U1IB 1FDPA 4OS1A 1AU8A 1KXEA 4ABIA 4B71A 3SJKA 2BOHB 4CR9A 1DX5M 2O8TA 3S9AA 1E35B 5JBAS 3RXSA 1BJUA 4ISLA 4CRBA 1DT2A 2FXRA 2ANWA 2H1UA 3S7HB 4YTAA 1TPPA 4X1QU 1FONA 4INKA 4E7RG 1P9UA 3SJOA 2B7DH 3DA9B 3IWMA 1AKSA 1GHXH 3T26A 1F92A 4WWYA 3V3MA 3EDXB 3TGKE 3OY6U 2G8TA 2WUCA 1LVOA 2M5TA 1OPHB 2ZCKP 4DVAU 2J9NA 2UWPA 4MPVA 1UK3A 1BTYA 3T25A 3WW7A 3MU1A 4K8BA 1MKXK 2ZFSA 3T28A 2UWOA 1FUJA 3GCHB 4NGAH 3BTFE 4VGCC 1F5RA 3OU0A 3U8OH 1G3CA 1GG6C 1SGDE 1RTLA 2BVSH 3ZZ6A 2ZI2H 1GGDC 1O33A 3BIUH 1QRXA 2QA9E 4INLA 2GT7A 1P3EA 2A2XH 5DP4A 1EFRD 2A5AA 1Y5BT 2Y5HA 1C5LH 4Q2KA 1LPKB 1SGPE 1GJ5H 5F6MA 5LH8A 2CXVA 2QGRA 1H9LB 5HM2A 1QY6A 1P2JA 1GJ4H 2TGTA 1UMAH 3PWBA 4UFFH 4XFQA 3KYFA 2Y5GA 1DLEA 4CRAA 3CENA 3GCOA 2OQ5A 4B2AA 1LVBA 2BD7A 3SGBE 3TK5A 2Q6DA 2PV9B 3GDSA 3VPKA 3LGIA 1F0UA 3ZV9A 3LOXA 2WUBA 1BT7A 2XBVA 5DP5A 1DXWA 5HGGA 3RM2H 4ASHA 3MU5A 1J17T 2F9PA 5I25A 4CBNA 1MD7A 2ZHWH 2YMSD 3P8NA 1MABB 2FMJA 3F0PA 4ISIH 2IPHA 3LKWA 5E8EH 5H4IB 2M2AA 2ULLA 2WPMS 2ZGBH 1XUHA 2G55A 1DWEH 2V35A 1SMFE 2XBYA 4JYTA 1YPLH 1AE5A 3PYHA 4TWYA 3VB7A 4FVBA 2FTLE 1MBMA 3A8BA 1G32B 1C1PA 2HNTE 2AYWA 5HKKD 2CJIA 1A1RA 2V6NA 3M3VA 2QIQA 1ZHRA 1B7XB 3SUFA 4BAOB 1KSNA 4ACAA 2GT8A 5EQRA 3UNSA 3RXLA 1EJAA 3DUXH 1GI8B 3KHVA 1VITH 2PP6A 1MTSA 1BMMH 2QC2A 4K1TA 1T8MA 2BDAA 2ZKSA 2Z3CA 3C27B 2STBE 1T8NA 3TJNA 4ZCNA 1Y5AT 2GCTC 2DE9A 1QB9A 1WQVH 1CA0C 1HAVA 2BY6X 4X6MA 2K0QA 4UDWH 1BTXA 3RM0H 1QCPA 3V7TA 1FAKH 1FIWA 2G5VA 4X8UH 1O2LA 2EI6A 2CF9H 4FUFA 1UVPA 3DFLA 1C5UA 4BANB 1FXYA 1OOKB 1GCDA 1JOUB 3JZ2B 1EUFA 4Z6AH 1V2OT 1V2VT 1AHTH 1H1BA 9LPRA 1OP2A 3STJA 4I31A 5FHTA 1UK2A 1W14U 1KTTB 4E7NA 3SO3A 1LHDH 3ESTA 4UFDH 2OC8A 2XCNA 3A86A 1B0FA 2CF8H 1NRRH 2AHME 3PLPA 2HLCA 5HYOA 3ZZ7A 2Z9LA 5T1VA 4DIHH 1S0RA 5DSFA 1N8OB 1FLEE 3E90B 2YNAA 3OEED 4YESB 3P95A 3TPIZ 1W0YH 3ATLA 1NROH 1OWJA 1EJMA 2FI4E 1PJPA 3EE7A 1SPJA 4AGKA 3FKSD 3P70B 3RXKA 2G4TA 1E79D 1PPCE 5DN6D 1EXFA 1QQ4A 2ZF0H 2CN0H 2AGEX 3RXVA 1YCPK 3E16B 2Z9JA 5DP8A 5K0HA 3ELAH 3SV8A 4OS2A 5CHBA 3ODDA 3E6PH 3F1SB 3NRLA 4ZKNU 4XBBA 2BD2A 1NRQH 1NBMD 1ZTLA 3GY6A 1E1QD 2AH4X 4P02A 1NRNH 2AMPA 1MBQA 1ZJDA 4IMQA 3GY5A 2EA3A 1O37A 2XWBI 3P6ZB 1GBBA 3RXDA 2STAE 2ZCLP 4AG1A 1BBRK 3QTOH 1SL3A 1TGCA 1C2EA 2ZNKH 1NM6A 4JCNA 3RXMA 1MTUA 3URCA 1C2GA 2QN5T 1L4DA 2WHXA 4O3UA 1TNLA 4RT1A 2D2DA 1C1RA 2QXGA 3M7UA 4MPUA 2D8WA 4X1SU 2W26A 1SHYA 3Q00A 4NFFA 1P9SA 1GI3A 2GCHF 3GY2A 4MPXA 1V2QT 3U8RH 5GNDA 2BZ6H 2G5NA 2A5KA 4Y10E 1HAGE 3CP7A 1EPTA 3GY3A 1GMDG 2ZEBA 2RDEA 3MNXA 1D3TB 4JZDH 1UVTH 3SJIA 1UW7A 3GCTF 3UWJH 2PTNA 2OK5A 1N6YA 4Y8YA 1QB1A 4NA7A 1NU7B 4D9QA 3RXTA 2SFAA 2ZU1A 1SGFG 3BSQA 2GV6A 3SGAE 1A2CH 1XUGA 4OS6A 5C3NA 1GHAG 3AASA 2R2WU 3A85A 4KGAA 1ELDE 1Y59T 3ENSB 5FAHA 4O9VA 5EIYA 1QR3E 5F8TA 3P8FA 2Y7ZA 3PV5A 1GMDF 1TBRH 4WY3A 5B6LA 1W2KH 2VWLA 2Y80A 1OYTH 4XOJA 2J94A 1RXPA 2GDDA 1O34A 2XC0A 1XKBC 2WV9A 2ZCHP 1NY22 1UVSH 2PR3A 5FPSA 1VGCB 1Z8GA 4FU9A 2OUAA 3FFGA 1GHAF 2Z9KA 1NRPH 2SNWA 3SU5A 4BTTB 5HIZA 3DHKH 4MG3A 1O2QA 1BZXE 1YKTA 5EG4A 2FI3E 2ZP0H 1THRH 2FYRA 2R2MB 2SGFE 1CBWC 4BXSA 1VJAU 2P59A 1HLTH 1SLXB 1C5TA 1QNJA 2ZHEH 4ABAA 1AMHA 1GJ8B 3FP8E 3M3TA 4NSYA 1W7GH 5C0TA 1QURH 1TX6A 3N7EA 2QAAA 4MDSA 1E0FD 1O5EH 2ALPA 3GICB 1LVMA 1G3DA 1O2NA 5C2ZA 3RXGA 1P02A 1C5VA 3D62A 4JYVH 2VGCC 5A0BA 5HXFA 1DOJA 2GJGA 3I29A 1FAXA 1MAYA 4MNYA 4BAKB 1QL8A 3UREA 4IC6A 3RXPA 5LPEA 4DT7B 4XD7D 3I78A 1DE7H 4A1XA 1LO6A 1GJBB 1C1MA 1NZQH 4NZLA 3AAVA 4JZIA 1EOJA 1HRTH 3BG4C 2VWMA 4K60A 4Y11E 3LGTA 1HAXB 2ZU2A 1O3LA 4WXVA 3T27A 1K9OE 4K8YA 1P3CA 3GYMA 5KEDA 2WSSD 1J8AA 2FESH 5FBIA 1MMJN 1J15A 1TNHA 2ZHDA 3MQKC 1JMOH 4I8HA 5F53A 1G30B 1K2I1 3R0FA 5E2PA 2F83A 4JZEH 3VGCB 2VU8E 1Q31A 1TIOA 4OS7A 2ZWLH 2PUQH 1DITH 2FM2A 2F4LA 1HUTH 1AZZA 4X6NA 2BD4A 5T6GA 2PLXA 1NFYA 5EPNA 1ESBA 4Y7AA 4RT0A 1QFKH 1Q2WA 1LCYA 3WWFA 3RXAA 3RMLH 4MQAA 5A0AE 4NCYA 5DP7A 1HAOH 1WBGB 3MFJA 5C5NA 4Q7ZA 1BTZA 1Z1IA 2SGAA 3R3GB 2XTTB 1V2ST 1FJSA 4MPWA 4X2WA 3GDVA 2A4GA 3RXOA 1TMTH 2BQ6B 3OY5U 2PW8H 2ZECA 2BB4A 1TNIA 1C5WB 3QGJA 4HI3A 4BAQB 2PKAB 1K1JA 4ISOA 1GBTA 3SUDA 4UFEH 1MKXH 2Y82A 2GD4B 2VIQA 5IYTA 3SJ8A 1GBKA 2ZHFH 1XVMA 1SKYE 2BLVA 1D4PB 4AYYB 1W12U 1VGCC 1MKWK 3V13A 3FOAA 3AK5A 1ZTJA 2A32A 1PQ5A 1GVKB 4WMEA 1TBZH 1SR5C 1OP0A 1C2LA 5CMXH 1XXDA 5EQSA 2CGAA 2AFQB 3BEUA 1ZRBA 1K1NA 3EYDA 2Y81A 2ZZUH 2Q6FA 1TRYA 3PO1B 1A0JA 3UUZA 3SHAH 3BF6H 3SU0A 3GOVB 5C1UA 1AD8H 4JMYA 1ANDA 1QRWA 4RI0A 1L1NA 3SBKA 3ZZ9A 1BMLA 1GPZA 2HVXA 1QZ8A 1TNKA 1SGQE 3LT3A 3VXFH 4TPIZ 4LOYH 1P01A 1CGJE 1O2HA 1O2MA 2ZC9H 3TH3H 1O2KA 4LZ4B 1W8BH 4P00A 1W3CA 3EE0B 4DIIH 3OEHD 6GCHF 2VWNA 1BQYA 1THSH 1S83A 3NKKA 2J98A 2K8IA 1GL1A 1UTJA 2KCAA 5EOKA 1AIXH 1TRNA 2A2QH 1BRAA 2PSYA 3VB6A 1S82A 3MH7A 4RKOB 1V2WT 2ZQ2A 1HJAB 1WYKA 1AFEH 1HJ8A 1GG6B 4ZKRU 1EAIA 2AMDA 2QCYA 5C0UA 1QBVH 2OP9A 3F9FA 1GVZA 2LNCA 1GGDB 2A1DB 2FIRH 5E0HA 1P09A 5HMAA 1UTNA 1UCYE 2RG3A 4YT7H 1A61H 2THFB 3VGCC 1O0DH 3U69H 1TWXB 1FPCH 1O3IA 3RP2A 3Q3YA 1UTQA 4X6OA 1O5BB 2BXTH 7KMEH 1EJNA 4YO9A 3LC3A 3UNRA 1ELGA 1C2JA 1HAIH 1IQJA 3UY9A 4K1SA 3A83A 2Q1JA 3GS9A 1DICA 3LJOA 2GDEH 2TGDA 2VBCA 5BRRE 1MH0A 1O3FA 3SNCA 2VIOA 4A7IB 1YPGH 4A6LA 1TX8A 2R0KA 2PKSC 3I77A 4O03A 3TLOA 2O9QA 1G9IE 2EI8A 4FOUC 1C5ZB 1O2YA 1GHWH 6CHAC 1GHZA 1AVXA 1HPGA 5EU8A 1MU6B 1ZSJA 1O3PB 2B5TB 4I86A 3O8DA 1ID5H 1LHGH 1CU1A 1YPMH 3FZDA 3ZYEA 1V2UT 4JZ1A 5A2MH 1SVPA 1TA2A 1X7AC 4GSOA 1GI0A 1XX9A 3HATH 1EAXA 4FXGH 2XC5A 1O31A 4SGAE 1V2KT 3K6ZA 1O2TA 1TLDA 1B5GH 1HXFH 4K5ZA 1TB6H 1BMNH 4GLYA 1FN8A 3RXFA 1ZOMA 4ABEA 5HIYA 3LH1A 5DO4H 1Z71A 1AY6H 3PMJA 1C5OH 3QX5H 4HGCA 1C4U2 2BDBA 4B6EA 2FS8A 3LPRA 1YPHE 1WU1A 1AWFH 1YLDA 3F3BA 1GI5A 2GCTB 1GDNA 1CA0B 1ETTH 1S6HA 3Q77A 4ZHMU 3PO1C 1UTMA 2PSXA 1O3MA 2AMQA 1ETRH 2BDHA 1CGHA 1PPGE 3MOCA 1SLVB 2NU2E 2ANYA 4TY6A 3PTNA 1BBRH 4KTUA 2F9UA 1Z8JB 3PLBA 1RTKA 2FZZA 1ELBA 1IQLA 2KAIA 3U8TH 3QO6A 1IQMA 4ESTE 1Y3XA 1LPZB 2IOTA 4O97A 4XSKU 2ZGCA 1MCTA 1C2KA 1O36A 1SFIA 1CGIE 3QK1A 4H4FA 3W1EA 8GCHG 1NTPA 1ELCA 1YP9A 1FY1A 1ANCA 1EP6A 5DJ7A 2ZPSA 1TALA 2Z6BD 1SLUB 1J16A 1YY3A 1AQ7A 3P92A 1A3BH 2VWOA 1HJAC 3D49H 3VFEA 3A87A 3SNAA 1ETSH 1HB0B 1HJ9A 4DT4A 2AIPA 4Q63A 5ESBA 1WUNH 4DW2U 3SNBA 1HAYB 1NRSH 1P2MA 3BTWE 4FUJA 2BZAA 4X1NU 4BTUB 1YM0A 1GBDA 1TX7A 1RJXB 2R9PA 1P2KA 4FVDA 4B2CA 1HCGA 4ZUHA 1C2MA 5PTPA 8GCHF 4A1VA 1YCPM 5EXMA 2OD3B 1IQFA 1XMNB 1IAUA 3KQBA 2P8OC 4YLQH 3BTHE 1VJ9U 3LGYA 3PMBB 3O8BA 4IS5A 2VINA 1JXPA 1SQOA 1HGTH 3NPSA 1TOMH 1TGTA 2TBSA 2BD8A 3RLWH 1ABIH 5LPRA 1MCVA 1O5DH 4FUHA 4X1PU 1GHYH 1H8IH 2VH0A 3S9CA 3UPEA 3MH5A 1IQKA 6ESTA 5C5OA 1XM1A 4YLUA 3DT0H 3ATMA 3TNSA 1OKXA 1SG8B 1QJ6B 1RIWC 2JJ2D 1Z1JA 2F9NA 3H09A 2Z3DA 1O39A 1FZZA 3ZZCA 3A84A 4TYDA 2BY5X 4R8TB 1FMGA 3AW1A 5FXLA 1W13U 4NIWA 2XCFA 2LELA 1XUKA 4A1TA 2IN2A 1BTWA 3SN8A 1MQ5A 3RUOA 5A09A 3MU0A 1B0EA 5TJXA 1GI1A 1F0TA 3QZRA 2A0QB 3OX7U 3LH3A 4F4OC 1QL7A 1SQAA 3OTJE 1O38A 5C67A 3F68H 2XNDD 1Y5UT 2JH0D 2ODPA 1FY8E 1MZDA 4U01A 4I7YH 4ABJA 4CRCA 1T31A 4AFSA 2ZO3H 1UJ1A 5DPAA 3MU8A 2P3FH 2B8OH 3ZYDA 1AB9C 1O5AB 4NFEA 3TVJB 2FO9A 1HBTH 4AFZA 1HFDA 1O3OA 1SSXA 1O30A 3IG6B 1SC8U 2ANMH 4FU8A 1GBMA 1JIMA 1C1QA 3RMNH 4FUEA 4OGXA 3TU7H 1MUEB 4O3TA 1O2XA 1TBQH 2C8ZB 1UO6A 3PRBA 4Y6DA 1YLNA 1H9IE 2L6OA 1L4ZA 2ZDLA 2ZTYA 3RLYH 2HPPH 1LKAA 1H4WA 1ANBA 1HNEE 1QBOA 1NFUA 1ZRKA 2J97A 4Y7BA 3BTDE 4CRDA 1EP5A 5AHGH 3PWCA 3QZQA 1CBWB 1T4UH 1BJVA 2J2UA 1MTWA 2ZFRH 2KCPA 1W0JD 4KTCA 3ZZ5A 1AVGH 1DM4B 1D3DB 2JJ1D 4ABGA 1GJDB 4UEHH 4K69A 3RU4T 2BY7X 3OFND 5B6OA 2FDAA 1EB1H 5A8XA 3A7WA 3KQEA 2JIZD 1HV7A 1RRKA 1SGTA 1Y3WA 1YYY1 2VGCB 3RU4E 2OC0A 3F9GA 3D23A 1FPHH 1V2PT 4IN2A 2ZDNA 5C94A 1T8LA 1Z8IB 1ZHMA 2GCHG 2QXHA 3T29A 5EW2H 4DCDA 4ABBA 2Z7FE 1GBCA 1ZMNA 4MVNA 1LHCH 5FL7D 4GCHF 1K1IA 2OXSA 3HGPA 3BG4B 3FANA 4J1YA 3GCTG 1MKWH 2HNTF 4PROA 2W3KA 1KYNA 3SU1A 2ANKH 2Y5FA 4RSPA 4Y79A 3RXEA 3M35A 4XE4A 1IOEA 2NU0E 3DD2H 1WCZA 1PQAA 1AUJA 4ZMAH 2PUXB 1F7ZA 5J4QA 3HGNA 1SOZA 3AVZA 1A46H 3CNRA 1XKAC 2PGQB 1C2IA 5GWZA 5TCAA 1XUJA 2ZU5A 4SGBE 3QWCH 1Y8TA 1C2HA 1E37B 1UHBA 5ESTE 1ELAA 4X6PA 4ISHH 3IITA 5EJLA 1CE5A 1PPZA 3TIUA 3S0NA 3ZIAD 3QLPH 1SGNE 1HIAA 3RXBA 1ZR0A 1C2DA 3RXHA 2ODYB 1CT4E 4CH8B 2PFEA 2XNIA 1GI2A 1WXRA 3UQVA 2A4QA 3MHWU 4AFUA 3SU6A 1BTHH 2GX4A 4OM9A 3O8RA 1TOCB 1J14A 1SI5H 3KGPA 2C3SA 1O3AA 3N99A 4Y8XA 1BCUH 3SOSA 2HRVA 2FOGA 3A7ZA 4IGDA 5LGOA 1TFXA 1FIZA 2H9HA 3EAJA 2BVRH 1O3GA 1OHHD 1BB0B 1TGSZ 2XBWA 1K21H 2H9EH 5CDFE 2BD9A 1S6FA 2BMGB 1G36A 2ZGXH 2TRMA 1UTPA 3EQ0H 3BTKE
chains in the Genus database with same CATH topology
3MO9A 1DXPA 2YOLA 3ATWA 1O2IA 3KN2A 5JBBS 5GCHF 1YGCH 3Q3KA 1WQSA 1O2PA 1IHSH 3GY4A 5A0CA 5FX5A 4X2VA 3UWIA 3A81A 2VIPA 1C1SA 1WTGH 3UR6A 4AB9A 3LGWA 2PHBA 2XRCA 4NA9H 2VIDA 2RA0A 1BRUP 3Q3XA 3B23B 1KXCA 3LC5A 1LMWB 5HM9A 1PYTC 5L6NH 2WV4A 3ZZ8A 1UK4A 2FOHA 3K65B 1FV9A 4WMFA 1MTNC 1TGBA 2GP9B 3ITIA 1P12E 2C4FH 2ZFPH 1HDTH 3S7KB 2A4OA 5FPYA 2TIOA 2WYGA 1OSSA 3BV9B 1P0SH 1GI6A 2Z94A 4MTBA 5FCKA 4ZHLU 2ZU3A 3A89A 1V2NT 1ZZZA 2JKHA 2W3IA 5FBEA 3P8OA 3M61U 2NU4E 2C8XB 2GKVE 1LKBA 2AGIX 3T2NA 4IBLH 4A92A 4A5TS 1KLIH 2ZA5A 4I33A 3FP6E 1ZHPA 2JETC 1DDJA 1T32A 1W7XH 1E38B 5ABWA 3NZIA 3RDZA 2FOMB 2QF0A 1BDAA 3QUMP 3RMMH 4NZQA 2C90B 5C20A 4YT6H 5EODA 4UE7H 3SGQE 4CHAC 1YPJH 2I6SA 2VJ1A 4TWWA 3EA8A 5FX6A 3P8GA 1TRMA 2P95A 2UUJB 1Z7KA 2FP7B 2ZDKA 1NESE 4Y0ZE 4FU7A 5K7RA 2BM2A 1BOQA 4ZKOU 4Q7YA 4HTCH 4OS4A 1K1OA 2FEQH 3ZZDA 2RDLA 2WPJS 2SGDE 4R0IA 3MTYA 1ZGIA 4AZ2B 3A7TA 1U6QA 1ZMLA 4ZROA 2PKSB 2UUYA 3KL6A 1C5QA 1ELTA 3UFAA 4IMZA 6CHAB 1GBIA 5DP6A 2F9VA 1J9CH 2ZG0H 1DWBH 2A31A 1P11E 1SGCA 1HYLA 1GJ7B 1E34B 1QTFA 5JPMH 3ZVGA 3RMOH 1MAXA 1WSSH 2GZ7A 5A8YA 1LPGB 1GVLA 2ZQ1A 4FUCA 2GTBA 1ZYOA 2RCEA 2AS9A 2H5CA 2J95A 1O3NA 2GGVB 2EEKA 1D6WA 2J92A 2FOCA 5GDSH 4H6TA 1NO9H 1S81A 4CH2B 3LJJA 1QIXB 1K1MA 1XUFA 1Y3YA 3BEFB 3B9FH 1ELVA 1KXAA 1C1NA 1YBWA 2GVFA 3LU9B 1M9UA 1HAVB 2BLWA 4I8LA 4XBDA 3TJOA 1Z8RA 3MH4A 3NXPA 3GY7A 4GHQA 3QDZB 4NIYA 1AFQC 5FPTA 3F6UH 4NWKA 3RU4D 1A0LA 5L2YH 2FX4A 3MWIU 2HPQH 3PLKA 4LK4A 1ELEE 1SQTA 4BXWA 3L33A 4MNXA 5IDKA 5E2OA 2XW9A 2FWWA 1GJ9B 3V0XA 4XDEA 3STIA 5L2ZH 3U1JB 2AIQA 1ABJH 2XWAA 4AFQA 1DWCH 1O2WA 4K3JA 3LIWA 3ZVDA 1C4Y2 1PQ8A 3A8AA 1TNJA 5EPYA 1C1TA 1DY8A 4ZH8A 4M7GA 1OP8A 2P3TB 4ZKSU 1L0ZA 1TMBH 3RXJA 1V2TT 3ZVAA 1LQDB 3T5FH 2P8OB 3AW0A 3GY8A 1BRBE 1GBJA 1CHGA 6LPRA 3BEIB 3S9BA 1V2MT 3TITA 1F5LA 2ZGHA 1DSUA 1AVWA 1BTUA 1NPMA 4WF8A 1PPBH 1TQ0B 1F0RA 2OC7A 1JWTA 3FP7E 3VEQB 1EATA 2FLRH 1LHFH 4TY7A 1AGJA 1O32A 3RC6A 1CQQA 2BYAX 2V3HH 5E0JA 3M7TA 7GCHF 3TGJE 4CREA 4AORA 5G4BA 3FVFB 2AEIH 1G2LA 1Q3XA 3CS0A 1W0ZU 2ZPRA 1MD8A 2JH5D 3MNSA 1RIWB 3TK9A 2Z3EA 2C8YB 1DWDH 1NC6A 5I46H 1ZPBA 2A4RA 4YM9A 1XVOA 1S84A 3V12A 4DY7B 4NIXA 4BOHA 4CRGA 2ALVA 1JRTA 2BTCE 1C9TA 1AUTC 1BUIA 4CBOA 1UCYK 1IQHA 3HPTB 2I6QA 3MNBA 1E36B 1QB6A 4NSVA 3H7OA 1SOTA 2VVVA 3M3SA 3TNTA 4K1EA 1QJ7B 5DP3A 1O3EA 3H7TA 1JRSA 1MTVA 2OINA 1GHBF 3ATIA 2A7HA 1KTSB 3SI4H 2ZDMA 5JDUB 2SNVA 2TGPZ 2CHAC 1DANH 1AB9B 1QRZA 1TAWA 2WV5A 3RXRA 4INHA 1F2SE 2J34A 1CHOF 3GISB 4JK6A 5CHAB 1TNGA 3HK3B 3BIVH 1KLJH 3NCLA 3SUGA 5F8ZA 1IQEA 1O2VA 1P2NA 3RXCA 1UVUH 3G01A 3SI3H 2CV3A 4ABHA 5F03A 1SGYE 1O3DA 2BDCA 4GVUA 4X8TH 5J4SA 5C1XA 2WYJA 1GCTC 3A80A 5A8ZA 1A0HB 3FAOA 1ZJKA 2ZFQH 1GBAA 5T6DA 1MU8B 2OBOA 2DE8A 2EI7A 3PV4A 2W7UA 2NU1E 1YPKH 4LXBH 5AFZH 4KELA 1TABE 3L6PA 1P8VC 3SU4A 3A7YA 5AF9H 1RS0A 1ARBA 5T6FA 4AX9H 2P3UB 3QN7A 4F49A 2VH6A 3Q76A 4J2YB 4MNVA 3KIDU 1BHXF 5TCCA 1HAPH 2ZFFH 3SU2A 4ZAEA 1DLKB 1TPOA 3D65E 1DY9A 1K22H 1EOLA 1GBFA 1GDQA 5CE1A 1DFPA 1QHRB 2FLBH 1ORFA 1T8OA 4IN1A 1BITA 1P05A 4D76A 3A88A 4Q80A 1YPEH 1C9PA 3RC4A 1IHTH 3C1KA 3BTTE 1A4WH 2ZTXA 1O3CA 3H5CB 2WPLS 3MYWA 5JB8S 3B8JA 4NIVA 2Z9GA 3ZZ3A 3ODFA 2OTVA 3BTGE 2AERH 4TPYA 3M37A 4I8JA 2SGEE 3E8LA 1CO7E 2Q6GA 1P03A 2ODQA 1ACBE 1QQUA 4U32A 1O5GH 4I8GA 1C5NH 4H6SB 4Y76A 3VB4A 3W94A 2PKAA 2FOAA 4DGJA 3TJUA 5GIBA 3ZZBA 4YOGA 1DSTA 1BA8B 3NK8A 2F9OA 1G3EA 5L30H 1AWHB 2GMTC 2HWLB 1CVWH 2BOKA 3PMAB 4DOQA 3M36A 1EPTC 1EAWA 1OWEA 2UUKB 4JZFH 4I32A 4BNRA 3LGUA 2HNTC 1EKBB 8KME2 3OYPA 1OWDA 3VXEH 1FY3A 4B75A 2BX3A 3SQHE 1AI8H 3EGKH 1GBEA 3MI4A 1JBUH 1D3PB 4B76A 1ESTA 4CRFA 1Y3VA 1OWKA 4OS5A 4X8VH 4NA8A 5CHAC 1P57B 3PTBA 2DUCA 4BAMB 4X0WU 1P10A 1VR1H 2D26C 1BIOA 3MU4A 1DUEA 2H2ZA 1LVYA 2D1JA 4K2YA 4WMDA 1C2FA 5EXNA 4Y0YE 4E06H 2WPHS 1O2RA 2R3YA 1A5GH 2FTMA 4DURA 1ZLRA 2HOBA 3SV6A 3M5LA 4DG4A 5JBTA 1BBRE 1NT1A 1O3JA 1TONA 3P17H 3SNEA 5DP9A 2K1QA 1A3EH 1P2IA 3SORA 5GXPA 4GCHG 1F0SA 1C1VH 2A7JA 4HZHA 1OXGA 3KQDA 2FI5E 2H6MA 1ZPZA 2ZPQA 1W11U 4Y8ZA 1C5YB 1NN6A 3A82A 1MTNB 3L3TA 3GCHC 4X2YA 1DPOA 2CMYA 1C5XB 1QA7A 3E91A 2BY9X 1VCPA 1IQIA 2IJOB 1OWIA 4U30A 3SZNA 4I8KA 1V6DA 1MQ6A 3PB1E 1SBWA 1VZQH 2OQUA 1O35A 4KKDA 1N1LA 4X2XA 1PPHE 2O8WA 1Z6EA 1ZPCA 2ASUB 2FODA 1K1PA 1A5HA 1RGQA 2O8UA 4ABFA 1W10U 1UTKA 2VIVA 2F3CE 2B0FA 2QXIA 3AAUA 1DS2E 2Y6TA 1EASA 2JETB 9ESTA 2JH6D 1OX1A 2BDYA 2VVUA 3U9AH 1ARCA 4H42U 4CHAB 2V3OH 3ZVBA 3RXUA 3SUEA 4RKJB 4BAHB 4FUDA 3NWUA 3LONA 4YZUA 1C1WH 4D7FA 2F91A 2ZGJA 4ZXYH 2QXJA 4DJZB 1TYNA 3ZZ4A 3ZVFA 1CT2E 6GCHG 1GI7B 4X8SH 1ZSKA 5JB9S 1S0QA 1EZSC 1KLTA 2ZTZA 2G52A 2VIWA 2NWNA 3GDUA 4Z0KA 1C1OA 3MMGA 3SQEE 1G37A 5GCHG 1BMAA 1KDQB 2ZHQH 1O2GH 1GL0E 3UOUA 3JZ1B 1TA6A 3T62A 3M5OA 5F8XA 1EX3A 3MH6A 1K1LA 1ZTKA 1GJCB 3BTEE 2FOFA 2A45B 4ZHAA 1P2OA 3SW2B 2ZU4A 1IQGA 1FN6A 2AGGX 2J38A 1GI9B 2QYIA 1Y3UA 2HALA 5EGMA 1ZGVA 8ESTE 3A7VA 3K9XB 3ZZAA 1KXFA 3EA7A 2W7SA 2A7CA 2A5IA 1ANEA 4WH6A 2RA3A 1O5FH 3MNCA 4Q7XA 1C5MD 2TPIZ 2BD5A 1FI8A 3ZV8A 2QF3A 2QV1A 1V2RT 4KTSA 4GUXA 1GHVH 1OWHA 5AFYH 1YF4A 4AB8A 1P06A 7LPRA 3A8CA 1FQ3A 4UONA 2WINI 1AFQB 1RFNA 1N8OC 3K2UA 1THPB 1K28D 1SGFA 1PPFE 1KXDA 3A8DA 1KY9A 4QT8C 1O3BA 2BVXH 3SNDA 3UOPA 4CR5A 2KAIB 3M5MA 1AKSB 5FCRA 1JIRA 1S85A 1WTHD 2R0LA 2Z9IA 1XXFA 4LZ1H 1GJ6A 4MLFB 2HGTH 5GPIB 1QGFA 3KCGH 3HKIB 3E1XB 2BX4A 1D6RA 1V2LT 2J4IA 1ZSLA 2BDIA 3SHCH 4JYUH 3ZVEA 4WJG2 4U2WA 4HFPB 3HK6B 1P2QA 1UCYH 2O8LA 1VITG 1RTFB 1D9IA 4D7GA 1O3KA 3PROA 1C5SA 3VB5A 4Y71A 3K6YA 1VCWA 4X1RU 4IW4E 2EC9H 4RN6A 2ZFTA 1S5SA 4THNH 1VCQA 3FZZA 3MO6A 3TK6A 2BLOA 2OBQA 2W5EA 3M7QA 4ZXXH 4D8NA 1TMUH 1GJAB 2OCVB 3KEEA 2P16A 3DFJA 1O3HA 1MZAA 2LPRA 2XXLA 2SGPE 3ZVCA 1VITF 4B2BA 1GMCG 1C5PA 1CA8B 2H9TH 3MO3A 1KXBA 1QBNA 1QL9A 3HKJB 1LDTT 1RD3B 1H9HE 2B9LA 1BHXB 4BTIB 3ATKA 2XYAA 1WOFA 3RC5A 1V3XA 2R3UA 1FY4A 4GAWA 3UIRA 1O2SA 3CS7A 2C8WB 3N7OA 2FS9A 1WV7H 4FUIA 2ZDVH 2F9BH 1QA0A 2PTCE 1O2JA 1C4V2 2PGBB 5E0GA 2G00A 3TJVA 4XBCA 1GMCF 2GZ9A 3E3TA 2QY0B 1SHHB 1EQ9A 4OGYA 1GDUA 1LQEA 3NUMA 1PQ7A 2PWXA 1PFXC 5JBCS 1BRCE 1TGNA 2VB0A 5JYIA 2FX6A 1H8DH 1A5IA 3EA9A 5LPFA 1BTPA 1UVOA 3KNXA 1P04A 3QGNB 1ESAA 3SJ9A 1WAYB 5AVDA 2YNBA 1XUIA 2BXUH 4AYVB 2BQ7B 2OLGA 5DK1A 3TH4H 1TE0A 4FUBA 3LDXH 2G51A 1D3QB 2FYQA 2UUFB 2CHAB 3UQOA 1CSOE 2BDGA 2P94A 5ETXA 3RXQA 4E05H 1SLWB 3VB3A 3UR9A 1EZXC 5T3HA 4AN7A 2V0BA 3E0NB 3W95A 2G4UA 3U98H 1ELFA 5DKMA 3BG8A 4GPGA 5DGJA 4AG2A 2BHGA 1LHEH 1SGIB 1NFWA 2WPIS 3E0PB 5C1YA 3BN9A 1OYQA 1GCTB 2ILNA 2ZDAH 1OS8A 3PMHB 2OC1A 2Y7XA 1GI4A 3KQCA 1F5KU 1T7CA 1Z6JH 1FY5A 3M5NA 4MNWA 4KP0A 3URDA 4WH8A 3A7XA 1YLCA 3UNQA 4ABDA 3QTVH 1CT0E 5EQQA 1NU9A 4UD9H 1AN1E 3BTQE 1UTLM 2G81E 2GV7A 1C1UH 2C93B 4D9RA 2ESTE 2NU3E 1INCA 4AOQA 7GCHG 3F9EA 4AGJA 1HAHH 1N6XA 4VGCB 2O8MA 2BLQA 1LTOA 4NG9H 3LGVA 4B1TA 1EZQA 5DG6A 4YOJA 3GCNA 1KIGH 1AO5A 1A7SA 3SV7A 5SGAE 1DUAA 1L1JA 2VNTA 1QJ1B 1NFXA 3F9HA 1SGEE 4B74A 4GHTA 1O2OA 3KF2A 1O5CB 4WXIA 3O8CA 1L2EA 1YC0A 1UTOA 1AZ8A 7ESTE 5EW1H 1O2ZA 2XC4A 4NWLA 1TPSA 4WVPE 3TH2H 3OSYA 1GMHG 1EAUA 3S69A 3SU3A 4B73A 1G3BA 2XBXA 3GYLB 3SV2H 1GWAA 2FOBA 1V2JT 2UWLA 1GBLA 1EZUC 2BQWB 2WPKS 2TGAA 8LPRA 1IQNA 1KDQA 5EXLA 1GBHA 2GZ8A 1GHBG 4JK5A 2BD3A 3RXIA 1L1GA 3SV9A 1HXEH 2P93A 2GMTB 5BPEA 1C5RA 1HAZB 1O2UA 1CHOG 1NS3A 3PM3A 2BY8X 1EPTB 2VVCA 1SGRE 2ZIQH 1AE8H 2H5DA 4YOIA 1UHBB 5GJ4B 1GMHF 3UTUH 1HIAB 2FOEA 1ZMJA 3TGIE 1EB2A 2SGQE 1TQ7B 1DVAH 1SB1H 1YCPH 4UFGH 4FUGA 1TPAE 4IC5A 1PPEE 1YPHC 1G2MA 4ISNA 1SFQB 1T4VH 3BTME 1FNIA 1PYTD 2FPZA 3WY8A 3U1IB 1FDPA 4OS1A 1AU8A 1KXEA 4ABIA 4B71A 3SJKA 2BOHB 4CR9A 1DX5M 2O8TA 3S9AA 1E35B 5JBAS 3RXSA 1BJUA 4ISLA 4CRBA 1DT2A 2FXRA 2ANWA 2H1UA 3S7HB 4YTAA 1TPPA 4X1QU 1FONA 4INKA 4E7RG 1P9UA 3SJOA 2B7DH 3DA9B 3IWMA 1AKSA 1GHXH 3T26A 1F92A 4WWYA 3V3MA 3EDXB 3TGKE 3OY6U 2G8TA 2WUCA 1LVOA 2M5TA 1OPHB 2ZCKP 4DVAU 2J9NA 2UWPA 4MPVA 1UK3A 1BTYA 3T25A 3MU1A 4K8BA 1MKXK