1JIMA

Stereospecific reaction of 3-methoxy-4-chloro-7-aminoisocoumarin with crystalline porcine pancreatic elastase
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(serine proteinase)
molecule keywords PORCINE PANCREATIC ELASTASE
publication title Stereospecific Reaction of 3-Methoxy-4-Chloro-7-Aminoisocoumarin with Crystalline Porcine Pancreatic Elastase
pubmed rcsb
source organism Sus scrofa domestica
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1993-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1jimA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1jimA01
3ZZAA 3A87A 3ZVGA 6CHAB 2JH6D 5FX6A 1W7XH 3F9HA 3RXEA 4X2WA 2XW9A 2V35A 3M3SA 3SV2H 1GHZA 1N1LA 1NFWA 2GVFA 4NA8A 4THNH 3ZVCA 2WYGA 2A2XH 1QHRB 1TX7A 2ZPRA 3Q3XA 4CR9A 1FJSA 1Y3UA 2J95A 1BRCE 1TWXB 4CRAA 1O37A 1PYTC 3BTFE 3M36A 3K2UA 3U9AH 4ABAA 2A1DB 3PV4A 1Z1JA 1SGEE 3MMGA 1JXPA 1P06A 1SLWB 2ZFRH 4K1EA 5LH8A 3Q00A 2ZIQH 1GJ4H 4DOQA 3PMAB 4WMFA 4LZ1H 3SU0A 1SOZA 1BB0B 4XFQA 4AN7A 1AD8H 1C2LA 1O3NA 4K3JA 1G2MA 4Y6DA 1V2KT 1K1OA 4O97A 3MU1A 1HAHH 2PKAB 2Y6TA 5JBTA 1QY6A 1OSSA 1LDTT 1HAVA 1LKAA 1ANDA 1FY1A 2GP9B 1INCA 3TITA 2A4GA 1C2EA 3MO3A 3A8CA 1VITF 3ZYEA 1Y5UT 1GI9B 2A0QB 1XUHA 2D1JA 2BQ6B 1C1MA 2YNBA 4H4FA 1K28D 2JKHA 3S0NA 1GBHA 3TK9A 3RXPA 2A45B 1C2KA 1OWJA 5EW1H 3QLPH 5FPYA 1YPLH 1BMLA 2SGAA 2ZU2A 1EZSC 1P2IA 2QC2A 1BTHH 4RSPA 1B7XB 1GMCG 1O3MA 3U8RH 1GJ5H 1BJUA 5C20A 3L33A 4GVUA 2RDLA 1GHAG 2DUCA 2C8ZB 1SSXA 1A1RA 2Z3DA 3SQEE 1S0QA 3EDXB 1O5DH 1DY9A 1GI0A 2EEKA 3V13A 3MNCA 2OLGA 3BTME 1CGJE 4FU8A 3SOSA 1C2HA 1EJNA 4AFZA 1C2DA 4H6TA 1UJ1A 2O9QA 5JYIA 4Y8XA 1UHBA 3Q3YA 3UWJH 1WAYB 4XDEA 1T8OA 2QCYA 1LHCH 3RXBA 3STIA 2F9UA 1FDPA 1S83A 2BLQA 2GV7A 4DG4A 3RXFA 3MH5A 3P6ZB 2ALPA 4XOJA 2P94A 3H5CB 5C5OA 9LPRA 2W5EA 1O2YA 1YCPH 3D62A 4KTSA 2SNWA 1KTTB 4B2CA 4B76A 1H4WA 1SI5H 2BVRH 3A7TA 2GGVB 3E90B 4FUDA 1A4WH 1CSOE 3ZVEA 1YKTA 3PO1C 5FX5A 4ABBA 2OD3B 1P9SA 1AFEH 3BTEE 1KLJH 1FONA 3AW1A 5DP9A 2A7JA 5A0BA 2ZTXA 2GKVE 1J17T 1SQOA 4O03A 2PSXA 2ZFFH 5A09A 1C1WH 1F0TA 1IQKA 3HATH 1HAXB 1S81A 2ZFTA 2ZP0H 1C5RA 4ZKNU 4NG9H 2EC9H 5HXFA 1O3EA 5DP7A 1A61H 1C1RA 3ZZ9A 4VGCC 1QJ7B 1KXDA 2ZU4A 1AWHB 1ZSKA 1O5BB 1C5PA 1PQ7A 3Q77A 5EOKA 1OOKB 1Z71A 2SGDE 2GX4A 1KXAA 1KIGH 2ZGHA 4I8GA 2XBYA 2Z6BD 5EG4A 4ABGA 1UTQA 1GI5A 4UD9H 3A83A 1EPTB 2BY8X 1KLIH 1A2CH 1NU9A 3PB1E 1A5HA 1EAUA 1GHYH 1OS8A 4DVAU 2NU4E 3VB6A 2PUQH 2J92A 3HK6B 4JZFH 3E8LA 1MBQA 1FLEE 3F9EA 1KXEA 1TPSA 1IQJA 1BIOA 3AASA 1AB9B 2BDIA 1SLUB 1A5GH 2FTLE 2O8WA 3NKKA 2IPHA 2JETC 2Z3EA 3JZ1B 1O31A 5HM2A 2G8TA 1QL8A 1BRUP 1LO6A 3U8OH 3MH7A 3SNDA 3SNBA 3VB7A 4U32A 1N8OC 3RLWH 2A2QH 3LGVA 4A1VA 3SUEA 3UREA 3LJOA 3TK6A 2OC0A 2R2MB 2FYQA 3BTHE 3LT3A 5JDUB 3QTVH 1K1PA 1MU6B 4CBOA 2HLCA 1ANEA 1BBRE 4FUHA 4TWWA 4WXVA 4WH8A 2ULLA 2ZA5A 3A8DA 2ASUB 1L0ZA 3M37A 4Y71A 1AGJA 1CA0C 1MTUA 1B0EA 3SBKA 1MAYA 2QIQA 1J14A 1C5YB 2CHAB 5EQQA 3SU3A 4FUIA 4WWYA 4D7GA 4UFFH 1O5AB 1O3KA 3V3MA 1BJVA 1V2PT 1IAUA 1GHAF 1ZRBA 7GCHF 1GBAA 2J2UA 1ZPBA 1ANCA 1AE8H 2ZCLP 4K60A 1WSSH 4Z6AH 3S9CA 1GL1A 1O3FA 3A8BA 2EA3A 3P8OA 1VJAU 2CN0H 4RN6A 1DM4B 1P2OA 1EOLA 1G3CA 4UFEH 1G3EA 1QIXB 5JBBS 4UFDH 1QBOA 2UWLA 3TH3H 2FS9A 2XRCA 3AAUA 5AFZH 5FCKA 1O2QA 1GBFA 3EGKH 2UUYA 4M7GA 1P9UA 1A0LA 2FDAA 3PTBA 1E38B 4OGXA 1V3XA 2A4RA 4AFQA 4AG2A 1SOTA 1X7AC 2PTNA 1SG8B 1O3HA 1AU8A 1TQ0B 1AFQB 2A4QA 2DE9A 2W3KA 1KYNA 4GUXA 2ZO3H 2ODQA 3PYHA 5HMAA 1XUGA 2BX3A 2VIPA 1MQ5A 3SUGA 4KGAA 1O2WA 6GCHG 1TNLA 2G5VA 1MCTA 4JYTA 1EQ9A 3ATWA 2WPKS 2QAAA 2Z9LA 4R0IA 2BVSH 1JRSA 1K22H 1YLCA 1SGTA 3TJVA 5JB8S 3UY9A 1GBIA 3F1SB 3HK3B 1MD8A 1P0SH 4K8BA 5A8YA 4Q7YA 2WUCA 5C1YA 1SGNE 3A89A 4UDWH 2Y5HA 2BXTH 2PLXA 2BLOA 2FESH 2H5CA 1A5IA 3ODFA 1FPHH 3SJKA 1AWFH 1C4V2 1HJAC 5A8ZA 3DD2H 1TALA 4NIVA 4I8KA 1YBWA 1D6RA 2H2ZA 5EXNA 5GJ4B 1SGCA 1VR1H 4Y10E 2A32A 1C1SA 1F5RA 4JZDH 4MDSA 5FCRA 3ODDA 1RD3B 1HXEH 1E36B 1GL0E 3Q76A 2R0KA 2EI8A 5AVDA 4A7IB 1OWDA 5DK1A 4ZKOU 2BVXH 1Z8JB 4X6OA 1HAOH 3PLBA 3A7XA 3KIDU 1LTOA 1O3PB 5EQRA 1TOMH 1YCPK 1CT2E 2HNTE 2ILNA 2FOBA 2AGGX 3ESTA 2A7HA 1SLVB 4CREA 1NESE 3URCA 3SV9A 1Z8GA 1A0JA 1ZJDA 3RMNH 3L6PA 1Q2WA 4Y79A 3PROA 1C1QA 1VGCC 2P3UB 3NWUA 2ZU3A 3ZV8A 4ZUHA 4H42U 2F91A 3ZZDA 1NC6A 1L4DA 3PMBB 1DANH 1O34A 1IQMA 1OXGA 1WBGB 4CR5A 5BRRE 1O30A 1AN1E 1O2LA 5DO4H 2BOKA 3TGKE 2ZG0H 4AX9H 1S85A 4ZH8A 1ETTH 2K1QA 1GPZA 2VIOA 4WY3A 2WPJS 5AF9H 4U30A 1O2JA 1K1LA 2H9HA 1G2LA 4CHAB 5T3HA 1YPMH 5GIBA 1TABE 4B75A 2PUXB 4GSOA 4MPVA 1K21H 1TBRH 1QRXA 4FUEA 1UTMA 3V7TA 2FLRH 2XC5A 1MKXK 1RTFB 5G4BA 2G51A 1TE0A 2GZ7A 4BXWA 4B71A 2LPRA 1GGDC 2FM2A 2FMJA 2H6MA 3RXSA 1TGNA 1NTPA 3GYLB 4I32A 4YLQH 3QZQA 4BTUB 3D49H 4AYVB 3BG4B 3KQBA 1W0YH 4DJZB 5FXLA 3BN9A 1DSUA 5H4IB 5CHAC 1EB1H 1GCTC 3RC4A 1ESAA 1RXPA 1RJXB 3ZVAA 2FOCA 2G00A 3QK1A 2HALA 3ZZ7A 3GY2A 2XYAA 4E06H 1C5TA 2FIRH 2QA9E 1JMOH 3M5MA 1NRQH 1HAVB 1SGRE 1Z1IA 1Q31A 3T62A 1QTFA 4Y0YE 5L6NH 1ZHRA 3TJOA 5F6MA 1XUJA 1TB6H 6GCHF 1GJ7B 1GVZA 4I7YH 4SGAE 1GBDA 1C2GA 4HTCH 1GMDG 1FIZA 2BD3A 1SB1H 4BAMB 2YOLA 1W13U 2BQWB 4K2YA 1AO5A 3A80A 3GICB 1W2KH 3H7TA 1TRMA 4KKDA 1ZHPA 1BBRK 1EASA 2PWXA 4ISIH 2R9PA 5L2ZH 1D4PB 2PGQB 3U1JB 5EODA 1F0SA 5IYTA 3G01A 1PPZA 2ZGJA 4X1QU 2XBVA 3FP7E 1GBEA 1ETSH 3BSQA 1ELEE 3RXUA 3SQHE 3RXIA 2O8TA 1LMWB 2W26A 3GY5A 2FODA 2B0FA 3LONA 3VGCC 3PMHB 2ZPSA 1L4ZA 1O2TA 5GWZA 1ZOMA 1O2MA 4FUCA 3ATIA 1TOCB 1EZXC 1UTPA 4JYVH 4ISOA 3SI3H 3A84A 3UR6A 2QYIA 4AZ2B 1TAWA 5DKMA 2P59A 3OX7U 6CHAC 2BD2A 2NU1E 2NU2E 4Y11E 1JRTA 2ZECA 1UHBB 1V2RT 1LVBA 4WVPE 1O3IA 2FO9A 2OBOA 1TGSZ 1PJPA 1ELGA 4HI3A 3ZYDA 3VXFH 1G36A 2Z94A 5AHGH 1O2VA 2FI3E 1MTNB 1MTSA 1O2KA 1FQ3A 3MU8A 5JBCS 1BOQA 3EA8A 1MQ6A 1C1OA 2WUBA 2CV3A 1OP0A 2A7CA 3KGPA 7LPRA 5I25A 3KQDA 3UFAA 2CJIA 4MVNA 2Q1JA 4INHA 3L3TA 1DXPA 3P92A 1GI1A 3OTJE 4Y7BA 3OU0A 2HVXA 1IQLA 1P02A 4I31A 1GI4A 3RXJA 1MKWK 1MMJN 2UUFB 2ODPA 1V2VT 1P12E 2OCVB 3P17H 1BTUA 2QN5T 1FIWA 1F7ZA 4ABIA 2UWPA 1DITH 1FUJA 1ARBA 1UO6A 4YT6H 4FVDA 4INLA 5EQSA 3RXDA 1TGCA 3MNSA 3NUMA 4MTBA 1ZMNA 2DE8A 3FZZA 2O8LA 3GY4A 3S7HB 2BD4A 1FN8A 4NWLA 3FVFB 4AG1A 4YM9A 1YPGH 2V0BA 1OWKA 1E35B 3VXEH 2Y81A 1T7CA 5F8TA 3RU4E 3T25A 1DWCH 3MU4A 1P10A 2BZAA 2FOFA 2ZQ2A 3T27A 1ESBA 2FZZA 4FUBA 2J94A 5HYOA 2GT8A 2WPMS 1VCPA 1XUFA 2AEIH 5E0HA 1V2LT 3ENSB 5EPYA 3HKJB 1FNIA 2P8OB 1ZGIA 4X0WU 2ZQ1A 1S6HA 1DS2E 1HGTH 3Q3KA 4IN1A 1HPGA 3BEFB 2SGEE 5F03A 5LGOA 1TA2A 1TBZH 1TONA 2R0LA 1DPOA 2P3TB 2FOAA 1EAWA 4IN2A 2Z9IA 1KXFA 4OS4A 3LIWA 1GHBG 1WTHD 3SU2A 2OQUA 1LVOA 3A81A 1AY6H 4YZUA 4J1YA 1HCGA 3GDVA 3CS0A 2A31A 4NFEA 1C9PA 1SQAA 1C5OH 1D3DB 3ZZ5A 1XMNB 2BLVA 3B23B 3K6YA 1LHFH 1KTSB 2SNVA 5C1UA 2F9OA 1IHSH 1GI3A 1Y5BT 1CHOG 1ELTA 1HFDA 2XNIA 3SW2B 3GY3A 1TGBA 2GT7A 2ZFPH 2HNTF 2ANKH 3IG6B 4DCDA 4JK5A 4I8JA 4MNXA 1ELBA 4ESTE 3NCLA 1ETRH 2ZDNA 4ABHA 8GCHG 2PKSB 4B74A 2SGPE 3UPEA 2OC1A 4NSVA 1O2XA 1BMMH 3I77A 4ABEA 4X8UH 2WV5A 1A3BH 4B2AA 2WPHS 1B5GH 1ZGVA 2OQ5A 2ZCKP 2KAIB 3A7YA 3SJIA 1O33A 5ETXA 4BNRA 1RIWB 2NU0E 1P2QA 2G55A 1EB2A 1GWAA 1LKBA 3ATMA 2W3IA 3PLPA 3TVJB 1P3CA 4SGBE 1O2GH 1O32A 3RXKA 2Z9JA 3SU6A 1TMUH 3GISB 1BMNH 1CGIE 1EPTC 2ZHFH 3SV7A 3K6ZA 1NRNH 1SQTA 2Y7XA 1PQ5A 1PPGE 2HGTH 1PQ8A 3T2NA 3ATKA 2WYJA 2ANWA 4HZHA 2V3HH 4FUJA 1EP5A 3VB5A 1AUJA 1AB9C 3BG8A 1F0UA 1OYQA 5E0JA 1SC8U 4Y7AA 2BXUH 1TLDA 2Y5GA 3RXRA 1P8VC 1O2HA 2AIQA 3SU1A 1O2RA 2FXRA 4IS5A 3C1KA 1C4Y2 1TGTA 3SZNA 1IQEA 1ELCA 1Z8RA 1B0FA 2GCTB 3I29A 3QTOH 1GDUA 2CGAA 1BTYA 1XKBC 4NGAH 3MO9A 5EU8A 1QB9A 1KSNA 1C5WB 5B6OA 4B73A 4TPIZ 5IDKA 3LGYA 3N7OA 4YLUA 1WTGH 2TIOA 1E34B 2UUKB 1FY4A 4BANB 2B5TB 1NM6A 1AVWA 3SJOA 1JBUH 2CHAC 4X2YA 1OPHB 1T8NA 4ABFA 1P2KA 3EE0B 1UVUH 1EATA 2D2DA 1DVAH 1GI2A 1C5ZB 4NIYA 5DP3A 1W8BH 2JH5D 3ZZ4A 2BTCE 3JZ2B 5J4SA 4O3TA 4X8SH 1FAXA 5DP6A 3SJ9A 2ZCHP 1QJ6B 1DICA 1C5SA 3LOXA 4JCNA 1T31A 3BEIB 1GMCF 5GCHG 1W0ZU 7ESTE 4TPYA 3KEEA 4Q80A 2OP9A 2FTMA 1ANBA 4ZMAH 1GHBF 2ZGBH 2ZU1A 1HXFH 4FXGH 1EXFA 3SNAA 1SHHB 5LPEA 1LHDH 2NU3E 4KELA 2J38A 4GHTA 2B7DH 3A86A 3PWCA 2VGCB 1O0DH 1ZSLA 4NIWA 2QXGA 3RXQA 3SO3A 3RXOA 4Y76A 2FS8A 4IBLH 1BUIA 1HDTH 2BDBA 4AYYB 1LHEH 1ZTJA 4BTTB 1XVMA 1CVWH 1W3CA 1CHOF 1TYNA 5PTPA 4Q7ZA 4CRBA 2Y80A 1W14U 1OWHA 1CBWB 3SU4A 4ISHH 2KAIA 1HLTH 1QB1A 3RXAA 1CT0E 1J9CH 4DY7B 4ABJA 1AFQC 1GBBA 3UIRA 1BA8B 8GCHF 1ID5H 3MH6A 3MYWA 1MD7A 1BT7A 1SVPA 1JOUB 3OY6U 1ELFA 2XWBI 3SV8A 3RMMH 4CRFA 2BD5A 3EA9A 1AKSB 1VCWA 2VIQA 3UQVA 1HV7A 2C4FH 4BAOB 1YGCH 2ZHEH 2C90B 1FY8E 3E6PH 3ZZCA 1G3BA 1KLTA 3KNXA 3DFJA 2O8MA 4OS2A 1THSH 2BY5X 2ZTZA 1TNIA 3IWMA 3NPSA 2H5DA 2FWWA 3UR9A 1QL9A 3A88A 1LQDB 1ELVA 4DURA 2JH0D 4X1NU 1TX8A 2IJOB 1O3OA 2J4IA 3TU7H 3WY8A 4LOYH 4MLFB 1SFQB 2BDCA 2FI4E 1FXYA 1V2UT 1RFNA 4NCYA 4X2VA 1KDQA 3VFEA 1DWDH 2A5IA 2ZC9H 2G4UA 4HFPB 4ISNA 4AOQA 1YM0A 2BDHA 3QZRA 3MOCA 1XUIA 2ZGXH 3PM3A 5ESTE 1TMBH 3UQOA 1O3GA 2XBXA 1SGQE 4ZROA 2Q6DA 4BAHB 2P3FH 2XCFA 1NFYA 2YNAA 2ZFSA 1UVSH 1ZMJA 1ABIH 1ZMLA 2BHGA 1C1NA 1QRWA 2Y82A 2VU8E 3LC5A 3MU0A 4B2BA 3S7KB 2HWLB 1TQ7B 2QXJA 2I6QA 4CH8B 2V3OH 4RKOB 4FU7A 3BIUH 1LQEA 1QGFA 1V2NT 3RU4T 4D7FA 1SGPE 3U8TH 1TPPA 1DY8A 4E05H 1P2JA 1AZZA 3BTQE 4INKA 2VNTA 2HNTC 1NZQH 2C8XB 1YC0A 2EI7A 1A46H 4Z0KA 1A0HB 3RM0H 5DP8A 1KXBA 2GCHG 1O3DA 3LC3A 1V2QT 2QXHA 1K1MA 1QQ4A 2SGFE 3ITIA 1Z8IB 1SPJA 1O3LA 5DP4A 3D23A 1ELDE 1OWEA 4AFUA 1FMGA 1F5KU 3ZV9A 1ZPCA 3QUMP 1ZRKA 4GLYA 2VVCA 2GZ9A 5FAHA 2VWNA 3VB3A 4CHAC 3KN2A 1D6WA 2PGBB 1C1TA 2A4OA 3SHAH 3TJNA 1TNGA 1YPKH 4GCHG 2RA3A 2XBWA 5EXLA 1TRNA 1YPHE 2TGDA 2BOHB 1BHXF 2BD8A 1DXWA 4BOHA 3RXMA 4LK4A 1MTVA 8KME2 2D8WA 3GCNA 3F68H 1O35A 1XUKA 2Y5FA 3DA9B 1DUAA 1GVLA 2C3SA 3E91A 2ZF0H 2VWLA 1TNHA 2Z7FE 1MTWA 2C8YB 2V6NA 3BG4C 1A7SA 4I8HA 3EA7A 1A3EH 1GG6B 6LPRA 3U1IB 2ZU5A 1AKSA 2BY9X 2TGTA 3S69A 1HIAA 4K69A 3TGJE 1GJCB 3M61U 3A8AA 1NPMA 1J16A 4F49A 1HAYB 1WQSA 3R3GB 3SUDA 1BRBE 3LH1A 1DWEH 3SJ8A 4D8NA 1U6QA 2BY6X 2ESTE 4ASHA 2SFAA 3PLKA 4XSKU 3KCGH 5J4QA 6ESTA 4O9VA 1AE5A 1O2SA 1O3BA 1Y5AT 3RC6A 1FPCH 3QGJA 4ABDA 2IOTA 3ZZ3A 5TJXA 1GHWH 1L1JA 3LPRA 5SGAE 3SNEA 5CMXH 1C2FA 4NA7A 1GDQA 5FBIA 5DG6A 1CGHA 1DT2A 1GBTA 1FAKH 2R3YA 1O5CB 1FZZA 3LKWA 1HUTH 2O8UA 4WJG2 4BTIB 5EXMA 4UE7H 1GCDA 3O8DA 1RTKA 2ZTYA 3EAJA 3FZDA 5FBEA 5CE1A 2G5NA 5HM9A 1UK2A 1F5LA 3F9GA 3CS7A 2ZHDA 1V2JT 1SGFG 1O2ZA 1BTPA 2CXVA 3SUFA 2B9LA 3RXLA 2BLWA 5GXPA 5C1XA 3T29A 2FI5E 1HAIH 1C5MD 2H9TH 3LGWA 1UK3A 2W7SA 3PWBA 2EI6A 1DLKB 1N6XA 4B1TA 5HGGA 1GJ6A 4YO9A 2AMPA 4AFSA 1IQFA 3UNRA 3TNTA 1MTNC 1THPB 4ZHMU 2F9BH 1DLEA 2VINA 2OXSA 1D9IA 4TY6A 4Y0ZE 3VB4A 1DOJA 1TPOA 2VWMA 2GMTB 4PROA 5FPSA 1O5GH 1OYTH 2A5KA 4JYUH 1XXDA 3E3TA 4X1RU 1AIXH 2GCHF 2XC4A 1V2MT 1YF4A 3CP7A 4FUGA 2WINI 3W95A 5C5NA 1YLDA 1BDAA 1LVMA 2BB4A 1T4UH 1NRPH 3PTNA 1C2JA 1QCPA 2ZNKH 3P8FA 5T6DA 1XKAC 3AAVA 2ZWLH 4TY7A 3GCHB 1MAXA 2GV6A 3QDZB 4NA9H 4FU9A 3RXGA 1J8AA 3RU4D 4ZHLU 1LHGH 3FP8E 1IQGA 3MWIU 1GI6A 3STJA 4UEHH 3M3TA 1YCPM 3KF2A 5GDSH 1O2NA 4GCHF 3RXHA 2VVVA 1GBMA 5TCAA 1AZ8A 3BTWE 1THRH 2OBQA 1QURH 1SLXB 1UTKA 2ZPQA 1GBKA 3TPIZ 2QGRA 2ANMH 1H9IE 1FY3A 5T6GA 2TRMA 1Y3YA 2GDDA 4I8LA 1WYKA 3SHCH 1UCYE 1K1JA 2ZI2H 3VPKA 2G52A 3TK5A 3TGIE 2FX4A 2VB0A 2ZFQH 1S84A 4D9RA 2G81E 4AGKA 2ZKSA 2H9EH 2AH4X 1DDJA 2W7UA 4MNVA 1KY9A 1ZZZA 3M3VA 4MPUA 4U01A 4K1SA 3SV6A 3W94A 1K1NA 1IQHA 1SBWA 1UCYH 2P8OC 2WV4A 3KHVA 1O2UA 4WMDA 1C2IA 1Z6EA 2AMQA 3BV9B 2Z9KA 2ZDAH 2B8OH 3LGUA 3NZIA 1SGIB 1JWTA 1JIMA 5A2MH 1P01A 4TYDA 2VIWA 1TX6A 1ESTA 3HGPA 4Q7XA 4DIHH 2P93A 4X1PU 1ABJH 1O2OA 1ZTKA 1EJAA 4DGJA 1GMDF 1SFIA 1NRSH 2CMYA 3A85A 1QBNA 4WF8A 4XE4A 4ZHAA 1Q3XA 2Z9GA 3LH3A 3T26A 4CRCA 1GJ8B 3UUZA 1HAPH 3SU5A 1HJ9A 1LVYA 1IQIA 5LPRA 1HNEE 1CQQA 2P16A 1HJ8A 2SGQE 1AI8H 5ABWA 4ZXXH 1C2MA 2STAE 2Y7ZA 4IW4E 4GPGA 1NROH 3URDA 1T8MA 3P95A 2ZDMA 1FV9A 1GVKB 2IN2A 4XBCA 2BD9A 2PKSC 2BDGA 3QO6A 1G3DA 4D76A 5JB9S 4AB8A 8ESTE 1HYLA 4JZIA 5BPEA 2PTCE 2BD7A 7GCHG 1K1IA 2FOEA 1C5QA 3O8BA 1SGDE 1MZDA 3RDZA 3RXVA 1TIOA 1HBTH 3RLYH 5DGJA 4ZKRU 1G32B 4AGJA 1IOEA 1UVTH 1RIWC 4X6MA 5JBAS 1WCZA 3MH4A 1BHXB 3BTGE 2CF9H 3ELAH 2CF8H 1C1VH 1F2SE 1MUEB 4WXIA 2GDEH 1LPKB 2ZEBA 5K0HA 1PPEE 1SHYA 2HPQH 1M9UA 1AQ7A 2H1UA 1UTNA 3A7ZA 3ATLA 1F0RA 4IGDA 3PMJA 4R8TB 2J9NA 1O3JA 3U98H 1VJ9U 1CT4E 3V0XA 1V2OT 1MBMA 2Z3CA 4X8TH 3LU9B 3T28A 1Y3VA 4MNYA 2BQ7B 2I6SA 3H7OA 4ZAEA 2ODYB 3KQEA 3MTYA 3NK8A 3RM2H 3P8GA 2WPLS 4YT7H 3RMOH 5I46H 1TFXA 3ZVFA 1HAGE 1S5SA 2D26C 4OS1A 1PPCE 2XXLA 1EX3A 1Z7KA 3GY7A 1MU8B 1H9HE 2QY0B 1S82A 1TNJA 3A7VA 3GCTG 3F9FA 3TH2H 1WU1A 4I33A 4UFGH 3V12A 1ZSJA 1O3CA 1XM1A 2GCTC 1HB0B 4WH6A 1KXCA 2FP7B 4FUFA 3SN8A 1DX5M 1QB6A 3PO1B 5FPTA 5JPMH 1UTOA 1BZXE 1KDQB 3UWIA 5GPIB 2OC7A 4A6LA 1P09A 1K2I1 2TBSA 1RGQA 2WPIS 4WMEA 1C1PA 2PKAA 1LPZB 3OYPA 3E0NB 3RXCA 1P03A 1GHXH 1UK4A 2GZ8A 5E2OA 1YYY1 4GAWA 3T5FH 1C5UA 3E1XB 2RA0A 1V2WT 4VGCB 1W10U 4Q2KA 2PFEA 4E7RG 2HOBA 1MKXH 3TIUA 1AVXA 1IQNA 1QFKH 1P04A 2PSYA 1ZTLA 3R0FA 1H8IH 3MI4A 3AVZA 4NIXA 1VZQH 3SORA 1BQYA 3U69H 5C3NA 1AVGH 4NZQA 1BTWA 2BYAX 5L30H 1QJ1B 3B8JA 2FPZA 3UOUA 2FOMB 1GDNA 5A0CA 1IHTH 1PPBH 1EZUC 1QA7A 3TJUA 3DUXH 3EQ0H 1FN6A 1QNJA 4X2XA 3KQCA 2VGCC 3ZZ6A 1TPAE 2ZDLA 3LGTA 1PFXC 1TBQH 3E0PB 1WUNH 1WV7H 3FANA 5LPFA 3AW0A 2JETB 2F9NA 1DSTA 2OUAA 2J34A 2OTVA 2TGAA 1EZQA 1N8OB 1TA6A 2UUJB 1H8DH 2C93B 3S9AA 1CBWC 1P3EA 5C2ZA 1ZJKA 3A82A 1EP6A 3UNQA 4BAKB 1GMHG 1SGYE 3D65E 1V2TT 4U2WA 3GYMA 1NFXA 5DJ7A 1ZR0A 4DIIH 2PW8H 4A92A 1XX9A 4KP0A 1TMTH 1BBRH 1NO9H 5F8ZA 1AMHA 1CA0B 3MU5A 1C5VA 1D3PB 1JIRA 1Y3XA 2G4TA 5ESBA 1O36A 2TPIZ 1MH0A 2ALVA 1WQVH 4IMQA 4YOIA 1OWIA 4K1TA 1UCYK 3MFJA 4A1XA 5TCCA 3SI4H 1NT1A 1GI8B 2XTTB 1YP9A 3ZZBA 4LZ4B 1O2IA 1NN6A 4A5TS 1HIAB 1EKBB 3GDUA 3HPTB 1T32A 3DHKH 3BF6H 1DUEA 2THFB 2BZ6H 1O3AA 1ACBE 1H9LB 1XXFA 1L1NA 4X1SU 2PHBA 1D3TB 1OKXA 2GD4B 3KL6A 3OSYA 3GY8A 3M5OA 1Z6JH 5FHTA 4ISLA 1H1BA 2QXIA 1CHGA 4IC6A 5EPNA 3QWCH 1G9IE 1PPHE 1BCUH 1NY22 4JZEH 3ZVDA 3BIVH 1C9TA 3ZVBA 3GCTF 1UMAH 1BRAA 2RG3A 3MNXA 1QQUA 4CRGA 2Q6FA 4Y8YA 1C5XB 3I78A 1Y3WA 1EJMA 1EAXA 2VJ1A 3M5LA 2R3UA 1C4U2 4NWKA 1EPTA 2M5TA 1K9OE 5T6FA 2FX6A 2QV1A 4JK6A 1QR3E 1P05A 1E37B 5A0AE 1QL7A 1VITH 1L2EA 3GOVB 4DT7B 2BDYA 3BTDE 1BTXA 4CBNA 1MKWH 4YOGA 2C8WB 1HAZB 8LPRA 3K65B 1CU1A 3K9XB 3MNBA 5EGMA 1T4VH 3ZZ8A 3RC5A 4XBDA 3RUOA 2PV9B 2FEQH 1PQAA 3EYDA 1GI7B 1O39A 4D9QA 2AIPA 2ANYA 4J2YB 7KMEH 1D3QB 1SL3A 4F4OC 3RXTA 5K7RA 1E0FD 1LCYA 1ZHMA 1MCVA 1C1UH 4MNWA 1RRKA 1AHTH 4E7NA 1G37A 1HJAB 2ZHQH 5E2PA 4DW2U 2F83A 1T8LA 2BX4A 1P11E 1NS3A 5E0GA 4ZKSU 3GY6A 4FVBA 4IMZA 3B9FH 1RS0A 3TNSA 2AMDA 1DFPA 1HRTH 1C5LH 3HKIB 3HGNA 3DFLA 1SMFE 3QN7A 4MG3A 3UNSA 3O8RA 2STBE 1GJAB 1G30B 5GCHF 3BTTE 4HGCA 1NU7B 3QGNB 3E16B 1QA0A 1L1GA 1CA8B 2AGEX 2QF0A 1YPHC 1GG6C 1TRYA 4KTUA 2VVUA 3BEUA 5E8EH 4Y8ZA 1AUTC 4MQAA 2FOGA 2ZDKA 4H6SB 3C27B 3LDXH 4OS6A 1DWBH 2PR3A 1GMHF 3RMLH 2VH6A 3UTUH 2UWOA 1GBLA 1VGCB 4O3UA 1BMAA 1FY5A 3OY5U 1P2MA 2VWOA 4MPWA 4MPXA 1UTJA 2GTBA 2AYWA 2P95A 4LXBH 2AS9A 4XBBA 1BITA 3FP6E 3FFGA 4NSYA 5L2YH 2LNCA 3M7UA 1WOFA 3UOPA 2FOHA 2AFQB 4QT8C 5AFYH 1GJDB 3TLOA 2AGIX 1ELAA 1TNKA 1GHVH 2NWNA 1ARCA 4JZ1A 4K5ZA 3CENA 2BY7X 2F9VA 2RCEA 1N6YA 1XVOA 2FLBH 2BDAA 2BMGB 4AB9A 1W11U 1FI8A 3P8NA 1VITG 4OS7A 3TH4H 1CE5A 4CRDA 3VEQB 1LPGB 2OINA 4TWYA 1GGDB 1Y59T 1CO7E 4AORA 1W12U 2HPPH 1VCQA 3FAOA 1O38A 3MO6A 4UONA 3NXPA 4RKJB 1ZYOA 2F9PA 1GBCA 1OP8A 1EUFA 1GJ9B 5CHAB 1GCTB 1OP2A 1ORFA 4YTAA 4YESB 2VH0A 1UVPA 1W7GH 3M7TA 2XCNA 4BAQB 1Y8TA 2XC0A 4X8VH 3SNCA 3DT0H 9ESTA 1DE7H 4K8YA 3M35A 1MZAA 4OS5A 4JMYA 2ZDVH 1V2ST 2R2WU 1QRZA 1RTLA 1ZLRA 1ZPZA 2GMTC 3SGAE 1SGFA 1YPEH 2F3CE 1NFUA 3GDSA 1O5EH 4X6PA 2VIVA 1OX1A 1PPFE 3QX5H 2VIDA 3BTKE 4X6NA 3RP2A 2BM2A 3LJJA 3F6UH 4GHQA 4NZLA 1S0RA 2AERH 3GCHC 3LGIA 2A5AA 4CH2B 4ZXYH 1PYTD 5DP5A 2QF3A 4BXSA 5C67A 4IC5A 3MHWU 1NRRH 5A8XA 5DPAA 1O5FH 2TGPZ 4A1TA 3GCOA 1EAIA 1GBJA 1YPJH 5F8XA 3SGQE 2XWAA 3M7QA 3SGBE 2HRVA 1V6DA 1SR5C 3O8CA 1BTZA 1S6FA 3VGCB 3IITA 3A7WA 1P2NA 5EW2H 1J15A 4NFFA 1UTLM 3P70B 2Q6GA 1QBVH 3S9BA 2OC8A 2ZZUH 1EOJA 1GJBB 4OGYA 1P57B 3M5NA 4YOJA 2FYRA 4KTCA 2ZHWH 2ZGCA 1O2PA 1C5NH 1F92A 1UVOA
chains in the Genus database with same CATH superfamily
3ZZAA 3A87A 3ZVGA 6CHAB 1H8HD 2JH6D 5FX6A 1W7XH 3F9HA 3RXEA 4X2WA 2XW9A 2V35A 3M3SA 3SV2H 1GHZA 1N1LA 1NFWA 2GVFA 4NA8A 4THNH 3ZVCA 2WYGA 2A2XH 1QHRB 1TX7A 2ZPRA 3Q3XA 4CR9A 1FJSA 2V3MA 1Y3UA 2J95A 1BRCE 1TWXB 4CRAA 1O37A 1PYTC 3BTFE 3M36A 3K2UA 3U9AH 4ABAA 2A1DB 3PV4A 1Z1JA 1SGEE 3MMGA 1JXPA 1P06A 1SLWB 2ZFRH 4K1EA 5LH8A 3Q00A 2ZIQH 1GJ4H 4DOQA 3PMAB 4WMFA 4LZ1H 3SU0A 1SOZA 1BB0B 4XFQA 4AN7A 1AD8H 1C2LA 1O3NA 4K3JA 1G2MA 4Y6DA 1V2KT 1K1OA 4O97A 3F3BA 3SZEA 3W1EA 3MU1A 1HAHH 2PKAB 5IK2D 2Y6TA 5JBTA 1QY6A 1OSSA 1LDTT 1HAVA 1LKAA 3F2FA 1ANDA 1FY1A 2GP9B 1INCA 3TITA 2A4GA 1C2EA 3MO3A 3A8CA 1VITF 5HIYA 3ZYEA 1Y5UT 1GI9B 2A0QB 1XUHA 2D1JA 5HIZA 2BQ6B 1C1MA 2YNBA 4H4FA 1K28D 2JKHA 3S0NA 1GBHA 3TK9A 3RXPA 2A45B 1C2KA 1OWJA 3CNRA 5EW1H 3QLPH 5FPYA 1YPLH 2WSSD 1BMLA 2VBCA 2SGAA 2ZU2A 1EZSC 1P2IA 2QC2A 1BTHH 4RSPA 1B7XB 1GMCG 1O3MA 3U8RH 1GJ5H 1BJUA 5C20A 3L33A 4GVUA 2RDLA 1GHAG 2DUCA 3F2GA 2C8ZB 1SSXA 1A1RA 2Z3DA 3SQEE 1S0QA 3EDXB 1O5DH 1DY9A 1GI0A 2EEKA 3V13A 3MNCA 2OLGA 3BTME 1CGJE 4FU8A 3SOSA 1C2HA 1EJNA 4AFZA 1C2DA 4H6TA 1UJ1A 2O9QA 5JYIA 4Y8XA 1UHBA 3Q3YA 3UWJH 1WAYB 4XDEA 1T8OA 2QCYA 1LHCH 3RXBA 3STIA 2F9UA 1FDPA 1S83A 2BLQA 2GV7A 4DG4A 3RXFA 3PV2A 3MH5A 3P6ZB 2ALPA 4XOJA 2P94A 3H5CB 5C5OA 9LPRA 2W5EA 1O2YA 1YCPH 3D62A 4KTSA 2SNWA 1KTTB 4TT3D 4B2CA 4B76A 2WHXA 1H4WA 1SI5H 2BVRH 3A7TA 2GGVB 3E90B 4FUDA 1A4WH 1CSOE 3ZVEA 1YKTA 3PO1C 5FX5A 4ABBA 2OD3B 1P9SA 1AFEH 3BTEE 1KLJH 1FONA 3AW1A 5DP9A 2A7JA 5A0BA 2ZTXA 2GKVE 1J17T 1SQOA 4O03A 2PSXA 2ZFFH 5A09A 1C1WH 1F0TA 1IQKA 3HATH 1HAXB 1S81A 2ZFTA 2ZP0H 1C5RA 4ZKNU 4NG9H 2EC9H 5HXFA 1O3EA 1E79D 5DP7A 1A61H 1C1RA 3ZZ9A 4VGCC 1QJ7B 1KXDA 1YWUA 2KCPA 2ZU4A 1AWHB 1ZSKA 1O5BB 1C5PA 1PQ7A 3Q77A 5EOKA 1OOKB 1Z71A 2SGDE 3ZIAD 2GX4A 1KXAA 1KIGH 2ZGHA 4I8GA 4OM9A 2XBYA 2Z6BD 5EG4A 4ABGA 1UTQA 3FN8A 1GI5A 4UD9H 3A83A 1EPTB 2BY8X 1KLIH 1A2CH 1NU9A 3PB1E 1A5HA 1EAUA 1GHYH 1OS8A 4DVAU 2NU4E 3VB6A 2PUQH 2J92A 3HK6B 4JZFH 3E8LA 1MBQA 1FLEE 3F9EA 1KXEA 1TPSA 1IQJA 1BIOA 3AASA 1AB9B 2BDIA 1SLUB 1A5GH 2FTLE 2O8WA 3NKKA 2IPHA 2JETC 2Z3EA 3JZ1B 1O31A 5HM2A 2G8TA 1QL8A 1BRUP 1LO6A 3U8OH 3MH7A 3SNDA 3SNBA 3VB7A 4U32A 1N8OC 3RLWH 2A2QH 3LGVA 4A1VA 3SUEA 3UREA 3LJOA 3TK6A 2OC0A 2R2MB 2FYQA 3BTHE 3LT3A 5JDUB 3QTVH 1K1PA 1MU6B 4CBOA 2HLCA 2GJGA 1ANEA 1BBRE 4FUHA 4TWWA 4WXVA 4WH8A 2ULLA 2ZA5A 3A8DA 2ASUB 1L0ZA 3M37A 3OTPA 3OE7D 1AGJA 4Y71A 1CA0C 1MTUA 1B0EA 3SBKA 1MAYA 2QIQA 1J14A 4HG6A 1C5YB 2CHAB 5EQQA 3SU3A 4FUIA 1WDIA 4WWYA 4D7GA 4UFFH 1O5AB 1O3KA 3V3MA 1BJVA 1V2PT 1IAUA 1GHAF 1ZRBA 5C94A 7GCHF 1GBAA 2J2UA 1ZPBA 1ANCA 1AE8H 2ZCLP 4K60A 1WSSH 4Z6AH 3S9CA 1GL1A 2IPQX 1O3FA 3A8BA 2EA3A 3P8OA 1VJAU 2CN0H 4RN6A 1DM4B 1P2OA 1EOLA 3KQ5A 1G3CA 3H09A 4UFEH 1G3EA 1QIXB 5JBBS 4UFDH 1QBOA 4Z1MD 2UWLA 3TH3H 2FS9A 2XRCA 3AAUA 5AFZH 5FCKA 1O2QA 1GBFA 3EGKH 2UUYA 4M7GA 1P9UA 1A0LA 2FDAA 3PTBA 1E38B 4OGXA 1V3XA 2A4RA 4AFQA 4AG2A 1SOTA 1X7AC 2PTNA 1SG8B 1O3HA 5EJLA 1AU8A 1TQ0B 1AFQB 2A4QA 2DE9A 2W3KA 1KYNA 4GUXA 2ZO3H 2ODQA 3PYHA 5HMAA 1XUGA 2BX3A 2VIPA 1MQ5A 3SUGA 4F55A 4KGAA 1O2WA 6GCHG 1TNLA 2G5VA 2KR7A 1MCTA 4JYTA 1EQ9A 3ATWA 2WPKS 2QAAA 2Z9LA 4R0IA 2BVSH 1JRSA 1K22H 1YLCA 1SGTA 3TJVA 4B6FA 2LP6A 5JB8S 3UY9A 1GBIA 3F1SB 3AK5A 3HK3B 1MD8A 1P0SH 4K8BA 5A8YA 4Q7YA 2WUCA 5C1YA 1SGNE 3A89A 4UDWH 2Y5HA 4ASUD 3KYGA 2BXTH 2PLXA 2BLOA 2FESH 2H5CA 1A5IA 3F0PA 3ODFA 1FPHH 3SJKA 1AWFH 1C4V2 1HJAC 2LELA 5A8ZA 3DD2H 1TALA 4NIVA 4I8KA 1YBWA 2OK5A 4FOUC 1D6RA 2H2ZA 4Q63A 2W6JD 5EXNA 5GJ4B 1SGCA 1VR1H 4Y10E 2A32A 1C1SA 1F5RA 4JZDH 5GNDA 4MDSA 5FCRA 3ODDA 2YMSD 1RD3B 1HXEH 1E36B 1GL0E 3Q76A 2R0KA 2EI8A 5AVDA 4A7IB 1OWDA 5DK1A 4ZKOU 2BVXH 1Z8JB 4X6OA 1HAOH 3PLBA 3A7XA 3KIDU 1LTOA 1O3PB 5EQRA 1TOMH 1YCPK 1CT2E 2HNTE 2ILNA 2FOBA 2AGGX 3ESTA 2A7HA 1SLVB 4CREA 1NESE 3URCA 3SV9A 1Z8GA 1A0JA 1ZJDA 3RMNH 3L6PA 1Q2WA 4Y79A 3PROA 1C1QA 1VGCC 2HLDD 2P3UB 3NWUA 2ZU3A 3ZV8A 4ZUHA 4H42U 2F91A 3ZZDA 1NC6A 1L4DA 2XNDD 3PMBB 1DANH 1O34A 1IQMA 1OXGA 1WBGB 4CR5A 5BRRE 1UW7A 1O30A 5EIYA 1AN1E 1O2LA 5DO4H 2BOKA 3TGKE 2ZG0H 4AX9H 1S85A 4ZH8A 1ETTH 2K1QA 1GPZA 2VIOA 4WY3A 5KECA 2WPJS 5AF9H 4U30A 1O2JA 1K1LA 2K8IA 2YMSC 2H9HA 1G2LA 4CHAB 5T3HA 1YPMH 5GIBA 1TABE 4B75A 2PUXB 5C17A 4GSOA 4MPVA 1K21H 1TBRH 1QRXA 4FUEA 3DSGA 1UTMA 3PV5A 3V7TA 2FLRH 2XC5A 1MKXK 1RTFB 5G4BA 2G51A 1TE0A 2GZ7A 4BXWA 4B71A 2LPRA 4FETA 1GGDC 2FM2A 2FMJA 2H6MA 3RXSA 1TGNA 1NTPA 3GYLB 4I32A 4YLQH 3QZQA 4BTUB 3D49H 4AYVB 3BG4B 3KQBA 1W0YH 4DJZB 5FXLA 3BN9A 1DSUA 5H4IB 5CHAC 5FL7D 1EB1H 1GCTC 3RC4A 1ESAA 1RXPA 1RJXB 3ZVAA 2FOCA 2G00A 3QK1A 2HALA 3ZZ7A 3GY2A 2XYAA 4E06H 1C5TA 2FIRH 2QA9E 1JMOH 3M5MA 1NRQH 1HAVB 1SGRE 1Z1IA 1Q31A 3T62A 1QTFA 4Y0YE 5L6NH 1ZHRA 3TJOA 5F6MA 1XUJA 1TB6H 6GCHF 1GJ7B 1GVZA 4I7YH 4SGAE 1GBDA 1C2GA 4HTCH 1GMDG 2J98B 1FIZA 2BD3A 1SB1H 4BAMB 2YOLA 1W13U 2BQWB 4K2YA 1AO5A 3A80A 3GICB 1W2KH 3H7TA 1TRMA 4KKDA 1ZHPA 1BBRK 1EASA 2PWXA 4ISIH 2R9PA 5L2ZH 1D4PB 2PGQB 3U1JB 5EODA 1F0SA 5IYTA 3G01A 1PPZA 2ZGJA 4X1QU 2XBVA 3FP7E 1GBEA 2EQNA 1ETSH 3BSQA 1ELEE 3RXUA 3SQHE 3RXIA 2O8TA 2WV9A 1LMWB 2W26A 3GY5A 2FODA 2B0FA 3LONA 3VGCC 3PMHB 2ZPSA 1L4ZA 1O2TA 5GWZA 1ZOMA 4F48B 3OEHD 1O2MA 4FUCA 3ATIA 1TOCB 1EZXC 1UTPA 4JYVH 4ISOA 3SI3H 3A84A 3UR6A 2QYIA 4AZ2B 1TAWA 5DKMA 2P59A 3OX7U 6CHAC 2BD2A 2NU1E 2NU2E 4Y11E 1JRTA 2ZECA 1UHBB 1V2RT 1LVBA 4WVPE 1O3IA 2FO9A 2OBOA 1TGSZ 1PJPA 1ELGA 1H8ED 4HI3A 3ZYDA 3VXFH 2CK3D 1G36A 2Z94A 5AHGH 1O2VA 2FI3E 1MTNB 2RFKC 2EY4C 1MTSA 1O2KA 1FQ3A 3MU8A 5JBCS 1BOQA 3EA8A 1MQ6A 1C1OA 2WUBA 2CV3A 1OP0A 2A7CA 3KGPA 7LPRA 5I25A 3KQDA 3UFAA 2CJIA 4MVNA 2Q1JA 4INHA 3L3TA 1DXPA 3P92A 1GI1A 4ZCNA 3OTJE 4M9FA 4Y7BA 3OU0A 2HVXA 1IQLA 1P02A 4I31A 1GI4A 3RXJA 1MKWK 1MMJN 2UUFB 2KZ4A 2ODPA 1V2VT 1P12E 2OCVB 3P17H 1BTUA 2QN5T 1FIWA 1F7ZA 2WPDD 2UWPA 4ABIA 1DITH 1FUJA 1ARBA 1UO6A 4YT6H 4FVDA 4INLA 5EQSA 3RXDA 1TGCA 3MNSA 3NUMA 4MTBA 1ZMNA 2DE8A 3FZZA 2O8LA 3GY4A 3S7HB 2BD4A 1FN8A 4NWLA 3FVFB 4AG1A 4YM9A 1YPGH 2V0BA 1OWKA 1E35B 3VXEH 2Y81A 1T7CA 5F8TA 3RU4E 3T25A 1DWCH 3MU4A 1P10A 2BZAA 2FOFA 2QF5A 2ZQ2A 1ESBA 2FZZA 3T27A 4FUBA 2J94A 5HYOA 2GT8A 2J98A 2WPMS 1VCPA 4P00A 1XUFA 2AEIH 5E0HA 2XOKD 1V2LT 3ENSB 5EPYA 3HKJB 1FNIA 2P8OB 3KYFA 1ZGIA 4X0WU 2ZQ1A 1S6HA 1DS2E 1HGTH 3Q3KA 4IN1A 1HPGA 3BEFB 2SGEE 5F03A 5LGOA 1TA2A 1TBZH 1TONA 2R0LA 1DPOA 2P3TB 2FOAA 1EAWA 4IN2A 2Z9IA 1KXFA 4OS4A 5C0TA 3LIWA 1GHBG 1WTHD 3SU2A 2OQUA 1LVOA 3A81A 1AY6H 4YZUA 4J1YA 1HCGA 3GDVA 3CS0A 2A31A 4NFEA 1C9PA 1SQAA 1C5OH 1D3DB 3ZZ5A 1XMNB 2BLVA 3B23B 3K6YA 1LHFH 1KTSB 2SNVA 5C1UA 2F9OA 1IHSH 1GI3A 1Y5BT 1CHOG 1ELTA 1HFDA 2XNIA 3SW2B 3GY3A 1TGBA 2GT7A 2ZFPH 2HNTF 2ANKH 3IG6B 4DCDA 1COWD 4JK5A 4I8JA 4MNXA 1ELBA 4ESTE 3NCLA 1ETRH 2ZDNA 4ABHA 8GCHG 2PKSB 4B74A 2SGPE 3UPEA 2OC1A 4NSVA 1O2XA 1BMMH 3UB0A 3I77A 4ABEA 4X8UH 2J5UA 2WV5A 1A3BH 4B2AA 2WPHS 1B5GH 1ZGVA 2K0QA 2OQ5A 2ZCKP 2KAIB 3A7YA 3SJIA 1O33A 5ETXA 4BNRA 1RIWB 2NU0E 1P2QA 2G55A 1EB2A 1GWAA 1LKBA 3ATMA 2W3IA 3PLPA 3U28C 2QE7D 3TVJB 1P3CA 4SGBE 1O2GH 1O32A 3RXKA 2Z9JA 3SU6A 1TMUH 3GISB 1BMNH 1CGIE 1EPTC 2ZHFH 3SV7A 3K6ZA 1NRNH 1SQTA 2Y7XA 1PQ5A 1PPGE 2HGTH 1PQ8A 3T2NA 3ATKA 2WYJA 2ANWA 4HZHA 2V3HH 4FUJA 1EP5A 3VB5A 1AUJA 1AB9C 3BG8A 1F0UA 1OYQA 5E0JA 1SC8U 4Y7AA 2BXUH 1TLDA 2Y5GA 3RXRA 1P8VC 1O2HA 2AIQA 3SU1A 1O2RA 2FXRA 4IS5A 3C1KA 1C4Y2 1TGTA 3SZNA 1IQEA 1ELCA 1Z8RA 1B0FA 2GCTB 3I29A 3QTOH 1GDUA 2CGAA 1BTYA 1XKBC 4NGAH 3MO9A 5EU8A 1QB9A 1KSNA 1C5WB 5B6OA 4B73A 4TPIZ 5IDKA 3LGYA 3N7OA 4YLUA 1MABB 1WTGH 2TIOA 1E34B 2UUKB 1FY4A 4BANB 2B5TB 1NM6A 1AVWA 3SJOA 1JBUH 2CHAC 4X2YA 1OPHB 1T8NA 2KCAA 4ABFA 1P2KA 3EE0B 1UVUH 1EATA 2D2DA 2F4LA 1DVAH 1GI2A 1C5ZB 3NRLA 4NIYA 5DP3A 1E1RD 1W8BH 2JH5D 2BTCE 3ZZ4A 3JZ2B 5J4SA 4O3TA 4X8SH 1FAXA 5DP6A 3SJ9A 2ZCHP 1QJ6B 1DICA 1C5SA 3LOXA 4JCNA 1T31A 3BEIB 1GMCF 5GCHG 1W0ZU 7ESTE 4TPYA 3KEEA 4Q80A 2OP9A 2FTMA 1ANBA 4ZMAH 1GHBF 2ZGBH 2ZU1A 1HXFH 4FXGH 1EXFA 3SNAA 1SHHB 5LPEA 1LHDH 2NU3E 4KELA 2J38A 4GHTA 2B7DH 3A86A 3PWCA 2VGCB 1O0DH 1ZSLA 4NIWA 2QXGA 3RXQA 3SO3A 3RXOA 4Y76A 2FS8A 4IBLH 3DSOA 1BUIA 1HDTH 2BDBA 4AYYB 1LHEH 1ZTJA 4BTTB 1XVMA 1CVWH 1W3CA 1CHOF 1TYNA 5PTPA 5T1VA 4Q7ZA 4CRBA 2Y80A 1W14U 1OWHA 1CBWB 3SU4A 4ISHH 2KAIA 1HLTH 1QB1A 3RXAA 4DT4A 1CT0E 1J9CH 4DY7B 4ABJA 1AFQC 1GBBA 3UIRA 1BA8B 8GCHF 1ID5H 3MH6A 3MYWA 1MD7A 1BT7A 1SVPA 1JOUB 3OY6U 1ELFA 2XWBI 3SV8A 3RMMH 4CRFA 2BD5A 3EA9A 1AKSB 1VCWA 2VIQA 3UQVA 1HV7A 1OHHD 2C4FH 4BAOB 1YGCH 2ZHEH 2C90B 1FY8E 3E6PH 3ZZCA 1G3BA 1KLTA 3KNXA 3DFJA 2O8MA 4OS2A 1THSH 2BY5X 2ZTZA 1TNIA 3IWMA 3NPSA 2H5DA 1S6LA 2FWWA 3UR9A 1QL9A 3A88A 1LQDB 1ELVA 4DURA 2JH0D 4X1NU 1TX8A 3WW7A 2IJOB 1O3OA 2J4IA 3TU7H 3WY8A 4LOYH 4MLFB 1SFQB 2BDCA 2FI4E 1FXYA 1V2UT 1RFNA 4NCYA 4X2VA 1KDQA 3VFEA 1DWDH 2A5IA 2ZC9H 3F0OA 2G4UA 4HFPB 4ISNA 4AOQA 1YM0A 2BDHA 3QZRA 3MOCA 1XUIA 2ZGXH 3PM3A 5ESTE 1TMBH 3UQOA 1O3GA 2V7QD 2XBXA 1SGQE 4ZROA 2Q6DA 4BAHB 2P3FH 2XCFA 1NFYA 2YNAA 2ZFSA 1UVSH 1ZMJA 1ABIH 1ZMLA 2BHGA 1C1NA 1QRWA 2Y82A 2VU8E 3LC5A 3MU0A 4B2BA 3S7KB 4RT1A 2HWLB 1TQ7B 2QXJA 2I6QA 4CH8B 2V3OH 4RKOB 4FU7A 3BIUH 1LQEA 1QGFA 1V2NT 3RU4T 4D7FA 1SGPE 3U8TH 1TPPA 1DY8A 4E05H 3DCLA 1P2JA 1AZZA 3BTQE 4INKA 1VKYA 2VNTA 2HNTC 1NZQH 2C8XB 1YC0A 2EI7A 1A46H 4Z0KA 1A0HB 3RM0H 5DP8A 3MQKC 1KXBA 2GCHG 1O3DA 3LC3A 1V2QT 2QXHA 1K1MA 1QQ4A 2SGFE 3ITIA 1Z8IB 1SPJA 1O3LA 2KM0A 5DP4A 3D23A 1ELDE 1OWEA 4AFUA 1FMGA 1F5KU 3ZV9A 1ZPCA 3QUMP 1ZRKA 4GLYA 2VVCA 2GZ9A 5FAHA 2VWNA 3VB3A 4CHAC 3KN2A 1D6WA 2PGBB 1C1TA 2A4OA 3SHAH 3TJNA 1TNGA 1YPKH 4GCHG 2RA3A 2XBWA 5EXLA 1TRNA 1YPHE 2TGDA 2BOHB 1BHXF 2BD8A 1DXWA 4BOHA 4YXWD 3RXMA 4LK4A 1MTVA 8KME2 2D8WA 3GCNA 5KGOA 3F68H 1O35A 1XUKA 2Y5FA 3DA9B 2JJ1D 1DUAA 1GVLA 2C3SA 3E91A 2ZF0H 2VWLA 1TNHA 3F2HA 2Z7FE 1MTWA 2C8YB 2V6NA 3BG4C 1A7SA 3EE7A 4I8HA 3EA7A 1A3EH 1GG6B 6LPRA 3U1IB 2ZU5A 1AKSA 2BY9X 2TGTA 3S69A 1HIAA 4K69A 3TGJE 1GJCB 3M61U 3A8AA 1NPMA 1J16A 4F49A 1HAYB 1WQSA 3R3GB 3SUDA 1BRBE 1EFRD 3LH1A 1DWEH 3SJ8A 5F53A 4D8NA 1U6QA 1YY3A 2BY6X 2ESTE 3DSPA 4ASHA 2SFAA 3PLKA 4XSKU 3KCGH 5J4QA 6ESTA 4O9VA 1AE5A 1O2SA 1O3BA 1Y5AT 3RC6A 1FPCH 3QGJA 4ABDA 2IOTA 3ZZ3A 5TJXA 1GHWH 1L1JA 3LPRA 5SGAE 3SNEA 5CMXH 1C2FA 2JJ2D 1GDQA 4NA7A 5FBIA 5DG6A 1CGHA 1DT2A 1GBTA 1FAKH 2R3YA 3FKSD 1O5CB 1FZZA 3LKWA 1HUTH 2O8UA 4WJG2 4BTIB 1FX0B 5EXMA 4UE7H 1GCDA 2JDID 3O8DA 1RTKA 2ZTYA 3EAJA 3FZDA 5FBEA 5CE1A 2G5NA 5HM9A 1UK2A 1F5LA 3F9GA 3CS7A 2ZHDA 1V2JT 1SGFG 1O2ZA 1BTPA 2CXVA 3SUFA 2B9LA 3OAAD 3RXLA 2BLWA 5GXPA 5C1XA 3T29A 2KCYA 2FI5E 1HAIH 1C5MD 2H9TH 3LGWA 1UK3A 2W7SA 3PWBA 2EI6A 1WXRA 1DLKB 1N6XA 4B1TA 5HGGA 1GJ6A 4YO9A 2AMPA 4AFSA 1IQFA 3UNRA 3TNTA 2JIZD 1MTNC 1THPB 4ZHMU 2F9BH 1DLEA 2VINA 2OXSA 1D9IA 4TY6A 4Y0ZE 3VB4A 1DOJA 1TPOA 2VWMA 2GMTB 4PROA 5FPSA 1O5GH 1OYTH 2A5KA 4JYUH 1XXDA 3E3TA 4X1RU 1AIXH 2GCHF 2XC4A 1V2MT 1YF4A 3CP7A 4FUGA 2WINI 3W95A 5C5NA 1YLDA 2KX4A 1BDAA 1LVMA 2BB4A 1T4UH 1NRPH 3PTNA 1C2JA 1QCPA 2ZNKH 3P8FA 5T6DA 1XKAC 3AAVA 2ZWLH 4TY7A 3GCHB 1MAXA 2GV6A 3QDZB 4NA9H 4FU9A 3RXGA 1J8AA 1SQRA 3RU4D 4RI0A 4ZHLU 1LHGH 3FP8E 1IQGA 3MWIU 1GI6A 3STJA 4UEHH 3M3TA 1YCPM 3KF2A 5GDSH 1O2NA 4GCHF 3RXHA 2VVVA 1GBMA 5TCAA 1AZ8A 3BTWE 2J97A 1NBME 1THRH 2OBQA 1QURH 1SLXB 1UTKA 4ACBA 1SKYE 2ZPQA 1GBKA 3TPIZ 2QGRA 2ANMH 2W6ID 1H9IE 1FY3A 5T6GA 2TRMA 1Y3YA 2GDDA 3GS9A 4I8LA 1WYKA 3SHCH 1UCYE 1K1JA 1W0KD 2ZI2H 3VPKA 2G52A 3TK5A 3TGIE 2FX4A 2VB0A 2ZFQH 1S84A 4D9RA 2G81E 4AGKA 2ZKSA 2QF4A 2H9EH 2AH4X 1DDJA 2W7UA 4MNVA 1KY9A 1ZZZA 3M3VA 4MPUA 4U01A 4K1SA 3SV6A 3W94A 1K1NA 1IQHA 1SBWA 1UCYH 2P8OC 2WV4A 3KHVA 1O2UA 4WMDA 1C2IA 1Z6EA 2AMQA 3BV9B 2Z9KA 2ZDAH 2B8OH 3LGUA 3NZIA 1SGIB 1JWTA 2L74A 1JIMA 5A2MH 1P01A 4TYDA 2VIWA 1TX6A 1ESTA 3HGPA 5B6LA 4Q7XA 4DIHH 2P93A 4X1PU 1ABJH 1O2OA 1ZTKA 1EJAA 4DGJA 1GMDF 1SFIA 1NRSH 2CMYA 3A85A 1QBNA 4WF8A 4XE4A 4ZHAA 1Q3XA 2Z9GA 3LH3A 3T26A 4CRCA 3N7DA 1GJ8B 3UUZA 1HAPH 3SU5A 1HJ9A 1LVYA 1IQIA 5LPRA 1HNEE 1CQQA 2P16A 1HJ8A 2SGQE 1AI8H 4AC9A 5ABWA 4ZXXH 1C2MA 2STAE 2Y7ZA 4IW4E 4GPGA 1NROH 3URDA 1T8MA 3P95A 5EJ1A 2ZDMA 1FV9A 1GVKB 2IN2A 4XBCA 2BD9A 2PKSC 2BDGA 3QO6A 1G3DA 4D76A 5JB9S 4AB8A 8ESTE 1HYLA 4JZIA 3PRDA 5BPEA 2PTCE 2BD7A 7GCHG 1K1IA 2FOEA 1C5QA 3O8BA 1SGDE 1MZDA 3RDZA 3RXVA 1TIOA 1HBTH 3RLYH 5DGJA 4ZKRU 1G32B 4AGJA 1IOEA 1UVTH 1RIWC 4X6MA 5JBAS 1WCZA 3MH4A 4I86A 1BHXB 3BTGE 2CF9H 3ELAH 2CF8H 1C1VH 1F2SE 1MUEB 4XD7D 4WXIA 2GDEH 1LPKB 2ZEBA 5K0HA 1PPEE 1SHYA 2HPQH 1M9UA 1AQ7A 2H1UA 1UTNA 3A7ZA 3ATLA 1F0RA 4IGDA 3PMJA 4R8TB 2J9NA 1O3JA 3U98H 1VJ9U 1CT4E 3V0XA 1V2OT 1MBMA 4XRNA 2Z3CA 4X8TH 3LU9B 3T28A 1Y3VA 4MNYA 2BQ7B 2I6SA 3H7OA 4ZAEA 2ODYB 3KQEA 3MTYA 3NK8A 3RM2H 3P8GA 2WPLS 4YT7H 3RMOH 5I46H 1TFXA 3ZVFA 1HAGE 3OFND 1S5SA 2D26C 4OS1A 1PPCE 2XXLA 1EX3A 1Z7KA 3GY7A 1MU8B 1H9HE 2QY0B 1S82A 1TNJA 3A7VA 3GCTG 1K0HA 3F9FA 3TH2H 1WU1A 4I33A 4UFGH 3V12A 1ZSJA 1O3CA 1XM1A 2GCTC 1HB0B 4WH6A 1KXCA 2FP7B 4FUFA 3SN8A 1DX5M 1QB6A 3PO1B 5FPTA 5JPMH 1UTOA 1BZXE 1KDQB 3UWIA 4TSFD 5GPIB 2OC7A 4A6LA 1P09A 1K2I1 2TBSA 1RGQA 2WPIS 4WMEA 1C1PA 2PKAA 4B6EA 1LPZB 3OYPA 3E0NB 3RXCA 1P03A 1GHXH 1UK4A 2GZ8A 5E2OA 1YYY1 4GAWA 3T5FH 1C5UA 3E1XB 2AHME 2RA0A 1V2WT 4VGCB 1W10U 2RDEA 4Q2KA 2PFEA 1E1QD 2HOBA 1MKXH 4E7RG 3TIUA 1AVXA 1IQNA 1QFKH 1P04A 2PSYA 1ZTLA 3R0FA 1H8IH 2IJD1 5DN6D 3MI4A 4Q4LA 3AVZA 4NIXA 1VZQH 3SORA 1BQYA 4ACAA 3U69H 5C3NA 1AVGH 4NZQA 1BTWA 2BYAX 5L30H 1QJ1B 3B8JA 2FPZA 3UOUA 2FOMB 1GDNA 5A0CA 1IHTH 1PPBH 1EZUC 1QA7A 3TJUA 3DUXH 3EQ0H 3N7EA 1FN6A 1QNJA 4X2XA 3KQCA 2VGCC 3ZZ6A 2PP6A 1TPAE 2ZDLA 3LGTA 1PFXC 1TBQH 3E0PB 1WUNH 1WV7H 3FANA 5LPFA 3AW0A 2JETB 2F9NA 1DSTA 2OUAA 2J34A 2OTVA 2TGAA 1EZQA 1N8OB 1TA6A 2UUJB 1H8DH 2C93B 3S9AA 1CBWC 1P3EA 5C2ZA 1ZJKA 3A82A 1EP6A 3UNQA 4BAKB 1GMHG 1SGYE 3D65E 1V2TT 4U2WA 3GYMA 1NFXA 5DJ7A 1ZR0A 5KEDA 4DIIH 2PW8H 4A92A 1XX9A 4KP0A 1TMTH 1BBRH 1NO9H 5F8ZA 1AMHA 1CA0B 3MU5A 1C5VA 1D3PB 1JIRA 1Y3XA 2G4TA 5ESBA 1O36A 2TPIZ 1MH0A 2ALVA 1WQVH 4IMQA 3VG8A 4YOIA 1OWIA 4K1TA 1UCYK 3MFJA 4A1XA 5TCCA 3SI4H 1NT1A 1GI8B 2XTTB 1YP9A 3ZZBA 4LZ4B 1O2IA 1NN6A 4A5TS 1HIAB 1EKBB 3GDUA 3HPTB 1T32A 3DHKH 3BF6H 1DUEA 2THFB 2BZ6H 1O3AA 1YLNA 1ACBE 1H9LB 1XXFA 1L1NA 4X1SU 2PHBA 1D3TB 1OKXA 2GD4B 3KL6A 3OSYA 3GY8A 3M5OA 1Z6JH 5CDFE 5FHTA 4ISLA 1H1BA 2QXIA 1CHGA 4IC6A 5EPNA 3QWCH 1G9IE 1PPHE 4P02A 2KCOA 1BCUH 1NY22 4JZEH 3ZVDA 3BIVH 1C9TA 3OEED 3ZVBA 3GCTF 1UMAH 1BRAA 2RG3A 3MNXA 1QQUA 4CRGA 2Q6FA 4Y8YA 1C5XB 3I78A 1Y3WA 1EJMA 1EAXA 2L6OA 2VJ1A 3M5LA 2R3UA 1C4U2 4NWKA 1EPTA 2HVYB 2M5TA 1K9OE 5T6FA 2FX6A 2QV1A 4JK6A 1BMFD 5CHBA 1QR3E 1P05A 1E37B 5A0AE 1QL7A 1VITH 1L2EA 3GOVB 4DT7B 2BDYA 3BTDE 1BTXA 4CBNA 1MKWH 4YOGA 2C8WB 1HAZB 8LPRA 3K65B 1CU1A 3K9XB 3MNBA 5EGMA 1T4VH 3ZZ8A 3RC5A 4XBDA 3RUOA 2PV9B 2FEQH 1PQAA 3EYDA 1GI7B 1O39A 4D9QA 2AIPA 2ANYA 4J2YB 7KMEH 1D3QB 1SL3A 4F4OC 3RXTA 5K7RA 1E0FD 1LCYA 1ZHMA 1MCVA 1C1UH 4MNWA 1RRKA 1AHTH 4E7NA 1G37A 1HJAB 2ZHQH 5E2PA 4DW2U 2F83A 1T8LA 2BX4A 1P11E 1NS3A 5E0GA 4ZKSU 3GY6A 4FVBA 4IMZA 3B9FH 1RS0A 3TNSA 2AMDA 1DFPA 1HRTH 1C5LH 3HKIB 3HGNA 3DFLA 1SMFE 3QN7A 4MG3A 3UNSA 3O8RA 2STBE 1GJAB 1G30B 5GCHF 3BTTE 4HGCA 1NU7B 3QGNB 3E16B 1QA0A 1L1GA 1CA8B 2AGEX 5HKKD 2QF0A 1YPHC 1GG6C 1TRYA 4KTUA 2VVUA 3BEUA 1KMHB 5E8EH 4Y8ZA 1AUTC 2WZQA 4MQAA 2FOGA 2ZDKA 4H6SB 3C27B 3LDXH 4OS6A 1DWBH 2PR3A 1GMHF 3RMLH 2VH6A 3UTUH 2UWOA 1GBLA 1VGCB 4O3UA 1BMAA 1FY5A 3OY5U 1P2MA 2VWOA 2KFWA 4MPWA 4MPXA 1UTJA 2GTBA 2AYWA 5C0UA 2P95A 4LXBH 2AS9A 4XBBA 1BITA 3FP6E 3FFGA 4NSYA 5L2YH 2LNCA 3M7UA 3SYJA 1WOFA 3UOPA 2FOHA 2AFQB 4QT8C 5AFYH 1GJDB 3TLOA 2YMSB 2AGIX 1ELAA 1TNKA 3N99A 3FOAA 1GHVH 2F43B 1ARCA 2NWNA 1QZ8A 4JZ1A 4K5ZA 3CENA 2BY7X 2F9VA 2RCEA 1N6YA 1XVOA 2FLBH 2BDAA 2BMGB 4AB9A 1W11U 1FI8A 3P8NA 1VITG 4OS7A 3TH4H 1CE5A 4CRDA 3VEQB 1LPGB 2OINA 4TWYA 1GGDB 1Y59T 1CO7E 4AORA 1W12U 2HPPH 1VCQA 3FAOA 1O38A 3MO6A 4UONA 5EJZA 3NXPA 4RKJB 1ZYOA 2F9PA 1GBCA 1OP8A 1EUFA 1GJ9B 5CHAB 1GCTB 1OP2A 1ORFA 4YTAA 4YESB 2VH0A 1UVPA 1W7GH 3M7TA 2XCNA 4BAQB 1Y8TA 2XC0A 4X8VH 3SNCA 3DT0H 9ESTA 1DE7H 4K8YA 3M35A 1W0JD 1MZAA 4OS5A 4JMYA 2ZDVH 1V2ST 2R2WU 1NBMD 1QRZA 1RTLA 1ZLRA 1ZPZA 3WWBA 2GMTC 3SGAE 1SGFA 1YPEH 2F3CE 1NFUA 3GDSA 1O5EH 4X6PA 2VIVA 1OX1A 1PPFE 3QX5H 3PRBA 2VIDA 3BTKE 4X6NA 3RP2A 3WWFA 2BM2A 3LJJA 3F6UH 4GHQA 4NZLA 5DSFA 1S0RA 2AERH 3GCHC 3LGIA 2A5AA 4CH2B 4ZXYH 1PYTD 5DP5A 2QF3A 4BXSA 5C67A 4IC5A 3MHWU 1NRRH 4RT0A 5DPAA 1O5FH 5A8XA 2TGPZ 4A1TA 3GCOA 1EAIA 1GBJA 1YPJH 5F8XA 3SGQE 2XWAA 3FO8D 3M7QA 3SGBE 3UAIC 2HRVA 1V6DA 1SR5C 3O8CA 1BTZA 1S6FA 3VGCB 3IITA 3A7WA 1P2NA 5EW2H 1J15A 4NFFA 1UTLM 3P70B 2Q6GA 1QBVH 3S9BA 2OC8A 2M2AA 2ZZUH 1EOJA 1GJBB 4OGYA 1P57B 3M5NA 4YOJA 2FYRA 4KTCA 2ZHWH 2ZGCA 1O2PA 1C5NH 1F92A 1UVOA
chains in the Genus database with same CATH topology
3ZZAA 3A87A 3ZVGA 6CHAB 2JH6D 5FX6A 1W7XH 3F9HA 3RXEA 4X2WA 2XW9A 2V35A 3M3SA 3SV2H 1GHZA 1N1LA 1NFWA 2GVFA 4NA8A 4THNH 3ZVCA 2WYGA 2A2XH 1QHRB 1TX7A 2ZPRA 3Q3XA 4CR9A 1FJSA 1Y3UA 2J95A 1BRCE 1TWXB 4CRAA 1O37A 1PYTC 3BTFE 3M36A 3K2UA 3U9AH 4ABAA 2A1DB 3PV4A 1Z1JA 1SGEE 3MMGA 1JXPA 1P06A 1SLWB 2ZFRH 4K1EA 5LH8A 3Q00A 2ZIQH 1GJ4H 4DOQA 3PMAB 4WMFA 4LZ1H 3SU0A 1SOZA 1BB0B 4XFQA 4AN7A 1AD8H 1C2LA 1O3NA 4K3JA 1G2MA 4Y6DA 1V2KT 1K1OA 4O97A 3MU1A 1HAHH 2PKAB 2Y6TA 5JBTA 1QY6A 1OSSA 1LDTT 1HAVA 1LKAA 1ANDA 1FY1A 2GP9B 1INCA 3TITA 2A4GA 1C2EA 3MO3A 3A8CA 1VITF 3ZYEA 1Y5UT 1GI9B 2A0QB 1XUHA 2D1JA 2BQ6B 1C1MA 2YNBA 4H4FA 1K28D 2JKHA 3S0NA 1GBHA 3TK9A 3RXPA 2A45B 1C2KA 1OWJA 5EW1H 3QLPH 5FPYA 1YPLH 1BMLA 2SGAA 2ZU2A 1EZSC 1P2IA 2QC2A 1BTHH 4RSPA 1B7XB 1GMCG 1O3MA 3U8RH 1GJ5H 1BJUA 5C20A 3L33A 4GVUA 2RDLA 1GHAG 2DUCA 2C8ZB 1SSXA 1A1RA 2Z3DA 3SQEE 1S0QA 3EDXB 1O5DH 1DY9A 1GI0A 2EEKA 3V13A 3MNCA 2OLGA 3BTME 1CGJE 4FU8A 3SOSA 1C2HA 1EJNA 4AFZA 1C2DA 4H6TA 1UJ1A 2O9QA 5JYIA 4Y8XA 1UHBA 3Q3YA 3UWJH 1WAYB 4XDEA 1T8OA 2QCYA 1LHCH 3RXBA 3STIA 2F9UA 1FDPA 1S83A 2BLQA 2GV7A 4DG4A 3RXFA 3MH5A 3P6ZB 2ALPA 4XOJA 2P94A 3H5CB 5C5OA 9LPRA 2W5EA 1O2YA 1YCPH 3D62A 4KTSA 2SNWA 1KTTB 4B2CA 4B76A 1H4WA 1SI5H 2BVRH 3A7TA 2GGVB 3E90B 4FUDA 1A4WH 1CSOE 3ZVEA 1YKTA 3PO1C 5FX5A 4ABBA 2OD3B 1P9SA 1AFEH 3BTEE 1KLJH 1FONA 3AW1A 5DP9A 2A7JA 5A0BA 2ZTXA 2GKVE 1J17T 1SQOA 4O03A 2PSXA 2ZFFH 5A09A 1C1WH 1F0TA 1IQKA 3HATH 1HAXB 1S81A 2ZFTA 2ZP0H 1C5RA 4ZKNU 4NG9H 2EC9H 5HXFA 1O3EA 5DP7A 1A61H 1C1RA 3ZZ9A 4VGCC 1QJ7B 1KXDA 2ZU4A 1AWHB 1ZSKA 1O5BB 1C5PA 1PQ7A 3Q77A 5EOKA 1OOKB 1Z71A 2SGDE 2GX4A 1KXAA 1KIGH 2ZGHA 4I8GA 2XBYA 2Z6BD 5EG4A 4ABGA 1UTQA 1GI5A 4UD9H 3A83A 1EPTB 2BY8X 1KLIH 1A2CH 1NU9A 3PB1E 1A5HA 1EAUA 1GHYH 1OS8A 4DVAU 2NU4E 3VB6A 2PUQH 2J92A 3HK6B 4JZFH 3E8LA 1MBQA 1FLEE 3F9EA 1KXEA 1TPSA 1IQJA 1BIOA 3AASA 1AB9B 2BDIA 1SLUB 1A5GH 2FTLE 2O8WA 3NKKA 2IPHA 2JETC 2Z3EA 3JZ1B 1O31A 5HM2A 2G8TA 1QL8A 1BRUP 1LO6A 3U8OH 3MH7A 3SNDA 3SNBA 3VB7A 4U32A 1N8OC 3RLWH 2A2QH 3LGVA 4A1VA 3SUEA 3UREA 3LJOA 3TK6A 2OC0A 2R2MB 2FYQA 3BTHE 3LT3A 5JDUB 3QTVH 1K1PA 1MU6B 4CBOA 2HLCA 1ANEA 1BBRE 4FUHA 4TWWA 4WXVA 4WH8A 2ULLA 2ZA5A 3A8DA 2ASUB 1L0ZA 3M37A 4Y71A 1AGJA 1CA0C 1MTUA 1B0EA 3SBKA 1MAYA 2QIQA 1J14A 1C5YB 2CHAB 5EQQA 3SU3A 4FUIA 4WWYA 4D7GA 4UFFH 1O5AB 1O3KA 3V3MA 1BJVA 1V2PT 1IAUA 1GHAF 1ZRBA 7GCHF 1GBAA 2J2UA 1ZPBA 1ANCA 1AE8H 2ZCLP 4K60A 1WSSH 4Z6AH 3S9CA 1GL1A 1O3FA 3A8BA 2EA3A 3P8OA 1VJAU 2CN0H 4RN6A 1DM4B 1P2OA 1EOLA 1G3CA 4UFEH 1G3EA 1QIXB 5JBBS 4UFDH 1QBOA 2UWLA 3TH3H 2FS9A 2XRCA 3AAUA 5AFZH 5FCKA 1O2QA 1GBFA 3EGKH 2UUYA 4M7GA 1P9UA 1A0LA 2FDAA 3PTBA 1E38B 4OGXA 1V3XA 2A4RA 4AFQA 4AG2A 1SOTA 1X7AC 2PTNA 1SG8B 1O3HA 1AU8A 1TQ0B 1AFQB 2A4QA 2DE9A 2W3KA 1KYNA 4GUXA 2ZO3H 2ODQA 3PYHA 5HMAA 1XUGA 2BX3A 2VIPA 1MQ5A 3SUGA 4KGAA 1O2WA 6GCHG 1TNLA 2G5VA 1MCTA 4JYTA 1EQ9A 3ATWA 2WPKS 2QAAA 2Z9LA 4R0IA 2BVSH 1JRSA 1K22H 1YLCA 1SGTA 3TJVA 5JB8S 3UY9A 1GBIA 3F1SB 3HK3B 1MD8A 1P0SH 4K8BA 5A8YA 4Q7YA 2WUCA 5C1YA 1SGNE 3A89A 4UDWH 2Y5HA 2BXTH 2PLXA 2BLOA 2FESH 2H5CA 1A5IA 3ODFA 1FPHH 3SJKA 1AWFH 1C4V2 1HJAC 5A8ZA 3DD2H 1TALA 4NIVA 4I8KA 1YBWA 1D6RA 2H2ZA 5EXNA 5GJ4B 1SGCA 1VR1H 4Y10E 2A32A 1C1SA 1F5RA 4JZDH 4MDSA 5FCRA 3ODDA 1RD3B 1HXEH 1E36B 1GL0E 3Q76A 2R0KA 2EI8A 5AVDA 4A7IB 1OWDA 5DK1A 4ZKOU 2BVXH 1Z8JB 4X6OA 1HAOH 3PLBA 3A7XA 3KIDU 1LTOA 1O3PB 5EQRA 1TOMH 1YCPK 1CT2E 2HNTE 2ILNA 2FOBA 2AGGX 3ESTA 2A7HA 1SLVB 4CREA 1NESE 3URCA 3SV9A 1Z8GA 1A0JA 1ZJDA 3RMNH 3L6PA 1Q2WA 4Y79A 3PROA 1C1QA 1VGCC 2P3UB 3NWUA 2ZU3A 3ZV8A 4ZUHA 4H42U 2F91A 3ZZDA 1NC6A 1L4DA 3PMBB 1DANH 1O34A 1IQMA 1OXGA 1WBGB 4CR5A 5BRRE 1O30A 1AN1E 1O2LA 5DO4H 2BOKA 3TGKE 2ZG0H 4AX9H 1S85A 4ZH8A 1ETTH 2K1QA 1GPZA 2VIOA 4WY3A 2WPJS 5AF9H 4U30A 1O2JA 1K1LA 2H9HA 1G2LA 4CHAB 5T3HA 1YPMH 5GIBA 1TABE 4B75A 2PUXB 4GSOA 4MPVA 1K21H 1TBRH 1QRXA 4FUEA 1UTMA 3V7TA 2FLRH 2XC5A 1MKXK 1RTFB 5G4BA 2G51A 1TE0A 2GZ7A 4BXWA 4B71A 2LPRA 1GGDC 2FM2A 2FMJA 2H6MA 3RXSA 1TGNA 1NTPA 3GYLB 4I32A 4YLQH 3QZQA 4BTUB 3D49H 4AYVB 3BG4B 3KQBA 1W0YH 4DJZB 5FXLA 3BN9A 1DSUA 5H4IB 5CHAC 1EB1H 1GCTC 3RC4A 1ESAA 1RXPA 1RJXB 3ZVAA 2FOCA 2G00A 3QK1A 2HALA 3ZZ7A 3GY2A 2XYAA 4E06H 1C5TA 2FIRH 2QA9E 1JMOH 3M5MA 1NRQH 1HAVB 1SGRE 1Z1IA 1Q31A 3T62A 1QTFA 4Y0YE 5L6NH 1ZHRA 3TJOA 5F6MA 1XUJA 1TB6H 6GCHF 1GJ7B 1GVZA 4I7YH 4SGAE 1GBDA 1C2GA 4HTCH 1GMDG 1FIZA 2BD3A 1SB1H 4BAMB 2YOLA 1W13U 2BQWB 4K2YA 1AO5A 3A80A 3GICB 1W2KH 3H7TA 1TRMA 4KKDA 1ZHPA 1BBRK 1EASA 2PWXA 4ISIH 2R9PA 5L2ZH 1D4PB 2PGQB 3U1JB 5EODA 1F0SA 5IYTA 3G01A 1PPZA 2ZGJA 4X1QU 2XBVA 3FP7E 1GBEA 1ETSH 3BSQA 1ELEE 3RXUA 3SQHE 3RXIA 2O8TA 1LMWB 2W26A 3GY5A 2FODA 2B0FA 3LONA 3VGCC 3PMHB 2ZPSA 1L4ZA 1O2TA 5GWZA 1ZOMA 1O2MA 4FUCA 3ATIA 1TOCB 1EZXC 1UTPA 4JYVH 4ISOA 3SI3H 3A84A 3UR6A 2QYIA 4AZ2B 1TAWA 5DKMA 2P59A 3OX7U 6CHAC 2BD2A 2NU1E 2NU2E 4Y11E 1JRTA 2ZECA 1UHBB 1V2RT 1LVBA 4WVPE 1O3IA 2FO9A 2OBOA 1TGSZ 1PJPA 1ELGA 4HI3A 3ZYDA 3VXFH 1G36A 2Z94A 5AHGH 1O2VA 2FI3E 1MTNB 1MTSA 1O2KA 1FQ3A 3MU8A 5JBCS 1BOQA 3EA8A 1MQ6A 1C1OA 2WUBA 2CV3A 1OP0A 2A7CA 3KGPA 7LPRA 5I25A 3KQDA 3UFAA 2CJIA 4MVNA 2Q1JA 4INHA 3L3TA 1DXPA 3P92A 1GI1A 3OTJE 4Y7BA 3OU0A 2HVXA 1IQLA 1P02A 4I31A 1GI4A 3RXJA 1MKWK 1MMJN 2UUFB 2ODPA 1V2VT 1P12E 2OCVB 3P17H 1BTUA 2QN5T 1FIWA 1F7ZA 4ABIA 2UWPA 1DITH 1FUJA 1ARBA 1UO6A 4YT6H 4FVDA 4INLA 5EQSA 3RXDA 1TGCA 3MNSA 3NUMA 4MTBA 1ZMNA 2DE8A 3FZZA 2O8LA 3GY4A 3S7HB 2BD4A 1FN8A 4NWLA 3FVFB 4AG1A 4YM9A 1YPGH 2V0BA 1OWKA 1E35B 3VXEH 2Y81A 1T7CA 5F8TA 3RU4E 3T25A 1DWCH 3MU4A 1P10A 2BZAA 2FOFA 2ZQ2A 3T27A 1ESBA 2FZZA 4FUBA 2J94A 5HYOA 2GT8A 2WPMS 1VCPA 1XUFA 2AEIH 5E0HA 1V2LT 3ENSB 5EPYA 3HKJB 1FNIA 2P8OB 1ZGIA 4X0WU 2ZQ1A 1S6HA 1DS2E 1HGTH 3Q3KA 4IN1A 1HPGA 3BEFB 2SGEE 5F03A 5LGOA 1TA2A 1TBZH 1TONA 2R0LA 1DPOA 2P3TB 2FOAA 1EAWA 4IN2A 2Z9IA 1KXFA 4OS4A 3LIWA 1GHBG 1WTHD 3SU2A 2OQUA 1LVOA 3A81A 1AY6H 4YZUA 4J1YA 1HCGA 3GDVA 3CS0A 2A31A 4NFEA 1C9PA 1SQAA 1C5OH 1D3DB 3ZZ5A 1XMNB 2BLVA 3B23B 3K6YA 1LHFH 1KTSB 2SNVA 5C1UA 2F9OA 1IHSH 1GI3A 1Y5BT 1CHOG 1ELTA 1HFDA 2XNIA 3SW2B 3GY3A 1TGBA 2GT7A 2ZFPH 2HNTF 2ANKH 3IG6B 4DCDA 4JK5A 4I8JA 4MNXA 1ELBA 4ESTE 3NCLA 1ETRH 2ZDNA 4ABHA 8GCHG 2PKSB 4B74A 2SGPE 3UPEA 2OC1A 4NSVA 1O2XA 1BMMH 3I77A 4ABEA 4X8UH 2WV5A 1A3BH 4B2AA 2WPHS 1B5GH 1ZGVA 2OQ5A 2ZCKP 2KAIB 3A7YA 3SJIA 1O33A 5ETXA 4BNRA 1RIWB 2NU0E 1P2QA 2G55A 1EB2A 1GWAA 1LKBA 3ATMA 2W3IA 3PLPA 3TVJB 1P3CA 4SGBE 1O2GH 1O32A 3RXKA 2Z9JA 3SU6A 1TMUH 3GISB 1BMNH 1CGIE 1EPTC 2ZHFH 3SV7A 3K6ZA 1NRNH 1SQTA 2Y7XA 1PQ5A 1PPGE 2HGTH 1PQ8A 3T2NA 3ATKA 2WYJA 2ANWA 4HZHA 2V3HH 4FUJA 1EP5A 3VB5A 1AUJA 1AB9C 3BG8A 1F0UA 1OYQA 5E0JA 1SC8U 4Y7AA 2BXUH 1TLDA 2Y5GA 3RXRA 1P8VC 1O2HA 2AIQA 3SU1A 1O2RA 2FXRA 4IS5A 3C1KA 1C4Y2 1TGTA 3SZNA 1IQEA 1ELCA 1Z8RA 1B0FA 2GCTB 3I29A 3QTOH 1GDUA 2CGAA 1BTYA 1XKBC 4NGAH 3MO9A 5EU8A 1QB9A 1KSNA 1C5WB 5B6OA 4B73A 4TPIZ 5IDKA 3LGYA 3N7OA 4YLUA 1WTGH 2TIOA 1E34B 2UUKB 1FY4A 4BANB 2B5TB 1NM6A 1AVWA 3SJOA 1JBUH 2CHAC 4X2YA 1OPHB 1T8NA 4ABFA 1P2KA 3EE0B 1UVUH 1EATA 2D2DA 1DVAH 1GI2A 1C5ZB 4NIYA 5DP3A 1W8BH 2JH5D 3ZZ4A 2BTCE 3JZ2B 5J4SA 4O3TA 4X8SH 1FAXA 5DP6A 3SJ9A 2ZCHP 1QJ6B 1DICA 1C5SA 3LOXA 4JCNA 1T31A 3BEIB 1GMCF 5GCHG 1W0ZU 7ESTE 4TPYA 3KEEA 4Q80A 2OP9A 2FTMA 1ANBA 4ZMAH 1GHBF 2ZGBH 2ZU1A 1HXFH 4FXGH 1EXFA 3SNAA 1SHHB 5LPEA 1LHDH 2NU3E 4KELA 2J38A 4GHTA 2B7DH 3A86A 3PWCA 2VGCB 1O0DH 1ZSLA 4NIWA 2QXGA 3RXQA 3SO3A 3RXOA 4Y76A 2FS8A 4IBLH 1BUIA 1HDTH 2BDBA 4AYYB 1LHEH 1ZTJA 4BTTB 1XVMA 1CVWH 1W3CA 1CHOF 1TYNA 5PTPA 4Q7ZA 4CRBA 2Y80A 1W14U 1OWHA 1CBWB 3SU4A 4ISHH 2KAIA 1HLTH 1QB1A 3RXAA 1CT0E 1J9CH 4DY7B 4ABJA 1AFQC 1GBBA 3UIRA 1BA8B 8GCHF 1ID5H 3MH6A 3MYWA 1MD7A 1BT7A 1SVPA 1JOUB 3OY6U 1ELFA 2XWBI 3SV8A 3RMMH 4CRFA 2BD5A 3EA9A 1AKSB 1VCWA 2VIQA 3UQVA 1HV7A 2C4FH 4BAOB 1YGCH 2ZHEH 2C90B 1FY8E 3E6PH 3ZZCA 1G3BA 1KLTA 3KNXA 3DFJA 2O8MA