1JIMA

Stereospecific reaction of 3-methoxy-4-chloro-7-aminoisocoumarin with crystalline porcine pancreatic elastase
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stereospecific Reaction of 3-Methoxy-4-Chloro-7-Aminoisocoumarin with Crystalline Porcine Pancreatic Elastase
pubmed rcsb
source organism Sus scrofa domestica
molecule tags Hydrolase(serine proteinase)
molecule keywords PORCINE PANCREATIC ELASTASE
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1993-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1jimA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1jimA01
2BYAX 5CHAB 2SGEE 2ANKH 2ZO3H 3JZ2B 1C1RA 3BTTE 2UWLA 8LPRA 5JPMH 3E3TA 2H6MA 1XUJA 1EZSC 1D6WA 3A85A 5EXNA 1UCYK 3MO6A 3GY6A 1NTPA 1ZSKA 5GXPA 5JYIA 2F9VA 2Q6DA 5A0AE 1AKSA 2J94A 3GICB 3OU0A 1QRZA 1P2QA 2C93B 1EAUA 1PPBH 1UTNA 1OWJA 3SO3A 4D9RA 1BJUA 1ELBA 4Y8YA 1OS8A 4UFFH 3RXMA 4UFEH 1Z1IA 1MCTA 1ZTJA 1P11E 2D26C 1Z6EA 1DS2E 1UJ1A 1C4U2 2W26A 4VGCC 4ZKOU 1F2SE 4MDSA 1WQSA 1EAIA 2PLXA 1P2OA 2BD9A 3FAOA 5EQQA 1HIAB 3P8OA 2WV4A 2BDIA 2Y6TA 3T25A 1A4WH 1FY5A 1Y3WA 2G00A 3EA8A 4I8LA 1GMDG 2ZDNA 1C4V2 4FU8A 1O5EH 3SJKA 3VB6A 2G5VA 5HYOA 2SGDE 3FANA 2ZA5A 1GBHA 5B6OA 2Z6BD 3RXRA 1C1QA 1IQIA 1C1NA 1X7AC 2ZPSA 3RXTA 1CVWH 1BOQA 2F9PA 3QX5H 1O30A 4NIWA 2ZGXH 3SGAE 1FDPA 1OYQA 3BG4C 1NM6A 1XKAC 1FIWA 2NU2E 2HPPH 2XBYA 1G32B 4A92A 4DCDA 2NU4E 4NZLA 5EPYA 3U1JB 1TRYA 1C5TA 1W7XH 1HYLA 1QHRB 1WTGH 3AW0A 4E06H 2ESTE 2EI7A 4BTIB 1C2HA 1JIMA 1NZQH 1TB6H 2M5TA 1C1OA 2Q6GA 3PM3A 4B74A 3SUDA 5H4IB 1FUJA 3RXSA 4I8HA 4AZ2B 1P10A 1BRAA 1GHAG 1SL3A 3MFJA 4CRFA 2ALVA 1P12E 3SUGA 1P06A 2WINI 2ZTZA 1Z6JH 2BD4A 3OY6U 4IBLH 4UDWH 1XVOA 4KELA 1BTXA 1K1LA 3ZYDA 4HI3A 5K7RA 4JZFH 1ZSJA 3UNRA 1CA0B 2P3UB 1H4WA 2A5AA 1OWKA 2PKAA 1KXEA 5K0HA 4F49A 4FUJA 1QQUA 1IHSH 4ZKSU 7GCHF 1SHYA 1A2CH 4ISHH 3ODFA 3MO3A 5C67A 4I7YH 3RXQA 4OS4A 2XWAA 1ZOMA 2XCNA 5JB8S 3UIRA 2A32A 3SJIA 2H5DA 1BHXB 3RXDA 1G36A 5F6MA 1UTJA 3JZ1B 1O3AA 2VVUA 1UTKA 4JMYA 3RUOA 3A8BA 5C1XA 3HK3B 2PGQB 3PO1C 4YOIA 3SHCH 3RU4D 3LGWA 3V12A 1C5ZB 1O5FH 2ZDMA 2FTLE 3SV9A 1W7GH 3MWIU 1TE0A 4K8BA 3D23A 4FU7A 1PFXC 1V2RT 1F5KU 2ZCKP 1BDAA 3ZZ4A 2Y5FA 3QLPH 5EQRA 2HVXA 5JBCS 1DUEA 2JH6D 1DUAA 3SU3A 2P8OB 1TRMA 3T2NA 4DIIH 3QGJA 4ZHMU 1A5GH 5C20A 4XSKU 4H42U 5A09A 3RM2H 2HOBA 3I29A 1ELTA 1O5AB 1LO6A 3TH2H 1S0QA 3UOUA 4IC5A 7LPRA 1O3HA 4X1QU 3L33A 1QY6A 1SQOA 2ZCLP 2A5KA 2H2ZA 4CRBA 2K1QA 1FN8A 1O2JA 1MBQA 2C8YB 2Y5HA 1GI6A 2H5CA 4DW2U 2FI5E 3TLOA 2PGBB 2ZDAH 1FZZA 3PMBB 1HGTH 2BDGA 1XVMA 2UWPA 2XRCA 1AWHB 4GLYA 2QXJA 3G01A 1XM1A 1C1VH 2VJ1A 3QTVH 3M36A 4OS6A 1HNEE 1IQHA 5A2MH 1BTZA 1QA7A 2TGAA 1PYTD 1RXPA 3ZVFA 2ZDLA 2GDEH 1BJVA 1HAVB 4B2BA 1GL1A 2J34A 4NSYA 1G2LA 1TOCB 3PLBA 2QF3A 5ESTE 2Z9JA 1YPHC 1TIOA 1O37A 1V2UT 2ZFRH 2WPMS 3RXLA 2J95A 3QZRA 2FM2A 4GCHG 3UQOA 2BDCA 1J17T 1D3DB 1CA0C 1ZR0A 2VH6A 5FBEA 3ZZBA 3LH3A 1C5VA 3GCHC 1FY8E 1L0ZA 2VB0A 2R3UA 1S82A 1C5XB 3O8RA 1HBTH 2BD8A 1AZZA 4ABEA 4XBCA 3EE0B 2R3YA 3MYWA 3RXKA 4CHAB 2FDAA 1WCZA 1C1UH 1NT1A 3RMOH 1OWHA 3AAUA 3CS7A 1NO9H 3F9GA 3H7OA 2GDDA 3TJOA 2A7HA 2O8MA 4LZ4B 1ESBA 1MTWA 1ZPBA 2C4FH 2QXHA 4IMZA 1WAYB 5L2YH 3RXGA 1QRXA 1D3TB 2P8OC 1GBCA 1GMDF 3SQEE 1TX6A 4H6SB 2BXTH 4B1TA 1SFIA 1TMTH 4CR9A 1UTQA 4OS7A 1KTTB 2FXRA 1AGJA 3TITA 1PQ7A 1QB9A 1V2KT 5GCHF 2BQWB 4K60A 2UUFB 1O3PB 4KTUA 5BRRE 1GPZA 4JZEH 4B73A 5EW2H 2FWWA 4BXWA 1NRSH 2Z9LA 3BEIB 5EXLA 5AVDA 1GHBF 2GGVB 3EQ0H 2B8OH 1C2LA 1THSH 2ANWA 4H4FA 3Q3XA 1JOUB 1BITA 4LZ1H 4U01A 2PFEA 2TGTA 1FN6A 4JK6A 1SR5C 4U32A 1GBTA 1QURH 2BLOA 1HRTH 1T7CA 4F4OC 3A8CA 3NZIA 4U2WA 1J8AA 4FUBA 4X1NU 1ANCA 3EA7A 3LC5A 2ZHWH 1PPEE 4JK5A 1THRH 4Z0KA 2EEKA 1BRBE 1Y3UA 1HAXB 2ZPRA 2GCHF 2PTCE 3TK6A 3LIWA 1AU8A 5TCAA 5T3HA 1MQ6A 1TPSA 3SV2H 4NA8A 4XBBA 1IQGA 1J15A 1A5IA 1NU9A 4HTCH 1TQ0B 1BA8B 2FS8A 1DWDH 2THFB 3SUEA 2CJIA 4M7GA 3MU8A 3DD2H 1O2WA 1GJ9B 4MVNA 5AFYH 1A3EH 3RXJA 3ATMA 1MZDA 3I78A 2STAE 2FOHA 3STIA 1KTSB 2GX4A 4CHAC 2J2UA 3PWBA 2BD7A 1MAYA 1RIWC 1BMLA 3SNDA 1SGFA 3SNBA 3IG6B 4ZXXH 2G81E 1EPTA 1K1NA 1J14A 4A6LA 2RA3A 5GCHG 1TBZH 1D3QB 1RTFB 3EYDA 1EUFA 4CRDA 1GVZA 1O3OA 1BRCE 1TNKA 1LHEH 2H9TH 3PYHA 1HJAC 1B0EA 3SU1A 3BEFB 1LCYA 1C2EA 5GPIB 3M7TA 1GJ4H 3RXVA 3SI3H 3E1XB 3SN8A 1THPB 3BSQA 3TGKE 3T62A 2F9OA 1SHHB 4X2WA 3M5NA 1ARCA 1CGHA 1ESTA 4FUEA 2IN2A 3RXOA 2PV9B 2IJOB 3A89A 5FPYA 1ARBA 4Z6AH 5C2ZA 3SZNA 1MD8A 1RRKA 3ZVCA 1ID5H 4NWKA 1Z8JB 5AFZH 5CMXH 2FESH 1ETRH 3V7TA 3NUMA 2JETC 2SGPE 1TX8A 2ZGJA 1AUTC 1YF4A 4OS5A 1TYNA 3FFGA 4ABFA 3SW2B 1XUIA 1XXFA 2HLCA 3FVFB 3S7KB 1O31A 4NFFA 2AYWA 3O8BA 5A8YA 1AY6H 2FLRH 1GI5A 2WPLS 1L1GA 3LGVA 3ZZ8A 1NC6A 1C2FA 3VB4A 4E7NA 1MTVA 1SGNE 2FI3E 1G37A 1VGCC 1ZZZA 1P0SH 1CU1A 1QL8A 4OS1A 1C1PA 1GL0E 3Q3YA 4X2VA 2PW8H 2ZQ1A 3RXBA 2R0LA 4I33A 2TIOA 4JCNA 3SHAH 1FV9A 2BY6X 1W11U 1CGJE 3V0XA 1AFQC 2ZECA 3TIUA 1CHOG 4DOQA 2OC0A 4YT7H 2O9QA 4CRCA 4D7FA 3MNXA 1FAXA 4R8TB 2BZ6H 3ATWA 1YPMH 3TNTA 1Q2WA 4D76A 3GYMA 4ZHLU 3A7ZA 1DT2A 1EP5A 1O2TA 4DJZB 3AW1A 3E6PH 1TGSZ 3NCLA 4FVDA 5L30H 1O3IA 1T31A 3R3GB 2GZ9A 5GJ4B 1P09A 1QJ1B 1CGIE 1SOZA 5EPNA 3SU5A 1AIXH 3AAVA 1UO6A 2G55A 4AFQA 1VJ9U 3A87A 2PSXA 5F8ZA 2XXLA 1RFNA 2NWNA 1TX7A 3ZVGA 1V2JT 1QBOA 2FTMA 4FUHA 1BBRK 3W94A 1MAXA 1E36B 1K9OE 1DSTA 2BOHB 2FZZA 1OKXA 3BTWE 4MNXA 4O97A 2BLQA 5T6DA 1DXWA 3MHWU 1C2JA 2OINA 1EJMA 1A7SA 1VZQH 3M7QA 5EU8A 3F1SB 1GBFA 1ORFA 1S84A 3F9HA 1GI9B 1GBEA 1O3FA 2HWLB 3OX7U 4LXBH 3T27A 2ZFSA 1GCDA 3GCTG 2FI4E 1TNGA 3LOXA 6GCHG 1INCA 1UTLM 1IQMA 1TPAE 1PJPA 1V2LT 2VIVA 2BOKA 2EI8A 3A84A 4NWLA 1KXFA 3UR6A 1O5BB 2QCYA 3N7OA 1T8LA 1ZTLA 3P95A 1WSSH 1VCPA 3FZDA 1GHYH 3ZV8A 2ZWLH 5AF9H 5C1YA 2FOFA 3OTJE 4X1SU 2OC8A 1TMBH 2OLGA 2IOTA 4I8KA 3RXEA 4O3UA 3UWJH 1ELAA 2DE8A 2ZFQH 1AB9B 1YPGH 3RDZA 3BTGE 1C2MA 1EASA 1TNLA 1K2I1 1KXCA 2WV5A 5GIBA 4D7GA 1DICA 1VGCB 2HNTE 2ZNKH 2F3CE 3DFLA 1C1MA 3RC4A 1GG6B 5FX5A 1ZTKA 2GD4B 2XC5A 1TGCA 4IN1A 2ZP0H 1QB6A 1DFPA 2ANYA 1JRSA 2F9BH 4X6OA 4NFEA 2BVRH 2EA3A 1MH0A 1C5MD 3LONA 5HGGA 3MU4A 3UNSA 1O3DA 1RS0A 1T8MA 1S5SA 3F6UH 4KTCA 2Q1JA 3RMLH 3TJVA 1FXYA 2A5IA 3A81A 4B2CA 1BTYA 1LMWB 1W0ZU 2C8WB 1GI0A 3DUXH 2EC9H 1TFXA 4K69A 3IITA 1GI2A 4WH6A 2XCFA 2PSYA 2ASUB 8KME2 1C1SA 2FP7B 3MH6A 1BTWA 3Q77A 4TWYA 5FCRA 1B0FA 2XWBI 1FPHH 4X6PA 3S9AA 1O34A 4BAQB 1K1PA 4BNRA 2VH0A 2WYJA 3CP7A 1ZMLA 1FY1A 2XBVA 2CN0H 1EZUC 3BIUH 4MPXA 2ZGCA 1H8IH 3U9AH 5A8XA 3MNCA 3TPIZ 2P95A 6GCHF 4A5TS 4YM9A 1HIAA 1O0DH 2FO9A 1SLUB 2Y81A 1MCVA 2A4GA 5DG6A 2BXUH 3U98H 2AERH 4ABBA 1VR1H 4BTUB 1O3CA 1C5LH 1YCPM 5EXMA 1K1OA 1AQ7A 3S0NA 1V2NT 1D4PB 5FCKA 3A7YA 3BIVH 1GI7B 1GHAF 2C8XB 1S0RA 1IAUA 4ZHAA 1UMAH 2TRMA 4WXIA 4X2YA 4ZMAH 3L6PA 1SSXA 3U8RH 2ZPQA 1D9IA 5TJXA 1LHCH 1P02A 1P2MA 1XUKA 1HPGA 3DT0H 1SGRE 4AOQA 2NU1E 3ELAH 1E0FD 1FY4A 2AGIX 3KEEA 3SV8A 1N6XA 2ZCHP 3TU7H 2H9HA 2F9NA 4ISLA 2CHAC 2FPZA 3SJ9A 3KQEA 3MMGA 4DGJA 4BOHA 3PO1B 3U69H 2EI6A 1O2SA 2W5EA 3ZZ9A 1QBNA 1HFDA 1OWEA 1LPKB 1FI8A 1WUNH 1O3LA 1DE7H 1EOLA 1MKXK 4ZH8A 5E0GA 1UVTH 1LVOA 1DANH 1A3BH 5TCCA 1AI8H 1DOJA 1BB0B 1GG6C 4UFGH 2ZTYA 4ZKNU 3BTKE 5F8TA 1O2PA 5F8XA 3HATH 4FUGA 3SV6A 3ATIA 3TK5A 1O2HA 2LNCA 8GCHG 1CHOF 4MPUA 5L6NH 1TOMH 5I46H 2AS9A 5FXLA 2AMQA 3SNAA 1S6FA 2GT7A 3MNSA 1DLKB 1O2KA 2FOMB 2FYRA 1ZLRA 1GVKB 1C2GA 1YCPH 1YPLH 4Q80A 4ABAA 6CHAB 4AB9A 3ZVDA 1EX3A 2FOCA 2FOEA 1BUIA 1W14U 4R0IA 2G8TA 3KCGH 1ZPCA 3O8DA 1ZSLA 1ETTH 1V2OT 2QY0B 3A88A 4JZDH 2G4TA 1QCPA 1AE8H 3SGQE 4MPWA 1HUTH 1MTUA 1WYKA 1N1LA 1SGDE 2BHGA 4FU9A 2GCTC 4ABJA 4Q7YA 1WTHD 1O3KA 4AORA 2TBSA 1GJBB 1W3CA 3UR9A 2XYAA 4DIHH 2ALPA 2ODYB 2P3TB 3GY7A 2RDLA 4TPIZ 1SI5H 2G51A 4B76A 1V2ST 1P01A 3KN2A 3P8FA 1WBGB 1DM4B 2CV3A 1SOTA 3RP2A 2ZDVH 5C5OA 4NZQA 1AVWA 4Q7ZA 3P70B 2BX4A 1MBMA 1GMCG 4INLA 1ZMJA 3GDUA 3TGIE 3LKWA 1GBMA 1C5NH 1H1BA 2KAIA 3ZYEA 1TNIA 4WF8A 3Q76A 1HCGA 2ZFFH 4WXVA 4HZHA 3VB5A 1OWIA 4GCHF 1F92A 3P92A 1TGBA 2GZ8A 2UUKB 4GAWA 1WV7H 2ZU5A 3K6ZA 3RXIA 1F0TA 3SU2A 2AMDA 1A61H 1XKBC 3U8OH 1W10U 1HV7A 1GBDA 2ZGBH 3SU0A 3H5CB 3NXPA 2A2QH 1O2OA 3GYLB 3GCOA 2C90B 1UCYH 3RXCA 1GHXH 2F91A 4TYDA 2FODA 2ZU1A 4UFDH 4JYVH 1GJ6A 2ZU2A 1YLDA 1O38A 4NA7A 1S83A 2C8ZB 3D62A 1FONA 1HDTH 2A4RA 2RG3A 3MI4A 1FIZA 4Y11E 2B5TB 3LH1A 1JWTA 1V2QT 1EAXA 1ANDA 1HAHH 1T32A 1LPZB 4X8SH 3ZZDA 1O2UA 1H9HE 4YESB 1XXDA 1HAIH 1NFUA 1PYTC 1EZQA 2DE9A 4K2YA 4DVAU 3ITIA 1QR3E 1ELVA 1GBAA 1SGTA 2UUJB 2C3SA 1S6HA 1Y3YA 2OD3B 4YZUA 2GMTB 3MU1A 1Q31A 1K1IA 1AMHA 2VIWA 3KHVA 3BG4B 1GHZA 1V2MT 1SLVB 2A7CA 3L3TA 3SJ8A 2GZ7A 1UVSH 2GP9B 3ZVBA 2BQ6B 3BTHE 1GMHG 1UCYE 4Y76A 2CF8H 2QA9E 4AG1A 4FUFA 2AEIH 2VGCB 1HAPH 1B7XB 1BBRE 4NSVA 3SBKA 5EODA 1K28D 4K1TA 5HM2A 2AGEX 2Z9GA 1JBUH 3FP8E 4Y0YE 4CRAA 1EP6A 1TMUH 3SQHE 1TALA 1SPJA 2XTTB 5T6GA 1C9PA 2SNWA 1QGFA 3S9CA 1AHTH 1V2PT 2A4QA 2OQUA 4IS5A 4B2AA 2BDBA 1RIWB 2BY5X 1H8DH 1H9LB 1IQJA 3RXFA 1GJCB 4H6TA 4IMQA 4WWYA 2HNTC 1ELCA 1ZRBA 4AGKA 1DX5M 2HPQH 4D9QA 3T29A 1G3BA 3TJNA 2PWXA 2Y82A 1O35A 3SU6A 1P2IA 3MOCA 2VIPA 2Y7XA 2FLBH 1AD8H 3QGNB 3GDVA 3OYPA 1KSNA 5DP4A 1HAGE 3SNCA 4AFUA 4J2YB 1HXEH 3KL6A 3HPTB 3QN7A 1EKBB 2Q6FA 1SQTA 2QF0A 1L1JA 1Z7KA 1YBWA 5ETXA 1JMOH 2CMYA 4Y79A 5J4QA 4XE4A 1GCTC 1GI4A 3HKIB 3M5LA 7KMEH 3GCNA 3S69A 1J16A 5CE1A 4DG4A 2R2MB 4GUXA 2XC4A 5DGJA 4Y71A 3BTFE 5CHAC 3SOSA 3OY5U 1V2WT 4U30A 1UVPA 2Y5GA 2Z3CA 1SMFE 5FHTA 1EJAA 1SFQB 5E8EH 1PPGE 2A4OA 1GVLA 1Z8IB 1HAYB 3ZZAA 1M9UA 4ISOA 2FX4A 3A7WA 4OGYA 2VIOA 1P3CA 2BY8X 1EQ9A 1UHBB 1HAZB 1BTHH 1P2KA 1YPEH 3V13A 1WU1A 3QO6A 1DWCH 5DPAA 1O36A 1N8OB 1QRWA 3RU4E 1AZ8A 1CE5A 1YPJH 3E91A 4A7IB 1YP9A 1CT2E 1KXBA 1XUGA 2XBXA 5DK1A 1KY9A 4GHTA 2O8TA 1AFEH 1GWAA 4NA9H 8ESTE 4THNH 3WY8A 2PKSB 4TWWA 1FAKH 5JDUB 1P04A 5DP5A 1EB1H 3RLWH 1D3PB 1ZMNA 6ESTA 3TGJE 4IC6A 1TGNA 2PUXB 3CENA 2W3KA 3HGNA 1OP8A 1BTUA 3QDZB 2VU8E 3ATKA 1K1MA 1KLIH 2Z3EA 4BTTB 4NIVA 1E35B 2CF9H 3M37A 4GHQA 2WPKS 1A0JA 3GOVB 2BLVA 1O5GH 2P94A 3T26A 1TWXB 1O2RA 3MH7A 1KDQA 5A8ZA 1NFYA 5E0HA 4CBNA 4JZIA 5LPFA 2AGGX 4X1RU 1UVOA 3QK1A 1SGPE 1P8VC 3LC3A 1A46H 1GMCF 1KXAA 2PUQH 2ZFPH 4E05H 3LDXH 3PMHB 1A5HA 3RXAA 4AG2A 1MKWK 5DP8A 1IQEA 3EGKH 4MNYA 1AWFH 2WPHS 1FPCH 1LKAA 4BAMB 3TNSA 1BMMH 4QT8C 2AIQA 2B9LA 4IW4E 4O3TA 1L2EA 2A0QB 4Y0ZE 1GBJA 1MTNB 4A1TA 3BEUA 2BDYA 1GCTB 3KGPA 2FOGA 1DXPA 5LGOA 1C2DA 1LVYA 1W8BH 4GVUA 1O2QA 2SGAA 2A31A 1BQYA 4JZ1A 3E90B 1V3XA 2W7SA 3DFJA 1W12U 2ZQ2A 5GDSH 5PTPA 1S81A 2QN5T 3M3SA 3VPKA 5JB9S 3C27B 1ZHRA 1BCUH 4KKDA 5E0JA 4PROA 3F9FA 2ZHEH 2ZFTA 2CXVA 1TNHA 3VGCB 5C5NA 2LPRA 3SU4A 1PQ5A 1U6QA 1QL7A 4AFSA 3UFAA 3VXEH 2F83A 3KQCA 2P93A 2FIRH 2PR3A 1BMNH 3K2UA 1OYTH 2STBE 1BBRH 1KXDA 1UVUH 2ZHDA 4OGXA 4MPVA 1GDNA 5HXFA 1P9SA 2PKSC 2H1UA 4SGAE 1CSOE 1MMJN 2GV7A 1BMAA 3B9FH 3MU5A 2VWMA 3C1KA 1O2IA 4I8JA 1XMNB 2AFQB 2PKAB 3GY2A 4Y10E 3KQDA 3P17H 4FUCA 2ZF0H 1QFKH 4SGBE 3ZZCA 4K8YA 3PB1E 1SGIB 1QBVH 3M3TA 2FOBA 1JIRA 4A1VA 2ZC9H 2BD2A 3HK6B 1GBBA 3BTDE 3LPRA 1GJDB 3QUMP 3UWIA 2D1JA 1YPHE 2GCHG 4UEHH 1YGCH 2A7JA 1DPOA 1CQQA 3RMNH 3KQBA 1F0SA 5DKMA 4ASHA 2Y80A 1DLEA 4IN2A 1AB9C 3QWCH 1LDTT 4KGAA 2BB4A 4MG3A 1IQLA 3K65B 1G30B 2W3IA 1HJ9A 3AVZA 2VWOA 3TH4H 1C5UA 1QA0A 1VITG 2O8UA 1O5DH 1F0RA 2OP9A 3KIDU 1TABE 1K21H 5A0CA 4D8NA 2UWOA 1ZHMA 1PQAA 3A7TA 1Y3XA 2FYQA 3DHKH 2R0KA 2WUCA 3EDXB 1OPHB 1S85A 1SVPA 1L4ZA 2NU0E 2QC2A 4WJG2 1LHFH 2BD5A 4NG9H 1QNJA 4J1YA 1T8NA 2G52A 2P16A 2GKVE 3GY8A 2VWNA 2VIDA 3BG8A 1T8OA 1O3EA 1TA2A 1ZYOA 3EAJA 2QYIA 3PV4A 4Y8ZA 4K1EA 3MH4A 4GPGA 2TGPZ 4TPYA 3UTUH 1ELGA 5HMAA 2IPHA 4XBDA 4TY6A 1GBIA 2OBOA 1O3JA 1E38B 5AHGH 4HGCA 1HJAB 1L4DA 2HGTH 2OC1A 1NRQH 1UTOA 2A45B 1LPGB 1SC8U 2RCEA 3PMJA 4RKOB 2CHAB 1QIXB 1C2KA 2JH5D 2WPJS 2BQ7B 1GHBG 3P8GA 5GWZA 4FUDA 3SNEA 2SGFE 2NU3E 1GDUA 1CT4E 1NFXA 2V6NA 3RM0H 4WVPE 1FQ3A 3P6ZB 4FVBA 4IGDA 8GCHF 2J38A 3A83A 1NPMA 3BN9A 3RXPA 5T6FA 1IQFA 2BMGB 3MU0A 1OX1A 3A7XA 2ZZUH 4XDEA 2PTNA 1AN1E 3GY4A 1BZXE 4I31A 4K3JA 1WOFA 3S7HB 1P03A 1ZGVA 2P59A 1P9UA 4ZROA 1NN6A 2P3FH 1VCWA 1BTPA 4MNVA 2VWLA 1AVGH 2BTCE 1Y5UT 2QV1A 1GI3A 1C5WB 4I32A 7ESTE 3SUFA 5EW1H 1TA6A 1CO7E 2ZHQH 1CA8B 3LGYA 1HAOH 5F03A 3H7TA 1MD7A 4XOJA 4ZKRU 4I8GA 4RKJB 1Y5AT 3A8DA 2GTBA 1C1TA 3A80A 1NU7B 4NIXA 2QIQA 1Z8RA 1T4VH 1EB2A 3R0FA 5IYTA 4ISNA 2UUYA 2A1DB 1MTSA 3UOPA 1BHXF 2AMPA 2KAIB 3VB3A 3MTYA 4UD9H 1VITF 1OWDA 1O2NA 3U1IB 1F5RA 1G3EA 3TVJB 2D2DA 2BY9X 1O3NA 5LPEA 1HB0B 1ANEA 1UHBA 2HALA 2B0FA 2GCTB 3E0NB 2XW9A 4K5ZA 3QZQA 1CBWB 2HRVA 1UK3A 2YNBA 3VEQB 3P8NA 2ZI2H 5DP9A 1AE5A 3PLPA 2I6QA 4WH8A 3GCTF 3HKJB 1HAVA 5G4BA 1EOJA 4X0WU 1ANBA 1Q3XA 1LVBA 1SGCA 1ETSH 1SGEE 3NPSA 1EPTB 2O8LA 3D65E 1C9TA 1RJXB 3SV7A 1C2IA 1ABJH 1Z71A 3BV9B 1SLXB 4MLFB 3ZZ6A 2GVFA 3GY3A 3GDSA 1O2XA 3LT3A 1SQAA 3V3MA 1P05A 1P3EA 2A2XH 2ZU3A 1GDQA 2ZKSA 2R2WU 2VNTA 4ZUHA 4ABDA 1RTKA 1OP2A 2RA0A 2FEQH 4BAOB 4X1PU 3ZZ5A 4CR5A 2JKHA 1XUFA 3LGTA 4Q7XA 2V35A 1GMHF 4CRGA 1A0HB 1F5LA 2VVVA 5EOKA 3ZZ3A 1GI1A 2XC0A 1DWBH 1O2VA 4AGJA 2R9PA 3RXUA 1XX9A 2GMTC 4X8UH 2TPIZ 2I6SA 4DURA 1MKWH 5I25A 1DVAH 1OP0A 4UE7H 5ESBA 3QTOH 1EATA 1A1RA 1LVMA 2B7DH 1AKSB 4YT6H 1RTLA 5SGAE 1FNIA 2CGAA 3M5MA 1V2VT 3NK8A 1DY8A 2OTVA 1JXPA 1MUEB 4X2XA 1EJNA 1GJ5H 2D8WA 2FS9A 4AB8A 4GSOA 1UTMA 1YLCA 5C3NA 2OQ5A 4DY7B 1T4UH 1RD3B 1O2YA 1TRNA 3VXFH 1MZAA 2OBQA 3FP6E 1NS3A 3RC5A 4ZXYH 3M5OA 1VJAU 2J4IA 5A0BA 1TBQH 1C5SA 4DT7B 1KIGH 1SG8B 4X8VH 2GT8A 1O3GA 1SBWA 1UK2A 2J92A 3BTME 4BXSA 1NROH 1GGDB 3U8TH 1ZJDA 3SI4H 3RLYH 5HM9A 1G3DA 1TPOA 3GCHB 2OCVB 4LK4A 1TONA 4YLUA 1L1NA 1CBWC 3F68H 4XFQA 1CHGA 1N6YA 4K1SA 2ZTXA 3A86A 3RMMH 4YOGA 1Y59T 1O32A 1DDJA 1ZRKA 1LKBA 4A1XA 2OC7A 1TQ7B 3URCA 2Z9KA 1FLEE 1J9CH 1ELDE 1C5PA 1V6DA 4HFPB 2ZHFH 3MNBA 1EPTC 1B5GH 1K1JA 4BANB 3TH3H 1GJ7B 1G9IE 4AN7A 3E8LA 3LJOA 1D6RA 1DY9A 1FJSA 4ISIH 5DO4H 4WMEA 4RSPA 5C1UA 1TGTA 2ODQA 1K22H 3NKKA 1DITH 1GBKA 1LQDB 4X8TH 4FUIA 1N8OC 1SGQE 4MQAA 4WY3A 1JRTA 1OSSA 3FZZA 3FP7E 3GISB 1EXFA 2YOLA 3HGPA 4KP0A 1NRNH 5J4SA 1BT7A 1LHGH 4CREA 1O2MA 3ATLA 1BIOA 1H9IE 4OS2A 4YTAA 1E34B 1QQ4A 1W2KH 3RU4T 1O39A 1YYY1 2PHBA 1O2GH 1Z1JA 4UONA 3A7VA 3TJUA 1ELFA 2VINA 1GHWH 2ANMH 4WMDA 3SGBE 3T28A 1YC0A 2ZGHA 1F7ZA 4YO9A 5LH8A 3PMAB 3F9EA 1ESAA 3ODDA 1GI8B 3PROA 3PTNA 1LTOA 2YNAA 1GJAB 3DA9B 4JYTA 1OOKB 2SFAA 1TAWA 5FX6A 1F0UA 1UK4A 3RXHA 1FMGA 2Y7ZA 1V2TT 1EAWA 4Y7AA 2ZIQH 1TPPA 1FY3A 3LU9B 4B75A 3W95A 1O33A 9ESTA 1HJ8A 4CH2B 4YOJA 2AIPA 6CHAC 1UTPA 3IWMA 2ZU4A 3ZVEA 1IHTH 2FOAA 3TK9A 1IQNA 2DUCA 2ULLA 1QL9A 2BDAA 2BM2A 3B8JA 5FBIA 1MU8B 4O03A 4KTSA 2BVXH 1ZHPA 3M7UA 4X6NA 3E16B 3PTBA 4NCYA 1PPFE 1TBRH 2ZDKA 3K6YA 1GGDC 1ZPZA 2F9UA 1DWEH 2HNTF 4CH8B 1W0YH 1OXGA 1QJ7B 4INHA 3BTQE 4AYYB 4ESTE 1GJ8B 5FPSA 1Y8TA 1IQKA 1C5RA 5E2OA 3ESTA 2ZG0H 5JBBS 1SGFG 2J9NA 1CT0E 2V3OH 1W13U 4RN6A 4ABIA 1YPKH 2W7UA 3AASA 3KNXA 3PLKA 1C5YB 1QJ6B 3BF6H 2FX6A 3OSYA 4Y6DA 1RGQA 3EA9A 3LGIA 1P2JA 1O3MA 1KDQB 3SJOA 1ZGIA 1GBLA 3VGCC 1P57B 1WQVH 1AVXA 3ZVAA 2ODPA 1O5CB 1Y3VA 3STJA 4NIYA 3VB7A 2BLWA 1MTNC 2BZAA 3E0PB 3UQVA 1E37B 1Z8GA 1SGYE 3M61U 3PWCA 5DP6A 1O3BA 1KLTA 1VITH 4CBOA 5EQSA 4AYVB 1G3CA 1VCQA 1KYNA 1PPCE 3I77A 2SGQE 4MNWA 1ABIH 1C4Y2 3UNQA 1NRRH 3S9BA 4O9VA 3NWUA 3ZV9A 1QTFA 5BPEA 5EG4A 4ABGA 1XUHA 2QGRA 5LPRA 4ZAEA 1DSUA 1GHVH 3A8AA 1ELEE 2QXGA 1TNJA 2V3HH 3VFEA 1C1WH 2Z94A 1SLWB 1ZJKA 4NGAH 1MU6B 2JETB 1YKTA 5JBTA 5E2PA 5L2ZH 1NESE 3SORA 7GCHG 2TGDA 1AO5A 3RC6A 4INKA 4WMFA 6LPRA 3UREA 3ENSB 4B71A 4MTBA 5DP3A 4LOYH 2OUAA 3T5FH 4VGCB 2QAAA 2WYGA 3LGUA 2BD3A 2H9EH 5EGMA 1Y5BT 3GY5A 1QB1A 1SB1H 3KF2A 1NRPH 1NFWA 1C5OH 1LHDH 1MQ5A 1O2ZA 3MO9A 4BAKB 5ABWA 2ILNA 3ZZ7A 3D49H 2O8WA 1EZXC 2SNVA 4AX9H 4BAHB 2XNIA 1P2NA 2VGCC 5JBAS 1YCPK 2G5NA 1AFQB 3M3VA 2BDHA 1BRUP 2Z9IA 1O2LA 4JYUH 4ABHA 5FAHA 2AH4X 2GV6A 1LQEA 3URDA 1A0LA 1YM0A 1HXFH 1KLJH 2FMJA 1PPZA 2JH0D 2BX3A 2VVCA 3M35A 4AFZA 3CS0A 1C5QA 2Z7FE 4E7RG 2OXSA 4Y7BA 1PQ8A 2WPIS 4X6MA 2XBWA 4Y8XA 3UY9A 5DP7A 1AUJA 1MKXH 3O8CA 2VIQA 5IDKA 3MH5A 1TLDA 3A82A 3K9XB 5FPTA 2G4UA 3B23B 2ZEBA 2Z3DA 2BY7X 4FXGH 1ACBE 2V0BA 1G2MA 1IOEA 3UPEA 3Q00A 2WUBA 3Q3KA 3BTEE 1HLTH 5DJ7A 4Q2KA 4YLQH 4TY7A 2BVSH 3LJJA 9LPRA 2QXIA 3UUZA 1NY22 1PPHE
chains in the Genus database with same CATH superfamily
2BYAX 5CHAB 2SGEE 2ANKH 2ZO3H 3JZ2B 1C1RA 5F53A 3BTTE 2UWLA 8LPRA 5JPMH 3E3TA 2H6MA 1XUJA 1EZSC 1D6WA 3A85A 5EXNA 1UCYK 3MO6A 3GY6A 1NTPA 4ACBA 1ZSKA 5GXPA 5JYIA 2F9VA 3F0PA 2Q6DA 5A0AE 1AKSA 2J94A 3GICB 3OU0A 1QRZA 1P2QA 2C93B 1YWUA 1EAUA 1PPBH 1UTNA 1OWJA 3SO3A 4D9RA 1BJUA 1ELBA 1BMFD 4Y8YA 1OS8A 4UFFH 3RXMA 1QZ8A 4UFEH 1Z1IA 1MCTA 1ZTJA 1P11E 2D26C 1Z6EA 1DS2E 1UJ1A 1C4U2 2W26A 4VGCC 4ZKOU 1F2SE 4MDSA 1WQSA 1EAIA 2PLXA 1P2OA 2BD9A 3FAOA 5EQQA 1HIAB 3P8OA 2WV4A 2BDIA 2Y6TA 3T25A 1A4WH 1FY5A 1Y3WA 2G00A 3EA8A 4I8LA 2KFWA 2WZQA 1GMDG 2ZDNA 1C4V2 4FU8A 1O5EH 3SJKA 3VB6A 2G5VA 4XD7D 2SGDE 5HYOA 3FANA 2ZA5A 1GBHA 5B6OA 2Z6BD 3RXRA 1C1QA 1IQIA 1C1NA 1X7AC 2ZPSA 3RXTA 1CVWH 1BOQA 2F9PA 3QX5H 1O30A 4NIWA 2ZGXH 3SGAE 1FDPA 1OYQA 3BG4C 1NM6A 1XKAC 1FIWA 2NU2E 3OEHD 2HPPH 2XBYA 1G32B 3DSOA 4A92A 4DCDA 2NU4E 4NZLA 5EPYA 3U1JB 1TRYA 1C5TA 1W7XH 1HYLA 1QHRB 1WTGH 3AW0A 4E06H 3GS9A 2ESTE 2EI7A 1K0HA 2K8IA 4BTIB 1YY3A 1C2HA 1JIMA 1NZQH 1TB6H 2M5TA 1C1OA 2Q6GA 3PM3A 4B74A 3SUDA 5H4IB 1FUJA 3RXSA 4I8HA 3UB0A 4AZ2B 1P10A 1BRAA 1GHAG 1SL3A 3MFJA 4CRFA 2ALVA 1P12E 3SUGA 4RT0A 1P06A 2WINI 2ZTZA 1Z6JH 2BD4A 3OY6U 4IBLH 4UDWH 1XVOA 4KELA 1BTXA 1K1LA 3ZYDA 4HI3A 5K7RA 4JZFH 1ZSJA 3UNRA 1CA0B 2P3UB 2QF5A 1H4WA 2A5AA 1OWKA 2PKAA 1KXEA 5K0HA 4F49A 4FUJA 1QQUA 1IHSH 4ZKSU 7GCHF 1SHYA 1A2CH 2LP6A 4ISHH 3ODFA 3MO3A 5C67A 4I7YH 3RXQA 4OS4A 2XWAA 1ZOMA 2XCNA 5JB8S 3UIRA 2A32A 3SJIA 2H5DA 1BHXB 3RXDA 1G36A 5F6MA 1UTJA 3JZ1B 1O3AA 2VVUA 1UTKA 4JMYA 3RUOA 3A8BA 5C1XA 3HK3B 2PGQB 3PO1C 4YOIA 3SHCH 3RU4D 3LGWA 3V12A 1C5ZB 1O5FH 2ZDMA 2FTLE 3SV9A 1W7GH 2JDID 1TE0A 3MWIU 4K8BA 3D23A 4FU7A 1PFXC 1V2RT 1F5KU 2ZCKP 1BDAA 3ZZ4A 2Y5FA 3QLPH 5EQRA 2HVXA 5JBCS 1DUEA 2JH6D 1DUAA 3F2HA 3SU3A 2P8OB 1TRMA 3T2NA 4DIIH 3QGJA 4ZHMU 1A5GH 5C20A 3FN8A 5C17A 4XSKU 4H42U 5A09A 3RM2H 2HOBA 3I29A 1ELTA 1O5AB 5CDFE 1LO6A 3TH2H 2WSSD 1S0QA 3UOUA 4IC5A 7LPRA 1O3HA 4X1QU 3L33A 1QY6A 1SQOA 2ZCLP 2A5KA 2H2ZA 4CRBA 2K1QA 1FN8A 1O2JA 1MBQA 2C8YB 2H5CA 1GI6A 2Y5HA 4DW2U 2FI5E 3TLOA 2PGBB 2ZDAH 1FZZA 3PMBB 1HGTH 2OK5A 2BDGA 1XVMA 2UWPA 2XRCA 3WW7A 1AWHB 4GLYA 2QXJA 3G01A 1XM1A 1C1VH 2VJ1A 3QTVH 3M36A 4OS6A 1HNEE 1IQHA 2W6ID 5A2MH 1BTZA 1QA7A 2TGAA 1PYTD 1RXPA 3ZVFA 5FL7D 2ZDLA 2GDEH 1BJVA 1HAVB 4B2BA 1GL1A 2J34A 4NSYA 1G2LA 1TOCB 3PLBA 2QF3A 5ESTE 2Z9JA 1YPHC 1TIOA 1O37A 1V2UT 2ZFRH 2WPMS 3RXLA 2J95A 3QZRA 2FM2A 4GCHG 3UQOA 2BDCA 1J17T 1D3DB 1CA0C 1ZR0A 2VH6A 5FBEA 3ZZBA 3LH3A 1C5VA 3GCHC 1FY8E 1L0ZA 2VB0A 2R3UA 1S82A 1C5XB 3O8RA 1HBTH 2BD8A 1AZZA 4ABEA 4XBCA 3EE0B 2R3YA 3MYWA 3RXKA 4CHAB 2FDAA 1WCZA 1C1UH 1NT1A 3RMOH 1OWHA 3AAUA 3CS7A 1NO9H 3WWFA 3F9GA 3H7OA 2GDDA 3TJOA 2A7HA 2O8MA 2PP6A 5DSFA 4LZ4B 1ESBA 1MTWA 1ZPBA 2C4FH 2QXHA 4IMZA 1WAYB 4Z1MD 5L2YH 3RXGA 2KR7A 1QRXA 1D3TB 2P8OC 1GBCA 1GMDF 3SQEE 1TX6A 4H6SB 2BXTH 4B1TA 1SFIA 1TMTH 4CR9A 1UTQA 4OS7A 1KTTB 2FXRA 1AGJA 3TITA 1PQ7A 1QB9A 1V2KT 5GCHF 2BQWB 4K60A 2UUFB 1O3PB 4KTUA 5BRRE 1GPZA 4JZEH 4B73A 5EW2H 2FWWA 4BXWA 1NRSH 2Z9LA 3BEIB 5EXLA 5AVDA 1GHBF 2GGVB 3EQ0H 2B8OH 1C2LA 1THSH 2ANWA 4H4FA 3Q3XA 1JOUB 1BITA 4LZ1H 4U01A 2KZ4A 2PFEA 1FN6A 2TGTA 2YMSB 4JK6A 1SR5C 4U32A 1GBTA 1QURH 4Q4LA 2BLOA 1HRTH 1T7CA 4F4OC 3A8CA 3NZIA 4U2WA 1J8AA 4FUBA 3PRBA 4X1NU 1ANCA 3EA7A 3LC5A 2ZHWH 1PPEE 4JK5A 1THRH 4Z0KA 2EEKA 1BRBE 1Y3UA 1HAXB 2ZPRA 2GCHF 2PTCE 3TK6A 3LIWA 1AU8A 5TCAA 5T3HA 1MQ6A 1TPSA 1FX0B 2QE7D 3SV2H 4NA8A 4XBBA 1IQGA 1J15A 1A5IA 1NU9A 4I86A 4HTCH 1TQ0B 1BA8B 2FS8A 5KGOA 1DWDH 2THFB 3SUEA 2CJIA 4M7GA 3MU8A 3DD2H 1O2WA 1GJ9B 4MVNA 5AFYH 1A3EH 3RXJA 3ATMA 4TT3D 1MZDA 3I78A 2STAE 2FOHA 3STIA 1KTSB 2GX4A 4CHAC 2J2UA 3PWBA 2BD7A 1MAYA 1RIWC 1BMLA 3SNDA 1SGFA 3SNBA 3IG6B 4ZXXH 2G81E 1EPTA 3F2GA 1K1NA 1J14A 4A6LA 2RA3A 4TSFD 5GCHG 1TBZH 3W1EA 1D3QB 1RTFB 3EYDA 1EUFA 4CRDA 1GVZA 1O3OA 1BRCE 2J97A 1TNKA 1LHEH 2H9TH 3PYHA 1HJAC 1B0EA 3SU1A 2IPQX 3BEFB 1LCYA 1C2EA 5GPIB 3H09A 3M7TA 1GJ4H 3RXVA 3SI3H 3E1XB 3SN8A 1THPB 3BSQA 3TGKE 3T62A 2F9OA 1SHHB 4X2WA 3M5NA 1ARCA 1CGHA 1ESTA 4FETA 4FUEA 2IN2A 3RXOA 2PV9B 2IJOB 3A89A 5FPYA 1ARBA 4Z6AH 5C2ZA 1UW7A 3SZNA 1MD8A 5T1VA 1RRKA 3ZVCA 1ID5H 4NWKA 1Z8JB 5AFZH 5CMXH 2AHME 2FESH 1ETRH 3SZEA 3V7TA 3NUMA 2JETC 2SGPE 1TX8A 2ZGJA 1AUTC 1YF4A 4OS5A 1TYNA 3FFGA 4ABFA 3SW2B 1XUIA 1XXFA 2HLCA 3FVFB 3S7KB 1O31A 4NFFA 2AYWA 3O8BA 5A8YA 1AY6H 2FLRH 1GI5A 2WPLS 3AK5A 1L1GA 3LGVA 3ZZ8A 1NC6A 1C2FA 3VB4A 4E7NA 1MTVA 1SGNE 2FI3E 1G37A 1VGCC 1ZZZA 1P0SH 1CU1A 1QL8A 2HVYB 4OS1A 1C1PA 1GL0E 3Q3YA 4X2VA 2PW8H 2ZQ1A 3RXBA 2R0LA 4I33A 2TIOA 4JCNA 3SHAH 1FV9A 2BY6X 1W11U 1CGJE 3V0XA 1AFQC 2ZECA 3TIUA 1CHOG 4DOQA 2OC0A 4YT7H 2O9QA 4CRCA 4D7FA 3MNXA 1FAXA 4R8TB 2BZ6H 3ATWA 3KYFA 1YPMH 3TNTA 1Q2WA 4D76A 3GYMA 4ZHLU 3A7ZA 5B6LA 1DT2A 1EP5A 1O2TA 4DJZB 3AW1A 3KYGA 1OHHD 3E6PH 1TGSZ 3NCLA 4FVDA 5L30H 1O3IA 1NBMD 1T31A 3CNRA 3KQ5A 3R3GB 2GZ9A 5GJ4B 1P09A 1QJ1B 1CGIE 1EFRD 1SOZA 5EPNA 3SU5A 1AIXH 3AAVA 1UO6A 2G55A 4AFQA 1VJ9U 3A87A 2PSXA 5F8ZA 2XXLA 1RFNA 2NWNA 1TX7A 3N99A 1V2JT 3ZVGA 1QBOA 2FTMA 4FUHA 3OTPA 1BBRK 3W94A 3PRDA 1MAXA 1E36B 1K9OE 1DSTA 2BOHB 2FZZA 1OKXA 3BTWE 4MNXA 4O97A 2BLQA 5T6DA 1DXWA 3MHWU 1C2JA 2OINA 1EJMA 1A7SA 1VZQH 3M7QA 5EU8A 3F1SB 1GBFA 1ORFA 1S84A 3F9HA 1GI9B 1GBEA 1O3FA 2HWLB 3OX7U 4LXBH 1SKYE 3T27A 2ZFSA 1GCDA 3GCTG 2FI4E 1TNGA 3LOXA 6GCHG 1INCA 1UTLM 1IQMA 1TPAE 1PJPA 1V2LT 2VIVA 2BOKA 2EI8A 3A84A 4NWLA 1KXFA 3UR6A 1O5BB 2QCYA 3N7OA 1T8LA 1ZTLA 3P95A 1WSSH 1VCPA 3FZDA 1GHYH 3ZV8A 2ZWLH 5AF9H 2J98A 5C1YA 2FOFA 3OTJE 4X1SU 2OC8A 1TMBH 2OLGA 2IOTA 4I8KA 3RXEA 4O3UA 3UWJH 1ELAA 2DE8A 2ZFQH 1AB9B 1YPGH 3RDZA 3BTGE 1C2MA 1EASA 1TNLA 1K2I1 1KXCA 2WV5A 5GIBA 4D7GA 1DICA 1VGCB 2HNTE 2ZNKH 2F3CE 3DFLA 1C1MA 2M2AA 3RC4A 1GG6B 5FX5A 1ZTKA 2GD4B 2XC5A 1TGCA 4IN1A 2ZP0H 1QB6A 1DFPA 2ANYA 1JRSA 2F9BH 4X6OA 4NFEA 2BVRH 2EA3A 1MH0A 1C5MD 3LONA 2K0QA 3MU4A 5HGGA 3UNSA 1O3DA 1RS0A 1T8MA 1S5SA 3F6UH 4KTCA 2Q1JA 3RMLH 3TJVA 1FXYA 2A5IA 3A81A 4B2CA 1BTYA 1LMWB 1W0ZU 2C8WB 1GI0A 3DUXH 2EC9H 1TFXA 4K69A 3IITA 1GI2A 4WH6A 2XCFA 2PSYA 2ASUB 8KME2 1C1SA 2FP7B 3MH6A 1BTWA 3Q77A 4TWYA 5FCRA 1B0FA 2XWBI 1FPHH 1WXRA 4X6PA 3S9AA 1O34A 4BAQB 1K1PA 4BNRA 2VH0A 2WYJA 3CP7A 1ZMLA 1FY1A 2XBVA 2CN0H 3PV5A 1EZUC 3BIUH 4MPXA 2ZGCA 1H8IH 3U9AH 5A8XA 4AC9A 3MNCA 3TPIZ 2P95A 6GCHF 5HIZA 4A5TS 4YM9A 2IJD1 1HIAA 1O0DH 2FO9A 1NBME 1SLUB 2Y81A 1E1QD 1MCVA 2A4GA 5DG6A 2BXUH 3U98H 2AERH 4ABBA 1VR1H 4BTUB 1O3CA 1C5LH 1YCPM 5EXMA 1K1OA 1AQ7A 3S0NA 1V2NT 1D4PB 5FCKA 3A7YA 3BIVH 1GI7B 1GHAF 2C8XB 1S0RA 1IAUA 4ZHAA 1UMAH 2TRMA 4WXIA 4X2YA 4ZMAH 3L6PA 1SSXA 3U8RH 2ZPQA 1D9IA 5TJXA 1LHCH 1P02A 2L6OA 1P2MA 1XUKA 1HPGA 3DT0H 1SGRE 4AOQA 2NU1E 3ELAH 1E0FD 1FY4A 2AGIX 3KEEA 3SV8A 2V3MA 1N6XA 2ZCHP 3TU7H 2H9HA 2F9NA 4ISLA 2CHAC 2FPZA 3SJ9A 3KQEA 3MMGA 4DGJA 4BOHA 2KX4A 3PO1B 3U69H 2EI6A 1O2SA 2W5EA 3ZZ9A 1QBNA 1HFDA 1OWEA 1LPKB 1FI8A 1WUNH 1O3LA 1DE7H 1EOLA 1MKXK 4ZH8A 5E0GA 1UVTH 1LVOA 1DANH 1A3BH 5TCCA 1AI8H 1DOJA 1BB0B 1GG6C 4UFGH 2XNDD 2ZTYA 4ZKNU 3BTKE 2KM0A 5F8TA 1O2PA 5F8XA 3HATH 4FUGA 3SV6A 5EIYA 3ATIA 3TK5A 1O2HA 2LNCA 8GCHG 1CHOF 2VBCA 4MPUA 5L6NH 1TOMH 5I46H 2AS9A 5FXLA 2AMQA 4XRNA 3SNAA 1S6FA 2GT7A 3MNSA 1DLKB 1O2KA 2FOMB 2FYRA 1ZLRA 1GVKB 1C2GA 1YCPH 1YPLH 4Q80A 4ABAA 6CHAB 4AB9A 3ZVDA 1EX3A 2FOCA 2FOEA 1BUIA 2EY4C 1W14U 4R0IA 2G8TA 3KCGH 1ZPCA 3O8DA 3DCLA 1ZSLA 1ETTH 1V2OT 2QY0B 3A88A 4JZDH 2G4TA 1QCPA 1AE8H 3SGQE 4MPWA 1HUTH 1MTUA 1WYKA 1N1LA 1SGDE 3OAAD 2BHGA 4FU9A 2GCTC 4ABJA 4Q7YA 1WTHD 1O3KA 4AORA 2TBSA 1COWD 1GJBB 1W3CA 3UR9A 2XYAA 4DIHH 2ALPA 2ODYB 2P3TB 3GY7A 2RDLA 4TPIZ 1SI5H 2G51A 4B76A 1V2ST 1P01A 3KN2A 3P8FA 1WBGB 1DM4B 2CV3A 1SOTA 4RT1A 3RP2A 2ZDVH 5C5OA 4NZQA 1AVWA 4Q7ZA 3P70B 2BX4A 1MBMA 1GMCG 4INLA 1ZMJA 3GDUA 3TGIE 3LKWA 1GBMA 1C5NH 1H1BA 2KAIA 3ZYEA 1TNIA 4WF8A 3Q76A 1HCGA 2ZFFH 4WXVA 4HZHA 3VB5A 1OWIA 4GCHF 1F92A 3P92A 1TGBA 2GZ8A 2YMSD 2UUKB 4GAWA 1WV7H 2ZU5A 3K6ZA 3RXIA 1F0TA 3SU2A 2AMDA 1A61H 1XKBC 3U8OH 1W10U 1HV7A 1GBDA 2ZGBH 3SU0A 3H5CB 3NXPA 2A2QH 1O2OA 3GYLB 3GCOA 2C90B 1UCYH 3RXCA 1GHXH 2F91A 4TYDA 2FODA 2ZU1A 4UFDH 4JYVH 1GJ6A 2ZU2A 1YLDA 1O38A 4NA7A 1S83A 2C8ZB 2YMSC 3D62A 1FONA 1HDTH 5GNDA 2A4RA 2RG3A 3MI4A 1FIZA 4Y11E 2B5TB 3LH1A 1JWTA 1V2QT 1EAXA 1ANDA 1HAHH 1T32A 1LPZB 4X8SH 3ZZDA 1O2UA 1H9HE 4YESB 1XXDA 1HAIH 1NFUA 1PYTC 1EZQA 2DE9A 4K2YA 4DVAU 3ITIA 1QR3E 1ELVA 1GBAA 1SGTA 2UUJB 2C3SA 1S6HA 1Y3YA 2OD3B 4YZUA 2GMTB 3MU1A 1Q31A 1K1IA 1AMHA 2VIWA 3KHVA 3BG4B 1GHZA 1V2MT 1SLVB 2A7CA 3L3TA 3SJ8A 2GZ7A 1UVSH 2GP9B 2XOKD 3ZVBA 2BQ6B 3BTHE 1GMHG 1UCYE 4Y76A 2CF8H 2QA9E 4AG1A 4FUFA 2AEIH 2VGCB 1HAPH 1B7XB 1BBRE 4HG6A 4NSVA 3SBKA 5EODA 1K28D 4K1TA 5HM2A 2AGEX 2Z9GA 1JBUH 3FP8E 4Y0YE 4CRAA 1EP6A 1TMUH 3SQHE 1TALA 1SPJA 2XTTB 5T6GA 1C9PA 2SNWA 1QGFA 3S9CA 1AHTH 1V2PT 2A4QA 2OQUA 4IS5A 3UAIC 4B2AA 2BDBA 1RIWB 2BY5X 1H8DH 2JIZD 1H9LB 1IQJA 5DN6D 4ASUD 3RXFA 1GJCB 4H6TA 4IMQA 4WWYA 2HNTC 1ELCA 1ZRBA 4AGKA 3EE7A 1WDIA 1DX5M 2HPQH 4D9QA 3T29A 1G3BA 3TJNA 2PWXA 2Y82A 1O35A 3SU6A 1P2IA 3MOCA 2VIPA 2Y7XA 2FLBH 4P00A 1AD8H 3QGNB 3GDVA 3OYPA 1KSNA 5DP4A 1HAGE 3SNCA 4AFUA 4J2YB 1HXEH 3KL6A 3HPTB 3QN7A 1EKBB 2Q6FA 1SQTA 2QF0A 1L1JA 1Z7KA 1YBWA 5ETXA 1JMOH 2CMYA 2KCAA 4Y79A 5J4QA 4XE4A 1GCTC 1GI4A 3HKIB 3OEED 2KCYA 3M5LA 7KMEH 1W0JD 3GCNA 3S69A 1J16A 5CE1A 4DG4A 2R2MB 4GUXA 2XC4A 5DGJA 4Y71A 3BTFE 5CHAC 3SOSA 3OY5U 1V2WT 4U30A 1UVPA 2Y5GA 2Z3CA 1SMFE 5FHTA 1EJAA 1SFQB 5E8EH 1PPGE 2A4OA 1GVLA 1Z8IB 1HAYB 3ZZAA 1M9UA 4ISOA 2FX4A 3A7WA 4OGYA 4YXWD 2VIOA 1P3CA 2BY8X 1EQ9A 1UHBB 1HAZB 1BTHH 1P2KA 1YPEH 3V13A 1WU1A 3QO6A 1DWCH 5DPAA 1O36A 1N8OB 1QRWA 3RU4E 1AZ8A 5C0TA 1CE5A 1YPJH 3E91A 4A7IB 1YP9A 1CT2E 1KXBA 1XUGA 2XBXA 5DK1A 1KY9A 4GHTA 2O8TA 1AFEH 1GWAA 4NA9H 8ESTE 4THNH 3WY8A 2PKSB 4TWWA 1FAKH 5JDUB 1P04A 5DP5A 1EB1H 3RLWH 1D3PB 1ZMNA 6ESTA 3TGJE 4IC6A 1TGNA 2PUXB 2JJ1D 3CENA 2W3KA 3HGNA 1OP8A 1BTUA 3QDZB 2VU8E 3ATKA 1K1MA 1KLIH 2Z3EA 4BTTB 4NIVA 1E35B 2CF9H 3M37A 4GHQA 2WPKS 1A0JA 3GOVB 2BLVA 1O5GH 2P94A 1KMHB 3T26A 1TWXB 1O2RA 3MH7A 1KDQA 5A8ZA 1NFYA 3FO8D 5E0HA 4CBNA 4JZIA 5LPFA 2AGGX 4X1RU 1UVOA 3QK1A 1SGPE 2KCOA 1P8VC 3LC3A 1A46H 1GMCF 1KXAA 2PUQH 2ZFPH 4E05H 4F55A 3LDXH 3PMHB 1A5HA 3RXAA 4AG2A 1MKWK 5DP8A 1IQEA 3EGKH 4MNYA 1AWFH 2WPHS 1FPCH 1LKAA 4BAMB 3TNSA 1BMMH 4QT8C 2AIQA 2B9LA 4IW4E 4O3TA 1L2EA 2A0QB 4Y0ZE 1GBJA 1MTNB 4A1TA 2F43B 3BEUA 2BDYA 3FOAA 1GCTB 3KGPA 2FOGA 2W6JD 1DXPA 5LGOA 1C2DA 1LVYA 1W8BH 4GVUA 1O2QA 2SGAA 2A31A 1BQYA 4JZ1A 3E90B 5IK2D 1V3XA 2W7SA 3DFJA 1W12U 2ZQ2A 5GDSH 5PTPA 1S81A 2QN5T 3M3SA 3VPKA 5JB9S 3C27B 1ZHRA 1BCUH 4KKDA 5E0JA 4PROA 3F9FA 2ZHEH 2ZFTA 4ZCNA 2CXVA 1TNHA 3VGCB 5C5NA 3U28C 2LPRA 3SU4A 1PQ5A 1U6QA 1QL7A 4AFSA 3UFAA 3VXEH 2F83A 3KQCA 2P93A 2FIRH 2PR3A 1W0KD 1BMNH 3K2UA 1OYTH 2STBE 1BBRH 1KXDA 1UVUH 2ZHDA 4OGXA 4MPVA 1GDNA 5HXFA 1P9SA 5HIYA 2PKSC 2H1UA 2JJ2D 4SGAE 1CSOE 1MMJN 2GV7A 1BMAA 3B9FH 3MU5A 2VWMA 3C1KA 1O2IA 4I8JA 1XMNB 2AFQB 3N7EA 2PKAB 3GY2A 4Y10E 3KQDA 3P17H 4FUCA 2ZF0H 1QFKH 4SGBE 3ZZCA 4K8YA 3PB1E 1SGIB 1QBVH 3M3TA 2FOBA 1JIRA 4A1VA 2ZC9H 2BD2A 3HK6B 1GBBA 3BTDE 3LPRA 1GJDB 3QUMP 3UWIA 2D1JA 1YPHE 2GCHG 4UEHH 1YGCH 2A7JA 1DPOA 1CQQA 3RMNH 3KQBA 1F0SA 5DKMA 4ASHA 2Y80A 1DLEA 4IN2A 1AB9C 3QWCH 1LDTT 4KGAA 2BB4A 4MG3A 1IQLA 3K65B 1G30B 2W3IA 1HJ9A 3AVZA 2VWOA 3TH4H 1C5UA 1QA0A 1VITG 2O8UA 1O5DH 1F0RA 2OP9A 3KIDU 1TABE 1K21H 5A0CA 4D8NA 2UWOA 1ZHMA 1PQAA 3A7TA 1Y3XA 2FYQA 3DHKH 2WPDD 2R0KA 2WUCA 3EDXB 1OPHB 1S85A 1SVPA 1L4ZA 2NU0E 2QC2A 4WJG2 1LHFH 3F3BA 1H8HD 2BD5A 4NG9H 1QNJA 4J1YA 1T8NA 2G52A 2P16A 2GKVE 1H8ED 3GY8A 2VWNA 2VIDA 3N7DA 3BG8A 1T8OA 1O3EA 1TA2A 1ZYOA 3EAJA 2QYIA 3PV4A 4Y8ZA 4K1EA 3MH4A 4Q63A 4GPGA 2TGPZ 4TPYA 3UTUH 1ELGA 5HMAA 2IPHA 4XBDA 4TY6A 1GBIA 2OBOA 1O3JA 1E38B 5AHGH 4HGCA 1HJAB 1L4DA 2HGTH 2OC1A 2QF4A 1NRQH 1UTOA 2A45B 1LPGB 1SC8U 2RCEA 3PMJA 4RKOB 2CHAB 2LELA 1QIXB 1C2KA 2JH5D 2WPJS 2BQ7B 1GHBG 3P8GA 5GWZA 4FUDA 3SNEA 2SGFE 2NU3E 1GDUA 1CT4E 1NFXA 2V6NA 3RM0H 4WVPE 1FQ3A 3P6ZB 4FVBA 4IGDA 8GCHF 2J38A 3VG8A 3A83A 1NPMA 3BN9A 3RXPA 5T6FA 1IQFA 2BMGB 5HKKD 1VKYA 1YLNA 3MU0A 1OX1A 3A7XA 2ZZUH 4XDEA 2PTNA 1AN1E 3GY4A 1BZXE 4I31A 4K3JA 1WOFA 3S7HB 1P03A 1ZGVA 2P59A 1P9UA 4ZROA 1NN6A 2P3FH 1VCWA 1BTPA 4MNVA 2GJGA 2VWLA 1AVGH 2BTCE 1Y5UT 1E79D 2QV1A 1GI3A 1C5WB 4I32A 7ESTE 3SUFA 3SYJA 5EW1H 1TA6A 1CO7E 2ZHQH 1CA8B 3LGYA 1HAOH 5F03A 3H7TA 1MD7A 4XOJA 4ZKRU 4I8GA 4RKJB 1Y5AT 3A8DA 2GTBA 2L74A 1C1TA 3A80A 1NU7B 4NIXA 2QIQA 1Z8RA 1T4VH 1EB2A 3R0FA 5IYTA 4ISNA 2UUYA 2A1DB 2CK3D 1MTSA 3UOPA 1BHXF 2AMPA 2KAIB 3VB3A 3MTYA 4UD9H 1VITF 1OWDA 1O2NA 3U1IB 1F5RA 1G3EA 3TVJB 4ACAA 2D2DA 1MABB 2BY9X 1O3NA 5LPEA 3F2FA 1HB0B 1ANEA 1UHBA 2HALA 2B0FA 2GCTB 3E0NB 2XW9A 4K5ZA 3QZQA 1CBWB 2HRVA 1UK3A 2YNBA 3VEQB 3P8NA 2ZI2H 5DP9A 1AE5A 3PLPA 5EJ1A 2I6QA 4WH8A 3GCTF 3HKJB 1HAVA 5G4BA 1EOJA 4X0WU 1ANBA 1Q3XA 1LVBA 1SGCA 1ETSH 1SGEE 3NPSA 1EPTB 2O8LA 3D65E 1C9TA 1RJXB 3SV7A 1C2IA 1ABJH 1Z71A 3BV9B 1SLXB 4MLFB 3ZZ6A 2GVFA 3GY3A 3GDSA 1O2XA 3LT3A 1SQAA 3V3MA 1P05A 1P3EA 2A2XH 2ZU3A 1GDQA 2ZKSA 2R2WU 2VNTA 2RDEA 4ZUHA 4B6EA 2J98B 4ABDA 1RTKA 3DSGA 1OP2A 2RA0A 2FEQH 4BAOB 4X1PU 3ZZ5A 4CR5A 2JKHA 1XUFA 3LGTA 4Q7XA 2V35A 1GMHF 4CRGA 1A0HB 1F5LA 2VVVA 5EOKA 3ZZ3A 1GI1A 2XC0A 1DWBH 1O2VA 4AGJA 2R9PA 3RXUA 1XX9A 2GMTC 4X8UH 2TPIZ 2I6SA 4DURA 1MKWH 5I25A 1DVAH 1OP0A 4B6FA 4UE7H 5ESBA 3QTOH 1EATA 1A1RA 1LVMA 5KEDA 2B7DH 1AKSB 4YT6H 1RTLA 5SGAE 1FNIA 2CGAA 3M5MA 1V2VT 3NK8A 1DY8A 2OTVA 1JXPA 1MUEB 4X2XA 1EJNA 1GJ5H 4M9FA 2D8WA 2FS9A 4AB8A 4GSOA 1UTMA 1YLCA 5C3NA 2OQ5A 4DY7B 1T4UH 1RD3B 1O2YA 1TRNA 3VXFH 1MZAA 3ZIAD 2OBQA 3FP6E 1NS3A 3RC5A 2KCPA 4ZXYH 3M5OA 1VJAU 2J4IA 5A0BA 1TBQH 1C5SA 4DT7B 1KIGH 1SG8B 4X8VH 2GT8A 1O3GA 1SBWA 1UK2A 2J92A 3BTME 4BXSA 1NROH 1GGDB 3U8TH 1ZJDA 3SI4H 3RLYH 5HM9A 1G3DA 1TPOA 3GCHB 2OCVB 4LK4A 1TONA 4YLUA 1L1NA 1CBWC 3F68H 4XFQA 1CHGA 2WHXA 1N6YA 4K1SA 2ZTXA 3A86A 3RMMH 4YOGA 1Y59T 1O32A 1DDJA 1ZRKA 1LKBA 4A1XA 2OC7A 1TQ7B 3URCA 2Z9KA 1FLEE 1J9CH 1ELDE 1C5PA 1V6DA 4HFPB 2ZHFH 3MNBA 1EPTC 1B5GH 1K1JA 4BANB 3TH3H 2WV9A 1GJ7B 1G9IE 4AN7A 3E8LA 3LJOA 1D6RA 1DY9A 1FJSA 4ISIH 5DO4H 2F4LA 4WMEA 4RSPA 5C1UA 1TGTA 2ODQA 1K22H 3NKKA 5EJZA 1DITH 1GBKA 1LQDB 4X8TH 4FUIA 1N8OC 1SGQE 4MQAA 4WY3A 1JRTA 1OSSA 3FZZA 3FP7E 3GISB 1EXFA 2YOLA 3HGPA 4KP0A 1NRNH 5J4SA 1BT7A 5C94A 1LHGH 4CREA 1O2MA 3ATLA 1BIOA 1H9IE 4OS2A 4YTAA 1E34B 1QQ4A 1W2KH 3MQKC 3RU4T 1O39A 1YYY1 2PHBA 1O2GH 1Z1JA 4UONA 3A7VA 3TJUA 1ELFA 2VINA 1GHWH 2ANMH 4WMDA 3SGBE 3T28A 1YC0A 2ZGHA 1F7ZA 4YO9A 4F48B 3PMAB 5LH8A 3F9EA 1ESAA 3ODDA 1GI8B 3PROA 3PTNA 1LTOA 2YNAA 1GJAB 3DA9B 4JYTA 1OOKB 4OM9A 5C0UA 2SFAA 1TAWA 5FX6A 1F0UA 1UK4A 3RXHA 1FMGA 3WWBA 2Y7ZA 1V2TT 1EAWA 4Y7AA 2ZIQH 1TPPA 1FY3A 3LU9B 4B75A 3W95A 1O33A 9ESTA 1HJ8A 4CH2B 4YOJA 2AIPA 6CHAC 1UTPA 3IWMA 2ZU4A 4DT4A 3ZVEA 1IHTH 3NRLA 2FOAA 3TK9A 1IQNA 2ULLA 2DUCA 1QL9A 2BDAA 2BM2A 3B8JA 3PV2A 5FBIA 1MU8B 2V7QD 4O03A 4KTSA 2BVXH 1ZHPA 4P02A 3M7UA 4X6NA 3E16B 1S6LA 3PTBA 4NCYA 1PPFE 1TBRH 2ZDKA 3K6YA 1GGDC 1ZPZA 2F9UA 1DWEH 2HNTF 4CH8B 1W0YH 1OXGA 1QJ7B 4INHA 3BTQE 4AYYB 4ESTE 1GJ8B 2J5UA 5FPSA 3OE7D 1Y8TA 1IQKA 1C5RA 5E2OA 3ESTA 2ZG0H 5JBBS 1SGFG 2J9NA 5EJLA 1CT0E 2V3OH 1W13U 4FOUC 4RN6A 4ABIA 1YPKH 2W7UA 3AASA 3KNXA 3PLKA 1C5YB 1QJ6B 3BF6H 2FX6A 3OSYA 4Y6DA 1RGQA 3EA9A 3LGIA 1P2JA 1SQRA 1O3MA 1KDQB 3SJOA 1ZGIA 1GBLA 3VGCC 1P57B 1WQVH 1AVXA 4RI0A 3ZVAA 2ODPA 1O5CB 1Y3VA 3DSPA 3STJA 4NIYA 3VB7A 2BLWA 1MTNC 2BZAA 3E0PB 3UQVA 1E37B 1Z8GA 1SGYE 3M61U 3PWCA 5DP6A 1O3BA 1KLTA 1VITH 4CBOA 5EQSA 4AYVB 1G3CA 1VCQA 1KYNA 1PPCE 3I77A 2SGQE 4MNWA 1ABIH 1C4Y2 3UNQA 1NRRH 3S9BA 2EQNA 4O9VA 3NWUA 3ZV9A 1QTFA 5BPEA 5EG4A 4ABGA 1XUHA 2QGRA 5LPRA 4ZAEA 1DSUA 1GHVH 3A8AA 1ELEE 2QXGA 1TNJA 2V3HH 3FKSD 3VFEA 1C1WH 2Z94A 1SLWB 1ZJKA 4NGAH 1MU6B 2JETB 1YKTA 5JBTA 5E2PA 5L2ZH 3F0OA 1NESE 3SORA 7GCHG 2TGDA 1AO5A 3RC6A 4INKA 4WMFA 6LPRA 3UREA 2HLDD 3ENSB 4B71A 4MTBA 5DP3A 4LOYH 2OUAA 3T5FH 4VGCB 2QAAA 2WYGA 3LGUA 2BD3A 2H9EH 5EGMA 1Y5BT 3GY5A 1QB1A 1SB1H 3KF2A 1NRPH 1NFWA 1C5OH 1LHDH 1MQ5A 1O2ZA 3MO9A 4BAKB 5ABWA 2ILNA 3ZZ7A 3D49H 2O8WA 1EZXC 2SNVA 4AX9H 4BAHB 5CHBA 2XNIA 1P2NA 2VGCC 5JBAS 1YCPK 2G5NA 1AFQB 3M3VA 2BDHA 1BRUP 2Z9IA 1O2LA 4JYUH 4ABHA 5FAHA 2AH4X 2GV6A 1LQEA 3URDA 1A0LA 1YM0A 1HXFH 1KLJH 2FMJA 1PPZA 3OFND 2JH0D 2BX3A 2VVCA 3M35A 4AFZA 3CS0A 1C5QA 2Z7FE 4E7RG 2OXSA 4Y7BA 1PQ8A 2WPIS 4X6MA 2XBWA 4Y8XA 3UY9A 5DP7A 1AUJA 1MKXH 3O8CA 2VIQA 5IDKA 3MH5A 1TLDA 3A82A 3K9XB 5FPTA 2G4UA 3B23B 2ZEBA 2Z3DA 5KECA 2BY7X 4FXGH 1ACBE 2V0BA 1G2MA 1IOEA 3UPEA 3Q00A 2WUBA 3Q3KA 3BTEE 1HLTH 1E1RD 5DJ7A 4Q2KA 4YLQH 4TY7A 2BVSH 3LJJA 9LPRA 2QXIA 3UUZA 2RFKC 1NY22 1PPHE
chains in the Genus database with same CATH topology
2BYAX 5CHAB 2SGEE 2ANKH 2ZO3H 3JZ2B 1C1RA 3BTTE 2UWLA 8LPRA 5JPMH 3E3TA 2H6MA 1XUJA 1EZSC 1D6WA 3A85A 5EXNA 1UCYK 3MO6A 3GY6A 1NTPA 1ZSKA 5GXPA 5JYIA 2F9VA 2Q6DA 5A0AE 1AKSA 2J94A 3GICB 3OU0A 1QRZA 1P2QA 2C93B 1EAUA 1PPBH 1UTNA 1OWJA 3SO3A 4D9RA 1BJUA 1ELBA 4Y8YA 1OS8A 4UFFH 3RXMA 4UFEH 1Z1IA 1MCTA 1ZTJA 1P11E 2D26C 1Z6EA 1DS2E 1UJ1A 1C4U2 2W26A 4VGCC 4ZKOU 1F2SE 4MDSA 1WQSA 1EAIA 2PLXA 1P2OA 2BD9A 3FAOA 5EQQA 1HIAB 3P8OA 2WV4A 2BDIA 2Y6TA 3T25A 1A4WH 1FY5A 1Y3WA 2G00A 3EA8A 4I8LA 1GMDG 2ZDNA 1C4V2 4FU8A 1O5EH 3SJKA 3VB6A 2G5VA 5HYOA 2SGDE 3FANA 2ZA5A 1GBHA 5B6OA 2Z6BD 3RXRA 1C1QA 1IQIA 1C1NA 1X7AC 2ZPSA 3RXTA 1CVWH 1BOQA 2F9PA 3QX5H 1O30A 4NIWA 2ZGXH 3SGAE 1FDPA 1OYQA 3BG4C 1NM6A 1XKAC 1FIWA 2NU2E 2HPPH 2XBYA 1G32B 4A92A 4DCDA 2NU4E 4NZLA 5EPYA 3U1JB 1TRYA 1C5TA 1W7XH 1HYLA 1QHRB 1WTGH 3AW0A 4E06H 2ESTE 2EI7A 4BTIB 1C2HA 1JIMA 1NZQH 1TB6H 2M5TA 1C1OA 2Q6GA 3PM3A 4B74A 3SUDA 5H4IB 1FUJA 3RXSA 4I8HA 4AZ2B 1P10A 1BRAA 1GHAG 1SL3A 3MFJA 4CRFA 2ALVA 1P12E 3SUGA 1P06A 2WINI 2ZTZA 1Z6JH 2BD4A 3OY6U 4IBLH 4UDWH 1XVOA 4KELA 1BTXA 1K1LA 3ZYDA 4HI3A 5K7RA 4JZFH 1ZSJA 3UNRA 1CA0B 2P3UB 1H4WA 2A5AA 1OWKA 2PKAA 1KXEA 5K0HA 4F49A 4FUJA 1QQUA 1IHSH 4ZKSU 7GCHF 1SHYA 1A2CH 4ISHH 3ODFA 3MO3A 5C67A 4I7YH 3RXQA 4OS4A 2XWAA 1ZOMA 2XCNA 5JB8S 3UIRA 2A32A 3SJIA 2H5DA 1BHXB 3RXDA 1G36A 5F6MA 1UTJA 3JZ1B 1O3AA 2VVUA 1UTKA 4JMYA 3RUOA 3A8BA 5C1XA 3HK3B 2PGQB 3PO1C 4YOIA 3SHCH 3RU4D 3LGWA 3V12A 1C5ZB 1O5FH 2ZDMA 2FTLE 3SV9A 1W7GH 3MWIU 1TE0A 4K8BA 3D23A 4FU7A 1PFXC 1V2RT 1F5KU 2ZCKP 1BDAA 3ZZ4A 2Y5FA 3QLPH 5EQRA 2HVXA 5JBCS 1DUEA 2JH6D 1DUAA 3SU3A 2P8OB 1TRMA 3T2NA 4DIIH 3QGJA 4ZHMU 1A5GH 5C20A 4XSKU 4H42U 5A09A 3RM2H 2HOBA 3I29A 1ELTA 1O5AB 1LO6A 3TH2H 1S0QA 3UOUA 4IC5A 7LPRA 1O3HA 4X1QU 3L33A 1QY6A 1SQOA 2ZCLP 2A5KA 2H2ZA 4CRBA 2K1QA 1FN8A 1O2JA 1MBQA 2C8YB 2Y5HA 1GI6A 2H5CA 4DW2U 2FI5E 3TLOA 2PGBB 2ZDAH 1FZZA 3PMBB 1HGTH 2BDGA 1XVMA 2UWPA 2XRCA 1AWHB 4GLYA 2QXJA 3G01A 1XM1A 1C1VH 2VJ1A 3QTVH 3M36A 4OS6A 1HNEE 1IQHA 5A2MH 1BTZA 1QA7A 2TGAA 1PYTD 1RXPA 3ZVFA 2ZDLA 2GDEH 1BJVA 1HAVB 4B2BA 1GL1A 2J34A 4NSYA 1G2LA 1TOCB 3PLBA 2QF3A 5ESTE 2Z9JA 1YPHC 1TIOA 1O37A 1V2UT 2ZFRH 2WPMS 3RXLA 2J95A 3QZRA 2FM2A 4GCHG 3UQOA 2BDCA 1J17T 1D3DB 1CA0C 1ZR0A 2VH6A 5FBEA 3ZZBA 3LH3A 1C5VA 3GCHC 1FY8E 1L0ZA 2VB0A 2R3UA 1S82A 1C5XB 3O8RA 1HBTH 2BD8A 1AZZA 4ABEA 4XBCA 3EE0B 2R3YA 3MYWA 3RXKA 4CHAB 2FDAA 1WCZA 1C1UH 1NT1A 3RMOH 1OWHA 3AAUA 3CS7A 1NO9H 3F9GA 3H7OA 2GDDA 3TJOA 2A7HA 2O8MA 4LZ4B 1ESBA 1MTWA 1ZPBA 2C4FH 2QXHA 4IMZA 1WAYB 5L2YH 3RXGA 1QRXA 1D3TB 2P8OC 1GBCA 1GMDF 3SQEE 1TX6A 4H6SB 2BXTH 4B1TA 1SFIA 1TMTH 4CR9A 1UTQA 4OS7A 1KTTB 2FXRA 1AGJA 3TITA 1PQ7A 1QB9A 1V2KT 5GCHF 2BQWB 4K60A 2UUFB 1O3PB 4KTUA 5BRRE 1GPZA 4JZEH 4B73A 5EW2H 2FWWA 4BXWA 1NRSH 2Z9LA 3BEIB 5EXLA 5AVDA 1GHBF 2GGVB 3EQ0H 2B8OH 1C2LA 1THSH 2ANWA 4H4FA 3Q3XA 1JOUB 1BITA 4LZ1H 4U01A 2PFEA 2TGTA 1FN6A 4JK6A 1SR5C 4U32A 1GBTA 1QURH 2BLOA 1HRTH 1T7CA 4F4OC 3A8CA 3NZIA 4U2WA 1J8AA 4FUBA 4X1NU 1ANCA 3EA7A 3LC5A 2ZHWH 1PPEE 4JK5A 1THRH 4Z0KA 2EEKA 1BRBE 1Y3UA 1HAXB 2ZPRA 2GCHF 2PTCE 3TK6A 3LIWA 1AU8A 5TCAA 5T3HA 1MQ6A 1TPSA 3SV2H 4NA8A 4XBBA 1IQGA 1J15A 1A5IA 1NU9A 4HTCH 1TQ0B 1BA8B 2FS8A 1DWDH 2THFB 3SUEA 2CJIA 4M7GA 3MU8A 3DD2H 1O2WA 1GJ9B 4MVNA 5AFYH 1A3EH 3RXJA 3ATMA 1MZDA 3I78A 2STAE 2FOHA 3STIA 1KTSB 2GX4A 4CHAC 2J2UA 3PWBA 2BD7A 1MAYA 1RIWC 1BMLA 3SNDA 1SGFA 3SNBA 3IG6B 4ZXXH 2G81E 1EPTA 1K1NA 1J14A 4A6LA 2RA3A 5GCHG 1TBZH 1D3QB 1RTFB 3EYDA 1EUFA 4CRDA 1GVZA 1O3OA 1BRCE 1TNKA 1LHEH 2H9TH 3PYHA 1HJAC 1B0EA 3SU1A 3BEFB 1LCYA 1C2EA 5GPIB 3M7TA 1GJ4H 3RXVA 3SI3H 3E1XB 3SN8A 1THPB 3BSQA 3TGKE 3T62A 2F9OA 1SHHB 4X2WA 3M5NA 1ARCA 1CGHA 1ESTA 4FUEA 2IN2A 3RXOA 2PV9B 2IJOB 3A89A 5FPYA 1ARBA 4Z6AH 5C2ZA 3SZNA 1MD8A 1RRKA 3ZVCA 1ID5H 4NWKA 1Z8JB 5AFZH 5CMXH 2FESH 1ETRH 3V7TA 3NUMA 2JETC 2SGPE 1TX8A 2ZGJA 1AUTC 1YF4A 4OS5A 1TYNA 3FFGA 4ABFA 3SW2B 1XUIA 1XXFA 2HLCA 3FVFB 3S7KB 1O31A 4NFFA 2AYWA 3O8BA 5A8YA 1AY6H 2FLRH 1GI5A 2WPLS 1L1GA 3LGVA 3ZZ8A 1NC6A 1C2FA 3VB4A 4E7NA 1MTVA 1SGNE 2FI3E 1G37A 1VGCC 1ZZZA 1P0SH 1CU1A 1QL8A 4OS1A 1C1PA 1GL0E 3Q3YA 4X2VA 2PW8H 2ZQ1A 3RXBA 2R0LA 4I33A 2TIOA 4JCNA 3SHAH 1FV9A 2BY6X 1W11U 1CGJE 3V0XA 1AFQC 2ZECA 3TIUA 1CHOG 4DOQA 2OC0A 4YT7H 2O9QA 4CRCA 4D7FA 3MNXA 1FAXA 4R8TB 2BZ6H 3ATWA 1YPMH 3TNTA 1Q2WA 4D76A 3GYMA 4ZHLU 3A7ZA 1DT2A 1EP5A 1O2TA 4DJZB 3AW1A 3E6PH 1TGSZ 3NCLA 4FVDA 5L30H 1O3IA 1T31A 3R3GB 2GZ9A 5GJ4B 1P09A 1QJ1B 1CGIE 1SOZA 5EPNA 3SU5A 1AIXH 3AAVA 1UO6A 2G55A 4AFQA 1VJ9U 3A87A 2PSXA 5F8ZA 2XXLA 1RFNA 2NWNA 1TX7A 3ZVGA 1V2JT 1QBOA 2FTMA 4FUHA 1BBRK 3W94A 1MAXA 1E36B 1K9OE 1DSTA 2BOHB 2FZZA 1OKXA 3BTWE 4MNXA 4O97A 2BLQA 5T6DA 1DXWA 3MHWU 1C2JA 2OINA 1EJMA 1A7SA 1VZQH 3M7QA 5EU8A 3F1SB 1GBFA 1ORFA 1S84A 3F9HA 1GI9B 1GBEA 1O3FA 2HWLB 3OX7U 4LXBH 3T27A 2ZFSA 1GCDA 3GCTG 2FI4E 1TNGA 3LOXA 6GCHG 1INCA 1UTLM 1IQMA 1TPAE 1PJPA 1V2LT 2VIVA 2BOKA 2EI8A 3A84A 4NWLA 1KXFA 3UR6A 1O5BB 2QCYA 3N7OA 1T8LA 1ZTLA 3P95A 1WSSH 1VCPA 3FZDA 1GHYH 3ZV8A 2ZWLH 5AF9H 5C1YA 2FOFA 3OTJE 4X1SU 2OC8A 1TMBH 2OLGA 2IOTA 4I8KA 3RXEA 4O3UA 3UWJH 1ELAA 2DE8A 2ZFQH 1AB9B 1YPGH 3RDZA 3BTGE 1C2MA 1EASA 1TNLA 1K2I1 1KXCA 2WV5A 5GIBA 4D7GA 1DICA 1VGCB 2HNTE 2ZNKH 2F3CE 3DFLA 1C1MA 3RC4A 1GG6B 5FX5A 1ZTKA 2GD4B 2XC5A 1TGCA 4IN1A 2ZP0H 1QB6A 1DFPA 2ANYA 1JRSA 2F9BH 4X6OA 4NFEA 2BVRH 2EA3A 1MH0A 1C5MD 3LONA 5HGGA 3MU4A 3UNSA 1O3DA 1RS0A 1T8MA 1S5SA 3F6UH 4KTCA 2Q1JA 3RMLH 3TJVA 1FXYA 2A5IA 3A81A 4B2CA 1BTYA 1LMWB 1W0ZU 2C8WB 1GI0A 3DUXH 2EC9H 1TFXA 4K69A 3IITA 1GI2A 4WH6A 2XCFA 2PSYA 2ASUB 8KME2 1C1SA 2FP7B 3MH6A 1BTWA 3Q77A 4TWYA 5FCRA 1B0FA 2XWBI 1FPHH 4X6PA 3S9AA 1O34A 4BAQB 1K1PA 4BNRA 2VH0A 2WYJA 3CP7A 1ZMLA 1FY1A 2XBVA 2CN0H 1EZUC 3BIUH 4MPXA 2ZGCA 1H8IH 3U9AH 5A8XA 3MNCA 3TPIZ 2P95A 6GCHF 4A5TS 4YM9A 1HIAA 1O0DH 2FO9A 1SLUB 2Y81A 1MCVA 2A4GA 5DG6A 2BXUH 3U98H 2AERH 4ABBA 1VR1H 4BTUB 1O3CA 1C5LH 1YCPM 5EXMA 1K1OA 1AQ7A 3S0NA 1V2NT 1D4PB 5FCKA 3A7YA 3BIVH 1GI7B 1GHAF 2C8XB 1S0RA 1IAUA 4ZHAA 1UMAH 2TRMA 4WXIA 4X2YA 4ZMAH 3L6PA 1SSXA 3U8RH 2ZPQA 1D9IA 5TJXA 1LHCH 1P02A 1P2MA 1XUKA 1HPGA 3DT0H 1SGRE 4AOQA 2NU1E 3ELAH 1E0FD 1FY4A 2AGIX 3KEEA 3SV8A 1N6XA 2ZCHP 3TU7H 2H9HA 2F9NA 4ISLA 2CHAC 2FPZA 3SJ9A 3KQEA 3MMGA 4DGJA 4BOHA 3PO1B 3U69H 2EI6A 1O2SA 2W5EA 3ZZ9A 1QBNA 1HFDA 1OWEA 1LPKB 1FI8A 1WUNH 1O3LA 1DE7H 1EOLA 1MKXK 4ZH8A 5E0GA 1UVTH 1LVOA 1DANH 1A3BH 5TCCA 1AI8H 1DOJA 1BB0B 1GG6C 4UFGH 2ZTYA 4ZKNU 3BTKE 5F8TA 1O2PA 5F8XA 3HATH 4FUGA 3SV6A 3ATIA 3TK5A 1O2HA 2LNCA 8GCHG 1CHOF 4MPUA 5L6NH 1TOMH 5I46H 2AS9A 5FXLA 2AMQA 3SNAA 1S6FA 2GT7A 3MNSA 1DLKB 1O2KA 2FOMB 2FYRA 1ZLRA 1GVKB 1C2GA 1YCPH 1YPLH 4Q80A 4ABAA 6CHAB 4AB9A 3ZVDA 1EX3A 2FOCA 2FOEA 1BUIA 1W14U 4R0IA 2G8TA 3KCGH 1ZPCA 3O8DA 1ZSLA 1ETTH 1V2OT 2QY0B 3A88A 4JZDH 2G4TA 1QCPA 1AE8H 3SGQE 4MPWA 1HUTH 1MTUA 1WYKA 1N1LA 1SGDE 2BHGA 4FU9A 2GCTC 4ABJA 4Q7YA 1WTHD 1O3KA 4AORA 2TBSA 1GJBB 1W3CA 3UR9A 2XYAA 4DIHH 2ALPA 2ODYB 2P3TB 3GY7A 2RDLA 4TPIZ 1SI5H 2G51A 4B76A 1V2ST 1P01A 3KN2A 3P8FA 1WBGB 1DM4B 2CV3A 1SOTA 3RP2A 2ZDVH 5C5OA 4NZQA 1AVWA 4Q7ZA 3P70B 2BX4A 1MBMA 1GMCG 4INLA 1ZMJA 3GDUA 3TGIE 3LKWA 1GBMA 1C5NH 1H1BA 2KAIA 3ZYEA 1TNIA 4WF8A 3Q76A 1HCGA 2ZFFH 4WXVA 4HZHA 3VB5A 1OWIA 4GCHF 1F92A 3P92A 1TGBA 2GZ8A 2UUKB 4GAWA 1WV7H 2ZU5A 3K6ZA 3RXIA 1F0TA 3SU2A 2AMDA 1A61H 1XKBC 3U8OH 1W10U 1HV7A 1GBDA 2ZGBH 3SU0A 3H5CB 3NXPA 2A2QH 1O2OA 3GYLB 3GCOA 2C90B 1UCYH 3RXCA 1GHXH 2F91A 4TYDA 2FODA 2ZU1A 4UFDH 4JYVH 1GJ6A 2ZU2A 1YLDA 1O38A 4NA7A 1S83A 2C8ZB 3D62A 1FONA 1HDTH 2A4RA 2RG3A 3MI4A 1FIZA 4Y11E 2B5TB 3LH1A 1JWTA 1V2QT 1EAXA 1ANDA 1HAHH 1T32A 1LPZB 4X8SH 3ZZDA 1O2UA 1H9HE 4YESB 1XXDA 1HAIH 1NFUA 1PYTC 1EZQA 2DE9A 4K2YA 4DVAU 3ITIA 1QR3E 1ELVA 1GBAA 1SGTA 2UUJB 2C3SA 1S6HA 1Y3YA 2OD3B 4YZUA 2GMTB 3MU1A 1Q31A 1K1IA 1AMHA 2VIWA 3KHVA 3BG4B 1GHZA 1V2MT 1SLVB 2A7CA 3L3TA 3SJ8A 2GZ7A 1UVSH