1JIMA

Stereospecific reaction of 3-methoxy-4-chloro-7-aminoisocoumarin with crystalline porcine pancreatic elastase
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORCINE PANCREATIC ELASTASE
publication title Stereospecific Reaction of 3-Methoxy-4-Chloro-7-Aminoisocoumarin with Crystalline Porcine Pancreatic Elastase
pubmed rcsb
source organism Sus scrofa domestica
molecule tags Hydrolase(serine proteinase)
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1993-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1jimA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1jimA01
5E0JA 4DW2U 4WMFA 2IOTA 3BV9B 3KNXA 2Q6GA 1C1NA 1QBNA 2HGTH 1P57B 2HLCA 3F9EA 3MU8A 1ARBA 2ZGHA 3KCGH 3TGIE 2FMJA 5EG4A 5EXNA 1OYTH 2Y81A 1C1VH 3MU0A 1ELAA 4RKOB 4OS7A 2GP9B 1DUAA 4GPGA 2ZDMA 1MTNC 3EA8A 4KTUA 4ABJA 1JIRA 3GY4A 5GPIB 3PMBB 3M3TA 2BB4A 2FYRA 1XUKA 2BVXH 2XBWA 1RGQA 2G81E 3TK5A 1HAYB 4U01A 3M7QA 1QFKH 1ZGVA 1ELCA 3D49H 2TBSA 2VH0A 1TABE 1P3EA 3A82A 5HXFA 3ENSB 3S7HB 1DPOA 2JH0D 1FJSA 4FUEA 2UUYA 2HOBA 5EW1H 4X2XA 3M5NA 1K1JA 3D23A 2Y5GA 3PYHA 3ZZ7A 3B23B 5AF9H 3UNSA 1ZMJA 1GBTA 2AGEX 4AFUA 3F9GA 2C93B 1UO6A 2G00A 1QIXB 3ZYDA 1T4VH 2XBYA 3CS7A 4AB9A 2OCVB 3A7WA 3SU0A 3VXEH 1BB0B 2V35A 2SNVA 1BBRK 1GBLA 3HK6B 3TIUA 3F9FA 5FAHA 1OWJA 3L3TA 1EXFA 1L1JA 3ZZ8A 3LC3A 4AFZA 5A0BA 1SG8B 1GDNA 3GISB 3QWCH 4FVBA 3B9FH 3SJ9A 1YPEH 2ALPA 4YOJA 2VWNA 4WXVA 3ZZ3A 1LMWB 2B0FA 4HGCA 5LH8A 1O3HA 1ABIH 2BLVA 1PQ7A 1C5UA 3RU4E 1DY9A 1AN1E 3TU7H 3ZZ5A 3RXUA 1PPEE 5JB9S 1MMJN 2P94A 1KDQA 5DKMA 2PTNA 1TPPA 2W5EA 5CHAB 2HPPH 2H6MA 3ZZ6A 1WSSH 1P02A 1FONA 1C1UH 3GYLB 4CRAA 6CHAB 2A5KA 1AUTC 2ZPSA 1TLDA 2BDGA 1Y59T 1PPBH 3RU4D 3T26A 4MPUA 1HAXB 4OS4A 2CF8H 1BTUA 2R9PA 2H9HA 3W95A 3BF6H 3E16B 6GCHF 1O3IA 3ZV8A 3EGKH 2Z9LA 3TLOA 1P2MA 9ESTA 2EA3A 3GCNA 1QRWA 2VGCC 1SHHB 1F5KU 2B9LA 4XBBA 1GJ9B 1JWTA 1K1MA 2GV6A 1ETTH 1H4WA 2BD7A 2ZFFH 1V2MT 3SV6A 1MZAA 1EX3A 5C1YA 1MKWH 1T31A 1GVKB 2RCEA 3A80A 5LPRA 3ZZ4A 3U1JB 1HCGA 4J2YB 1QR3E 4YT6H 1SGTA 1QJ6B 1RRKA 4OS2A 2P8OB 1EUFA 1QL9A 1P11E 5TJXA 2IPHA 1BQYA 1JRTA 2ZEBA 4H42U 1LVOA 1O2MA 1SGEE 1S82A 2UUJB 1PPCE 3A7TA 3GCTG 2SGDE 4OGYA 3MI4A 1Z8GA 3A8CA 3MO9A 1TX7A 3RMOH 1GMCG 2PWXA 1GL1A 2ODYB 1O2YA 1EP6A 3C1KA 3MU5A 3W94A 4AZ2B 2PKAA 4ZKRU 2FTLE 1PQ8A 1UTNA 3DT0H 3RXEA 1D3QB 5C1UA 2G4UA 1BMAA 1CO7E 1YPMH 2ZHWH 4RN6A 3BN9A 3SJIA 2ANWA 4A1TA 3T29A 1GVZA 2G4TA 3U8OH 4Z6AH 4BXWA 2FYQA 1C5WB 2KAIA 3SNDA 1SMFE 1NFUA 1NN6A 1DSUA 2CV3A 3DFLA 4H6SB 3RXSA 1TPOA 3A8BA 2ZCHP 1NTPA 1Q31A 1EAUA 1MKXH 1QQUA 1DXWA 5EODA 1MTNB 2ESTE 1C1QA 1D9IA 5ETXA 1FIZA 2O8TA 3ESTA 3LKWA 4NZLA 5TCAA 1BHXF 2FX6A 3E6PH 3QX5H 1GI9B 1KLJH 1O2RA 2V0BA 1DX5M 1NROH 2Y80A 2GMTB 2ZCKP 3UTUH 4X1RU 1CA0C 3URCA 1MTVA 2YNBA 4DOQA 4F4OC 4Y7AA 2B5TB 4FU9A 4MG3A 3UFAA 1ELTA 2J4IA 3KQEA 4Q2KA 3F9HA 3Q00A 4BOHA 3P95A 1TIOA 1FN8A 5E0HA 1GJ8B 1O5DH 1F0TA 2BYAX 1GHBF 4M7GA 3V3MA 3L6PA 3UQVA 2V3OH 5HGGA 5SGAE 2AGIX 3M61U 2A4GA 4UD9H 4NIXA 5HM2A 1HNEE 2CHAC 2OQ5A 1KXAA 2BOHB 2ZHEH 1QURH 1DE7H 4NSVA 1ZJKA 4XSKU 4X2VA 1P06A 1IQJA 3BTTE 3M37A 2VWLA 2BX3A 3JZ1B 1TGTA 4H4FA 4CREA 3F1SB 2ODPA 3KEEA 5K0HA 1DITH 2FEQH 1HFDA 2FPZA 1V2WT 1ZR0A 1WTHD 2SGAA 4NIVA 2WV5A 2ZGBH 2XC5A 3RC4A 2QXHA 3I29A 2ZU3A 1BRUP 4K1SA 5HYOA 1XM1A 3KHVA 2XRCA 5EQSA 3MH6A 2R0LA 5FHTA 2Z3DA 1GVLA 2W7SA 3RLWH 1EP5A 2W26A 1BRAA 5L2ZH 1G3DA 1CGHA 5DPAA 4NSYA 1BTXA 1SOZA 4YTAA 9LPRA 1BUIA 1NFYA 1TOMH 3VGCC 3PLKA 1Y3VA 1LPGB 5C5OA 5LPEA 2W3IA 1KXCA 1Y5BT 2ZFSA 4CHAC 1O3JA 1A1RA 4NGAH 1BTHH 1TRMA 1C2IA 2BLWA 3VB5A 2R2WU 3ZZBA 1ACBE 1PPGE 1GGDB 4LXBH 4JZDH 4X1QU 2LPRA 2SGFE 3A86A 4AYVB 5J4QA 4FUJA 3A8DA 1V2PT 3LGUA 3SU1A 2BDIA 1WYKA 2H1UA 1C5TA 1GBFA 3HGPA 3KIDU 2BY9X 1RXPA 1PQAA 3I77A 1LQEA 3MFJA 3O8DA 2FOEA 2ANMH 1C1SA 1Z6JH 3GY6A 2WPKS 1XUHA 2Q1JA 1O32A 1DANH 3SJKA 2ZFTA 4BTIB 1LVMA 2FOFA 4E7RG 1QRZA 5A2MH 1C2LA 1EZQA 4X6OA 2P3FH 1T32A 1W10U 3FVFB 5EQRA 1BRCE 1GBKA 1UCYE 1IQHA 3H5CB 3MHWU 3ZZCA 1OWDA 4MNWA 3FP8E 2G8TA 1KLIH 2WPIS 1TOCB 3UNRA 1IHTH 3AASA 2O8WA 1SPJA 1F0RA 1GJ7B 5DG6A 4INHA 3O8RA 1UTJA 1AY6H 1THRH 2CF9H 4KGAA 3UY9A 2P93A 2PUQH 6LPRA 1GBJA 2QY0B 1AGJA 3GY2A 3ZYEA 1LKBA 3PTNA 4ZH8A 1TNIA 4YLUA 2HWLB 5FX5A 3U8TH 1VITF 1SGPE 2IN2A 3OTJE 1Z1IA 1TNHA 2BXTH 1AWFH 1HB0B 4YESB 1C2EA 1QHRB 1P2IA 1YGCH 1O2HA 1K2I1 3TH2H 3ZVDA 1O36A 5F03A 5DP8A 4ABAA 1SL3A 3U1IB 2OQUA 3UIRA 4MPXA 3URDA 4FUCA 1N6YA 2GZ8A 1TYNA 4ISHH 2J94A 2ANKH 3SV2H 4K8BA 1Z71A 3FP7E 2GT8A 4IC6A 1FLEE 2ZTZA 1V2QT 3DA9B 3NCLA 4ABFA 1AVGH 4UFDH 1ELGA 4ZAEA 1EOJA 4JYUH 2AMDA 3SV8A 2R2MB 3ATWA 1HV7A 5H4IB 2A4QA 2BY5X 3RXGA 6CHAC 5HM9A 2A7JA 3M5LA 3SU6A 3CP7A 1GHBG 4IMQA 4Q7ZA 3PO1B 1NS3A 3RXQA 3GDUA 2ZHDA 1JIMA 2WINI 1E0FD 5FPSA 3L33A 1V2KT 3RUOA 1KSNA 2BD4A 1YPLH 5I46H 2QXGA 3PB1E 1K21H 3SQEE 4GLYA 1MAYA 1C5ZB 1XXFA 4ZUHA 1P04A 3F6UH 2C4FH 2OC7A 2QAAA 2A31A 1FN6A 2FZZA 1BRBE 2ZU2A 4SGAE 1O0DH 1S6HA 1NFWA 1T8LA 4BAHB 1D4PB 3SU4A 1QY6A 1W13U 3ZVEA 1A5IA 2DUCA 2Z3CA 1ZYOA 4D9RA 2O8MA 1E34B 1QB6A 5GDSH 1AI8H 3UOPA 1YPGH 1SFQB 5DP7A 3SHCH 1C1PA 2FX4A 5JPMH 1TAWA 4LOYH 3RXOA 4YO9A 2UWOA 4IGDA 2ZFRH 1AZ8A 2VIQA 3D65E 1JBUH 1EAXA 1DFPA 1O3OA 2BD5A 1G9IE 1YPJH 1EAIA 1EJMA 1YCPK 1WUNH 2ZU1A 4WXIA 3TJUA 2GCHF 1UHBB 4A7IB 2ZU4A 3QK1A 1BHXB 4FUDA 2ZP0H 1VJAU 4XDEA 5EPNA 4FUFA 2F9VA 5JYIA 1FY1A 1KXBA 1PFXC 1TFXA 2OC0A 1LVBA 3Q76A 1C4U2 1V6DA 1C5QA 3NZIA 3C27B 1IOEA 2JH5D 1SLUB 1SHYA 1P2QA 3EA7A 3SUDA 5CMXH 2QF0A 2F83A 3O8CA 2WYGA 3IG6B 4WWYA 4LK4A 1ZTLA 4K1TA 1RTFB 2VVUA 2BDYA 1ANEA 1HLTH 1W8BH 3MH5A 2QXJA 4AFSA 2Y5FA 3SN8A 3MO6A 4DIHH 4FUBA 1J14A 2C8WB 2VJ1A 4O9VA 1T8NA 4AG2A 2GV7A 1THPB 1YF4A 2BDAA 4B75A 1K1NA 1O3EA 1BMLA 3LIWA 1C1TA 1N6XA 3QO6A 1SR5C 1NPMA 3BTME 3TITA 4DGJA 4SGBE 3RXMA 2BLQA 2GMTC 3LT3A 3MMGA 1AMHA 4CH8B 1XUIA 2PLXA 1J15A 1O3AA 4AGKA 1AFQC 1A2CH 1P2NA 5EOKA 2J95A 3R3GB 4MPWA 3TK9A 5DP5A 2C8YB 1C5PA 2PR3A 1Q2WA 5K7RA 2WYJA 3TJOA 3KQBA 2HVXA 1UVTH 3U98H 1WCZA 1C1MA 1IQEA 1VCQA 2AIPA 3VFEA 2FOAA 5T6DA 4AFQA 1AVXA 1Y3UA 5GXPA 3RM2H 1JXPA 1TGSZ 5E2OA 2BD3A 2BOKA 1AD8H 1ZSKA 3UPEA 2FOCA 2BY6X 3S9CA 4NFEA 2SNWA 2FESH 2D26C 3T2NA 2QF3A 1F7ZA 5A09A 4Y0YE 1O2WA 1GDUA 1HIAB 1O2IA 2SGQE 1GCDA 4Y7BA 2I6QA 1GBDA 1F5LA 1CU1A 2ILNA 5EU8A 1ZOMA 5F8TA 4YOGA 4ZHLU 1C2FA 8KME2 1F0UA 2ZQ2A 4D76A 2BVSH 3VB4A 1C5NH 5C2ZA 1RTLA 3CS0A 1NRSH 4CRGA 4I31A 3ZZAA 1S0RA 1P09A 1GHYH 5EW2H 1BBRH 3UUZA 4NZQA 1K28D 3LGVA 1O2ZA 1OS8A 3KN2A 5B6OA 3AVZA 1S0QA 1SC8U 1FAKH 1UTQA 2F9NA 2BQ6B 5CE1A 1H9HE 5JBBS 1B0FA 1DLKB 2ZGJA 3OY6U 3VEQB 3PLPA 1SQTA 1O3KA 1DUEA 2BTCE 2A1DB 2FLBH 3FFGA 4O3UA 3ZVCA 1NM6A 1MUEB 2P3UB 3BTKE 1ELEE 1GMDF 1OWHA 2DE9A 4PROA 1AKSA 5F8ZA 5BRRE 5F6MA 2J9NA 1AQ7A 2BZ6H 2ZU5A 2GZ7A 4HI3A 2OLGA 4U32A 4WJG2 1GGDC 1SGIB 1HAZB 1MU8B 1THSH 2SGEE 1LCYA 4K60A 4WMDA 1QB9A 2O8LA 3CENA 1YBWA 3E3TA 3RXBA 2SGPE 4R0IA 1AB9B 3ATKA 1G37A 1WAYB 3LC5A 3BEUA 1P2KA 1Z8JB 3FANA 1LHFH 3TJNA 2Q6FA 1DDJA 1OPHB 1O2TA 3RXDA 1CVWH 1E35B 1YKTA 2RDLA 5GJ4B 1P9SA 3SI4H 3NWUA 1C5RA 1W12U 2NU3E 1HDTH 1V2TT 1A5GH 1ESTA 1HUTH 1UHBA 2P95A 3LDXH 3N7OA 3WY8A 2C90B 2VH6A 1P0SH 4A1XA 1V2ST 1U6QA 4XFQA 2H2ZA 1C1WH 4KP0A 1AE5A 3TPIZ 3RM0H 1YYY1 2ALVA 2PHBA 1VGCB 5A0AE 4E06H 4QT8C 1FXYA 3ODDA 3R0FA 3VPKA 3UNQA 2PV9B 1B7XB 2FDAA 2GCHG 1W11U 1GWAA 2WV4A 1VITH 2R3YA 2BMGB 3M3SA 3E91A 3VB6A 3EDXB 3SOSA 2BX4A 4RSPA 2PKSB 1XX9A 4NA8A 3KQCA 3SUGA 1DWDH 1K22H 3K6YA 1GBCA 2Q6DA 1LHDH 2A2XH 2ZFPH 3V0XA 1LVYA 5C67A 1O3LA 1TALA 1HBTH 2QYIA 2ZGCA 3TGJE 2G55A 1ESBA 1OXGA 2OP9A 1ZPBA 2HRVA 2XW9A 1A0HB 5DP3A 4DVAU 1SQAA 5T3HA 1UVSH 4KELA 1RTKA 2H5DA 1FPHH 1O2OA 1C9TA 2B7DH 3OU0A 2O9QA 4FXGH 1IQKA 1V2UT 2THFB 3ZVGA 2D1JA 4INLA 3U9AH 1DSTA 1TWXB 2VWMA 3OSYA 2P3TB 4CBNA 1GHZA 1INCA 4K1EA 1V2OT 4CRFA 4E7NA 4GCHF 1DY8A 1AFQB 1IHSH 3OX7U 2FP7B 1G36A 1FNIA 4MQAA 4ESTE 1C2DA 1O3PB 1O2GH 1AUJA 1BOQA 1CGIE 4TPIZ 2H9EH 3O8BA 1N8OB 1DXPA 1NC6A 3RLYH 1TNKA 2YNAA 1TGCA 4O03A 1GJ6A 3T28A 3U69H 4TPYA 1SGQE 4GHQA 3GICB 4H6TA 4RKJB 1XKBC 1HIAA 1C2MA 1O2KA 2F91A 1ORFA 4J1YA 1GMHF 3PO1C 1EAWA 4ISNA 3V7TA 1OSSA 1QGFA 2OUAA 1Z8IB 1O5EH 1UTLM 1W0ZU 4JZIA 1SGYE 1AU8A 1TQ0B 4FUHA 2F9OA 1TBZH 3P70B 3JZ2B 2VIVA 1E36B 5EQQA 1HPGA 1IQLA 4I8GA 1OP0A 1H8IH 1Z8RA 2Y5HA 3NK8A 1RIWB 1A61H 5JBCS 3LPRA 1O2SA 4X6MA 1H1BA 3HATH 1ZGIA 3FZZA 4A5TS 2QV1A 4K5ZA 4DY7B 4ZXYH 2RA0A 2HNTF 8GCHF 1SGRE 4IN2A 3SZNA 1UVPA 3PTBA 4BNRA 1EASA 1RFNA 1CHOF 3BSQA 1C1RA 2A32A 4Q80A 5BPEA 1G3BA 1MZDA 1TMUH 1GI6A 2C8ZB 3PMAB 1X7AC 3TK6A 4F49A 1F2SE 4Y71A 4GHTA 3D62A 3MNXA 2OINA 1H9IE 1S6FA 3K65B 1XKAC 5FX6A 4DJZB 5F8XA 3EE0B 1KLTA 2F3CE 1TRNA 2ZA5A 4IW4E 3QDZB 4I7YH 1AZZA 3M5MA 4KTSA 1TB6H 1TGBA 5EGMA 4KKDA 4MNXA 2BQ7B 6GCHG 3EAJA 1GMDG 4ABGA 3UQOA 5GIBA 3LU9B 1MH0A 1FY5A 1C2HA 1CE5A 3BTGE 1PYTC 2FI5E 1ELVA 3E1XB 4AGJA 1GG6B 3ZVFA 2VU8E 4X2WA 5L30H 3SGBE 1S81A 1GI0A 1A4WH 4WF8A 1O2NA 5GCHF 3BG4B 4OS5A 1GI3A 2BXUH 2ZGXH 2PTCE 2ZTYA 8ESTE 4UFFH 1L4ZA 1UTMA 2XC0A 2ZNKH 5LPFA 2PGQB 4B2AA 3S0NA 3UOUA 2ZDKA 2STBE 1D3TB 2J92A 3SJOA 2ZCLP 1O34A 2XCNA 1H9LB 4I8LA 1WOFA 1GBIA 1HYLA 4HZHA 4NA9H 3RXIA 4DG4A 4DURA 1MQ5A 5ESTE 1EPTB 3NKKA 2Y82A 2BDCA 3PWBA 1GBBA 4UEHH 5L2YH 5A0CA 1LPKB 3A89A 1YCPM 1SLVB 2QXIA 2FIRH 3SU3A 2AH4X 4X1SU 1CHGA 4LZ1H 1K1OA 1XUFA 1QA7A 2PGBB 4CR9A 2K1QA 1VR1H 1W0YH 1GHXH 2HNTC 1P2OA 4ISLA 5FPTA 1HAGE 3KGPA 2BD8A 2QC2A 1O2JA 2F9UA 3FAOA 1YPKH 2FI3E 1FV9A 1AHTH 2DE8A 4NFFA 5AFYH 5A8ZA 2FXRA 1FQ3A 4BAQB 3RXTA 1KIGH 3QZRA 3DD2H 3QLPH 1S83A 4ISIH 1NU7B 2BQWB 5FBIA 1EZXC 5C3NA 1DM4B 1KYNA 1O3NA 1O30A 1DS2E 1HJAC 4GCHG 3RC6A 4UFEH 1UCYK 2TGPZ 1GJDB 4ABEA 1D3DB 2OXSA 2WUBA 3P17H 4JMYA 2G5NA 1EATA 1GJ4H 2A0QB 1NRRH 2GTBA 2VIWA 1O38A 1VCWA 1RJXB 2BY8X 3SHAH 1J17T 4B1TA 1NESE 1C2JA 4ZKOU 3T25A 3ITIA 2Z9KA 1JOUB 1A46H 2P59A 1ANCA 5T6GA 4YM9A 4INKA 2VVCA 2R3UA 1GMHG 4A1VA 3LOXA 4B74A 5ESBA 1TMTH 3RC5A 2V6NA 1EQ9A 4D7FA 4E05H 1OP8A 4NWKA 1GJAB 4BAMB 1EKBB 1M9UA 2OBOA 1TNJA 2STAE 4BANB 1SFIA 1ZRKA 1QBOA 1RD3B 2AIQA 3DHKH 2NU2E 3UREA 1AIXH 1KDQB 3LGYA 1O2XA 1NU9A 1IQMA 1LQDB 1PYTD 1T8MA 1HJ8A 1SLXB 1BJVA 1HGTH 2TGDA 2JETB 3RXLA 4THNH 4Y8YA 3PV4A 3Q3XA 1AB9C 3ATIA 2I6SA 8GCHG 1TA2A 4R8TB 2Y7ZA 1GBHA 1C5SA 3MH4A 1CHOG 3Q77A 1TBQH 2BVRH 4IC5A 1ZMLA 1NRQH 1O2QA 3MYWA 2Y6TA 1OYQA 4TWWA 3BTDE 3SI3H 2XCFA 2QCYA 1F0SA 4AX9H 3RMMH 2SFAA 1DWEH 1B0EA 4ABDA 1PPZA 3B8JA 1YLCA 1O3CA 1O2UA 4X8TH 3RXCA 3SGQE 5DP9A 4YOIA 3SORA 1VGCC 1TPAE 1FUJA 5FPYA 1PQ5A 1ZZZA 4NIWA 5GWZA 1NFXA 4GAWA 3AAVA 2FWWA 4VGCB 1C2KA 1CSOE 3GCTF 1V2JT 4AORA 1P10A 1BDAA 1F92A 1SBWA 3BTEE 4AG1A 5DP6A 3ZVAA 1BTZA 2HNTE 1GMCF 1MAXA 1L2EA 4I32A 1UTOA 1G32B 1Y3XA 1ZTKA 2FS9A 1IQIA 5T6FA 1YM0A 3SV9A 5GCHG 2PKSC 1DOJA 2D8WA 4XOJA 4AN7A 1QQ4A 2CN0H 7LPRA 4ZHAA 4O3TA 1W7XH 3QGJA 1P01A 2VWOA 1TBRH 1EPTA 1YCPH 3GDSA 2WPLS 1BBRE 2HALA 3I78A 1AVWA 1P8VC 2H5CA 2ZF0H 1AE8H 2TIOA 2GD4B 1ZMNA 5ABWA 1SQOA 1YPHE 3RXRA 2H9TH 1SGDE 1AO5A 1YP9A 3LGIA 1HAOH 1GPZA 1L4DA 3LJJA 5I25A 3BTQE 3UWJH 2ZQ1A 3BTHE 4I33A 2LNCA 4X1PU 2AFQB 2KAIB 2CMYA 1K1IA 2XTTB 1V3XA 2Z9IA 1P2JA 1TA6A 2Z94A 1C5MD 1ID5H 3P8FA 3V12A 3A7VA 1BTPA 1NY22 4ZKSU 1N8OC 3HKJB 1ABJH 1VCPA 2F9PA 2PSXA 1OP2A 3DUXH 3BEIB 2ULLA 2EI8A 1O37A 4A92A 2GCTC 5IDKA 3A8AA 1VITG 1E37B 7KMEH 1WV7H 1O3DA 1ZHPA 3M3VA 4NWLA 1J8AA 4X0WU 4Z0KA 2XBXA 1LHCH 1A3BH 2GX4A 1C5VA 2ZI2H 1GI1A 1GCTB 1UTKA 1QJ7B 1P12E 3TH3H 2WPJS 3RXPA 3E0NB 4B2BA 2Z7FE 3LH1A 1OWIA 2JKHA 4I8HA 3A84A 1FY4A 1HJAB 3LGWA 4IN1A 1QL7A 1ZLRA 1RIWC 3A81A 4JZEH 1JMOH 4Q7XA 5A8YA 5LGOA 4WY3A 3QUMP 1VJ9U 3SO3A 4ZKNU 4HTCH 3NPSA 2ZDNA 3SNBA 4ASHA 2VB0A 3MTYA 5EXMA 2ZFQH 4JZFH 3PLBA 1MTSA 5AFZH 1XUGA 1QJ1B 4FVDA 4TYDA 3AW0A 5AHGH 2F9BH 2TRMA 1ANBA 2GVFA 1EB1H 1Y3YA 1MCTA 2PFEA 2Z9JA 1NT1A 4DIIH 1SB1H 1NRPH 3VB3A 3PMHB 1MTWA 3SU2A 4Y79A 4Y11E 3ZZ9A 5E2PA 1J9CH 1MKWK 2VVVA 2TPIZ 3SUFA 1C1OA 1ETSH 1O5GH 2ZPRA 3LH3A 3MNSA 2ANYA 2VIPA 4Y76A 1UK2A 1VZQH 1ETRH 1LPZB 2AEIH 2IJOB 2W3KA 1YLDA 2CGAA 3QTVH 1Y8TA 3GCHB 1LDTT 1WQSA 1GG6C 1QNJA 3SQHE 3OYPA 1UK4A 3RXAA 1GBMA 2Y7XA 2FODA 8LPRA 1SOTA 2OC1A 4D8NA 1SGCA 1S85A 3BG4C 3T62A 2AERH 1H8DH 1BMMH 1O35A 2OBQA 4BXSA 3SW2B 5IYTA 1GI4A 3QZQA 2FOMB 3GY3A 4YZUA 1N1LA 1L0ZA 5DO4H 1HRTH 5DK1A 6ESTA 5G4BA 3UR9A 1TQ7B 2ZZUH 2ZTXA 4AYYB 1CBWB 2XC4A 1EJNA 2BD2A 1FDPA 3SBKA 3RMLH 2ZDLA 3TJVA 3H7OA 2ZC9H 2VNTA 4DT7B 4FUGA 3A7XA 1BIOA 2Z3EA 3MH7A 1BT7A 1W2KH 3S9AA 2A2QH 2M5TA 3KL6A 1EPTC 1HAHH 4K2YA 2GKVE 1BITA 2O8UA 4CBOA 4YLQH 3BIUH 1PPHE 1S84A 3P6ZB 1UK3A 3FP6E 1D6RA 1MKXK 3ELAH 2GDDA 4MNVA 4D9QA 1GI5A 2AGGX 1XMNB 2J2UA 4WVPE 4ABHA 1DWBH 1G2MA 1QTFA 4IS5A 4IMZA 4MDSA 2P16A 4ZROA 1MQ6A 4ZHMU 1B5GH 2B8OH 5AVDA 1OWEA 2XWAA 2RA3A 4XE4A 4DCDA 4UONA 1TX6A 5EXLA 3NXPA 4JK6A 1MBQA 3MU4A 4I8KA 3HPTB 5C5NA 1GJCB 1MBMA 2A7HA 2ASUB 4GVUA 4NCYA 4JYVH 3KQDA 3P8GA 1GJ5H 1HAVB 3EYDA 1W3CA 5DJ7A 2QN5T 4X6PA 1C5OH 1P9UA 1E38B 3MOCA 1C4V2 1O33A 3RMNH 3A7ZA 1C5XB 2GDEH 3TGKE 4X8UH 3S7KB 3GY5A 4MTBA 2YOLA 3UWIA 4X6NA 2OC8A 1EOLA 3NUMA 1CQQA 1OWKA 1LHGH 2OTVA 1SGFG 1A7SA 1ZPCA 4K8YA 3RXFA 3EQ0H 1TX8A 2GCTB 1ELBA 4ZMAH 2FLRH 5JDUB 1O5CB 4X2YA 1LHEH 1C9PA 1QB1A 3E8LA 7GCHF 4JK5A 1FI8A 4JYTA 2GGVB 1BTYA 2VINA 1SLWB 1GBEA 1WU1A 1GBAA 1L1GA 3IITA 3F68H 1XUJA 1XVOA 2JH6D 1IQNA 4BAOB 2XYAA 1S5SA 3G01A 4MNYA 4TWYA 3M7TA 4B2CA 2FOHA 1CGJE 5DGJA 2WPHS 3GY8A 1HAPH 4D7GA 3MU1A 3A88A 1AWHB 1IQGA 3RP2A 5FCKA 5JBTA 5FXLA 3TNSA 4X1NU 5HMAA 7ESTE 5C20A 2VIDA 2W7UA 1KTSB 1MU6B 2J38A 4HFPB 1GDQA 1HAIH 4X8VH 4X8SH 1GHAF 1O3BA 2JETC 1D6WA 2BDHA 4WMEA 2Z6BD 1O3MA 4NIYA 1DT2A 4YT7H 1ANDA 4BAKB 2J34A 1CT2E 1Z6EA 3AAUA 1T8OA 1SSXA 2OD3B 1DLEA 1TE0A 3PWCA 4GUXA 3V13A 5EPYA 1Y5UT 3S69A 3TVJB 3TNTA 1C5YB 1GHVH 4ZXXH 5L6NH 2ZHQH 4UE7H 3PROA 3K9XB 1KTTB 2EI7A 1PJPA 2G51A 3HGNA 2WPMS 1FIWA 3RXHA 3MWIU 2A5IA 1ARCA 1QBVH 4VGCC 1NZQH 5PTPA 2FM2A 3GY7A 1ZJDA 1CT4E 4CRBA 1YC0A 1Y5AT 1ZPZA 1G30B 3K2UA 3QTOH 2TGTA 1UMAH 4WH6A 1BZXE 1ZTJA 4XBCA 1Z7KA 2VGCB 1SGNE 3SJ8A 4I8JA 2HPQH 1O2PA 3HK3B 3MNBA 3SNAA 4WH8A 3RXVA 3UR6A 2TGAA 2XXLA 3ATMA 1TPSA 1TONA 1WQVH 3OY5U 4FU8A 1V2NT 4XBDA 4B71A 4Y6DA 3M7UA 3ZVBA 1FZZA 4ISOA 1T7CA 3A85A 3DFJA 4OS1A 1O2LA 1ZHMA 3GCOA 3M5OA 3BIVH 1O31A 1C5LH 3PM3A 1NRNH 2NU4E 3QGNB 4OS6A 2ZIQH 1ZSJA 1LKAA 3EA9A 1HXEH 4ABIA 1BCUH 1ZSLA 2FOGA 1UVUH 4CR5A 4GSOA 4U30A 4AOQA 1TRYA 1T4UH 2BDBA 1O39A 4KTCA 4TY6A 1GI8B 3BEFB 3U8RH 1AFEH 2BY7X 2EEKA 1MD8A 2EI6A 2G5VA 2FTMA 1SI5H 1EZSC 4MPVA 1WTGH 4JCNA 3PMJA 1P05A 2ZDVH 1BA8B 1O5BB 1FY8E 2A4OA 1Y3WA 2UWPA 1NO9H 1TNGA 1CT0E 2D2DA 4OGXA 1O3FA 2ZG0H 3ODFA 5FBEA 2ODQA 2A45B 2CXVA 1HAVA 1ELFA 2ZECA 3VB7A 4MLFB 3LONA 4Q7YA 2BD9A 2NWNA 1UVOA 3VXFH 2RG3A 1LO6A 3SGAE 1C2GA 1EJAA 2ZHFH 2GT7A 2PUXB 1C4Y2 2UWLA 3LJOA 2CJIA 4LZ4B 1IAUA 1ZRBA 5A8XA 1GCTC 1OX1A 1Q3XA 1HXFH 4BTUB 3BG8A 1O5FH 1GJBB 3MNCA 4CRDA 4MVNA 2NU0E 4Y8ZA 5JBAS 3GYMA 3STJA 3A7YA 2A7CA 1KY9A 4B73A 1YPHC 3SU5A 1UTPA 1XVMA 4U2WA 2UUKB 3LGTA 1ESAA 4BTTB 1K1PA 1FAXA 1JRSA 3HKIB 3P8NA 1XXDA 2FOBA 1CA0B 5TCCA 3AW1A 5JB8S 1F5RA 3MO3A 1HJ9A 3SNCA 5E8EH 1V2VT 1GL0E 2BM2A 2ZO3H 2ZKSA 1A0JA 1P3CA 2C8XB 7GCHG 5E0GA 1ZHRA 3A83A 3TH4H 2BHGA 5CHAC 4AB8A 1QA0A 1DWCH 3QN7A 1EZUC 3M36A 2FS8A 2GZ9A 4O97A 1UCYH 2CHAB 1DICA 2EC9H 2AMPA 3SV7A 1UJ1A 2C3SA 1K1LA 1TMBH 3BTFE 1P03A 2A5AA 5C1XA 1O3GA 4JZ1A 1O2VA 1GI7B 3T27A 4UFGH 3GCHC 2VIOA 3RXJA 2XWBI 1Z1JA 3M35A 3T5FH 1GHAG 1GI2A 3E90B 3GOVB 2BZAA 3ZV9A 4NA7A 5DP4A 1MCVA 1K9OE 1CA8B 1MD7A 2ZDAH 5FCRA 1FY3A 3Q3KA 1V2RT 2NU1E 1FMGA 1SVPA 1V2LT 1LTOA 4ABBA 1A5HA 1AKSB 3FZDA 2V3HH 3E0PB 4TY7A 1QCPA 3Q3YA 4A6LA 2PW8H 3P92A 4K3JA 1BJUA 3K6ZA 1EB2A 2Z9GA 1G3EA 1W14U 2A4RA 3SUEA 1RS0A 1WBGB 4Y0ZE 3H7TA 2AYWA 2R0KA 3RXKA 2BLOA 1G2LA 1CBWC 1KXFA 2G52A 4FUIA 1D3PB 3RU4T 1J16A 3KF2A 3ZZDA 3VGCB 1DVAH 2P8OC 4Y10E 3RDZA 4CRCA 1GHWH 1FPCH 4NG9H 4Y8XA 3ATLA 1KXDA 1TNLA 2AMQA 4CHAB 1SGFA 3IWMA 1KXEA 1A3EH 1BMNH 1QL8A 4CH2B 2FI4E 2FO9A 1ELDE 3STIA 1QRXA 2XBVA 3SNEA 1O5AB 3GDVA 4UDWH 1OOKB 4K69A 1A0LA 2QIQA 1TGNA 2XNIA 2WUCA 4FU7A 4IBLH 2QGRA 3P8OA 5J4SA 1W7GH 3S9BA 1MTUA 2AS9A 1OKXA 1BTWA 4B76A 3BTWE 1G3CA 2ZPQA 2PKAB 2ZWLH 2PSYA 1IQFA 1L1NA 1PPFE 2QA9E 2UUFB 3A87A
chains in the Genus database with same CATH superfamily
5E0JA 4DW2U 4WMFA 2IOTA 3BV9B 3KNXA 2Q6GA 1C1NA 1QBNA 2HGTH 1P57B 2HLCA 5B6LA 3F9EA 3MU8A 2JJ1D 1ARBA 2ZGHA 3KCGH 3TGIE 2FMJA 5EG4A 5EXNA 1OYTH 2Y81A 1C1VH 3MU0A 1ELAA 4RKOB 3OEHD 4OS7A 2QE7D 2GP9B 1DUAA 2WSSD 4GPGA 2ZDMA 1MTNC 3EA8A 4KTUA 4ABJA 1JIRA 3GY4A 5GPIB 3PMBB 3M3TA 2BB4A 2FYRA 1XUKA 2BVXH 3CNRA 2XBWA 1RGQA 2G81E 3TK5A 1HAYB 4U01A 3M7QA 3OTPA 1QFKH 1ZGVA 1ELCA 3D49H 2TBSA 2VH0A 1TABE 1P3EA 3A82A 5HXFA 3ENSB 3S7HB 1DPOA 2JH0D 1FJSA 4FUEA 2UUYA 1E79D 2HOBA 5EW1H 4B6FA 4X2XA 3M5NA 1K1JA 3D23A 2Y5GA 3PYHA 3ZZ7A 3B23B 5AF9H 2KFWA 3UNSA 1ZMJA 1GBTA 2AGEX 4AFUA 3F9GA 2C93B 1UO6A 2G00A 1QIXB 3ZYDA 1T4VH 2XBYA 3CS7A 4AB9A 2OCVB 3A7WA 3SU0A 3VXEH 1BB0B 2V35A 2SNVA 1BBRK 1GBLA 3HK6B 3TIUA 3F9FA 5FAHA 1OWJA 3L3TA 1EXFA 1L1JA 3ZZ8A 2M2AA 3LC3A 4AFZA 5A0BA 1SG8B 1GDNA 3GISB 3QWCH 4FVBA 2J97A 3B9FH 3SJ9A 1YPEH 2ALPA 4YOJA 2VWNA 4WXVA 3ZZ3A 1LMWB 2B0FA 4HGCA 4AC9A 5LH8A 2V3MA 1O3HA 1ABIH 2BLVA 1PQ7A 1C5UA 3RU4E 1DY9A 1AN1E 2K0QA 3TU7H 3ZZ5A 3RXUA 1PPEE 5JB9S 1MMJN 2P94A 1KDQA 5DKMA 2PTNA 1TPPA 2W5EA 5CHAB 2HPPH 2H6MA 3ZZ6A 1WSSH 1P02A 1FONA 1C1UH 3GYLB 4CRAA 6CHAB 4XD7D 2A5KA 1AUTC 2ZPSA 1TLDA 2BDGA 1Y59T 1PPBH 3RU4D 3T26A 4MPUA 1HAXB 4OS4A 5IK2D 2CF8H 1BTUA 2R9PA 2H9HA 2YMSD 3W95A 4RI0A 3BF6H 3E16B 6GCHF 1O3IA 4B6EA 3ZV8A 3EGKH 2Z9LA 3TLOA 1P2MA 9ESTA 2EA3A 3GCNA 1QRWA 2VGCC 1SHHB 1F5KU 2B9LA 2VBCA 1GJ9B 1JWTA 1K1MA 2GV6A 4XBBA 1ETTH 1H4WA 2BD7A 2ZFFH 1V2MT 3SV6A 1MZAA 1EX3A 5C1YA 1MKWH 1T31A 1GVKB 2RCEA 4Q63A 3A80A 5LPRA 3ZZ4A 3U1JB 1HCGA 4J2YB 1QR3E 4YT6H 1SGTA 1QJ6B 1RRKA 4OS2A 2P8OB 1EUFA 1QL9A 1P11E 5TJXA 2IPHA 1BQYA 1JRTA 2ZEBA 4H42U 1LVOA 1O2MA 1SGEE 1S82A 2UUJB 1PPCE 3A7TA 3GCTG 2SGDE 4OGYA 2IPQX 3MI4A 1Z8GA 3A8CA 3MO9A 1TX7A 3RMOH 1GMCG 2PWXA 5DSFA 1GL1A 2ODYB 1O2YA 1EP6A 3C1KA 3MU5A 3W94A 4AZ2B 2PKAA 4ZKRU 2FTLE 3KYFA 1PQ8A 1UTNA 3DT0H 3RXEA 1D3QB 5C1UA 3GS9A 2G4UA 3DSGA 1BMAA 5EJ1A 1CO7E 1YPMH 2ZHWH 4RN6A 3BN9A 3SJIA 2ANWA 4A1TA 3T29A 1GVZA 2G4TA 3U8OH 4Z6AH 4BXWA 2FYQA 1C5WB 2KAIA 3SNDA 1SMFE 1NFUA 1NN6A 1DSUA 2WZQA 2CV3A 3DFLA 4H6SB 3RXSA 1TPOA 3A8BA 2ZCHP 1NTPA 1Q31A 1EAUA 1MKXH 1QQUA 1DXWA 5EODA 1MTNB 2AHME 2ESTE 1C1QA 1D9IA 5ETXA 1FIZA 2O8TA 3ESTA 3LKWA 4NZLA 5TCAA 1BHXF 2FX6A 3E6PH 3QX5H 1GI9B 1KLJH 1O2RA 2V0BA 1DX5M 1NROH 2Y80A 2GMTB 2ZCKP 3UTUH 4X1RU 3DSPA 1CA0C 3URCA 1MTVA 1YLNA 2YNBA 4DOQA 4F4OC 4Y7AA 2B5TB 4FU9A 4MG3A 3UFAA 1ELTA 2J4IA 3KQEA 4Q2KA 3F9HA 3Q00A 4BOHA 3P95A 1TIOA 1FN8A 5E0HA 1GJ8B 1O5DH 1F0TA 2BYAX 1GHBF 4M7GA 3V3MA 3L6PA 3UQVA 2V3OH 5HGGA 2RDEA 5SGAE 2AGIX 3M61U 2A4GA 4UD9H 4NIXA 5HM2A 1HNEE 2CHAC 2OQ5A 1KXAA 2BOHB 2ZHEH 1QURH 1DE7H 4NSVA 1ZJKA 4XSKU 4X2VA 1P06A 1IQJA 3BTTE 3M37A 2VWLA 2BX3A 3JZ1B 1TGTA 4H4FA 4CREA 3F1SB 2ODPA 1UW7A 1VKYA 3KEEA 5K0HA 1DITH 2FEQH 1HFDA 2FPZA 1V2WT 1ZR0A 1WTHD 2SGAA 4NIVA 2WV5A 2ZGBH 2XC5A 3RC4A 2QXHA 3I29A 2ZU3A 1BRUP 4K1SA 5HYOA 1XM1A 3KHVA 2XRCA 5EQSA 3MH6A 2R0LA 5FHTA 2Z3DA 1GVLA 2W7SA 3RLWH 1EP5A 2W26A 1BRAA 5L2ZH 1G3DA 1CGHA 5DPAA 4NSYA 1BTXA 1SOZA 4YTAA 9LPRA 1BUIA 1NFYA 1TOMH 4ACBA 3VGCC 3PLKA 1Y3VA 1LPGB 5C5OA 5LPEA 1YY3A 2W3IA 1KXCA 1Y5BT 2ZFSA 4CHAC 1O3JA 1A1RA 4NGAH 1BTHH 1TRMA 3F0OA 1C2IA 2BLWA 3VB5A 2R2WU 3ZZBA 1ACBE 1PPGE 1GGDB 4LXBH 4JZDH 4X1QU 2LPRA 2SGFE 2XNDD 3A86A 4AYVB 5J4QA 4FUJA 3A8DA 4F55A 4F48B 1V2PT 3LGUA 3SU1A 2BDIA 1WYKA 2H1UA 1C5TA 1GBFA 3HGPA 3KIDU 2BY9X 1RXPA 1PQAA 3I77A 1LQEA 3MFJA 3O8DA 2FOEA 2ANMH 1C1SA 1Z6JH 3GY6A 4XRNA 2WPKS 1XUHA 2HLDD 2Q1JA 1O32A 1DANH 3SJKA 2ZFTA 4BTIB 1LVMA 2FOFA 4E7RG 1QRZA 5A2MH 1C2LA 1EZQA 4X6OA 1T32A 1W10U 2P3FH 3FVFB 5EQRA 1BRCE 1GBKA 1UCYE 1IQHA 3H5CB 3MHWU 3ZZCA 4RT0A 1OWDA 4MNWA 3FP8E 2G8TA 1KLIH 2WPIS 1TOCB 3UNRA 1IHTH 3AASA 2O8WA 1SPJA 1F0RA 1GJ7B 5DG6A 4INHA 3O8RA 1UTJA 1AY6H 1THRH 1COWD 2CF9H 4KGAA 3UY9A 2P93A 2PUQH 6LPRA 4ASUD 1GBJA 2QY0B 1AGJA 3GY2A 3ZYEA 1LKBA 3PTNA 4ZH8A 1TNIA 2IJD1 4YLUA 2HWLB 5FX5A 3U8TH 1VITF 1SGPE 2IN2A 3OTJE 1Z1IA 1TNHA 2BXTH 1AWFH 1HB0B 4YESB 1C2EA 1QHRB 5CDFE 1P2IA 1YGCH 1O2HA 1K2I1 3TH2H 3ZVDA 1O36A 5F03A 5DP8A 4ABAA 1SL3A 3U1IB 2OQUA 3UIRA 4MPXA 3URDA 4FUCA 1N6YA 2GZ8A 1TYNA 4ISHH 2J94A 2ANKH 3SV2H 4K8BA 1Z71A 3FP7E 2GT8A 4IC6A 1FLEE 2ZTZA 1V2QT 3DA9B 3NCLA 3MQKC 4ABFA 1AVGH 4UFDH 1ELGA 4ZAEA 1EOJA 4JYUH 2AMDA 3SV8A 2R2MB 3ATWA 1HV7A 5H4IB 2A4QA 2BY5X 3RXGA 6CHAC 5HM9A 2A7JA 3M5LA 3SU6A 3CP7A 1GHBG 4IMQA 4Q7ZA 3PO1B 1NS3A 3RXQA 3GDUA 2ZHDA 1JIMA 2WINI 1E0FD 5FPSA 3L33A 4Q4LA 1V2KT 3RUOA 1NBME 1KSNA 2BD4A 1YPLH 5I46H 2QXGA 3PB1E 1K21H 3SQEE 4GLYA 1MAYA 1C5ZB 1XXFA 4ZUHA 1P04A 1SQRA 3F6UH 2C4FH 2OC7A 4M9FA 2QAAA 2A31A 3WW7A 1FN6A 3FOAA 2FZZA 1BRBE 2ZU2A 4SGAE 1NBMD 1O0DH 1S6HA 1NFWA 1T8LA 2OK5A 4BAHB 1KMHB 1D4PB 3SU4A 1QY6A 1W13U 3ZVEA 1A5IA 2DUCA 2Z3CA 1ZYOA 4D9RA 2O8MA 1E34B 1QB6A 5GDSH 1AI8H 3UOPA 1YPGH 1SFQB 5DP7A 3SHCH 1C1PA 2FX4A 5JPMH 1TAWA 4LOYH 3RXOA 4YO9A 2UWOA 1FX0B 4IGDA 2ZFRH 1AZ8A 2VIQA 3D65E 1JBUH 1EAXA 1DFPA 1O3OA 2BD5A 1G9IE 1YPJH 1EAIA 1EJMA 1YCPK 1WUNH 2ZU1A 4WXIA 3TJUA 2GCHF 1UHBB 4A7IB 2ZU4A 3QK1A 1BHXB 4FUDA 5C0UA 2ZP0H 1VJAU 4XDEA 5EPNA 5EJZA 4FUFA 2F9VA 5JYIA 1FY1A 1KXBA 1PFXC 1TFXA 4ACAA 2OC0A 3KQ5A 1LVBA 3Q76A 1C4U2 1V6DA 3DSOA 1C5QA 3NZIA 3C27B 1IOEA 2JH5D 1SLUB 1SHYA 1P2QA 3EA7A 3SUDA 5CMXH 2QF0A 3FO8D 2F83A 3O8CA 2WYGA 3IG6B 4WWYA 4LK4A 1ZTLA 4K1TA 1RTFB 2VVUA 2BDYA 1ANEA 1HLTH 1W8BH 3MH5A 2QXJA 4AFSA 2Y5FA 3SN8A 3MO6A 4DIHH 4FUBA 1J14A 2C8WB 2VJ1A 4O9VA 1T8NA 4AG2A 2GV7A 1THPB 1YF4A 2BDAA 4B75A 1K1NA 1O3EA 1BMLA 3LIWA 1C1TA 1N6XA 3QO6A 1SR5C 1NPMA 3BTME 3TITA 4DGJA 4SGBE 3RXMA 2BLQA 2GMTC 3LT3A 3MMGA 1AMHA 4CH8B 1XUIA 2PLXA 1J15A 1O3AA 4AGKA 1AFQC 1A2CH 1P2NA 5EOKA 2J95A 3R3GB 4MPWA 3TK9A 5DP5A 2C8YB 1C5PA 2PR3A 1E1RD 1Q2WA 5K7RA 2WYJA 3TJOA 4FOUC 3KQBA 2HVXA 1UVTH 3U98H 1WCZA 1C1MA 1IQEA 1VCQA 2AIPA 2KCOA 3WWFA 3VFEA 2FOAA 5T6DA 4AFQA 1AVXA 1Y3UA 5GXPA 3RM2H 1JXPA 1TGSZ 5E2OA 2BD3A 2BOKA 1AD8H 1ZSKA 3UPEA 2FOCA 2BY6X 3S9CA 5T1VA 4NFEA 2SNWA 2FESH 2D26C 3T2NA 2QF3A 1F7ZA 5A09A 4Y0YE 1O2WA 1GDUA 1HIAB 1O2IA 2SGQE 1GCDA 4Y7BA 2I6QA 1GBDA 1F5LA 1CU1A 2ILNA 5EU8A 1ZOMA 5F8TA 4YOGA 4ZHLU 1C2FA 8KME2 2LELA 1F0UA 2ZQ2A 4D76A 2BVSH 3VB4A 1C5NH 3UAIC 5C2ZA 1RTLA 3CS0A 1NRSH 4CRGA 4I31A 3F2GA 3ZZAA 1S0RA 1P09A 1GHYH 4ZCNA 5EW2H 1BBRH 3UUZA 4NZQA 1K28D 3LGVA 1O2ZA 1OS8A 3KN2A 5B6OA 3AVZA 1S0QA 1SC8U 1FAKH 1UTQA 2F9NA 2BQ6B 5CE1A 1H9HE 5JBBS 1B0FA 1DLKB 2ZGJA 3OY6U 3VEQB 3PLPA 1SQTA 1O3KA 1DUEA 2BTCE 2A1DB 2FLBH 3FFGA 4O3UA 3ZVCA 1NM6A 1MUEB 2P3UB 3BTKE 1ELEE 1GMDF 1OWHA 2DE9A 3FKSD 1AKSA 4PROA 5F8ZA 5BRRE 2J9NA 1AQ7A 5F6MA 2BZ6H 2ZU5A 2GZ7A 4HI3A 2OLGA 4U32A 4WJG2 1GGDC 1SGIB 1HAZB 1MU8B 1THSH 2SGEE 1LCYA 4K60A 4WMDA 1QB9A 2O8LA 3CENA 1YBWA 3E3TA 3RXBA 2SGPE 4R0IA 1AB9B 3ATKA 1G37A 1WAYB 3LC5A 3BEUA 1P2KA 1Z8JB 3FANA 1LHFH 3TJNA 2Q6FA 1DDJA 1OPHB 1O2TA 3RXDA 1CVWH 1E35B 1YKTA 2RDLA 5GJ4B 1P9SA 3SI4H 3NWUA 1C5RA 1W12U 2NU3E 1HDTH 1V2TT 1A5GH 1ESTA 1HUTH 1UHBA 2P95A 3LDXH 3N7OA 3WY8A 2C90B 2VH6A 1P0SH 4A1XA 1WDIA 1V2ST 1U6QA 4XFQA 2H2ZA 1C1WH 4KP0A 1AE5A 3TPIZ 3RM0H 1YYY1 2ALVA 2PHBA 1VGCB 5A0AE 4E06H 4QT8C 1FXYA 3ODDA 3R0FA 3VPKA 3UNQA 3OAAD 2PV9B 1B7XB 2FDAA 2GCHG 1W11U 1GWAA 2WV4A 1VITH 2R3YA 2BMGB 3M3SA 3E91A 2RFKC 3VB6A 3EDXB 3SOSA 2BX4A 2CK3D 4RSPA 2PKSB 1K0HA 1XX9A 4NA8A 3KQCA 3SUGA 1DWDH 1K22H 3K6YA 1GBCA 2Q6DA 1LHDH 2A2XH 2J98B 2ZFPH 3V0XA 1LVYA 5C67A 1O3LA 1TALA 1HBTH 2QYIA 2ZGCA 3TGJE 2G55A 1ESBA 1OXGA 2OP9A 1ZPBA 2HRVA 2XW9A 1A0HB 5DP3A 4DVAU 1SQAA 5T3HA 1UVSH 4KELA 1RTKA 2H5DA 1FPHH 1O2OA 1C9TA 2B7DH 3OU0A 2O9QA 4FXGH 1IQKA 1V2UT 2THFB 3ZVGA 2D1JA 4INLA 3U9AH 1DSTA 1TWXB 2VWMA 3OSYA 2P3TB 4CBNA 1GHZA 1INCA 4K1EA 1V2OT 2JJ2D 4CRFA 4E7NA 4GCHF 1DY8A 1AFQB 1IHSH 3OX7U 2FP7B 1G36A 1FNIA 4MQAA 4ESTE 1C2DA 1O3PB 1O2GH 1AUJA 1BOQA 1CGIE 4TPIZ 2H9EH 3O8BA 1N8OB 1DXPA 1NC6A 3RLYH 1TNKA 2YNAA 1TGCA 4O03A 1GJ6A 3T28A 3U69H 4TPYA 1SGQE 4GHQA 3GICB 4H6TA 3N7DA 4RKJB 1XKBC 1HIAA 1C2MA 1W0JD 1O2KA 2F91A 1ORFA 4J1YA 1GMHF 3ZIAD 3PO1C 1EAWA 4ISNA 3V7TA 1OSSA 1QGFA 2OUAA 1Z8IB 1O5EH 1UTLM 1W0ZU 4JZIA 1SGYE 1AU8A 1TQ0B 4FUHA 2HVYB 2JIZD 2F9OA 1TBZH 3P70B 3JZ2B 2VIVA 1E36B 5EQQA 1HPGA 1IQLA 4I8GA 1OP0A 1H8IH 1Z8RA 2Y5HA 3NK8A 1RIWB 1A61H 3DCLA 5JBCS 3LPRA 1O2SA 4X6MA 1H1BA 3HATH 1ZGIA 3FZZA 4A5TS 2QV1A 4K5ZA 4DY7B 4ZXYH 2RA0A 2HNTF 8GCHF 1SGRE 4IN2A 3SZNA 1UVPA 3PTBA 4BNRA 1EASA 1RFNA 1CHOF 3BSQA 1C1RA 2A32A 4Q80A 5BPEA 1G3BA 1MZDA 1TMUH 1GI6A 2C8ZB 3PMAB 1X7AC 3TK6A 4F49A 1F2SE 4Y71A 3W1EA 4GHTA 3D62A 3MNXA 2OINA 1H9IE 1S6FA 3K65B 1XKAC 5FX6A 4DJZB 5F8XA 3EE0B 1KLTA 2F3CE 1TRNA 2ZA5A 4IW4E 3QDZB 4I7YH 1AZZA 3M5MA 4KTSA 1TB6H 1TGBA 5EGMA 4KKDA 4MNXA 5KECA 1EFRD 2BQ7B 6GCHG 3EAJA 1GMDG 4ABGA 3UQOA 5GIBA 3LU9B 1MH0A 1FY5A 3F2HA 1C2HA 1CE5A 3BTGE 1PYTC 2FI5E 1ELVA 3E1XB 4AGJA 1GG6B 3ZVFA 2VU8E 4X2WA 5L30H 3SGBE 1S81A 1GI0A 1A4WH 4WF8A 1O2NA 5GCHF 3NRLA 3BG4B 4OS5A 1GI3A 2BXUH 2ZGXH 2PTCE 2ZTYA 8ESTE 4UFFH 1L4ZA 1UTMA 2XC0A 2ZNKH 5LPFA 2PGQB 4B2AA 3S0NA 3UOUA 5C17A 2ZDKA 2STBE 1D3TB 2J92A 3SJOA 2ZCLP 1O34A 2XCNA 1H9LB 4I8LA 1WOFA 1GBIA 1HYLA 4HZHA 4NA9H 3RXIA 4DG4A 4DURA 1MQ5A 5ESTE 1EPTB 3NKKA 2Y82A 2BDCA 2J98A 3PWBA 1GBBA 4UEHH 5L2YH 5A0CA 1LPKB 3A89A 1YCPM 2XOKD 1SLVB 2QXIA 2FIRH 3SU3A 2AH4X 4X1SU 1CHGA 4LZ1H 1K1OA 1XUFA 1QA7A 2PGBB 4CR9A 2K1QA 1VR1H 1W0YH 1GHXH 2HNTC 1P2OA 4ISLA 5FPTA 1HAGE 3KGPA 2BD8A 2QC2A 1O2JA 2F9UA 3FAOA 1YPKH 2FI3E 1FV9A 1AHTH 2DE8A 4NFFA 5AFYH 5A8ZA 2FXRA 1FQ3A 4BAQB 3RXTA 1KIGH 3QZRA 3DD2H 3QLPH 1S83A 4ISIH 1NU7B 2BQWB 5FBIA 1EZXC 2KX4A 3VG8A 5C3NA 1DM4B 1KYNA 1O3NA 1O30A 1DS2E 1HJAC 4GCHG 3RC6A 1WXRA 4UFEH 1UCYK 2QF5A 1GJDB 2TGPZ 1D3DB 4ABEA 2OXSA 2WUBA 3P17H 4JMYA 2G5NA 1EATA 1GJ4H 2A0QB 1NRRH 2GTBA 2VIWA 1O38A 1VCWA 1RJXB 2BY8X 3SHAH 1J17T 4B1TA 1NESE 1C2JA 4ZKOU 3T25A 3ITIA 2Z9KA 1JOUB 1A46H 2P59A 1ANCA 5T6GA 4YM9A 4INKA 2VVCA 2R3UA 3WWBA 1GMHG 1H8HD 4A1VA 3LOXA 4B74A 5ESBA 1TMTH 3RC5A 2V6NA 1EQ9A 4D7FA 4E05H 1OP8A 4NWKA 1GJAB 3UB0A 4BAMB 1EKBB 1M9UA 2OBOA 1TNJA 2STAE 4BANB 1SFIA 1ZRKA 1YWUA 1QBOA 1RD3B 2AIQA 3DHKH 2NU2E 3UREA 1AIXH 1KDQB 3LGYA 1O2XA 1NU9A 1IQMA 1LQDB 1PYTD 1T8MA 1HJ8A 1SLXB 1BJVA 1BMFD 1HGTH 3PRBA 2TGDA 2JETB 3RXLA 4THNH 4Y8YA 3PV4A 3Q3XA 1AB9C 3ATIA 2I6SA 8GCHG 1TA2A 4R8TB 2Y7ZA 1GBHA 1C5SA 3MH4A 1CHOG 3Q77A 1TBQH 2BVRH 4IC5A 1ZMLA 1NRQH 4DT4A 1O2QA 3MYWA 2Y6TA 1OYQA 4TWWA 3BTDE 3SI3H 2XCFA 2QCYA 3KYGA 1F0SA 4AX9H 4P02A 1H8ED 3RMMH 2SFAA 1DWEH 1B0EA 4ABDA 1PPZA 3B8JA 1YLCA 1O3CA 1O2UA 4X8TH 3RXCA 3SGQE 5DP9A 4YOIA 3SORA 1VGCC 1TPAE 1FUJA 5FPYA 1PQ5A 1ZZZA 4NIWA 5GWZA 1NFXA 4GAWA 3AAVA 2FWWA 4VGCB 1C2KA 1CSOE 3GCTF 1V2JT 4AORA 1P10A 1BDAA 1F92A 1SBWA 3BTEE 4AG1A 5DP6A 3ZVAA 1BTZA 2HNTE 1GMCF 1MAXA 1L2EA 4I32A 1UTOA 1G32B 2W6JD 1Y3XA 1ZTKA 2FS9A 1IQIA 5T6FA 1YM0A 3SV9A 5GCHG 2PKSC 1DOJA 2D8WA 4XOJA 4AN7A 1QQ4A 2CN0H 7LPRA 4ZHAA 4O3TA 1W7XH 3QGJA 1P01A 2VWOA 1TBRH 1EPTA 1YCPH 1OHHD 3GDSA 2WPLS 1BBRE 2HALA 3I78A 1AVWA 1P8VC 2H5CA 2ZF0H 1AE8H 2TIOA 2GD4B 1ZMNA 5ABWA 1SQOA 1YPHE 3RXRA 2H9TH 1SGDE 1AO5A 1YP9A 3LGIA 1HAOH 1GPZA 1L4DA 3LJJA 5I25A 3BTQE 3UWJH 2ZQ1A 3BTHE 4I33A 2LNCA 4X1PU 2AFQB 2KAIB 2CMYA 1K1IA 4HG6A 2XTTB 1V3XA 2Z9IA 1P2JA 1TA6A 2Z94A 1C5MD 1ID5H 3P8FA 3V12A 3A7VA 1BTPA 1NY22 4ZKSU 1N8OC 3HKJB 3EE7A 3SYJA 1ABJH 1VCPA 2F9PA 2PSXA 1OP2A 3DUXH 3BEIB 2ULLA 2EI8A 1O37A 4A92A 2KCYA 2GCTC 5IDKA 3A8AA 1VITG 1E37B 7KMEH 1WV7H 1O3DA 1ZHPA 3M3VA 4NWLA 1J8AA 4X0WU 4Z0KA 2XBXA 1LHCH 1A3BH 1SKYE 2GX4A 1C5VA 2ZI2H 1GI1A 3U28C 1GCTB 1UTKA 1QJ7B 1P12E 3TH3H 2WPJS 3RXPA 3E0NB 4B2BA 2Z7FE 5CHBA 3LH1A 1OWIA 2JKHA 4I8HA 3A84A 1FY4A 1HJAB 3LGWA 4IN1A 1QL7A 1ZLRA 1RIWC 3A81A 4JZEH 1JMOH 4Q7XA 5A8YA 5LGOA 3AK5A 4WY3A 3QUMP 1VJ9U 3SO3A 3N99A 4ZKNU 3SZEA 4HTCH 3NPSA 2ZDNA 3SNBA 4ASHA 2VB0A 3MTYA 5EXMA 2ZFQH 4JZFH 3PLBA 1MTSA 5AFZH 1XUGA 1QJ1B 4FVDA 3PV2A 4TYDA 3AW0A 5AHGH 2F9BH 2TRMA 1ANBA 2GVFA 1EB1H 1Y3YA 1MCTA 2PFEA 2Z9JA 1NT1A 4DIIH 1SB1H 1NRPH 3VB3A 3PMHB 1MTWA 3SU2A 4Y79A 4Y11E 3ZZ9A 5E2PA 1J9CH 1MKWK 2VVVA 2TPIZ 3SUFA 1C1OA 1E1QD 1ETSH 1O5GH 2ZPRA 3LH3A 3MNSA 2ANYA 2VIPA 4Y76A 1UK2A 1VZQH 1ETRH 1LPZB 2AEIH 2IJOB 2W3KA 2KR7A 1YLDA 2CGAA 3QTVH 1Y8TA 3GCHB 1LDTT 1WQSA 1GG6C 1QNJA 3SQHE 2W6ID 1UK4A 3OYPA 3RXAA 1GBMA 2Y7XA 2FODA 4OM9A 8LPRA 1SOTA 2OC1A 4D8NA 1SGCA 1S85A 3BG4C 5C94A 3T62A 2AERH 1H8DH 1BMMH 1O35A 2OBQA 4BXSA 3SW2B 5IYTA 1GI4A 3QZQA 2FOMB 3GY3A 1QZ8A 4YZUA 1N1LA 1L0ZA 5DO4H 1HRTH 5DK1A 3PV5A 6ESTA 5G4BA 3UR9A 1TQ7B 2ZZUH 2ZTXA 4AYYB 1CBWB 2XC4A 1EJNA 2BD2A 1FDPA 3SBKA 3RMLH 2ZDLA 3TJVA 3H7OA 2ZC9H 5FL7D 2VNTA 4DT7B 4FUGA 3A7XA 1BIOA 2Z3EA 3MH7A 1BT7A 1W2KH 3S9AA 2A2QH 2M5TA 3KL6A 2YMSB 1EPTC 1HAHH 3F0PA 4K2YA 2GKVE 1BITA 2WPDD 2O8UA 4CBOA 4YLQH 3BIUH 1PPHE 1S84A 3P6ZB 1UK3A 3FP6E 1D6RA 1MKXK 3ELAH 1MABB 2GDDA 4MNVA 4D9QA 1GI5A 3H09A 2AGGX 1XMNB 2J2UA 4WVPE 4ABHA 1DWBH 1G2MA 1QTFA 4IS5A 4IMZA 3OE7D 4MDSA 2P16A 4ZROA 1MQ6A 4ZHMU 1B5GH 2J5UA 2B8OH 5AVDA 1OWEA 2XWAA 2RA3A 4XE4A 4DCDA 4UONA 1TX6A 5EXLA 3NXPA 4JK6A 1MBQA 3MU4A 4I8KA 3HPTB 5C5NA 1GJCB 1MBMA 2A7HA 2ASUB 4GVUA 4NCYA 4JYVH 2GJGA 3KQDA 3P8GA 1GJ5H 1HAVB 3EYDA 1W3CA 5DJ7A 2QN5T 4X6PA 1C5OH 1P9UA 1E38B 3MOCA 1C4V2 1O33A 3RMNH 3A7ZA 1C5XB 2GDEH 3TGKE 4X8UH 3S7KB 3GY5A 4MTBA 2YOLA 3UWIA 4X6NA 2OC8A 1EOLA 3NUMA 1CQQA 1OWKA 1LHGH 3N7EA 2OTVA 5HIYA 5EJLA 1SGFG 1A7SA 1ZPCA 4K8YA 3RXFA 3EQ0H 1TX8A 2GCTB 1ELBA 3F3BA 4ZMAH 2FLRH 5JDUB 1O5CB 4X2YA 1LHEH 2L6OA 1C9PA 1QB1A 3E8LA 7GCHF 4JK5A 1FI8A 4JYTA 2GGVB 1BTYA 2VINA 2EY4C 1SLWB 1GBEA 1WU1A 1GBAA 1L1GA 3IITA 4RT1A 3F68H 1XUJA 1XVOA 2JH6D 1IQNA 4BAOB 2WV9A 2XYAA 1S5SA 3G01A 4MNYA 4TWYA 3M7TA 5C0TA 4B2CA 2FOHA 1CGJE 5DGJA 2K8IA 2WPHS 3GY8A 1HAPH 4D7GA 3MU1A 3A88A 1AWHB 1IQGA 3RP2A 5FCKA 5JBTA 5FXLA 3TNSA 4X1NU 5HMAA 7ESTE 5C20A 2VIDA 2W7UA 1KTSB 1MU6B 2J38A 4HFPB 1GDQA 1HAIH 4X8VH 4X8SH 1GHAF 1O3BA 2JETC 1D6WA 2BDHA 4WMEA 2Z6BD 1O3MA 4NIYA 1DT2A 4YT7H 5KEDA 1ANDA 4BAKB 2J34A 1CT2E 1Z6EA 3AAUA 1T8OA 1SSXA 2OD3B 1DLEA 1TE0A 3PWCA 4GUXA 3V13A 5EPYA 1Y5UT 3S69A 3TVJB 3TNTA 1C5YB 3OEED 1GHVH 4ZXXH 5L6NH 2ZHQH 4UE7H 3PROA 3K9XB 1KTTB 2EI7A 1PJPA 2G51A 3HGNA 2WPMS 1FIWA 3RXHA 3MWIU 2A5IA 1ARCA 1QBVH 4VGCC 1NZQH 5PTPA 2FM2A 3GY7A 1ZJDA 1CT4E 4YXWD 1S6LA 4CRBA 1YC0A 1Y5AT 1ZPZA 1G30B 3K2UA 3QTOH 2TGTA 3F2FA 1UMAH 4WH6A 1BZXE 1ZTJA 4XBCA 1Z7KA 2VGCB 1SGNE 3SJ8A 4I8JA 2HPQH 5F53A 1O2PA 3HK3B 3MNBA 3FN8A 3SNAA 4WH8A 3RXVA 3UR6A 2TGAA 2XXLA 3ATMA 1TPSA 1TONA 1WQVH 3OY5U 4FU8A 2KCAA 1V2NT 4XBDA 4B71A 4Y6DA 3M7UA 3ZVBA 1FZZA 4ISOA 1T7CA 3A85A 3DFJA 2KZ4A 4OS1A 1O2LA 1ZHMA 3GCOA 3M5OA 3BIVH 1O31A 1C5LH 3PM3A 1NRNH 2NU4E 3QGNB 4OS6A 2ZIQH 1ZSJA 1LKAA 3EA9A 1HXEH 4ABIA 1BCUH 1ZSLA 2FOGA 1UVUH 3PRDA 4CR5A 4GSOA 4U30A 2PP6A 4AOQA 1TRYA 1T4UH 2BDBA 1O39A 4I86A 4KTCA 4TY6A 1GI8B 3BEFB 3U8RH 1AFEH 2BY7X 2EEKA 1MD8A 2EI6A 2G5VA 2FTMA 1SI5H 1EZSC 4MPVA 5HKKD 1WTGH 4JCNA 3PMJA 1P05A 2ZDVH 1BA8B 1O5BB 1FY8E 2A4OA 1Y3WA 2UWPA 1NO9H 1TNGA 1CT0E 2D2DA 4OGXA 1O3FA 2ZG0H 3ODFA 5FBEA 2ODQA 2QF4A 2A45B 2EQNA 2CXVA 1HAVA 1ELFA 2ZECA 3VB7A 4MLFB 3LONA 4Q7YA 2BD9A 2NWNA 1UVOA 3VXFH 2RG3A 1LO6A 3SGAE 1C2GA 1EJAA 2ZHFH 2GT7A 2PUXB 1C4Y2 2UWLA 3LJOA 2CJIA 4LZ4B 1IAUA 1ZRBA 5A8XA 1GCTC 1OX1A 1Q3XA 1HXFH 4BTUB 3BG8A 1O5FH 1GJBB 3MNCA 4CRDA 4MVNA 2NU0E 4Y8ZA 5JBAS 3GYMA 3STJA 3A7YA 2F43B 2A7CA 1KY9A 4TT3D 4B73A 1YPHC 1W0KD 3SU5A 1UTPA 1XVMA 4U2WA 2UUKB 3LGTA 1ESAA 4BTTB 1K1PA 1FAXA 1JRSA 3HKIB 3P8NA 1XXDA 2FOBA 1CA0B 5TCCA 4FETA 3AW1A 5JB8S 1F5RA 3MO3A 2F4LA 1HJ9A 5GNDA 3SNCA 4TSFD 5E8EH 3OFND 1V2VT 1GL0E 2BM2A 2ZO3H 2ZKSA 1A0JA 1P3CA 2C8XB 4P00A 7GCHG 5E0GA 4Z1MD 1ZHRA 3A83A 3TH4H 2BHGA 5CHAC 4AB8A 1QA0A 1DWCH 3QN7A 1EZUC 3M36A 2FS8A 2GZ9A 4O97A 1UCYH 2CHAB 1DICA 2EC9H 2AMPA 3SV7A 1UJ1A 2C3SA 1K1LA 1TMBH 3BTFE 1P03A 2A5AA 5C1XA 1O3GA 4JZ1A 1O2VA 1GI7B 3T27A 4UFGH 3GCHC 2VIOA 3RXJA 2XWBI 1Z1JA 3M35A 3T5FH 1GHAG 1GI2A 3E90B 3GOVB 2BZAA 3ZV9A 4NA7A 5DP4A 1MCVA 1K9OE 2KCPA 1CA8B 1MD7A 2ZDAH 5EIYA 5FCRA 1FY3A 3Q3KA 1V2RT 2NU1E 1FMGA 1SVPA 2JDID 1V2LT 1LTOA 4ABBA 1A5HA 1AKSB 3FZDA 2V3HH 3E0PB 4TY7A 1QCPA 3Q3YA 4A6LA 2PW8H 3P92A 4K3JA 1BJUA 3K6ZA 1EB2A 2Z9GA 1G3EA 1W14U 2A4RA 3SUEA 5DN6D 1RS0A 1WBGB 4Y0ZE 3H7TA 2AYWA 2R0KA 3RXKA 2BLOA 1G2LA 1CBWC 1KXFA 2G52A 4FUIA 1D3PB 3RU4T 1J16A 3KF2A 3ZZDA 3VGCB 5KGOA 1DVAH 2P8OC 4Y10E 3RDZA 4CRCA 1GHWH 2L74A 1FPCH 4NG9H 4Y8XA 3ATLA 1KXDA 1TNLA 2YMSC 2AMQA 2KM0A 4CHAB 1SGFA 3IWMA 1KXEA 1A3EH 1BMNH 1QL8A 2V7QD 4CH2B 2FO9A 2FI4E 2WHXA 1ELDE 3STIA 1QRXA 2XBVA 3SNEA 1O5AB 3GDVA 4UDWH 1OOKB 4K69A 1A0LA 2QIQA 1TGNA 2XNIA 2WUCA 4FU7A 4IBLH 2QGRA 3P8OA 5J4SA 1W7GH 3S9BA 1MTUA 2AS9A 1OKXA 1BTWA 4B76A 3BTWE 1G3CA 2ZPQA 2PKAB 2LP6A 2ZWLH 2PSYA 1IQFA 1L1NA 1PPFE 2QA9E 2UUFB 3A87A 5HIZA
chains in the Genus database with same CATH topology
5E0JA 4DW2U 4WMFA 2IOTA 3BV9B 3KNXA 2Q6GA 1C1NA 1QBNA 2HGTH 1P57B 2HLCA 3F9EA 3MU8A 1ARBA 2ZGHA 3KCGH 3TGIE 2FMJA 5EG4A 5EXNA 1OYTH 2Y81A 1C1VH 3MU0A 1ELAA 4RKOB 4OS7A 2GP9B 1DUAA 4GPGA 2ZDMA 1MTNC 3EA8A 4KTUA 4ABJA 1JIRA 3GY4A 5GPIB 3PMBB 3M3TA 2BB4A 2FYRA 1XUKA 2BVXH 2XBWA 1RGQA 2G81E 3TK5A 1HAYB 4U01A 3M7QA 1QFKH 1ZGVA 1ELCA 3D49H 2TBSA 2VH0A 1TABE 1P3EA 3A82A 5HXFA 3ENSB 3S7HB 1DPOA 2JH0D 1FJSA 4FUEA 2UUYA 2HOBA 5EW1H 4X2XA 3M5NA 1K1JA 3D23A 2Y5GA 3PYHA 3ZZ7A 3B23B 5AF9H 3UNSA 1ZMJA 1GBTA 2AGEX 4AFUA 3F9GA 2C93B 1UO6A 2G00A 1QIXB 3ZYDA 1T4VH 2XBYA 3CS7A 4AB9A 2OCVB 3A7WA 3SU0A 3VXEH 1BB0B 2V35A 2SNVA 1BBRK 1GBLA 3HK6B 3TIUA 3F9FA 5FAHA 1OWJA 3L3TA 1EXFA 1L1JA 3ZZ8A 3LC3A 4AFZA 5A0BA 1SG8B 1GDNA 3GISB 3QWCH 4FVBA 3B9FH 3SJ9A 1YPEH 2ALPA 4YOJA 2VWNA 4WXVA 3ZZ3A 1LMWB 2B0FA 4HGCA 5LH8A 1O3HA 1ABIH 2BLVA 1PQ7A 1C5UA 3RU4E 1DY9A 1AN1E 3TU7H 3ZZ5A 3RXUA 1PPEE 5JB9S 1MMJN 2P94A 1KDQA 5DKMA 2PTNA 1TPPA 2W5EA 5CHAB 2HPPH 2H6MA 3ZZ6A 1WSSH 1P02A 1FONA 1C1UH 3GYLB 4CRAA 6CHAB 2A5KA 1AUTC 2ZPSA 1TLDA 2BDGA 1Y59T 1PPBH 3RU4D 3T26A 4MPUA 1HAXB 4OS4A 2CF8H 1BTUA 2R9PA 2H9HA 3W95A 3BF6H 3E16B 6GCHF 1O3IA 3ZV8A 3EGKH 2Z9LA 3TLOA 1P2MA 9ESTA 2EA3A 3GCNA 1QRWA 2VGCC 1SHHB 1F5KU 2B9LA 4XBBA 1GJ9B 1JWTA 1K1MA 2GV6A 1ETTH 1H4WA 2BD7A 2ZFFH 1V2MT 3SV6A 1MZAA 1EX3A 5C1YA 1MKWH 1T31A 1GVKB 2RCEA 3A80A 5LPRA 3ZZ4A 3U1JB 1HCGA 4J2YB 1QR3E 4YT6H 1SGTA 1QJ6B 1RRKA 4OS2A 2P8OB 1EUFA 1QL9A 1P11E 5TJXA 2IPHA 1BQYA 1JRTA 2ZEBA 4H42U 1LVOA 1O2MA 1SGEE 1S82A 2UUJB 1PPCE 3A7TA 3GCTG 2SGDE 4OGYA 3MI4A 1Z8GA 3A8CA 3MO9A 1TX7A 3RMOH 1GMCG 2PWXA 1GL1A 2ODYB 1O2YA 1EP6A 3C1KA 3MU5A 3W94A 4AZ2B 2PKAA 4ZKRU 2FTLE 1PQ8A 1UTNA 3DT0H 3RXEA 1D3QB 5C1UA 2G4UA 1BMAA 1CO7E 1YPMH 2ZHWH 4RN6A 3BN9A 3SJIA 2ANWA 4A1TA 3T29A 1GVZA 2G4TA 3U8OH 4Z6AH 4BXWA 2FYQA 1C5WB 2KAIA 3SNDA 1SMFE 1NFUA 1NN6A 1DSUA 2CV3A 3DFLA 4H6SB 3RXSA 1TPOA 3A8BA 2ZCHP 1NTPA 1Q31A 1EAUA 1MKXH 1QQUA 1DXWA 5EODA 1MTNB 2ESTE 1C1QA 1D9IA 5ETXA 1FIZA 2O8TA 3ESTA 3LKWA 4NZLA 5TCAA 1BHXF 2FX6A 3E6PH 3QX5H 1GI9B 1KLJH 1O2RA 2V0BA 1DX5M 1NROH 2Y80A 2GMTB 2ZCKP 3UTUH 4X1RU 1CA0C 3URCA 1MTVA 2YNBA 4DOQA 4F4OC 4Y7AA 2B5TB 4FU9A 4MG3A 3UFAA 1ELTA 2J4IA 3KQEA 4Q2KA 3F9HA 3Q00A 4BOHA 3P95A 1TIOA 1FN8A 5E0HA 1GJ8B 1O5DH 1F0TA 2BYAX 1GHBF 4M7GA 3V3MA 3L6PA 3UQVA 2V3OH 5HGGA 5SGAE 2AGIX 3M61U 2A4GA 4UD9H 4NIXA 5HM2A 1HNEE 2CHAC 2OQ5A 1KXAA 2BOHB 2ZHEH 1QURH 1DE7H 4NSVA 1ZJKA 4XSKU 4X2VA 1P06A 1IQJA 3BTTE 3M37A 2VWLA 2BX3A 3JZ1B 1TGTA 4H4FA 4CREA 3F1SB 2ODPA 3KEEA 5K0HA 1DITH 2FEQH 1HFDA 2FPZA 1V2WT 1ZR0A 1WTHD 2SGAA 4NIVA 2WV5A 2ZGBH 2XC5A 3RC4A 2QXHA 3I29A 2ZU3A 1BRUP 4K1SA 5HYOA 1XM1A 3KHVA 2XRCA 5EQSA 3MH6A 2R0LA 5FHTA 2Z3DA 1GVLA 2W7SA 3RLWH 1EP5A 2W26A 1BRAA 5L2ZH 1G3DA 1CGHA 5DPAA 4NSYA 1BTXA 1SOZA 4YTAA 9LPRA 1BUIA 1NFYA 1TOMH 3VGCC 3PLKA 1Y3VA 1LPGB 5C5OA 5LPEA 2W3IA 1KXCA 1Y5BT 2ZFSA 4CHAC 1O3JA 1A1RA 4NGAH 1BTHH 1TRMA 1C2IA 2BLWA 3VB5A 2R2WU 3ZZBA 1ACBE 1PPGE 1GGDB 4LXBH 4JZDH 4X1QU 2LPRA 2SGFE 3A86A 4AYVB 5J4QA 4FUJA 3A8DA 1V2PT 3LGUA 3SU1A 2BDIA 1WYKA 2H1UA 1C5TA 1GBFA 3HGPA 3KIDU 2BY9X 1RXPA 1PQAA 3I77A 1LQEA 3MFJA 3O8DA 2FOEA 2ANMH 1C1SA 1Z6JH 3GY6A 2WPKS 1XUHA 2Q1JA 1O32A 1DANH 3SJKA 2ZFTA 4BTIB 1LVMA 2FOFA 4E7RG 1QRZA 5A2MH 1C2LA 1EZQA 4X6OA 2P3FH 1T32A 1W10U 3FVFB 5EQRA 1BRCE 1GBKA 1UCYE 1IQHA 3H5CB 3MHWU 3ZZCA 1OWDA 4MNWA 3FP8E 2G8TA 1KLIH 2WPIS 1TOCB 3UNRA 1IHTH 3AASA 2O8WA 1SPJA 1F0RA 1GJ7B 5DG6A 4INHA 3O8RA 1UTJA 1AY6H 1THRH 2CF9H 4KGAA 3UY9A 2P93A 2PUQH 6LPRA 1GBJA 2QY0B 1AGJA 3GY2A 3ZYEA 1LKBA 3PTNA 4ZH8A 1TNIA 4YLUA 2HWLB 5FX5A 3U8TH 1VITF 1SGPE 2IN2A 3OTJE 1Z1IA 1TNHA 2BXTH 1AWFH 1HB0B 4YESB 1C2EA 1QHRB 1P2IA 1YGCH 1O2HA 1K2I1 3TH2H 3ZVDA 1O36A 5F03A 5DP8A 4ABAA 1SL3A 3U1IB 2OQUA 3UIRA 4MPXA 3URDA 4FUCA 1N6YA 2GZ8A 1TYNA 4ISHH 2J94A 2ANKH 3SV2H 4K8BA 1Z71A 3FP7E 2GT8A 4IC6A 1FLEE 2ZTZA 1V2QT 3DA9B 3NCLA 4ABFA 1AVGH 4UFDH 1ELGA 4ZAEA 1EOJA 4JYUH 2AMDA 3SV8A 2R2MB 3ATWA 1HV7A 5H4IB 2A4QA 2BY5X 3RXGA 6CHAC 5HM9A 2A7JA 3M5LA 3SU6A 3CP7A 1GHBG 4IMQA 4Q7ZA 3PO1B 1NS3A 3RXQA 3GDUA 2ZHDA 1JIMA 2WINI 1E0FD 5FPSA 3L33A 1V2KT 3RUOA 1KSNA 2BD4A 1YPLH 5I46H 2QXGA 3PB1E 1K21H 3SQEE 4GLYA 1MAYA 1C5ZB 1XXFA 4ZUHA 1P04A 3F6UH 2C4FH 2OC7A 2QAAA 2A31A 1FN6A 2FZZA 1BRBE 2ZU2A 4SGAE 1O0DH 1S6HA 1NFWA 1T8LA 4BAHB 1D4PB 3SU4A 1QY6A 1W13U 3ZVEA 1A5IA 2DUCA 2Z3CA 1ZYOA 4D9RA 2O8MA 1E34B 1QB6A 5GDSH 1AI8H 3UOPA 1YPGH 1SFQB 5DP7A 3SHCH 1C1PA 2FX4A 5JPMH 1TAWA 4LOYH 3RXOA 4YO9A 2UWOA 4IGDA 2ZFRH 1AZ8A 2VIQA 3D65E 1JBUH 1EAXA 1DFPA 1O3OA 2BD5A 1G9IE 1YPJH 1EAIA 1EJMA 1YCPK 1WUNH 2ZU1A 4WXIA 3TJUA 2GCHF 1UHBB 4A7IB 2ZU4A 3QK1A 1BHXB 4FUDA 2ZP0H 1VJAU 4XDEA 5EPNA 4FUFA 2F9VA 5JYIA 1FY1A 1KXBA 1PFXC 1TFXA 2OC0A 1LVBA 3Q76A 1C4U2 1V6DA 1C5QA 3NZIA 3C27B 1IOEA 2JH5D 1SLUB 1SHYA 1P2QA 3EA7A 3SUDA 5CMXH 2QF0A 2F83A 3O8CA 2WYGA 3IG6B 4WWYA 4LK4A 1ZTLA 4K1TA 1RTFB 2VVUA 2BDYA 1ANEA 1HLTH 1W8BH 3MH5A 2QXJA 4AFSA 2Y5FA 3SN8A 3MO6A 4DIHH 4FUBA 1J14A 2C8WB 2VJ1A 4O9VA 1T8NA 4AG2A 2GV7A 1THPB 1YF4A 2BDAA 4B75A 1K1NA 1O3EA 1BMLA 3LIWA 1C1TA 1N6XA 3QO6A 1SR5C 1NPMA 3BTME 3TITA 4DGJA 4SGBE 3RXMA 2BLQA 2GMTC 3LT3A 3MMGA 1AMHA 4CH8B 1XUIA 2PLXA 1J15A 1O3AA 4AGKA 1AFQC 1A2CH 1P2NA 5EOKA 2J95A 3R3GB 4MPWA 3TK9A 5DP5A 2C8YB 1C5PA 2PR3A 1Q2WA 5K7RA 2WYJA 3TJOA 3KQBA 2HVXA 1UVTH 3U98H 1WCZA 1C1MA 1IQEA 1VCQA 2AIPA 3VFEA 2FOAA 5T6DA 4AFQA 1AVXA 1Y3UA 5GXPA 3RM2H 1JXPA 1TGSZ 5E2OA 2BD3A 2BOKA 1AD8H 1ZSKA 3UPEA 2FOCA 2BY6X 3S9CA 4NFEA 2SNWA 2FESH 2D26C 3T2NA 2QF3A 1F7ZA 5A09A 4Y0YE 1O2WA 1GDUA 1HIAB 1O2IA 2SGQE 1GCDA 4Y7BA 2I6QA 1GBDA 1F5LA 1CU1A 2ILNA 5EU8A 1ZOMA 5F8TA 4YOGA 4ZHLU 1C2FA 8KME2 1F0UA 2ZQ2A 4D76A 2BVSH 3VB4A 1C5NH 5C2ZA 1RTLA 3CS0A 1NRSH 4CRGA 4I31A 3ZZAA 1S0RA 1P09A 1GHYH 5EW2H 1BBRH 3UUZA 4NZQA 1K28D 3LGVA 1O2ZA 1OS8A 3KN2A 5B6OA 3AVZA 1S0QA 1SC8U 1FAKH 1UTQA 2F9NA 2BQ6B 5CE1A 1H9HE 5JBBS 1B0FA 1DLKB 2ZGJA 3OY6U 3VEQB 3PLPA 1SQTA 1O3KA 1DUEA 2BTCE 2A1DB 2FLBH 3FFGA 4O3UA 3ZVCA 1NM6A 1MUEB 2P3UB 3BTKE 1ELEE 1GMDF 1OWHA 2DE9A 4PROA 1AKSA 5F8ZA 5BRRE 5F6MA 2J9NA 1AQ7A 2BZ6H 2ZU5A 2GZ7A 4HI3A 2OLGA 4U32A 4WJG2 1GGDC 1SGIB 1HAZB 1MU8B 1THSH 2SGEE 1LCYA 4K60A 4WMDA 1QB9A 2O8LA 3CENA 1YBWA 3E3TA 3RXBA 2SGPE 4R0IA 1AB9B 3ATKA 1G37A 1WAYB 3LC5A 3BEUA 1P2KA 1Z8JB 3FANA 1LHFH 3TJNA 2Q6FA 1DDJA 1OPHB 1O2TA 3RXDA 1CVWH 1E35B 1YKTA 2RDLA 5GJ4B 1P9SA 3SI4H 3NWUA 1C5RA 1W12U 2NU3E 1HDTH 1V2TT 1A5GH 1ESTA 1HUTH 1UHBA 2P95A 3LDXH 3N7OA 3WY8A 2C90B 2VH6A 1P0SH 4A1XA 1V2ST 1U6QA 4XFQA 2H2ZA 1C1WH 4KP0A 1AE5A 3TPIZ 3RM0H 1YYY1 2ALVA 2PHBA 1VGCB 5A0AE 4E06H 4QT8C 1FXYA 3ODDA 3R0FA 3VPKA 3UNQA 2PV9B 1B7XB 2FDAA 2GCHG 1W11U 1GWAA 2WV4A 1VITH 2R3YA 2BMGB 3M3SA 3E91A 3VB6A 3EDXB 3SOSA 2BX4A 4RSPA 2PKSB 1XX9A 4NA8A 3KQCA 3SUGA 1DWDH 1K22H 3K6YA 1GBCA 2Q6DA 1LHDH 2A2XH 2ZFPH 3V0XA 1LVYA 5C67A 1O3LA 1TALA 1HBTH 2QYIA 2ZGCA 3TGJE 2G55A 1ESBA 1OXGA 2OP9A 1ZPBA 2HRVA 2XW9A 1A0HB 5DP3A 4DVAU 1SQAA 5T3HA 1UVSH 4KELA 1RTKA 2H5DA 1FPHH 1O2OA 1C9TA 2B7DH 3OU0A 2O9QA 4FXGH 1IQKA 1V2UT 2THFB 3ZVGA 2D1JA 4INLA 3U9AH 1DSTA 1TWXB 2VWMA 3OSYA 2P3TB 4CBNA 1GHZA 1INCA 4K1EA 1V2OT 4CRFA 4E7NA 4GCHF 1DY8A 1AFQB 1IHSH 3OX7U 2FP7B 1G36A 1FNIA 4MQAA 4ESTE 1C2DA 1O3PB 1O2GH 1AUJA 1BOQA 1CGIE 4TPIZ 2H9EH 3O8BA 1N8OB 1DXPA 1NC6A 3RLYH 1TNKA 2YNAA 1TGCA 4O03A 1GJ6A 3T28A 3U69H 4TPYA 1SGQE 4GHQA 3GICB 4H6TA 4RKJB 1XKBC 1HIAA 1C2MA 1O2KA 2F91A 1ORFA 4J1YA 1GMHF 3PO1C 1EAWA 4ISNA 3V7TA 1OSSA 1QGFA 2OUAA 1Z8IB 1O5EH 1UTLM 1W0ZU 4JZIA 1SGYE 1AU8A 1TQ0B 4FUHA 2F9OA 1TBZH 3P70B 3JZ2B 2VIVA 1E36B 5EQQA 1HPGA 1IQLA 4I8GA 1OP0A 1H8IH 1Z8RA 2Y5HA 3NK8A 1RIWB 1A61H 5JBCS 3LPRA 1O2SA 4X6MA 1H1BA 3HATH 1ZGIA 3FZZA 4A5TS 2QV1A 4K5ZA 4DY7B 4ZXYH 2RA0A 2HNTF 8GCHF 1SGRE 4IN2A 3SZNA 1UVPA 3PTBA 4BNRA 1EASA 1RFNA 1CHOF 3BSQA 1C1RA 2A32A 4Q80A 5BPEA 1G3BA 1MZDA 1TMUH 1GI6A 2C8ZB 3PMAB 1X7AC 3TK6A 4F49A 1F2SE 4Y71A 4GHTA 3D62A 3MNXA