1J17T

Factor xa specific inhibitor in complex with rat trypsin mutant x99/175/190rt
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRETYNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASSSFIITDNMVCVGFLEGGKDACQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin II, anionic
publication title Reconstructing the Binding Site of Factor Xa in Trypsin Reveals Ligand-induced Structural Plasticity
pubmed doi rcsb
source organism Rattus norvegicus
total genus 49
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j17T01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j17T02
1DOJA 1YPMH 2RA3A 3EA8A 3M36A 1ZTKA 1BRBE 3RXTA 4D7FA 4IMQA 8GCHF 3O8RA 3SORA 5EOKA 3SZNA 2BLVA 2P3FH 3HKJB 2GCHF 3PB1E 4Y11E 3P6ZB 2F9VA 2AH4X 3U69H 5C1YA 1UTKA 4Z0KA 1O3CA 3ITIA 1NRSH 3DT0H 3A80A 2A7HA 4XSKU 1O2NA 5C1UA 3TJVA 4FVDA 2V3HH 1BCUH 3KL6A 2FYQA 1O30A 1ZOMA 4NIVA 3MTYA 1GPZA 2P93A 1WV7H 1P2MA 1Z7KA 1G3CA 1HJ8A 1EAIA 4X0WU 1HJAB 3C27B 2J38A 1XUHA 2F9PA 2Y5HA 1XVOA 1HAPH 4ISHH 3FP8E 5C5NA 1O3PB 1GDUA 2FS8A 1IHSH 4DG4A 1ZTLA 4AG2A 1FIWA 2GD4B 2JETC 2PTNA 4JMYA 2PWXA 4Q7YA 3C1KA 1TGSZ 1A1RA 1YCPH 4YOJA 1DM4B 2VWLA 2HWLB 1V2PT 1GBCA 3U98H 1K1LA 2FYRA 1AE8H 4HTCH 1BBRE 4AGKA 1C2FA 5B6OA 2R3UA 5I25A 3SUDA 1UJ1A 3DFJA 2BZAA 1ZGIA 1C2EA 2BY9X 5FPTA 1ELEE 1YLDA 2BXTH 2EI6A 1ZZZA 3BTKE 1MUEB 5K0HA 1BTYA 2XCNA 4INHA 1TAWA 1TYNA 1PPBH 1V2RT 2FP7B 1J9CH 2AFQB 1UVUH 5ETXA 2XBWA 1H1BA 1HAZB 2FO9A 1XXDA 3NPSA 2TGPZ 1SL3A 2ANMH 1H9HE 4NWKA 1ELAA 5I46H 1A3EH 1EPTC 3BTGE 1OPHB 4MNVA 1YPKH 4K1EA 1GJAB 1A7SA 2QV1A 3CS7A 1EB1H 3R0FA 3K6YA 2J4IA 3DHKH 4MNYA 2VU8E 1SGFA 2Y5GA 3SU0A 1BMLA 4JZFH 3TGKE 3V3MA 2B0FA 2ZHWH 3L33A 2GX4A 2FTMA 1BA8B 5DGJA 1BBRH 1C1PA 1IAUA 1LTOA 3ESTA 1CE5A 2OC8A 3UREA 1WCZA 1Q2WA 5EQQA 2CXVA 2Q6GA 4ABEA 1C5MD 3ODFA 2VVVA 4B2BA 2ZPSA 2P3TB 3A7ZA 3DUXH 5AFZH 4F4OC 2GMTC 1K1MA 2BX4A 1DWCH 4BXWA 1QIXB 2BD2A 2GMTB 4K2YA 3QK1A 1LPZB 3QTOH 1Y3UA 2H9HA 1ANDA 1MD7A 1A2CH 1WYKA 1KDQB 5EQSA 3RXPA 4MNWA 2AEIH 3EE0B 3FP7E 1SLVB 1MBQA 1HLTH 4B2AA 5CHAB 3GDUA 1G9IE 5E8EH 3MH7A 1W12U 4XDEA 5TCCA 3ZVFA 4DGJA 3S0NA 4AYVB 1SG8B 2XWAA 4XE4A 1P2OA 1AZZA 1UCYE 1MTWA 1GL0E 1QCPA 1Y5AT 1C4Y2 3PMBB 1IQGA 1E37B 2LNCA 1C1WH 1IQLA 1P8VC 2BMGB 1FN6A 3TLOA 3LH1A 5JB8S 2WUBA 2A4OA 2OQUA 1F5LA 3MO9A 1LMWB 4IC5A 3URDA 5DP4A 1O2WA 7LPRA 2NU4E 1O32A 3GDSA 5L6NH 1JOUB 1GJCB 1MKWH 1QL8A 1AVGH 1BHXB 4O03A 2VIDA 1WQVH 2KAIB 3PROA 1K22H 1YPEH 1A5GH 2GDEH 1JWTA 2A5AA 3AW1A 2H1UA 4MPXA 3RXVA 3RU4T 1KLTA 4K8BA 4OGXA 1DPOA 3A8DA 1PJPA 1TNHA 1UK4A 3ZVGA 1BZXE 3RMNH 2EI7A 2RCEA 1HPGA 4JK6A 1O2XA 1GHBG 1FJSA 1UCYH 4TPIZ 1SLUB 2AGEX 5SGAE 1G32B 2FLRH 3ZZCA 1GHXH 2PKAA 3O8BA 4VGCB 2G55A 1ETTH 1SBWA 3KHVA 4U01A 1PPFE 3OTJE 4NG9H 4LZ4B 5DKMA 1V2ST 5BRRE 3RXIA 1UK2A 1FV9A 4X2WA 3U9AH 3RXFA 2ZG0H 3PLKA 3LDXH 1PPEE 1XVMA 1SI5H 2ALVA 1XUGA 2ZFSA 5PTPA 3F9HA 1S5SA 5GJ4B 2GZ9A 2Z9LA 1XM1A 1SGRE 3M3SA 2IJOB 3S7KB 3M5LA 4X6NA 1BTPA 2SGFE 2UUJB 2H2ZA 1Y5UT 4X8SH 2GDDA 1MCTA 1KSNA 2D2DA 4UFGH 1O3HA 1CT0E 1Y3XA 1BRUP 1DWBH 2G51A 3TNTA 4ABAA 1F2SE 2GCTC 3F68H 3T26A 4AB9A 1GG6C 4BNRA 3A82A 3KCGH 1ZJKA 3AASA 1TBRH 3RM0H 2O8TA 4ZHMU 1GG6B 1ANBA 2XCFA 2M5TA 1V2OT 2IOTA 2Z6BD 1QB9A 1SGDE 3P95A 1P2QA 3R3GB 1P05A 2R9PA 2SNWA 3KNXA 1C1MA 4WWYA 3KQCA 1MTVA 4LK4A 4I7YH 3GICB 1C5SA 1MCVA 2H6MA 4DJZB 1RGQA 2P8OC 1Y8TA 1XUKA 1O31A 3ZZ6A 2FOHA 2FLBH 1GBFA 1CSOE 1HAIH 5J4SA 1P04A 1TBQH 1BJVA 1EZXC 1L1JA 1O2SA 3A8AA 2CJIA 3JZ2B 1O33A 1P12E 1FAXA 1QRWA 4NIXA 3U8OH 3ZZAA 1D3QB 1TFXA 1EJNA 1TLDA 2TPIZ 2BDGA 3U1JB 2ZFPH 3DA9B 1UMAH 1SVPA 1ABJH 1GI3A 1C1VH 1K1OA 1W10U 3UOUA 1HAVA 4NIYA 1MQ5A 1F92A 5DP5A 1S83A 1IQMA 2J34A 2FODA 2ZU3A 2P94A 1AY6H 4ZKOU 1TALA 1NROH 2QXIA 3AW0A 1P10A 1G2LA 1OYQA 1WQSA 1CT4E 2ZDAH 4HI3A 4UEHH 4ZXXH 1D3TB 1C5NH 1XKBC 2FOGA 1O5AB 1MBMA 1CVWH 3M61U 5E0GA 5EODA 1NU7B 2FI5E 2Q6FA 3ZVBA 1C5VA 3RDZA 2R0LA 3ENSB 4X2XA 1C5WB 3MH4A 4IS5A 3A83A 4J2YB 4MPVA 3ZZBA 2FX6A 1T8NA 2EEKA 2ZECA 4KTCA 4ZKSU 3SJ8A 2H9EH 1B0FA 1L1GA 2F91A 1NPMA 2OLGA 2THFB 2OC7A 3SHCH 1TRMA 2OC0A 1MH0A 2XC0A 3SN8A 7ESTE 1WTGH 1TWXB 2Q1JA 1YF4A 4A6LA 2J94A 3E0PB 1NTPA 1QQUA 2OBQA 3QDZB 1GBMA 3SV6A 2TRMA 2FI4E 3K6ZA 3EAJA 3RXRA 1A0JA 1BB0B 1T31A 1JIMA 3RXHA 2J2UA 1O2IA 1GWAA 3W94A 4CBOA 1HNEE 1ZMJA 3ZYEA 2FOEA 4NZLA 2Z3EA 2PUXB 1BMMH 2ZFQH 2DUCA 3SGBE 2G81E 1GL1A 2PLXA 2VB0A 1TB6H 4KGAA 1SGPE 1D6RA 1TNLA 3T5FH 2CF8H 6GCHG 1MTNC 2W3IA 1HBTH 4H4FA 4UONA 1VITG 3ATIA 3LH3A 3GCTG 1DY9A 4B73A 3ODDA 1HAGE 1W0YH 1GI0A 3SU2A 3UWJH 4IW4E 4YOGA 5IYTA 1MU6B 3UY9A 2ZDVH 1WAYB 3F1SB 1RIWB 1VCPA 2QN5T 2ZCLP 3TU7H 2V6NA 1P2NA 4NGAH 2A2XH 1S0QA 4R0IA 2Z9IA 1YM0A 1TNJA 4TWYA 2GGVB 3V13A 3ZV8A 2QF3A 5AFYH 2WPIS 5F8ZA 1C2HA 1O39A 1VZQH 3TITA 1E35B 1NZQH 5JBCS 2O8WA 4AB8A 1NN6A 3O8CA 2AGGX 2GVFA 3P17H 1OP2A 2BLWA 4TY6A 3CENA 4MPWA 1SFQB 2RDLA 1C9TA 1H9IE 1CGJE 2TGTA 1GMDF 1B7XB 1UTJA 4K60A 1GI7B 1OKXA 3UNSA 4MVNA 1C1TA 1K28D 1Y5BT 1QL9A 2O8UA 2W5EA 3MO6A 4E05H 1T4UH 4MG3A 4YLUA 2GV7A 4MPUA 1DWDH 1OWJA 4AORA 3SNBA 3VFEA 3UIRA 4GHTA 5GCHG 4X1PU 2UWOA 4E06H 2ZFFH 2AIPA 1E0FD 4D9QA 2VJ1A 3STIA 4JYVH 2VIPA 1SSXA 3A81A 1O0DH 3OY5U 1S84A 1Z8GA 4UFFH 1GGDC 2ZU1A 1C5UA 3MU0A 1LDTT 4Q7XA 8GCHG 1SGTA 3F9GA 4GUXA 1ZMNA 2QXGA 4DIIH 2W3KA 2ZGBH 1VR1H 1ARCA 2ZTXA 2BD8A 2OD3B 4KKDA 2VNTA 1ZJDA 1A46H 3SJ9A 3KN2A 4JZIA 2PKAB 4ZKNU 3HKIB 4E7RG 5EW1H 1O3BA 4QT8C 3GCHC 2G00A 1GVLA 1LVMA 4WH8A 1MZDA 3RXOA 1V2JT 9LPRA 1ANEA 1LCYA 3QUMP 1CBWB 1EAUA 4Z6AH 2JKHA 1MD8A 5TJXA 1K2I1 3NKKA 1GI1A 2ZPRA 3NWUA 3AVZA 1CGHA 3SV8A 3QN7A 1DLKB 3KQDA 1UVTH 1V2KT 1YPHC 1VGCC 1A5IA 2VH6A 1GBKA 5IDKA 1A4WH 1ZPZA 2GKVE 1F5KU 2BD9A 1VGCB 3MH6A 4D8NA 4JZEH 1PQAA 2SNVA 3PLPA 2FXRA 2FI3E 3MFJA 3RXBA 2K1QA 1L1NA 2VH0A 3EA9A 1WOFA 4O3TA 1G3DA 2YNAA 5LH8A 1ZRKA 1BRCE 5C20A 1G36A 1GBDA 1GJ8B 1NU9A 1O3OA 3B8JA 4Y76A 1GHZA 3MU5A 1WSSH 1TQ0B 4OS1A 3B9FH 5LPFA 3ATMA 3RXQA 1TMUH 1SHYA 1BTXA 2BHGA 4NWLA 1GHAG 1MQ6A 1YCPK 1K1IA 4XBDA 4BOHA 1HJAC 3RU4E 6CHAB 4ZHAA 1K1JA 2RA0A 1HAXB 2H5CA 3EGKH 3SQHE 2PSXA 3STJA 4X2YA 3KQBA 1LVYA 2ZFTA 4ABJA 2JH0D 4ESTE 3UNQA 2AMDA 2FESH 4HGCA 4BANB 2UUYA 1OXGA 3AAUA 4HZHA 5GIBA 3S69A 4MDSA 4ISIH 2HVXA 3HGNA 1GJ9B 1SGEE 3A86A 2FOCA 1AHTH 1TE0A 1EP5A 2Z94A 5AVDA 1VJAU 1YP9A 2QA9E 1PYTC 1OWDA 3G01A 1PYTD 4BAHB 1HAVB 3T25A 4NA8A 1DE7H 4A5TS 1TIOA 2A0QB 1QJ1B 2D1JA 4FXGH 1EKBB 1GI5A 1AKSA 2J95A 1QRXA 1HDTH 3T2NA 4XBCA 1LVOA 2GV6A 1F5RA 2SGAA 4ABHA 1O5EH 4OS6A 4CH8B 1BBRK 1JMOH 4AFZA 1KLIH 3ZYDA 4DIHH 3M35A 4ZAEA 2ZPQA 2BVSH 7KMEH 4WY3A 1S82A 1D3DB 1AB9C 5ABWA 4NA7A 1TPOA 1QBNA 1GJ7B 3QWCH 5TCAA 2DE8A 2ZZUH 4CBNA 1NY22 2BX3A 1KY9A 3M37A 3SBKA 1AB9B 2QAAA 4GVUA 4IN1A 3D23A 1DSTA 1MAYA 2ZCHP 2F9BH 4WVPE 4Y7BA 3Q00A 1DXWA 1OWEA 1O5BB 1EOLA 4WXVA 1ZHMA 1DT2A 1EJMA 1LQEA 1C1OA 4GPGA 2PGBB 4YESB 3RC5A 3E0NB 3ATKA 3SO3A 3UOPA 1IQHA 1NS3A 4YOIA 2R2WU 1HYLA 1HIAA 1W7GH 1DDJA 1GHVH 2ZNKH 5AHGH 3GY4A 3B23B 1OP0A 2WPLS 4Y8ZA 3W95A 2XXLA 1AD8H 1FNIA 4A7IB 4Q2KA 1MZAA 2AIQA 4IC6A 3RMMH 3BG4C 4D9RA 1EP6A 5CHAC 1V2WT 4NZQA 1CU1A 2BY7X 1P9SA 3BG4B 1HAYB 4FUCA 4X8UH 2XRCA 1L4DA 1MKWK 5C5OA 3EDXB 2WV4A 2A4QA 1NM6A 1P3EA 3UR9A 3QTVH 1RXPA 3LGVA 1O2OA 2ZGHA 1GCDA 3NK8A 2VIOA 2HNTC 1EB2A 3TGJE 3RXAA 1SQOA 1O2HA 1A5HA 1KXBA 5JBAS 1EZQA 1TGNA 1C1UH 5A0CA 3BSQA 3FVFB 1C2DA 1UCYK 1QFKH 2ULLA 2NU0E 3SI4H 1HXFH 2BD4A 3ZZDA 3FANA 1C9PA 2WV5A 4AFUA 2CHAB 1QL7A 2QY0B 2JH5D 4M7GA 2AERH 1FN8A 2BY8X 1TPAE 3A7XA 4F49A 5EGMA 3H5CB 2PSYA 4KTUA 2XC4A 2NU3E 3SUFA 4FUIA 1Z8RA 4A1VA 2HPQH 5FPYA 3E16B 3ZZ7A 2ASUB 1UTOA 2UWLA 4TY7A 2PUQH 2R0KA 1OYTH 4AGJA 2QCYA 3GY3A 1LHCH 1UTMA 2G5NA 4INLA 2SFAA 1FDPA 1XUJA 4VGCC 5FCKA 1C2IA 1LHGH 1SMFE 3E91A 2P95A 1ARBA 2LPRA 2Z3DA 5T6DA 3RC4A 1UHBA 1SPJA 3SNEA 2OQ5A 5JBBS 1P2IA 3M7UA 3TVJB 1F0UA 2ILNA 1KXCA 2VWOA 3SOSA 4DVAU 2I6QA 1DVAH 2FOMB 3M3TA 4D76A 1GJ4H 1KLJH 2B5TB 2BQ6B 1C5YB 1FPHH 5FCRA 1MU8B 2BLOA 4ZH8A 2AMQA 2AS9A 3D65E 1QQ4A 4K69A 2VWMA 2F9UA 1HB0B 2CF9H 1IQEA 1ZYOA 3TK9A 3BTME 1VCWA 2IN2A 2Z7FE 2ZGJA 1CA0C 3BTFE 3A7WA 2BQWB 3OYPA 3HK6B 1A0HB 4INKA 3SU4A 1TGCA 1O3JA 2C93B 5K7RA 1CA0B 1ZSJA 3A7TA 2C8YB 2IPHA 2QC2A 4K8YA 3GY6A 1AFQB 2PR3A 1AWHB 5LPRA 1HJ9A 2BZ6H 2FOAA 4GSOA 1NFXA 5A2MH 1O3IA 4ABDA 4ZROA 5LGOA 4FUEA 1SGYE 2ZIQH 2ZGCA 3SGQE 3SQEE 1GMHG 1F7ZA 2OBOA 1J15A 1Z1IA 1K9OE 3BG8A 4A1XA 2BY5X 3KGPA 3ZZ3A 1J17T 4I31A 1FPCH 1P01A 2C8ZB 1ZHRA 3MOCA 1P02A 3E8LA 3RXMA 4JZ1A 4RSPA 6LPRA 1BTUA 1JRTA 4AYYB 2HGTH 2A4GA 1QRZA 1EATA 3U8RH 5EPNA 3MNCA 3Q77A 1K21H 1JXPA 1NFUA 3RLYH 2HLCA 2GT8A 1QB6A 3BIVH 3S7HB 4GHQA 4B76A 1ORFA 5HXFA 1MKXK 1HCGA 2ZFRH 3BEIB 3GY5A 4FUDA 1J8AA 4PROA 1AU8A 3ZV9A 1V6DA 1AUJA 3PO1B 1C2GA 3PYHA 4FUFA 4ZXYH 4Y0YE 4A92A 3DD2H 1RTKA 4X1NU 1RD3B 1P9UA 3U1IB 4WJG2 3IITA 5GWZA 4I8GA 1OS8A 1GBLA 3RXCA 1EJAA 1SOZA 2BB4A 1EUFA 5A8YA 2Y80A 2UWPA 3DFLA 5T6GA 2ZTZA 2FTLE 2Y5FA 2G8TA 1AQ7A 1C5RA 4X1SU 3MYWA 4ABIA 1GHYH 5E0HA 3F6UH 2P59A 4MQAA 1YBWA 5EU8A 3ZVCA 2Y7ZA 3OX7U 1HXEH 5FX5A 3A85A 2FWWA 2GZ8A 3K2UA 4ABGA 1A0LA 1LVBA 2XBVA 2STBE 3VB6A 1W7XH 2OXSA 3LT3A 2BD5A 1LQDB 2O8LA 3GYLB 3RP2A 3GISB 1B0EA 1NRRH 1Y3VA 4UDWH 1TRYA 5CMXH 2F9OA 1H9LB 1V2NT 3HATH 3MMGA 3S9BA 5G4BA 3NUMA 2SGPE 5JDUB 4UFEH 3V12A 1N8OB 4U30A 1HV7A 1M9UA 2A45B 2ZHQH 3CS0A 3FAOA 3SNDA 1GJDB 1THSH 1S81A 4B2CA 1EZUC 4Q7ZA 7GCHF 3M7QA 3KQEA 3P8NA 1QY6A 1TABE 4ISLA 4SGAE 1EASA 5JBTA 1H8DH 5LPEA 1PQ8A 3TH2H 5EPYA 5C1XA 1AKSB 1C1RA 1EPTA 4BTTB 1T7CA 4O9VA 1TONA 1X7AC 4MNXA 1ACBE 1WUNH 3H7OA 1IQKA 4IBLH 2FM2A 5GPIB 1O3GA 3LGWA 1ZMLA 1Y3WA 3F9FA 3RM2H 2W7UA 1O2QA 1O5GH 2Z9KA 1O2TA 1C2KA 3BTWE 3SUEA 1KTSB 1OOKB 2WPHS 2XC5A 2ZO3H 1N6XA 4Y0ZE 1HAOH 2C90B 1O2LA 4SGBE 1TNKA 2ZCKP 2EC9H 4O3UA 4X6PA 4DT7B 3BF6H 3PMHB 5FBIA 2WPKS 3GY7A 4XBBA 1P03A 1SQTA 2BDIA 1CQQA 1G3EA 1OSSA 1Y59T 2ZI2H 1KDQA 4K1SA 1CHOF 1GMDG 2Z9GA 1S0RA 1FY1A 1QNJA 1G37A 4LZ1H 1FQ3A 1RIWC 3A7YA 1D6WA 1V2MT 5ESBA 3V0XA 1W11U 3MH5A 1V2LT 1RTLA 4FU9A 1D3PB 1TX7A 3TNSA 4Q80A 1BTWA 4FUBA 1XMNB 3PV4A 1EQ9A 3BTEE 1SLXB 1G30B 1V2TT 2WPMS 3KIDU 1Z71A 3NZIA 4AZ2B 1TGTA 3MWIU 3ZZ8A 5C67A 3RXGA 1GMCF 1O37A 2BDBA 5ESTE 3RC6A 3TIUA 4CRAA 1THRH 2PV9B 2ANWA 3LU9B 1P06A 1BIOA 3RU4D 2ODQA 3QO6A 1NFWA 3E90B 3OU0A 2KAIA 9ESTA 3SU1A 1ID5H 5JB9S 3PTBA 1GCTB 1BTZA 1ZR0A 3TH3H 1T32A 1LPKB 1SHHB 4NFEA 1SLWB 3SU3A 1UTNA 1C5ZB 2I6SA 5E0JA 5HMAA 4IMZA 1QJ7B 2VIWA 2BDHA 1UTPA 3KEEA 1A61H 5T3HA 3D49H 4LXBH 4YO9A 1AE5A 4CRCA 1IOEA 4YZUA 1FY4A 1QR3E 2G4TA 3L6PA 2XBXA 4MLFB 2VINA 1MAXA 4OS7A 5DO4H 1B5GH 2B9LA 4ABBA 1PPHE 1Z6EA 3Q76A 2QGRA 3MO3A 1QA0A 1UTQA 3A88A 3TGIE 2GP9B 1Z6JH 1EAWA 1EOJA 3HPTB 4OS5A 1TA2A 1C2JA 2GCHG 1NC6A 3VB7A 2SGQE 1TBZH 2W7SA 1DFPA 3GCNA 4BAKB 1T4VH 3TJNA 1ELDE 4TPYA 1U6QA 4KELA 3M5OA 2VIQA 3LKWA 1UHBB 1THPB 1CBWC 1AFEH 1HRTH 2FOFA 1C5TA 3MU8A 3PMJA 4FUJA 4ZUHA 3LGTA 2J92A 4X8VH 3TH4H 3GYMA 2H5DA 3BTDE 4RKJB 2XTTB 1FIZA 3SNCA 2A7JA 3P70B 3S9CA 3VXFH 1DLEA 2ZWLH 3D62A 4Y8XA 1QBVH 3SJOA 1GDNA 3A7VA 5DP6A 1IQIA 2FS9A 4CRFA 1BT7A 2BM2A 4WF8A 4JCNA 2OC1A 3ELAH 2OP9A 1J14A 3VB5A 1LHEH 2ODPA 1BMAA 1QA7A 4GAWA 3RLWH 1LKBA 1N1LA 1O35A 2UUKB 1GJBB 1P2JA 2GT7A 1V2UT 1ZLRA 5EQRA 2OTVA 1W2KH 2QIQA 1O5FH 4OS2A 3PTNA 4R8TB 4YM9A 1O2VA 2ZDMA 1LHFH 3F9EA 4WXIA 3SJKA 3UR6A 6CHAC 1GVKB 2BDCA 1ABIH 3M5NA 2BLQA 3EA7A 4BAQB 2BDYA 1GI9B 4XOJA 2ZHEH 2QXHA 1DX5M 2V3OH 3ATLA 4CRBA 1K1PA 1ELCA 4KTSA 2ODYB 2WINI 5F8TA 2ZTYA 1YLCA 5A09A 1LPGB 3VB3A 2FX4A 1ELFA 3I78A 1W3CA 1DITH 2A5KA 5E2OA 1DY8A 4ABFA 2C3SA 1YKTA 1GI8B 4GCHF 4WMDA 1V3XA 2TGDA 2SGDE 5DP7A 2FDAA 4OGYA 2H9TH 1SOTA 5EG4A 1P2KA 4X1QU 3BEUA 3Q3KA 1TQ7B 1LO6A 4WMEA 5L2YH 3SV2H 3UPEA 2CV3A 1GBHA 4K3JA 2B8OH 4FU7A 4AFQA 4ZKRU 3UNRA 2JETB 1YPGH 3VXEH 3RXDA 2ZGXH 3U8TH 1QB1A 1J16A 1CT2E 2CMYA 4GLYA 1JIRA 2ZDKA 5A0AE 3BTQE 2AYWA 3FZDA 3LOXA 3FFGA 2A32A 3HGPA 3PWCA 1GHAF 1D4PB 3TPIZ 8KME2 5H4IB 1AVWA 1PPGE 3BEFB 1DSUA 1DXPA 1EZSC 2XYAA 3FP6E 3M3VA 3RMOH 1ETSH 1DWEH 1XXFA 3RUOA 3A84A 4AN7A 3H7TA 4JYTA 4TYDA 1G2MA 3EQ0H 1YGCH 2WYJA 1KXAA 5FAHA 1DANH 1GI6A 3LGYA 4NIWA 4ASHA 8ESTE 2QF0A 4IN2A 3A87A 1C1QA 4X6MA 5DPAA 2ZKSA 1L4ZA 3AAVA 1UVSH 4Y71A 1S6FA 3SV7A 1OWKA 5CE1A 3MNSA 1KXEA 2ZU4A 1HUTH 3LJJA 2BTCE 4NA9H 2A4RA 3RXJA 1GBJA 5FXLA 2BDAA 3LGUA 1SGIB 5BPEA 1ZPCA 1C1NA 1KXFA 3Q3YA 1CHGA 1EPTB 1SGFG 1QGFA 1AZ8A 1AIXH 3E3TA 2ZHFH 2EI8A 1YPHE 1TRNA 1BOQA 1O5DH 4OS4A 1GBEA 1Y3YA 1PQ7A 1V2VT 3SI3H 5A8ZA 5L2ZH 1L2EA 1NRQH 4J1YA 5J4QA 1H4WA 3BV9B 1BDAA 4MTBA 2OCVB 3MHWU 2BD3A 4LOYH 3ZZ9A 3BIUH 3UFAA 4CRGA 5F6MA 1BUIA 1P09A 4BAOB 3VB4A 5C3NA 1C5QA 1RTFB 1Z8JB 4JYUH 1O3FA 1FAKH 3VGCC 5JYIA 3QZRA 3KF2A 5A8XA 1W0ZU 1KYNA 2PFEA 1O3KA 5EXMA 2NU2E 3VGCB 2BY6X 3A8CA 1IQJA 2ZU5A 1BQYA 2ZC9H 3LC5A 1O3AA 2YNBA 2PTCE 1C2LA 3FZZA 1TMTH 3LIWA 1MTSA 2WPJS 1INCA 2CGAA 2D26C 2TGAA 6ESTA 5L30H 2V0BA 2CHAC 1T8LA 1OWIA 8LPRA 3HK3B 4CR9A 1JRSA 1YC0A 4I32A 2PKSC 3S9AA 2P16A 5DJ7A 2Y6TA 5DP3A 5EXNA 4BXSA 3TJOA 2PKSB 4X2VA 1O3LA 2GTBA 5JPMH 1SGNE 1NRPH 4YT6H 1BMNH 1O2JA 2V35A 2ZU2A 1SB1H 1UO6A 2NU1E 4RKOB 3E6PH 1OWHA 5EW2H 2VGCC 4Y79A 1AUTC 1FY5A 3PLBA 1KTTB 3LC3A 3L3TA 2VGCB 3URCA 4FUGA 3VPKA 3SV9A 1PPZA 1P3CA 2FPZA 3V7TA 2VVUA 4NCYA 1C5OH 1TA6A 4DOQA 1FXYA 3RXEA 3WY8A 1HGTH 2HOBA 2ZP0H 1SR5C 1AO5A 2ANYA 4B71A 1DICA 2ZEBA 1NFYA 3LGIA 2XW9A 1UVPA 5C2ZA 3P8GA 2ZDNA 4CHAC 3PWBA 2BOHB 2XWBI 2Y7XA 1VCQA 3MU1A 3SU6A 4IGDA 3O8DA 1S6HA 4CHAB 1Q3XA 1ELBA 1MTUA 4I33A 2J9NA 2R3YA 4XFQA 3MNBA 5DP8A 1W13U 4X1RU 1ZHPA 2B7DH 3SW2B 2AMPA 1NT1A 3MI4A 4YT7H 1ESTA 2FZZA 1LHDH 1TOCB 1AFQC 3QZQA 3NXPA 5FBEA 5FX6A 1T8MA 4NSYA 1ZGVA 4I8KA 3M7TA 4UE7H 5DP9A 1BJUA 2Y82A 1P11E 1YYY1 4RN6A 3GOVB 2P3UB 5DK1A 1GHBF 2BVXH 1F0TA 1CO7E 4Y7AA 5GDSH 2ZHDA 1NRNH 1ZSKA 4JZDH 1GJ6A 1BRAA 2JH6D 4AOQA 3ZZ5A 1WTHD 2GCTB 3OSYA 1IHTH 1RRKA 1SQAA 1QHRB 1C5LH 1E38B 1C4U2 2ANKH 3UUZA 4YTAA 3T27A 5F8XA 3JZ1B 1TNGA 4WMFA 1O2UA 5HYOA 5FPSA 4I8HA 3VEQB 1HAHH 4BTIB 3ATWA 4JK5A 1DS2E 2A1DB 1JBUH 2FEQH 4HFPB 2WUCA 2HNTE 1C4V2 1Z8IB 3PO1C 3GCOA 1OP8A 4CR5A 2XBYA 2XNIA 4X8TH 1A3BH 1TNIA 1E36B 3UTUH 2BXUH 2O8MA 3GDVA 2P8OB 3K65B 2O9QA 4ZMAH 1VITH 1K1NA 2AGIX 5F03A 1O2ZA 1GBIA 4H42U 7GCHG 4DCDA 2W26A 5DG6A 1AVXA 1AWFH 5AF9H 1YPLH 1C5XB 4BTUB 4H6SB 1GMHF 4U32A 3P92A 4K5ZA 2G52A 1P57B 1D9IA 1EX3A 1L0ZA 3RXKA 4BAMB 3N7OA 1S85A 3TJUA 2F3CE 2CN0H 3A8BA 2OUAA 1TMBH 1ZRBA 4UD9H 1LKAA 1BTHH 1N8OC 2WYGA 1IQNA 3SU5A 1KXDA 5HM9A 1FMGA 4AX9H 1TPPA 1FI8A 1MKXH 1PQ5A 2F9NA 2PGQB 1DUAA 2ALPA 4FU8A 2FMJA 3IWMA 1CHOG 1GJ5H 1XKAC 2R2MB 3P8OA 1PFXC 3LONA 5A0BA 2C8XB 3UQVA 3E1XB 3BTHE 1ETRH 1YPJH 1MMJN 3CP7A 3PMAB 4NSVA 3SHAH 1RS0A 4NFFA 1HFDA 1EAXA 4THNH 3BTTE 3GY8A 4A1TA 2VWNA 3TK5A 1IQFA 2ESTE 2G5VA 4CH2B 1GI4A 1XUFA 4ZHLU 3TK6A 1QURH 4ISOA 3UWIA 1T8OA 1GMCG 1UTLM 4B1TA 2HPPH 1XUIA 1SGQE 2PHBA 4H6TA 1EXFA 3PM3A 1F0SA 1O2KA 3LPRA 1O5CB 4Y6DA 1C1SA 2ZA5A 4FVBA 3RXSA 4AG1A 3K9XB 3MU4A 1AI8H 4ISNA 1O3NA 3GY2A 1TPSA 3T62A 2ZDLA 1QBOA 1MTNB 1C2MA 3RMLH 1GI2A 3SGAE 1O2MA 1TX8A 1HIAB 3LJOA 5E2PA 2BQ7B 3I77A 3RXLA 2A2QH 4X6OA 1AN1E 3NCLA 1DUEA 2ZF0H 1ESAA 2OINA 1FZZA 3Q3XA 1RFNA 2GZ7A 3ZVDA 2C8WB 1GBAA 5EXLA 1SGCA 3QGNB 5GXPA 1P0SH 1O3MA 2BD7A 2EA3A 1TOMH 1NESE 1O2PA 2FIRH 1TGBA 1GCTC 1W14U 2HRVA 1E34B 6GCHF 1H8IH 1OX1A 1WBGB 2YOLA 1ELTA 2VIVA 1VITF 4CREA 1Z1JA 2BOKA 3GCTF 2BVRH 4KP0A 3MNXA 4DY7B 1O38A 1UVOA 2HALA 2SGEE 4FUHA 1WU1A 1CGIE 3RXUA 2Z3CA 4Y8YA 4I8LA 2BYAX 1FONA 5T6FA 2A7CA 1O34A 4I8JA 3T29A 2Q6DA 2FOBA 3SJIA 2UUFB 1RJXB 2ZQ1A 2D8WA 2VVCA 1W8BH 3M5MA 2C4FH 3P8FA 4DURA 1F0RA 2A31A 1UK3A 3ZVEA 1XX9A 1CA8B 5FHTA 1GVZA 1QTFA 3A89A 2STAE 4D7GA 2HNTF 1ELVA 1O2YA 3BN9A 3EYDA 4DW2U 1SFIA 1N6YA 4YLQH 2G4UA 3SUGA 2Y81A 4B74A 1QJ6B 2F83A 4B75A 1O3DA 1VJ9U 4AFSA 1ANCA 2TBSA 4K1TA 2QXJA 1FUJA 2TIOA 5HGGA 3ZVAA 1BHXF 1BITA 1GGDB 2PW8H 4O97A 3IG6B 1G3BA 3QX5H 1YCPM 4UFDH 1ZSLA 1PPCE 4CRDA 3OY6U 1O3EA 2QYIA 1GHWH 2DE9A 1AMHA 1GBTA 1AGJA 3I29A 1O2GH 1Q31A 1ZPBA 4Y10E 1O36A 1FLEE 3UQOA 1NO9H 1TX6A 3QLPH 4E7NA 1FY3A 4TWWA 5HM2A 2A5IA 4WH6A 1GBBA 1GDQA 1C5PA 1O2RA 3QGJA 1ELGA 5GCHF 2RG3A 3T28A 2Z9JA 1SC8U 4U2WA 1FY8E 3GCHB 2ZQ2A 1ESBA 2NWNA 3SNAA 1V2QT 3ZZ4A 1ZTJA 4GCHG 1KIGH
chains in the Genus database with same CATH superfamily
1DOJA 1YPMH 2RA3A 3EA8A 3M36A 1ZTKA 2F43B 1BRBE 3RXTA 4D7FA 4IMQA 8GCHF 3O8RA 3SORA 5EOKA 3SZNA 2BLVA 2P3FH 3HKJB 2GCHF 3PB1E 4Y11E 3P6ZB 2F9VA 2AH4X 3U69H 5C1YA 1UTKA 4Z0KA 1O3CA 3ITIA 1NRSH 3DT0H 3A80A 2A7HA 4XSKU 1O2NA 5C1UA 3TJVA 4FVDA 2V3HH 1BCUH 3KL6A 2FYQA 1O30A 1ZOMA 4NIVA 3MTYA 1GPZA 2P93A 1WV7H 1P2MA 1Z7KA 1G3CA 1HJ8A 1EAIA 4X0WU 1HJAB 3C27B 2J38A 1XUHA 2F9PA 2Y5HA 1XVOA 1HAPH 4ISHH 3FP8E 5C5NA 1O3PB 1GDUA 2FS8A 1IHSH 4DG4A 1ZTLA 4AG2A 1FIWA 2GD4B 2JETC 2PTNA 4JMYA 2PWXA 4Q7YA 3C1KA 1TGSZ 1A1RA 1YCPH 4YOJA 1DM4B 2VWLA 2HWLB 1V2PT 1GBCA 3U98H 1K1LA 2FYRA 1AE8H 4HTCH 1BBRE 4AGKA 1C2FA 5B6OA 2R3UA 5I25A 3SUDA 1UJ1A 3DFJA 4P00A 2BZAA 1ZGIA 2J98B 1C2EA 2BY9X 5FPTA 1ELEE 1YLDA 2BXTH 2EI6A 1ZZZA 3BTKE 1MUEB 4Q4LA 5K0HA 4AC9A 1BTYA 4XD7D 2XCNA 4INHA 1TAWA 1TYNA 1PPBH 1V2RT 2FP7B 1J9CH 2AFQB 1UVUH 5ETXA 2XBWA 1H1BA 1HAZB 2FO9A 1XXDA 3NPSA 2TGPZ 1SL3A 2ANMH 1H9HE 4NWKA 1ELAA 5I46H 1A3EH 1EPTC 3BTGE 1OPHB 4MNVA 2KCPA 1YPKH 4K1EA 1GJAB 1A7SA 2QV1A 3CS7A 1EB1H 3R0FA 3K6YA 2J4IA 3DHKH 4MNYA 2VU8E 1SGFA 2AHME 2Y5GA 3SU0A 1BMLA 4JZFH 3TGKE 3V3MA 1MABB 2B0FA 2ZHWH 3L33A 2GX4A 2FTMA 1BA8B 5DGJA 1BBRH 1C1PA 1IAUA 1LTOA 3ESTA 1CE5A 2OC8A 3UREA 1WCZA 1Q2WA 5EQQA 2CXVA 2Q6GA 4ABEA 1C5MD 3ODFA 2VVVA 4B2BA 2ZPSA 2P3TB 3A7ZA 3DUXH 5AFZH 4F4OC 2GMTC 1K1MA 2BX4A 1DWCH 4BXWA 1QIXB 2BD2A 2GMTB 4K2YA 3QK1A 1LPZB 3QTOH 1Y3UA 2H9HA 1ANDA 1MD7A 4YXWD 1A2CH 1WYKA 1KDQB 5EQSA 3RXPA 4MNWA 2AEIH 3EE0B 4TSFD 3FP7E 1SLVB 1MBQA 1HLTH 4B2AA 5CHAB 3GDUA 1G9IE 5E8EH 3MH7A 1W12U 4XDEA 5TCCA 3ZVFA 4DGJA 3S0NA 4AYVB 1SG8B 2XWAA 4XE4A 1P2OA 1AZZA 1UCYE 1MTWA 1GL0E 1QCPA 5KEDA 1Y5AT 1C4Y2 3PMBB 1IQGA 1E37B 2LNCA 1C1WH 1IQLA 1P8VC 5IK2D 2BMGB 1FN6A 3DSGA 3TLOA 3LH1A 5JB8S 2W6JD 2WUBA 3WWBA 2A4OA 2OQUA 1F5LA 3MO9A 1LMWB 4IC5A 3URDA 5DP4A 1O2WA 7LPRA 2NU4E 4Q63A 1O32A 3GDSA 5L6NH 1JOUB 4RT0A 1GJCB 1MKWH 1QL8A 1AVGH 1BHXB 4O03A 2VIDA 3ZIAD 1WQVH 2KAIB 4HG6A 3PROA 1K22H 1YPEH 1A5GH 2GDEH 1JWTA 2A5AA 3AW1A 2H1UA 4MPXA 3SZEA 3RXVA 3FN8A 3RU4T 1KLTA 4K8BA 4OGXA 1DPOA 3A8DA 1PJPA 1TNHA 1UK4A 3ZVGA 1BZXE 3RMNH 2EI7A 2RCEA 2LELA 1HPGA 4JK6A 1O2XA 1GHBG 1FJSA 1UCYH 4TPIZ 1SLUB 2AGEX 2QF5A 5SGAE 1G32B 2FLRH 3ZZCA 1GHXH 2PKAA 3O8BA 4VGCB 2G55A 1ETTH 1SBWA 3KHVA 4U01A 1PPFE 3OTJE 4NG9H 4LZ4B 5DKMA 1V2ST 5BRRE 1QZ8A 3RXIA 1UK2A 1FV9A 4X2WA 3U9AH 3RXFA 2ZG0H 2WZQA 3PLKA 3LDXH 1PPEE 1XVMA 1SI5H 2ALVA 1XUGA 2ZFSA 5PTPA 3F9HA 1S5SA 5GJ4B 2GZ9A 2Z9LA 1XM1A 1SGRE 3M3SA 2IJOB 3S7KB 3M5LA 4X6NA 1BTPA 2SGFE 2UUJB 2H2ZA 3EE7A 1Y5UT 4X8SH 2GDDA 3F2HA 1MCTA 1KSNA 2D2DA 4UFGH 1O3HA 1CT0E 1Y3XA 1BRUP 1DWBH 2G51A 3TNTA 4ABAA 1F2SE 2GCTC 3F68H 3T26A 4AB9A 1GG6C 4BNRA 3A82A 3KCGH 1ZJKA 3AASA 1TBRH 3RM0H 2O8TA 4ZHMU 1GG6B 5DN6D 1ANBA 2XCFA 2M5TA 1V2OT 2IOTA 2Z6BD 1QB9A 1SGDE 1WDIA 3P95A 1P2QA 3R3GB 1P05A 2R9PA 2SNWA 3KNXA 1C1MA 4WWYA 3KQCA 2YMSC 1MTVA 4LK4A 4I7YH 3GICB 1C5SA 1MCVA 2H6MA 4DJZB 1RGQA 2L6OA 1NBME 2P8OC 1Y8TA 1XUKA 1O31A 3ZZ6A 2FOHA 2FLBH 1GBFA 1CSOE 1HAIH 5J4SA 1P04A 1TBQH 1BJVA 1EZXC 1L1JA 1O2SA 3A8AA 2CJIA 3JZ2B 1O33A 1P12E 1FAXA 1QRWA 4NIXA 3U8OH 3ZZAA 1D3QB 1TFXA 1EJNA 1TLDA 2TPIZ 2BDGA 2F4LA 3U1JB 2ZFPH 3DA9B 1UMAH 1SVPA 1ABJH 1GI3A 1C1VH 1K1OA 1W10U 3UOUA 1HAVA 4NIYA 1MQ5A 2KCAA 1F92A 2WHXA 5DP5A 1S83A 1IQMA 2J34A 2FODA 2ZU3A 2P94A 1AY6H 4ZKOU 1TALA 1NROH 5HIYA 1KMHB 2QXIA 3AW0A 1P10A 1G2LA 1OYQA 1WQSA 1CT4E 2ZDAH 4HI3A 4UEHH 4ZXXH 1D3TB 2JJ1D 1C5NH 1XKBC 2FOGA 1O5AB 1MBMA 1CVWH 3M61U 4TT3D 5E0GA 5EODA 1NU7B 2FI5E 2Q6FA 3ZVBA 2EQNA 1C5VA 3RDZA 2R0LA 3ENSB 4X2XA 1C5WB 3MH4A 4IS5A 3A83A 4J2YB 4MPVA 3ZZBA 2FX6A 1T8NA 2EEKA 2ZECA 4KTCA 4ZKSU 3SJ8A 2H9EH 1B0FA 1L1GA 2F91A 5B6LA 1NPMA 2OLGA 2THFB 2OC7A 3SHCH 1TRMA 2OC0A 1MH0A 2XC0A 3SN8A 7ESTE 1WTGH 1TWXB 2Q1JA 4B6FA 4F55A 1YF4A 4A6LA 2J94A 3E0PB 1NTPA 1QQUA 2OBQA 3QDZB 1GBMA 3SV6A 2TRMA 2FI4E 3K6ZA 3EAJA 3RXRA 1A0JA 1BB0B 1T31A 1JIMA 3RXHA 2J2UA 1SQRA 1O2IA 1GWAA 3W94A 4ZCNA 4CBOA 1HNEE 1ZMJA 3OE7D 3ZYEA 2FOEA 4NZLA 2Z3EA 2PUXB 1BMMH 2ZFQH 2DUCA 3SGBE 2G81E 1GL1A 2PLXA 2VB0A 1TB6H 4KGAA 1SGPE 1D6RA 1TNLA 3T5FH 2CF8H 6GCHG 1MTNC 2W3IA 1HBTH 2IJD1 3F2GA 4H4FA 4UONA 2IPQX 1VITG 3ATIA 3LH3A 3GCTG 1DY9A 4B73A 3ODDA 1HAGE 1W0YH 3MQKC 3U28C 1GI0A 3UAIC 4OM9A 3SU2A 3UWJH 4IW4E 4YOGA 5IYTA 1MU6B 3UY9A 2ZDVH 1WAYB 3F1SB 1RIWB 1VCPA 2QN5T 2ZCLP 3TU7H 2V6NA 1P2NA 4NGAH 2A2XH 1S0QA 4R0IA 2Z9IA 1YM0A 1TNJA 4TWYA 2GGVB 3V13A 3ZV8A 2QF3A 5AFYH 2WPIS 5F8ZA 1C2HA 1O39A 1VZQH 3TITA 1E35B 1NZQH 5JBCS 2O8WA 4AB8A 1NN6A 3O8CA 2AGGX 2GVFA 3P17H 1OP2A 2BLWA 4TY6A 3CENA 4MPWA 1SFQB 2RDLA 1C9TA 1H9IE 1CGJE 2TGTA 3SYJA 1GMDF 1B7XB 1UTJA 4K60A 1GI7B 1OKXA 3UNSA 4MVNA 1C1TA 1K28D 1Y5BT 1QL9A 2O8UA 2W5EA 3MO6A 4E05H 1T4UH 5CDFE 4MG3A 4YLUA 2GV7A 4MPUA 1DWDH 1OWJA 4AORA 3SNBA 1EFRD 3UIRA 4GHTA 3VFEA 5GCHG 3W1EA 4X1PU 2UWOA 4E06H 2ZFFH 2AIPA 1E0FD 4D9QA 4I86A 2VJ1A 3STIA 4JYVH 2VIPA 1SSXA 3A81A 1O0DH 3OY5U 1S84A 1Z8GA 4UFFH 1GGDC 2ZU1A 1C5UA 3MU0A 1LDTT 4Q7XA 8GCHG 1SGTA 3F9GA 4GUXA 1E79D 1ZMNA 2QXGA 4DIIH 2W3KA 2ZGBH 1VR1H 1ARCA 2ZTXA 5CHBA 2BD8A 2OD3B 4KKDA 2VNTA 1ZJDA 1A46H 3SJ9A 3KN2A 4JZIA 2PKAB 4ZKNU 3HKIB 2WSSD 4E7RG 5EW1H 1O3BA 4QT8C 3AK5A 3GCHC 2G00A 1GVLA 1LVMA 4WH8A 1MZDA 3RXOA 1V2JT 9LPRA 1ANEA 1LCYA 3QUMP 1CBWB 1EAUA 4Z6AH 2JKHA 1MD8A 5TJXA 1K2I1 3NKKA 1GI1A 2ZPRA 3NWUA 3AVZA 1CGHA 3SV8A 3QN7A 1DLKB 3KQDA 1UVTH 1V2KT 1YPHC 1VGCC 1A5IA 2VH6A 1GBKA 5IDKA 1A4WH 3DCLA 1ZPZA 2GKVE 1F5KU 2BD9A 1VGCB 3MH6A 4D8NA 4JZEH 1PQAA 3PV5A 2SNVA 3PLPA 2FXRA 2FI3E 3MFJA 3RXBA 2K1QA 1L1NA 2VH0A 3EA9A 1WOFA 4O3TA 1G3DA 2YNAA 5LH8A 1ZRKA 1BRCE 5C20A 1G36A 1GBDA 1GJ8B 1NU9A 1O3OA 3B8JA 4Y76A 4FETA 1GHZA 3MU5A 1WSSH 1TQ0B 5EJLA 4OS1A 3B9FH 5LPFA 3ATMA 3RXQA 3OEHD 1TMUH 1SHYA 1BTXA 2BHGA 4NWLA 1GHAG 1MQ6A 1YCPK 1K1IA 4XBDA 4BOHA 1HJAC 3RU4E 6CHAB 4ZHAA 1K1JA 2RA0A 3PRDA 1HAXB 3F3BA 2KM0A 2H5CA 3EGKH 3SQHE 2PSXA 5HKKD 3STJA 4X2YA 3KQBA 1LVYA 2ZFTA 4ABJA 2JH0D 4ESTE 3UNQA 2AMDA 2FESH 4HGCA 4BANB 2UUYA 1OXGA 3AAUA 4HZHA 5GIBA 3S69A 4MDSA 4ISIH 2HVXA 3HGNA 1GJ9B 1SGEE 3A86A 2FOCA 1AHTH 1TE0A 1EP5A 2Z94A 5AVDA 1UW7A 1VJAU 1YP9A 2QA9E 1PYTC 1OWDA 3G01A 1PYTD 4BAHB 1HAVB 3T25A 4NA8A 1DE7H 4A5TS 3F2FA 1TIOA 2A0QB 1QJ1B 2D1JA 4FXGH 1EKBB 1GI5A 2J95A 1AKSA 1QRXA 1HDTH 3T2NA 4XBCA 1LVOA 2GV6A 1F5RA 2SGAA 4ABHA 1O5EH 4OS6A 5KGOA 4CH8B 1BBRK 1JMOH 4AFZA 1KLIH 3ZYDA 4DIHH 3M35A 4ZAEA 2ZPQA 2BVSH 7KMEH 4WY3A 1S82A 1D3DB 1AB9C 5ABWA 4NA7A 1TPOA 1QBNA 1GJ7B 3QWCH 5TCAA 2DE8A 2ZZUH 4CBNA 1NY22 2BX3A 1KY9A 3M37A 3SBKA 1AB9B 2QAAA 4GVUA 4IN1A 3D23A 1DSTA 1MAYA 2ZCHP 2F9BH 4WVPE 4Y7BA 2KFWA 3Q00A 1DXWA 1OWEA 1O5BB 1EOLA 4WXVA 3VG8A 1ZHMA 1DT2A 1EJMA 1LQEA 1C1OA 4GPGA 2PGBB 4YESB 3RC5A 3E0NB 3ATKA 3SO3A 3UOPA 1IQHA 1NS3A 4YOIA 2R2WU 1HYLA 1HIAA 1W7GH 1DDJA 1GHVH 2ZNKH 5AHGH 3GY4A 3B23B 1OP0A 2WPLS 4Y8ZA 3W95A 1COWD 2XXLA 1AD8H 1FNIA 4A7IB 4Q2KA 1MZAA 2AIQA 4IC6A 3RMMH 3BG4C 4D9RA 1EP6A 5CHAC 1V2WT 4NZQA 1CU1A 2BY7X 1P9SA 3BG4B 1HAYB 4FUCA 3F0PA 4X8UH 2XRCA 1L4DA 1MKWK 5C5OA 3EDXB 2WV4A 2A4QA 1NM6A 1P3EA 3UR9A 3QTVH 1RXPA 3LGVA 1O2OA 2ZGHA 1GCDA 3NK8A 2VIOA 2HNTC 5GNDA 1EB2A 3PRBA 3TGJE 3RXAA 1SQOA 1NBMD 1A5HA 1KXBA 1O2HA 5JBAS 1EZQA 1TGNA 1C1UH 5A0CA 3OEED 3BSQA 3FVFB 1C2DA 1UCYK 1QFKH 2ULLA 2NU0E 3SI4H 1HXFH 2WV9A 1YLNA 2BD4A 3ZZDA 3FANA 4ACBA 1C9PA 2WV5A 4AFUA 2CHAB 3H09A 1QL7A 2QY0B 3KYGA 2JH5D 4M7GA 2AERH 1FN8A 2BY8X 1TPAE 3A7XA 4F49A 5EGMA 3H5CB 2PSYA 4KTUA 2XC4A 2NU3E 3SUFA 4FUIA 1Z8RA 4A1VA 2HPQH 5FPYA 3KYFA 3E16B 3ZZ7A 2ASUB 1UTOA 2UWLA 4TY7A 2PUQH 2R0KA 1OYTH 4AGJA 5C17A 2QCYA 3GY3A 1LHCH 1UTMA 2G5NA 4INLA 2SFAA 1FDPA 1XUJA 4VGCC 5FCKA 1C2IA 1LHGH 1SMFE 3E91A 2P95A 1ARBA 2LPRA 2Z3DA 5T6DA 3RC4A 1UHBA 1SPJA 3SNEA 2OQ5A 5JBBS 1P2IA 3M7UA 3TVJB 1F0UA 2ILNA 1KXCA 2VWOA 3SOSA 4DVAU 2I6QA 1DVAH 2FOMB 3M3TA 4D76A 1GJ4H 3DSPA 1KLJH 2B5TB 1WXRA 2BQ6B 1C5YB 1FPHH 5FCRA 1MU8B 2BLOA 4ZH8A 2AMQA 2AS9A 3D65E 1QQ4A 4K69A 2VWMA 2WPDD 2F9UA 1HB0B 2CF9H 1IQEA 1ZYOA 3TK9A 3BTME 1VCWA 2IN2A 2Z7FE 2CK3D 2ZGJA 1CA0C 3BTFE 3A7WA 2BQWB 3OYPA 4XRNA 3HK6B 1A0HB 3UB0A 4INKA 3SU4A 1TGCA 1O3JA 2C93B 5K7RA 1CA0B 1ZSJA 3A7TA 2C8YB 2IPHA 2QC2A 4K8YA 3GY6A 1AFQB 2PR3A 1AWHB 5LPRA 1HJ9A 2BZ6H 2FOAA 4GSOA 1NFXA 5A2MH 1O3IA 4ABDA 4ZROA 5LGOA 4FUEA 1SGYE 2ZIQH 2ZGCA 3SGQE 3SQEE 1GMHG 1F7ZA 1J15A 2OBOA 5T1VA 1Z1IA 1K9OE 3BG8A 4A1XA 2BY5X 3OTPA 3KGPA 3ZZ3A 1J17T 4I31A 5FL7D 1FPCH 1P01A 2C8ZB 1ZHRA 3MOCA 1P02A 3E8LA 3RXMA 4JZ1A 4RSPA 6LPRA 5EJ1A 1BTUA 1JRTA 4AYYB 2HGTH 2A4GA 1QRZA 1EATA 3U8RH 5EPNA 5HIZA 3MNCA 3Q77A 1K21H 1JXPA 1NFUA 3RLYH 2HLCA 2GT8A 1QB6A 3BIVH 3S7HB 4GHQA 4B76A 1ORFA 5HXFA 1MKXK 1HCGA 2ZFRH 3BEIB 3GY5A 4FUDA 1J8AA 4PROA 1AU8A 3ZV9A 1V6DA 1AUJA 3PO1B 1C2GA 3PYHA 4FUFA 4ZXYH 4Y0YE 4A92A 3DD2H 1RTKA 4X1NU 1RD3B 1P9UA 3U1IB 4WJG2 3IITA 5GWZA 4I8GA 1OS8A 1GBLA 3RXCA 1EJAA 1SOZA 2BB4A 1EUFA 5A8YA 2Y80A 2UWPA 3DFLA 5T6GA 2ZTZA 2FTLE 2Y5FA 2G8TA 1AQ7A 3FOAA 1C5RA 4X1SU 3MYWA 4ABIA 2J98A 1GHYH 5E0HA 3F6UH 2P59A 4MQAA 1YBWA 5EU8A 3ZVCA 2Y7ZA 3OX7U 1HXEH 5FX5A 3A85A 2FWWA 2GZ8A 3K2UA 4ABGA 1A0LA 1LVBA 2XBVA 2STBE 3VB6A 1W7XH 2OXSA 3LT3A 2BD5A 1LQDB 2O8LA 3GYLB 3RP2A 3GISB 1B0EA 1NRRH 1Y3VA 4UDWH 1TRYA 5CMXH 2F9OA 1H9LB 1V2NT 3HATH 3MMGA 3S9BA 5G4BA 3NUMA 2SGPE 5JDUB 4UFEH 3V12A 1N8OB 4U30A 1HV7A 1M9UA 2A45B 2ZHQH 3CS0A 3FAOA 3SNDA 1GJDB 1THSH 1S81A 4B2CA 5C94A 1EZUC 4Q7ZA 7GCHF 3M7QA 3KQEA 3P8NA 1QY6A 1TABE 4ISLA 4SGAE 1EASA 5JBTA 1H8DH 5LPEA 1PQ8A 3TH2H 5EPYA 5C1XA 1AKSB 1C1RA 1EPTA 4BTTB 1T7CA 4O9VA 1TONA 1X7AC 4MNXA 1ACBE 1WUNH 3H7OA 1IQKA 4IBLH 2FM2A 5GPIB 1O3GA 3LGWA 1ZMLA 3OAAD 1Y3WA 3F9FA 3RM2H 2W7UA 1O2QA 1O5GH 2Z9KA 1O2TA 1C2KA 3BTWE 3SUEA 1KTSB 1OOKB 2WPHS 2XC5A 2ZO3H 1N6XA 4Y0ZE 1HAOH 2C90B 1O2LA 4SGBE 1TNKA 2ZCKP 2EC9H 4O3UA 4X6PA 4DT7B 3BF6H 3PMHB 5FBIA 2WPKS 3GY7A 4XBBA 4DT4A 2J97A 1P03A 1SQTA 2BDIA 1CQQA 1G3EA 1OSSA 1Y59T 2ZI2H 1KDQA 4K1SA 1CHOF 2RFKC 1GMDG 2Z9GA 1S0RA 1FY1A 1QNJA 1G37A 4LZ1H 1FQ3A 1RIWC 3A7YA 1D6WA 1V2MT 5ESBA 3V0XA 1W11U 3MH5A 1V2LT 1RTLA 4FU9A 1D3PB 1TX7A 3TNSA 4Q80A 1BTWA 4FUBA 1XMNB 3PV4A 1EQ9A 2K8IA 3BTEE 1SLXB 1G30B 1V2TT 2WPMS 3KIDU 1Z71A 3NZIA 4AZ2B 1TGTA 3MWIU 2PP6A 3ZZ8A 5C67A 3RXGA 1GMCF 1O37A 2BDBA 2V3MA 5ESTE 3RC6A 3TIUA 4CRAA 1THRH 2PV9B 2ANWA 3LU9B 1P06A 1BIOA 3RU4D 2ODQA 2KX4A 3QO6A 1NFWA 3E90B 3OU0A 2KAIA 9ESTA 3SU1A 1ID5H 5JB9S 3PTBA 1GCTB 1BTZA 1ZR0A 3TH3H 1T32A 1LPKB 1SHHB 4NFEA 1SLWB 3SU3A 1UTNA 1C5ZB 2I6SA 5E0JA 5HMAA 4IMZA 1QJ7B 2VIWA 4ACAA 2BDHA 1UTPA 3KEEA 1A61H 5T3HA 3D49H 4LXBH 4YO9A 1AE5A 4CRCA 1IOEA 4YZUA 1FY4A 1QR3E 2G4TA 3L6PA 2XBXA 4MLFB 2VINA 1MAXA 4B6EA 4OS7A 5DO4H 1B5GH 2B9LA 4ABBA 5EIYA 1PPHE 1Z6EA 3N7DA 3Q76A 2QGRA 3MO3A 2KR7A 1QA0A 1UTQA 3A88A 3TGIE 2GP9B 1Z6JH 1EAWA 1EOJA 3HPTB 4OS5A 1TA2A 1C2JA 2GCHG 1NC6A 3VB7A 2SGQE 1TBZH 2W7SA 1DFPA 3GCNA 4BAKB 1T4VH 3TJNA 1ELDE 4RT1A 4TPYA 1U6QA 4KELA 3M5OA 2VIQA 3LKWA 1UHBB 2EY4C 1THPB 1CBWC 1AFEH 1HRTH 2FOFA 1C5TA 3MU8A 3PMJA 4FUJA 4ZUHA 3LGTA 1K0HA 2J92A 4X8VH 3TH4H 1FX0B 3GYMA 2H5DA 3BTDE 4RKJB 2XTTB 3WWFA 2XOKD 1FIZA 3SNCA 2A7JA 3P70B 3S9CA 3VXFH 1DLEA 2ZWLH 3D62A 4Y8XA 1QBVH 3SJOA 1GDNA 3A7VA 5DP6A 1IQIA 2FS9A 4CRFA 1BT7A 2BM2A 4WF8A 4JCNA 2OC1A 3ELAH 2OP9A 1J14A 3VB5A 1LHEH 2ODPA 1BMAA 1QA7A 4GAWA 3RLWH 1LKBA 1N1LA 1O35A 2UUKB 1GJBB 1P2JA 2GT7A 1V2UT 1ZLRA 5EQRA 2OTVA 1W2KH 2QIQA 1O5FH 4OS2A 3PTNA 4R8TB 4YM9A 1O2VA 2ZDMA 1LHFH 3F9EA 4WXIA 3SJKA 3UR6A 6CHAC 1GVKB 2BDCA 1ABIH 1BMFD 3M5NA 2BLQA 1E1QD 3EA7A 4BAQB 2BDYA 1GI9B 1SKYE 4XOJA 2ZHEH 2QXHA 1DX5M 2V3OH 3ATLA 4CRBA 1K1PA 1ELCA 3WW7A 4KTSA 2ODYB 2WINI 5EJZA 5F8TA 2ZTYA 1YLCA 5A09A 1LPGB 3VB3A 2FX4A 1ELFA 3I78A 1W3CA 1DITH 2A5KA 5E2OA 4RI0A 1DY8A 4ABFA 2C3SA 1YKTA 1GI8B 4GCHF 4WMDA 1V3XA 2TGDA 2SGDE 2JDID 2LP6A 5DP7A 4F48B 2FDAA 4OGYA 2H9TH 1SOTA 5EG4A 1P2KA 4X1QU 3BEUA 3Q3KA 1TQ7B 1LO6A 4WMEA 5L2YH 5DSFA 3SV2H 3UPEA 2CV3A 1GBHA 4K3JA 2B8OH 4FU7A 3DSOA 4AFQA 4ZKRU 3UNRA 2JETB 1YPGH 3VXEH 3RXDA 2ZGXH 3U8TH 1QB1A 1J16A 1CT2E 2KCYA 2CMYA 4GLYA 1VKYA 1JIRA 1OHHD 2ZDKA 5A0AE 3BTQE 2AYWA 3FZDA 2RDEA 3FFGA 3LOXA 2A32A 3HGPA 3PWCA 1GHAF 1D4PB 3TPIZ 8KME2 5H4IB 1AVWA 1PPGE 3BEFB 1DSUA 1DXPA 1EZSC 2XYAA 3FP6E 3M3VA 3RMOH 1ETSH 1DWEH 1S6LA 1XXFA 3RUOA 3A84A 4AN7A 3H7TA 4JYTA 4TYDA 1G2MA 3EQ0H 1YGCH 2WYJA 1KXAA 2OK5A 5FAHA 1DANH 1GI6A 3LGYA 4NIWA 4ASHA 8ESTE 2QF0A 4IN2A 3A87A 1C1QA 4X6MA 5DPAA 2ZKSA 2J5UA 1L4ZA 3AAVA 1UVSH 4Y71A 1S6FA 3SV7A 1OWKA 5CE1A 3MNSA 1KXEA 2ZU4A 1HUTH 3LJJA 2BTCE 4NA9H 2A4RA 3RXJA 1GBJA 5FXLA 2BDAA 3LGUA 1SGIB 5BPEA 1ZPCA 1C1NA 1KXFA 3F0OA 3Q3YA 4M9FA 1CHGA 1EPTB 1SGFG 2QE7D 1QGFA 1AZ8A 1AIXH 3E3TA 2ZHFH 2EI8A 1YPHE 2W6ID 1TRNA 1BOQA 1O5DH 4OS4A 1GBEA 1Y3YA 1PQ7A 1V2VT 3SI3H 5A8ZA 5L2ZH 2K0QA 1L2EA 1NRQH 4J1YA 5J4QA 1H4WA 3BV9B 1BDAA 4MTBA 2OCVB 3MHWU 2BD3A 4LOYH 3ZZ9A 3BIUH 3UFAA 4CRGA 5F6MA 1BUIA 1P09A 4BAOB 3VB4A 5C3NA 1C5QA 1RTFB 1Z8JB 4JYUH 1O3FA 1FAKH 3VGCC 5JYIA 3QZRA 3KF2A 5A8XA 1W0ZU 1KYNA 2PFEA 1O3KA 5EXMA 2NU2E 3VGCB 2BY6X 3A8CA 1IQJA 2ZU5A 1BQYA 2ZC9H 3LC5A 1O3AA 2YNBA 2PTCE 1C2LA 3FZZA 3PV2A 1TMTH 3LIWA 1MTSA 2WPJS 1INCA 1YY3A 2CGAA 2D26C 2TGAA 6ESTA 5L30H 2V0BA 2CHAC 1T8LA 2HVYB 1OWIA 8LPRA 3HK3B 4CR9A 1JRSA 1YC0A 4I32A 2PKSC 3S9AA 2P16A 5DJ7A 2Y6TA 5DP3A 5EXNA 4BXSA 3TJOA 2PKSB 4X2VA 1O3LA 1W0JD 2GTBA 5JPMH 1SGNE 1NRPH 4YT6H 1BMNH 1O2JA 2V35A 2ZU2A 1SB1H 1UO6A 2NU1E 4RKOB 3E6PH 1OWHA 5EW2H 2VGCC 4Y79A 1AUTC 1FY5A 3PLBA 1KTTB 3LC3A 3L3TA 2VGCB 3URCA 4FUGA 3VPKA 3SV9A 1PPZA 1P3CA 2FPZA 3V7TA 2VVUA 4NCYA 2M2AA 1C5OH 1TA6A 4DOQA 1FXYA 3RXEA 3WY8A 1HGTH 2HOBA 2ZP0H 1SR5C 1AO5A 2ANYA 4B71A 1DICA 2ZEBA 1NFYA 3LGIA 2XW9A 1UVPA 5C2ZA 3P8GA 2ZDNA 4CHAC 3PWBA 2BOHB 2XWBI 2Y7XA 1VCQA 3MU1A 3SU6A 4IGDA 3O8DA 1S6HA 4CHAB 2KCOA 1Q3XA 1ELBA 1MTUA 4I33A 2J9NA 2R3YA 4XFQA 3MNBA 5DP8A 1W13U 4X1RU 1ZHPA 2B7DH 3SW2B 2AMPA 1NT1A 2L74A 3MI4A 4YT7H 1ESTA 2FZZA 1LHDH 1TOCB 1AFQC 3QZQA 3NXPA 5FBEA 5FX6A 1T8MA 2JJ2D 4NSYA 1ZGVA 4I8KA 3M7TA 4UE7H 5DP9A 1BJUA 2Y82A 3N7EA 1P11E 1YYY1 4RN6A 3GOVB 2P3UB 5DK1A 1GHBF 2BVXH 1F0TA 4FOUC 1CO7E 4Y7AA 5GDSH 2ZHDA 1NRNH 1ZSKA 4JZDH 1GJ6A 1BRAA 2JH6D 4AOQA 3ZZ5A 1WTHD 2HLDD 2GCTB 3OSYA 1IHTH 1RRKA 1SQAA 1QHRB 1C5LH 1E38B 1C4U2 2ANKH 3UUZA 4YTAA 3T27A 5F8XA 3JZ1B 1TNGA 4WMFA 1O2UA 5HYOA 5FPSA 4I8HA 3VEQB 1HAHH 4BTIB 3ATWA 4JK5A 1H8HD 1DS2E 2A1DB 1JBUH 2FEQH 2YMSD 4HFPB 2WUCA 2HNTE 1C4V2 1Z8IB 3PO1C 2YMSB 3GCOA 1OP8A 4CR5A 2XBYA 2XNIA 4X8TH 1A3BH 1TNIA 1E36B 3UTUH 2BXUH 2O8MA 2QF4A 3GDVA 2P8OB 3K65B 2JIZD 2O9QA 4ZMAH 1VITH 1K1NA 2AGIX 4Z1MD 5F03A 1O2ZA 1GBIA 4H42U 7GCHG 4DCDA 2W26A 5DG6A 1AVXA 1AWFH 5AF9H 1YPLH 1C5XB 4BTUB 4H6SB 1GMHF 4U32A 3P92A 4K5ZA 2G52A 1P57B 1D9IA 1EX3A 1L0ZA 3RXKA 4BAMB 3N7OA 3FO8D 1S85A 3TJUA 2F3CE 2CN0H 3A8BA 2OUAA 1TMBH 1ZRBA 4UD9H 1LKAA 1BTHH 1N8OC 2WYGA 5C0UA 1IQNA 3SU5A 1KXDA 5HM9A 1FMGA 4AX9H 1TPPA 1FI8A 1MKXH 1PQ5A 2F9NA 2PGQB 3NRLA 1DUAA 2ALPA 4FU8A 2FMJA 3IWMA 1CHOG 1GJ5H 3FKSD 1XKAC 2R2MB 3P8OA 1PFXC 3LONA 5A0BA 2C8XB 3UQVA 3E1XB 3BTHE 1ETRH 1YPJH 1MMJN 3CP7A 3PMAB 4NSVA 3SHAH 1RS0A 4NFFA 1HFDA 1EAXA 3OFND 4THNH 3BTTE 3GY8A 4A1TA 2VWNA 3TK5A 1IQFA 2ESTE 2G5VA 4CH2B 1GI4A 1XUFA 4ZHLU 3GS9A 3TK6A 1QURH 4ISOA 3UWIA 1T8OA 1GMCG 1UTLM 4B1TA 2HPPH 1XUIA 1SGQE 2PHBA 4H6TA 1EXFA 3PM3A 1F0SA 1O2KA 3LPRA 1O5CB 4Y6DA 1C1SA 1W0KD 2ZA5A 4FVBA 3RXSA 4AG1A 3K9XB 3MU4A 1AI8H 4ISNA 1O3NA 3GY2A 1TPSA 3T62A 2ZDLA 1QBOA 1MTNB 1C2MA 3RMLH 1GI2A 3SGAE 4P02A 1O2MA 1TX8A 1HIAB 1E1RD 3LJOA 5E2PA 2BQ7B 3I77A 3RXLA 2A2QH 4X6OA 1AN1E 3NCLA 1DUEA 2ZF0H 1ESAA 2OINA 1FZZA 3Q3XA 2GZ7A 1RFNA 3ZVDA 2C8WB 1GBAA 5EXLA 2VBCA 1SGCA 3QGNB 5GXPA 1P0SH 1O3MA 2BD7A 2EA3A 1TOMH 1NESE 3N99A 1O2PA 2FIRH 1TGBA 2HRVA 1GCTC 1W14U 1E34B 6GCHF 1H8IH 1OX1A 1WBGB 2YOLA 1ELTA 2VIVA 1VITF 4CREA 1Z1JA 2BOKA 3GCTF 2BVRH 4KP0A 3MNXA 4DY7B 1O38A 1UVOA 2HALA 2SGEE 4FUHA 1WU1A 1CGIE 3RXUA 2Z3CA 4Y8YA 4I8LA 2BYAX 1FONA 5T6FA 2A7CA 1O34A 4I8JA 3T29A 2V7QD 2Q6DA 2FOBA 3CNRA 3SJIA 2UUFB 1RJXB 2ZQ1A 2D8WA 2VVCA 1W8BH 3M5MA 2C4FH 5C0TA 1YWUA 3P8FA 4DURA 1F0RA 2A31A 1UK3A 3ZVEA 1XX9A 1CA8B 5FHTA 2GJGA 1GVZA 1QTFA 2KZ4A 3A89A 2STAE 4D7GA 2HNTF 1ELVA 1O2YA 3BN9A 3EYDA 5KECA 4DW2U 1SFIA 1N6YA 4YLQH 2G4UA 3SUGA 2Y81A 4B74A 1QJ6B 2F83A 4B75A 1O3DA 1VJ9U 1H8ED 4AFSA 1ANCA 2TBSA 4K1TA 2QXJA 1FUJA 2TIOA 5HGGA 3ZVAA 1BHXF 1BITA 1GGDB 2PW8H 4O97A 3IG6B 1G3BA 3QX5H 1YCPM 4UFDH 1ZSLA 1PPCE 4CRDA 3OY6U 1O3EA 2QYIA 1GHWH 2DE9A 1AMHA 1GBTA 1AGJA 3I29A 1O2GH 1Q31A 1ZPBA 4Y10E 1O36A 1FLEE 3UQOA 5F53A 1NO9H 2XNDD 1TX6A 3QLPH 4E7NA 1FY3A 4TWWA 5HM2A 2A5IA 4WH6A 1GBBA 1GDQA 1C5PA 1O2RA 3QGJA 1ELGA 5GCHF 2RG3A 3T28A 2Z9JA 1SC8U 4U2WA 1FY8E 3GCHB 2ZQ2A 3KQ5A 1ESBA 2NWNA 4ASUD 3SNAA 1V2QT 3ZZ4A 1ZTJA 4GCHG 1KIGH
chains in the Genus database with same CATH topology
1DOJA 1YPMH 2RA3A 3EA8A 3M36A 1ZTKA 1BRBE 3RXTA 4D7FA 4IMQA 8GCHF 3O8RA 3SORA 5EOKA 3SZNA 2BLVA 2P3FH 3HKJB 2GCHF 3PB1E 4Y11E 3P6ZB 2F9VA 2AH4X 3U69H 5C1YA 1UTKA 4Z0KA 1O3CA 3ITIA 1NRSH 3DT0H 3A80A 2A7HA 4XSKU 1O2NA 5C1UA 3TJVA 4FVDA 2V3HH 1BCUH 3KL6A 2FYQA 1O30A 1ZOMA 4NIVA 3MTYA 1GPZA 2P93A 1WV7H 1P2MA 1Z7KA 1G3CA 1HJ8A 1EAIA 4X0WU 1HJAB 3C27B 2J38A 1XUHA 2F9PA 2Y5HA 1XVOA 1HAPH 4ISHH 3FP8E 5C5NA 1O3PB 1GDUA 2FS8A 1IHSH 4DG4A 1ZTLA 4AG2A 1FIWA 2GD4B 2JETC 2PTNA 4JMYA 2PWXA 4Q7YA 3C1KA 1TGSZ 1A1RA 1YCPH 4YOJA 1DM4B 2VWLA 2HWLB 1V2PT 1GBCA 3U98H 1K1LA 2FYRA 1AE8H 4HTCH 1BBRE 4AGKA 1C2FA 5B6OA 2R3UA 5I25A 3SUDA 1UJ1A 3DFJA 2BZAA 1ZGIA 1C2EA 2BY9X 5FPTA 1ELEE 1YLDA 2BXTH 2EI6A 1ZZZA 3BTKE 1MUEB 5K0HA 1BTYA 2XCNA 4INHA 1TAWA 1TYNA 1PPBH 1V2RT 2FP7B 1J9CH 2AFQB 1UVUH 5ETXA 2XBWA 1H1BA 1HAZB 2FO9A 1XXDA 3NPSA 2TGPZ 1SL3A 2ANMH 1H9HE 4NWKA 1ELAA 5I46H 1A3EH 1EPTC 3BTGE 1OPHB 4MNVA 1YPKH 4K1EA 1GJAB 1A7SA 2QV1A 3CS7A 1EB1H 3R0FA 3K6YA 2J4IA 3DHKH 4MNYA 2VU8E 1SGFA 2Y5GA 3SU0A 1BMLA 4JZFH 3TGKE 3V3MA 2B0FA 2ZHWH 3L33A 2GX4A 2FTMA 1BA8B 5DGJA 1BBRH 1C1PA 1IAUA 1LTOA 3ESTA 1CE5A 2OC8A 3UREA 1WCZA 1Q2WA 5EQQA 2CXVA 2Q6GA 4ABEA 1C5MD 3ODFA 2VVVA 4B2BA 2ZPSA 2P3TB 3A7ZA 3DUXH 5AFZH 4F4OC 2GMTC 1K1MA 2BX4A 1DWCH 4BXWA 1QIXB 2BD2A 2GMTB 4K2YA 3QK1A 1LPZB 3QTOH 1Y3UA 2H9HA 1ANDA 1MD7A 1A2CH 1WYKA 1KDQB 5EQSA 3RXPA 4MNWA 2AEIH 3EE0B 3FP7E 1SLVB 1MBQA 1HLTH 4B2AA 5CHAB 3GDUA 1G9IE 5E8EH 3MH7A 1W12U 4XDEA 5TCCA 3ZVFA 4DGJA 3S0NA 4AYVB 1SG8B 2XWAA 4XE4A 1P2OA 1AZZA 1UCYE 1MTWA 1GL0E 1QCPA 1Y5AT 1C4Y2 3PMBB 1IQGA 1E37B 2LNCA 1C1WH 1IQLA 1P8VC 2BMGB 1FN6A 3TLOA 3LH1A 5JB8S 2WUBA 2A4OA 2OQUA 1F5LA 3MO9A 1LMWB 4IC5A 3URDA 5DP4A 1O2WA 7LPRA 2NU4E 1O32A 3GDSA 5L6NH 1JOUB 1GJCB 1MKWH 1QL8A 1AVGH 1BHXB 4O03A 2VIDA 1WQVH 2KAIB 3PROA 1K22H 1YPEH 1A5GH 2GDEH 1JWTA 2A5AA 3AW1A 2H1UA 4MPXA 3RXVA 3RU4T 1KLTA 4K8BA 4OGXA 1DPOA 3A8DA 1PJPA 1TNHA 1UK4A 3ZVGA 1BZXE 3RMNH 2EI7A 2RCEA 1HPGA 4JK6A 1O2XA 1GHBG 1FJSA 1UCYH 4TPIZ 1SLUB 2AGEX 5SGAE 1G32B 2FLRH 3ZZCA 1GHXH 2PKAA 3O8BA 4VGCB 2G55A 1ETTH 1SBWA 3KHVA 4U01A 1PPFE 3OTJE 4NG9H 4LZ4B 5DKMA 1V2ST 5BRRE 3RXIA 1UK2A 1FV9A 4X2WA 3U9AH 3RXFA 2ZG0H 3PLKA 3LDXH 1PPEE 1XVMA 1SI5H 2ALVA 1XUGA 2ZFSA 5PTPA 3F9HA 1S5SA 5GJ4B 2GZ9A 2Z9LA 1XM1A 1SGRE 3M3SA 2IJOB 3S7KB 3M5LA 4X6NA 1BTPA 2SGFE 2UUJB 2H2ZA 1Y5UT 4X8SH 2GDDA 1MCTA 1KSNA 2D2DA 4UFGH 1O3HA 1CT0E 1Y3XA 1BRUP 1DWBH 2G51A 3TNTA 4ABAA 1F2SE 2GCTC 3F68H 3T26A 4AB9A 1GG6C 4BNRA 3A82A 3KCGH 1ZJKA 3AASA 1TBRH 3RM0H 2O8TA 4ZHMU 1GG6B 1ANBA 2XCFA 2M5TA 1V2OT 2IOTA 2Z6BD 1QB9A 1SGDE 3P95A 1P2QA 3R3GB 1P05A 2R9PA 2SNWA 3KNXA 1C1MA 4WWYA 3KQCA 1MTVA 4LK4A 4I7YH 3GICB 1C5SA 1MCVA 2H6MA 4DJZB 1RGQA 2P8OC 1Y8TA 1XUKA 1O31A 3ZZ6A 2FOHA 2FLBH 1GBFA 1CSOE 1HAIH 5J4SA 1P04A 1TBQH 1BJVA 1EZXC 1L1JA 1O2SA 3A8AA 2CJIA 3JZ2B 1O33A 1P12E 1FAXA 1QRWA 4NIXA 3U8OH 3ZZAA 1D3QB 1TFXA 1EJNA 1TLDA 2TPIZ 2BDGA 3U1JB 2ZFPH 3DA9B 1UMAH 1SVPA 1ABJH 1GI3A 1C1VH 1K1OA 1W10U 3UOUA 1HAVA 4NIYA 1MQ5A 1F92A 5DP5A 1S83A 1IQMA 2J34A 2FODA 2ZU3A 2P94A 1AY6H 4ZKOU 1TALA 1NROH 2QXIA 3AW0A 1P10A 1G2LA 1OYQA 1WQSA 1CT4E 2ZDAH 4HI3A 4UEHH 4ZXXH 1D3TB 1C5NH 1XKBC 2FOGA 1O5AB 1MBMA 1CVWH 3M61U 5E0GA 5EODA 1NU7B 2FI5E 2Q6FA 3ZVBA 1C5VA 3RDZA 2R0LA 3ENSB 4X2XA 1C5WB 3MH4A 4IS5A 3A83A 4J2YB 4MPVA 3ZZBA 2FX6A 1T8NA 2EEKA 2ZECA 4KTCA 4ZKSU 3SJ8A 2H9EH 1B0FA 1L1GA 2F91A 1NPMA 2OLGA 2THFB 2OC7A 3SHCH 1TRMA 2OC0A 1MH0A 2XC0A 3SN8A 7ESTE 1WTGH 1TWXB 2Q1JA 1YF4A 4A6LA 2J94A 3E0PB 1NTPA 1QQUA 2OBQA 3QDZB 1GBMA 3SV6A 2TRMA 2FI4E 3K6ZA 3EAJA 3RXRA 1A0JA 1BB0B 1T31A 1JIMA 3RXHA 2J2UA 1O2IA 1GWAA 3W94A 4CBOA 1HNEE 1ZMJA 3ZYEA 2FOEA 4NZLA 2Z3EA 2PUXB 1BMMH 2ZFQH 2DUCA 3SGBE 2G81E 1GL1A 2PLXA 2VB0A 1TB6H 4KGAA 1SGPE 1D6RA 1TNLA 3T5FH 2CF8H 6GCHG 1MTNC 2W3IA 1HBTH 4H4FA 4UONA 1VITG 3ATIA 3LH3A 3GCTG 1DY9A 4B73A 3ODDA 1HAGE 1W0YH 1GI0A 3SU2A 3UWJH 4IW4E 4YOGA 5IYTA 1MU6B 3UY9A 2ZDVH 1WAYB 3F1SB 1RIWB 1VCPA 2QN5T 2ZCLP 3TU7H 2V6NA 1P2NA 4NGAH 2A2XH 1S0QA 4R0IA 2Z9IA 1YM0A 1TNJA 4TWYA 2GGVB 3V13A 3ZV8A 2QF3A 5AFYH 2WPIS 5F8ZA 1C2HA 1O39A 1VZQH 3TITA 1E35B 1NZQH 5JBCS 2O8WA 4AB8A 1NN6A 3O8CA 2AGGX 2GVFA 3P17H 1OP2A 2BLWA 4TY6A 3CENA 4MPWA 1SFQB 2RDLA 1C9TA 1H9IE 1CGJE 2TGTA 1GMDF 1B7XB 1UTJA 4K60A 1GI7B 1OKXA 3UNSA 4MVNA 1C1TA 1K28D 1Y5BT 1QL9A 2O8UA 2W5EA 3MO6A 4E05H 1T4UH 4MG3A 4YLUA 2GV7A 4MPUA 1DWDH 1OWJA 4AORA 3SNBA 3VFEA 3UIRA 4GHTA 5GCHG 4X1PU 2UWOA 4E06H 2ZFFH 2AIPA 1E0FD 4D9QA 2VJ1A 3STIA 4JYVH 2VIPA 1SSXA 3A81A 1O0DH 3OY5U 1S84A 1Z8GA 4UFFH 1GGDC 2ZU1A 1C5UA 3MU0A 1LDTT 4Q7XA 8GCHG 1SGTA 3F9GA 4GUXA 1ZMNA 2QXGA 4DIIH 2W3KA 2ZGBH 1VR1H 1ARCA 2ZTXA 2BD8A 2OD3B 4KKDA 2VNTA 1ZJDA 1A46H 3SJ9A 3KN2A 4JZIA 2PKAB 4ZKNU 3HKIB 4E7RG 5EW1H 1O3BA 4QT8C 3GCHC 2G00A 1GVLA 1LVMA 4WH8A 1MZDA 3RXOA 1V2JT 9LPRA 1ANEA 1LCYA 3QUMP 1CBWB 1EAUA 4Z6AH 2JKHA 1MD8A 5TJXA 1K2I1 3NKKA 1GI1A 2ZPRA 3NWUA 3AVZA 1CGHA 3SV8A 3QN7A 1DLKB 3KQDA 1UVTH 1V2KT 1YPHC 1VGCC 1A5IA 2VH6A 1GBKA 5IDKA 1A4WH 1ZPZA 2GKVE 1F5KU 2BD9A 1VGCB 3MH6A 4D8NA 4JZEH 1PQAA 2SNVA 3PLPA 2FXRA 2FI3E 3MFJA 3RXBA 2K1QA 1L1NA 2VH0A 3EA9A 1WOFA 4O3TA 1G3DA 2YNAA 5LH8A 1ZRKA 1BRCE 5C20A 1G36A 1GBDA 1GJ8B 1NU9A 1O3OA 3B8JA 4Y76A 1GHZA 3MU5A 1WSSH 1TQ0B 4OS1A 3B9FH 5LPFA 3ATMA 3RXQA 1TMUH 1SHYA 1BTXA 2BHGA 4NWLA 1GHAG 1MQ6A 1YCPK 1K1IA 4XBDA 4BOHA 1HJAC 3RU4E 6CHAB 4ZHAA 1K1JA 2RA0A 1HAXB 2H5CA 3EGKH 3SQHE 2PSXA 3STJA 4X2YA 3KQBA 1LVYA 2ZFTA 4ABJA 2JH0D 4ESTE 3UNQA 2AMDA 2FESH 4HGCA 4BANB 2UUYA 1OXGA 3AAUA 4HZHA 5GIBA 3S69A 4MDSA 4ISIH 2HVXA 3HGNA 1GJ9B 1SGEE 3A86A 2FOCA 1AHTH 1TE0A 1EP5A 2Z94A 5AVDA 1VJAU 1YP9A 2QA9E 1PYTC 1OWDA 3G01A 1PYTD 4BAHB 1HAVB 3T25A 4NA8A 1DE7H 4A5TS 1TIOA 2A0QB 1QJ1B 2D1JA 4FXGH 1EKBB 1GI5A 1AKSA 2J95A 1QRXA 1HDTH 3T2NA 4XBCA 1LVOA 2GV6A 1F5RA 2SGAA 4ABHA 1O5EH 4OS6A 4CH8B 1BBRK 1JMOH 4AFZA 1KLIH 3ZYDA 4DIHH 3M35A 4ZAEA 2ZPQA 2BVSH 7KMEH 4WY3A 1S82A 1D3DB 1AB9C 5ABWA 4NA7A 1TPOA 1QBNA 1GJ7B 3QWCH 5TCAA 2DE8A 2ZZUH 4CBNA 1NY22 2BX3A 1KY9A 3M37A 3SBKA 1AB9B 2QAAA 4GVUA 4IN1A 3D23A 1DSTA 1MAYA 2ZCHP 2F9BH 4WVPE 4Y7BA 3Q00A 1DXWA 1OWEA 1O5BB 1EOLA 4WXVA 1ZHMA 1DT2A 1EJMA 1LQEA 1C1OA 4GPGA 2PGBB 4YESB 3RC5A 3E0NB 3ATKA 3SO3A 3UOPA 1IQHA 1NS3A 4YOIA 2R2WU 1HYLA 1HIAA 1W7GH 1DDJA 1GHVH 2ZNKH 5AHGH 3GY4A 3B23B 1OP0A 2WPLS 4Y8ZA 3W95A 2XXLA 1AD8H 1FNIA 4A7IB 4Q2KA 1MZAA 2AIQA 4IC6A 3RMMH 3BG4C 4D9RA 1EP6A 5CHAC 1V2WT 4NZQA 1CU1A 2BY7X 1P9SA 3BG4B 1HAYB 4FUCA 4X8UH 2XRCA 1L4DA 1MKWK 5C5OA 3EDXB 2WV4A 2A4QA 1NM6A 1P3EA 3UR9A 3QTVH 1RXPA 3LGVA 1O2OA 2ZGHA 1GCDA 3NK8A 2VIOA 2HNTC 1EB2A 3TGJE 3RXAA 1SQOA 1O2HA 1A5HA 1KXBA 5JBAS 1EZQA 1TGNA 1C1UH 5A0CA 3BSQA 3FVFB 1C2DA 1UCYK 1QFKH 2ULLA 2NU0E 3SI4H 1HXFH 2BD4A 3ZZDA 3FANA 1C9PA 2WV5A 4AFUA 2CHAB 1QL7A 2QY0B 2JH5D 4M7GA 2AERH 1FN8A 2BY8X 1TPAE 3A7XA 4F49A 5EGMA 3H5CB 2PSYA 4KTUA 2XC4A 2NU3E 3SUFA 4FUIA 1Z8RA 4A1VA 2HPQH 5FPYA 3E16B 3ZZ7A 2ASUB 1UTOA 2UWLA 4TY7A 2PUQH 2R0KA 1OYTH 4AGJA 2QCYA 3GY3A 1LHCH 1UTMA 2G5NA 4INLA 2SFAA 1FDPA 1XUJA 4VGCC 5FCKA 1C2IA 1LHGH 1SMFE 3E91A 2P95A 1ARBA 2LPRA 2Z3DA 5T6DA 3RC4A 1UHBA 1SPJA 3SNEA 2OQ5A 5JBBS 1P2IA 3M7UA 3TVJB 1F0UA 2ILNA 1KXCA 2VWOA 3SOSA 4DVAU 2I6QA 1DVAH 2FOMB 3M3TA 4D76A 1GJ4H 1KLJH 2B5TB 2BQ6B 1C5YB 1FPHH 5FCRA 1MU8B 2BLOA 4ZH8A 2AMQA 2AS9A 3D65E 1QQ4A 4K69A 2VWMA 2F9UA 1HB0B 2CF9H 1IQEA 1ZYOA 3TK9A 3BTME 1VCWA 2IN2A 2Z7FE 2ZGJA 1CA0C 3BTFE 3A7WA 2BQWB 3OYPA 3HK6B 1A0HB 4INKA 3SU4A 1TGCA 1O3JA 2C93B 5K7RA 1CA0B 1ZSJA 3A7TA 2C8YB 2IPHA 2QC2A 4K8YA 3GY6A 1AFQB 2PR3A 1AWHB 5LPRA 1HJ9A 2BZ6H 2FOAA 4GSOA 1NFXA 5A2MH 1O3IA 4ABDA 4ZROA 5LGOA 4FUEA 1SGYE 2ZIQH 2ZGCA 3SGQE 3SQEE 1GMHG 1F7ZA 2OBOA 1J15A 1Z1IA 1K9OE 3BG8A 4A1XA 2BY5X 3KGPA 3ZZ3A 1J17T 4I31A 1FPCH 1P01A 2C8ZB 1ZHRA 3MOCA 1P02A 3E8LA 3RXMA 4JZ1A 4RSPA 6LPRA 1BTUA 1JRTA 4AYYB 2HGTH 2A4GA 1QRZA 1EATA 3U8RH 5EPNA 3MNCA 3Q77A 1K21H 1JXPA 1NFUA 3RLYH