1J17T

Factor xa specific inhibitor in complex with rat trypsin mutant x99/175/190rt
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRETYNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASSSFIITDNMVCVGFLEGGKDACQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin II, anionic
publication title Reconstructing the Binding Site of Factor Xa in Trypsin Reveals Ligand-induced Structural Plasticity
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 49
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j17T01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1j17T02
3U1IB 3BF6H 2WPHS 3M5MA 3ZYEA 3T2NA 3E90B 1LCYA 2ZI2H 4MDSA 3A81A 3QTVH 1C5YB 5HGGA 5A09A 1NO9H 2WPMS 1QB9A 1S82A 1GL0E 1GHBF 2TGTA 1AD8H 3SV9A 1C5XB 1LMWB 5EPYA 4A1TA 4KKDA 1AO5A 1VITG 2QY0B 3RXFA 2XCFA 3SW2B 4CR9A 1AZZA 3TGKE 1OP8A 1NS3A 3ATMA 1CBWC 3LH3A 3O8BA 3ZZBA 1TA6A 1RFNA 2AIPA 1C5UA 1N6YA 1WV7H 5DO4H 2BY7X 2BQ6B 3O8DA 2AIQA 4E7NA 3GY8A 1C5TA 2O8UA 2J9NA 4NIYA 3SZNA 1X7AC 5FXLA 1DFPA 1BDAA 1O3KA 3ENSB 1HCGA 3N7OA 1G37A 3MO9A 1FMGA 2ZZUH 4H4FA 1DICA 5JBCS 2BXUH 1EX3A 3OTJE 4UFFH 4PROA 3LJOA 3CENA 1FY8E 3EGKH 3RXHA 4MVNA 4ABAA 1TGTA 1FY4A 1CA8B 1GJ4H 2FI3E 2WPJS 1MH0A 1P01A 1GI2A 2JETC 1O2LA 1A46H 1WBGB 1QTFA 1E34B 2AGIX 3B8JA 4Y8XA 5K7RA 3S9BA 2BYAX 3EA9A 2QYIA 1C5WB 1K1NA 2ZPRA 1JXPA 1HAYB 1WUNH 3PM3A 1FLEE 1ZOMA 3RXOA 5E2PA 2I6SA 4NA8A 1GI0A 1BRCE 4Y76A 1A5GH 1PPGE 2Z3DA 2OQ5A 3GCOA 1B0FA 2VGCC 3PLBA 1ZLRA 3NZIA 3RXIA 3BTWE 1C2EA 1SC8U 4YOGA 3F9GA 1FJSA 2OINA 4HI3A 1QGFA 4XSKU 1HAGE 1XMNB 2ILNA 1W7GH 2ZA5A 5FBIA 3KGPA 3MO3A 3FP7E 3ZZDA 3BTQE 2BVRH 3URDA 1Q2WA 3PTNA 3V7TA 1F0RA 1ESAA 4ZHAA 5DK1A 3KL6A 3M7TA 3SI4H 1KY9A 3SGAE 2W7UA 1PPCE 3UTUH 3BG4B 2ODYB 2VIWA 3M3SA 3TVJB 1QA7A 2HWLB 3M37A 4ISLA 2ZC9H 2GMTB 1GMHG 2GT8A 1TFXA 2ZFTA 2Y5GA 3GDVA 1GCTB 4NG9H 2A7HA 1O2ZA 2VVUA 1GMDG 1AB9B 1Z71A 3GCTG 4ZH8A 1RS0A 1LHEH 2G4UA 1QR3E 2CMYA 5PTPA 1Y3UA 1C1MA 3SV2H 3W95A 1DXWA 1G36A 2BMGB 4ZHLU 1V2VT 1C5SA 3A7ZA 4IC6A 1GG6B 1Z7KA 3EA7A 4BAHB 5BPEA 2AFQB 5JB8S 1EOLA 5GCHG 1EP5A 1O5BB 3U98H 2ULLA 1DPOA 3A8DA 1ZHMA 2CV3A 3QZRA 5DPAA 2XWAA 4WF8A 1MBMA 1VGCC 2EEKA 1P8VC 1GJAB 1DT2A 1OKXA 1T8OA 2OXSA 3PWCA 5C5NA 1IQFA 1KSNA 4XBDA 1AFQC 1HAXB 1TQ7B 2P3TB 1Y5UT 4Y8YA 1HJAB 2NWNA 1KTSB 5A2MH 3H5CB 2BD4A 4AN7A 4K60A 3GCNA 4HTCH 1TGNA 4JZ1A 2A2XH 1W0ZU 6LPRA 3HK6B 2XNIA 5C2ZA 1TGSZ 4CRGA 1C2FA 4Y0YE 4XOJA 1IQKA 1P2MA 3SJ8A 5L6NH 4LZ1H 1K1MA 1K9OE 1QBVH 3V13A 1O3BA 4UDWH 1VZQH 3P17H 6ESTA 4DURA 4X8UH 1TAWA 1EASA 1DXPA 1VCWA 1FQ3A 1EAXA 1NT1A 2R2MB 1UHBB 1ZYOA 4K1SA 1NTPA 4U30A 2FOHA 1CT4E 1MZDA 1G9IE 4BOHA 3LIWA 4FU9A 2Z7FE 1RXPA 1ZRKA 3KNXA 4OS4A 2ZFFH 2XW9A 1GI6A 3K6YA 5ETXA 2GDDA 2YNBA 2WYGA 5JB9S 1NY22 1AFEH 5FCKA 1NFWA 1AIXH 2D8WA 2W3KA 4TY7A 1C1VH 4ZMAH 1FXYA 1C9TA 3VB5A 2AMPA 2BY6X 1OSSA 2HVXA 3SV7A 1TRNA 2D1JA 5GPIB 3LGUA 3TH4H 1SLVB 2BLQA 4AB9A 3HKJB 5JDUB 1KYNA 3S0NA 1AZ8A 1C5MD 1C5QA 2O8WA 4MNYA 3C1KA 4INLA 4A1VA 2G81E 3M5OA 5EU8A 1S6FA 1A0LA 3HPTB 2GMTC 1CU1A 1LKBA 3ZZAA 1YKTA 1INCA 1H9HE 1ZRBA 1O2NA 1JRTA 1TX7A 2BQWB 1AB9C 2FWWA 3A89A 3U8OH 1K1LA 4DOQA 3SNDA 1T8LA 3UWJH 3SNBA 4LZ4B 4B2AA 3PTBA 1O5FH 3RM0H 7ESTE 1THRH 2VVCA 4FU7A 3KN2A 4HZHA 2Y5HA 2SNVA 2ZQ1A 1ELFA 1G2MA 1NESE 5A0CA 1SGCA 4JZFH 3I78A 3F68H 4AFSA 1HAIH 4FUFA 2PLXA 1HAVB 2PW8H 1G3EA 1BT7A 4R0IA 5H4IB 4D7GA 3SU3A 4MQAA 3QTOH 3RXAA 2EA3A 4RKJB 1EZXC 1N6XA 1TLDA 3LDXH 1TYNA 1HJAC 3GY3A 2BY5X 2FEQH 1UCYK 4MPVA 1L1GA 4B71A 2PTNA 1ZSJA 4AFQA 1GHBG 2F83A 4NFFA 1C5VA 3RXEA 2J38A 1L4DA 2ZWLH 5A8YA 1W14U 4Y71A 2K1QA 4JYUH 3RC4A 4K2YA 1TOMH 2A4RA 1SGNE 1O39A 1VCPA 2J34A 1K28D 1NRPH 1HFDA 1WAYB 2HNTC 1K1OA 2VIVA 3PMBB 1TNHA 2ZHQH 3GICB 4CH8B 5AFZH 1GJDB 5DP7A 1XKBC 1JIRA 1YLDA 1P03A 3QK1A 3EE0B 1UVPA 5GIBA 3Q77A 3SBKA 2F9BH 1SOZA 1TNGA 3URCA 3ZVBA 5FCRA 1WYKA 3SI3H 3SNAA 3FAOA 3A8BA 3ZVFA 4IC5A 1BOQA 2C93B 1O2PA 2BOKA 1TWXB 3ZZCA 3ZV8A 1MKXK 1QIXB 3F6UH 4Y7AA 3ATKA 5GWZA 4B73A 1V2KT 5EQRA 4AG1A 2P16A 2HRVA 3MNXA 2OBOA 2PKSB 1IQLA 3IWMA 2OBQA 2ZU4A 1ELVA 1GHWH 2CJIA 2IJOB 4GPGA 2J92A 1SR5C 1FNIA 3T25A 1LHFH 1ZR0A 4OS2A 1LHDH 3SV6A 1C2DA 1AMHA 3D49H 3RU4D 1O34A 3LT3A 2PV9B 2BDAA 3L33A 3MHWU 1TMTH 1MU6B 4XBCA 4DJZB 1DY9A 3BTDE 1QNJA 1P2KA 3P8NA 1QL8A 4MNXA 1FUJA 1GBFA 3TJUA 2TBSA 4NSYA 1S5SA 4FXGH 4NA7A 4X2YA 1H1BA 5C1UA 4B2BA 1UJ1A 4I33A 4J2YB 6GCHF 5L2ZH 2WPIS 3SHAH 1O3FA 3P8FA 1O3PB 3LC5A 1IQHA 1YPLH 4Z0KA 1KTTB 3GY5A 1FAKH 5EGMA 1YCPH 1GGDC 1QFKH 4YOJA 1W12U 1C2JA 1S0QA 1MTUA 1DM4B 1CGHA 4YESB 4X8TH 1BTWA 2D26C 4DW2U 2BB4A 3MNSA 1BCUH 1CT0E 4OGXA 2XYAA 1HB0B 5C1YA 1BTPA 1UVUH 2AMQA 3RM2H 1NFUA 4A1XA 4F4OC 3R3GB 1UTKA 2B5TB 3AAVA 3UOPA 3BTME 1IHSH 1D6RA 2BX3A 4GAWA 2ZG0H 2CHAB 3PMHB 3SNEA 1O2JA 1BTHH 1V2PT 1WTHD 2VIPA 3MU4A 1EAWA 1RTLA 4CRAA 1O5CB 2M5TA 4RN6A 2R9PA 3A7WA 3SV8A 3QUMP 1MBQA 4B74A 3T26A 4LOYH 1PJPA 1TPOA 4X1PU 3UR6A 1GBCA 1ACBE 1MKWH 1V2ST 2RA0A 1H9IE 3BIUH 2GZ8A 1TGBA 1TA2A 1OWDA 3P92A 3S7HB 2NU1E 1OX1A 1UTQA 2ANYA 3M5NA 2ODQA 1DE7H 1FPCH 1TBQH 1F92A 2ALVA 1XX9A 2XC0A 1ZPZA 1QURH 2FIRH 1XVOA 2TPIZ 3PLKA 2GX4A 1FIZA 1O3CA 3FFGA 1C1SA 2BDHA 2PUXB 4FUBA 3RXMA 3RMMH 3PLPA 1V2OT 1P02A 2ZDAH 1BHXB 1TRMA 1O5GH 4WVPE 3L6PA 1SSXA 5TJXA 4K69A 2ZPQA 1D9IA 2A45B 3RXGA 3GCHC 2Q6DA 4A6LA 1A0JA 1C5ZB 3E1XB 4Z6AH 2QF3A 5GJ4B 1YPEH 1CHGA 5EXMA 4ISNA 3MFJA 4TPIZ 5AFYH 1NZQH 3RXJA 1GBBA 1O32A 1MAXA 3RXKA 5JPMH 1RIWC 1P2OA 2BD5A 4HFPB 4XBBA 3OSYA 3SU5A 4B75A 2XBYA 2P8OB 3U69H 1XUIA 2EI7A 2WV4A 4AZ2B 5E2OA 2FM2A 1GJ8B 3G01A 1GJCB 2NU3E 1HIAB 4CRFA 4IN2A 1FPHH 3BV9B 2GGVB 2Q6FA 3A7YA 2JH5D 2FTLE 3E0PB 5FAHA 1GI7B 1O2UA 2AERH 5K0HA 4NCYA 3MTYA 1S85A 4I32A 2OUAA 1RD3B 4JCNA 4Q80A 2FTMA 1CGJE 1GJBB 1NN6A 1V2TT 4YO9A 3RMLH 4ISHH 2ANMH 1P57B 2JKHA 1UVOA 3UY9A 1DVAH 1W0YH 3TH3H 2GDEH 3ZZ9A 3BEFB 1L0ZA 6CHAB 1KLIH 4JMYA 3LOXA 1GDQA 3V3MA 4CHAB 5AVDA 1TGCA 2FPZA 1J14A 3UNQA 1QBOA 4YTAA 2BM2A 1YP9A 2ZCKP 1QQUA 3FP8E 1O2RA 2H9HA 1NM6A 4WJG2 4WXVA 1YPHC 2CF8H 4KP0A 5E8EH 2ODPA 2SFAA 1GI8B 1EQ9A 4AFZA 1XVMA 1UMAH 3DD2H 1B0EA 3LGTA 4NFEA 3AASA 1E35B 1EXFA 3UWIA 1QA0A 5DP3A 4CRCA 1UTOA 3UPEA 4KTSA 3AW0A 3QGJA 1TIOA 8ESTE 1HBTH 4ZXXH 2C8XB 2PFEA 1DDJA 1CA0C 1C2KA 1SOTA 3RXUA 1C9PA 1UO6A 5I25A 3E8LA 1JMOH 3MNCA 1HXEH 2BDYA 1YGCH 4U2WA 5F03A 2H6MA 4BNRA 1O5DH 1ANBA 1T4VH 1NPMA 3MI4A 4M7GA 3RC6A 5ESTE 1S81A 3LH1A 1IHTH 1J17T 2QCYA 2ZDKA 4NIVA 3BTHE 4UD9H 4ZHMU 2PSYA 1FI8A 1O3EA 1B5GH 3PWBA 2Z9JA 4Y7BA 5BRRE 2SGFE 1P09A 3OU0A 2W3IA 1MD8A 1ETSH 2B7DH 4VGCB 1E36B 2WV5A 2ZDMA 3LKWA 2P3UB 2W26A 3SORA 1F2SE 4UEHH 4ESTE 2XBWA 2OQUA 2QAAA 4BTIB 2ZECA 2Y6TA 1PYTC 3RLYH 2TGDA 1BMLA 2BHGA 1D3PB 1P11E 3A82A 3SQHE 1EJAA 2P93A 3FVFB 2ZDNA 2LNCA 4E06H 4YZUA 1JRSA 2ZDVH 4UFEH 1O2VA 3DHKH 1JWTA 4A7IB 1MTVA 3VFEA 1QHRB 2ZTZA 2ASUB 1EUFA 3A8CA 1XUHA 2R3YA 1BRUP 3IG6B 3FP6E 2QF0A 4JK5A 5CHAB 3T29A 1W2KH 2ZKSA 5A0AE 2ZHFH 3L3TA 1PYTD 1O35A 2F9NA 3E6PH 4LXBH 2GT7A 1IQGA 4U01A 1W11U 1GI9B 3PMAB 1WQVH 1BJUA 1MQ6A 1O3NA 1Y3XA 3QZQA 4Q2KA 1W8BH 1BRBE 2BVSH 4WXIA 3CS7A 1O3MA 3EAJA 1G30B 3SHCH 3KCGH 3VXFH 1P2QA 2LPRA 3SU2A 2A2QH 1GBJA 4GHQA 6GCHG 1M9UA 1QBNA 6CHAC 4O97A 1D3QB 4CHAC 1SHHB 1G2LA 2RA3A 2Z3CA 3S9AA 4XE4A 1ZPBA 5B6OA 1VR1H 3HATH 1H9LB 1HJ9A 2BDGA 2UWPA 1YLCA 1IQJA 3D65E 1MU8B 4BTTB 1F7ZA 1T8MA 3TITA 1TALA 1RRKA 4ZKSU 2FOEA 3A87A 3PO1B 2R2WU 1YF4A 1CQQA 1FN8A 3S9CA 1KXEA 2OC1A 2TGAA 1OWJA 1XUJA 3TH2H 2ZNKH 4ZKRU 5FBEA 2CF9H 4B2CA 1Y3WA 1HPGA 2B0FA 5A8ZA 1TONA 1V6DA 3SJIA 4GUXA 3CS0A 1TPPA 4I8LA 1OOKB 1MTWA 2AS9A 5EW2H 3R0FA 4I7YH 1C1NA 3HK3B 3LGVA 3O8RA 1UTLM 2PTCE 1UVSH 2QA9E 1PQ7A 3F9HA 3TK6A 1UK3A 3DA9B 3UOUA 2EC9H 1GJ7B 3PYHA 3FZZA 3RP2A 2WYJA 3TGJE 1O3GA 1QB1A 2CN0H 5DP5A 2SNWA 1O3DA 5DKMA 3K6ZA 3ZVAA 1LVMA 3NK8A 2G52A 7GCHF 1S84A 1SGDE 2OC7A 1SMFE 1LPKB 1QL9A 2HLCA 1O2YA 3RU4E 1F0UA 1XXFA 4K8BA 4BXSA 4U32A 4FUIA 1GBIA 2ZHEH 2FLBH 1TBRH 3SN8A 1MMJN 1P0SH 1TNLA 5C1XA 5FX5A 2ZGJA 2ZU5A 1GBMA 3VGCB 2F9OA 1O3OA 4X1NU 3MU8A 1G3BA 1MTNB 3MU0A 3RU4T 2A5KA 2VWOA 1T31A 3B9FH 3VPKA 1V2WT 2FS9A 4CRBA 1K22H 2FI4E 1GI3A 4IS5A 3KHVA 3BG4C 2HOBA 4X1SU 1GBKA 3MMGA 3RXVA 3KQEA 2BDBA 3Q3XA 3RXCA 1AE5A 1TRYA 2W7SA 1GCTC 1LTOA 1YPKH 4INKA 3DT0H 3F9EA 1CE5A 1DOJA 1IQEA 2G5VA 4A92A 1EB1H 1E0FD 7KMEH 3ZVGA 1JIMA 1GG6C 1EJNA 2A4GA 1ZGIA 2RG3A 3KQBA 1GBDA 2TIOA 3BEUA 4TPYA 1G32B 3RMNH 4O9VA 3S69A 2SGQE 5ESBA 4DG4A 3RMOH 3GYMA 4DCDA 1P12E 2HGTH 1Y5BT 2OCVB 3NPSA 1AU8A 1C1RA 1GBAA 1N8OB 3UIRA 1FONA 1P2JA 2FS8A 1QRZA 4MLFB 1E38B 3TIUA 1AKSB 1C1PA 3TNTA 2VU8E 1P05A 1W3CA 2FP7B 5T6DA 1SFQB 1QRXA 3SGBE 1TNJA 1FIWA 2BD8A 3PV4A 2SGDE 1FY3A 3NWUA 2FXRA 2FOMB 4B76A 3ZZ6A 1UTJA 4X8SH 3RDZA 1NROH 1RTFB 1KXBA 1MD7A 1LKAA 2G00A 1O2GH 2F91A 3BN9A 5EQSA 4Y11E 4NSVA 2FX6A 3M35A 4FUHA 5CE1A 1IQNA 2FOGA 2XCNA 1P2NA 3ESTA 1ESBA 1YM0A 4ABDA 1BBRH 2VB0A 4Q7YA 1K21H 2PGBB 2PKAB 1OP0A 2FMJA 3VXEH 1ARBA 3IITA 3BEIB 1W7XH 2ZDLA 1G3CA 2C8ZB 3TJVA 2O8MA 2XBVA 1O2XA 2Q6GA 1UHBA 4JK6A 3MNBA 2YNAA 3OY6U 4FUGA 1A7SA 4A5TS 4MPUA 1AVWA 1YPMH 5L30H 1SGTA 2AGGX 1A3BH 1ZJKA 3NKKA 1Y59T 3ZYDA 5LPRA 1K2I1 2WPKS 1LVBA 3VGCC 1DLKB 5F8XA 1OP2A 2FESH 1F5KU 1TNKA 1MTNC 1BZXE 3TLOA 1XUFA 1NRNH 2XBXA 1GI4A 1GBTA 3DFJA 1DITH 1TX8A 1BA8B 3MU1A 1F0TA 1F5LA 1O2KA 2Z9LA 1LHCH 3BTEE 2G51A 4UFGH 3GDUA 3TJNA 3K65B 1BQYA 1O0DH 3BTGE 1S0RA 1A4WH 1C4V2 2ANWA 4BAQB 3M7UA 4ISOA 3ZVDA 1A5HA 1NU7B 4OS6A 2CGAA 1LPGB 4Q7ZA 3STIA 4ZKNU 3SJOA 1ELDE 1BRAA 3KF2A 4IN1A 1K1PA 1V2LT 3SU6A 4K3JA 1EPTB 3MWIU 4I8HA 1ZMJA 1C2HA 1UK2A 2VWMA 2F3CE 1L4ZA 2P59A 2V35A 1BJVA 1EB2A 1GJ9B 1KIGH 1AQ7A 2BXTH 3BTFE 4K1TA 3HGNA 4IBLH 1S6HA 1AUJA 2J94A 1GHXH 4AGKA 4X0WU 2BY9X 1Y3VA 1DS2E 2QXGA 3PROA 2EI6A 1HUTH 1HAVA 5GDSH 3SUGA 1GMHF 2XTTB 4NZQA 3VB7A 1V2NT 4BANB 2QXJA 2FDAA 3EDXB 2FLRH 1FAXA 5DJ7A 1O36A 2VIQA 3U8RH 1QB6A 1TBZH 4AYYB 3RC5A 4AOQA 1VJAU 2ZGBH 1ELEE 2C8WB 1NRRH 1HYLA 1SGPE 1C1WH 3W94A 1O30A 1THSH 4MPWA 3OYPA 4GHTA 4KTUA 4I8KA 3TPIZ 2VNTA 1HAZB 1Z1IA 1GJ5H 1QY6A 3LGWA 2Y5FA 4AYVB 1ZHRA 1TQ0B 4JZDH 5LPFA 1GPZA 4CBNA 1RTKA 4D9QA 2A31A 2WUCA 1ESTA 1TMUH 2RDLA 2ZHDA 1KDQB 1ELCA 5DP8A 1O2QA 2A4QA 5LPEA 1XM1A 2AYWA 3RXSA 2VH6A 1SGIB 3E3TA 3ZVEA 1ABJH 5AF9H 1YPHE 4YOIA 2ZGHA 4D76A 3ZVCA 1ANEA 1UTMA 2YOLA 1A3EH 2ZGCA 1TMBH 2HPPH 2C3SA 1C2IA 1B7XB 1T4UH 1Y5AT 2PR3A 1ZGVA 2PKSC 4IGDA 4D9RA 2GP9B 2XWBI 4H6TA 3LONA 1PPEE 2AH4X 1TB6H 1CBWB 4UE7H 4JZEH 3KQDA 5HMAA 1RGQA 2C90B 1C4Y2 5C3NA 3MOCA 4GSOA 2J95A 5EPNA 1PPBH 1L2EA 3GY6A 5HM2A 3JZ2B 5A0BA 3MH5A 3VEQB 3Q00A 4GVUA 2H9TH 3O8CA 2BOHB 3M7QA 4X1QU 3BTTE 1IOEA 3D62A 2FOAA 1Y3YA 1FDPA 1L1JA 7GCHG 1S83A 4AB8A 1DWEH 2OC8A 3BSQA 1PFXC 2OD3B 1GHZA 4J1YA 1ZZZA 3VB3A 4FUEA 1TX6A 3MO6A 2V6NA 1EPTC 5HXFA 1EJMA 4E05H 2QC2A 2VWNA 3ZZ4A 4DVAU 2V3HH 1D6WA 3UQVA 1J9CH 1SGQE 1A1RA 2ZCLP 3H7OA 2BD2A 3UREA 3SJ9A 2H5CA 1TOCB 2D2DA 1DUEA 2XC5A 1EPTA 3BG8A 3MH7A 1YPGH 2B9LA 2H1UA 3VB4A 2QXIA 2SGAA 3A83A 3NXPA 4NGAH 4DIHH 2JETB 4NA9H 1P9SA 4K8YA 3A85A 2Z94A 1OXGA 4O3UA 1EOJA 4X2VA 4QT8C 1O38A 2FOCA 4DIIH 1GJ6A 3ZZ5A 2CHAC 3T62A 4O03A 4ABFA 2JH6D 3E0NB 1O2MA 2BDCA 1TNIA 1FV9A 2SGEE 3PB1E 2OP9A 2ZFRH 4CR5A 2JH0D 4MNVA 4DY7B 4CBOA 1FN6A 1WTGH 4KTCA 5DG6A 2ZPSA 1MCVA 1C1TA 2BDIA 1H8IH 2FX4A 1LQDB 3RUOA 3LJJA 1BBRE 2ANKH 2AEIH 4O3TA 3SU1A 5LH8A 3I29A 4WH6A 4ABBA 1AN1E 2GVFA 3OX7U 3A7TA 1EP6A 1DWDH 1GL1A 1SQOA 4K5ZA 4IMQA 3P95A 3LPRA 3SOSA 2GCTB 1O37A 1SI5H 2DUCA 3LC3A 2QN5T 3UFAA 3GDSA 1AY6H 1KDQA 1QCPA 3QWCH 5FHTA 4DGJA 1HJ8A 2ZFSA 1KLJH 1YCPK 4TWWA 5L2YH 2GCHF 2BQ7B 2UUKB 2Y81A 3UNRA 3SGQE 1BMMH 3STJA 2KAIB 1Z8RA 1C4U2 2Z6BD 2R3UA 1HXFH 1AI8H 3KEEA 1ZTKA 1C2MA 2G8TA 1AGJA 2A5AA 4ISIH 4DT7B 1FZZA 1MAYA 1GDNA 4FUJA 4ABIA 1GDUA 5E0JA 1SLXB 2F9PA 1CO7E 2R0LA 2G4TA 3UQOA 1A61H 1HV7A 2ZEBA 1VGCB 1C5RA 2G55A 5EQQA 3UUZA 2F9VA 2FYQA 1J15A 1XKAC 1EZSC 1AFQB 4H42U 4X6NA 2ZP0H 3HKIB 2FOFA 1AWHB 1PQAA 1P3CA 3EA8A 3ZZ3A 3RXRA 3A80A 4FVDA 3U1JB 4LK4A 2J2UA 2P8OC 5EODA 1LO6A 2V0BA 1SG8B 3QO6A 1MKWK 5DP6A 3U9AH 1O2SA 4D8NA 1HAOH 1SFIA 1P2IA 2FODA 2Q1JA 4ASHA 1SBWA 1QJ6B 2DE9A 1ZMLA 4H6SB 5F8TA 2WINI 1UK4A 1SQAA 1SVPA 4K1EA 1GI5A 1L1NA 3K2UA 2BVXH 1O3AA 1PQ8A 4IW4E 2PSXA 1DX5M 1HIAA 5G4BA 1V2QT 2I6QA 1C1UH 1AVXA 4Q7XA 1O3JA 1K1IA 1SLUB 4WMEA 2H9EH 1VITH 2UUJB 1BTYA 1SLWB 1HNEE 4AG2A 2ZU1A 5EW1H 1HDTH 4BTUB 1LQEA 1ZMNA 4YLUA 4OGYA 2NU4E 1C1OA 4Y6DA 1UCYH 3ODFA 1FY1A 2C4FH 1NFYA 2FOBA 4TY6A 1NRQH 5JBBS 2HNTF 3Q3KA 3P6ZB 3FANA 1YBWA 2BTCE 1YYY1 3SQEE 2OTVA 1CGIE 1ANCA 2Y7ZA 3A86A 2GCTC 5C5OA 5AHGH 4XDEA 2J4IA 2G5NA 3WY8A 2IOTA 4ZAEA 2ZU2A 1PPHE 1ZHPA 5FPSA 5JYIA 2V3OH 1O2OA 3LGIA 4Y79A 3TGIE 2GZ7A 2GKVE 1LVOA 2STAE 4I31A 3Q3YA 4JZIA 9LPRA 2BLVA 1AVGH 2PHBA 1UTPA 4F49A 1P06A 1N1LA 1HLTH 1VCQA 4WWYA 2BD9A 4FVBA 1T8NA 4SGBE 3QN7A 1CHOF 5A8XA 1KXFA 1JOUB 1YPJH 4ZROA 4AFUA 1NC6A 1MKXH 2KAIA 5I46H 4YT7H 4JYTA 1ZJDA 3QDZB 3T27A 4TWYA 1T32A 2ZFQH 4FU8A 1O3LA 1WCZA 5C67A 1OPHB 1DWBH 4FUCA 3H7TA 1CT2E 4THNH 1OWHA 1ZSKA 1GCDA 5FX6A 1ZPCA 5DP9A 2HNTE 8GCHF 2BLOA 1GMCF 3ATIA 1DUAA 4E7RG 4VGCC 2P95A 2IN2A 4AORA 2GTBA 1ELBA 3M36A 1U6QA 2TRMA 3E91A 2GZ9A 2ZCHP 1C5NH 3OY5U 4ZKOU 4I8GA 4X6MA 3GY2A 3LU9B 4SGAE 1GI1A 2HALA 3VB6A 1XUKA 4ABGA 1OWKA 3KQCA 1UVTH 1GVKB 2AMDA 1BMAA 1BB0B 2OLGA 3ATWA 4Y8ZA 2F9UA 2Z9GA 1KXAA 3HGPA 2BZAA 1GHAF 3F9FA 1QRWA 2H5DA 1A0HB 2O9QA 4IMZA 5CHAC 1MCTA 1HAPH 1AE8H 1BIOA 4WY3A 5E0HA 1EAUA 1PQ5A 3RXPA 3UR9A 5T6FA 3ELAH 1LVYA 2XRCA 3TJOA 3T5FH 4ABEA 1Z8JB 1QJ1B 1Y8TA 3K9XB 4AGJA 1CVWH 1GVLA 1TPAE 2FYRA 1LPZB 1BTXA 4GCHF 1D3DB 2NU2E 1H4WA 3T28A 1SGYE 3ZZ7A 3B23B 2WPLS 4NWKA 3E16B 1UTNA 5J4SA 4X8VH 3GYLB 3U8TH 5ABWA 3UNSA 4D7FA 3PO1C 1ABIH 1EAIA 1LDTT 4CH2B 5EOKA 2SGPE 1O2HA 3S7KB 4WMFA 5EXLA 2UUFB 2BD7A 7LPRA 4X2WA 2GV6A 1WOFA 1O33A 2THFB 3SUEA 1SB1H 3SUDA 4Y10E 1EATA 2STBE 4MG3A 4NWLA 1V2UT 1ETTH 1VITF 8KME2 3TU7H 1C1QA 4B1TA 4YM9A 1ETRH 1O5EH 3I77A 3A7VA 4R8TB 1GGDB 1NFXA 1DSTA 1BTUA 2ZTXA 3CP7A 3PMJA 3GISB 3Q76A 4INHA 2ESTE 4ZXYH 3SO3A 1O2WA 3RXQA 1C5OH 5JBAS 1C2GA 3SU4A 3RXBA 1GBEA 2CXVA 2ZU3A 3MH6A 1V3XA 1MUEB 1IAUA 2A7JA 3MH4A 2ZGXH 2QIQA 5C20A 3ZV9A 2ZFPH 1BITA 2VWLA 1ZTLA 1IQMA 2VIDA 3ITIA 2A4OA 2DE8A 5EG4A 1ID5H 2GCHG 4BAOB 3ODDA 5T6GA 2EI8A 1NRSH 3LGYA 1ZSLA 1OWEA 3SJKA 1SQTA 3EYDA 3RXLA 1P04A 4NIXA 1EZQA 2GV7A 1ELGA 1V2RT 3M61U 2VJ1A 1YC0A 3TNSA 3V0XA 3MU5A 1W10U 2ZF0H 4OS1A 1P10A 2Y82A 4X6PA 2O8LA 1ELAA 1Z6EA 4I8JA 1SGEE 2WUBA 5FPTA 1F5RA 1A2CH 3A84A 3ATLA 1UCYE 2Y7XA 1Z6JH 5F6MA 2ZO3H 1A5IA 2FI5E 3C27B 4BAMB 4MNWA 1LHGH 3A7XA 3BIVH 1ANDA 3SU0A 1QQ4A 2PUQH 3GOVB 2A5IA 4WH8A 5CMXH 4X1RU 1TPSA 2VVVA 1J8AA 1DY8A 3M3TA 1P3EA 1O31A 5IDKA 2PWXA 1DSUA 2B8OH 2O8TA 1GHYH 1P9UA 3KIDU 1F0SA 2Z9KA 1ARCA 5SGAE 1PPZA 3DUXH 5J4QA 3GCHB 3V12A 1N8OC 4ABHA 5EXNA 2FZZA 1O2TA 3NCLA 5F8ZA 1Q3XA 4Y0ZE 4ABJA 1EKBB 1MQ5A 1GBHA 5FPYA 2UWLA 3ZZ8A 4X2XA 5HYOA 5IYTA 2QXHA 2VINA 4OS5A 1CSOE 4CRDA 1EZUC 1KXCA 1SPJA 2OC0A 1BHXF 1Z8IB 2HPQH 1GMDF 1DLEA 3GCTF 4XFQA 1TABE 1RIWB 1AKSA 5GXPA 1TE0A 3P8OA 5HM9A 4X6OA 1E37B 3P70B 2Y80A 2H2ZA 1BMNH 3AVZA 2BLWA 3SNCA 4YLQH 4JYVH 2VH0A 3A88A 1SL3A 4BXWA 1O3IA 4GLYA 4ZUHA 5GCHF 3RLWH 1W13U 5E0GA 2QGRA 2ZTYA 4HGCA 1HRTH 1O2IA 4NZLA 1ZTJA 1Z1JA 3MYWA 1KLTA 2BD3A 1XUGA 2TGPZ 3AW1A 3M3VA 1QL7A 1DANH 2PKAA 2NU0E 1OYTH 2W5EA 3QX5H 4CREA 2A32A 3F1SB 1SGFA 1Z8GA 2VIOA 3QLPH 1WQSA 3D23A 4AX9H 1MTSA 3RXDA 1ORFA 4UONA 1V2JT 1SHYA 1CHOG 1IQIA 1V2MT 1WSSH 2C8YB 2UUYA 2UWOA 4RKOB 4YT6H 1OYQA 3GY7A 2R0KA 4WMDA 2BY8X 1OWIA 5T3HA 1FY5A 1OS8A 2A0QB 3FZDA 2Z9IA 1C5LH 1D4PB 8GCHG 4NIWA 1GMCG 1J16A 2ZQ2A 1Q31A 8LPRA 5LGOA 1ELTA 4UFDH 2BX4A 1AHTH 1DWCH 1JBUH 1THPB 1WU1A 1XXDA 3TK9A 2P94A 3EQ0H 3DFLA 4OS7A 5DP4A 1K1JA 2PGQB 1AUTC 1CA0B 1NU9A 5DGJA 1G3DA 2A7CA 1BBRK 3M5LA 3NUMA 3AAUA 3P8GA 1BUIA 1O3HA 3SUFA 1HAHH 1GHAG 4TYDA 2ALPA 4MTBA 4FUDA 1T7CA 2AGEX 1SGRE 4BAKB 1KXDA 2P3FH 1C5PA 4MPXA 1O5AB 3TK5A 1VJ9U 1MZAA 4RSPA 5TCAA 2BZ6H 3RXTA 1GHVH 1AWFH 1SGFG 2ZHWH 2ZIQH 1GVZA 1YCPM 5JBTA 3GY4A 3BTKE 1QJ7B 2IPHA 2XXLA 2RCEA 2GD4B 9ESTA 1RJXB 1H8DH 1PPFE 1BTZA 4GCHG 2FO9A 3A8AA 1GBLA 1D3TB 2QV1A 2VGCB 3QGNB 4KELA 3JZ1B 2A1DB 5TCCA 4KGAA 1GWAA 1C2LA 2XC4A 1HGTH 2Z3EA
chains in the Genus database with same CATH superfamily
3U1IB 3BF6H 2WPHS 3M5MA 3ZYEA 1SQRA 3T2NA 3E90B 1LCYA 2ZI2H 4MDSA 3A81A 3QTVH 1C5YB 5HGGA 5A09A 1NO9H 2WPMS 1QB9A 1S82A 1GL0E 3F0OA 1GHBF 2TGTA 1AD8H 3SV9A 1C5XB 1LMWB 5EPYA 4A1TA 4KKDA 1AO5A 1VITG 2QY0B 3RXFA 2XCFA 3SW2B 4CR9A 1AZZA 2XNDD 3TGKE 1OP8A 1NS3A 3ATMA 1CBWC 3LH3A 3O8BA 3ZZBA 1TA6A 1RFNA 2AIPA 1C5UA 1N6YA 1WV7H 5DO4H 2BY7X 2BQ6B 3O8DA 2AIQA 4E7NA 3GY8A 1C5TA 2O8UA 2J9NA 4NIYA 3SZNA 1X7AC 5FXLA 1DFPA 1BDAA 1O3KA 3ENSB 1HCGA 3N7OA 1G37A 3MO9A 1FMGA 2ZZUH 4H4FA 1DICA 5JBCS 2BXUH 1EX3A 3OTJE 2KR7A 4UFFH 4PROA 2LELA 3LJOA 3CENA 4F48B 1FY8E 3EGKH 5C0TA 3RXHA 4MVNA 4ABAA 1TGTA 1FY4A 3CNRA 1CA8B 1GJ4H 2FI3E 2WPJS 1MH0A 1P01A 1GI2A 2JETC 1O2LA 1A46H 1WBGB 1QTFA 1E34B 2AGIX 3B8JA 2WV9A 4Y8XA 5K7RA 3S9BA 2BYAX 3EA9A 2QYIA 1C5WB 1K1NA 2ZPRA 1JXPA 4RT0A 1HAYB 1WUNH 3EE7A 3PM3A 1FLEE 1ZOMA 3RXOA 5E2PA 2I6SA 4NA8A 1GI0A 1BRCE 4Y76A 1A5GH 1PPGE 2Z3DA 2OQ5A 3GCOA 1B0FA 2VGCC 3PLBA 1ZLRA 3NZIA 3RXIA 3BTWE 3F3BA 1C2EA 1SC8U 4YOGA 3F9GA 1FJSA 2OINA 4HI3A 2IPQX 1QGFA 4XSKU 1HAGE 1XMNB 2ILNA 1W7GH 2ZA5A 5FBIA 3KGPA 3MO3A 3FP7E 3ZZDA 3BTQE 2BVRH 3URDA 1Q2WA 3PTNA 3V7TA 1F0RA 1ESAA 4ZHAA 5DK1A 3KL6A 3M7TA 3SI4H 1KY9A 3SGAE 2W7UA 1PPCE 3UTUH 3BG4B 2ODYB 2VIWA 2HLDD 3M3SA 3TVJB 1QA7A 2HWLB 3M37A 4ISLA 2ZC9H 2GMTB 1GMHG 2GT8A 1TFXA 2ZFTA 2Y5GA 3GDVA 1GCTB 4NG9H 2A7HA 1O2ZA 2VVUA 1GMDG 1AB9B 1Z71A 3GCTG 4ZH8A 1RS0A 1NBME 1LHEH 2G4UA 4DT4A 1QR3E 2CMYA 5PTPA 1Y3UA 1C1MA 3SV2H 3W95A 1DXWA 1G36A 2BMGB 4ZHLU 1V2VT 1C5SA 3A7ZA 4IC6A 1GG6B 1Z7KA 3EA7A 2VBCA 5BPEA 2AFQB 4BAHB 5JB8S 1EOLA 5GCHG 1EP5A 1O5BB 3U98H 2ULLA 1DPOA 3A8DA 1ZHMA 2CV3A 3QZRA 5DPAA 2XWAA 4WF8A 1MBMA 1VGCC 2EEKA 2WPDD 1P8VC 1GJAB 1DT2A 1OKXA 1T8OA 2OXSA 3PWCA 5HIYA 5C5NA 1IQFA 1KSNA 2KCAA 4XBDA 1AFQC 1HAXB 1TQ7B 2P3TB 1Y5UT 2JDID 2V3MA 1KMHB 4Y8YA 5KEDA 1HJAB 2NWNA 1KTSB 5A2MH 3H5CB 2BD4A 4AN7A 4K60A 3GCNA 4HTCH 1TGNA 4JZ1A 2A2XH 1W0ZU 6LPRA 2KZ4A 3HK6B 2XNIA 5C2ZA 1TGSZ 4CRGA 1C2FA 4Y0YE 4XOJA 3DSPA 1IQKA 1P2MA 3SJ8A 5L6NH 4LZ1H 1K1MA 1K9OE 1QBVH 3V13A 1O3BA 4UDWH 1UW7A 1VZQH 3P17H 4DURA 6ESTA 4X8UH 1TAWA 1EASA 1DXPA 1VCWA 1FQ3A 1EAXA 1NT1A 2R2MB 1UHBB 1ZYOA 4K1SA 1NTPA 4U30A 2FOHA 1CT4E 1MZDA 1G9IE 4BOHA 3LIWA 4FU9A 2Z7FE 1RXPA 1ZRKA 3KNXA 3UB0A 4OS4A 2ZFFH 2XW9A 1GI6A 3K6YA 5ETXA 2GDDA 2YNBA 2WYGA 5JB9S 1NY22 1AFEH 5FCKA 1NFWA 1AIXH 2D8WA 2W3KA 4TY7A 1C1VH 4ZMAH 1FXYA 1C9TA 5T1VA 3VB5A 2AMPA 2BY6X 1OSSA 2HVXA 3SV7A 1TRNA 2D1JA 5GPIB 3LGUA 3TH4H 1SLVB 2BLQA 4AB9A 3HKJB 5JDUB 1KYNA 2JJ1D 3S0NA 1AZ8A 1C5MD 1C5QA 2O8WA 4MNYA 3C1KA 4INLA 4A1VA 2G81E 3M5OA 5EU8A 1S6FA 1A0LA 3HPTB 2GMTC 1CU1A 1LKBA 3ZZAA 1YKTA 1INCA 1H9HE 1ZRBA 1O2NA 1JRTA 1TX7A 2BQWB 1AB9C 2FWWA 3A89A 3U8OH 1K1LA 4DOQA 3SNDA 1T8LA 2K8IA 3UWJH 3SNBA 4LZ4B 4B2AA 3PTBA 1O5FH 3RM0H 7ESTE 1THRH 2VVCA 4FU7A 3KN2A 4HZHA 2Y5HA 2SNVA 2ZQ1A 1ELFA 1G2MA 1NESE 5A0CA 1SGCA 4JZFH 3I78A 3F68H 4AFSA 1HAIH 4FUFA 2PLXA 1HAVB 2PW8H 1G3EA 1BT7A 4R0IA 5H4IB 4D7GA 3SU3A 4MQAA 3QTOH 3RXAA 3DSGA 2EA3A 4RKJB 1EZXC 1N6XA 1TLDA 3LDXH 1TYNA 1HJAC 3GY3A 2BY5X 2FEQH 1UCYK 4MPVA 1L1GA 4B71A 2PTNA 1ZSJA 4AFQA 2PP6A 1GHBG 2F83A 4NFFA 1C5VA 3RXEA 2J38A 1L4DA 2ZWLH 5A8YA 1W14U 4Y71A 2K1QA 4JYUH 3RC4A 4K2YA 1TOMH 2A4RA 1SGNE 1O39A 1VCPA 2J34A 1K28D 1NRPH 1HFDA 1WAYB 2HNTC 1K1OA 2VIVA 3PMBB 3VG8A 1TNHA 2ZHQH 3GICB 4CH8B 5AFZH 1GJDB 5DP7A 1XKBC 1JIRA 1YLDA 1P03A 3QK1A 3EE0B 1UVPA 5GIBA 3Q77A 3SBKA 2F9BH 1SOZA 1TNGA 3URCA 3ZVBA 5FCRA 1WYKA 3SI3H 3SNAA 3FAOA 3A8BA 3ZVFA 4IC5A 1BOQA 2C93B 1O2PA 3UAIC 2BOKA 3N7DA 1TWXB 3ZZCA 3ZV8A 1MKXK 2L6OA 1QIXB 3F6UH 4Y7AA 3ATKA 5GWZA 4B73A 1V2KT 5EQRA 4AG1A 2P16A 2HRVA 3U28C 3MNXA 2OBOA 2PKSB 1IQLA 3IWMA 2OBQA 2ZU4A 1ELVA 1GHWH 2CJIA 2IJOB 4GPGA 2J92A 1SR5C 1FNIA 3T25A 1LHFH 1ZR0A 4OS2A 1LHDH 3SV6A 1C2DA 1AMHA 3D49H 3RU4D 1O34A 3LT3A 2PV9B 2BDAA 3L33A 3MHWU 1TMTH 1MU6B 4XBCA 4DJZB 1DY9A 3BTDE 1QNJA 1P2KA 3P8NA 1QL8A 4MNXA 1FUJA 2KCPA 1GBFA 3TJUA 2TBSA 4NSYA 1S5SA 4FXGH 4NA7A 4X2YA 1H1BA 5C1UA 4B2BA 1UJ1A 4I33A 4J2YB 6GCHF 5L2ZH 2WPIS 3SHAH 1COWD 1O3FA 3P8FA 1O3PB 3LC5A 1IQHA 1YPLH 4Z0KA 1KTTB 3GY5A 1FAKH 5EGMA 1YCPH 1GGDC 1QFKH 4YOJA 1W12U 1C2JA 1S0QA 1MTUA 1DM4B 1CGHA 4YESB 4X8TH 1BTWA 2D26C 4DW2U 2BB4A 3MNSA 1BCUH 1CT0E 4OGXA 2XYAA 1HB0B 2CK3D 5C1YA 1BTPA 1UVUH 2AMQA 2GJGA 3RM2H 1NFUA 4A1XA 2HVYB 4F4OC 3R3GB 1UTKA 2B5TB 3AAVA 3UOPA 3BTME 1IHSH 1D6RA 2BX3A 2L74A 4GAWA 2ZG0H 2CHAB 3PMHB 3SNEA 1O2JA 1BTHH 1V2PT 1WTHD 1MABB 2VIPA 3MU4A 1EAWA 1RTLA 4CRAA 1O5CB 2M5TA 4RN6A 3SYJA 2R9PA 3A7WA 3SV8A 3QUMP 1MBQA 4B74A 3T26A 4LOYH 1PJPA 2J98B 1TPOA 4X1PU 3AK5A 3UR6A 4Q63A 1GBCA 1ACBE 1MKWH 1V2ST 2RA0A 2WSSD 1H9IE 3BIUH 2GZ8A 1TGBA 1TA2A 3KQ5A 1OWDA 3P92A 3S7HB 2NU1E 1OX1A 1UTQA 2ANYA 3M5NA 2ODQA 1DE7H 1FPCH 1TBQH 2KFWA 4I86A 1F92A 2ALVA 1XX9A 2XC0A 1ZPZA 1QURH 2OK5A 2FIRH 1XVOA 2TPIZ 3PLKA 2GX4A 1FIZA 1O3CA 3FFGA 1C1SA 2BDHA 2PUXB 4FUBA 3RXMA 3RMMH 3PLPA 1V2OT 1P02A 2ZDAH 1BHXB 1TRMA 1O5GH 4WVPE 3L6PA 1SSXA 5TJXA 4P02A 4K69A 2ZPQA 1D9IA 2WZQA 2A45B 3RXGA 3GCHC 2Q6DA 4A6LA 1A0JA 1C5ZB 3E1XB 3ZIAD 4Z6AH 2QF3A 5GJ4B 1YPEH 1CHGA 5EXMA 4ISNA 3MFJA 4TPIZ 5AFYH 1NZQH 1QZ8A 3RXJA 1GBBA 1O32A 1MAXA 3RXKA 5JPMH 1RIWC 1P2OA 2BD5A 4HFPB 4XBBA 3OSYA 3SU5A 4B75A 2XBYA 2P8OB 3U69H 1XUIA 2EI7A 2WV4A 4AZ2B 5E2OA 2FM2A 1GJ8B 3G01A 1GJCB 2NU3E 1HIAB 4CRFA 4IN2A 1FPHH 3BV9B 4RT1A 2GGVB 2Q6FA 3A7YA 2JH5D 3OEED 2FTLE 3E0PB 5FAHA 1GI7B 1O2UA 2AERH 5K0HA 4NCYA 3MTYA 1S85A 4I32A 4OM9A 2OUAA 3OTPA 1RD3B 4JCNA 4Q80A 2FTMA 1CGJE 1GJBB 1NN6A 1V2TT 4YO9A 2QF5A 3RMLH 4ISHH 2ANMH 1P57B 2JKHA 1UVOA 3UY9A 1DVAH 1W0YH 3TH3H 2GDEH 3ZZ9A 3BEFB 1L0ZA 3WW7A 6CHAB 1KLIH 4JMYA 3LOXA 1GDQA 3V3MA 4CHAB 5AVDA 1TGCA 2FPZA 1J14A 3UNQA 2J98A 1QBOA 4YTAA 2BM2A 1YP9A 2ZCKP 1QQUA 3FP8E 1O2RA 2H9HA 1NM6A 4WJG2 4WXVA 1YPHC 2CF8H 4KP0A 5E8EH 5HIZA 2ODPA 2SFAA 1GI8B 1EQ9A 4AFZA 1XVMA 1UMAH 3DD2H 1B0EA 3LGTA 4NFEA 3AASA 1E35B 1EXFA 3UWIA 1QA0A 5DP3A 4CRCA 2RFKC 1UTOA 3UPEA 4KTSA 3AW0A 3QGJA 1TIOA 8ESTE 1HBTH 4ZXXH 2C8XB 2PFEA 1DDJA 1CA0C 1C2KA 1SOTA 3RXUA 1C9PA 1UO6A 5I25A 3E8LA 1JMOH 3MNCA 1HXEH 2BDYA 1YGCH 4U2WA 5F03A 2H6MA 4BNRA 1O5DH 1ANBA 1T4VH 1NPMA 3MI4A 4M7GA 3RC6A 5ESTE 1S81A 3LH1A 1IHTH 3OEHD 1J17T 2QCYA 2ZDKA 4NIVA 3BTHE 4UD9H 4ZHMU 2PSYA 1FI8A 1O3EA 1B5GH 3PWBA 2Z9JA 4Y7BA 5BRRE 2SGFE 1P09A 3OU0A 2W3IA 1MD8A 1ETSH 2B7DH 4VGCB 1E36B 2WV5A 2ZDMA 3LKWA 2P3UB 2W26A 3SORA 1F2SE 4UEHH 4ESTE 2XBWA 2OQUA 2QAAA 4BTIB 2ZECA 2Y6TA 1PYTC 3RLYH 2TGDA 1BMLA 2BHGA 1D3PB 1P11E 3A82A 3SQHE 1EJAA 2P93A 3FVFB 2YMSC 2ZDNA 2LNCA 4E06H 4YZUA 1JRSA 3OE7D 2ZDVH 4UFEH 1O2VA 3DHKH 3DCLA 1JWTA 4A7IB 1MTVA 3VFEA 1QHRB 2ZTZA 2ASUB 1EUFA 3A8CA 1XUHA 2R3YA 1BRUP 3IG6B 3FP6E 2QF0A 4JK5A 5CHAB 3T29A 1W2KH 2ZKSA 3PV5A 5A0AE 2ZHFH 3L3TA 1PYTD 5KGOA 1O35A 2F9NA 3E6PH 4LXBH 2GT7A 1IQGA 4U01A 1W11U 1GI9B 3PMAB 1WQVH 1BJUA 1MQ6A 1O3NA 1Y3XA 3QZQA 4Q2KA 1W8BH 1BRBE 2BVSH 4WXIA 3CS7A 2YMSD 1O3MA 3EAJA 1G30B 3SHCH 3KCGH 3VXFH 1P2QA 2LPRA 3SU2A 2A2QH 1GBJA 4GHQA 4TSFD 6GCHG 1M9UA 1QBNA 6CHAC 4O97A 1D3QB 4CHAC 1SHHB 1G2LA 2RA3A 2Z3CA 3S9AA 4P00A 4XE4A 1ZPBA 5B6OA 1VR1H 3HATH 1H9LB 1HJ9A 2BDGA 2UWPA 1YLCA 1IQJA 3D65E 1MU8B 4BTTB 1F7ZA 3F2GA 1T8MA 3TITA 2XOKD 1TALA 1RRKA 4ZKSU 2FOEA 3A87A 3PO1B 2R2WU 1YF4A 1CQQA 1FN8A 3S9CA 1KXEA 2OC1A 2TGAA 1OWJA 1XUJA 3TH2H 2ZNKH 4ZKRU 5FBEA 2CF9H 4B2CA 3SZEA 1Y3WA 1HPGA 2B0FA 2K0QA 5A8ZA 1TONA 1V6DA 3SJIA 4GUXA 3CS0A 1TPPA 4I8LA 1OOKB 1MTWA 2AS9A 5EW2H 3R0FA 4I7YH 1C1NA 3HK3B 3LGVA 3O8RA 1UTLM 1H8HD 2PTCE 1UVSH 2QA9E 1PQ7A 3F9HA 3TK6A 1UK3A 3DA9B 3UOUA 2EC9H 1GJ7B 3PYHA 3FZZA 3RP2A 2WYJA 3TGJE 1O3GA 1QB1A 2CN0H 5DP5A 2SNWA 1O3DA 5DKMA 3N7EA 3K6ZA 3ZVAA 1LVMA 3NK8A 2G52A 7GCHF 1S84A 1SGDE 2OC7A 1SMFE 1LPKB 4Q4LA 1QL9A 3F0PA 2W6ID 2HLCA 1O2YA 3RU4E 1F0UA 1XXFA 4K8BA 4BXSA 4U32A 4FUIA 1GBIA 2ZHEH 2FLBH 1TBRH 3SN8A 1MMJN 1P0SH 1TNLA 5C1XA 5FX5A 2ZGJA 2ZU5A 1GBMA 3VGCB 2F9OA 1O3OA 4X1NU 3MU8A 1G3BA 1MTNB 3MU0A 3RU4T 2A5KA 2VWOA 1T31A 3W1EA 3B9FH 3VPKA 1V2WT 3FOAA 2FS9A 4CRBA 1K22H 2FI4E 1GI3A 4IS5A 3KHVA 3BG4C 2HOBA 4X1SU 1GBKA 3MMGA 3RXVA 3KQEA 2BDBA 3Q3XA 3RXCA 1AE5A 1TRYA 2W7SA 1GCTC 1LTOA 1YPKH 4INKA 3DT0H 3F9EA 1CE5A 1DOJA 1IQEA 2G5VA 4A92A 1EB1H 1E0FD 7KMEH 2QE7D 3ZVGA 1JIMA 2JIZD 1GG6C 1EJNA 2A4GA 1ZGIA 2RG3A 3KQBA 1GBDA 2TIOA 2W6JD 3BEUA 1G32B 4TPYA 3RMNH 4O9VA 3S69A 2SGQE 5ESBA 4DG4A 3RMOH 3GYMA 4DCDA 1P12E 2HGTH 1Y5BT 2OCVB 3NPSA 1AU8A 1C1RA 1GBAA 1N8OB 3UIRA 1FONA 1P2JA 2FS8A 1QRZA 4MLFB 1E38B 3TIUA 1AKSB 1C1PA 3TNTA 2VU8E 1P05A 1W3CA 2FP7B 5T6DA 1SFQB 1QRXA 3SGBE 1TNJA 1FIWA 2BD8A 3PV4A 2SGDE 1FY3A 3NWUA 2FXRA 2FOMB 4B76A 3ZZ6A 1UTJA 2M2AA 4X8SH 4FETA 3RDZA 1NROH 1RTFB 2QF4A 1KXBA 1MD7A 1LKAA 2G00A 1O2GH 2F91A 3BN9A 5EQSA 4Y11E 4NSVA 2FX6A 3M35A 4FUHA 5CE1A 1IQNA 2FOGA 2XCNA 1P2NA 3ESTA 1ESBA 1YM0A 4ABDA 1BBRH 2VB0A 4Q7YA 1K21H 2PGBB 2PKAB 1OP0A 2FMJA 3VXEH 1ARBA 3IITA 3BEIB 1W7XH 2ZDLA 1G3CA 2C8ZB 3TJVA 2O8MA 2XBVA 1O2XA 4HG6A 2Q6GA 1UHBA 4JK6A 3MNBA 2YNAA 3OY6U 4FUGA 1A7SA 4A5TS 4MPUA 1AVWA 1W0KD 1YPMH 5L30H 1SGTA 2AGGX 1A3BH 1ZJKA 3NKKA 1Y59T 3ZYDA 5LPRA 1K2I1 2WPKS 1LVBA 2J97A 3VGCC 1DLKB 5F8XA 1OP2A 2FESH 1F5KU 1TNKA 1MTNC 1BZXE 3TLOA 1XUFA 1NRNH 2XBXA 1GI4A 1GBTA 3DFJA 1DITH 1TX8A 1BA8B 3MU1A 1F0TA 1F5LA 1O2KA 2Z9LA 1LHCH 3BTEE 2G51A 4UFGH 3GDUA 3TJNA 3K65B 1BQYA 1O0DH 3BTGE 1S0RA 1A4WH 1C4V2 4ACBA 2ANWA 4BAQB 1WDIA 3M7UA 4ISOA 3ZVDA 1A5HA 1NU7B 4OS6A 2CGAA 1LPGB 4Q7ZA 3STIA 4ZKNU 3SJOA 1ELDE 5C94A 1BRAA 3KF2A 4IN1A 1K1PA 2KM0A 1V2LT 1S6LA 3SU6A 4K3JA 1EPTB 3MWIU 4I8HA 1ZMJA 1C2HA 1UK2A 2VWMA 2F3CE 1L4ZA 2P59A 2V35A 1BJVA 1EB2A 1GJ9B 1KIGH 5IK2D 1AQ7A 2BXTH 3BTFE 4K1TA 3HGNA 4IBLH 1S6HA 1AUJA 2J94A 1GHXH 4AGKA 4X0WU 2BY9X 1Y3VA 1DS2E 2QXGA 3PROA 2EI6A 1HUTH 1HAVA 5GDSH 3SUGA 1GMHF 2XTTB 4NZQA 3VB7A 1V2NT 2LP6A 4BANB 2QXJA 2FDAA 3EDXB 2FLRH 1FAXA 5DJ7A 1O36A 1YY3A 2VIQA 3U8RH 1QB6A 1TBZH 4AYYB 3RC5A 4AOQA 1VJAU 2ZGBH 1ELEE 2C8WB 1NRRH 1HYLA 1SGPE 1C1WH 3W94A 1O30A 1THSH 4MPWA 3OYPA 4GHTA 4KTUA 4I8KA 3TPIZ 2VNTA 1HAZB 1Z1IA 1GJ5H 1QY6A 3LGWA 2Y5FA 4AYVB 1ZHRA 1TQ0B 4JZDH 5LPFA 1GPZA 4CBNA 1RTKA 4D9QA 2A31A 2WUCA 1ESTA 1TMUH 2RDLA 2ZHDA 1KDQB 1ELCA 5DP8A 1O2QA 2A4QA 5LPEA 1XM1A 2AYWA 3RXSA 2VH6A 1SGIB 3E3TA 3ZVEA 1ABJH 5AF9H 1YPHE 4YOIA 2ZGHA 4D76A 3ZVCA 1ANEA 1UTMA 2YOLA 1A3EH 1H8ED 2ZGCA 1TMBH 2EQNA 2HPPH 2C3SA 1C2IA 1B7XB 1T4UH 1Y5AT 2PR3A 1ZGVA 2PKSC 4IGDA 1K0HA 4D9RA 2GP9B 2XWBI 4H6TA 3LONA 1PPEE 2AH4X 1TB6H 1CBWB 4UE7H 4JZEH 3KQDA 5HMAA 1RGQA 2C90B 1C4Y2 5C3NA 3MOCA 4GSOA 2J95A 5EPNA 1PPBH 4F55A 1L2EA 3GY6A 5HM2A 3KYFA 3JZ2B 5A0BA 3MH5A 3VEQB 3Q00A 4GVUA 2H9TH 3O8CA 2BOHB 3M7QA 4X1QU 3BTTE 1IOEA 3D62A 2FOAA 1Y3YA 1FDPA 1L1JA 7GCHG 1S83A 4AB8A 1DWEH 2OC8A 3BSQA 1PFXC 2OD3B 1GHZA 4B6FA 4J1YA 1ZZZA 1OHHD 3VB3A 4FUEA 1TX6A 3MO6A 2V6NA 1EPTC 5HXFA 1EJMA 4E05H 2QC2A 2VWNA 3ZZ4A 4DVAU 2V3HH 1D6WA 3UQVA 1J9CH 1SGQE 1A1RA 2ZCLP 3H7OA 2BD2A 5GNDA 3UREA 3SJ9A 2IJD1 2H5CA 1TOCB 2D2DA 1DUEA 2XC5A 1EPTA 3BG8A 3MH7A 1YPGH 2B9LA 2H1UA 3VB4A 2QXIA 2SGAA 3A83A 3NXPA 4NGAH 4DIHH 2JETB 4NA9H 1P9SA 4K8YA 3A85A 2Z94A 5CHBA 1OXGA 4O3UA 1EOJA 4X2VA 4QT8C 1O38A 2FOCA 4DIIH 1GJ6A 3ZZ5A 2CHAC 3T62A 3DSOA 4O03A 4ABFA 2JH6D 3E0NB 1O2MA 2BDCA 1TNIA 1FV9A 2SGEE 3PB1E 2OP9A 2ZFRH 4CR5A 2JH0D 4MNVA 4DY7B 4CBOA 1WXRA 1FN6A 1WTGH 4KTCA 5DG6A 2ZPSA 1MCVA 1C1TA 2BDIA 1H8IH 2FX4A 1LQDB 3RUOA 3LJJA 2KCYA 1BBRE 2ANKH 2AEIH 4O3TA 3SU1A 5LH8A 3I29A 4WH6A 4ABBA 1AN1E 2GVFA 3OX7U 3A7TA 1EP6A 1DWDH 1GL1A 1SQOA 4K5ZA 3PRDA 4IMQA 3P95A 3LPRA 3SOSA 2GCTB 1O37A 1SI5H 2DUCA 3LC3A 2QN5T 3NRLA 3UFAA 3GDSA 1AY6H 1KDQA 1QCPA 3QWCH 5FHTA 4DGJA 1HJ8A 2EY4C 2ZFSA 1KLJH 5HKKD 1YCPK 2AHME 4TWWA 5L2YH 3F2FA 2GCHF 2BQ7B 2UUKB 2Y81A 3UNRA 3SGQE 1BMMH 3STJA 2KAIB 4XD7D 1Z8RA 1C4U2 2Z6BD 2R3UA 1HXFH 1AI8H 3KEEA 1ZTKA 2G8TA 1C2MA 1AGJA 1SKYE 2A5AA 4ISIH 5KECA 4DT7B 1FZZA 1MAYA 1GDNA 4FUJA 4ABIA 1GDUA 5E0JA 1SLXB 2F9PA 1CO7E 2R0LA 2G4TA 3UQOA 1A61H 1HV7A 2ZEBA 4M9FA 1VGCB 1C5RA 1YLNA 2G55A 5EQQA 3UUZA 2F9VA 2FYQA 1J15A 1XKAC 1EZSC 1AFQB 4H42U 4X6NA 5EJZA 5C0UA 2ZP0H 3HKIB 2FOFA 1AWHB 1PQAA 1P3CA 3EA8A 3ZZ3A 3RXRA 3A80A 4FVDA 3U1JB 4LK4A 2J2UA 2P8OC 5EODA 1LO6A 2V0BA 1SG8B 3QO6A 1MKWK 5DP6A 3U9AH 1O2SA 4D8NA 1HAOH 1SFIA 1P2IA 2FODA 2Q1JA 4ASHA 1SBWA 1QJ6B 1VKYA 2DE9A 1ZMLA 4H6SB 5F8TA 2WINI 1UK4A 1SQAA 3H09A 1SVPA 4K1EA 1GI5A 1L1NA 3K2UA 2BVXH 1O3AA 1PQ8A 4IW4E 2PSXA 1DX5M 1HIAA 5G4BA 4YXWD 1V2QT 2I6QA 5C17A 1C1UH 1AVXA 4Q7XA 1O3JA 1K1IA 1SLUB 4WMEA 2H9EH 1VITH 2UUJB 1BTYA 1SLWB 3F2HA 1HNEE 4AG2A 2ZU1A 5EW1H 1HDTH 4BTUB 1LQEA 1ZMNA 4YLUA 4OGYA 1E1QD 2NU4E 1C1OA 4Y6DA 1UCYH 3ODFA 1FY1A 5FL7D 2C4FH 1NFYA 2FOBA 4TY6A 1NRQH 5JBBS 2HNTF 3Q3KA 3P6ZB 3FANA 1YBWA 2BTCE 1YYY1 3SQEE 2OTVA 1CGIE 3GS9A 1ANCA 2Y7ZA 3A86A 2GCTC 5C5OA 5AHGH 4XDEA 2J4IA 2G5NA 3WY8A 2IOTA 2JJ2D 4ZAEA 2ZU2A 2KX4A 1PPHE 1ZHPA 5FPSA 5JYIA 2V3OH 1O2OA 3LGIA 4Y79A 3TGIE 2GZ7A 2GKVE 1LVOA 2STAE 4I31A 3Q3YA 4JZIA 9LPRA 2BLVA 1AVGH 2PHBA 1UTPA 4F49A 1P06A 3N99A 1N1LA 1HLTH 1VCQA 2WHXA 4WWYA 2BD9A 4FVBA 1T8NA 4SGBE 3QN7A 1CHOF 5A8XA 1KXFA 1JOUB 1YPJH 4ZROA 4RI0A 4AFUA 1NC6A 1MKXH 5F53A 2KAIA 5I46H 4YT7H 4JYTA 1FX0B 1ZJDA 3QDZB 3T27A 4TWYA 1T32A 2ZFQH 4FU8A 1O3LA 1WCZA 5C67A 1OPHB 1DWBH 4FUCA 3H7TA 1CT2E 4THNH 1OWHA 1ZSKA 1GCDA 5FX6A 1ZPCA 5DP9A 2HNTE 8GCHF 2BLOA 1GMCF 3ATIA 1DUAA 4E7RG 4VGCC 2P95A 2IN2A 4AORA 2GTBA 1ELBA 3M36A 5EJLA 1U6QA 2TRMA 3E91A 2GZ9A 2ZCHP 1C5NH 3OY5U 4ZKOU 4I8GA 4X6MA 3GY2A 3LU9B 4SGAE 1GI1A 2HALA 3VB6A 5DN6D 1XUKA 4ABGA 1OWKA 3KQCA 1UVTH 1GVKB 2AMDA 1BMAA 1BB0B 2OLGA 3ATWA 4ZCNA 4Y8ZA 2F9UA 2Z9GA 1KXAA 3HGPA 2BZAA 1GHAF 5EIYA 3F9FA 1QRWA 2H5DA 1A0HB 2O9QA 4IMZA 5CHAC 1MCTA 1HAPH 1AE8H 1BIOA 4WY3A 5E0HA 1EAUA 1PQ5A 3RXPA 3UR9A 5T6FA 3ELAH 1LVYA 2XRCA 3TJOA 3T5FH 4ABEA 1Z8JB 1QJ1B 1Y8TA 3K9XB 4AGJA 1CVWH 1GVLA 1TPAE 2FYRA 1LPZB 1BTXA 4GCHF 1D3DB 2NU2E 1H4WA 3T28A 1SGYE 3ZZ7A 3B23B 2WPLS 4NWKA 3E16B 1UTNA 5J4SA 4X8VH 3GYLB 3U8TH 3MQKC 5ABWA 3UNSA 4D7FA 3PO1C 1ABIH 1EAIA 1LDTT 4CH2B 5EOKA 2SGPE 1O2HA 1W0JD 3S7KB 4WMFA 5EXLA 2UUFB 5B6LA 2BD7A 7LPRA 4X2WA 2GV6A 1WOFA 1O33A 2THFB 4TT3D 3SUEA 1SB1H 3SUDA 4Y10E 1EATA 2STBE 4MG3A 4NWLA 1V2UT 1ETTH 1VITF 8KME2 3TU7H 1C1QA 3WWBA 4B1TA 4YM9A 1ETRH 1O5EH 3I77A 3A7VA 4R8TB 1GGDB 1NFXA 1DSTA 1BTUA 2ZTXA 3CP7A 3PMJA 3GISB 3Q76A 3FKSD 4INHA 2ESTE 4ZXYH 3SO3A 1O2WA 5DSFA 1C5OH 3RXQA 5JBAS 1C2GA 3SU4A 3RXBA 1NBMD 1GBEA 2CXVA 2ZU3A 3MH6A 1V3XA 1YWUA 1MUEB 1IAUA 2A7JA 3MH4A 2ZGXH 2QIQA 5C20A 3ZV9A 2ZFPH 4ASUD 1BITA 2VWLA 1ZTLA 1IQMA 2VIDA 3ITIA 2A4OA 2DE8A 5EG4A 1ID5H 2GCHG 4BAOB 3ODDA 5T6GA 2EI8A 1NRSH 3LGYA 1ZSLA 1OWEA 3SJKA 1SQTA 3EYDA 3RXLA 1P04A 4NIXA 1EZQA 2GV7A 1ELGA 1E79D 1V2RT 3M61U 2VJ1A 2RDEA 1YC0A 3TNSA 3V0XA 3MU5A 1W10U 2ZF0H 4OS1A 1P10A 2Y82A 4X6PA 2O8LA 1ELAA 1Z6EA 4I8JA 1SGEE 2WUBA 5FPTA 1F5RA 1A2CH 3A84A 3ATLA 1UCYE 2Y7XA 1Z6JH 5F6MA 2ZO3H 1A5IA 2FI5E 3C27B 4BAMB 4MNWA 1LHGH 3A7XA 3BIVH 1ANDA 4FOUC 1QQ4A 3SU0A 2PUQH 3GOVB 2A5IA 4WH8A 5CMXH 5EJ1A 4X1RU 1TPSA 2VVVA 1J8AA 1DY8A 3M3TA 1P3EA 1O31A 5IDKA 2PWXA 1DSUA 2B8OH 2O8TA 1GHYH 1P9UA 3KIDU 1F0SA 2Z9KA 1ARCA 1EFRD 5SGAE 1PPZA 3DUXH 5J4QA 3GCHB 3V12A 1N8OC 4ABHA 5EXNA 4XRNA 2FZZA 3PRBA 1O2TA 3NCLA 5F8ZA 1Q3XA 4Y0ZE 4ABJA 1EKBB 1MQ5A 1GBHA 2F43B 5FPYA 2UWLA 3ZZ8A 4X2XA 5HYOA 5IYTA 2QXHA 2VINA 2J5UA 4OS5A 1CSOE 4CRDA 1EZUC 1KXCA 1SPJA 1BHXF 2OC0A 1E1RD 1Z8IB 2HPQH 1GMDF 1DLEA 3GCTF 4XFQA 1TABE 1RIWB 1AKSA 5GXPA 1TE0A 3P8OA 5HM9A 4X6OA 1E37B 3P70B 2Y80A 2H2ZA 1BMNH 3FO8D 3AVZA 2BLWA 3SNCA 4YLQH 4JYVH 2VH0A 3A88A 1SL3A 4BXWA 1O3IA 4GLYA 2V7QD 4ZUHA 4ACAA 5GCHF 3RLWH 1W13U 3FN8A 5E0GA 4AC9A 2QGRA 2ZTYA 4HGCA 1HRTH 1O2IA 4NZLA 1ZTJA 1Z1JA 3MYWA 1KLTA 2BD3A 1XUGA 2TGPZ 3AW1A 3KYGA 3M3VA 1QL7A 1DANH 2PKAA 2NU0E 1OYTH 2W5EA 3QX5H 4CREA 2A32A 3F1SB 1SGFA 1Z8GA 2VIOA 3QLPH 1WQSA 3D23A 4AX9H 1MTSA 3RXDA 1ORFA 4UONA 1V2JT 1SHYA 1CHOG 1IQIA 1V2MT 1WSSH 2C8YB 2UUYA 2UWOA 4RKOB 4YT6H 1OYQA 3GY7A 2R0KA 4WMDA 2BY8X 1OWIA 5T3HA 1FY5A 1OS8A 2A0QB 3FZDA 2Z9IA 1C5LH 1D4PB 8GCHG 4NIWA 1GMCG 1J16A 2ZQ2A 1Q31A 8LPRA 5LGOA 1ELTA 1BMFD 4UFDH 2BX4A 1AHTH 1DWCH 1JBUH 1THPB 1WU1A 1XXDA 3TK9A 2P94A 3EQ0H 3DFLA 4OS7A 5DP4A 4Z1MD 1K1JA 2PGQB 1AUTC 1CA0B 1NU9A 5DGJA 5CDFE 1G3DA 3PV2A 2A7CA 1BBRK 3M5LA 3NUMA 3AAUA 3P8GA 1BUIA 1O3HA 3SUFA 1HAHH 1GHAG 4TYDA 2ALPA 4MTBA 4FUDA 1T7CA 2AGEX 1SGRE 3OAAD 4BAKB 1KXDA 2P3FH 1C5PA 4MPXA 1O5AB 3TK5A 1VJ9U 1MZAA 4RSPA 5TCAA 2BZ6H 3RXTA 1GHVH 1AWFH 1SGFG 2ZHWH 2ZIQH 1GVZA 1YCPM 5JBTA 3GY4A 3BTKE 1QJ7B 3OFND 2IPHA 2XXLA 2RCEA 2GD4B 4B6EA 9ESTA 1RJXB 1H8DH 2YMSB 1PPFE 1BTZA 4GCHG 2FO9A 3A8AA 3WWFA 2KCOA 2F4LA 1GBLA 1D3TB 2QV1A 2VGCB 3QGNB 4KELA 3JZ1B 2A1DB 5TCCA 4KGAA 1GWAA 1C2LA 2XC4A 1HGTH 2Z3EA
chains in the Genus database with same CATH topology
3U1IB 3BF6H 2WPHS 3M5MA 3ZYEA 3T2NA 3E90B 1LCYA 2ZI2H 4MDSA 3A81A 3QTVH 1C5YB 5HGGA 5A09A 1NO9H 2WPMS 1QB9A 1S82A 1GL0E 1GHBF 2TGTA 1AD8H 3SV9A 1C5XB 1LMWB 5EPYA 4A1TA 4KKDA 1AO5A 1VITG 2QY0B 3RXFA 2XCFA 3SW2B 4CR9A 1AZZA 3TGKE 1OP8A 1NS3A 3ATMA 1CBWC 3LH3A 3O8BA 3ZZBA 1TA6A 1RFNA 2AIPA 1C5UA 1N6YA 1WV7H 5DO4H 2BY7X 2BQ6B 3O8DA 2AIQA 4E7NA 3GY8A 1C5TA 2O8UA 2J9NA 4NIYA 3SZNA 1X7AC 5FXLA 1DFPA 1BDAA 1O3KA 3ENSB 1HCGA 3N7OA 1G37A 3MO9A 1FMGA 2ZZUH 4H4FA 1DICA 5JBCS 2BXUH 1EX3A 3OTJE 4UFFH 4PROA 3LJOA 3CENA 1FY8E 3EGKH 3RXHA 4MVNA 4ABAA 1TGTA 1FY4A 1CA8B 1GJ4H 2FI3E 2WPJS 1MH0A 1P01A 1GI2A 2JETC 1O2LA 1A46H 1WBGB 1QTFA 1E34B 2AGIX 3B8JA 4Y8XA 5K7RA 3S9BA 2BYAX 3EA9A 2QYIA 1C5WB 1K1NA 2ZPRA 1JXPA 1HAYB 1WUNH 3PM3A 1FLEE 1ZOMA 3RXOA 5E2PA 2I6SA 4NA8A 1GI0A 1BRCE 4Y76A 1A5GH 1PPGE 2Z3DA 2OQ5A 3GCOA 1B0FA 2VGCC 3PLBA 1ZLRA 3NZIA 3RXIA 3BTWE 1C2EA 1SC8U 4YOGA 3F9GA 1FJSA 2OINA 4HI3A 1QGFA 4XSKU 1HAGE 1XMNB 2ILNA 1W7GH 2ZA5A 5FBIA 3KGPA 3MO3A 3FP7E 3ZZDA 3BTQE 2BVRH 3URDA 1Q2WA 3PTNA 3V7TA 1F0RA 1ESAA 4ZHAA 5DK1A 3KL6A 3M7TA 3SI4H 1KY9A 3SGAE 2W7UA 1PPCE 3UTUH 3BG4B 2ODYB 2VIWA 3M3SA 3TVJB 1QA7A 2HWLB 3M37A 4ISLA 2ZC9H 2GMTB 1GMHG 2GT8A 1TFXA 2ZFTA 2Y5GA 3GDVA 1GCTB 4NG9H 2A7HA 1O2ZA 2VVUA 1GMDG 1AB9B 1Z71A 3GCTG 4ZH8A 1RS0A 1LHEH 2G4UA 1QR3E 2CMYA 5PTPA 1Y3UA 1C1MA 3SV2H 3W95A 1DXWA 1G36A 2BMGB 4ZHLU 1V2VT 1C5SA 3A7ZA 4IC6A 1GG6B 1Z7KA 3EA7A 4BAHB 5BPEA 2AFQB 5JB8S 1EOLA 5GCHG 1EP5A 1O5BB 3U98H 2ULLA 1DPOA 3A8DA 1ZHMA 2CV3A 3QZRA 5DPAA 2XWAA 4WF8A 1MBMA 1VGCC 2EEKA 1P8VC 1GJAB 1DT2A 1OKXA 1T8OA 2OXSA 3PWCA 5C5NA 1IQFA 1KSNA 4XBDA 1AFQC 1HAXB 1TQ7B 2P3TB 1Y5UT 4Y8YA 1HJAB 2NWNA 1KTSB 5A2MH 3H5CB 2BD4A 4AN7A 4K60A 3GCNA 4HTCH 1TGNA 4JZ1A 2A2XH 1W0ZU 6LPRA 3HK6B 2XNIA 5C2ZA 1TGSZ 4CRGA 1C2FA 4Y0YE 4XOJA 1IQKA 1P2MA 3SJ8A 5L6NH 4LZ1H 1K1MA 1K9OE 1QBVH 3V13A 1O3BA 4UDWH 1VZQH 3P17H 6ESTA 4DURA 4X8UH 1TAWA 1EASA 1DXPA 1VCWA 1FQ3A 1EAXA 1NT1A 2R2MB 1UHBB 1ZYOA 4K1SA 1NTPA 4U30A 2FOHA 1CT4E 1MZDA 1G9IE 4BOHA 3LIWA 4FU9A 2Z7FE 1RXPA 1ZRKA 3KNXA 4OS4A 2ZFFH 2XW9A 1GI6A 3K6YA 5ETXA 2GDDA 2YNBA 2WYGA 5JB9S 1NY22 1AFEH 5FCKA 1NFWA 1AIXH 2D8WA 2W3KA 4TY7A 1C1VH 4ZMAH 1FXYA 1C9TA 3VB5A 2AMPA 2BY6X 1OSSA 2HVXA 3SV7A 1TRNA 2D1JA 5GPIB 3LGUA 3TH4H 1SLVB 2BLQA 4AB9A 3HKJB 5JDUB 1KYNA 3S0NA 1AZ8A 1C5MD 1C5QA 2O8WA 4MNYA 3C1KA 4INLA 4A1VA 2G81E 3M5OA 5EU8A 1S6FA 1A0LA 3HPTB 2GMTC 1CU1A 1LKBA 3ZZAA 1YKTA 1INCA 1H9HE 1ZRBA 1O2NA 1JRTA 1TX7A 2BQWB 1AB9C 2FWWA 3A89A 3U8OH 1K1LA 4DOQA 3SNDA 1T8LA 3UWJH 3SNBA 4LZ4B 4B2AA 3PTBA 1O5FH 3RM0H 7ESTE 1THRH 2VVCA 4FU7A 3KN2A 4HZHA 2Y5HA 2SNVA 2ZQ1A 1ELFA 1G2MA 1NESE 5A0CA 1SGCA 4JZFH 3I78A 3F68H 4AFSA 1HAIH 4FUFA 2PLXA 1HAVB 2PW8H 1G3EA 1BT7A 4R0IA 5H4IB 4D7GA 3SU3A 4MQAA 3QTOH 3RXAA 2EA3A 4RKJB 1EZXC 1N6XA 1TLDA 3LDXH 1TYNA 1HJAC 3GY3A 2BY5X 2FEQH 1UCYK 4MPVA 1L1GA 4B71A 2PTNA 1ZSJA 4AFQA 1GHBG 2F83A 4NFFA 1C5VA 3RXEA 2J38A 1L4DA 2ZWLH 5A8YA 1W14U 4Y71A 2K1QA 4JYUH 3RC4A 4K2YA 1TOMH 2A4RA 1SGNE 1O39A 1VCPA 2J34A 1K28D 1NRPH 1HFDA 1WAYB 2HNTC 1K1OA 2VIVA 3PMBB 1TNHA 2ZHQH 3GICB 4CH8B 5AFZH 1GJDB 5DP7A 1XKBC 1JIRA 1YLDA 1P03A 3QK1A 3EE0B 1UVPA 5GIBA 3Q77A 3SBKA 2F9BH 1SOZA 1TNGA 3URCA 3ZVBA 5FCRA 1WYKA 3SI3H 3SNAA 3FAOA 3A8BA 3ZVFA 4IC5A 1BOQA 2C93B 1O2PA 2BOKA 1TWXB 3ZZCA 3ZV8A 1MKXK 1QIXB 3F6UH 4Y7AA 3ATKA 5GWZA 4B73A 1V2KT 5EQRA 4AG1A 2P16A 2HRVA 3MNXA 2OBOA 2PKSB 1IQLA 3IWMA 2OBQA 2ZU4A 1ELVA 1GHWH 2CJIA 2IJOB 4GPGA 2J92A 1SR5C 1FNIA 3T25A 1LHFH 1ZR0A 4OS2A 1LHDH 3SV6A 1C2DA 1AMHA 3D49H 3RU4D 1O34A 3LT3A 2PV9B 2BDAA 3L33A 3MHWU 1TMTH 1MU6B 4XBCA 4DJZB 1DY9A 3BTDE 1QNJA 1P2KA 3P8NA 1QL8A 4MNXA 1FUJA 1GBFA 3TJUA 2TBSA 4NSYA 1S5SA 4FXGH 4NA7A 4X2YA 1H1BA 5C1UA 4B2BA 1UJ1A 4I33A 4J2YB 6GCHF 5L2ZH 2WPIS 3SHAH 1O3FA 3P8FA 1O3PB 3LC5A 1IQHA 1YPLH 4Z0KA 1KTTB 3GY5A 1FAKH 5EGMA 1YCPH 1GGDC 1QFKH 4YOJA 1W12U 1C2JA 1S0QA 1MTUA 1DM4B 1CGHA 4YESB 4X8TH 1BTWA 2D26C 4DW2U 2BB4A 3MNSA 1BCUH 1CT0E 4OGXA 2XYAA 1HB0B 5C1YA 1BTPA 1UVUH 2AMQA 3RM2H 1NFUA 4A1XA 4F4OC 3R3GB 1UTKA 2B5TB 3AAVA 3UOPA 3BTME 1IHSH 1D6RA 2BX3A 4GAWA 2ZG0H 2CHAB 3PMHB 3SNEA 1O2JA 1BTHH 1V2PT 1WTHD 2VIPA 3MU4A 1EAWA 1RTLA 4CRAA 1O5CB 2M5TA 4RN6A 2R9PA 3A7WA 3SV8A 3QUMP 1MBQA 4B74A 3T26A 4LOYH 1PJPA 1TPOA 4X1PU 3UR6A 1GBCA 1ACBE 1MKWH 1V2ST 2RA0A 1H9IE 3BIUH 2GZ8A 1TGBA 1TA2A 1OWDA 3P92A 3S7HB 2NU1E 1OX1A 1UTQA 2ANYA 3M5NA 2ODQA 1DE7H 1FPCH 1TBQH 1F92A 2ALVA 1XX9A 2XC0A 1ZPZA 1QURH 2FIRH 1XVOA 2TPIZ 3PLKA 2GX4A 1FIZA 1O3CA 3FFGA 1C1SA 2BDHA 2PUXB 4FUBA 3RXMA 3RMMH 3PLPA 1V2OT 1P02A 2ZDAH 1BHXB 1TRMA 1O5GH 4WVPE 3L6PA 1SSXA 5TJXA 4K69A 2ZPQA 1D9IA 2A45B 3RXGA 3GCHC 2Q6DA 4A6LA 1A0JA 1C5ZB 3E1XB 4Z6AH 2QF3A 5GJ4B 1YPEH 1CHGA 5EXMA 4ISNA 3MFJA 4TPIZ 5AFYH 1NZQH 3RXJA 1GBBA 1O32A 1MAXA 3RXKA 5JPMH 1RIWC 1P2OA 2BD5A 4HFPB 4XBBA 3OSYA 3SU5A 4B75A 2XBYA 2P8OB 3U69H 1XUIA 2EI7A 2WV4A 4AZ2B 5E2OA 2FM2A 1GJ8B 3G01A 1GJCB 2NU3E 1HIAB 4CRFA 4IN2A 1FPHH 3BV9B 2GGVB 2Q6FA 3A7YA 2JH5D 2FTLE 3E0PB 5FAHA 1GI7B 1O2UA 2AERH 5K0HA 4NCYA 3MTYA 1S85A 4I32A 2OUAA 1RD3B 4JCNA 4Q80A 2FTMA 1CGJE 1GJBB 1NN6A 1V2TT 4YO9A 3RMLH 4ISHH 2ANMH 1P57B 2JKHA 1UVOA 3UY9A 1DVAH 1W0YH 3TH3H 2GDEH 3ZZ9A 3BEFB 1L0ZA 6CHAB 1KLIH 4JMYA 3LOXA 1GDQA 3V3MA 4CHAB 5AVDA 1TGCA 2FPZA 1J14A 3UNQA 1QBOA 4YTAA 2BM2A 1YP9A 2ZCKP 1QQUA 3FP8E 1O2RA 2H9HA 1NM6A 4WJG2 4WXVA 1YPHC 2CF8H 4KP0A 5E8EH 2ODPA 2SFAA 1GI8B 1EQ9A 4AFZA 1XVMA 1UMAH 3DD2H 1B0EA 3LGTA 4NFEA 3AASA 1E35B 1EXFA 3UWIA 1QA0A 5DP3A 4CRCA 1UTOA 3UPEA 4KTSA 3AW0A 3QGJA 1TIOA 8ESTE 1HBTH 4ZXXH 2C8XB 2PFEA 1DDJA 1CA0C 1C2KA 1SOTA 3RXUA 1C9PA 1UO6A 5I25A 3E8LA 1JMOH 3MNCA 1HXEH 2BDYA 1YGCH 4U2WA 5F03A 2H6MA 4BNRA 1O5DH 1ANBA 1T4VH 1NPMA 3MI4A 4M7GA 3RC6A 5ESTE 1S81A 3LH1A 1IHTH 1J17T 2QCYA 2ZDKA 4NIVA 3BTHE 4UD9H 4ZHMU 2PSYA 1FI8A 1O3EA 1B5GH 3PWBA 2Z9JA 4Y7BA 5BRRE 2SGFE 1P09A 3OU0A 2W3IA 1MD8A 1ETSH 2B7DH 4VGCB 1E36B 2WV5A 2ZDMA 3LKWA 2P3UB 2W26A 3SORA 1F2SE 4UEHH 4ESTE 2XBWA 2OQUA 2QAAA 4BTIB 2ZECA 2Y6TA 1PYTC 3RLYH 2TGDA 1BMLA 2BHGA 1D3PB 1P11E 3A82A 3SQHE 1EJAA 2P93A 3FVFB 2ZDNA 2LNCA 4E06H 4YZUA 1JRSA 2ZDVH 4UFEH 1O2VA 3DHKH 1JWTA 4A7IB 1MTVA 3VFEA 1QHRB 2ZTZA 2ASUB 1EUFA 3A8CA 1XUHA 2R3YA 1BRUP 3IG6B 3FP6E 2QF0A 4JK5A 5CHAB 3T29A 1W2KH 2ZKSA 5A0AE 2ZHFH 3L3TA 1PYTD 1O35A 2F9NA 3E6PH 4LXBH 2GT7A 1IQGA 4U01A 1W11U 1GI9B 3PMAB 1WQVH 1BJUA 1MQ6A 1O3NA 1Y3XA 3QZQA 4Q2KA 1W8BH 1BRBE 2BVSH 4WXIA 3CS7A 1O3MA 3EAJA 1G30B 3SHCH 3KCGH 3VXFH 1P2QA 2LPRA 3SU2A 2A2QH 1GBJA 4GHQA 6GCHG 1M9UA 1QBNA 6CHAC 4O97A 1D3QB 4CHAC 1SHHB 1G2LA 2RA3A 2Z3CA 3S9AA 4XE4A 1ZPBA 5B6OA 1VR1H 3HATH 1H9LB 1HJ9A 2BDGA 2UWPA 1YLCA 1IQJA 3D65E 1MU8B 4BTTB 1F7ZA 1T8MA 3TITA 1TALA 1RRKA 4ZKSU 2FOEA 3A87A 3PO1B 2R2WU 1YF4A 1CQQA 1FN8A 3S9CA 1KXEA 2OC1A 2TGAA 1OWJA 1XUJA 3TH2H 2ZNKH 4ZKRU 5FBEA 2CF9H 4B2CA 1Y3WA 1HPGA 2B0FA 5A8ZA 1TONA 1V6DA 3SJIA 4GUXA 3CS0A 1TPPA 4I8LA 1OOKB 1MTWA 2AS9A 5EW2H 3R0FA 4I7YH 1C1NA 3HK3B 3LGVA 3O8RA 1UTLM 2PTCE 1UVSH 2QA9E 1PQ7A 3F9HA 3TK6A 1UK3A 3DA9B 3UOUA 2EC9H 1GJ7B 3PYHA 3FZZA 3RP2A 2WYJA 3TGJE 1O3GA 1QB1A 2CN0H 5DP5A 2SNWA 1O3DA 5DKMA 3K6ZA 3ZVAA 1LVMA 3NK8A 2G52A 7GCHF 1S84A 1SGDE 2OC7A 1SMFE 1LPKB 1QL9A 2HLCA 1O2YA 3RU4E 1F0UA 1XXFA 4K8BA 4BXSA 4U32A 4FUIA 1GBIA 2ZHEH 2FLBH 1TBRH 3SN8A 1MMJN 1P0SH 1TNLA 5C1XA 5FX5A 2ZGJA 2ZU5A 1GBMA 3VGCB 2F9OA 1O3OA 4X1NU 3MU8A 1G3BA 1MTNB 3MU0A 3RU4T 2A5KA 2VWOA 1T31A 3B9FH 3VPKA 1V2WT 2FS9A 4CRBA 1K22H 2FI4E 1GI3A 4IS5A 3KHVA 3BG4C 2HOBA 4X1SU 1GBKA 3MMGA 3RXVA 3KQEA 2BDBA 3Q3XA 3RXCA 1AE5A 1TRYA 2W7SA 1GCTC 1LTOA 1YPKH 4INKA 3DT0H 3F9EA 1CE5A 1DOJA 1IQEA 2G5VA 4A92A 1EB1H 1E0FD 7KMEH 3ZVGA 1JIMA 1GG6C 1EJNA 2A4GA 1ZGIA 2RG3A 3KQBA 1GBDA 2TIOA 3BEUA 4TPYA 1G32B 3RMNH 4O9VA 3S69A 2SGQE 5ESBA 4DG4A 3RMOH 3GYMA 4DCDA 1P12E 2HGTH 1Y5BT 2OCVB 3NPSA 1AU8A 1C1RA 1GBAA 1N8OB 3UIRA 1FONA 1P2JA 2FS8A 1QRZA 4MLFB 1E38B 3TIUA 1AKSB 1C1PA 3TNTA 2VU8E