4ZCNA

Crystal structure of nvpizza2-s16s58
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
86
structure length
86
Chain Sequence
b'SHMFTGLNTPSGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVLPFTGLNTPSGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nvPizza2-S16S58
molecule tags De novo protein
publication title Crystal structure of nvPizza2-S16S58
rcsb
total genus 12
structure length 86
sequence length 86
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.500 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4zcnA00
3WW7A 4ZCNA 3WWFA 3WWBA 5CHBA 5F53A
chains in the Genus database with same CATH superfamily
2FIRH 2ZGCA 1GBFA 1WBGB 2EC9H 5EJLA 3EYDA 1YP9A 1K1NA 2SGEE 3PM3A 1TNHA 1SBWA 3Q00A 2P95A 1F5KU 4Y6DA 1ESAA 1MTWA 5FCRA 1TRNA 4NWLA 4ABAA 1DY9A 1HIAA 4ABIA 1KXEA 2AFQB 1CO7E 1Z8GA 1OKXA 1RS0A 4Y7AA 1SLUB 2QC2A 3A7XA 4U30A 3GCTG 2G8TA 4WF8A 1XM1A 3SQEE 5F53A 2BY6X 1C5PA 2QCYA 2PV9B 4I8JA 1C1WH 2FM2A 1AE5A 2ZG0H 2BY5X 1B5GH 4K3JA 2A5IA 1EZXC 1NRNH 3F1SB 2ZIQH 4GLYA 1GI9B 3KYGA 4AOQA 2TGPZ 2ZU5A 4MTBA 2ZDLA 1SGDE 1GMHF 2W6ID 3FOAA 4DCDA 1H4WA 1F7ZA 2OBOA 4IS5A 1H8ED 3MO9A 1SGEE 2PWXA 1W8BH 2UWPA 2F91A 3CNRA 5DP6A 3F2GA 1NRRH 3T25A 1EPTA 3NZIA 1CGHA 1B0EA 2WINI 4X2YA 3GY5A 1DFPA 1JMOH 4O3UA 5GXPA 2P16A 4HZHA 2OTVA 1F5LA 2RG3A 1YPJH 3M36A 2ZCKP 1MU8B 3LJOA 2CHAC 1NFWA 1O5EH 4F48B 1DLKB 3M7QA 1THSH 1E1RD 3L33A 3KYFA 1WU1A 1RXPA 3RXIA 2BZ6H 2CF8H 3UQOA 4XDEA 4BTUB 1QCPA 4DJZB 1G36A 3VEQB 1JRTA 2BDGA 2RDEA 4AYYB 2XC0A 4TPYA 1O3AA 4XSKU 1UMAH 1DOJA 1EX3A 1KXAA 1DWEH 1GCTC 4GHTA 1GI8B 1VCQA 3D62A 2LPRA 4GSOA 2RA3A 5A0CA 1RIWC 4DIHH 2AIQA 5EW1H 4ZMAH 2BDHA 2L6OA 1KXDA 1GI1A 2XNIA 1ELTA 2QA9E 3GS9A 2TBSA 1O38A 5EOKA 2BZAA 3GCTF 3F9EA 1F2SE 3F6UH 1FY5A 3NUMA 3E0NB 1BIOA 4Q7ZA 1ETSH 3PRDA 4MNVA 1HUTH 3I78A 3VB4A 1YLCA 2F9BH 3SU1A 1IOEA 1TBRH 2JETB 4B74A 4Y8XA 3DFLA 3RLWH 3MFJA 4CHAC 1K28D 5LH8A 2VWMA 1TA6A 2ASUB 2JETC 3BTTE 3F0PA 5JBBS 2SGQE 3SZEA 1MUEB 2V35A 3LGUA 1TPAE 3T28A 2HGTH 3PO1B 2GVFA 3SZNA 5F03A 3DSGA 1YPKH 2FEQH 3N99A 1SGFG 2J92A 4RI0A 3QLPH 1C5ZB 2EY4C 2YMSB 1LKAA 3AAUA 2J4IA 1VCWA 1JWTA 1ZMLA 2WV5A 1SGFA 5BRRE 2JH0D 1GJ5H 3O8BA 3KCGH 4GHQA 2YMSC 2O8LA 3KQDA 5FBIA 3ODDA 1GJ7B 1C9TA 3CS0A 1O2QA 1EJNA 1KLIH 2KAIB 1A2CH 1DSTA 2P3TB 1CHGA 4K8BA 1C2DA 5HM2A 3FZDA 1BT7A 1O33A 4XBCA 3L6PA 5TCCA 4IMZA 1GBKA 2AGIX 2GCHF 4HGCA 3RMMH 3SJIA 2PGQB 1BRCE 1OWDA 1AZZA 1TBZH 2H2ZA 3V7TA 2ZHEH 1A1RA 2ODPA 4B2AA 2FPZA 2FS8A 3ZV9A 3HK6B 5E8EH 2W5EA 1ZHMA 1E38B 3EA7A 4DG4A 3SJOA 1AU8A 1MTSA 1QFKH 2HLDD 2GT7A 1TGTA 3TNSA 1E0FD 1ZHPA 1O3JA 1P3EA 4IW4E 4O03A 1GWAA 1VJ9U 1VGCC 1DPOA 5C67A 3BIUH 4AGJA 2H5DA 3ZZDA 1AB9C 1V2KT 1DXWA 1H8HD 4DW2U 2GJGA 1CVWH 2J5UA 4PROA 4DVAU 1OYTH 2Y5GA 4Q63A 2XWBI 2A7JA 3U69H 4DT7B 3SHAH 3VB5A 4M9FA 1XVOA 2BX3A 3RXFA 3GCHC 1LCYA 1KXBA 2XC5A 2B5TB 5C5OA 3TGIE 1GJBB 1Y3WA 3OFND 5DG6A 3GY7A 7LPRA 3ZZCA 4VGCB 4IGDA 1DITH 4JZEH 1WYKA 3DD2H 4LK4A 1LO6A 1UTOA 1XXFA 1MCTA 2WPIS 1PPEE 1SFQB 2ZDMA 3RXJA 5JBAS 1A5HA 2QYIA 3BTQE 3QWCH 1LPGB 1FQ3A 1V3XA 1B7XB 4ABFA 2OD3B 3VXEH 2ODYB 1D6WA 4JMYA 7ESTE 3SGQE 1C1SA 1YY3A 4UEHH 3E90B 4MG3A 2BB4A 2BOKA 2FOFA 1ABIH 1QQ4A 3VGCC 1C1NA 2UUYA 2VVUA 3LGYA 1YCPM 4JK5A 3W1EA 3S7KB 2XXLA 2F43B 2ZDAH 5J4QA 3OEHD 3RXBA 1BCUH 4IBLH 4TY7A 4WH8A 4I8LA 1O31A 1HBTH 2FOHA 1T4UH 3TJNA 1GJ9B 2AYWA 3WWBA 3UB0A 3MWIU 5TJXA 2P3FH 2H9TH 3MHWU 2OLGA 1EFRD 2Z6BD 5JPMH 1UCYK 1RTKA 3TH4H 1QL9A 1IQEA 1YWUA 1SG8B 2ZU3A 3F68H 1NPMA 1TALA 3A82A 1C5SA 1ZGVA 1W10U 1O2NA 1UTLM 5CMXH 5DP3A 3A89A 2HNTC 2GP9B 1E36B 3FP8E 3RM2H 3TH3H 4CBOA 4E06H 1Z7KA 4X1QU 3A81A 4KELA 3PV4A 3NXPA 1ZYOA 9ESTA 2V3HH 1N6XA 1O2PA 3M5MA 5EODA 1FONA 2Y82A 1IQIA 1WAYB 4ASUD 1MQ5A 3V13A 2B8OH 5H4IB 1L4ZA 1DICA 2Y5FA 1EQ9A 2FLRH 2FTLE 4X1NU 1QA0A 1S6FA 2IOTA 3PTBA 3TK6A 1O2XA 1AWFH 5I25A 2O8MA 2VIVA 3OY6U 4YZUA 5EQQA 1LPKB 2XYAA 3OAAD 5FX6A 2ANYA 1GJ6A 3T62A 2HPPH 3D49H 1ZSKA 2JDID 1K0HA 2A4RA 4GVUA 4BTIB 2LNCA 5L2ZH 2ZGJA 2CHAB 1EZUC 1CA0C 3KQEA 1OWJA 5DPAA 3MI4A 1D3TB 2OCVB 3Q3KA 3MU0A 4D7FA 4WY3A 1C4V2 1FI8A 1K1IA 1XMNB 4YT6H 4JZFH 1CA0B 4Q80A 1TOCB 1G37A 1YPHC 2V7QD 5K7RA 1K1JA 1XUIA 1NFUA 1HAGE 1NY22 1A0LA 5C94A 1GCDA 4CR9A 4R0IA 1DSUA 3F2HA 3LH1A 2FWWA 4X8UH 1ID5H 2FI5E 1SB1H 1LQEA 4INKA 3S69A 2P93A 1SQAA 3BEIB 5DP8A 1G2MA 4BAMB 2RDLA 1O3EA 1O32A 4P00A 1QZ8A 2ZC9H 4K8YA 3ZVDA 1GBEA 1K2I1 2ZTYA 3BN9A 3FANA 2A5KA 1TX8A 2WV9A 2Z9GA 1C2HA 1SL3A 3SW2B 1GJCB 3EE7A 1O37A 2WSSD 1VR1H 4X2VA 1P04A 1GHVH 2P94A 3QN7A 2ZCHP 2WZQA 1MKXK 4ZKRU 4OGXA 1MKXH 3URDA 2FP7B 3RXVA 4BNRA 1S0RA 2STBE 4NA8A 1TPPA 4TPIZ 3STJA 1KTSB 5A8YA 3PO1C 4XD7D 4MPVA 2QXJA 1HV7A 1XVMA 3UNQA 3WW7A 3ZYEA 1SFIA 1FPHH 4FUIA 1GI7B 3PMJA 3HK3B 4B2BA 4ABHA 3F3BA 2NWNA 3OE7D 2PKAB 3PLPA 9LPRA 3SU4A 1N8OB 3KEEA 1WQSA 3P6ZB 2Y81A 2SGDE 2Y80A 1QBNA 1N1LA 4AFUA 2ZTZA 2VVVA 1LVMA 2LP6A 4Y0YE 1HAVB 4I33A 5IDKA 1V2TT 2R2MB 3LOXA 2Z94A 1VKYA 1DDJA 1J14A 2ALVA 4A1XA 4HG6A 2VWLA 4FU8A 1AKSA 3MMGA 3PV2A 1LPZB 2QXHA 4ZAEA 3TVJB 2IJD1 1SQRA 3M61U 2BD3A 1P03A 5F8XA 2FYQA 2XNDD 6ESTA 1V2NT 3DSPA 1S6HA 1AIXH 3H5CB 4UFFH 5E0JA 3GCHB 3GISB 3URCA 2AHME 2NU2E 1HJ8A 1CHOF 1XUGA 2FOMB 1UTNA 1H8DH 1T8MA 5JBTA 2B7DH 4UONA 1JBUH 3I77A 3LONA 4F55A 1HAOH 1C1PA 2O8WA 1V2MT 4NFFA 1AVGH 2LELA 3M5LA 4E7RG 2WPJS 3BEUA 2J97A 2PTCE 2ZZUH 4K69A 1FPCH 4FUCA 4MQAA 3LGVA 2ZO3H 2BY8X 1ARCA 5EG4A 1UVSH 1C5OH 3E8LA 4YT7H 1O2TA 1O5DH 4X1RU 3ATLA 5FXLA 2OC1A 3TNTA 1K1OA 2YNAA 1QURH 1THRH 4K1SA 4JYUH 5ETXA 2XCNA 2HRVA 1QB6A 3MH7A 3ELAH 1AHTH 2UUKB 2YMSD 3AAVA 1PYTD 3ZZ9A 1C2EA 2GZ9A 1MAXA 2G4TA 3S9AA 2PKSC 3BF6H 1XUKA 1A46H 4NA9H 1BMLA 1ZR0A 1V2WT 1O2OA 3RXDA 2VIWA 4U01A 3RC6A 4Y0ZE 2FOGA 3LGWA 2OUAA 1C2MA 1HFDA 2F9UA 1WV7H 2A32A 5EGMA 2XWAA 2R3YA 4JYVH 1EATA 1ZSJA 2WHXA 3GY3A 2OXSA 3EDXB 1MKWK 2HPQH 4YM9A 6CHAB 2GD4B 4FUEA 4ZKNU 1P9UA 2P3UB 2VJ1A 1QRZA 3RU4T 3SV8A 1YPLH 3MH5A 4NSYA 4ZH8A 1QB1A 1D3QB 3UUZA 1H9IE 2OINA 4JZIA 2H5CA 1MCVA 2VVCA 4WH6A 2BD8A 2GX4A 2KCYA 2FMJA 2FI4E 1UCYH 2A2XH 1YCPK 4THNH 2BLQA 3MU8A 3KQ5A 3QX5H 1FMGA 1T7CA 5AFYH 5EXMA 1P2KA 2OQUA 4IC6A 1TWXB 1H9LB 1KDQB 1UHBA 4FUJA 1UW7A 3IG6B 2A4OA 1V2VT 2BQ6B 3SU3A 2PKAA 1RGQA 3DT0H 1W0JD 2FODA 2P59A 1LHEH 4X1SU 3GCNA 4AG2A 5JDUB 3SV2H 3SHCH 1H9HE 1BTPA 4FUDA 1GBIA 4J1YA 1O3MA 1BOQA 3FP6E 2BLVA 2TRMA 3RXRA 3RXPA 2AMQA 1ZRBA 1GCTB 2KX4A 4ZUHA 8LPRA 5CHAB 3OU0A 1TGCA 1TAWA 2BVXH 1ELCA 3PV5A 1TPSA 4OM9A 1A4WH 2ZCLP 4DT4A 5A8XA 5GDSH 2BQWB 1D3DB 1O5BB 4WJG2 1G3BA 2D8WA 3LDXH 2A2QH 2AIPA 4H4FA 3LC5A 1QY6A 4NCYA 3ZZ5A 1FN6A 1NC6A 1GBLA 1GBTA 4WVPE 3SNCA 1GDQA 2VH6A 3E91A 4FVBA 1XKBC 4WMFA 3FZZA 1XX9A 4GCHG 1V2UT 1SGNE 2I6SA 1ZZZA 1GHAG 8GCHG 1YBWA 4NWKA 4GPGA 3MQKC 2KZ4A 1C5QA 5A8ZA 1UTPA 2JH6D 3NCLA 3M3TA 1NROH 3RU4E 2ANKH 2BD5A 3TIUA 3ODFA 1DUAA 4HI3A 1O2HA 3H7TA 1MAYA 4M7GA 1OX1A 6GCHG 1D9IA 3F2FA 5SGAE 3RMNH 1W3CA 1G9IE 1VCPA 3KHVA 1DWDH 4ABEA 5E0HA 3PWBA 4OS7A 5KEDA 4LZ1H 1MZDA 3STIA 1IQKA 5C1XA 5LGOA 2SGPE 1EPTC 2ZU4A 1P2QA 1S84A 2CMYA 4B6FA 3OTJE 1SLWB 1KLTA 1UK2A 2NU3E 3SU5A 1KTTB 2XC4A 4KTCA 2BTCE 2KR7A 1EUFA 2ZDNA 3SU2A 5L30H 2W26A 1O5FH 3AASA 4YXWD 1MABB 4O9VA 1FAKH 1BMFD 1WQVH 3BTDE 1NBMD 5DO4H 3PMHB 3BTHE 4CRFA 1TONA 2A1DB 3M7UA 1ARBA 4LZ4B 1CT4E 3K2UA 1K1MA 3AW1A 4A1VA 4A92A 1YPMH 3BV9B 3JZ2B 1JRSA 1IHTH 3V3MA 1F0UA 2ZHQH 1Y3UA 1KDQA 1UHBB 1UVTH 8ESTE 3ATMA 4MPWA 1AKSB 1QBVH 1KSNA 1EP6A 3VG8A 1HAYB 1AZ8A 2QN5T 1P12E 3MNCA 2G4UA 1LVYA 1W11U 4TYDA 2ESTE 1O3IA 4FUFA 1TMUH 1EASA 2Z9KA 3GYMA 3ZVFA 2FDAA 4D7GA 5GWZA 4CHAB 3SYJA 1NRQH 1G3CA 1QR3E 2XTTB 1FY3A 1Y3XA 2FX4A 1ANBA 4UDWH 4A6LA 2NU4E 2ZFSA 3MYWA 1QGFA 2JIZD 1O2MA 1O3KA 3PLKA 3SNDA 4X1PU 4X8SH 3OEED 3FP7E 1UK4A 1FY1A 3P8GA 1IQJA 1Z8JB 1QNJA 3DCLA 3MNBA 4Q2KA 5C0TA 1YPHE 1ANEA 1ELBA 1KXCA 1L4DA 2C8YB 2WPDD 1OS8A 1P3CA 3SJ9A 3UWIA 3QK1A 3S9CA 4OS1A 5FHTA 5EU8A 3BTEE 3VGCB 5HIZA 3PYHA 4TWYA 2SGAA 3BTGE 2M5TA 4NA7A 3BG8A 1KYNA 1QHRB 4CR5A 3SU0A 2ZECA 2A7CA 2ZDVH 1QB9A 4AB9A 3GICB 2GZ8A 3NWUA 4DGJA 5C0UA 1SOZA 3N7EA 1F0TA 1YPEH 1P10A 1K21H 1CA8B 2YOLA 5LPEA 1HAHH 2BY9X 2P8OB 1ZMNA 2GCHG 1SHYA 3LPRA 1J15A 2GZ7A 4AZ2B 4YLQH 1C2JA 1LVOA 4XE4A 1DXPA 1TNKA 1ZPBA 3M7TA 4H6SB 4ASHA 1TOMH 2A4QA 3BIVH 1OHHD 2O9QA 1NFYA 1IQGA 3UY9A 5B6LA 6LPRA 1C5VA 3PMBB 3M37A 3MNXA 1ELAA 1GDUA 1WDIA 3KF2A 2VIOA 3EQ0H 3GY4A 5AF9H 4OGYA 1EOJA 1G30B 2O8UA 2UWLA 1O3HA 4X8TH 1Q3XA 4X2XA 1NO9H 1NBME 1GMDG 3NKKA 2ZFQH 5EPYA 5FAHA 3S7HB 2AGGX 4KTUA 2D1JA 1GL0E 3ZVAA 4INLA 4D9QA 4XRNA 1PFXC 4YTAA 3Q76A 2QE7D 3UQVA 1MTVA 1CGIE 1GMDF 2UUFB 1Y8TA 1E37B 1S6LA 2C3SA 3E1XB 4DURA 1HXFH 2PUXB 1AFEH 2KCAA 2ZPQA 5DJ7A 2CXVA 1O2JA 1C2GA 4RSPA 1FLEE 2OQ5A 1HRTH 3ITIA 1YGCH 4CRBA 2CV3A 1SMFE 1O2GH 4BTTB 1F5RA 2VWNA 1MZAA 2ZGXH 1TNGA 4NIXA 2QXGA 3TGJE 1OYQA 3OY5U 4B2CA 1TNJA 1GG6C 1BHXB 3UFAA 3RXLA 4FU7A 4UD9H 4O3TA 1O2RA 2SGFE 4WXVA 3UTUH 3UAIC 2SFAA 1SR5C 3C1KA 1C2KA 3FVFB 3HGNA 3LC3A 4YLUA 5DK1A 4TY6A 1HAVA 1BA8B 3P95A 3SUFA 2BYAX 1FV9A 1FIWA 3S0NA 2Q6DA 3T26A 1MMJN 3AK5A 1ETTH 3DA9B 1LKBA 4FUGA 1HLTH 3VFEA 2A4GA 2FI3E 2Z3CA 1CBWC 3UOUA 4ABGA 4DIIH 1F0SA 3B8JA 2PUQH 1H1BA 1K22H 1W12U 2F9VA 1HJAB 2BD2A 1XUFA 2Z9JA 1PPCE 3B23B 1TNLA 2FOCA 1TGNA 2H6MA 1ABJH 1ELFA 1PPGE 3PB1E 3A7WA 1OWHA 5HMAA 4OS6A 3BG4B 4X6MA 1GHXH 1W0YH 1SGQE 5BPEA 2BHGA 4XOJA 5A0AE 3K9XB 4DY7B 1O3CA 2R0KA 2EI8A 3SI4H 3LGIA 3UR9A 3UREA 4A5TS 1S82A 3Q77A 5ABWA 4FXGH 1MQ6A 4B6EA 1HGTH 1SVPA 4Y79A 3F9HA 1EP5A 1DWCH 4K60A 4RT1A 1GI6A 2AERH 1EPTB 2ZNKH 3SGAE 2AMDA 2ZDKA 5DSFA 3ZVEA 4TSFD 3F0OA 3A80A 1P57B 2GT8A 3U1JB 1T32A 1C2LA 3KIDU 5A0BA 3VXFH 3QGNB 1IAUA 1UO6A 1NESE 2YNBA 2A5AA 2GV6A 3H09A 1QJ7B 2AGEX 1EJAA 2ZGBH 3N7OA 1V2QT 4Y8ZA 4Q4LA 2Z3DA 4RT0A 2VWOA 5EXNA 2A45B 1GI3A 5E2OA 5I46H 3FFGA 2PLXA 1GJDB 4K1EA 1CGJE 3PROA 1DS2E 4Y76A 1PPBH 3TJUA 1P05A 2AEIH 2BOHB 1JXPA 1TB6H 4I32A 1IQHA 3A85A 3MU1A 2HLCA 4XBBA 4I7YH 1GGDB 2FOAA 1NRSH 1DUEA 3GY6A 2ZKSA 1GBJA 3I29A 3D65E 1W0KD 4I86A 1K9OE 4B71A 2EQNA 2VU8E 1WOFA 3T27A 1E34B 2BD9A 1EJMA 3LJJA 4KKDA 3QZQA 5CE1A 1SOTA 1GDNA 1S5SA 4ABBA 4AX9H 1FY4A 3RMLH 1MTNC 1Y5AT 4KTSA 2G51A 3RXMA 1F0RA 1SQOA 3HPTB 4YOJA 1HAIH 2H1UA 2JJ1D 1ZRKA 1OP8A 1WSSH 3SV7A 3RP2A 3RXOA 4ZHMU 1DM4B 1GJAB 1V2OT 1ACBE 1ELEE 1P2IA 2I6QA 1Z1JA 2W6JD 4BOHA 1O35A 3RXCA 1SC8U 3O8DA 3LT3A 4X0WU 1P06A 1SLVB 5DKMA 3RXTA 4NZLA 5F8TA 2R2WU 1LHCH 1EB2A 1NTPA 4BAKB 4B76A 4D9RA 2WPHS 2ZGHA 1OWIA 1ZPCA 3QTOH 1OXGA 3RU4D 1SGPE 2KM0A 1LHGH 4A1TA 1BRAA 2FYRA 2JKHA 2GKVE 5J4SA 1W0ZU 2G00A 1DE7H 3FKSD 3SJ8A 2JH5D 1E79D 1C1VH 3ENSB 3A86A 2AH4X 1L1NA 2VGCB 1CSOE 1TNIA 2C90B 2BLWA 4I8HA 2HVYB 2VGCC 4FUHA 3KL6A 4ISLA 2ZFRH 3QDZB 1MD7A 4GAWA 1KY9A 2DE9A 1BRUP 4WWYA 3QGJA 1COWD 1S0QA 4H6TA 5FX5A 1INCA 2XW9A 2FS9A 5CHAC 4UFDH 2RCEA 3M5NA 3P17H 2FZZA 3E6PH 1T4VH 1P2JA 1YC0A 2H9HA 1Z8IB 1BBRK 1TBQH 2OK5A 1QQUA 2ZU1A 1BZXE 3SU6A 3OSYA 2IJOB 3HKJB 4ZHLU 1DT2A 3U8RH 1HCGA 4NG9H 1TLDA 4ACBA 2A31A 2PKSB 1AN1E 1TPOA 1W14U 1BBRE 1MTUA 1ANDA 1V2JT 4JCNA 2STAE 4OS2A 1FJSA 2BD7A 1E1QD 2BDAA 1O5CB 5T6FA 1ETRH 1SGCA 1EZSC 4R8TB 3RXGA 2QGRA 1EAUA 1AFQC 1BTWA 5KECA 3H7OA 1BMMH 1CBWB 1FY8E 2K1QA 1UVPA 4CREA 2PSYA 5C17A 1NS3A 4JZDH 1QL7A 3M3SA 4GUXA 3RXAA 1AFQB 4ABDA 4X8VH 1AUTC 1LDTT 5HXFA 1YYY1 1GHZA 1TRYA 1DANH 3PWCA 5FCKA 4E7NA 1G2LA 1N6YA 3SNEA 1DWBH 3E0PB 5JB9S 2GTBA 2H9EH 4CRDA 2BY7X 2KAIA 2KCOA 3P92A 1GG6B 2K0QA 1OWEA 1H8IH 1FX0B 1Z6EA 1ZJKA 2WYGA 1O2VA 3TU7H 5L2YH 2G5NA 3GY8A 1GMHG 1XKAC 2OP9A 3R0FA 2ZP0H 4OS4A 5C2ZA 4AC9A 3WWFA 1NN6A 1LMWB 3ZIAD 4YOIA 3SUGA 1SHHB 1VITF 3C27B 1JOUB 4NSVA 2EI7A 1UVOA 1BTHH 4BXSA 4ZXYH 5T1VA 5TCAA 3RMOH 2AMPA 2HNTE 1BHXF 1UTMA 1BJUA 2F4LA 4B75A 1C2FA 1LHDH 2W7UA 5HKKD 1VITG 1PQ8A 1ELDE 1V6DA 1ESTA 3PLBA 2OBQA 1FZZA 1P2NA 2WPMS 4OS5A 2TGDA 4BAOB 2UUJB 2HOBA 1GMCF 1SGTA 1O5AB 4XFQA 4Y7BA 3RC4A 5EQSA 1LQDB 3ZVCA 2F9OA 1ELVA 2SNVA 3E16B 3VB7A 5B6OA 4F49A 1RTLA 4AFQA 2GGVB 2Z9LA 2R3UA 1VITH 1T31A 1Z8RA 1V2RT 2OC8A 2GDEH 3DUXH 3DFJA 2CN0H 2FXRA 1K1LA 3FO8D 4NIWA 2BM2A 4K2YA 4XBDA 1QRXA 4RKOB 1SI5H 1AE8H 3MO6A 5E2PA 3VPKA 2ZFTA 1XUHA 4ISNA 3SJKA 3CP7A 2J38A 3SV9A 5GPIB 1TIOA 1X7AC 2CK3D 4ZKSU 3QUMP 5GIBA 4B73A 2Y6TA 4BAQB 3KNXA 2RA0A 1UTKA 1ZPZA 2ILNA 3IWMA 3S9BA 2NU1E 3A83A 1HB0B 1QBOA 1T8NA 3MH6A 1QL8A 1O5GH 4MDSA 4CRGA 4FVDA 2QAAA 2TGTA 1KIGH 1GHYH 2ULLA 5F6MA 4JK6A 5C20A 4Y11E 1BTYA 3LU9B 2ZA5A 5JBCS 2EA3A 4GCHF 1Y5BT 1GMCG 4ISOA 3SGBE 1P02A 3JZ1B 2ZHWH 1UVUH 4ZXXH 1BB0B 1ZHRA 1O2YA 2WPKS 2Z9IA 2BXTH 3MO3A 5EPNA 3KQCA 4K1TA 1P01A 1P2OA 3W94A 5T3HA 4CH8B 2ZPSA 1MTNB 5L6NH 2ZI2H 3U1IB 2BVSH 4MPUA 1GBMA 3BTFE 4U2WA 1Y3VA 2RFKC 2FO9A 1ZLRA 2QF3A 1ZSLA 4I8GA 1ZTJA 2Y7ZA 4MVNA 2V3MA 5C3NA 2PFEA 1N8OC 1U6QA 1S81A 3SV6A 1MD8A 3R3GB 3PTNA 5T6DA 2C93B 1A0JA 3A84A 1DY8A 4FETA 4TT3D 3RXEA 1A5IA 1O34A 3WY8A 4X6PA 1NU9A 2PSXA 5C1UA 2FOBA 2DUCA 5FPYA 1CE5A 2GDDA 2W7SA 1CT0E 1M9UA 1W13U 3A88A 1C5UA 1HIAB 1D3PB 1AGJA 1Y5UT 2R9PA 3NPSA 4ISIH 1Y3YA 1TABE 1YPGH 1HAXB 5HGGA 1C9PA 1EXFA 1GBCA 3LIWA 4AB8A 1HNEE 2ANMH 2V0BA 3AVZA 1T8OA 2J98A 3UWJH 1V2LT 4P02A 2GMTB 5DP4A 4Z6AH 1EZQA 3TPIZ 3P70B 2J94A 1AQ7A 3TK9A 3M35A 2G81E 5ESBA 5LPFA 4ZROA 1TYNA 3T2NA 3LH3A 3SNBA 1UTJA 1D6RA 3TJVA 2V3OH 4E05H 3K6YA 1AY6H 5EJZA 2ZWLH 1OOKB 2BX4A 3P8NA 6GCHF 1UJ1A 5K0HA 5GCHG 3MH4A 1FXYA 2FESH 1MBMA 2WPLS 1Z71A 4IN1A 1G3DA 1C1QA 2GCTB 3QZRA 4Y71A 4YO9A 4CBNA 4Z1MD 2W3KA 3SBKA 3A87A 4RN6A 7GCHG 3CENA 4JZ1A 4A7IB 1BBRH 1OPHB 1W2KH 2BXUH 4AG1A 5GJ4B 2FLBH 4MLFB 3V12A 3UNSA 1QIXB 2VNTA 1AB9B 1J17T 3MNSA 1WTGH 3RXHA 1PQ5A 4AGKA 2CJIA 5DGJA 3SUEA 4CH2B 5FPTA 3VB3A 3M5OA 1LHFH 3KN2A 1PPHE 3OYPA 1PYTC 5KGOA 2JJ2D 3K65B 1O3GA 3P8FA 1ZTKA 1ZTLA 1C1TA 3KGPA 1FN8A 1QA7A 2W3IA 3HATH 3ZZBA 3A8CA 1NZQH 1A3BH 3F9FA 2Q6GA 4ABJA 1HYLA 3P8OA 3U8OH 4I31A 4TWWA 2B9LA 2XCFA 2QY0B 3RDZA 1WUNH 4AYVB 3B9FH 1GI4A 3GDUA 4FUBA 1HJAC 2EEKA 5EJ1A 1TGSZ 5EIYA 1T8LA 1ORFA 3ZZAA 1E35B 3A7ZA 4ZKOU 2G52A 1C4Y2 4NFEA 5DP9A 1GL1A 3BTKE 2HWLB 3QO6A 1BTZA 1BRBE 3FN8A 1XUJA 1IQMA 2BLOA 5EQRA 2BQ7B 6CHAC 2R0LA 3ZZ7A 1ZOMA 1FIZA 4FOUC 1S85A 2A7HA 1K1PA 3K6ZA 1UTQA 2B0FA 1OP2A 1O36A 4CRCA 4HFPB 1IHSH 1NU7B 1RJXB 2ZPRA 3TLOA 2PGBB 2VINA 3EA8A 3RM0H 3UR6A 3ZZ3A 3ZZ4A 1TX6A 1LTOA 4O97A 1O3FA 1GHAF 2GV7A 2ZQ1A 8GCHF 7KMEH 4IMQA 1C5LH 1ELGA 5IYTA 1C1OA 3QTVH 4WMDA 1ANCA 1NM6A 4LOYH 1SQTA 1KXFA 2QXIA 1SKYE 4MNYA 1Y59T 3ZZ8A 4ACAA 1BTUA 3BTME 1GBBA 1S83A 4D76A 1EKBB 1P11E 2VIDA 3ATKA 2VB0A 4X6OA 1O3NA 4HTCH 1GI5A 2PHBA 2IN2A 1ZGIA 1Q2WA 1BUIA 3DHKH 2ZFFH 3W95A 4IN2A 1NFXA 5EXLA 1BJVA 1VGCB 1C1MA 3A8DA 3KQBA 1LVBA 4F4OC 1TMTH 1Q31A 4K5ZA 8KME2 1PQ7A 1L2EA 2FOEA 5A2MH 2ZU2A 2J2UA 1P2MA 1SGIB 3PMAB 2Y7XA 5EW2H 1GPZA 1C1UH 2VIQA 1EOLA 2BD4A 1O2UA 2VIPA 2XBXA 1P8VC 2ZQ2A 1GGDC 1SPJA 1HXEH 3LKWA 1ESBA 1SGRE 1YLNA 5DP7A 1WXRA 1L1JA 4QT8C 3Q3YA 5LPRA 1TA2A 5AFZH 1AMHA 2QV1A 2HNTF 3MTYA 3Q3XA 1D4PB 3CS7A 3SNAA 1V2PT 5FBEA 4RKJB 2Z3EA 1UK3A 3EGKH 4VGCC 2XBYA 3U9AH 3RXUA 3ZV8A 4MNWA 1EAWA 4NIYA 2PR3A 3OX7U 2FTMA 3SN8A 1BQYA 1J8AA 3T29A 1QRWA 1O3BA 1YF4A 2SNWA 1BMAA 2KCPA 3N7DA 2VH0A 1C1RA 2G55A 1O2SA 4AN7A 1O3DA 1GHWH 3A8BA 1AVWA 1AD8H 1A3EH 4CRAA 2CGAA 1C5MD 4UE7H 1HAPH 1PJPA 2K8IA 4INHA 2QIQA 4JYTA 4Q7XA 4NIVA 3TK5A 4FU9A 1F92A 1GJ4H 3EA9A 2BMGB 1BDAA 1BMNH 2XBWA 2HALA 3O8CA 1RD3B 5GNDA 2Z7FE 1SLXB 3OTPA 3BEFB 1EAXA 1MBQA 4Y10E 2ZFPH 4ZHAA 2XBVA 1MU6B 1FAXA 2Q6FA 3SQHE 3MU4A 4UFGH 3EAJA 4BAHB 1O3LA 2Y5HA 3GDVA 5JYIA 5A09A 3TH2H 1HDTH 2EI6A 2BDBA 5E0GA 2ZTXA 1W7GH 4AFSA 2BVRH 2OC0A 1TQ7B 1CU1A 4B1TA 4BXWA 1AWHB 2F83A 3ZVGA 1O39A 1IQFA 1GVZA 3BG4C 2WYJA 2AS9A 3SI3H 1ZMJA 1C4U2 4KGAA 4ISHH 2TGAA 3ESTA 5FL7D 3UOPA 1TFXA 1RIWB 3UNRA 4LXBH 1BITA 2ZF0H 1JIRA 1HJ9A 4X2WA 5HYOA 1O3PB 3SO3A 1P9SA 1Z6JH 3IITA 4WMEA 2BDYA 3RXKA 1B0FA 3TITA 3SOSA 1CQQA 3RXQA 1VJAU 1OWKA 1O2IA 5AHGH 3ZVBA 5GCHF 1IQNA 1G32B 2J9NA 5PTPA 1C5XB 2IPHA 3TGKE 1OP0A 5T6GA 3O8RA 1EB1H 4AORA 2L74A 4AFZA 2DE8A 1C5RA 3L3TA 1J9CH 4ZCNA 5DP5A 2F3CE 2WUBA 3F9GA 3E3TA 2ALPA 2G5VA 2ZEBA 2PW8H 5ESTE 1A61H 2OC7A 2GMTC 1GVKB 1TQ0B 2C8WB 2F9PA 3D23A 4I8KA 1RTFB 3G01A 3BSQA 2CF9H 1DLEA 1NRPH 2PP6A 1O3OA 4ESTE 1PQAA 3A7VA 5DN6D 1SSXA 3ZZ6A 2D2DA 3LGTA 4NZQA 2A0QB 3FAOA 5FPSA 3UPEA 1BTXA 3V0XA 1MKWH 4BANB 3A7TA 1WTHD 1O2WA 3GYLB 4KP0A 1V2ST 3RXSA 1QJ6B 2TPIZ 4YESB 4WXIA 1GI2A 3PRBA 4Q7YA 1HAZB 1L0ZA 2GCTC 1GHBG 1TGBA 1FDPA 1MH0A 3EE0B 5F8ZA 1AUJA 4SGBE 4D8NA 1AO5A 3SUDA 4UFEH 5C1YA 7GCHF 5G4BA 2IPQX 4DOQA 1GBDA 2BDCA 1YCPH 4YOGA 1YM0A 2C8ZB 1P09A 2ZHDA 2BDIA 2ZHFH 2QF4A 3MOCA 2J95A 5C5NA 1A0HB 1DVAH 2QF0A 1TRMA 4Z0KA 1RRKA 1P0SH 4SGAE 2ANWA 3SORA 1TX7A 2KFWA 3U8TH 1GVLA 1THPB 3MU5A 2D26C 5HIYA 2M2AA 2O8TA 3HGPA 3UIRA 1C5NH 3NRLA 3A8AA 3ATIA 4U32A 1WCZA 4IC5A 1O30A 3U98H 1C5TA 2P8OC 2QF5A 3ZYDA 2UWOA 3GCOA 2J34A 5IK2D 1YLDA 1AVXA 1NT1A 2THFB 3DSOA 1GJ8B 1KLJH 4NGAH 1RFNA 3HKIB 1L1GA 4J2YB 1ZJDA 3TJOA 2TIOA 3GY2A 1A7SA 1FNIA 2ODQA 1IQLA 4H42U 1YKTA 1DX5M 1G3EA 1QJ1B 1GBAA 1GHBF 2VBCA 1SGYE 5AVDA 1KMHB 4MPXA 3GDSA 3A7YA 3BTWE 2HVXA 1PPFE 3RLYH 1J16A 3T5FH 2PTNA 1XXDA 1QTFA 1TMBH 5HM9A 5CDFE 1HPGA 1O0DH 1C2IA 1Z1IA 1TE0A 2F9NA 4Y8YA 1CT2E 1O2ZA 1FUJA 1UCYE 5CHBA 1GBHA 2XOKD 3RC5A 1AI8H 3M3VA 1C5YB 4X6NA 1VZQH 2C4FH 1CHOG 3VB6A 1C5WB 5JB8S 2NU0E 1GI0A 1O2LA 1PPZA 3GOVB 2Q1JA 3RUOA 1W7XH 1EAIA 2WV4A 2C8XB 2V6NA 1OSSA 3ATWA 2WUCA 1JIMA 1A5GH 3NK8A 1O2KA 3AW0A 2J98B 3U28C 4MNXA 2FX6A 2XRCA
chains in the Genus database with same CATH topology
1DXWA 1H8HD 1N1LA 3M5NA 4I32A 5GNDA 2J5UA 3RC4A 2O8MA 3EYDA 5EQQA 5EQSA 5IDKA 2OINA 3OTPA 4I33A 4WH6A 2KCYA 3LOXA 3OAAD 2OK5A 1W0KD 4Q63A 2QF4A 1RTLA 4B6FA 3PRDA 3SU0A 2GGVB 4NWLA 4B71A 3SU6A 1DY9A 2IJOB 2OC8A 2JDID 3SU1A 4A1XA 4M9FA 2A4RA 3PV2A 4B74A 3SUFA 2IJD1 3SU5A 4KTCA 5C0UA 2KFWA 2KR7A 3N7EA 2XNDD 3FO8D 3OFND 3DSPA 3SU3A 3SU2A 3AK5A 1RGQA 4WF8A 5ESBA 5F53A 3F0PA 2A4GA 2P59A 2OC0A 1MABB 1W0JD 2AHME 1SKYE 1CU1A 2FOMB 2M2AA 2YOLA 3SZEA 1BMFD 1E1QD 2V7QD 3NRLA 1NBMD 3SV9A 2F9VA 2FM2A 2JJ1D 4R8TB 5GPIB 2CK3D 2GVFA 3P8NA 4B73A 3SV7A 3KNXA 2QF5A 2K1QA 5C17A 5IK2D 1NS3A 1DXPA 4A1VA 5FL7D 3DSOA 4A92A 3LONA 4F55A 3F2HA 2A4QA 3N99A 4YXWD 3O8CA 2LELA 4JMYA 2W6JD 1OHHD 3M5LA 4Z1MD 4RI0A 2W6ID 2YMSB 3FOAA 3O8DA 2XNIA 5B6LA 2OBOA 1H8ED 3E90B 3PV5A 4OM9A 5GJ4B 4DT4A 3F2GA 3O8BA 3KF2A 3VG8A 2VBCA 2YMSC 3W1EA 2KCOA 4B6EA 2F43B 3OEHD 1KMHB 2K0QA 4WH8A 4B76A 3O8RA 3LKWA 3SUEA 4TYDA 1FX0B 5FPTA 1NBME 2WV9A 2OC1A 3M5OA 3KN2A 3OYPA 1WXRA 5DSFA 5EPYA 3WWBA 2JJ2D 2WSSD 4TSFD 3F0OA 3UB0A 4ZCNA 2KM0A 4K8BA 5ETXA 2XCNA 3SV8A 2QV1A 1EFRD 5CDFE 4A1TA 1BT7A 3WWFA 5EPNA 2YMSD 2OC7A 1E1RD 3L6PA 3SYJA 3ZIAD 3SUGA 3U1JB 3FKSD 2WZQA 1E79D 5CHBA 3U1IB 3P8OA 2QE7D 2FP7B 2XOKD 4NWKA 1A1RA 4I31A 2KZ4A 3RC5A 2XCFA 3H09A 2KCPA 5T1VA 1S6LA 3N7DA 4Q4LA 2JIZD 4U01A 3RC6A 5DN6D 2KCAA 3OEED 2F4LA 4B75A 4XD7D 3M5MA 2HLDD 2F9UA 5FPSA 3WW7A 5EQRA 5HKKD 4ASUD 3SV6A 3F2FA 2WHXA 5H4IB 3DCLA 3F3BA 1DY8A 1W3CA 2K8IA 2OBQA 4FETA 3OE7D 4TT3D 3PRBA 5C0TA 1COWD 3SU4A 3KEEA 2L6OA 3FN8A 3GS9A 5FPYA 2WPDD 1JXPA 3SUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WW7 A;  4ZCN A;  3WWF A;  3WWB A;  5CHB A;  5F53 A; 
#chains in the Genus database with same CATH topology
 2FIR H;  2ZGC A;  1GBF A;  1WBG B;  2EC9 H;  5EJL A;  3EYD A;  1YP9 A;  1K1N A;  2SGE E;  3PM3 A;  1TNH A;  1SBW A;  3Q00 A;  2P95 A;  1F5K U;  4Y6D A;  1ESA A;  1MTW A;  5FCR A;  1TRN A;  4NWL A;  4ABA A;  1DY9 A;  1HIA A;  4ABI A;  1KXE A;  2AFQ B;  1CO7 E;  1Z8G A;  1OKX A;  1RS0 A;  4Y7A A;  1SLU B;  2QC2 A;  3A7X A;  4U30 A;  3GCT G;  2G8T A;  4WF8 A;  1XM1 A;  3SQE E;  5F53 A;  2BY6 X;  1C5P A;  2QCY A;  2PV9 B;  4I8J A;  1C1W H;  2FM2 A;  1AE5 A;  2ZG0 H;  2BY5 X;  1B5G H;  4K3J A;  2A5I A;  1EZX C;  1NRN H;  3F1S B;  2ZIQ H;  4GLY A;  1GI9 B;  3KYG A;  4AOQ A;  2TGP Z;  2ZU5 A;  4MTB A;  2ZDL A;  1SGD E;  1GMH F;  2W6I D;  3FOA A;  4DCD A;  1H4W A;  1F7Z A;  2OBO A;  4IS5 A;  1H8E D;  3MO9 A;  1SGE E;  2PWX A;  1W8B H;  2UWP A;  2F91 A;  3CNR A;  5DP6 A;  3F2G A;  1NRR H;  3T25 A;  1EPT A;  3NZI A;  1CGH A;  1B0E A;  2WIN I;  4X2Y A;  3GY5 A;  1DFP A;  1JMO H;  4O3U A;  5GXP A;  2P16 A;  4HZH A;  2OTV A;  1F5L A;  2RG3 A;  1YPJ H;  3M36 A;  2ZCK P;  1MU8 B;  3LJO A;  2CHA C;  1NFW A;  1O5E H;  4F48 B;  1DLK B;  3M7Q A;  1THS H;  1E1R D;  3L33 A;  3KYF A;  1WU1 A;  1RXP A;  3RXI A;  2BZ6 H;  2CF8 H;  3UQO A;  4XDE A;  4BTU B;  1QCP A;  4DJZ B;  1G36 A;  3VEQ B;  1JRT A;  2BDG A;  2RDE A;  4AYY B;  2XC0 A;  4TPY A;  1O3A A;  4XSK U;  1UMA H;  1DOJ A;  1EX3 A;  1KXA A;  1DWE H;  1GCT C;  4GHT A;  1GI8 B;  1VCQ A;  3D62 A;  2LPR A;  4GSO A;  2RA3 A;  5A0C A;  1RIW C;  4DIH H;  2AIQ A;  5EW1 H;  4ZMA H;  2BDH A;  2L6O A;  1KXD A;  1GI1 A;  2XNI A;  1ELT A;  2QA9 E;  3GS9 A;  2TBS A;  1O38 A;  5EOK A;  2BZA A;  3GCT F;  3F9E A;  1F2S E;  3F6U H;  1FY5 A;  3NUM A;  3E0N B;  1BIO A;  4Q7Z A;  1ETS H;  3PRD A;  4MNV A;  1HUT H;  3I78 A;  3VB4 A;  1YLC A;  2F9B H;  3SU1 A;  1IOE A;  1TBR H;  2JET B;  4B74 A;  4Y8X A;  3DFL A;  3RLW H;  3MFJ A;  4CHA C;  1K28 D;  5LH8 A;  2VWM A;  1TA6 A;  2ASU B;  2JET C;  3BTT E;  3F0P A;  5JBB S;  2SGQ E;  3SZE A;  1MUE B;  2V35 A;  3LGU A;  1TPA E;  3T28 A;  2HGT H;  3PO1 B;  2GVF A;  3SZN A;  5F03 A;  3DSG A;  1YPK H;  2FEQ H;  3N99 A;  1SGF G;  2J92 A;  4RI0 A;  3QLP H;  1C5Z B;  2EY4 C;  2YMS B;  1LKA A;  3AAU A;  2J4I A;  1VCW A;  1JWT A;  1ZML A;  2WV5 A;  1SGF A;  5BRR E;  2JH0 D;  1GJ5 H;  3O8B A;  3KCG H;  4GHQ A;  2YMS C;  2O8L A;  3KQD A;  5FBI A;  3ODD A;  1GJ7 B;  1C9T A;  3CS0 A;  1O2Q A;  1EJN A;  1KLI H;  2KAI B;  1A2C H;  1DST A;  2P3T B;  1CHG A;  4K8B A;  1C2D A;  5HM2 A;  3FZD A;  1BT7 A;  1O33 A;  4XBC A;  3L6P A;  5TCC A;  4IMZ A;  1GBK A;  2AGI X;  2GCH F;  4HGC A;  3RMM H;  3SJI A;  2PGQ B;  1BRC E;  1OWD A;  1AZZ A;  1TBZ H;  2H2Z A;  3V7T A;  2ZHE H;  1A1R A;  2ODP A;  4B2A A;  2FPZ A;  2FS8 A;  3ZV9 A;  3HK6 B;  5E8E H;  2W5E A;  1ZHM A;  1E38 B;  3EA7 A;  4DG4 A;  3SJO A;  1AU8 A;  1MTS A;  1QFK H;  2HLD D;  2GT7 A;  1TGT A;  3TNS A;  1E0F D;  1ZHP A;  1O3J A;  1P3E A;  4IW4 E;  4O03 A;  1GWA A;  1VJ9 U;  1VGC C;  1DPO A;  5C67 A;  3BIU H;  4AGJ A;  2H5D A;  3ZZD A;  1AB9 C;  1V2K T;  1DXW A;  1H8H D;  4DW2 U;  2GJG A;  1CVW H;  2J5U A;  4PRO A;  4DVA U;  1OYT H;  2Y5G A;  4Q63 A;  2XWB I;  2A7J A;  3U69 H;  4DT7 B;  3SHA H;  3VB5 A;  4M9F A;  1XVO A;  2BX3 A;  3RXF A;  3GCH C;  1LCY A;  1KXB A;  2XC5 A;  2B5T B;  5C5O A;  3TGI E;  1GJB B;  1Y3W A;  3OFN D;  5DG6 A;  3GY7 A;  7LPR A;  3ZZC A;  4VGC B;  4IGD A;  1DIT H;  4JZE H;  1WYK A;  3DD2 H;  4LK4 A;  1LO6 A;  1UTO A;  1XXF A;  1MCT A;  2WPI S;  1PPE E;  1SFQ B;  2ZDM A;  3RXJ A;  5JBA S;  1A5H A;  2QYI A;  3BTQ E;  3QWC H;  1LPG B;  1FQ3 A;  1V3X A;  1B7X B;  4ABF A;  2OD3 B;  3VXE H;  2ODY B;  1D6W A;  4JMY A;  7EST E;  3SGQ E;  1C1S A;  1YY3 A;  4UEH H;  3E90 B;  4MG3 A;  2BB4 A;  2BOK A;  2FOF A;  1ABI H;  1QQ4 A;  3VGC C;  1C1N A;  2UUY A;  2VVU A;  3LGY A;  1YCP M;  4JK5 A;  3W1E A;  3S7K B;  2XXL A;  2F43 B;  2ZDA H;  5J4Q A;  3OEH D;  3RXB A;  1BCU H;  4IBL H;  4TY7 A;  4WH8 A;  4I8L A;  1O31 A;  1HBT H;  2FOH A;  1T4U H;  3TJN A;  1GJ9 B;  2AYW A;  3WWB A;  3UB0 A;  3MWI U;  5TJX A;  2P3F H;  2H9T H;  3MHW U;  2OLG A;  1EFR D;  2Z6B D;  5JPM H;  1UCY K;  1RTK A;  3TH4 H;  1QL9 A;  1IQE A;  1YWU A;  1SG8 B;  2ZU3 A;  3F68 H;  1NPM A;  1TAL A;  3A82 A;  1C5S A;  1ZGV A;  1W10 U;  1O2N A;  1UTL M;  5CMX H;  5DP3 A;  3A89 A;  2HNT C;  2GP9 B;  1E36 B;  3FP8 E;  3RM2 H;  3TH3 H;  4CBO A;  4E06 H;  1Z7K A;  4X1Q U;  3A81 A;  4KEL A;  3PV4 A;  3NXP A;  1ZYO A;  9EST A;  2V3H H;  1N6X A;  1O2P A;  3M5M A;  5EOD A;  1FON A;  2Y82 A;  1IQI A;  1WAY B;  4ASU D;  1MQ5 A;  3V13 A;  2B8O H;  5H4I B;  1L4Z A;  1DIC A;  2Y5F A;  1EQ9 A;  2FLR H;  2FTL E;  4X1N U;  1QA0 A;  1S6F A;  2IOT A;  3PTB A;  3TK6 A;  1O2X A;  1AWF H;  5I25 A;  2O8M A;  2VIV A;  3OY6 U;  4YZU A;  5EQQ A;  1LPK B;  2XYA A;  3OAA D;  5FX6 A;  2ANY A;  1GJ6 A;  3T62 A;  2HPP H;  3D49 H;  1ZSK A;  2JDI D;  1K0H A;  2A4R A;  4GVU A;  4BTI B;  2LNC A;  5L2Z H;  2ZGJ A;  2CHA B;  1EZU C;  1CA0 C;  3KQE A;  1OWJ A;  5DPA A;  3MI4 A;  1D3T B;  2OCV B;  3Q3K A;  3MU0 A;  4D7F A;  4WY3 A;  1C4V 2;  1FI8 A;  1K1I A;  1XMN B;  4YT6 H;  4JZF H;  1CA0 B;  4Q80 A;  1TOC B;  1G37 A;  1YPH C;  2V7Q D;  5K7R A;  1K1J A;  1XUI A;  1NFU A;  1HAG E;  1NY2 2;  1A0L A;  5C94 A;  1GCD A;  4CR9 A;  4R0I A;  1DSU A;  3F2H A;  3LH1 A;  2FWW A;  4X8U H;  1ID5 H;  2FI5 E;  1SB1 H;  1LQE A;  4INK A;  3S69 A;  2P93 A;  1SQA A;  3BEI B;  5DP8 A;  1G2M A;  4BAM B;  2RDL A;  1O3E A;  1O32 A;  4P00 A;  1QZ8 A;  2ZC9 H;  4K8Y A;  3ZVD A;  1GBE A;  1K2I 1;  2ZTY A;  3BN9 A;  3FAN A;  2A5K A;  1TX8 A;  2WV9 A;  2Z9G A;  1C2H A;  1SL3 A;  3SW2 B;  1GJC B;  3EE7 A;  1O37 A;  2WSS D;  1VR1 H;  4X2V A;  1P04 A;  1GHV H;  2P94 A;  3QN7 A;  2ZCH P;  2WZQ A;  1MKX K;  4ZKR U;  4OGX A;  1MKX H;  3URD A;  2FP7 B;  3RXV A;  4BNR A;  1S0R A;  2STB E;  4NA8 A;  1TPP A;  4TPI Z;  3STJ A;  1KTS B;  5A8Y A;  3PO1 C;  4XD7 D;  4MPV A;  2QXJ A;  1HV7 A;  1XVM A;  3UNQ A;  3WW7 A;  3ZYE A;  1SFI A;  1FPH H;  4FUI A;  1GI7 B;  3PMJ A;  3HK3 B;  4B2B A;  4ABH A;  3F3B A;  2NWN A;  3OE7 D;  2PKA B;  3PLP A;  9LPR A;  3SU4 A;  1N8O B;  3KEE A;  1WQS A;  3P6Z B;  2Y81 A;  2SGD E;  2Y80 A;  1QBN A;  1N1L A;  4AFU A;  2ZTZ A;  2VVV A;  1LVM A;  2LP6 A;  4Y0Y E;  1HAV B;  4I33 A;  5IDK A;  1V2T T;  2R2M B;  3LOX A;  2Z94 A;  1VKY A;  1DDJ A;  1J14 A;  2ALV A;  4A1X A;  4HG6 A;  2VWL A;  4FU8 A;  1AKS A;  3MMG A;  3PV2 A;  1LPZ B;  2QXH A;  4ZAE A;  3TVJ B;  2IJD 1;  1SQR A;  3M61 U;  2BD3 A;  1P03 A;  5F8X A;  2FYQ A;  2XND D;  6EST A;  1V2N T;  3DSP A;  1S6H A;  1AIX H;  3H5C B;  4UFF H;  5E0J A;  3GCH B;  3GIS B;  3URC A;  2AHM E;  2NU2 E;  1HJ8 A;  1CHO F;  1XUG A;  2FOM B;  1UTN A;  1H8D H;  1T8M A;  5JBT A;  2B7D H;  4UON A;  1JBU H;  3I77 A;  3LON A;  4F55 A;  1HAO H;  1C1P A;  2O8W A;  1V2M T;  4NFF A;  1AVG H;  2LEL A;  3M5L A;  4E7R G;  2WPJ S;  3BEU A;  2J97 A;  2PTC E;  2ZZU H;  4K69 A;  1FPC H;  4FUC A;  4MQA A;  3LGV A;  2ZO3 H;  2BY8 X;  1ARC A;  5EG4 A;  1UVS H;  1C5O H;  3E8L A;  4YT7 H;  1O2T A;  1O5D H;  4X1R U;  3ATL A;  5FXL A;  2OC1 A;  3TNT A;  1K1O A;  2YNA A;  1QUR H;  1THR H;  4K1S A;  4JYU H;  5ETX A;  2XCN A;  2HRV A;  1QB6 A;  3MH7 A;  3ELA H;  1AHT H;  2UUK B;  2YMS D;  3AAV A;  1PYT D;  3ZZ9 A;  1C2E A;  2GZ9 A;  1MAX A;  2G4T A;  3S9A A;  2PKS C;  3BF6 H;  1XUK A;  1A46 H;  4NA9 H;  1BML A;  1ZR0 A;  1V2W T;  1O2O A;  3RXD A;  2VIW A;  4U01 A;  3RC6 A;  4Y0Z E;  2FOG A;  3LGW A;  2OUA A;  1C2M A;  1HFD A;  2F9U A;  1WV7 H;  2A32 A;  5EGM A;  2XWA A;  2R3Y A;  4JYV H;  1EAT A;  1ZSJ A;  2WHX A;  3GY3 A;  2OXS A;  3EDX B;  1MKW K;  2HPQ H;  4YM9 A;  6CHA B;  2GD4 B;  4FUE A;  4ZKN U;  1P9U A;  2P3U B;  2VJ1 A;  1QRZ A;  3RU4 T;  3SV8 A;  1YPL H;  3MH5 A;  4NSY A;  4ZH8 A;  1QB1 A;  1D3Q B;  3UUZ A;  1H9I E;  2OIN A;  4JZI A;  2H5C A;  1MCV A;  2VVC A;  4WH6 A;  2BD8 A;  2GX4 A;  2KCY A;  2FMJ A;  2FI4 E;  1UCY H;  2A2X H;  1YCP K;  4THN H;  2BLQ A;  3MU8 A;  3KQ5 A;  3QX5 H;  1FMG A;  1T7C A;  5AFY H;  5EXM A;  1P2K A;  2OQU A;  4IC6 A;  1TWX B;  1H9L B;  1KDQ B;  1UHB A;  4FUJ A;  1UW7 A;  3IG6 B;  2A4O A;  1V2V T;  2BQ6 B;  3SU3 A;  2PKA A;  1RGQ A;  3DT0 H;  1W0J D;  2FOD A;  2P59 A;  1LHE H;  4X1S U;  3GCN A;  4AG2 A;  5JDU B;  3SV2 H;  3SHC H;  1H9H E;  1BTP A;  4FUD A;  1GBI A;  4J1Y A;  1O3M A;  1BOQ A;  3FP6 E;  2BLV A;  2TRM A;  3RXR A;  3RXP A;  2AMQ A;  1ZRB A;  1GCT B;  2KX4 A;  4ZUH A;  8LPR A;  5CHA B;  3OU0 A;  1TGC A;  1TAW A;  2BVX H;  1ELC A;  3PV5 A;  1TPS A;  4OM9 A;  1A4W H;  2ZCL P;  4DT4 A;  5A8X A;  5GDS H;  2BQW B;  1D3D B;  1O5B B;  4WJG 2;  1G3B A;  2D8W A;  3LDX H;  2A2Q H;  2AIP A;  4H4F A;  3LC5 A;  1QY6 A;  4NCY A;  3ZZ5 A;  1FN6 A;  1NC6 A;  1GBL A;  1GBT A;  4WVP E;  3SNC A;  1GDQ A;  2VH6 A;  3E91 A;  4FVB A;  1XKB C;  4WMF A;  3FZZ A;  1XX9 A;  4GCH G;  1V2U T;  1SGN E;  2I6S A;  1ZZZ A;  1GHA G;  8GCH G;  1YBW A;  4NWK A;  4GPG A;  3MQK C;  2KZ4 A;  1C5Q A;  5A8Z A;  1UTP A;  2JH6 D;  3NCL A;  3M3T A;  1NRO H;  3RU4 E;  2ANK H;  2BD5 A;  3TIU A;  3ODF A;  1DUA A;  4HI3 A;  1O2H A;  3H7T A;  1MAY A;  4M7G A;  1OX1 A;  6GCH G;  1D9I A;  3F2F A;  5SGA E;  3RMN H;  1W3C A;  1G9I E;  1VCP A;  3KHV A;  1DWD H;  4ABE A;  5E0H A;  3PWB A;  4OS7 A;  5KED A;  4LZ1 H;  1MZD A;  3STI A;  1IQK A;  5C1X A;  5LGO A;  2SGP E;  1EPT C;  2ZU4 A;  1P2Q A;  1S84 A;  2CMY A;  4B6F A;  3OTJ E;  1SLW B;  1KLT A;  1UK2 A;  2NU3 E;  3SU5 A;  1KTT B;  2XC4 A;  4KTC A;  2BTC E;  2KR7 A;  1EUF A;  2ZDN A;  3SU2 A;  5L30 H;  2W26 A;  1O5F H;  3AAS A;  4YXW D;  1MAB B;  4O9V A;  1FAK H;  1BMF D;  1WQV H;  3BTD E;  1NBM D;  5DO4 H;  3PMH B;  3BTH E;  4CRF A;  1TON A;  2A1D B;  3M7U A;  1ARB A;  4LZ4 B;  1CT4 E;  3K2U A;  1K1M A;  3AW1 A;  4A1V A;  4A92 A;  1YPM H;  3BV9 B;  3JZ2 B;  1JRS A;  1IHT H;  3V3M A;  1F0U A;  2ZHQ H;  1Y3U A;  1KDQ A;  1UHB B;  1UVT H;  8EST E;  3ATM A;  4MPW A;  1AKS B;  1QBV H;  1KSN A;  1EP6 A;  3VG8 A;  1HAY B;  1AZ8 A;  2QN5 T;  1P12 E;  3MNC A;  2G4U A;  1LVY A;  1W11 U;  4TYD A;  2EST E;  1O3I A;  4FUF A;  1TMU H;  1EAS A;  2Z9K A;  3GYM A;  3ZVF A;  2FDA A;  4D7G A;  5GWZ A;  4CHA B;  3SYJ A;  1NRQ H;  1G3C A;  1QR3 E;  2XTT B;  1FY3 A;  1Y3X A;  2FX4 A;  1ANB A;  4UDW H;  4A6L A;  2NU4 E;  2ZFS A;  3MYW A;  1QGF A;  2JIZ D;  1O2M A;  1O3K A;  3PLK A;  3SND A;  4X1P U;  4X8S H;  3OEE D;  3FP7 E;  1UK4 A;  1FY1 A;  3P8G A;  1IQJ A;  1Z8J B;  1QNJ A;  3DCL A;  3MNB A;  4Q2K A;  5C0T A;  1YPH E;  1ANE A;  1ELB A;  1KXC A;  1L4D A;  2C8Y B;  2WPD D;  1OS8 A;  1P3C A;  3SJ9 A;  3UWI A;  3QK1 A;  3S9C A;  4OS1 A;  5FHT A;  5EU8 A;  3BTE E;  3VGC B;  5HIZ A;  3PYH A;  4TWY A;  2SGA A;  3BTG E;  2M5T A;  4NA7 A;  3BG8 A;  1KYN A;  1QHR B;  4CR5 A;  3SU0 A;  2ZEC A;  2A7C A;  2ZDV H;  1QB9 A;  4AB9 A;  3GIC B;  2GZ8 A;  3NWU A;  4DGJ A;  5C0U A;  1SOZ A;  3N7E A;  1F0T A;  1YPE H;  1P10 A;  1K21 H;  1CA8 B;  2YOL A;  5LPE A;  1HAH H;  2BY9 X;  2P8O B;  1ZMN A;  2GCH G;  1SHY A;  3LPR A;  1J15 A;  2GZ7 A;  4AZ2 B;  4YLQ H;  1C2J A;  1LVO A;  4XE4 A;  1DXP A;  1TNK A;  1ZPB A;  3M7T A;  4H6S B;  4ASH A;  1TOM H;  2A4Q A;  3BIV H;  1OHH D;  2O9Q A;  1NFY A;  1IQG A;  3UY9 A;  5B6L A;  6LPR A;  1C5V A;  3PMB B;  3M37 A;  3MNX A;  1ELA A;  1GDU A;  1WDI A;  3KF2 A;  2VIO A;  3EQ0 H;  3GY4 A;  5AF9 H;  4OGY A;  1EOJ A;  1G30 B;  2O8U A;  2UWL A;  1O3H A;  4X8T H;  1Q3X A;  4X2X A;  1NO9 H;  1NBM E;  1GMD G;  3NKK A;  2ZFQ H;  5EPY A;  5FAH A;  3S7H B;  2AGG X;  4KTU A;  2D1J A;  1GL0 E;  3ZVA A;  4INL A;  4D9Q A;  4XRN A;  1PFX C;  4YTA A;  3Q76 A;  2QE7 D;  3UQV A;  1MTV A;  1CGI E;  1GMD F;  2UUF B;  1Y8T A;  1E37 B;  1S6L A;  2C3S A;  3E1X B;  4DUR A;  1HXF H;  2PUX B;  1AFE H;  2KCA A;  2ZPQ A;  5DJ7 A;  2CXV A;  1O2J A;  1C2G A;  4RSP A;  1FLE E;  2OQ5 A;  1HRT H;  3ITI A;  1YGC H;  4CRB A;  2CV3 A;  1SMF E;  1O2G H;  4BTT B;  1F5R A;  2VWN A;  1MZA A;  2ZGX H;  1TNG A;  4NIX A;  2QXG A;  3TGJ E;  1OYQ A;  3OY5 U;  4B2C A;  1TNJ A;  1GG6 C;  1BHX B;  3UFA A;  3RXL A;  4FU7 A;  4UD9 H;  4O3T A;  1O2R A;  2SGF E;  4WXV A;  3UTU H;  3UAI C;  2SFA A;  1SR5 C;  3C1K A;  1C2K A;  3FVF B;  3HGN A;  3LC3 A;  4YLU A;  5DK1 A;  4TY6 A;  1HAV A;  1BA8 B;  3P95 A;  3SUF A;  2BYA X;  1FV9 A;  1FIW A;  3S0N A;  2Q6D A;  3T26 A;  1MMJ N;  3AK5 A;  1ETT H;  3DA9 B;  1LKB A;  4FUG A;  1HLT H;  3VFE A;  2A4G A;  2FI3 E;  2Z3C A;  1CBW C;  3UOU A;  4ABG A;  4DII H;  1F0S A;  3B8J A;  2PUQ H;  1H1B A;  1K22 H;  1W12 U;  2F9V A;  1HJA B;  2BD2 A;  1XUF A;  2Z9J A;  1PPC E;  3B23 B;  1TNL A;  2FOC A;  1TGN A;  2H6M A;  1ABJ H;  1ELF A;  1PPG E;  3PB1 E;  3A7W A;  1OWH A;  5HMA A;  4OS6 A;  3BG4 B;  4X6M A;  1GHX H;  1W0Y H;  1SGQ E;  5BPE A;  2BHG A;  4XOJ A;  5A0A E;  3K9X B;  4DY7 B;  1O3C A;  2R0K A;  2EI8 A;  3SI4 H;  3LGI A;  3UR9 A;  3URE A;  4A5T S;  1S82 A;  3Q77 A;  5ABW A;  4FXG H;  1MQ6 A;  4B6E A;  1HGT H;  1SVP A;  4Y79 A;  3F9H A;  1EP5 A;  1DWC H;  4K60 A;  4RT1 A;  1GI6 A;  2AER H;  1EPT B;  2ZNK H;  3SGA E;  2AMD A;  2ZDK A;  5DSF A;  3ZVE A;  4TSF D;  3F0O A;  3A80 A;  1P57 B;  2GT8 A;  3U1J B;  1T32 A;  1C2L A;  3KID U;  5A0B A;  3VXF H;  3QGN B;  1IAU A;  1UO6 A;  1NES E;  2YNB A;  2A5A A;  2GV6 A;  3H09 A;  1QJ7 B;  2AGE X;  1EJA A;  2ZGB H;  3N7O A;  1V2Q T;  4Y8Z A;  4Q4L A;  2Z3D A;  4RT0 A;  2VWO A;  5EXN A;  2A45 B;  1GI3 A;  5E2O A;  5I46 H;  3FFG A;  2PLX A;  1GJD B;  4K1E A;  1CGJ E;  3PRO A;  1DS2 E;  4Y76 A;  1PPB H;  3TJU A;  1P05 A;  2AEI H;  2BOH B;  1JXP A;  1TB6 H;  4I32 A;  1IQH A;  3A85 A;  3MU1 A;  2HLC A;  4XBB A;  4I7Y H;  1GGD B;  2FOA A;  1NRS H;  1DUE A;  3GY6 A;  2ZKS A;  1GBJ A;  3I29 A;  3D65 E;  1W0K D;  4I86 A;  1K9O E;  4B71 A;  2EQN A;  2VU8 E;  1WOF A;  3T27 A;  1E34 B;  2BD9 A;  1EJM A;  3LJJ A;  4KKD A;  3QZQ A;  5CE1 A;  1SOT A;  1GDN A;  1S5S A;  4ABB A;  4AX9 H;  1FY4 A;  3RML H;  1MTN C;  1Y5A T;  4KTS A;  2G51 A;  3RXM A;  1F0R A;  1SQO A;  3HPT B;  4YOJ A;  1HAI H;  2H1U A;  2JJ1 D;  1ZRK A;  1OP8 A;  1WSS H;  3SV7 A;  3RP2 A;  3RXO A;  4ZHM U;  1DM4 B;  1GJA B;  1V2O T;  1ACB E;  1ELE E;  1P2I A;  2I6Q A;  1Z1J A;  2W6J D;  4BOH A;  1O35 A;  3RXC A;  1SC8 U;  3O8D A;  3LT3 A;  4X0W U;  1P06 A;  1SLV B;  5DKM A;  3RXT A;  4NZL A;  5F8T A;  2R2W U;  1LHC H;  1EB2 A;  1NTP A;  4BAK B;  4B76 A;  4D9R A;  2WPH S;  2ZGH A;  1OWI A;  1ZPC A;  3QTO H;  1OXG A;  3RU4 D;  1SGP E;  2KM0 A;  1LHG H;  4A1T A;  1BRA A;  2FYR A;  2JKH A;  2GKV E;  5J4S A;  1W0Z U;  2G00 A;  1DE7 H;  3FKS D;  3SJ8 A;  2JH5 D;  1E79 D;  1C1V H;  3ENS B;  3A86 A;  2AH4 X;  1L1N A;  2VGC B;  1CSO E;  1TNI A;  2C90 B;  2BLW A;  4I8H A;  2HVY B;  2VGC C;  4FUH A;  3KL6 A;  4ISL A;  2ZFR H;  3QDZ B;  1MD7 A;  4GAW A;  1KY9 A;  2DE9 A;  1BRU P;  4WWY A;  3QGJ A;  1COW D;  1S0Q A;  4H6T A;  5FX5 A;  1INC A;  2XW9 A;  2FS9 A;  5CHA C;  4UFD H;  2RCE A;  3M5N A;  3P17 H;  2FZZ A;  3E6P H;  1T4V H;  1P2J A;  1YC0 A;  2H9H A;  1Z8I B;  1BBR K;  1TBQ H;  2OK5 A;  1QQU A;  2ZU1 A;  1BZX E;  3SU6 A;  3OSY A;  2IJO B;  3HKJ B;  4ZHL U;  1DT2 A;  3U8R H;  1HCG A;  4NG9 H;  1TLD A;  4ACB A;  2A31 A;  2PKS B;  1AN1 E;  1TPO A;  1W14 U;  1BBR E;  1MTU A;  1AND A;  1V2J T;  4JCN A;  2STA E;  4OS2 A;  1FJS A;  2BD7 A;  1E1Q D;  2BDA A;  1O5C B;  5T6F A;  1ETR H;  1SGC A;  1EZS C;  4R8T B;  3RXG A;  2QGR A;  1EAU A;  1AFQ C;  1BTW A;  5KEC A;  3H7O A;  1BMM H;  1CBW B;  1FY8 E;  2K1Q A;  1UVP A;  4CRE A;  2PSY A;  5C17 A;  1NS3 A;  4JZD H;  1QL7 A;  3M3S A;  4GUX A;  3RXA A;  1AFQ B;  4ABD A;  4X8V H;  1AUT C;  1LDT T;  5HXF A;  1YYY 1;  1GHZ A;  1TRY A;  1DAN H;  3PWC A;  5FCK A;  4E7N A;  1G2L A;  1N6Y A;  3SNE A;  1DWB H;  3E0P B;  5JB9 S;  2GTB A;  2H9E H;  4CRD A;  2BY7 X;  2KAI A;  2KCO A;  3P92 A;  1GG6 B;  2K0Q A;  1OWE A;  1H8I H;  1FX0 B;  1Z6E A;  1ZJK A;  2WYG A;  1O2V A;  3TU7 H;  5L2Y H;  2G5N A;  3GY8 A;  1GMH G;  1XKA C;  2OP9 A;  3R0F A;  2ZP0 H;  4OS4 A;  5C2Z A;  4AC9 A;  3WWF A;  1NN6 A;  1LMW B;  3ZIA D;  4YOI A;  3SUG A;  1SHH B;  1VIT F;  3C27 B;  1JOU B;  4NSV A;  2EI7 A;  1UVO A;  1BTH H;  4BXS A;  4ZXY H;  5T1V A;  5TCA A;  3RMO H;  2AMP A;  2HNT E;  1BHX F;  1UTM A;  1BJU A;  2F4L A;  4B75 A;  1C2F A;  1LHD H;  2W7U A;  5HKK D;  1VIT G;  1PQ8 A;  1ELD E;  1V6D A;  1EST A;  3PLB A;  2OBQ A;  1FZZ A;  1P2N A;  2WPM S;  4OS5 A;  2TGD A;  4BAO B;  2UUJ B;  2HOB A;  1GMC F;  1SGT A;  1O5A B;  4XFQ A;  4Y7B A;  3RC4 A;  5EQS A;  1LQD B;  3ZVC A;  2F9O A;  1ELV A;  2SNV A;  3E16 B;  3VB7 A;  5B6O A;  4F49 A;  1RTL A;  4AFQ A;  2GGV B;  2Z9L A;  2R3U A;  1VIT H;  1T31 A;  1Z8R A;  1V2R T;  2OC8 A;  2GDE H;  3DUX H;  3DFJ A;  2CN0 H;  2FXR A;  1K1L A;  3FO8 D;  4NIW A;  2BM2 A;  4K2Y A;  4XBD A;  1QRX A;  4RKO B;  1SI5 H;  1AE8 H;  3MO6 A;  5E2P A;  3VPK A;  2ZFT A;  1XUH A;  4ISN A;  3SJK A;  3CP7 A;  2J38 A;  3SV9 A;  5GPI B;  1TIO A;  1X7A C;  2CK3 D;  4ZKS U;  3QUM P;  5GIB A;  4B73 A;  2Y6T A;  4BAQ B;  3KNX A;  2RA0 A;  1UTK A;  1ZPZ A;  2ILN A;  3IWM A;  3S9B A;  2NU1 E;  3A83 A;  1HB0 B;  1QBO A;  1T8N A;  3MH6 A;  1QL8 A;  1O5G H;  4MDS A;  4CRG A;  4FVD A;  2QAA A;  2TGT A;  1KIG H;  1GHY H;  2ULL A;  5F6M A;  4JK6 A;  5C20 A;  4Y11 E;  1BTY A;  3LU9 B;  2ZA5 A;  5JBC S;  2EA3 A;  4GCH F;  1Y5B T;  1GMC G;  4ISO A;  3SGB E;  1P02 A;  3JZ1 B;  2ZHW H;  1UVU H;  4ZXX H;  1BB0 B;  1ZHR A;  1O2Y A;  2WPK S;  2Z9I A;  2BXT H;  3MO3 A;  5EPN A;  3KQC A;  4K1T A;  1P01 A;  1P2O A;  3W94 A;  5T3H A;  4CH8 B;  2ZPS A;  1MTN B;  5L6N H;  2ZI2 H;  3U1I B;  2BVS H;  4MPU A;  1GBM A;  3BTF E;  4U2W A;  1Y3V A;  2RFK C;  2FO9 A;  1ZLR A;  2QF3 A;  1ZSL A;  4I8G A;  1ZTJ A;  2Y7Z A;  4MVN A;  2V3M A;  5C3N A;  2PFE A;  1N8O C;  1U6Q A;  1S81 A;  3SV6 A;  1MD8 A;  3R3G B;  3PTN A;  5T6D A;  2C93 B;  1A0J A;  3A84 A;  1DY8 A;  4FET A;  4TT3 D;  3RXE A;  1A5I A;  1O34 A;  3WY8 A;  4X6P A;  1NU9 A;  2PSX A;  5C1U A;  2FOB A;  2DUC A;  5FPY A;  1CE5 A;  2GDD A;  2W7S A;  1CT0 E;  1M9U A;  1W13 U;  3A88 A;  1C5U A;  1HIA B;  1D3P B;  1AGJ A;  1Y5U T;  2R9P A;  3NPS A;  4ISI H;  1Y3Y A;  1TAB E;  1YPG H;  1HAX B;  5HGG A;  1C9P A;  1EXF A;  1GBC A;  3LIW A;  4AB8 A;  1HNE E;  2ANM H;  2V0B A;  3AVZ A;  1T8O A;  2J98 A;  3UWJ H;  1V2L T;  4P02 A;  2GMT B;  5DP4 A;  4Z6A H;  1EZQ A;  3TPI Z;  3P70 B;  2J94 A;  1AQ7 A;  3TK9 A;  3M35 A;  2G81 E;  5ESB A;  5LPF A;  4ZRO A;  1TYN A;  3T2N A;  3LH3 A;  3SNB A;  1UTJ A;  1D6R A;  3TJV A;  2V3O H;  4E05 H;  3K6Y A;  1AY6 H;  5EJZ A;  2ZWL H;  1OOK B;  2BX4 A;  3P8N A;  6GCH F;  1UJ1 A;  5K0H A;  5GCH G;  3MH4 A;  1FXY A;  2FES H;  1MBM A;  2WPL S;  1Z71 A;  4IN1 A;  1G3D A;  1C1Q A;  2GCT B;  3QZR A;  4Y71 A;  4YO9 A;  4CBN A;  4Z1M D;  2W3K A;  3SBK A;  3A87 A;  4RN6 A;  7GCH G;  3CEN A;  4JZ1 A;  4A7I B;  1BBR H;  1OPH B;  1W2K H;  2BXU H;  4AG1 A;  5GJ4 B;  2FLB H;  4MLF B;  3V12 A;  3UNS A;  1QIX B;  2VNT A;  1AB9 B;  1J17 T;  3MNS A;  1WTG H;  3RXH A;  1PQ5 A;  4AGK A;  2CJI A;  5DGJ A;  3SUE A;  4CH2 B;  5FPT A;  3VB3 A;  3M5O A;  1LHF H;  3KN2 A;  1PPH E;  3OYP A;  1PYT C;  5KGO A;  2JJ2 D;  3K65 B;  1O3G A;  3P8F A;  1ZTK A;  1ZTL A;  1C1T A;  3KGP A;  1FN8 A;  1QA7 A;  2W3I A;  3HAT H;  3ZZB A;  3A8C A;  1NZQ H;  1A3B H;  3F9F A;  2Q6G A;  4ABJ A;  1HYL A;  3P8O A;  3U8O H;  4I31 A;  4TWW A;  2B9L A;  2XCF A;  2QY0 B;  3RDZ A;  1WUN H;  4AYV B;  3B9F H;  1GI4 A;  3GDU A;  4FUB A;  1HJA C;  2EEK A;  5EJ1 A;  1TGS Z;  5EIY A;  1T8L A;  1ORF A;  3ZZA A;  1E35 B;  3A7Z A;  4ZKO U;  2G52 A;  1C4Y 2;  4NFE A;  5DP9 A;  1GL1 A;  3BTK E;  2HWL B;  3QO6 A;  1BTZ A;  1BRB E;  3FN8 A;  1XUJ A;  1IQM A;  2BLO A;  5EQR A;  2BQ7 B;  6CHA C;  2R0L A;  3ZZ7 A;  1ZOM A;  1FIZ A;  4FOU C;  1S85 A;  2A7H A;  1K1P A;  3K6Z A;  1UTQ A;  2B0F A;  1OP2 A;  1O36 A;  4CRC A;  4HFP B;  1IHS H;  1NU7 B;  1RJX B;  2ZPR A;  3TLO A;  2PGB B;  2VIN A;  3EA8 A;  3RM0 H;  3UR6 A;  3ZZ3 A;  3ZZ4 A;  1TX6 A;  1LTO A;  4O97 A;  1O3F A;  1GHA F;  2GV7 A;  2ZQ1 A;  8GCH F;  7KME H;  4IMQ A;  1C5L H;  1ELG A;  5IYT A;  1C1O A;  3QTV H;  4WMD A;  1ANC A;  1NM6 A;  4LOY H;  1SQT A;  1KXF A;  2QXI A;  1SKY E;  4MNY A;  1Y59 T;  3ZZ8 A;  4ACA A;  1BTU A;  3BTM E;  1GBB A;  1S83 A;  4D76 A;  1EKB B;  1P11 E;  2VID A;  3ATK A;  2VB0 A;  4X6O A;  1O3N A;  4HTC H;  1GI5 A;  2PHB A;  2IN2 A;  1ZGI A;  1Q2W A;  1BUI A;  3DHK H;  2ZFF H;  3W95 A;  4IN2 A;  1NFX A;  5EXL A;  1BJV A;  1VGC B;  1C1M A;  3A8D A;  3KQB A;  1LVB A;  4F4O C;  1TMT H;  1Q31 A;  4K5Z A;  8KME 2;  1PQ7 A;  1L2E A;  2FOE A;  5A2M H;  2ZU2 A;  2J2U A;  1P2M A;  1SGI B;  3PMA B;  2Y7X A;  5EW2 H;  1GPZ A;  1C1U H;  2VIQ A;  1EOL A;  2BD4 A;  1O2U A;  2VIP A;  2XBX A;  1P8V C;  2ZQ2 A;  1GGD C;  1SPJ A;  1HXE H;  3LKW A;  1ESB A;  1SGR E;  1YLN A;  5DP7 A;  1WXR A;  1L1J A;  4QT8 C;  3Q3Y A;  5LPR A;  1TA2 A;  5AFZ H;  1AMH A;  2QV1 A;  2HNT F;  3MTY A;  3Q3X A;  1D4P B;  3CS7 A;  3SNA A;  1V2P T;  5FBE A;  4RKJ B;  2Z3E A;  1UK3 A;  3EGK H;  4VGC C;  2XBY A;  3U9A H;  3RXU A;  3ZV8 A;  4MNW A;  1EAW A;  4NIY A;  2PR3 A;  3OX7 U;  2FTM A;  3SN8 A;  1BQY A;  1J8A A;  3T29 A;  1QRW A;  1O3B A;  1YF4 A;  2SNW A;  1BMA A;  2KCP A;  3N7D A;  2VH0 A;  1C1R A;  2G55 A;  1O2S A;  4AN7 A;  1O3D A;  1GHW H;  3A8B A;  1AVW A;  1AD8 H;  1A3E H;  4CRA A;  2CGA A;  1C5M D;  4UE7 H;  1HAP H;  1PJP A;  2K8I A;  4INH A;  2QIQ A;  4JYT A;  4Q7X A;  4NIV A;  3TK5 A;  4FU9 A;  1F92 A;  1GJ4 H;  3EA9 A;  2BMG B;  1BDA A;  1BMN H;  2XBW A;  2HAL A;  3O8C A;  1RD3 B;  5GND A;  2Z7F E;  1SLX B;  3OTP A;  3BEF B;  1EAX A;  1MBQ A;  4Y10 E;  2ZFP H;  4ZHA A;  2XBV A;  1MU6 B;  1FAX A;  2Q6F A;  3SQH E;  3MU4 A;  4UFG H;  3EAJ A;  4BAH B;  1O3L A;  2Y5H A;  3GDV A;  5JYI A;  5A09 A;  3TH2 H;  1HDT H;  2EI6 A;  2BDB A;  5E0G A;  2ZTX A;  1W7G H;  4AFS A;  2BVR H;  2OC0 A;  1TQ7 B;  1CU1 A;  4B1T A;  4BXW A;  1AWH B;  2F83 A;  3ZVG A;  1O39 A;  1IQF A;  1GVZ A;  3BG4 C;  2WYJ A;  2AS9 A;  3SI3 H;  1ZMJ A;  1C4U 2;  4KGA A;  4ISH H;  2TGA A;  3EST A;  5FL7 D;  3UOP A;  1TFX A;  1RIW B;  3UNR A;  4LXB H;  1BIT A;  2ZF0 H;  1JIR A;  1HJ9 A;  4X2W A;  5HYO A;  1O3P B;  3SO3 A;  1P9S A;  1Z6J H;  3IIT A;  4WME A;  2BDY A;  3RXK A;  1B0F A;  3TIT A;  3SOS A;  1CQQ A;  3RXQ A;  1VJA U;  1OWK A;  1O2I A;  5AHG H;  3ZVB A;  5GCH F;  1IQN A;  1G32 B;  2J9N A;  5PTP A;  1C5X B;  2IPH A;  3TGK E;  1OP0 A;  5T6G A;  3O8R A;  1EB1 H;  4AOR A;  2L74 A;  4AFZ A;  2DE8 A;  1C5R A;  3L3T A;  1J9C H;  4ZCN A;  5DP5 A;  2F3C E;  2WUB A;  3F9G A;  3E3T A;  2ALP A;  2G5V A;  2ZEB A;  2PW8 H;  5EST E;  1A61 H;  2OC7 A;  2GMT C;  1GVK B;  1TQ0 B;  2C8W B;  2F9P A;  3D23 A;  4I8K A;  1RTF B;  3G01 A;  3BSQ A;  2CF9 H;  1DLE A;  1NRP H;  2PP6 A;  1O3O A;  4EST E;  1PQA A;  3A7V A;  5DN6 D;  1SSX A;  3ZZ6 A;  2D2D A;  3LGT A;  4NZQ A;  2A0Q B;  3FAO A;  5FPS A;  3UPE A;  1BTX A;  3V0X A;  1MKW H;  4BAN B;  3A7T A;  1WTH D;  1O2W A;  3GYL B;  4KP0 A;  1V2S T;  3RXS A;  1QJ6 B;  2TPI Z;  4YES B;  4WXI A;  1GI2 A;  3PRB A;  4Q7Y A;  1HAZ B;  1L0Z A;  2GCT C;  1GHB G;  1TGB A;  1FDP A;  1MH0 A;  3EE0 B;  5F8Z A;  1AUJ A;  4SGB E;  4D8N A;  1AO5 A;  3SUD A;  4UFE H;  5C1Y A;  7GCH F;  5G4B A;  2IPQ X;  4DOQ A;  1GBD A;  2BDC A;  1YCP H;  4YOG A;  1YM0 A;  2C8Z B;  1P09 A;  2ZHD A;  2BDI A;  2ZHF H;  2QF4 A;  3MOC A;  2J95 A;  5C5N A;  1A0H B;  1DVA H;  2QF0 A;  1TRM A;  4Z0K A;  1RRK A;  1P0S H;  4SGA E;  2ANW A;  3SOR A;  1TX7 A;  2KFW A;  3U8T H;  1GVL A;  1THP B;  3MU5 A;  2D26 C;  5HIY A;  2M2A A;  2O8T A;  3HGP A;  3UIR A;  1C5N H;  3NRL A;  3A8A A;  3ATI A;  4U32 A;  1WCZ A;  4IC5 A;  1O30 A;  3U98 H;  1C5T A;  2P8O C;  2QF5 A;  3ZYD A;  2UWO A;  3GCO A;  2J34 A;  5IK2 D;  1YLD A;  1AVX A;  1NT1 A;  2THF B;  3DSO A;  1GJ8 B;  1KLJ H;  4NGA H;  1RFN A;  3HKI B;  1L1G A;  4J2Y B;  1ZJD A;  3TJO A;  2TIO A;  3GY2 A;  1A7S A;  1FNI A;  2ODQ A;  1IQL A;  4H42 U;  1YKT A;  1DX5 M;  1G3E A;  1QJ1 B;  1GBA A;  1GHB F;  2VBC A;  1SGY E;  5AVD A;  1KMH B;  4MPX A;  3GDS A;  3A7Y A;  3BTW E;  2HVX A;  1PPF E;  3RLY H;  1J16 A;  3T5F H;  2PTN A;  1XXD A;  1QTF A;  1TMB H;  5HM9 A;  5CDF E;  1HPG A;  1O0D H;  1C2I A;  1Z1I A;  1TE0 A;  2F9N A;  4Y8Y A;  1CT2 E;  1O2Z A;  1FUJ A;  1UCY E;  5CHB A;  1GBH A;  2XOK D;  3RC5 A;  1AI8 H;  3M3V A;  1C5Y B;  4X6N A;  1VZQ H;  2C4F H;  1CHO G;  3VB6 A;  1C5W B;  5JB8 S;  2NU0 E;  1GI0 A;  1O2L A;  1PPZ A;  3GOV B;  2Q1J A;  3RUO A;  1W7X H;  1EAI A;  2WV4 A;  2C8X B;  2V6N A;  1OSS A;  3ATW A;  2WUC A;  1JIM A;  1A5G H;  3NK8 A;  1O2K A;  3AW0 A;  2J98 B;  3U28 C;  4MNX A;  2FX6 A;  2XRC A; 
#chains in the Genus database with same CATH homology
 1DXW A;  1H8H D;  1N1L A;  3M5N A;  4I32 A;  5GND A;  2J5U A;  3RC4 A;  2O8M A;  3EYD A;  5EQQ A;  5EQS A;  5IDK A;  2OIN A;  3OTP A;  4I33 A;  4WH6 A;  2KCY A;  3LOX A;  3OAA D;  2OK5 A;  1W0K D;  4Q63 A;  2QF4 A;  1RTL A;  4B6F A;  3PRD A;  3SU0 A;  2GGV B;  4NWL A;  4B71 A;  3SU6 A;  1DY9 A;  2IJO B;  2OC8 A;  2JDI D;  3SU1 A;  4A1X A;  4M9F A;  2A4R A;  3PV2 A;  4B74 A;  3SUF A;  2IJD 1;  3SU5 A;  4KTC A;  5C0U A;  2KFW A;  2KR7 A;  3N7E A;  2XND D;  3FO8 D;  3OFN D;  3DSP A;  3SU3 A;  3SU2 A;  3AK5 A;  1RGQ A;  4WF8 A;  5ESB A;  5F53 A;  3F0P A;  2A4G A;  2P59 A;  2OC0 A;  1MAB B;  1W0J D;  2AHM E;  1SKY E;  1CU1 A;  2FOM B;  2M2A A;  2YOL A;  3SZE A;  1BMF D;  1E1Q D;  2V7Q D;  3NRL A;  1NBM D;  3SV9 A;  2F9V A;  2FM2 A;  2JJ1 D;  4R8T B;  5GPI B;  2CK3 D;  2GVF A;  3P8N A;  4B73 A;  3SV7 A;  3KNX A;  2QF5 A;  2K1Q A;  5C17 A;  5IK2 D;  1NS3 A;  1DXP A;  4A1V A;  5FL7 D;  3DSO A;  4A92 A;  3LON A;  4F55 A;  3F2H A;  2A4Q A;  3N99 A;  4YXW D;  3O8C A;  2LEL A;  4JMY A;  2W6J D;  1OHH D;  3M5L A;  4Z1M D;  4RI0 A;  2W6I D;  2YMS B;  3FOA A;  3O8D A;  2XNI A;  5B6L A;  2OBO A;  1H8E D;  3E90 B;  3PV5 A;  4OM9 A;  5GJ4 B;  4DT4 A;  3F2G A;  3O8B A;  3KF2 A;  3VG8 A;  2VBC A;  2YMS C;  3W1E A;  2KCO A;  4B6E A;  2F43 B;  3OEH D;  1KMH B;  2K0Q A;  4WH8 A;  4B76 A;  3O8R A;  3LKW A;  3SUE A;  4TYD A;  1FX0 B;  5FPT A;  1NBM E;  2WV9 A;  2OC1 A;  3M5O A;  3KN2 A;  3OYP A;  1WXR A;  5DSF A;  5EPY A;  3WWB A;  2JJ2 D;  2WSS D;  4TSF D;  3F0O A;  3UB0 A;  4ZCN A;  2KM0 A;  4K8B A;  5ETX A;  2XCN A;  3SV8 A;  2QV1 A;  1EFR D;  5CDF E;  4A1T A;  1BT7 A;  3WWF A;  5EPN A;  2YMS D;  2OC7 A;  1E1R D;  3L6P A;  3SYJ A;  3ZIA D;  3SUG A;  3U1J B;  3FKS D;  2WZQ A;  1E79 D;  5CHB A;  3U1I B;  3P8O A;  2QE7 D;  2FP7 B;  2XOK D;  4NWK A;  1A1R A;  4I31 A;  2KZ4 A;  3RC5 A;  2XCF A;  3H09 A;  2KCP A;  5T1V A;  1S6L A;  3N7D A;  4Q4L A;  2JIZ D;  4U01 A;  3RC6 A;  5DN6 D;  2KCA A;  3OEE D;  2F4L A;  4B75 A;  4XD7 D;  3M5M A;  2HLD D;  2F9U A;  5FPS A;  3WW7 A;  5EQR A;  5HKK D;  4ASU D;  3SV6 A;  3F2F A;  2WHX A;  5H4I B;  3DCL A;  3F3B A;  1DY8 A;  1W3C A;  2K8I A;  2OBQ A;  4FET A;  3OE7 D;  4TT3 D;  3PRB A;  5C0T A;  1COW D;  3SU4 A;  3KEE A;  2L6O A;  3FN8 A;  3GS9 A;  5FPY A;  2WPD D;  1JXP A;  3SUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...