4ZCNA

Crystal structure of nvpizza2-s16s58
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
86
structure length
86
Chain Sequence
SHMFTGLNTPSGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVLPFTGLNTPSGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nvPizza2-S16S58
publication title Crystal structure of nvPizza2-S16S58
rcsb
molecule tags De novo protein
total genus 12
structure length 86
sequence length 86
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.500 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4zcnA00
3WWBA 3WW7A 5F53A 5CHBA 4ZCNA 3WWFA
chains in the Genus database with same CATH superfamily
3RXUA 1P05A 4JMYA 3F0PA 1ANCA 3S9BA 4DIHH 3VEQB 5LGOA 1DPOA 5DSFA 2H9EH 5IYTA 3SU2A 2J34A 1GBTA 1TRYA 1QBOA 2FWWA 3QLPH 1MCTA 3PMBB 1ANDA 1C2KA 3LH3A 1FIZA 3MU5A 1C9TA 3SU6A 3ZZ7A 3LGYA 1L2EA 4NG9H 1O2PA 3TNTA 1UTMA 2PKAB 1SSXA 2H9HA 3V7TA 4ABHA 4AB8A 1TBZH 1SLVB 2QN5T 2ZKSA 3OU0A 3QK1A 1SGPE 1MAYA 1Z1JA 2GCHG 4K1SA 2C93B 4K69A 2GP9B 2VWOA 4Y79A 1ESAA 1Z71A 1A5IA 3RMNH 1QNJA 4Y71A 1IQGA 4U01A 1WQVH 1OP2A 3DFJA 1SHHB 3RXQA 1GI1A 1WTGH 3WY8A 2VGCC 2BVSH 2F83A 1PQ7A 2OK5A 1C9PA 1DFPA 2FX4A 3OEED 5HM2A 4ABIA 3VXFH 1P57B 4H6TA 1NU9A 3SQEE 4WMEA 3BTGE 3NRLA 4K8YA 1XVMA 3RC5A 3UB0A 1C2FA 1C5PA 1Z8JB 1ZZZA 1WUNH 1BMAA 2SGPE 1C1WH 2FPZA 3LT3A 3BEIB 1P8VC 2KR7A 5E2OA 4JZ1A 1TX6A 1QIXB 4UD9H 1NFYA 1GJCB 6LPRA 4TPYA 5EW1H 2AS9A 2BD8A 2TBSA 3A8CA 2ZGXH 1FLEE 1YCPM 1W11U 1EOJA 2HPPH 1NRSH 3MFJA 3DUXH 2DE8A 2Z94A 1OWEA 4GHTA 3LONA 1MTWA 2FOHA 1AWHB 1EB2A 1O2TA 1RGQA 1MTNC 4OGXA 1O3NA 4UONA 1FV9A 3A7VA 1HXFH 1BJVA 1GWAA 3MH6A 2VVUA 2TPIZ 1NTPA 1V2TT 3MNBA 5FBEA 1FZZA 3K65B 3QN7A 5JPMH 1O3EA 4NIXA 2ZDKA 1H8HD 1TPPA 1WBGB 4I86A 3MU1A 4AFSA 5FXLA 2EC9H 3A8AA 3LJOA 3ATWA 1K1OA 1G9IE 1C1QA 2XCFA 1ABIH 1FPHH 4D7GA 4B74A 2PKAA 1N1LA 4DOQA 4YLQH 1DY9A 1ELEE 1SVPA 1ZTJA 4RT0A 2ZU3A 3SOSA 5C67A 1Z6EA 1SGDE 2AFQB 4IMQA 4MPVA 3TJOA 2JJ1D 3RXSA 3U98H 3HATH 1XM1A 4BAKB 1TE0A 3SU5A 3SGAE 2BLWA 1TONA 1NRPH 1EPTA 3QDZB 1UTPA 3STJA 2W3KA 2WHXA 4ZXYH 4YLUA 5DP8A 1ETRH 1LVOA 1GI5A 2A2XH 1ESTA 1DE7H 3TK6A 1TGTA 1FI8A 2B7DH 1C2JA 2XYAA 1K1JA 1AD8H 4YTAA 1AZZA 3AASA 3JZ1B 1AE5A 3WW7A 2AHME 3PRBA 1GI6A 3OTJE 5DP6A 3UNSA 5ABWA 1GCTB 2VB0A 4CRGA 1AMHA 1N8OC 1LCYA 1O3MA 3F9HA 1A61H 1RD3B 2ANYA 3KYFA 6ESTA 1C2MA 2AH4X 1BITA 2G4TA 1NRRH 4MVNA 3SJ9A 2IPHA 3AW1A 1QL8A 3U69H 1LDTT 1BHXB 1P2IA 1O2IA 4CRDA 1GMCF 4J2YB 2ANKH 5T3HA 1LHGH 1ZMNA 2R9PA 4UFEH 4ASHA 3AAVA 2GJGA 4SGAE 4AFUA 1TX8A 3VB6A 2ZTZA 2Z3DA 4I31A 2SNVA 2WINI 2FI5E 2PKSB 1C1VH 3M5OA 4Y10E 3MQKC 1CHGA 4I32A 1GBBA 4IC5A 1QURH 1GBEA 1GMDG 2G5NA 1WSSH 3M61U 1V3XA 1MQ5A 1IHSH 1O35A 2XC0A 1BZXE 5DP4A 1MU6B 2RA0A 3NUMA 2OBQA 1HJ8A 5HM9A 1P12E 2BB4A 4GLYA 5FAHA 2XWBI 2ZPSA 1L4ZA 4B6FA 1C2HA 3LGUA 2BLQA 3NWUA 4Z1MD 1E36B 1GPZA 3G01A 2A5IA 2ZIQH 1ZTKA 5EODA 4FU9A 2PSXA 1EKBB 2OXSA 1ELDE 2LPRA 2QXJA 3U8OH 2OBOA 1SGRE 2G81E 2OC0A 4AB9A 4TY7A 2C8WB 2VGCB 4B71A 4IN2A 1EJNA 1COWD 2NU3E 4RN6A 1NFWA 3SUEA 1TNHA 1S6FA 1VJAU 1EB1H 3C1KA 1QFKH 4NCYA 5JB8S 2VIOA 1C5QA 1GHVH 2YNBA 3MU4A 3KN2A 2VIDA 3M5NA 1AVWA 1XVOA 1LMWB 2OC7A 1B0FA 5E8EH 3UTUH 4ISLA 2ULLA 1E35B 1MMJN 2ZO3H 5HKKD 1YM0A 4CBNA 5GNDA 4YESB 2L6OA 1W0YH 2J94A 2K8IA 1PYTD 1O5CB 5LPEA 2HLCA 4B73A 4E7RG 3M5MA 2Z9LA 1SLUB 1K1MA 4OS6A 2ZFTA 3FZZA 3P70B 5CMXH 1ZSLA 2Y7ZA 4Q2KA 3SQHE 1MTNB 1YPMH 3SZNA 1RS0A 5AF9H 3URDA 4NGAH 2C8ZB 4GCHG 4AYYB 4UE7H 2Y5HA 5C1UA 2ZFSA 4M9FA 1DWCH 2J38A 3A85A 2ALPA 1BRUP 3M35A 1L1GA 3FP7E 2V3OH 3SW2B 3E90B 2PSYA 3BTWE 4ABFA 1LHFH 1YY3A 1EZXC 1HAYB 4NIYA 3BTDE 2WPLS 1AO5A 1QCPA 3UUZA 3RMOH 1DDJA 2TGPZ 1T4VH 3MH5A 2ZCKP 4MNWA 2P94A 5GJ4B 2XC5A 4K1EA 4Z0KA 3D23A 3GY4A 1Y3UA 3BF6H 1HNEE 5DN6D 1O2MA 1FY1A 1WDIA 2TGAA 2A4RA 2Q6FA 1SG8B 1RXPA 1UVUH 1C1MA 1T8LA 4XBDA 2EQNA 3A88A 3LH1A 4NIVA 2L74A 2YMSC 3RXMA 4NA7A 1NPMA 4NZLA 1FQ3A 4DURA 5E0JA 4A92A 5ESTE 3EQ0H 3DCLA 1QR3E 2GCTB 3UIRA 3UQVA 1GG6C 5KEDA 1O5DH 1DUAA 5GPIB 2VWMA 2PTNA 1C4Y2 4YOIA 5HIYA 4D7FA 9LPRA 3RU4E 3PV4A 3OFND 1DT2A 1FN6A 1LQEA 1J15A 1G37A 3EA7A 3SV8A 1P10A 1BRCE 4NSVA 3MO6A 2KCPA 2J4IA 3H7TA 4ZHAA 1W10U 1KXAA 3K6YA 1QA7A 4XBCA 1ZJKA 1N6YA 2FTLE 1GCDA 1IAUA 3RU4T 4NSYA 3SV7A 1PPEE 1GJ8B 1NBMD 3E1XB 1JRSA 2A31A 3FKSD 1A0JA 1TOCB 5FX6A 2F9OA 2JDID 3EA9A 2B8OH 1DLKB 2K1QA 2XRCA 3PV5A 3TJNA 2D8WA 5BRRE 5EOKA 3DT0H 5C5NA 2J9NA 3P8NA 5L6NH 3P8OA 2ZHEH 5AHGH 3ZYDA 1P0SH 2O8MA 4KTUA 1ZRBA 3T5FH 3SNCA 1BCUH 2ZECA 4XSKU 1C2IA 4LZ4B 2Z3EA 2R0LA 4U32A 1QGFA 1EPTC 3M7TA 1GHBF 8KME2 2WSSD 3GISB 3LGVA 1Z8IB 3BTME 9ESTA 4WXIA 3A7XA 5EXLA 5I46H 1UCYK 2JH5D 1LHDH 4FUEA 4TSFD 2IPQX 1ZHRA 3T29A 3SBKA 2ZWLH 2IN2A 3BTKE 3KQDA 1ZPZA 5LPRA 3UNRA 5DO4H 3MOCA 1O36A 4HZHA 4GPGA 1JRTA 5HXFA 1G2MA 2FP7B 1S84A 2WV5A 5F03A 5T1VA 1O2WA 4OS1A 1HIAB 2FOBA 1NFXA 1GBKA 5CDFE 5A2MH 2YNAA 2HVYB 1T7CA 1BTUA 4WWYA 2FZZA 1J14A 3RXLA 2ZCHP 5TCAA 1NRNH 1ZLRA 1PFXC 2HGTH 4YO9A 3A80A 2ZHWH 2WPHS 1GHWH 3GY5A 3TVJB 2GZ7A 1PPHE 1O37A 1AUJA 2F9VA 1TMUH 1QBNA 4VGCC 1IOEA 2LELA 1CHOG 1LQDB 3PROA 1WXRA 3TGKE 1HBTH 1P2JA 5KECA 1FY3A 3KQCA 3GCTG 1YPHE 2D2DA 1W13U 2KAIA 4A5TS 3L33A 1CT4E 3S9AA 1OP8A 1A3EH 2BY9X 3SU4A 1EAXA 2SGDE 1C1NA 4J1YA 1TBQH 2ASUB 3TIUA 4E06H 4LOYH 2STBE 1OS8A 1XKAC 2QV1A 5A8XA 3UOUA 1CQQA 3A82A 1UJ1A 2G00A 3FFGA 4TYDA 2HRVA 1C5XB 5F6MA 1AB9B 1G3DA 3ZVBA 1SMFE 1GI4A 1TPSA 2RDEA 1KLIH 4JZIA 4JCNA 3W95A 2KFWA 5EXMA 4ASUD 5T6FA 3DHKH 5C3NA 2ZU5A 5DK1A 1A5HA 2OLGA 2NWNA 2ZGCA 2JETC 3P8FA 1OWKA 2P16A 1UTNA 3LJJA 3ZVDA 2ZZUH 1W14U 2KZ4A 1TPAE 2A4QA 2D1JA 3F2FA 3V12A 3RXPA 3H09A 3PYHA 1L0ZA 3CS7A 3Q77A 1V2UT 3A86A 3SJIA 6GCHG 5TCCA 1DS2E 1A0HB 1YPLH 2R3YA 3LIWA 3ZVGA 3UFAA 1DLEA 1EFRD 1O3DA 1BQYA 1O2UA 2V6NA 4H6SB 1W8BH 4P02A 3SNDA 4X2XA 2G52A 1OP0A 4IC6A 3M36A 1VJ9U 4JYVH 1UTJA 1C2GA 1IQNA 3GYLB 4Y0YE 2VIQA 1PPFE 2XOKD 2KCYA 4KTSA 4X8VH 3DSOA 3R3GB 3E91A 1VCQA 5L2YH 1OPHB 1G3CA 2C90B 1GJ9B 3RP2A 1DXWA 3AK5A 2IJOB 2P3FH 3BTTE 3K2UA 1S85A 2VNTA 1NROH 2W5EA 1P3CA 3GY7A 1EZQA 4D8NA 3RXGA 7ESTE 4ISIH 3UQOA 5AFYH 3MYWA 3EYDA 3F0OA 3GY3A 1UCYH 1SI5H 1IQFA 2ZC9H 2GVFA 3RC4A 3GCOA 1O5BB 2FOFA 2XTTB 3SUGA 3MHWU 2CGAA 1FPCH 2XBVA 1EASA 4Z6AH 1TMTH 1HPGA 4HI3A 3RXCA 4I7YH 1D3PB 2TGTA 3E0PB 4RI0A 1LVMA 3M5LA 2KX4A 3TK5A 4KP0A 1TNIA 2FOEA 1C5MD 4Q7XA 3PV2A 2HWLB 1EPTB 1G32B 3HKIB 1OOKB 3ZZCA 4R0IA 1GJ7B 1K1LA 1O2OA 2H9TH 4GHQA 1YGCH 2FXRA 1O0DH 1DUEA 1NY22 1E79D 2FOMB 1D9IA 4DCDA 2GD4B 1S0QA 1ZPCA 1O5FH 2GZ8A 1KDQA 2Q6DA 4JZFH 1EUFA 3L3TA 1GDNA 3RXEA 2KCAA 8GCHF 5CHBA 4FU8A 3E3TA 2JH6D 1SPJA 3F9EA 3E0NB 2Z9IA 1W7GH 1O5GH 4DY7B 1SQOA 2SNWA 3N7EA 4B6EA 1YF4A 4KKDA 2V7QD 1CHOF 2PGQB 3GICB 1TBRH 2EI6A 1O34A 3BV9B 2QIQA 3DD2H 4X2WA 4YT7H 4AFQA 1RIWB 2XBWA 1HXEH 1QRZA 3MH7A 2BLVA 1SGTA 4CR5A 2A4GA 1THRH 5ESBA 3Q76A 1A46H 4AYVB 3Q3KA 3PMAB 2HNTF 4ACAA 4Y76A 2TIOA 2FLBH 4VGCB 1MZDA 5GIBA 1GJ4H 2ZFQH 2QCYA 1PQ8A 3VPKA 1TRNA 1LKBA 1P11E 3NPSA 1P2NA 1FY5A 4ABEA 4ESTE 2PGBB 4Y8ZA 2GT8A 2VBCA 4ZUHA 3BTFE 1O3KA 1ELVA 1MBMA 1DSTA 4RSPA 1P09A 3ZVEA 4WH6A 1C1PA 3DSPA 3ESTA 5C20A 3A87A 1GDQA 2AMDA 4TY6A 1GBAA 1X7AC 5EPYA 4MTBA 1OWDA 1T4UH 1E34B 1HDTH 4CHAB 1J9CH 3ENSB 2ZA5A 1C5LH 3PTBA 2BDAA 1PPCE 1V2JT 1XXFA 2HVXA 5H4IB 1EX3A 3ZVAA 4Y8XA 1EAWA 4K60A 2W7UA 1GI3A 5E0GA 4MG3A 1VKYA 4A1VA 5FPYA 1MKXH 2BX4A 2XWAA 1THSH 3ODFA 4GUXA 3LGWA 4I8HA 1ZYOA 2QXIA 3FAOA 4H42U 3TGJE 1F7ZA 1F5RA 1Y3WA 1DWEH 2JETB 2GMTC 1YLDA 3SNBA 1TOMH 2BY8X 1PQ5A 1GHXH 1KY9A 1ZHPA 5F53A 5FPSA 4A6LA 3ZV8A 4CR9A 2AERH 2W7SA 1KLTA 3GY6A 3ELAH 1JMOH 1SHYA 1FAXA 2BHGA 2GCTC 3BG4C 5C1XA 1HFDA 1AFQC 4FXGH 8ESTE 4GVUA 1HAIH 2F91A 2CJIA 2P3UB 3MTYA 1O31A 2A5AA 4CRBA 2J98A 2BDCA 3PLKA 2EA3A 2W3IA 1JOUB 2UUYA 1QTFA 1SOZA 1HJAC 1H9LB 2CF9H 2VH6A 5IK2D 2FOGA 1XUIA 2PUXB 4ABGA 4X2VA 4P00A 1CGHA 1K22H 5A0BA 3TJVA 1QA0A 5EJZA 1ANEA 1O39A 5CHAB 4DIIH 1VR1H 2QF5A 1ETSH 1ELAA 1S81A 1ZTLA 2GCHF 1BHXF 1ETTH 1UTKA 1EJMA 1YPGH 1GDUA 1ESBA 1QQ4A 3FANA 3ZVCA 4BOHA 4AFZA 2ZHQH 3OX7U 1A5GH 2VWLA 3M7UA 5SGAE 4H4FA 2VWNA 4Q7YA 3DA9B 1RRKA 1O3CA 4B2AA 1MD7A 4DT4A 3WWFA 2BXUH 2BLOA 1C1SA 2WPMS 2BY6X 3D49H 4KELA 1V2LT 1ZJDA 5FHTA 3EAJA 4FUIA 2QA9E 3B8JA 3LC3A 2ZDNA 1NBME 1IQIA 4Q80A 3D65E 4X6OA 4O03A 4A1XA 3LKWA 2EY4C 1OKXA 4IN1A 2BDBA 3A8BA 3MNXA 4O9VA 4CREA 2FI3E 3ATMA 4DG4A 5A0AE 4ZH8A 4ABDA 3F9GA 2F3CE 1MBQA 5JB9S 3A7TA 1O38A 1OSSA 1BMNH 3P8GA 4JYUH 3KL6A 5EGMA 3O8BA 5DGJA 1ZGIA 2A32A 1SGQE 1WQSA 1INCA 2GDDA 2ZGHA 1JIMA 2OQ5A 4UDWH 4B2CA 4FVBA 4K8BA 3RXIA 1O2KA 3CENA 1HGTH 2BZAA 3SI3H 1ELGA 1AKSB 1O33A 1O2RA 3SO3A 3ATIA 2ODQA 3SGBE 3M3SA 1WOFA 1DANH 3T25A 1F92A 3RXJA 1WTHD 2FM2A 1VITH 3FOAA 1P03A 1WAYB 1RTLA 1SGIB 2FMJA 2CMYA 1H8DH 2ESTE 1BBRK 1UVSH 2J92A 4X1SU 2PV9B 1MU8B 2EI7A 1B5GH 5DP7A 1DVAH 4CH8B 4HFPB 1HAVB 1TWXB 1A0LA 1Y5AT 3A83A 5TJXA 2AMQA 3K6ZA 1OWIA 2PWXA 1KSNA 3S7HB 3RXVA 4CRAA 2GV6A 5EPNA 5GCHG 1TIOA 1EOLA 1A3BH 2VJ1A 1E1QD 5FCRA 3OAAD 2QF4A 2WV9A 2ZDVH 1L1NA 1AB9C 3ATKA 3N7OA 1W2KH 1HCGA 2OTVA 2WZQA 1ELFA 5EQRA 4XRNA 3MNCA 3SU3A 1UVOA 3PO1C 3U1IB 2ZEBA 3TH4H 1P2QA 1HAHH 2STAE 3TITA 2F9NA 4QT8C 3D62A 3TGIE 1BTPA 2GZ9A 2QF3A 3O8CA 3GOVB 1E37B 3KGPA 3S7KB 2Z7FE 3QWCH 3SU1A 1QL7A 1ELTA 1ZMLA 2GMTB 3WWBA 4K5ZA 3BG8A 1PQAA 2BQ7B 3FVFB 3BTHE 3MU8A 3A89A 5JBCS 1TGSZ 3SV2H 1K21H 3LU9B 3R0FA 7GCHG 1OYQA 2ZPQA 1M9UA 1TMBH 4KTCA 1LVYA 1TALA 1ZHMA 1C5OH 3BG4B 3NKKA 4YXWD 3RXFA 1AFQB 1K1PA 1OYTH 3SJOA 4BAMB 5DJ7A 2FODA 4X8TH 1O2ZA 4ZKSU 5C2ZA 3E16B 1C5RA 2FOAA 3CP7A 1VITG 2PR3A 3PWCA 1ZOMA 5GWZA 3ZZ8A 1K1IA 1L4DA 4WMFA 1HJAB 3OTPA 4DGJA 1JXPA 2QC2A 3HK3B 1GMDF 1NZQH 1AKSA 1D3TB 4CRCA 3IITA 4ZMAH 1C5ZB 1CE5A 4E05H 4X0WU 1F5KU 1GHAG 1UTLM 1C2DA 1W0JD 4FOUC 2BYAX 3T27A 2J5UA 4FUHA 3ZZ3A 2KAIB 5EJLA 4ZAEA 1JWTA 1GL0E 3VB5A 1MTSA 2GV7A 3M3VA 3P6ZB 2OC8A 1Y3YA 1AHTH 2CK3D 1CO7E 1QRWA 2XC4A 1HAVA 1O3AA 3PM3A 3VB3A 2FLRH 2ZGJA 1G36A 3UNQA 3RXKA 1CA0C 1DXPA 1GJ5H 4F48B 1EAUA 3M3TA 1HYLA 2ZGBH 4OS5A 3KEEA 1ANBA 1QB6A 1LHCH 1RFNA 2GGVB 2Q6GA 3W94A 4LXBH 4ZROA 4AZ2B 1AVXA 2LP6A 3KQEA 4Y11E 2AIPA 3CNRA 4I8LA 3I78A 2FS9A 2GX4A 3GDSA 3V3MA 2RCEA 2F9BH 1GI9B 4O97A 3Q3XA 3F1SB 3W1EA 1LVBA 3BTEE 1CGJE 1GI2A 1MABB 4OS4A 1GMHG 5A09A 1Z7KA 2PUQH 1G30B 1H8IH 2AYWA 2OD3B 2QGRA 4OS7A 5T6DA 2IOTA 3KIDU 2M2AA 1PPGE 2CN0H 5EXNA 4HG6A 4BAHB 5HMAA 1BBRH 1FN8A 1XXDA 2FDAA 2BOHB 1S5SA 3PLPA 1KXDA 1ZSJA 2AIQA 3RXRA 2H5CA 4DJZB 1O3HA 4BTTB 2NU2E 1OX1A 2CF8H 1YPKH 1W7XH 2V0BA 3ZZAA 1C4U2 4MNVA 3SHAH 1T8OA 1NM6A 1O3GA 1TA6A 1KXCA 3FP8E 1SL3A 1DWBH 2BDIA 2HNTE 1RIWC 1S6HA 4GSOA 2KCOA 5DP9A 4GCHF 1TYNA 4UFFH 2ZFFH 3BEFB 1C5TA 3NK8A 2DE9A 1TAWA 1CT2E 5FCKA 1TX7A 1O2YA 2P8OC 2PW8H 1HAGE 3F2GA 4Y6DA 2G55A 3KQ5A 5GXPA 1C2EA 3QZQA 4DT7B 2WUBA 1KTSB 2A7JA 3U9AH 1GBHA 2VIPA 1WYKA 2ZDAH 2BM2A 3A81A 2WV4A 4NA8A 1KXFA 2FOCA 3OY5U 4AX9H 4THNH 2O8WA 1QZ8A 2W6JD 3LPRA 2C8XB 4CHAC 1NS3A 2YMSD 5FBIA 1AVGH 2THFB 5DKMA 4WF8A 1YPHC 5EG4A 2ZHFH 2M5TA 2ZU2A 2XNDD 4X8SH 3A8DA 3SYJA 2ZF0H 3GY2A 2F4LA 1C5VA 4OGYA 1K0HA 3OY6U 2NU0E 1HUTH 3PO1B 1SGEE 4AGKA 1A1RA 1G3BA 2D26C 3ITIA 4AG1A 3LDXH 3NZIA 5K7RA 2ZHDA 4YT6H 3PTNA 1FONA 1ID5H 2F43B 1KDQB 1K2I1 4B76A 1SGFA 1ZR0A 1VITF 4Y7AA 3EDXB 3U1JB 4X8UH 1ELCA 1LPGB 2C8YB 1AN1E 4HGCA 1GHAF 2AEIH 1AQ7A 1UK4A 3IG6B 3OYPA 1VGCB 1ARCA 3RMMH 2ZU1A 2FX6A 3Q00A 1O2NA 2PFEA 4WVPE 4Q7ZA 4K1TA 2CXVA 2BDHA 5J4QA 4MLFB 3KNXA 1GBCA 1XMNB 2PLXA 4D9RA 3I77A 4FVDA 3FO8D 2VINA 3RM0H 1QB9A 2ODYB 4I8KA 2Z9KA 5CHAC 4FUFA 3ZZ9A 5DG6A 4XD7D 4U2WA 1Z6JH 3MU0A 2K0QA 1FNIA 2FTMA 5L30H 1HJ9A 5F8XA 1SBWA 2A7HA 3ZYEA 2BVXH 1IQKA 1BRBE 2A7CA 3TLOA 1QJ6B 4AOQA 3QUMP 1T8NA 1HAOH 4X2YA 1PJPA 1FY4A 2Z9JA 2WYJA 2ZCLP 4IBLH 3SN8A 1EZSC 3O8DA 5C0TA 3QGJA 1S83A 1C1UH 4SGBE 3SJ8A 1CA0B 1SQRA 2OCVB 3GDVA 4FUCA 3TH2H 2AMPA 2UWPA 1Z8GA 1ZGVA 4NZQA 3PMJA 1SGYE 2QXHA 2AGGX 2WPKS 3DFLA 1XUFA 3URCA 1HB0B 3TH3H 3RC6A 2FYRA 1SQTA 1GMCG 5CE1A 2J95A 3RXHA 4RKOB 1P9SA 2FEQH 2Y80A 2Z9GA 1UCYE 4UEHH 4R8TB 4BTIB 1BTYA 2BDYA 2O8UA 4CH2B 1CVWH 4B2BA 1QJ1B 5A0CA 1O2LA 1QB1A 1O3OA 2BD7A 2PTCE 1SOTA 2HOBA 2HALA 5A8YA 3HK6B 1AFEH 1OWHA 3QO6A 1K1NA 1V2MT 1Z8RA 3GCHC 2J98B 1U6QA 1Y3VA 3H5CB 1F0RA 2CHAC 2B5TB 7KMEH 4MNYA 1J8AA 1TNGA 1AE8H 3BSQA 1THPB 3GCTF 2WPDD 3GYMA 2Z3CA 3S9CA 2A4OA 2ZU4A 4OS2A 1GJ6A 4UFGH 3HGPA 4JYTA 3UY9A 2YOLA 3BEUA 3RLWH 1ZMJA 4XOJA 2OUAA 1GGDB 4WY3A 5F8TA 4ZHLU 1TQ7B 1P3EA 1PPZA 4ZHMU 3NCLA 1Y3XA 1S6LA 1PPBH 2P8OB 3RXBA 3SGQE 2PHBA 2P93A 1MD8A 1A4WH 1AWFH 2ZQ1A 2VVCA 1NESE 3OEHD 4NFEA 2JKHA 3QZRA 5K0HA 1Y59T 5JDUB 4E7NA 1KIGH 1P2KA 3TK9A 3UOPA 1C2LA 1MZAA 3PMHB 1S82A 2BD2A 3KF2A 1EAIA 4FETA 4OM9A 2AGIX 3BTQE 5A8ZA 1Y8TA 3TNSA 2BY7X 4CBOA 3FP6E 5J4SA 4ISOA 1W3CA 5JYIA 1GJDB 6GCHF 2GT7A 2A45B 1DM4B 5HIZA 3ZZ5A 3ZZBA 4MPXA 1ZRKA 2WPIS 1A2CH 4INKA 3F68H 3LOXA 3B23B 5G4BA 2JJ2D 4MPUA 1O2HA 2C4FH 4YM9A 3T2NA 4RT1A 1D6WA 1PYTC 1KMHB 1H4WA 5E0HA 2ODPA 2V35A 4D76A 3SI4H 1CGIE 1TGNA 4FUBA 5JBTA 1JBUH 1DITH 4HTCH 4XFQA 2H1UA 3UPEA 3UAIC 1TGCA 4ABJA 2BQ6B 6CHAB 1B0EA 1LO6A 3RUOA 1BTWA 1H8ED 1ZPBA 4K3JA 3V0XA 4ABBA 1XX9A 1UHBB 1Y5BT 1O2XA 4B75A 2HLDD 1V2WT 4X1QU 2BDGA 4Y7BA 2Q1JA 2VIWA 4JZEH 3V13A 2BD9A 1QJ7B 5EIYA 2ZQ2A 1BT7A 5LH8A 5HGGA 5C94A 4IW4E 2ZDLA 1XKBC 4XE4A 1YBWA 1P01A 1SQAA 3ODDA 1YPJH 1XUKA 2PP6A 5KGOA 2GKVE 3QTVH 4AGJA 3F6UH 1A7SA 2LNCA 1J17T 1FJSA 4IS5A 2BMGB 1GBIA 1VCPA 2WPJS 3SORA 3A7ZA 4BAOB 1WV7H 2Y7XA 4NA9H 3H7OA 1T32A 1UO6A 2F9UA 1Q31A 4ZCNA 1FX0B 1O2GH 2FI4E 2XBXA 1KXBA 3VFEA 3S0NA 2UUKB 3F3BA 1AIXH 1CBWC 1P9UA 2Y5GA 5T6GA 1EXFA 1YCPK 2G8TA 1UTQA 2BOKA 1ELBA 1KXEA 3SU0A 7LPRA 3K9XB 2TGDA 4TPIZ 1O2QA 2UWOA 3FZDA 5L2ZH 2BY5X 5JBAS 2GDEH 2ZI2H 1FIWA 1GJAB 3BIUH 1B7XB 4ZKOU 1G2LA 1MTUA 5EQQA 1GI0A 2BQWB 1LKAA 3I29A 2ZNKH 1QL9A 2H2ZA 2RDLA 3KHVA 1DOJA 1GJBB 1NT1A 1WU1A 1S0RA 1UW7A 1BA8B 1ACBE 1ORFA 4LK4A 5E2PA 1SGNE 1V6DA 3AW0A 2ANMH 2UUJB 1HAXB 1V2RT 1BJUA 1MKWK 1QY6A 1NC6A 4NWKA 2EEKA 1D4PB 3O8RA 3QGNB 3OSYA 1P02A 1VCWA 3EE7A 1QRXA 3GCHB 1HV7A 1SFQB 1UHBA 2HPQH 3QTOH 2TRMA 3HGNA 4X1NU 1TNJA 1O3BA 2I6SA 1KTTB 1E38B 2CHAB 5GDSH 1LPKB 3SHCH 1TB6H 3SJKA 4AG2A 1BTXA 2RFKC 1J16A 2NU1E 1GHBG 4ZKNU 1OHHD 1AUTC 3UR9A 2BXTH 1SGFG 4O3TA 1SGCA 5JBBS 1O30A 1EATA 1NO9H 1HAPH 1BMLA 1HLTH 1C5SA 1GI7B 1NN6A 1NU7B 1FXYA 2FESH 2SGQE 4B1TA 1TABE 4INLA 4MQAA 4F49A 4Y8YA 2SGAA 3ZZ4A 3MMGA 4LZ1H 4A7IB 1V2NT 4WJG2 2CV3A 3T28A 1XUHA 2RA3A 1SKYE 4TT3D 5IDKA 1O5EH 3P95A 2BD3A 3UREA 3LGTA 1EP6A 3N99A 5EW2H 2P95A 1F0UA 1YC0A 4RKJB 1BB0B 1CT0E 5EU8A 4UFDH 2F9PA 2B9LA 3AAUA 3Q3YA 1K9OE 1SLWB 1UK2A 2SGFE 1SLXB 1YKTA 4NIWA 4BXWA 2JIZD 3CS0A 3EA8A 1TGBA 4NFFA 1JIRA 1O2SA 2SGEE 1YWUA 2OQUA 1TLDA 1YLNA 3IWMA 4MPWA 3T26A 4KGAA 2BD4A 4Q4LA 4JK5A 5C0UA 2B0FA 4X6MA 1E0FD 2QE7D 1UTOA 1WCZA 3ZV9A 1SFIA 3L6PA 4JK6A 4X6NA 3TJUA 2QXGA 2BVRH 2ZTXA 3SNEA 2RG3A 1QBVH 1NRQH 2IJD1 3GY8A 1RJXB 3VB7A 4YOJA 4ACBA 2O8TA 8LPRA 3MO9A 2ZFRH 2R2WU 2QY0B 3SZEA 3UWJH 1V2ST 1UK3A 2FYQA 1MUEB 1CU1A 4I8GA 3VGCC 5EJ1A 1D3QB 2FO9A 3MI4A 1BMFD 1UVTH 1KLJH 2Y81A 4IGDA 1VGCC 3SNAA 1FAKH 2UWLA 1DSUA 5HYOA 3U8TH 2I6QA 3MO3A 1YCPH 2R2MB 3KYGA 1YP9A 3SV6A 3PB1E 3GDUA 1HRTH 4PROA 4K2YA 3QX5H 1NFUA 2J2UA 1V2OT 5FX5A 3RXDA 1C5YB 1EJAA 1P04A 2ALVA 1TNKA 1Q3XA 5C5OA 1FDPA 4X1PU 3GS9A 2UUFB 1O3JA 2JH0D 4AC9A 1FY8E 2G4UA 2DUCA 1GBLA 3NXPA 1V2PT 5DP5A 4ZKRU 1W0ZU 1AI8H 3MNSA 1K28D 1N8OB 2VIVA 1KYNA 1T8MA 1W12U 4A1TA 1D3DB 3RM2H 4ISHH 3RMLH 1ABJH 3KCGH 4X1RU 1CBWB 2WYGA 1AGJA 1LHEH 3EE0B 4TWWA 2A2QH 1BTZA 1RTKA 1MKWH 1HAZB 4FU7A 1GI8B 1VZQH 4CRFA 3MWIU 4XBBA 4M7GA 1TPOA 5ETXA 1GBDA 1EP5A 2GTBA 3E6PH 1GL1A 2Y5FA 1F0TA 3VB4A 5EQSA 2P59A 3EGKH 1MTVA 4YOGA 2BTCE 1W0KD 4BNRA 1XUJA 2J97A 1GBFA 3VXEH 4F55A 1GVLA 2QF0A 4FUGA 1MCVA 4ISNA 1C1OA 4JZDH 1IQMA 3RLYH 1OXGA 1ARBA 1F0SA 1DX5M 5F8ZA 3P92A 3RXTA 2ANWA 1UVPA 1L1JA 4BANB 4FUJA 2OP9A 3PWBA 1H9HE 4WH8A 3M7QA 3C27B 1F5LA 4ZXXH 2NU4E 1O3LA 1CA8B 2G5VA 3U8RH 1FMGA 5I25A 3TPIZ 1Z1IA 1C1TA 1UMAH 2AGEX 2OC1A 4NWLA 2EI8A 2R0KA 3P17H 4ABAA 5DPAA 1D6RA 1TA2A 3ZZ6A 4D9QA 3SUFA 1TQ0B 2A0QB 2XW9A 3GCNA 1AZ8A 1BOQA 5FPTA 4MDSA 1GGDC 2BD5A 2P3TB 2A1DB 5C1YA 2SFAA 5GCHF 2V3HH 3KQBA 2V3MA 1C5WB 4DVAU 1C5UA 1SR5C 3LGIA 2VVVA 3ATLA 1P2MA 3PRDA 1IQLA 2H5DA 2HNTC 1P2OA 5B6LA 4GAWA 2O9QA 1BBRE 3VG8A 5C17A 1V2KT 2ZFPH 1H1BA 1GBJA 1QQUA 1DICA 1YYY1 3FN8A 3B9FH 4WMDA 1CSOE 4X6PA 8GCHG 1IHTH 2XXLA 1V2VT 4AN7A 2G51A 4I8JA 2VU8E 1T31A 3BIVH 2W6ID 1Y5UT 2Z6BD 1O3IA 1F2SE 3F9FA 3ZVFA 3N7DA 1MAXA 2H6MA 3PLBA 2WUCA 1SB1H 1G3EA 4INHA 1GBMA 3MH4A 1YLCA 3A7YA 3STIA 1GHZA 1O2JA 1O3PB 1TRMA 4U30A 1GHYH 3TU7H 2Y6TA 7GCHF 1OWJA 2ZTYA 5B6OA 1FUJA 4TWYA 1EQ9A 1TFXA 3M37A 1Q2WA 3ZZDA 2FS8A 2ZDMA 2OINA 2R3UA 3T62A 3HPTB 4MNXA 5AFZH 6CHAC 4IMZA 3UR6A 3DSGA 5LPFA 3RU4D 1O5AB 2C3SA 5DP3A 2A5KA 3RDZA 1N6XA 3S69A 1LTOA 1MQ6A 5PTPA 1V2QT 1GVKB 1O3FA 2FIRH 1BTHH 2KM0A 3VGCB 3LC5A 1DY8A 1LPZB 2W26A 4Q63A 4Y0ZE 5AVDA 1GVZA 1BUIA 1C1RA 5FL7D 3A84A 1IQJA 4AORA 3A7WA 2XBYA 3ZIAD 3SUDA 4FUDA 1BMMH 3OE7D 4BXSA 1AU8A 2BZ6H 1E1RD 2QAAA 1SC8U 3BN9A 3RXOA 5BPEA 4F4OC 1GCTC 1O32A 1H9IE 1O2VA 1YPEH 2YMSB 4O3UA 1MH0A 4XDEA 1HIAA 3JZ2B 1XUGA 2ZP0H 4YZUA 2Y82A 2XNIA 1C5NH 3RXAA 1ZSKA 1EZUC 1BIOA 1GG6B 4WXVA 2ZG0H 3SV9A 3AVZA 1MKXK 1P06A 4DW2U 4I33A 2O8LA 4BTUB 4BAQB 1TNLA 2XCNA 3UWIA 1BRAA 3U28C 1AY6H 1QHRB 2QYIA 3E8LA 3HKJB 1BDAA 2ZPRA 1RTFB 1IQHA 1C4V2 2PKSC 1IQEA 2BX3A 1GMHF 3F2HA 1DWDH 2VH0A 2ILNA
chains in the Genus database with same CATH topology
1E1QD 1OHHD 3F0PA 2A4RA 4JMYA 1A1RA 5ESBA 4Z1MD 2W6ID 3OAAD 2QF4A 5DSFA 2WV9A 5CDFE 1BT7A 2XOKD 2KCYA 3SU2A 2XCFA 4A1TA 2F43B 3DSOA 4B74A 4B76A 3N7DA 2OBOA 1N1LA 3W1EA 1DXWA 3AK5A 2IJOB 3U1JB 1DY9A 2OC0A 2YMSC 2WZQA 1MABB 5EQRA 3SU6A 4B71A 2JJ1D 3SU3A 4A92A 3U1IB 1COWD 2VBCA 2WPDD 3DCLA 3SU5A 3SUEA 2M2AA 1SKYE 4TT3D 4DT4A 5IDKA 3O8CA 3OYPA 5ETXA 3WWFA 3N99A 3EYDA 3F0OA 2F9VA 2WHXA 3DSPA 4WH6A 2YOLA 5GPIB 2F9UA 3SU1A 4ZCNA 1FX0B 3KN2A 3OFND 5EQSA 5EPYA 3M5NA 2GVFA 2LELA 3F3BA 4U01A 3RC4A 3SV8A 3WWBA 1WXRA 2P59A 1S6LA 2OINA 1W0KD 5H4IB 2KCPA 1NBME 2OC7A 2OK5A 3SUGA 2JIZD 3KNXA 4F55A 3OEED 3WW7A 3FO8D 2AHME 3PRBA 3SU0A 3LKWA 4A1XA 5HKKD 4KTCA 5GNDA 2KCOA 3NRLA 4Q4LA 5FPYA 4A1VA 3RC5A 2L6OA 3UB0A 5C0UA 4RI0A 2K8IA 4XD7D 3SU4A 4YXWD 3SV7A 2QE7D 2KM0A 4B73A 2K0QA 3M5LA 3M5MA 1NBMD 3OEHD 1DY8A 4Q63A 3FKSD 3L6PA 2KR7A 2QV1A 5FL7D 3O8BA 3PV2A 4WH8A 4TYDA 2JDID 3ZIAD 3SUDA 5F53A 5FPSA 3F2GA 3OE7D 3KF2A 3OTPA 1JXPA 5EQQA 4FETA 4OM9A 2K1QA 1E1RD 2IJD1 3PV5A 2OC1A 4NWLA 3SZEA 3O8DA 5C0TA 2KFWA 1W3CA 2YMSB 1E79D 2FOMB 3P8NA 3P8OA 4ASUD 4K8BA 2QF5A 1CU1A 4M9FA 1W0JD 2O8MA 3SUFA 1BMFD 2XNIA 2J5UA 4I31A 3LONA 5FPTA 3LOXA 3E90B 2KCAA 2JJ2D 3M5OA 1RGQA 4I32A 3SV9A 2W6JD 5CHBA 1KMHB 2KZ4A 3SV6A 1NS3A 2A4QA 2FM2A 2OC8A 2WSSD 2YMSD 2CK3D 3F2FA 3FOAA 4I33A 4WF8A 3H09A 1RTLA 2XCNA 3PRDA 4NWKA 3RC6A 3O8RA 3N7EA 4B6EA 5IK2D 5B6LA 2XNDD 2V7QD 4TSFD 3SYJA 1DXPA 2OBQA 1EFRD 3GS9A 5GJ4B 3VG8A 2F4LA 5C17A 4R8TB 1H8ED 3KEEA 2GGVB 3FN8A 4B6FA 5EPNA 3F2HA 5DN6D 1H8HD 4B75A 2HLDD 2FP7B 2A4GA 5T1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WWB A;  3WW7 A;  5F53 A;  5CHB A;  4ZCN A;  3WWF A; 
#chains in the Genus database with same CATH topology
 3RXU A;  1P05 A;  4JMY A;  3F0P A;  1ANC A;  3S9B A;  4DIH H;  3VEQ B;  5LGO A;  1DPO A;  5DSF A;  2H9E H;  5IYT A;  3SU2 A;  2J34 A;  1GBT A;  1TRY A;  1QBO A;  2FWW A;  3QLP H;  1MCT A;  3PMB B;  1AND A;  1C2K A;  3LH3 A;  1FIZ A;  3MU5 A;  1C9T A;  3SU6 A;  3ZZ7 A;  3LGY A;  1L2E A;  4NG9 H;  1O2P A;  3TNT A;  1UTM A;  2PKA B;  1SSX A;  2H9H A;  3V7T A;  4ABH A;  4AB8 A;  1TBZ H;  1SLV B;  2QN5 T;  2ZKS A;  3OU0 A;  3QK1 A;  1SGP E;  1MAY A;  1Z1J A;  2GCH G;  4K1S A;  2C93 B;  4K69 A;  2GP9 B;  2VWO A;  4Y79 A;  1ESA A;  1Z71 A;  1A5I A;  3RMN H;  1QNJ A;  4Y71 A;  1IQG A;  4U01 A;  1WQV H;  1OP2 A;  3DFJ A;  1SHH B;  3RXQ A;  1GI1 A;  1WTG H;  3WY8 A;  2VGC C;  2BVS H;  2F83 A;  1PQ7 A;  2OK5 A;  1C9P A;  1DFP A;  2FX4 A;  3OEE D;  5HM2 A;  4ABI A;  3VXF H;  1P57 B;  4H6T A;  1NU9 A;  3SQE E;  4WME A;  3BTG E;  3NRL A;  4K8Y A;  1XVM A;  3RC5 A;  3UB0 A;  1C2F A;  1C5P A;  1Z8J B;  1ZZZ A;  1WUN H;  1BMA A;  2SGP E;  1C1W H;  2FPZ A;  3LT3 A;  3BEI B;  1P8V C;  2KR7 A;  5E2O A;  4JZ1 A;  1TX6 A;  1QIX B;  4UD9 H;  1NFY A;  1GJC B;  6LPR A;  4TPY A;  5EW1 H;  2AS9 A;  2BD8 A;  2TBS A;  3A8C A;  2ZGX H;  1FLE E;  1YCP M;  1W11 U;  1EOJ A;  2HPP H;  1NRS H;  3MFJ A;  3DUX H;  2DE8 A;  2Z94 A;  1OWE A;  4GHT A;  3LON A;  1MTW A;  2FOH A;  1AWH B;  1EB2 A;  1O2T A;  1RGQ A;  1MTN C;  4OGX A;  1O3N A;  4UON A;  1FV9 A;  3A7V A;  1HXF H;  1BJV A;  1GWA A;  3MH6 A;  2VVU A;  2TPI Z;  1NTP A;  1V2T T;  3MNB A;  5FBE A;  1FZZ A;  3K65 B;  3QN7 A;  5JPM H;  1O3E A;  4NIX A;  2ZDK A;  1H8H D;  1TPP A;  1WBG B;  4I86 A;  3MU1 A;  4AFS A;  5FXL A;  2EC9 H;  3A8A A;  3LJO A;  3ATW A;  1K1O A;  1G9I E;  1C1Q A;  2XCF A;  1ABI H;  1FPH H;  4D7G A;  4B74 A;  2PKA A;  1N1L A;  4DOQ A;  4YLQ H;  1DY9 A;  1ELE E;  1SVP A;  1ZTJ A;  4RT0 A;  2ZU3 A;  3SOS A;  5C67 A;  1Z6E A;  1SGD E;  2AFQ B;  4IMQ A;  4MPV A;  3TJO A;  2JJ1 D;  3RXS A;  3U98 H;  3HAT H;  1XM1 A;  4BAK B;  1TE0 A;  3SU5 A;  3SGA E;  2BLW A;  1TON A;  1NRP H;  1EPT A;  3QDZ B;  1UTP A;  3STJ A;  2W3K A;  2WHX A;  4ZXY H;  4YLU A;  5DP8 A;  1ETR H;  1LVO A;  1GI5 A;  2A2X H;  1EST A;  1DE7 H;  3TK6 A;  1TGT A;  1FI8 A;  2B7D H;  1C2J A;  2XYA A;  1K1J A;  1AD8 H;  4YTA A;  1AZZ A;  3AAS A;  3JZ1 B;  1AE5 A;  3WW7 A;  2AHM E;  3PRB A;  1GI6 A;  3OTJ E;  5DP6 A;  3UNS A;  5ABW A;  1GCT B;  2VB0 A;  4CRG A;  1AMH A;  1N8O C;  1LCY A;  1O3M A;  3F9H A;  1A61 H;  1RD3 B;  2ANY A;  3KYF A;  6EST A;  1C2M A;  2AH4 X;  1BIT A;  2G4T A;  1NRR H;  4MVN A;  3SJ9 A;  2IPH A;  3AW1 A;  1QL8 A;  3U69 H;  1LDT T;  1BHX B;  1P2I A;  1O2I A;  4CRD A;  1GMC F;  4J2Y B;  2ANK H;  5T3H A;  1LHG H;  1ZMN A;  2R9P A;  4UFE H;  4ASH A;  3AAV A;  2GJG A;  4SGA E;  4AFU A;  1TX8 A;  3VB6 A;  2ZTZ A;  2Z3D A;  4I31 A;  2SNV A;  2WIN I;  2FI5 E;  2PKS B;  1C1V H;  3M5O A;  4Y10 E;  3MQK C;  1CHG A;  4I32 A;  1GBB A;  4IC5 A;  1QUR H;  1GBE A;  1GMD G;  2G5N A;  1WSS H;  3M61 U;  1V3X A;  1MQ5 A;  1IHS H;  1O35 A;  2XC0 A;  1BZX E;  5DP4 A;  1MU6 B;  2RA0 A;  3NUM A;  2OBQ A;  1HJ8 A;  5HM9 A;  1P12 E;  2BB4 A;  4GLY A;  5FAH A;  2XWB I;  2ZPS A;  1L4Z A;  4B6F A;  1C2H A;  3LGU A;  2BLQ A;  3NWU A;  4Z1M D;  1E36 B;  1GPZ A;  3G01 A;  2A5I A;  2ZIQ H;  1ZTK A;  5EOD A;  4FU9 A;  2PSX A;  1EKB B;  2OXS A;  1ELD E;  2LPR A;  2QXJ A;  3U8O H;  2OBO A;  1SGR E;  2G81 E;  2OC0 A;  4AB9 A;  4TY7 A;  2C8W B;  2VGC B;  4B71 A;  4IN2 A;  1EJN A;  1COW D;  2NU3 E;  4RN6 A;  1NFW A;  3SUE A;  1TNH A;  1S6F A;  1VJA U;  1EB1 H;  3C1K A;  1QFK H;  4NCY A;  5JB8 S;  2VIO A;  1C5Q A;  1GHV H;  2YNB A;  3MU4 A;  3KN2 A;  2VID A;  3M5N A;  1AVW A;  1XVO A;  1LMW B;  2OC7 A;  1B0F A;  5E8E H;  3UTU H;  4ISL A;  2ULL A;  1E35 B;  1MMJ N;  2ZO3 H;  5HKK D;  1YM0 A;  4CBN A;  5GND A;  4YES B;  2L6O A;  1W0Y H;  2J94 A;  2K8I A;  1PYT D;  1O5C B;  5LPE A;  2HLC A;  4B73 A;  4E7R G;  3M5M A;  2Z9L A;  1SLU B;  1K1M A;  4OS6 A;  2ZFT A;  3FZZ A;  3P70 B;  5CMX H;  1ZSL A;  2Y7Z A;  4Q2K A;  3SQH E;  1MTN B;  1YPM H;  3SZN A;  1RS0 A;  5AF9 H;  3URD A;  4NGA H;  2C8Z B;  4GCH G;  4AYY B;  4UE7 H;  2Y5H A;  5C1U A;  2ZFS A;  4M9F A;  1DWC H;  2J38 A;  3A85 A;  2ALP A;  1BRU P;  3M35 A;  1L1G A;  3FP7 E;  2V3O H;  3SW2 B;  3E90 B;  2PSY A;  3BTW E;  4ABF A;  1LHF H;  1YY3 A;  1EZX C;  1HAY B;  4NIY A;  3BTD E;  2WPL S;  1AO5 A;  1QCP A;  3UUZ A;  3RMO H;  1DDJ A;  2TGP Z;  1T4V H;  3MH5 A;  2ZCK P;  4MNW A;  2P94 A;  5GJ4 B;  2XC5 A;  4K1E A;  4Z0K A;  3D23 A;  3GY4 A;  1Y3U A;  3BF6 H;  1HNE E;  5DN6 D;  1O2M A;  1FY1 A;  1WDI A;  2TGA A;  2A4R A;  2Q6F A;  1SG8 B;  1RXP A;  1UVU H;  1C1M A;  1T8L A;  4XBD A;  2EQN A;  3A88 A;  3LH1 A;  4NIV A;  2L74 A;  2YMS C;  3RXM A;  4NA7 A;  1NPM A;  4NZL A;  1FQ3 A;  4DUR A;  5E0J A;  4A92 A;  5EST E;  3EQ0 H;  3DCL A;  1QR3 E;  2GCT B;  3UIR A;  3UQV A;  1GG6 C;  5KED A;  1O5D H;  1DUA A;  5GPI B;  2VWM A;  2PTN A;  1C4Y 2;  4YOI A;  5HIY A;  4D7F A;  9LPR A;  3RU4 E;  3PV4 A;  3OFN D;  1DT2 A;  1FN6 A;  1LQE A;  1J15 A;  1G37 A;  3EA7 A;  3SV8 A;  1P10 A;  1BRC E;  4NSV A;  3MO6 A;  2KCP A;  2J4I A;  3H7T A;  4ZHA A;  1W10 U;  1KXA A;  3K6Y A;  1QA7 A;  4XBC A;  1ZJK A;  1N6Y A;  2FTL E;  1GCD A;  1IAU A;  3RU4 T;  4NSY A;  3SV7 A;  1PPE E;  1GJ8 B;  1NBM D;  3E1X B;  1JRS A;  2A31 A;  3FKS D;  1A0J A;  1TOC B;  5FX6 A;  2F9O A;  2JDI D;  3EA9 A;  2B8O H;  1DLK B;  2K1Q A;  2XRC A;  3PV5 A;  3TJN A;  2D8W A;  5BRR E;  5EOK A;  3DT0 H;  5C5N A;  2J9N A;  3P8N A;  5L6N H;  3P8O A;  2ZHE H;  5AHG H;  3ZYD A;  1P0S H;  2O8M A;  4KTU A;  1ZRB A;  3T5F H;  3SNC A;  1BCU H;  2ZEC A;  4XSK U;  1C2I A;  4LZ4 B;  2Z3E A;  2R0L A;  4U32 A;  1QGF A;  1EPT C;  3M7T A;  1GHB F;  8KME 2;  2WSS D;  3GIS B;  3LGV A;  1Z8I B;  3BTM E;  9EST A;  4WXI A;  3A7X A;  5EXL A;  5I46 H;  1UCY K;  2JH5 D;  1LHD H;  4FUE A;  4TSF D;  2IPQ X;  1ZHR A;  3T29 A;  3SBK A;  2ZWL H;  2IN2 A;  3BTK E;  3KQD A;  1ZPZ A;  5LPR A;  3UNR A;  5DO4 H;  3MOC A;  1O36 A;  4HZH A;  4GPG A;  1JRT A;  5HXF A;  1G2M A;  2FP7 B;  1S84 A;  2WV5 A;  5F03 A;  5T1V A;  1O2W A;  4OS1 A;  1HIA B;  2FOB A;  1NFX A;  1GBK A;  5CDF E;  5A2M H;  2YNA A;  2HVY B;  1T7C A;  1BTU A;  4WWY A;  2FZZ A;  1J14 A;  3RXL A;  2ZCH P;  5TCA A;  1NRN H;  1ZLR A;  1PFX C;  2HGT H;  4YO9 A;  3A80 A;  2ZHW H;  2WPH S;  1GHW H;  3GY5 A;  3TVJ B;  2GZ7 A;  1PPH E;  1O37 A;  1AUJ A;  2F9V A;  1TMU H;  1QBN A;  4VGC C;  1IOE A;  2LEL A;  1CHO G;  1LQD B;  3PRO A;  1WXR A;  3TGK E;  1HBT H;  1P2J A;  5KEC A;  1FY3 A;  3KQC A;  3GCT G;  1YPH E;  2D2D A;  1W13 U;  2KAI A;  4A5T S;  3L33 A;  1CT4 E;  3S9A A;  1OP8 A;  1A3E H;  2BY9 X;  3SU4 A;  1EAX A;  2SGD E;  1C1N A;  4J1Y A;  1TBQ H;  2ASU B;  3TIU A;  4E06 H;  4LOY H;  2STB E;  1OS8 A;  1XKA C;  2QV1 A;  5A8X A;  3UOU A;  1CQQ A;  3A82 A;  1UJ1 A;  2G00 A;  3FFG A;  4TYD A;  2HRV A;  1C5X B;  5F6M A;  1AB9 B;  1G3D A;  3ZVB A;  1SMF E;  1GI4 A;  1TPS A;  2RDE A;  1KLI H;  4JZI A;  4JCN A;  3W95 A;  2KFW A;  5EXM A;  4ASU D;  5T6F A;  3DHK H;  5C3N A;  2ZU5 A;  5DK1 A;  1A5H A;  2OLG A;  2NWN A;  2ZGC A;  2JET C;  3P8F A;  1OWK A;  2P16 A;  1UTN A;  3LJJ A;  3ZVD A;  2ZZU H;  1W14 U;  2KZ4 A;  1TPA E;  2A4Q A;  2D1J A;  3F2F A;  3V12 A;  3RXP A;  3H09 A;  3PYH A;  1L0Z A;  3CS7 A;  3Q77 A;  1V2U T;  3A86 A;  3SJI A;  6GCH G;  5TCC A;  1DS2 E;  1A0H B;  1YPL H;  2R3Y A;  3LIW A;  3ZVG A;  3UFA A;  1DLE A;  1EFR D;  1O3D A;  1BQY A;  1O2U A;  2V6N A;  4H6S B;  1W8B H;  4P02 A;  3SND A;  4X2X A;  2G52 A;  1OP0 A;  4IC6 A;  3M36 A;  1VJ9 U;  4JYV H;  1UTJ A;  1C2G A;  1IQN A;  3GYL B;  4Y0Y E;  2VIQ A;  1PPF E;  2XOK D;  2KCY A;  4KTS A;  4X8V H;  3DSO A;  3R3G B;  3E91 A;  1VCQ A;  5L2Y H;  1OPH B;  1G3C A;  2C90 B;  1GJ9 B;  3RP2 A;  1DXW A;  3AK5 A;  2IJO B;  2P3F H;  3BTT E;  3K2U A;  1S85 A;  2VNT A;  1NRO H;  2W5E A;  1P3C A;  3GY7 A;  1EZQ A;  4D8N A;  3RXG A;  7EST E;  4ISI H;  3UQO A;  5AFY H;  3MYW A;  3EYD A;  3F0O A;  3GY3 A;  1UCY H;  1SI5 H;  1IQF A;  2ZC9 H;  2GVF A;  3RC4 A;  3GCO A;  1O5B B;  2FOF A;  2XTT B;  3SUG A;  3MHW U;  2CGA A;  1FPC H;  2XBV A;  1EAS A;  4Z6A H;  1TMT H;  1HPG A;  4HI3 A;  3RXC A;  4I7Y H;  1D3P B;  2TGT A;  3E0P B;  4RI0 A;  1LVM A;  3M5L A;  2KX4 A;  3TK5 A;  4KP0 A;  1TNI A;  2FOE A;  1C5M D;  4Q7X A;  3PV2 A;  2HWL B;  1EPT B;  1G32 B;  3HKI B;  1OOK B;  3ZZC A;  4R0I A;  1GJ7 B;  1K1L A;  1O2O A;  2H9T H;  4GHQ A;  1YGC H;  2FXR A;  1O0D H;  1DUE A;  1NY2 2;  1E79 D;  2FOM B;  1D9I A;  4DCD A;  2GD4 B;  1S0Q A;  1ZPC A;  1O5F H;  2GZ8 A;  1KDQ A;  2Q6D A;  4JZF H;  1EUF A;  3L3T A;  1GDN A;  3RXE A;  2KCA A;  8GCH F;  5CHB A;  4FU8 A;  3E3T A;  2JH6 D;  1SPJ A;  3F9E A;  3E0N B;  2Z9I A;  1W7G H;  1O5G H;  4DY7 B;  1SQO A;  2SNW A;  3N7E A;  4B6E A;  1YF4 A;  4KKD A;  2V7Q D;  1CHO F;  2PGQ B;  3GIC B;  1TBR H;  2EI6 A;  1O34 A;  3BV9 B;  2QIQ A;  3DD2 H;  4X2W A;  4YT7 H;  4AFQ A;  1RIW B;  2XBW A;  1HXE H;  1QRZ A;  3MH7 A;  2BLV A;  1SGT A;  4CR5 A;  2A4G A;  1THR H;  5ESB A;  3Q76 A;  1A46 H;  4AYV B;  3Q3K A;  3PMA B;  2HNT F;  4ACA A;  4Y76 A;  2TIO A;  2FLB H;  4VGC B;  1MZD A;  5GIB A;  1GJ4 H;  2ZFQ H;  2QCY A;  1PQ8 A;  3VPK A;  1TRN A;  1LKB A;  1P11 E;  3NPS A;  1P2N A;  1FY5 A;  4ABE A;  4EST E;  2PGB B;  4Y8Z A;  2GT8 A;  2VBC A;  4ZUH A;  3BTF E;  1O3K A;  1ELV A;  1MBM A;  1DST A;  4RSP A;  1P09 A;  3ZVE A;  4WH6 A;  1C1P A;  3DSP A;  3EST A;  5C20 A;  3A87 A;  1GDQ A;  2AMD A;  4TY6 A;  1GBA A;  1X7A C;  5EPY A;  4MTB A;  1OWD A;  1T4U H;  1E34 B;  1HDT H;  4CHA B;  1J9C H;  3ENS B;  2ZA5 A;  1C5L H;  3PTB A;  2BDA A;  1PPC E;  1V2J T;  1XXF A;  2HVX A;  5H4I B;  1EX3 A;  3ZVA A;  4Y8X A;  1EAW A;  4K60 A;  2W7U A;  1GI3 A;  5E0G A;  4MG3 A;  1VKY A;  4A1V A;  5FPY A;  1MKX H;  2BX4 A;  2XWA A;  1THS H;  3ODF A;  4GUX A;  3LGW A;  4I8H A;  1ZYO A;  2QXI A;  3FAO A;  4H42 U;  3TGJ E;  1F7Z A;  1F5R A;  1Y3W A;  1DWE H;  2JET B;  2GMT C;  1YLD A;  3SNB A;  1TOM H;  2BY8 X;  1PQ5 A;  1GHX H;  1KY9 A;  1ZHP A;  5F53 A;  5FPS A;  4A6L A;  3ZV8 A;  4CR9 A;  2AER H;  2W7S A;  1KLT A;  3GY6 A;  3ELA H;  1JMO H;  1SHY A;  1FAX A;  2BHG A;  2GCT C;  3BG4 C;  5C1X A;  1HFD A;  1AFQ C;  4FXG H;  8EST E;  4GVU A;  1HAI H;  2F91 A;  2CJI A;  2P3U B;  3MTY A;  1O31 A;  2A5A A;  4CRB A;  2J98 A;  2BDC A;  3PLK A;  2EA3 A;  2W3I A;  1JOU B;  2UUY A;  1QTF A;  1SOZ A;  1HJA C;  1H9L B;  2CF9 H;  2VH6 A;  5IK2 D;  2FOG A;  1XUI A;  2PUX B;  4ABG A;  4X2V A;  4P00 A;  1CGH A;  1K22 H;  5A0B A;  3TJV A;  1QA0 A;  5EJZ A;  1ANE A;  1O39 A;  5CHA B;  4DII H;  1VR1 H;  2QF5 A;  1ETS H;  1ELA A;  1S81 A;  1ZTL A;  2GCH F;  1BHX F;  1ETT H;  1UTK A;  1EJM A;  1YPG H;  1GDU A;  1ESB A;  1QQ4 A;  3FAN A;  3ZVC A;  4BOH A;  4AFZ A;  2ZHQ H;  3OX7 U;  1A5G H;  2VWL A;  3M7U A;  5SGA E;  4H4F A;  2VWN A;  4Q7Y A;  3DA9 B;  1RRK A;  1O3C A;  4B2A A;  1MD7 A;  4DT4 A;  3WWF A;  2BXU H;  2BLO A;  1C1S A;  2WPM S;  2BY6 X;  3D49 H;  4KEL A;  1V2L T;  1ZJD A;  5FHT A;  3EAJ A;  4FUI A;  2QA9 E;  3B8J A;  3LC3 A;  2ZDN A;  1NBM E;  1IQI A;  4Q80 A;  3D65 E;  4X6O A;  4O03 A;  4A1X A;  3LKW A;  2EY4 C;  1OKX A;  4IN1 A;  2BDB A;  3A8B A;  3MNX A;  4O9V A;  4CRE A;  2FI3 E;  3ATM A;  4DG4 A;  5A0A E;  4ZH8 A;  4ABD A;  3F9G A;  2F3C E;  1MBQ A;  5JB9 S;  3A7T A;  1O38 A;  1OSS A;  1BMN H;  3P8G A;  4JYU H;  3KL6 A;  5EGM A;  3O8B A;  5DGJ A;  1ZGI A;  2A32 A;  1SGQ E;  1WQS A;  1INC A;  2GDD A;  2ZGH A;  1JIM A;  2OQ5 A;  4UDW H;  4B2C A;  4FVB A;  4K8B A;  3RXI A;  1O2K A;  3CEN A;  1HGT H;  2BZA A;  3SI3 H;  1ELG A;  1AKS B;  1O33 A;  1O2R A;  3SO3 A;  3ATI A;  2ODQ A;  3SGB E;  3M3S A;  1WOF A;  1DAN H;  3T25 A;  1F92 A;  3RXJ A;  1WTH D;  2FM2 A;  1VIT H;  3FOA A;  1P03 A;  1WAY B;  1RTL A;  1SGI B;  2FMJ A;  2CMY A;  1H8D H;  2EST E;  1BBR K;  1UVS H;  2J92 A;  4X1S U;  2PV9 B;  1MU8 B;  2EI7 A;  1B5G H;  5DP7 A;  1DVA H;  4CH8 B;  4HFP B;  1HAV B;  1TWX B;  1A0L A;  1Y5A T;  3A83 A;  5TJX A;  2AMQ A;  3K6Z A;  1OWI A;  2PWX A;  1KSN A;  3S7H B;  3RXV A;  4CRA A;  2GV6 A;  5EPN A;  5GCH G;  1TIO A;  1EOL A;  1A3B H;  2VJ1 A;  1E1Q D;  5FCR A;  3OAA D;  2QF4 A;  2WV9 A;  2ZDV H;  1L1N A;  1AB9 C;  3ATK A;  3N7O A;  1W2K H;  1HCG A;  2OTV A;  2WZQ A;  1ELF A;  5EQR A;  4XRN A;  3MNC A;  3SU3 A;  1UVO A;  3PO1 C;  3U1I B;  2ZEB A;  3TH4 H;  1P2Q A;  1HAH H;  2STA E;  3TIT A;  2F9N A;  4QT8 C;  3D62 A;  3TGI E;  1BTP A;  2GZ9 A;  2QF3 A;  3O8C A;  3GOV B;  1E37 B;  3KGP A;  3S7K B;  2Z7F E;  3QWC H;  3SU1 A;  1QL7 A;  1ELT A;  1ZML A;  2GMT B;  3WWB A;  4K5Z A;  3BG8 A;  1PQA A;  2BQ7 B;  3FVF B;  3BTH E;  3MU8 A;  3A89 A;  5JBC S;  1TGS Z;  3SV2 H;  1K21 H;  3LU9 B;  3R0F A;  7GCH G;  1OYQ A;  2ZPQ A;  1M9U A;  1TMB H;  4KTC A;  1LVY A;  1TAL A;  1ZHM A;  1C5O H;  3BG4 B;  3NKK A;  4YXW D;  3RXF A;  1AFQ B;  1K1P A;  1OYT H;  3SJO A;  4BAM B;  5DJ7 A;  2FOD A;  4X8T H;  1O2Z A;  4ZKS U;  5C2Z A;  3E16 B;  1C5R A;  2FOA A;  3CP7 A;  1VIT G;  2PR3 A;  3PWC A;  1ZOM A;  5GWZ A;  3ZZ8 A;  1K1I A;  1L4D A;  4WMF A;  1HJA B;  3OTP A;  4DGJ A;  1JXP A;  2QC2 A;  3HK3 B;  1GMD F;  1NZQ H;  1AKS A;  1D3T B;  4CRC A;  3IIT A;  4ZMA H;  1C5Z B;  1CE5 A;  4E05 H;  4X0W U;  1F5K U;  1GHA G;  1UTL M;  1C2D A;  1W0J D;  4FOU C;  2BYA X;  3T27 A;  2J5U A;  4FUH A;  3ZZ3 A;  2KAI B;  5EJL A;  4ZAE A;  1JWT A;  1GL0 E;  3VB5 A;  1MTS A;  2GV7 A;  3M3V A;  3P6Z B;  2OC8 A;  1Y3Y A;  1AHT H;  2CK3 D;  1CO7 E;  1QRW A;  2XC4 A;  1HAV A;  1O3A A;  3PM3 A;  3VB3 A;  2FLR H;  2ZGJ A;  1G36 A;  3UNQ A;  3RXK A;  1CA0 C;  1DXP A;  1GJ5 H;  4F48 B;  1EAU A;  3M3T A;  1HYL A;  2ZGB H;  4OS5 A;  3KEE A;  1ANB A;  1QB6 A;  1LHC H;  1RFN A;  2GGV B;  2Q6G A;  3W94 A;  4LXB H;  4ZRO A;  4AZ2 B;  1AVX A;  2LP6 A;  3KQE A;  4Y11 E;  2AIP A;  3CNR A;  4I8L A;  3I78 A;  2FS9 A;  2GX4 A;  3GDS A;  3V3M A;  2RCE A;  2F9B H;  1GI9 B;  4O97 A;  3Q3X A;  3F1S B;  3W1E A;  1LVB A;  3BTE E;  1CGJ E;  1GI2 A;  1MAB B;  4OS4 A;  1GMH G;  5A09 A;  1Z7K A;  2PUQ H;  1G30 B;  1H8I H;  2AYW A;  2OD3 B;  2QGR A;  4OS7 A;  5T6D A;  2IOT A;  3KID U;  2M2A A;  1PPG E;  2CN0 H;  5EXN A;  4HG6 A;  4BAH B;  5HMA A;  1BBR H;  1FN8 A;  1XXD A;  2FDA A;  2BOH B;  1S5S A;  3PLP A;  1KXD A;  1ZSJ A;  2AIQ A;  3RXR A;  2H5C A;  4DJZ B;  1O3H A;  4BTT B;  2NU2 E;  1OX1 A;  2CF8 H;  1YPK H;  1W7X H;  2V0B A;  3ZZA A;  1C4U 2;  4MNV A;  3SHA H;  1T8O A;  1NM6 A;  1O3G A;  1TA6 A;  1KXC A;  3FP8 E;  1SL3 A;  1DWB H;  2BDI A;  2HNT E;  1RIW C;  1S6H A;  4GSO A;  2KCO A;  5DP9 A;  4GCH F;  1TYN A;  4UFF H;  2ZFF H;  3BEF B;  1C5T A;  3NK8 A;  2DE9 A;  1TAW A;  1CT2 E;  5FCK A;  1TX7 A;  1O2Y A;  2P8O C;  2PW8 H;  1HAG E;  3F2G A;  4Y6D A;  2G55 A;  3KQ5 A;  5GXP A;  1C2E A;  3QZQ A;  4DT7 B;  2WUB A;  1KTS B;  2A7J A;  3U9A H;  1GBH A;  2VIP A;  1WYK A;  2ZDA H;  2BM2 A;  3A81 A;  2WV4 A;  4NA8 A;  1KXF A;  2FOC A;  3OY5 U;  4AX9 H;  4THN H;  2O8W A;  1QZ8 A;  2W6J D;  3LPR A;  2C8X B;  4CHA C;  1NS3 A;  2YMS D;  5FBI A;  1AVG H;  2THF B;  5DKM A;  4WF8 A;  1YPH C;  5EG4 A;  2ZHF H;  2M5T A;  2ZU2 A;  2XND D;  4X8S H;  3A8D A;  3SYJ A;  2ZF0 H;  3GY2 A;  2F4L A;  1C5V A;  4OGY A;  1K0H A;  3OY6 U;  2NU0 E;  1HUT H;  3PO1 B;  1SGE E;  4AGK A;  1A1R A;  1G3B A;  2D26 C;  3ITI A;  4AG1 A;  3LDX H;  3NZI A;  5K7R A;  2ZHD A;  4YT6 H;  3PTN A;  1FON A;  1ID5 H;  2F43 B;  1KDQ B;  1K2I 1;  4B76 A;  1SGF A;  1ZR0 A;  1VIT F;  4Y7A A;  3EDX B;  3U1J B;  4X8U H;  1ELC A;  1LPG B;  2C8Y B;  1AN1 E;  4HGC A;  1GHA F;  2AEI H;  1AQ7 A;  1UK4 A;  3IG6 B;  3OYP A;  1VGC B;  1ARC A;  3RMM H;  2ZU1 A;  2FX6 A;  3Q00 A;  1O2N A;  2PFE A;  4WVP E;  4Q7Z A;  4K1T A;  2CXV A;  2BDH A;  5J4Q A;  4MLF B;  3KNX A;  1GBC A;  1XMN B;  2PLX A;  4D9R A;  3I77 A;  4FVD A;  3FO8 D;  2VIN A;  3RM0 H;  1QB9 A;  2ODY B;  4I8K A;  2Z9K A;  5CHA C;  4FUF A;  3ZZ9 A;  5DG6 A;  4XD7 D;  4U2W A;  1Z6J H;  3MU0 A;  2K0Q A;  1FNI A;  2FTM A;  5L30 H;  1HJ9 A;  5F8X A;  1SBW A;  2A7H A;  3ZYE A;  2BVX H;  1IQK A;  1BRB E;  2A7C A;  3TLO A;  1QJ6 B;  4AOQ A;  3QUM P;  1T8N A;  1HAO H;  4X2Y A;  1PJP A;  1FY4 A;  2Z9J A;  2WYJ A;  2ZCL P;  4IBL H;  3SN8 A;  1EZS C;  3O8D A;  5C0T A;  3QGJ A;  1S83 A;  1C1U H;  4SGB E;  3SJ8 A;  1CA0 B;  1SQR A;  2OCV B;  3GDV A;  4FUC A;  3TH2 H;  2AMP A;  2UWP A;  1Z8G A;  1ZGV A;  4NZQ A;  3PMJ A;  1SGY E;  2QXH A;  2AGG X;  2WPK S;  3DFL A;  1XUF A;  3URC A;  1HB0 B;  3TH3 H;  3RC6 A;  2FYR A;  1SQT A;  1GMC G;  5CE1 A;  2J95 A;  3RXH A;  4RKO B;  1P9S A;  2FEQ H;  2Y80 A;  2Z9G A;  1UCY E;  4UEH H;  4R8T B;  4BTI B;  1BTY A;  2BDY A;  2O8U A;  4CH2 B;  1CVW H;  4B2B A;  1QJ1 B;  5A0C A;  1O2L A;  1QB1 A;  1O3O A;  2BD7 A;  2PTC E;  1SOT A;  2HOB A;  2HAL A;  5A8Y A;  3HK6 B;  1AFE H;  1OWH A;  3QO6 A;  1K1N A;  1V2M T;  1Z8R A;  3GCH C;  2J98 B;  1U6Q A;  1Y3V A;  3H5C B;  1F0R A;  2CHA C;  2B5T B;  7KME H;  4MNY A;  1J8A A;  1TNG A;  1AE8 H;  3BSQ A;  1THP B;  3GCT F;  2WPD D;  3GYM A;  2Z3C A;  3S9C A;  2A4O A;  2ZU4 A;  4OS2 A;  1GJ6 A;  4UFG H;  3HGP A;  4JYT A;  3UY9 A;  2YOL A;  3BEU A;  3RLW H;  1ZMJ A;  4XOJ A;  2OUA A;  1GGD B;  4WY3 A;  5F8T A;  4ZHL U;  1TQ7 B;  1P3E A;  1PPZ A;  4ZHM U;  3NCL A;  1Y3X A;  1S6L A;  1PPB H;  2P8O B;  3RXB A;  3SGQ E;  2PHB A;  2P93 A;  1MD8 A;  1A4W H;  1AWF H;  2ZQ1 A;  2VVC A;  1NES E;  3OEH D;  4NFE A;  2JKH A;  3QZR A;  5K0H A;  1Y59 T;  5JDU B;  4E7N A;  1KIG H;  1P2K A;  3TK9 A;  3UOP A;  1C2L A;  1MZA A;  3PMH B;  1S82 A;  2BD2 A;  3KF2 A;  1EAI A;  4FET A;  4OM9 A;  2AGI X;  3BTQ E;  5A8Z A;  1Y8T A;  3TNS A;  2BY7 X;  4CBO A;  3FP6 E;  5J4S A;  4ISO A;  1W3C A;  5JYI A;  1GJD B;  6GCH F;  2GT7 A;  2A45 B;  1DM4 B;  5HIZ A;  3ZZ5 A;  3ZZB A;  4MPX A;  1ZRK A;  2WPI S;  1A2C H;  4INK A;  3F68 H;  3LOX A;  3B23 B;  5G4B A;  2JJ2 D;  4MPU A;  1O2H A;  2C4F H;  4YM9 A;  3T2N A;  4RT1 A;  1D6W A;  1PYT C;  1KMH B;  1H4W A;  5E0H A;  2ODP A;  2V35 A;  4D76 A;  3SI4 H;  1CGI E;  1TGN A;  4FUB A;  5JBT A;  1JBU H;  1DIT H;  4HTC H;  4XFQ A;  2H1U A;  3UPE A;  3UAI C;  1TGC A;  4ABJ A;  2BQ6 B;  6CHA B;  1B0E A;  1LO6 A;  3RUO A;  1BTW A;  1H8E D;  1ZPB A;  4K3J A;  3V0X A;  4ABB A;  1XX9 A;  1UHB B;  1Y5B T;  1O2X A;  4B75 A;  2HLD D;  1V2W T;  4X1Q U;  2BDG A;  4Y7B A;  2Q1J A;  2VIW A;  4JZE H;  3V13 A;  2BD9 A;  1QJ7 B;  5EIY A;  2ZQ2 A;  1BT7 A;  5LH8 A;  5HGG A;  5C94 A;  4IW4 E;  2ZDL A;  1XKB C;  4XE4 A;  1YBW A;  1P01 A;  1SQA A;  3ODD A;  1YPJ H;  1XUK A;  2PP6 A;  5KGO A;  2GKV E;  3QTV H;  4AGJ A;  3F6U H;  1A7S A;  2LNC A;  1J17 T;  1FJS A;  4IS5 A;  2BMG B;  1GBI A;  1VCP A;  2WPJ S;  3SOR A;  3A7Z A;  4BAO B;  1WV7 H;  2Y7X A;  4NA9 H;  3H7O A;  1T32 A;  1UO6 A;  2F9U A;  1Q31 A;  4ZCN A;  1FX0 B;  1O2G H;  2FI4 E;  2XBX A;  1KXB A;  3VFE A;  3S0N A;  2UUK B;  3F3B A;  1AIX H;  1CBW C;  1P9U A;  2Y5G A;  5T6G A;  1EXF A;  1YCP K;  2G8T A;  1UTQ A;  2BOK A;  1ELB A;  1KXE A;  3SU0 A;  7LPR A;  3K9X B;  2TGD A;  4TPI Z;  1O2Q A;  2UWO A;  3FZD A;  5L2Z H;  2BY5 X;  5JBA S;  2GDE H;  2ZI2 H;  1FIW A;  1GJA B;  3BIU H;  1B7X B;  4ZKO U;  1G2L A;  1MTU A;  5EQQ A;  1GI0 A;  2BQW B;  1LKA A;  3I29 A;  2ZNK H;  1QL9 A;  2H2Z A;  2RDL A;  3KHV A;  1DOJ A;  1GJB B;  1NT1 A;  1WU1 A;  1S0R A;  1UW7 A;  1BA8 B;  1ACB E;  1ORF A;  4LK4 A;  5E2P A;  1SGN E;  1V6D A;  3AW0 A;  2ANM H;  2UUJ B;  1HAX B;  1V2R T;  1BJU A;  1MKW K;  1QY6 A;  1NC6 A;  4NWK A;  2EEK A;  1D4P B;  3O8R A;  3QGN B;  3OSY A;  1P02 A;  1VCW A;  3EE7 A;  1QRX A;  3GCH B;  1HV7 A;  1SFQ B;  1UHB A;  2HPQ H;  3QTO H;  2TRM A;  3HGN A;  4X1N U;  1TNJ A;  1O3B A;  2I6S A;  1KTT B;  1E38 B;  2CHA B;  5GDS H;  1LPK B;  3SHC H;  1TB6 H;  3SJK A;  4AG2 A;  1BTX A;  2RFK C;  1J16 A;  2NU1 E;  1GHB G;  4ZKN U;  1OHH D;  1AUT C;  3UR9 A;  2BXT H;  1SGF G;  4O3T A;  1SGC A;  5JBB S;  1O30 A;  1EAT A;  1NO9 H;  1HAP H;  1BML A;  1HLT H;  1C5S A;  1GI7 B;  1NN6 A;  1NU7 B;  1FXY A;  2FES H;  2SGQ E;  4B1T A;  1TAB E;  4INL A;  4MQA A;  4F49 A;  4Y8Y A;  2SGA A;  3ZZ4 A;  3MMG A;  4LZ1 H;  4A7I B;  1V2N T;  4WJG 2;  2CV3 A;  3T28 A;  1XUH A;  2RA3 A;  1SKY E;  4TT3 D;  5IDK A;  1O5E H;  3P95 A;  2BD3 A;  3URE A;  3LGT A;  1EP6 A;  3N99 A;  5EW2 H;  2P95 A;  1F0U A;  1YC0 A;  4RKJ B;  1BB0 B;  1CT0 E;  5EU8 A;  4UFD H;  2F9P A;  2B9L A;  3AAU A;  3Q3Y A;  1K9O E;  1SLW B;  1UK2 A;  2SGF E;  1SLX B;  1YKT A;  4NIW A;  4BXW A;  2JIZ D;  3CS0 A;  3EA8 A;  1TGB A;  4NFF A;  1JIR A;  1O2S A;  2SGE E;  1YWU A;  2OQU A;  1TLD A;  1YLN A;  3IWM A;  4MPW A;  3T26 A;  4KGA A;  2BD4 A;  4Q4L A;  4JK5 A;  5C0U A;  2B0F A;  4X6M A;  1E0F D;  2QE7 D;  1UTO A;  1WCZ A;  3ZV9 A;  1SFI A;  3L6P A;  4JK6 A;  4X6N A;  3TJU A;  2QXG A;  2BVR H;  2ZTX A;  3SNE A;  2RG3 A;  1QBV H;  1NRQ H;  2IJD 1;  3GY8 A;  1RJX B;  3VB7 A;  4YOJ A;  4ACB A;  2O8T A;  8LPR A;  3MO9 A;  2ZFR H;  2R2W U;  2QY0 B;  3SZE A;  3UWJ H;  1V2S T;  1UK3 A;  2FYQ A;  1MUE B;  1CU1 A;  4I8G A;  3VGC C;  5EJ1 A;  1D3Q B;  2FO9 A;  3MI4 A;  1BMF D;  1UVT H;  1KLJ H;  2Y81 A;  4IGD A;  1VGC C;  3SNA A;  1FAK H;  2UWL A;  1DSU A;  5HYO A;  3U8T H;  2I6Q A;  3MO3 A;  1YCP H;  2R2M B;  3KYG A;  1YP9 A;  3SV6 A;  3PB1 E;  3GDU A;  1HRT H;  4PRO A;  4K2Y A;  3QX5 H;  1NFU A;  2J2U A;  1V2O T;  5FX5 A;  3RXD A;  1C5Y B;  1EJA A;  1P04 A;  2ALV A;  1TNK A;  1Q3X A;  5C5O A;  1FDP A;  4X1P U;  3GS9 A;  2UUF B;  1O3J A;  2JH0 D;  4AC9 A;  1FY8 E;  2G4U A;  2DUC A;  1GBL A;  3NXP A;  1V2P T;  5DP5 A;  4ZKR U;  1W0Z U;  1AI8 H;  3MNS A;  1K28 D;  1N8O B;  2VIV A;  1KYN A;  1T8M A;  1W12 U;  4A1T A;  1D3D B;  3RM2 H;  4ISH H;  3RML H;  1ABJ H;  3KCG H;  4X1R U;  1CBW B;  2WYG A;  1AGJ A;  1LHE H;  3EE0 B;  4TWW A;  2A2Q H;  1BTZ A;  1RTK A;  1MKW H;  1HAZ B;  4FU7 A;  1GI8 B;  1VZQ H;  4CRF A;  3MWI U;  4XBB A;  4M7G A;  1TPO A;  5ETX A;  1GBD A;  1EP5 A;  2GTB A;  3E6P H;  1GL1 A;  2Y5F A;  1F0T A;  3VB4 A;  5EQS A;  2P59 A;  3EGK H;  1MTV A;  4YOG A;  2BTC E;  1W0K D;  4BNR A;  1XUJ A;  2J97 A;  1GBF A;  3VXE H;  4F55 A;  1GVL A;  2QF0 A;  4FUG A;  1MCV A;  4ISN A;  1C1O A;  4JZD H;  1IQM A;  3RLY H;  1OXG A;  1ARB A;  1F0S A;  1DX5 M;  5F8Z A;  3P92 A;  3RXT A;  2ANW A;  1UVP A;  1L1J A;  4BAN B;  4FUJ A;  2OP9 A;  3PWB A;  1H9H E;  4WH8 A;  3M7Q A;  3C27 B;  1F5L A;  4ZXX H;  2NU4 E;  1O3L A;  1CA8 B;  2G5V A;  3U8R H;  1FMG A;  5I25 A;  3TPI Z;  1Z1I A;  1C1T A;  1UMA H;  2AGE X;  2OC1 A;  4NWL A;  2EI8 A;  2R0K A;  3P17 H;  4ABA A;  5DPA A;  1D6R A;  1TA2 A;  3ZZ6 A;  4D9Q A;  3SUF A;  1TQ0 B;  2A0Q B;  2XW9 A;  3GCN A;  1AZ8 A;  1BOQ A;  5FPT A;  4MDS A;  1GGD C;  2BD5 A;  2P3T B;  2A1D B;  5C1Y A;  2SFA A;  5GCH F;  2V3H H;  3KQB A;  2V3M A;  1C5W B;  4DVA U;  1C5U A;  1SR5 C;  3LGI A;  2VVV A;  3ATL A;  1P2M A;  3PRD A;  1IQL A;  2H5D A;  2HNT C;  1P2O A;  5B6L A;  4GAW A;  2O9Q A;  1BBR E;  3VG8 A;  5C17 A;  1V2K T;  2ZFP H;  1H1B A;  1GBJ A;  1QQU A;  1DIC A;  1YYY 1;  3FN8 A;  3B9F H;  4WMD A;  1CSO E;  4X6P A;  8GCH G;  1IHT H;  2XXL A;  1V2V T;  4AN7 A;  2G51 A;  4I8J A;  2VU8 E;  1T31 A;  3BIV H;  2W6I D;  1Y5U T;  2Z6B D;  1O3I A;  1F2S E;  3F9F A;  3ZVF A;  3N7D A;  1MAX A;  2H6M A;  3PLB A;  2WUC A;  1SB1 H;  1G3E A;  4INH A;  1GBM A;  3MH4 A;  1YLC A;  3A7Y A;  3STI A;  1GHZ A;  1O2J A;  1O3P B;  1TRM A;  4U30 A;  1GHY H;  3TU7 H;  2Y6T A;  7GCH F;  1OWJ A;  2ZTY A;  5B6O A;  1FUJ A;  4TWY A;  1EQ9 A;  1TFX A;  3M37 A;  1Q2W A;  3ZZD A;  2FS8 A;  2ZDM A;  2OIN A;  2R3U A;  3T62 A;  3HPT B;  4MNX A;  5AFZ H;  6CHA C;  4IMZ A;  3UR6 A;  3DSG A;  5LPF A;  3RU4 D;  1O5A B;  2C3S A;  5DP3 A;  2A5K A;  3RDZ A;  1N6X A;  3S69 A;  1LTO A;  1MQ6 A;  5PTP A;  1V2Q T;  1GVK B;  1O3F A;  2FIR H;  1BTH H;  2KM0 A;  3VGC B;  3LC5 A;  1DY8 A;  1LPZ B;  2W26 A;  4Q63 A;  4Y0Z E;  5AVD A;  1GVZ A;  1BUI A;  1C1R A;  5FL7 D;  3A84 A;  1IQJ A;  4AOR A;  3A7W A;  2XBY A;  3ZIA D;  3SUD A;  4FUD A;  1BMM H;  3OE7 D;  4BXS A;  1AU8 A;  2BZ6 H;  1E1R D;  2QAA A;  1SC8 U;  3BN9 A;  3RXO A;  5BPE A;  4F4O C;  1GCT C;  1O32 A;  1H9I E;  1O2V A;  1YPE H;  2YMS B;  4O3U A;  1MH0 A;  4XDE A;  1HIA A;  3JZ2 B;  1XUG A;  2ZP0 H;  4YZU A;  2Y82 A;  2XNI A;  1C5N H;  3RXA A;  1ZSK A;  1EZU C;  1BIO A;  1GG6 B;  4WXV A;  2ZG0 H;  3SV9 A;  3AVZ A;  1MKX K;  1P06 A;  4DW2 U;  4I33 A;  2O8L A;  4BTU B;  4BAQ B;  1TNL A;  2XCN A;  3UWI A;  1BRA A;  3U28 C;  1AY6 H;  1QHR B;  2QYI A;  3E8L A;  3HKJ B;  1BDA A;  2ZPR A;  1RTF B;  1IQH A;  1C4V 2;  2PKS C;  1IQE A;  2BX3 A;  1GMH F;  3F2H A;  1DWD H;  2VH0 A;  2ILN A; 
#chains in the Genus database with same CATH homology
 1E1Q D;  1OHH D;  3F0P A;  2A4R A;  4JMY A;  1A1R A;  5ESB A;  4Z1M D;  2W6I D;  3OAA D;  2QF4 A;  5DSF A;  2WV9 A;  5CDF E;  1BT7 A;  2XOK D;  2KCY A;  3SU2 A;  2XCF A;  4A1T A;  2F43 B;  3DSO A;  4B74 A;  4B76 A;  3N7D A;  2OBO A;  1N1L A;  3W1E A;  1DXW A;  3AK5 A;  2IJO B;  3U1J B;  1DY9 A;  2OC0 A;  2YMS C;  2WZQ A;  1MAB B;  5EQR A;  3SU6 A;  4B71 A;  2JJ1 D;  3SU3 A;  4A92 A;  3U1I B;  1COW D;  2VBC A;  2WPD D;  3DCL A;  3SU5 A;  3SUE A;  2M2A A;  1SKY E;  4TT3 D;  4DT4 A;  5IDK A;  3O8C A;  3OYP A;  5ETX A;  3WWF A;  3N99 A;  3EYD A;  3F0O A;  2F9V A;  2WHX A;  3DSP A;  4WH6 A;  2YOL A;  5GPI B;  2F9U A;  3SU1 A;  4ZCN A;  1FX0 B;  3KN2 A;  3OFN D;  5EQS A;  5EPY A;  3M5N A;  2GVF A;  2LEL A;  3F3B A;  4U01 A;  3RC4 A;  3SV8 A;  3WWB A;  1WXR A;  2P59 A;  1S6L A;  2OIN A;  1W0K D;  5H4I B;  2KCP A;  1NBM E;  2OC7 A;  2OK5 A;  3SUG A;  2JIZ D;  3KNX A;  4F55 A;  3OEE D;  3WW7 A;  3FO8 D;  2AHM E;  3PRB A;  3SU0 A;  3LKW A;  4A1X A;  5HKK D;  4KTC A;  5GND A;  2KCO A;  3NRL A;  4Q4L A;  5FPY A;  4A1V A;  3RC5 A;  2L6O A;  3UB0 A;  5C0U A;  4RI0 A;  2K8I A;  4XD7 D;  3SU4 A;  4YXW D;  3SV7 A;  2QE7 D;  2KM0 A;  4B73 A;  2K0Q A;  3M5L A;  3M5M A;  1NBM D;  3OEH D;  1DY8 A;  4Q63 A;  3FKS D;  3L6P A;  2KR7 A;  2QV1 A;  5FL7 D;  3O8B A;  3PV2 A;  4WH8 A;  4TYD A;  2JDI D;  3ZIA D;  3SUD A;  5F53 A;  5FPS A;  3F2G A;  3OE7 D;  3KF2 A;  3OTP A;  1JXP A;  5EQQ A;  4FET A;  4OM9 A;  2K1Q A;  1E1R D;  2IJD 1;  3PV5 A;  2OC1 A;  4NWL A;  3SZE A;  3O8D A;  5C0T A;  2KFW A;  1W3C A;  2YMS B;  1E79 D;  2FOM B;  3P8N A;  3P8O A;  4ASU D;  4K8B A;  2QF5 A;  1CU1 A;  4M9F A;  1W0J D;  2O8M A;  3SUF A;  1BMF D;  2XNI A;  2J5U A;  4I31 A;  3LON A;  5FPT A;  3LOX A;  3E90 B;  2KCA A;  2JJ2 D;  3M5O A;  1RGQ A;  4I32 A;  3SV9 A;  2W6J D;  5CHB A;  1KMH B;  2KZ4 A;  3SV6 A;  1NS3 A;  2A4Q A;  2FM2 A;  2OC8 A;  2WSS D;  2YMS D;  2CK3 D;  3F2F A;  3FOA A;  4I33 A;  4WF8 A;  3H09 A;  1RTL A;  2XCN A;  3PRD A;  4NWK A;  3RC6 A;  3O8R A;  3N7E A;  4B6E A;  5IK2 D;  5B6L A;  2XND D;  2V7Q D;  4TSF D;  3SYJ A;  1DXP A;  2OBQ A;  1EFR D;  3GS9 A;  5GJ4 B;  3VG8 A;  2F4L A;  5C17 A;  4R8T B;  1H8E D;  3KEE A;  2GGV B;  3FN8 A;  4B6F A;  5EPN A;  3F2H A;  5DN6 D;  1H8H D;  4B75 A;  2HLD D;  2FP7 B;  2A4G A;  5T1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...