4ZCNA

Crystal structure of nvpizza2-s16s58
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
86
structure length
86
Chain Sequence
SHMFTGLNTPSGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVLPFTGLNTPSGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords nvPizza2-S16S58
publication title Crystal structure of nvPizza2-S16S58
rcsb
total genus 12
structure length 86
sequence length 86
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.500 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4zcnA00
3WW7A 3WWFA 3WWBA 4ZCNA 5CHBA 5F53A
chains in the Genus database with same CATH superfamily
4YLQH 1GJ9B 1DOJA 1V2KT 4B75A 2AGEX 1SGNE 4RT0A 1GI0A 4WMEA 1OWIA 1CE5A 1O34A 3DUXH 4XDEA 2BYAX 1ANDA 2M5TA 2PKAB 1THPB 3KQ5A 1S6HA 1HV7A 1TNHA 1TGSZ 1VKYA 1SI5H 3SU4A 3SGAE 4FUHA 1BBRK 5T3HA 1C5TA 4MNWA 2LPRA 4IGDA 2ZGJA 4Q2KA 1SGQE 4E05H 4B1TA 4FUJA 1HJ8A 2HWLB 3AVZA 1HXEH 1CA8B 3FZDA 3EDXB 3KQCA 1C1TA 1AN1E 2BOKA 1P2NA 1A2CH 5JBAS 1DT2A 2TGTA 5T6FA 2A5IA 1E35B 1FZZA 1L1NA 2A5AA 2W5EA 1UK3A 1CGJE 4I7YH 3OAAD 1KLIH 1FIWA 1C5OH 2BDCA 1TGCA 1W0YH 2ZC9H 3UR6A 3EE7A 3Q00A 4MPXA 1ETSH 3P95A 4CBOA 2KFWA 2I6QA 1TPPA 2FLBH 3M7TA 3OYPA 1IQFA 2KCOA 8KME2 5C0TA 1BMAA 1FQ3A 2R3YA 3SN8A 2Y7XA 1CHGA 1EXFA 1O3CA 1KXCA 1UK4A 1ZPBA 2V0BA 2GDEH 1WAYB 4WJG2 5E2OA 1AIXH 5CHAB 1FMGA 2RFKC 1ZMLA 4ABJA 2FOAA 2I6SA 3ITIA 2P95A 2PKSB 1GBJA 1UO6A 5F6MA 1AWFH 1W7XH 3GY8A 1E38B 3TNSA 5I25A 3T29A 1C9PA 1Z1JA 2IPHA 3ODDA 3D62A 1BDAA 1C5MD 1HUTH 2G81E 1GBEA 2D8WA 3TIUA 2ZDMA 1GCTC 4Y0YE 2FI4E 1GMHG 1OKXA 1G2MA 1RRKA 4ZHLU 2ZP0H 1ARBA 2IJD1 3HPTB 4BTUB 3A7XA 4RKOB 2HRVA 2Y5HA 4BNRA 5FPSA 5LGOA 3SV6A 1GJ8B 2QE7D 6ESTA 4X6OA 3E3TA 4ZUHA 1O2WA 2C90B 4X8UH 1IQJA 1COWD 1AVGH 5C3NA 1WCZA 8GCHG 4TWWA 3CP7A 2Y81A 1QQUA 2BDBA 2BDYA 5BPEA 2H5DA 3QN7A 3QLPH 2GZ9A 2BD3A 4TY7A 3TJNA 1TBQH 1ETRH 1C4Y2 2C93B 1G3EA 3ZZBA 1K21H 1FPHH 1AD8H 2UWLA 2YOLA 4WMFA 2BZ6H 2FMJA 3SUFA 5BRRE 1LQEA 5A09A 2ZGXH 2A32A 1PPZA 1ZTJA 1DICA 1RFNA 2QYIA 2VU8E 1SGFA 4A1TA 2ZPQA 5GDSH 4RN6A 5FL7D 1WTGH 2FIRH 2P3UB 4ISIH 2Q6DA 1S0RA 1HJAB 4AGKA 2AMQA 2ZQ1A 1XX9A 2H2ZA 2QIQA 1E79D 4Y7AA 4YT7H 1F5KU 3U8OH 3GS9A 1HPGA 1KMHB 2VIVA 1O5EH 1H8HD 5ESTE 1TBRH 1LKAA 4MNVA 1C1RA 2R9PA 4TWYA 2HVXA 1HAXB 1BOQA 1PQ7A 2ZWLH 1RD3B 1P2JA 3W95A 1W0KD 3ZV8A 2FTMA 5EPNA 5FCRA 4Y6DA 1ZMJA 2CV3A 4K2YA 1J15A 3S9AA 5EIYA 3AW0A 1P8VC 2Y82A 4X2XA 3MNCA 4ABGA 1C5SA 2OC7A 4ZKNU 3TK5A 4DIHH 1GHBF 5EG4A 1H8DH 1TX8A 4ZH8A 1L0ZA 3A8CA 2XBYA 1A5GH 3S69A 1JIRA 1GGDB 2AIQA 4I33A 5EW1H 1IQLA 2OBOA 3SNCA 4D76A 1MU6B 3SNAA 1BB0B 1C2FA 1OYQA 1XKBC 1O0DH 2XW9A 3BTTE 2Z3CA 5H4IB 1XUKA 1Q3XA 1YC0A 2AFQB 3E90B 1MAYA 1SLVB 4LOYH 2YMSC 3SI4H 1PPBH 3ZV9A 2OUAA 3Q3YA 4XSKU 3Q3XA 3GCTG 3PV2A 2ZG0H 1GBAA 4MPWA 1W12U 4FETA 1EATA 4U30A 1P2KA 1SLWB 2JKHA 1WSSH 1GBKA 4H42U 3GY6A 1DS2E 1DDJA 5GCHF 4GHQA 1ORFA 1PPHE 4OS5A 3FVFB 1E1QD 1MUEB 4ABAA 1UVOA 1BBRH 1KSNA 1UCYH 3BTDE 3T62A 2W6JD 1G37A 3KF2A 1O5DH 5CHBA 3PRDA 1E36B 3KYGA 2D2DA 3FANA 3M5NA 3NWUA 1ELTA 3F1SB 3JZ1B 3GOVB 1C2IA 4Q7XA 4Y8YA 1UVSH 2QXIA 4ZROA 1JXPA 1O3GA 1PQAA 1QL7A 4OGXA 4BOHA 3ZZ5A 1O2SA 4HI3A 2BZAA 3RXUA 4YM9A 1QQ4A 2HLDD 5AFZH 2OD3B 2BQ7B 1PPGE 1C5ZB 3T2NA 1GHAF 1ZMNA 2ZDNA 4OS2A 3GCHB 5AHGH 2XXLA 2XBWA 2G8TA 2GP9B 5HMAA 1HAGE 1NU9A 4Y10E 4OS4A 3RXKA 1O33A 4A92A 2QXJA 1P2OA 1Y3WA 1CA0B 2WHXA 2FEQH 5K7RA 3SO3A 2FOHA 2B5TB 4CRFA 1TA2A 3A7ZA 1A3BH 1TMBH 2UUYA 2KAIA 3GDVA 1W11U 1NU7B 2H9EH 3HKIB 5JDUB 1D3DB 4X1NU 2GJGA 3VG8A 1GI9B 1SMFE 3T25A 3KQEA 3ENSB 3PLPA 2ZTZA 1P09A 2GCTB 3PO1B 1Y3XA 3M5OA 2Y5GA 3NCLA 1W3CA 1SHHB 4ABBA 2AIPA 1O32A 2G55A 3GDUA 1BITA 4K3JA 4CHAB 3TH4H 4HZHA 3Q76A 3WW7A 1K1NA 2W6ID 1UTPA 1O39A 1L2EA 2Y80A 1NY22 2D1JA 1N8OB 3SOSA 1EP6A 4BAQB 1S81A 2P3FH 1SGTA 5TJXA 1F0SA 1C1PA 1BA8B 1SGPE 1BTZA 1YLDA 3SBKA 5TCAA 3BN9A 4B73A 2P59A 1ELFA 2GGVB 1UTNA 3MU4A 2WV5A 1GL0E 1A3EH 3TH3H 1FN6A 3S7KB 3I77A 2FPZA 2XBXA 3RUOA 3SJ8A 1SGYE 2OINA 3GYMA 3F2GA 3RXFA 1CHOG 2C8WB 2ZEBA 2ANKH 4DURA 1O2NA 2RDEA 1ZOMA 1ZRKA 2VIPA 2B0FA 2OC0A 1AE5A 1NFYA 1IQMA 4ISHH 2K0QA 2Z9LA 4XRNA 3BV9B 4XBDA 4MDSA 1A61H 1LO6A 1LPZB 2Z3DA 1F5RA 1GVLA 1T8LA 1GVKB 2A4OA 1TOCB 3LOXA 2ODQA 4CBNA 3GY7A 1GBLA 3OTJE 4DY7B 1SGFG 3E16B 1QB9A 2F9OA 1NT1A 1GHBG 4TPIZ 1LVYA 3H09A 3SU0A 1T7CA 1GBCA 1TONA 5DG6A 2XRCA 5DK1A 4F4OC 3BTME 3HK6B 1H4WA 3P8FA 2QF0A 4Y0ZE 1QR3E 3ATIA 2JJ2D 3RXBA 1YPKH 1O2MA 5IDKA 1O2XA 1DLKB 2KCYA 2QGRA 1GI5A 2VJ1A 3FN8A 4YESB 1HNEE 3OEED 3OY5U 1NPMA 1GMCG 4NA8A 1HJAC 1O2VA 3RLWH 2YNBA 1H8IH 2J9NA 2DUCA 2PGBB 2SGFE 4BAMB 1MTVA 2FS9A 2Y7ZA 2A31A 3S0NA 2BY7X 2J5UA 4DGJA 5A2MH 1BZXE 5DGJA 3BTQE 4A1XA 1TAWA 2PKAA 3PB1E 2XTTB 2KAIB 1MTNC 2H5CA 1A1RA 3UTUH 4AYYB 2QF4A 1YCPM 3MH5A 6GCHG 3LGYA 3RXGA 1CBWB 3RXAA 4Q7YA 2EI7A 3F9GA 1H1BA 3SV7A 4TY6A 2WPKS 3SHAH 2BLVA 3SORA 3PM3A 5E0JA 1IHSH 1TMTH 4BXSA 3N7OA 3K2UA 2CJIA 4YTAA 6LPRA 4FXGH 2B9LA 4U32A 4BTIB 1JRTA 1F7ZA 3A80A 3FO8D 1GHAG 1O38A 2HPQH 1OYTH 3UAIC 2NU4E 3QZQA 1C2JA 1TYNA 1QIXB 2ZHDA 1GMHF 1QBNA 1L1JA 1YYY1 5EQSA 1TNJA 3SU5A 1P10A 2ZPRA 3V7TA 3EGKH 5DP3A 1C2GA 1C1UH 1GBDA 2WV4A 3U28C 1YCPK 1A0LA 1HLTH 4NSVA 4INLA 4CH8B 1EPTA 4YT6H 2H9TH 2BX3A 3QGNB 8GCHF 3RXOA 1PQ5A 1G9IE 4IC6A 1S84A 1PYTD 1G30B 3KQDA 1P3CA 3AK5A 2GV7A 3RXMA 1MKXK 1NROH 2J98A 3CENA 4GHTA 2PHBA 4O3TA 3QO6A 3RU4E 1O36A 3E0NB 3Q3KA 3T28A 3FP7E 4X1SU 1FY1A 2WUBA 1TGNA 2ZGHA 3LC5A 4WH8A 1WBGB 3H7OA 2AMDA 3ZZ7A 1S82A 2IOTA 2XC5A 1HBTH 3LJOA 1GL1A 2A45B 3HKJB 4FUIA 2FOBA 4NWLA 1SGCA 4AOQA 1TMUH 4HGCA 1D6RA 3N7EA 4P02A 3SYJA 4FUGA 1MTWA 4JYTA 3BEIB 1CT0E 1ESBA 2PTNA 1S83A 1HAOH 1LPGB 3TK9A 1ZPZA 3FAOA 1HIAA 1DSTA 2BMGB 1LPKB 1MD8A 1BMLA 1SHYA 5HIYA 4DG4A 4XBBA 2TRMA 3RXVA 1SPJA 2BY8X 3VEQB 2BD9A 4CRBA 2SGAA 1FONA 3SU3A 1XUGA 2ALVA 1V2OT 5A8XA 1D3PB 3ELAH 4B6FA 3TNTA 1MABB 3FOAA 3I78A 2QA9E 1DFPA 2TPIZ 2HNTF 4ABDA 1XUFA 1AO5A 4NG9H 2GMTC 1LVBA 3RXHA 1RGQA 1EAXA 1AFQC 1GHWH 1KTSB 1XUHA 2SGEE 3F0OA 2AHME 3PV5A 3ZVGA 1ARCA 3KIDU 2SFAA 3VB5A 3A7VA 1ANBA 1QB6A 4NIYA 3U1JB 3QDZB 2JJ1D 1P9UA 2OC8A 2PSYA 1SOTA 3OY6U 1RXPA 3SZNA 3M3VA 5C2ZA 2GCTC 3L6PA 1OSSA 2R0KA 4AB9A 4FUBA 1DSUA 5EQRA 2ZDKA 1B7XB 1NO9H 1BJVA 1BHXB 1E0FD 2QXGA 4DVAU 4NWKA 1IAUA 1P01A 1DX5M 1QJ7B 2ZKSA 5GJ4B 4FVBA 4JYVH 1QTFA 4ISNA 1FY5A 1O3JA 1KIGH 5JB9S 3RXJA 4MNXA 4LXBH 3UR9A 1ELBA 3MTYA 3F6UH 3OEHD 3GCTF 3ZZ8A 4CRAA 3AW1A 3KL6A 4VGCB 1O3EA 3UOUA 1A0HB 3T27A 3LONA 1O3NA 2BD2A 1J16A 3SZEA 3A81A 3P17H 4OS1A 1FI8A 2WV9A 1YY3A 2F3CE 2WYJA 3HK3B 3SQEE 4ASUD 1OXGA 3VGCC 1ANCA 1JWTA 3KGPA 1CVWH 2V35A 2PTCE 4RKJB 1NRSH 1EB1H 4I8LA 3T5FH 3VXEH 3JZ2B 1GHXH 5CDFE 3UQOA 1P03A 1Z6JH 3ZZ4A 1O3LA 2FM2A 2SNWA 1ZSJA 2QV1A 5HIZA 1LVOA 2ASUB 2ZQ2A 3BEFB 1DY9A 2LP6A 2BDIA 1EPTB 1H8ED 1NFXA 1E34B 2ALPA 1TQ7B 1XXDA 2P94A 2BLQA 3OSYA 1MZAA 2C4FH 3SNEA 4K5ZA 2A2QH 7GCHG 2J98B 9LPRA 2VWMA 2NU2E 4AORA 1VITH 4BAHB 2FESH 3RMMH 3NUMA 4MQAA 5C1YA 5I46H 1QGFA 4YZUA 3KEEA 1C5NH 1C1OA 3MNXA 4MPUA 3TH2H 1UTMA 4F49A 1F0UA 4ZKRU 2BD4A 2GKVE 5LPEA 4H4FA 2VVCA 1WXRA 2G00A 3OE7D 1AVWA 2QXHA 4RT1A 1P12E 3BTGE 2IN2A 4MPVA 1G32B 1GI8B 1HIAB 3KQBA 4K1TA 5G4BA 4X0WU 2ZU5A 5SGAE 2BX4A 2VGCB 2RA0A 1F0TA 2QY0B 1EZXC 2Y6TA 1LVMA 3M7UA 1KXFA 3KCGH 3FFGA 4K8BA 1SL3A 3ATKA 1TNIA 2F4LA 1RIWC 3SJOA 1NZQH 7ESTE 1QBVH 1H9HE 1MKWH 4UD9H 1GG6B 1WDIA 3ZZDA 3GYLB 2A4RA 1F0RA 2VB0A 4K1EA 3A8BA 1C5RA 1FN8A 3RLYH 5EGMA 3RMLH 5FCKA 1EP5A 1CBWC 5A8YA 1VJ9U 3DSOA 1UCYE 3RC5A 1ELDE 1DUEA 1MMJN 2WPMS 1FX0B 5DP9A 2BY9X 5GWZA 1DUAA 1X7AC 4NZQA 1O2PA 2EC9H 1Q2WA 4AFZA 1WUNH 5EU8A 2AERH 1QL8A 1E37B 1MZDA 4BTTB 1O5GH 1AQ7A 1ZJKA 3R3GB 1TRYA 1K28D 3MO3A 1CHOF 1PPEE 1BTHH 4TT3D 1VITF 1LHCH 2G4TA 2THFB 1KTTB 2Z3EA 4WXIA 3S9CA 1O3IA 3PLBA 1NC6A 2ZCLP 4K69A 4CREA 2G5NA 3LGTA 1FNIA 3IWMA 4NIVA 2EEKA 3S7HB 1EZUC 3QTOH 4OM9A 4AZ2B 1NRNH 4A7IB 2LELA 3BG4C 1G3DA 2ZI2H 1QRXA 1MTUA 4J1YA 3NRLA 1L4DA 2HGTH 4IC5A 1GI6A 3URCA 1ANEA 1Y5BT 4BAOB 4Y11E 1BTUA 1VJAU 1XUJA 2Q6FA 1PYTC 4PROA 2F9UA 1BQYA 4JZIA 2VIDA 3PMBB 5FX5A 3Q77A 4CR9A 1SG8B 1IQEA 1H9IE 1XVMA 3A88A 2OQ5A 4P00A 2KCAA 4B76A 1C5QA 1P05A 4MTBA 1AKSA 1QHRB 1V2MT 1QZ8A 2VVVA 3RU4D 1QNJA 1MAXA 2A1DB 3DCLA 1K22H 1O2LA 4DJZB 2ZCHP 3U98H 2Z9KA 1GMCF 1C1MA 1OP0A 1CGIE 2VVUA 4WVPE 3SU1A 1V2VT 1O3KA 2STBE 2A7HA 2XWAA 3TJUA 2UUFB 4DOQA 4E06H 3ATMA 3PWBA 5DJ7A 1VGCB 4Z1MD 1MQ5A 4D7GA 4ZKOU 2OBQA 1CT2E 1FAKH 1O3MA 5IYTA 2V3MA 3I29A 1SQRA 2A5KA 3UY9A 1Y8TA 1KXDA 4NCYA 1SVPA 1QFKH 2CF9H 2CMYA 1SKYE 2VH0A 3BTEE 2VWLA 5F8TA 2JETB 3QK1A 1O30A 4X2VA 2BVXH 6GCHF 4Q7ZA 5KECA 2EA3A 1BRBE 4X1RU 1NFWA 4RI0A 1W0JD 1HXFH 1GI2A 4ZCNA 1PPCE 3TVJB 2BVSH 3SUDA 2PP6A 2BOHB 2W26A 3RXPA 2BXUH 1KY9A 5EXNA 2ZPSA 1QRWA 3SNDA 1TLDA 3MI4A 1YPHE 2OK5A 3AAUA 1TNKA 4AFSA 3ZZ6A 4DT7B 4XFQA 1A5HA 3MMGA 5GPIB 5FAHA 3LJJA 4I8GA 2VIOA 5C5NA 4O3UA 3SUEA 3UNQA 1GHZA 4GCHF 3RXIA 1MU8B 2O8LA 2K8IA 1O5BB 1W13U 4KP0A 9ESTA 4O9VA 3RM2H 2JH5D 3GY3A 4HFPB 1EJMA 1UVUH 1K9OE 1GBFA 2BDAA 3HATH 4WY3A 4X6NA 2GT8A 2CHAB 3GY2A 1TB6H 3EAJA 3U8TH 1O5CB 2KX4A 3M37A 4OS7A 1AU8A 1BRCE 2ZF0H 4D8NA 1DM4B 2NWNA 1WU1A 2L74A 1XMNB 1YPMH 2XC0A 4IBLH 4KELA 1GJ6A 1IQGA 2AEIH 1G3CA 2GVFA 2TGDA 2Q1JA 3U69H 1THSH 1YBWA 2BHGA 1HRTH 2XCFA 1YM0A 1MCTA 1KYNA 1EKBB 1HAVA 1ZHMA 1XXFA 3F3BA 2ZCKP 1AI8H 3W94A 1VCWA 3SI3H 2F9NA 1TPSA 3PROA 3SU2A 4XOJA 2FOFA 1QL9A 5FBIA 3H5CB 1TRMA 3VPKA 2HOBA 4GLYA 5EXMA 4CH2B 5CHAC 3D23A 2XOKD 2FX4A 1T31A 2HNTC 1QBOA 2TIOA 1FDPA 1DXPA 2PKSC 2FZZA 1O2GH 4JK5A 2QF5A 1HDTH 1AKSB 2CGAA 2ZZUH 4IS5A 5HM9A 1AE8H 3M3SA 3RDZA 1O3DA 1ELGA 1OOKB 1ZSKA 1CO7E 1Z7KA 2HNTE 2PGQB 1JBUH 3PWCA 1IOEA 1IQHA 1VITG 2GZ7A 2WZQA 3LGWA 2V6NA 1CU1A 1W14U 2J38A 4ZHMU 3GCOA 3QTVH 5HM2A 1UK2A 3U1IB 5HXFA 5DP7A 2AGIX 3OFND 1RTKA 2R0LA 1ZGIA 3UOPA 1UTOA 1J8AA 1HB0B 2FI5E 2TGPZ 2AYWA 2PSXA 1GDUA 2BDGA 3OTPA 5EOKA 5DN6D 4YLUA 1C5VA 1V2TT 3UUZA 3BIVH 2P93A 1EAWA 3L3TA 3LH3A 1BTPA 1JIMA 2J97A 1OP8A 2ZFPH 2ZIQH 3SW2B 1AUTC 1O5AB 1CT4E 3D65E 1EAIA 1UTKA 3NPSA 1HAIH 4UFFH 2J95A 3EA8A 3GDSA 2BLWA 2ESTE 3PV4A 2Y5FA 3PTBA 1C5XB 2XYAA 3VXFH 2ULLA 2L6OA 1TGTA 4NSYA 4X6MA 4CR5A 1V2LT 3NKKA 2BD5A 3DT0H 3N7DA 2F83A 1TWXB 1IHTH 5C17A 3L33A 1T8MA 1Z8RA 2ZDAH 3TLOA 1C2KA 1O3OA 5EPYA 1KLJH 4NFFA 3MU5A 2WSSD 2V3OH 5AF9H 3RXCA 1DWBH 3H7TA 1HGTH 1LMWB 5C5OA 1C9TA 3RC6A 4XD7D 3TJOA 1GCTB 1EJAA 4B71A 2NU1E 4JZDH 4ZAEA 2FODA 4KGAA 2W3KA 2ZA5A 3M5MA 3SNBA 7GCHF 2JIZD 2FOCA 3ZVEA 2ZGCA 2ZTXA 3C27B 3V13A 1GJ5H 2VIQA 2KCPA 1QJ6B 2ZHWH 3DSPA 3FZZA 1ESTA 3TU7H 3PMAB 2AS9A 1YPEH 2XNIA 5ESBA 1S0QA 1SLUB 4AG1A 2RG3A 1O35A 2BD7A 3UWJH 1GGDC 4OS6A 3UB0A 1ZSLA 1HAVB 3ZVDA 1Y3YA 2ZFRH 3O8BA 2PWXA 3NXPA 1KDQA 5EODA 1ELEE 1HAZB 3AAVA 3MNSA 3MWIU 1TOMH 4GCHG 1BHXF 3TITA 3M5LA 2FO9A 1RS0A 5HKKD 2BB4A 1EZSC 3MH4A 1AFEH 2H9HA 2VWOA 1L1GA 2XBVA 2EQNA 2J2UA 2ZHEH 2BQ6B 2QCYA 1Z6EA 1GJ4H 1FIZA 3RM0H 3MFJA 3BSQA 1JRSA 7KMEH 5IK2D 1ELCA 3ZZ9A 3BTKE 3VB6A 1C1VH 4ISLA 3QGJA 2CF8H 4ZKSU 3P8GA 3SV9A 2OTVA 1NRPH 4X8VH 2AMPA 1OWHA 1LHDH 3PYHA 2ZDVH 2PFEA 2ZTYA 4BAKB 1W2KH 3QX5H 2C8XB 4YOGA 1FUJA 3PTNA 4LK4A 4Q4LA 4A1VA 4D7FA 2SGDE 2UWPA 1BMFD 3A89A 5C1UA 2BY6X 3GISB 2WPDD 2ODPA 1LDTT 5JYIA 3BTWE 1V2QT 5C1XA 1Y3VA 1QA7A 4H6SB 3V12A 3F9FA 3V0XA 2VWNA 1O37A 3LGVA 3UIRA 4LZ4B 2CK3D 1BMMH 2FS8A 2ZHQH 1AB9B 5AFYH 3WWFA 3RC4A 3DA9B 2QAAA 3MH6A 3GCHC 4Y76A 3CS7A 2XCNA 1G2LA 5T1VA 1ELAA 3EYDA 1YPLH 3BTFE 3F9EA 1SR5C 2O8WA 1P0SH 1T4UH 3TK6A 1EQ9A 4UEHH 2A0QB 5T6DA 5C0UA 4YXWD 1C1NA 1CA0C 2D26C 2ZGBH 2WPHS 4Y79A 2NU0E 2YMSB 1NBME 2Z9IA 3KNXA 1BRUP 4J2YB 1HAPH 1NESE 4SGBE 2FWWA 3HGNA 1SQAA 3RMNH 2QC2A 4ISOA 1YLNA 2CHAC 2XWBI 2GCHG 5A0CA 2FLRH 1LHFH 2F9BH 4KKDA 4CRDA 2K1QA 1DANH 1GI1A 3SU6A 1W7GH 4M7GA 4UFDH 1N6XA 1TIOA 3TJVA 3PO1C 3UNRA 4I8JA 4NA9H 1EOJA 1P57B 2ZFSA 1Y59T 3GICB 4YOJA 1SQTA 4ZXYH 2B7DH 2F43B 2A7JA 1T4VH 4MNYA 2JDID 4CHAC 1JMOH 2Z6BD 3M35A 1S5SA 1C5LH 1J14A 2PLXA 1VCQA 1QCPA 3ZZAA 4K1SA 1OX1A 1UVTH 3K65B 1WV7H 1V2WT 4THNH 2R2MB 1DLEA 1N8OC 4GPGA 4ZXXH 5B6LA 2OP9A 4WMDA 3MO9A 4JCNA 3RU4T 1FLEE 1T8OA 5GNDA 1PJPA 3O8DA 2BQWB 1RTFB 1EFRD 1AZZA 1Z71A 4JMYA 3F68H 5DPAA 2JH6D 4FOUC 1AY6H 3MHWU 1GJCB 5F8ZA 1KDQB 2ILNA 3PLKA 1UCYK 4A5TS 1O3FA 2A2XH 3OU0A 1ABIH 1S6FA 5GXPA 1DXWA 2F9VA 1B0FA 2FYRA 1O2HA 2P8OB 1ELVA 4NFEA 1UW7A 4DT4A 3LGIA 1ID5H 4I31A 5FPYA 1DWEH 1TPOA 4R8TB 1PPFE 2BXTH 4FUCA 3SJ9A 5TCCA 5DO4H 1M9UA 1F2SE 1GVZA 1Z1IA 4NIWA 3A87A 3E1XB 3M61U 1KXBA 3A83A 3FP8E 1PQ8A 3EQ0H 2FP7B 8LPRA 1OWKA 3SQHE 1ABJH 2BLOA 3A7YA 1HJ9A 3DD2H 2AGGX 1EAUA 3SUGA 1O2UA 3FP6E 2B8OH 5DKMA 2AH4X 3A85A 1RJXB 5HGGA 1P2QA 3PMJA 3MU0A 4Y8ZA 3TGIE 1KLTA 2ANYA 2G52A 3ZVFA 3SHCH 3P70B 4RSPA 1ZYOA 1P9SA 1ZRBA 1FV9A 1GCDA 4NA7A 1XUIA 1P3EA 5JPMH 1EASA 3LGUA 1HAYB 2BD8A 1KXAA 3GY5A 2WPLS 2IPQX 2O8TA 3MU8A 2QN5T 1TE0A 4B74A 2QF3A 3GCNA 4INHA 1K1JA 1HFDA 1WQVH 1SBWA 1W8BH 1TX7A 3A7WA 5EXLA 3BEUA 2KR7A 1SB1H 1P11E 4TYDA 3GY4A 2OCVB 5EJ1A 3O8RA 1GHYH 1YCPH 3MU1A 3NZIA 5EJLA 3STJA 2HPPH 1DE7H 2ZU3A 2Z9JA 4X8SH 2R2WU 3BG8A 4B2BA 1P06A 1GBMA 4TSFD 4HG6A 4X2YA 4I32A 1BBRE 3UWIA 2ZU4A 1V6DA 3TPIZ 4ABHA 2J92A 2PUQH 2WPIS 3EE0B 1MKXH 3NK8A 1OP2A 2A4GA 1WQSA 2OXSA 4D9RA 4AG2A 4JK6A 5F53A 1AMHA 1O3PB 2W7SA 3BF6H 1D9IA 4Y71A 5HYOA 1K0HA 2FTLE 6CHAB 1V3XA 4SGAE 1E1RD 1O5FH 3URDA 3ZVCA 4WWYA 3P92A 2GZ8A 1XKAC 1SFIA 3WWBA 2BM2A 3RXLA 3F2HA 5AVDA 2ZHFH 1LKBA 3U9AH 4B6EA 3B23B 1FY4A 4HTCH 1XM1A 1BTXA 5JB8S 3M7QA 1ZLRA 2GT7A 1IQNA 3UFAA 3A8AA 3LU9B 3A8DA 3LC3A 1UTJA 2FOMB 1SC8U 3K6YA 3BTHE 1L4ZA 3ATLA 4U01A 2W3IA 5EQQA 3VB3A 1OWEA 1O3HA 3RXQA 5J4SA 5L30H 4YO9A 4ACBA 1GBHA 1NS3A 3A82A 3G01A 2EI6A 1UTQA 1MBQA 1C5YB 3C1KA 1J9CH 4DIIH 4ZHAA 1MTNB 4B2CA 4CRGA 1GI4A 1C2LA 2F9PA 3E91A 3FKSD 1HCGA 2RCEA 1QB1A 2W7UA 2GX4A 3ZZ3A 2SGPE 2OC1A 5CE1A 1GDQA 1UTLM 3T26A 4ASHA 3RMOH 1AB9C 1G36A 1RTLA 1D4PB 3TGJE 4B2AA 2ZFFH 3QWCH 1EUFA 2KZ4A 5L2ZH 1Q31A 2ZFTA 5DP8A 1BJUA 1GMDF 3QUMP 2J4IA 1BTYA 1O2TA 2PW8H 4Z0KA 3UQVA 1MQ6A 4UE7H 3MYWA 1V2UT 4FUEA 7LPRA 5L6NH 1GDNA 1VZQH 2VNTA 3D49H 2JH0D 3KN2A 3N99A 1G3BA 3RXEA 2EY4C 2ZDLA 1OWDA 2KM0A 1YPHC 4UFGH 2O8MA 2Z9GA 4QT8C 1K2I1 1SGRE 1VR1H 5GIBA 1HAHH 1LCYA 3EA7A 3ZYDA 1GI7B 1UMAH 1NBMD 1K1LA 2G51A 8ESTE 5L2YH 1O2JA 1ZTLA 1BUIA 2H1UA 3DHKH 4I8HA 1KXEA 2RDLA 3U8RH 3KYFA 1WOFA 1YF4A 3K6ZA 4X1QU 4JZ1A 1O2OA 4MLFB 2BVRH 3LT3A 3UNSA 2GV6A 2A7CA 1TABE 1ZPCA 2DE9A 1TALA 4KTUA 1W10U 2C8YB 1YP9A 1TNGA 1V2NT 3B8JA 4ABFA 1A5IA 1Z8GA 2LNCA 3F0PA 2VH6A 1NTPA 1K1OA 1P2IA 3ZIAD 2G5VA 4VGCC 3VB7A 3DFLA 1C5WB 3UPEA 5A8ZA 3STIA 4BANB 5E0GA 4GSOA 5LPFA 1MH0A 1ZTKA 1NM6A 1A7SA 1SGEE 1GI3A 1GJBB 1GJAB 4Q63A 1C1SA 1ZZZA 1O2ZA 1HYLA 4JYUH 5JBBS 4WF8A 1OHHD 4FUFA 3QZRA 1IQKA 1C4U2 2HALA 1FPCH 2YNAA 3OX7U 4UDWH 1VCPA 1PFXC 4AB8A 5DP4A 1C2HA 5E8EH 2GMTB 1AFQB 2BY5X 2P8OC 5C67A 5LPRA 1FXYA 4E7RG 1EPTC 3IG6B 4YOIA 1GPZA 1ZJDA 4CRCA 2G4UA 3B9FH 3MQKC 3RXSA 4U2WA 2IJOB 4AN7A 2PV9B 4I86A 5EJZA 1TPAE 2CN0H 3A86A 2ZFQH 2FXRA 1ZHRA 5FPTA 1TX6A 5F8XA 5K0HA 4UFEH 4ZMAH 2ANWA 4NZLA 1O3BA 4ACAA 4M9FA 1TFXA 3A84A 1D3TB 2XNDD 5CMXH 1BMNH 3VB4A 5PTPA 1O3AA 3ODFA 2O9QA 3DFJA 2PR3A 1AVXA 4I8KA 1GWAA 4WH6A 3LH1A 5LH8A 1NRQH 2FOGA 2GCHF 1BRAA 2VIWA 1P04A 4IN2A 1UHBA 4AGJA 1N6YA 1SOZA 1A4WH 4DW2U 3VGCB 1GBTA 2VGCC 5E2PA 2Z7FE 2WUCA 1DWCH 1C4V2 5KEDA 1YLCA 2WYGA 5KGOA 1QY6A 4INKA 1ETTH 4H6TA 3P8OA 4KTSA 3RP2A 1AWHB 2Q6GA 3W1EA 1NRRH 3RXTA 1WTHD 1SLXB 1FY8E 1IQIA 1GG6C 3CS0A 2PUXB 4F55A 2FYQA 3MO6A 1BTWA 4K8YA 1TRNA 2O8UA 4D9QA 1BCUH 4Y7BA 3LIWA 5ABWA 1TA6A 2OLGA 5A0BA 2J94A 4X6PA 3VFEA 1CQQA 3AASA 2ANMH 3PRBA 1NN6A 1GBIA 1GJ7B 4ABIA 2ZO3H 1A46H 3CNRA 5DP5A 1THRH 4XE4A 5JBTA 2J34A 1C1QA 1K1IA 1O2KA 1O2RA 1CGHA 2WINI 3KHVA 2A4QA 3MOCA 1DY8A 4XBCA 1ESAA 2GDDA 1EZQA 3ZYEA 3MH7A 4KTCA 1F92A 1C5UA 1AGJA 1WYKA 6CHAC 1H9LB 1K1PA 1O31A 1Z8JB 3EA9A 1AUJA 3RXDA 2FX6A 1FY3A 4R0IA 1TQ0B 5FHTA 1ZR0A 5C94A 3S9BA 3LPRA 2ZNKH 4A6LA 1V2ST 2FI3E 1MCVA 1V2JT 4AFQA 1MTSA 1QRZA 5ETXA 4LZ1H 1BIOA 3ATWA 2UUKB 4O03A 2F91A 2BDHA 3SGBE 1GMDG 3DSGA 2HLCA 1K1MA 2RA3A 1J17T 2VBCA 4E7NA 3ESTA 4AX9H 4JZEH 1O2IA 4FU7A 2XC4A 1O2YA 2UUJB 3IITA 5JBCS 1YWUA 1YKTA 5FX6A 1CSOE 2VINA 5FBEA 1C5PA 1QA0A 4UONA 1GHVH 4NIXA 1NFUA 1V2PT 2FDAA 5GCHG 1C2DA 3ZVAA 1XVOA 1RIWB 4JZFH 1W0ZU 3P6ZB 3F2FA 3BIUH 1SQOA 3E6PH 3TGKE 2ZU2A 1DWDH 3M36A 1Y5AT 4IMZA 4IW4E 3F9HA 1SSXA 1T8NA 4X1PU 3O8CA 4FUDA 1INCA 1F5LA 1EX3A 2OQUA 3A7TA 2STAE 1LHEH 2V7QD 4FVDA 1UJ1A 1B5GH 4OGYA 1YGCH 1AHTH 1ZHPA 1QURH 4GUXA 1N1LA 3RXRA 1D6WA 1EOLA 1TGBA 2H6MA 4AYVB 1YPGH 1VGCC 2C8ZB 2TBSA 3SV2H 1UVPA 1MBMA 3WY8A 1YPJH 1DVAH 2TGAA 4MG3A 1Y3UA 1ACBE 3UREA 1QJ1B 5FXLA 2C3SA 1OS8A 1MKWK 1P02A 4FU9A 3SV8A 5E0HA 1GBBA 2Z94A 5DP6A 5J4QA 2JETC 1EJNA 1SFQB 2SNVA 4O97A 1FJSA 3MNBA 1UHBB 2WPJS 3BG4B 1U6QA 2SGQE 3R0FA 1Z8IB 4IMQA 1A0JA 4X2WA 4NGAH 1LTOA 2BTCE 2P16A 2DE8A 5B6OA 3P8NA 2ZU1A 4BXWA 3SGQE 3E0PB 5C20A 1AZ8A 2EI8A 3PMHB 1P2MA 5T6GA 1D3QB 5F03A 1LQDB 3ZZCA 4X8TH 5A0AE 4Q80A 2GTBA 1C2EA 4K60A 2YMSD 2M2AA 3E8LA 3V3MA 3SJIA 1B0EA 4WXVA 4ESTE 1C1WH 3SJKA 4TPYA 1O2QA 1DITH 1FAXA 2HVYB 2P3TB 4MVNA 1OPHB 2UWOA 1C2MA 2CXVA 4DCDA 4IN1A 1EB2A 2V3HH 1SGIB 4Z6AH 4F48B 1JOUB 5EW2H 1GJDB 1V2RT 1T32A 2GD4B 1TBZH 4GAWA 3LKWA 3K9XB 1S6LA 4Y8XA 1MD7A 1BT7A 1OWJA 1ZGVA 2ODYB 1Y5UT 4AFUA 2NU3E 2R3UA 2ZECA 4FU8A 1SGDE 1TNLA 2FOEA 3ZVBA 3LDXH 1LHGH 3HGPA 4ABEA 3M3TA 5DSFA 4GVUA 1S85A 1DPOA 4AC9A
chains in the Genus database with same CATH topology
3WW7A 4Q4LA 2QE7D 4A1VA 2W6ID 3SV6A 2YMSC 3SU3A 2F9VA 1BMFD 1DXWA 1N1LA 2J5UA 2L6OA 3KEEA 4B75A 1COWD 2WPDD 3PV2A 4B6FA 3N7DA 4A1XA 1MABB 3FOAA 4DT4A 3WWBA 3P8OA 2F9UA 4I31A 3F2HA 1A1RA 5FPYA 3W1EA 5C17A 2QF4A 4FETA 1RGQA 2KCAA 4R8TB 4B76A 4B6EA 5EPYA 1WXRA 4F55A 3F0OA 3OE7D 2AHME 2GVFA 3PV5A 3SV7A 2CK3D 3F0PA 3SV8A 3ZIAD 2WSSD 3WWFA 3RC4A 3SU4A 2XCFA 2XCNA 5T1VA 4B73A 1E1QD 2FOMB 2FP7B 2P59A 2GGVB 3EYDA 3PRBA 3RC6A 2JJ1D 3U1JB 2OC8A 3DCLA 2W6JD 3F3BA 4XD7D 2YOLA 4U01A 5EQQA 4B71A 3KF2A 3L6PA 5CHBA 3PRDA 3SUFA 5C0UA 2OINA 4Q63A 3F2GA 3FO8D 5EQRA 3SU2A 4YXWD 3M5NA 2A4QA 1NS3A 3SUGA 1DY8A 3SU1A 2YMSB 4WF8A 1NBME 1OHHD 3KNXA 3M5MA 4KTCA 3P8NA 2JIZD 4K8BA 4A1TA 2OC0A 4NWKA 4Z1MD 5GJ4B 1JXPA 2K0QA 2KCPA 2F4LA 3DSPA 5FL7D 2OBQA 2XOKD 5EQSA 3SU5A 2XNIA 5ESBA 2A4RA 2K1QA 1DXPA 2YMSD 3FKSD 2HLDD 1E79D 5ETXA 3SU6A 2M2AA 3LOXA 2QF5A 3OEHD 3GS9A 1SKYE 3OAAD 1KMHB 2OC1A 3AK5A 3LONA 3DSOA 3UB0A 1H8HD 3SZEA 2VBCA 3O8BA 3RC5A 2IJOB 5IDKA 1RTLA 2F43B 2WV9A 4B74A 2WZQA 4ASUD 1FX0B 1CU1A 2KFWA 4A92A 4RI0A 1W0KD 1W0JD 2JDID 2WHXA 3OYPA 2KZ4A 4ZCNA 3SUDA 2KCOA 3NRLA 3H09A 5EPNA 5FPTA 3SU0A 3M5LA 4WH8A 3U1IB 5C0TA 3OFND 5HKKD 2KR7A 4TYDA 4M9FA 2OK5A 5CDFE 3O8RA 2XNDD 5B6LA 2FM2A 3F2FA 3OTPA 2JJ2D 2OC7A 2QV1A 4NWLA 5GPIB 3LKWA 3N7EA 3SYJA 5DN6D 2KCYA 3KN2A 3N99A 4TSFD 4TT3D 5GNDA 3O8DA 4I32A 1S6LA 3VG8A 5IK2D 3FN8A 1DY9A 1H8ED 3SUEA 3OEED 1BT7A 2KM0A 1EFRD 4WH6A 2A4GA 4I33A 2O8MA 2OBOA 3SV9A 4JMYA 3M5OA 3O8CA 1W3CA 2K8IA 5F53A 4OM9A 2LELA 5H4IB 1NBMD 5DSFA 2IJD1 3E90B 2V7QD 1E1RD 5FPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WW7 A;  3WWF A;  3WWB A;  4ZCN A;  5CHB A;  5F53 A; 
#chains in the Genus database with same CATH topology
 4YLQ H;  1GJ9 B;  1DOJ A;  1V2K T;  4B75 A;  2AGE X;  1SGN E;  4RT0 A;  1GI0 A;  4WME A;  1OWI A;  1CE5 A;  1O34 A;  3DUX H;  4XDE A;  2BYA X;  1AND A;  2M5T A;  2PKA B;  1THP B;  3KQ5 A;  1S6H A;  1HV7 A;  1TNH A;  1TGS Z;  1VKY A;  1SI5 H;  3SU4 A;  3SGA E;  4FUH A;  1BBR K;  5T3H A;  1C5T A;  4MNW A;  2LPR A;  4IGD A;  2ZGJ A;  4Q2K A;  1SGQ E;  4E05 H;  4B1T A;  4FUJ A;  1HJ8 A;  2HWL B;  3AVZ A;  1HXE H;  1CA8 B;  3FZD A;  3EDX B;  3KQC A;  1C1T A;  1AN1 E;  2BOK A;  1P2N A;  1A2C H;  5JBA S;  1DT2 A;  2TGT A;  5T6F A;  2A5I A;  1E35 B;  1FZZ A;  1L1N A;  2A5A A;  2W5E A;  1UK3 A;  1CGJ E;  4I7Y H;  3OAA D;  1KLI H;  1FIW A;  1C5O H;  2BDC A;  1TGC A;  1W0Y H;  2ZC9 H;  3UR6 A;  3EE7 A;  3Q00 A;  4MPX A;  1ETS H;  3P95 A;  4CBO A;  2KFW A;  2I6Q A;  1TPP A;  2FLB H;  3M7T A;  3OYP A;  1IQF A;  2KCO A;  8KME 2;  5C0T A;  1BMA A;  1FQ3 A;  2R3Y A;  3SN8 A;  2Y7X A;  1CHG A;  1EXF A;  1O3C A;  1KXC A;  1UK4 A;  1ZPB A;  2V0B A;  2GDE H;  1WAY B;  4WJG 2;  5E2O A;  1AIX H;  5CHA B;  1FMG A;  2RFK C;  1ZML A;  4ABJ A;  2FOA A;  2I6S A;  3ITI A;  2P95 A;  2PKS B;  1GBJ A;  1UO6 A;  5F6M A;  1AWF H;  1W7X H;  3GY8 A;  1E38 B;  3TNS A;  5I25 A;  3T29 A;  1C9P A;  1Z1J A;  2IPH A;  3ODD A;  3D62 A;  1BDA A;  1C5M D;  1HUT H;  2G81 E;  1GBE A;  2D8W A;  3TIU A;  2ZDM A;  1GCT C;  4Y0Y E;  2FI4 E;  1GMH G;  1OKX A;  1G2M A;  1RRK A;  4ZHL U;  2ZP0 H;  1ARB A;  2IJD 1;  3HPT B;  4BTU B;  3A7X A;  4RKO B;  2HRV A;  2Y5H A;  4BNR A;  5FPS A;  5LGO A;  3SV6 A;  1GJ8 B;  2QE7 D;  6EST A;  4X6O A;  3E3T A;  4ZUH A;  1O2W A;  2C90 B;  4X8U H;  1IQJ A;  1COW D;  1AVG H;  5C3N A;  1WCZ A;  8GCH G;  4TWW A;  3CP7 A;  2Y81 A;  1QQU A;  2BDB A;  2BDY A;  5BPE A;  2H5D A;  3QN7 A;  3QLP H;  2GZ9 A;  2BD3 A;  4TY7 A;  3TJN A;  1TBQ H;  1ETR H;  1C4Y 2;  2C93 B;  1G3E A;  3ZZB A;  1K21 H;  1FPH H;  1AD8 H;  2UWL A;  2YOL A;  4WMF A;  2BZ6 H;  2FMJ A;  3SUF A;  5BRR E;  1LQE A;  5A09 A;  2ZGX H;  2A32 A;  1PPZ A;  1ZTJ A;  1DIC A;  1RFN A;  2QYI A;  2VU8 E;  1SGF A;  4A1T A;  2ZPQ A;  5GDS H;  4RN6 A;  5FL7 D;  1WTG H;  2FIR H;  2P3U B;  4ISI H;  2Q6D A;  1S0R A;  1HJA B;  4AGK A;  2AMQ A;  2ZQ1 A;  1XX9 A;  2H2Z A;  2QIQ A;  1E79 D;  4Y7A A;  4YT7 H;  1F5K U;  3U8O H;  3GS9 A;  1HPG A;  1KMH B;  2VIV A;  1O5E H;  1H8H D;  5EST E;  1TBR H;  1LKA A;  4MNV A;  1C1R A;  2R9P A;  4TWY A;  2HVX A;  1HAX B;  1BOQ A;  1PQ7 A;  2ZWL H;  1RD3 B;  1P2J A;  3W95 A;  1W0K D;  3ZV8 A;  2FTM A;  5EPN A;  5FCR A;  4Y6D A;  1ZMJ A;  2CV3 A;  4K2Y A;  1J15 A;  3S9A A;  5EIY A;  3AW0 A;  1P8V C;  2Y82 A;  4X2X A;  3MNC A;  4ABG A;  1C5S A;  2OC7 A;  4ZKN U;  3TK5 A;  4DIH H;  1GHB F;  5EG4 A;  1H8D H;  1TX8 A;  4ZH8 A;  1L0Z A;  3A8C A;  2XBY A;  1A5G H;  3S69 A;  1JIR A;  1GGD B;  2AIQ A;  4I33 A;  5EW1 H;  1IQL A;  2OBO A;  3SNC A;  4D76 A;  1MU6 B;  3SNA A;  1BB0 B;  1C2F A;  1OYQ A;  1XKB C;  1O0D H;  2XW9 A;  3BTT E;  2Z3C A;  5H4I B;  1XUK A;  1Q3X A;  1YC0 A;  2AFQ B;  3E90 B;  1MAY A;  1SLV B;  4LOY H;  2YMS C;  3SI4 H;  1PPB H;  3ZV9 A;  2OUA A;  3Q3Y A;  4XSK U;  3Q3X A;  3GCT G;  3PV2 A;  2ZG0 H;  1GBA A;  4MPW A;  1W12 U;  4FET A;  1EAT A;  4U30 A;  1P2K A;  1SLW B;  2JKH A;  1WSS H;  1GBK A;  4H42 U;  3GY6 A;  1DS2 E;  1DDJ A;  5GCH F;  4GHQ A;  1ORF A;  1PPH E;  4OS5 A;  3FVF B;  1E1Q D;  1MUE B;  4ABA A;  1UVO A;  1BBR H;  1KSN A;  1UCY H;  3BTD E;  3T62 A;  2W6J D;  1G37 A;  3KF2 A;  1O5D H;  5CHB A;  3PRD A;  1E36 B;  3KYG A;  2D2D A;  3FAN A;  3M5N A;  3NWU A;  1ELT A;  3F1S B;  3JZ1 B;  3GOV B;  1C2I A;  4Q7X A;  4Y8Y A;  1UVS H;  2QXI A;  4ZRO A;  1JXP A;  1O3G A;  1PQA A;  1QL7 A;  4OGX A;  4BOH A;  3ZZ5 A;  1O2S A;  4HI3 A;  2BZA A;  3RXU A;  4YM9 A;  1QQ4 A;  2HLD D;  5AFZ H;  2OD3 B;  2BQ7 B;  1PPG E;  1C5Z B;  3T2N A;  1GHA F;  1ZMN A;  2ZDN A;  4OS2 A;  3GCH B;  5AHG H;  2XXL A;  2XBW A;  2G8T A;  2GP9 B;  5HMA A;  1HAG E;  1NU9 A;  4Y10 E;  4OS4 A;  3RXK A;  1O33 A;  4A92 A;  2QXJ A;  1P2O A;  1Y3W A;  1CA0 B;  2WHX A;  2FEQ H;  5K7R A;  3SO3 A;  2FOH A;  2B5T B;  4CRF A;  1TA2 A;  3A7Z A;  1A3B H;  1TMB H;  2UUY A;  2KAI A;  3GDV A;  1W11 U;  1NU7 B;  2H9E H;  3HKI B;  5JDU B;  1D3D B;  4X1N U;  2GJG A;  3VG8 A;  1GI9 B;  1SMF E;  3T25 A;  3KQE A;  3ENS B;  3PLP A;  2ZTZ A;  1P09 A;  2GCT B;  3PO1 B;  1Y3X A;  3M5O A;  2Y5G A;  3NCL A;  1W3C A;  1SHH B;  4ABB A;  2AIP A;  1O32 A;  2G55 A;  3GDU A;  1BIT A;  4K3J A;  4CHA B;  3TH4 H;  4HZH A;  3Q76 A;  3WW7 A;  1K1N A;  2W6I D;  1UTP A;  1O39 A;  1L2E A;  2Y80 A;  1NY2 2;  2D1J A;  1N8O B;  3SOS A;  1EP6 A;  4BAQ B;  1S81 A;  2P3F H;  1SGT A;  5TJX A;  1F0S A;  1C1P A;  1BA8 B;  1SGP E;  1BTZ A;  1YLD A;  3SBK A;  5TCA A;  3BN9 A;  4B73 A;  2P59 A;  1ELF A;  2GGV B;  1UTN A;  3MU4 A;  2WV5 A;  1GL0 E;  1A3E H;  3TH3 H;  1FN6 A;  3S7K B;  3I77 A;  2FPZ A;  2XBX A;  3RUO A;  3SJ8 A;  1SGY E;  2OIN A;  3GYM A;  3F2G A;  3RXF A;  1CHO G;  2C8W B;  2ZEB A;  2ANK H;  4DUR A;  1O2N A;  2RDE A;  1ZOM A;  1ZRK A;  2VIP A;  2B0F A;  2OC0 A;  1AE5 A;  1NFY A;  1IQM A;  4ISH H;  2K0Q A;  2Z9L A;  4XRN A;  3BV9 B;  4XBD A;  4MDS A;  1A61 H;  1LO6 A;  1LPZ B;  2Z3D A;  1F5R A;  1GVL A;  1T8L A;  1GVK B;  2A4O A;  1TOC B;  3LOX A;  2ODQ A;  4CBN A;  3GY7 A;  1GBL A;  3OTJ E;  4DY7 B;  1SGF G;  3E16 B;  1QB9 A;  2F9O A;  1NT1 A;  1GHB G;  4TPI Z;  1LVY A;  3H09 A;  3SU0 A;  1T7C A;  1GBC A;  1TON A;  5DG6 A;  2XRC A;  5DK1 A;  4F4O C;  3BTM E;  3HK6 B;  1H4W A;  3P8F A;  2QF0 A;  4Y0Z E;  1QR3 E;  3ATI A;  2JJ2 D;  3RXB A;  1YPK H;  1O2M A;  5IDK A;  1O2X A;  1DLK B;  2KCY A;  2QGR A;  1GI5 A;  2VJ1 A;  3FN8 A;  4YES B;  1HNE E;  3OEE D;  3OY5 U;  1NPM A;  1GMC G;  4NA8 A;  1HJA C;  1O2V A;  3RLW H;  2YNB A;  1H8I H;  2J9N A;  2DUC A;  2PGB B;  2SGF E;  4BAM B;  1MTV A;  2FS9 A;  2Y7Z A;  2A31 A;  3S0N A;  2BY7 X;  2J5U A;  4DGJ A;  5A2M H;  1BZX E;  5DGJ A;  3BTQ E;  4A1X A;  1TAW A;  2PKA A;  3PB1 E;  2XTT B;  2KAI B;  1MTN C;  2H5C A;  1A1R A;  3UTU H;  4AYY B;  2QF4 A;  1YCP M;  3MH5 A;  6GCH G;  3LGY A;  3RXG A;  1CBW B;  3RXA A;  4Q7Y A;  2EI7 A;  3F9G A;  1H1B A;  3SV7 A;  4TY6 A;  2WPK S;  3SHA H;  2BLV A;  3SOR A;  3PM3 A;  5E0J A;  1IHS H;  1TMT H;  4BXS A;  3N7O A;  3K2U A;  2CJI A;  4YTA A;  6LPR A;  4FXG H;  2B9L A;  4U32 A;  4BTI B;  1JRT A;  1F7Z A;  3A80 A;  3FO8 D;  1GHA G;  1O38 A;  2HPQ H;  1OYT H;  3UAI C;  2NU4 E;  3QZQ A;  1C2J A;  1TYN A;  1QIX B;  2ZHD A;  1GMH F;  1QBN A;  1L1J A;  1YYY 1;  5EQS A;  1TNJ A;  3SU5 A;  1P10 A;  2ZPR A;  3V7T A;  3EGK H;  5DP3 A;  1C2G A;  1C1U H;  1GBD A;  2WV4 A;  3U28 C;  1YCP K;  1A0L A;  1HLT H;  4NSV A;  4INL A;  4CH8 B;  1EPT A;  4YT6 H;  2H9T H;  2BX3 A;  3QGN B;  8GCH F;  3RXO A;  1PQ5 A;  1G9I E;  4IC6 A;  1S84 A;  1PYT D;  1G30 B;  3KQD A;  1P3C A;  3AK5 A;  2GV7 A;  3RXM A;  1MKX K;  1NRO H;  2J98 A;  3CEN A;  4GHT A;  2PHB A;  4O3T A;  3QO6 A;  3RU4 E;  1O36 A;  3E0N B;  3Q3K A;  3T28 A;  3FP7 E;  4X1S U;  1FY1 A;  2WUB A;  1TGN A;  2ZGH A;  3LC5 A;  4WH8 A;  1WBG B;  3H7O A;  2AMD A;  3ZZ7 A;  1S82 A;  2IOT A;  2XC5 A;  1HBT H;  3LJO A;  1GL1 A;  2A45 B;  3HKJ B;  4FUI A;  2FOB A;  4NWL A;  1SGC A;  4AOQ A;  1TMU H;  4HGC A;  1D6R A;  3N7E A;  4P02 A;  3SYJ A;  4FUG A;  1MTW A;  4JYT A;  3BEI B;  1CT0 E;  1ESB A;  2PTN A;  1S83 A;  1HAO H;  1LPG B;  3TK9 A;  1ZPZ A;  3FAO A;  1HIA A;  1DST A;  2BMG B;  1LPK B;  1MD8 A;  1BML A;  1SHY A;  5HIY A;  4DG4 A;  4XBB A;  2TRM A;  3RXV A;  1SPJ A;  2BY8 X;  3VEQ B;  2BD9 A;  4CRB A;  2SGA A;  1FON A;  3SU3 A;  1XUG A;  2ALV A;  1V2O T;  5A8X A;  1D3P B;  3ELA H;  4B6F A;  3TNT A;  1MAB B;  3FOA A;  3I78 A;  2QA9 E;  1DFP A;  2TPI Z;  2HNT F;  4ABD A;  1XUF A;  1AO5 A;  4NG9 H;  2GMT C;  1LVB A;  3RXH A;  1RGQ A;  1EAX A;  1AFQ C;  1GHW H;  1KTS B;  1XUH A;  2SGE E;  3F0O A;  2AHM E;  3PV5 A;  3ZVG A;  1ARC A;  3KID U;  2SFA A;  3VB5 A;  3A7V A;  1ANB A;  1QB6 A;  4NIY A;  3U1J B;  3QDZ B;  2JJ1 D;  1P9U A;  2OC8 A;  2PSY A;  1SOT A;  3OY6 U;  1RXP A;  3SZN A;  3M3V A;  5C2Z A;  2GCT C;  3L6P A;  1OSS A;  2R0K A;  4AB9 A;  4FUB A;  1DSU A;  5EQR A;  2ZDK A;  1B7X B;  1NO9 H;  1BJV A;  1BHX B;  1E0F D;  2QXG A;  4DVA U;  4NWK A;  1IAU A;  1P01 A;  1DX5 M;  1QJ7 B;  2ZKS A;  5GJ4 B;  4FVB A;  4JYV H;  1QTF A;  4ISN A;  1FY5 A;  1O3J A;  1KIG H;  5JB9 S;  3RXJ A;  4MNX A;  4LXB H;  3UR9 A;  1ELB A;  3MTY A;  3F6U H;  3OEH D;  3GCT F;  3ZZ8 A;  4CRA A;  3AW1 A;  3KL6 A;  4VGC B;  1O3E A;  3UOU A;  1A0H B;  3T27 A;  3LON A;  1O3N A;  2BD2 A;  1J16 A;  3SZE A;  3A81 A;  3P17 H;  4OS1 A;  1FI8 A;  2WV9 A;  1YY3 A;  2F3C E;  2WYJ A;  3HK3 B;  3SQE E;  4ASU D;  1OXG A;  3VGC C;  1ANC A;  1JWT A;  3KGP A;  1CVW H;  2V35 A;  2PTC E;  4RKJ B;  1NRS H;  1EB1 H;  4I8L A;  3T5F H;  3VXE H;  3JZ2 B;  1GHX H;  5CDF E;  3UQO A;  1P03 A;  1Z6J H;  3ZZ4 A;  1O3L A;  2FM2 A;  2SNW A;  1ZSJ A;  2QV1 A;  5HIZ A;  1LVO A;  2ASU B;  2ZQ2 A;  3BEF B;  1DY9 A;  2LP6 A;  2BDI A;  1EPT B;  1H8E D;  1NFX A;  1E34 B;  2ALP A;  1TQ7 B;  1XXD A;  2P94 A;  2BLQ A;  3OSY A;  1MZA A;  2C4F H;  3SNE A;  4K5Z A;  2A2Q H;  7GCH G;  2J98 B;  9LPR A;  2VWM A;  2NU2 E;  4AOR A;  1VIT H;  4BAH B;  2FES H;  3RMM H;  3NUM A;  4MQA A;  5C1Y A;  5I46 H;  1QGF A;  4YZU A;  3KEE A;  1C5N H;  1C1O A;  3MNX A;  4MPU A;  3TH2 H;  1UTM A;  4F49 A;  1F0U A;  4ZKR U;  2BD4 A;  2GKV E;  5LPE A;  4H4F A;  2VVC A;  1WXR A;  2G00 A;  3OE7 D;  1AVW A;  2QXH A;  4RT1 A;  1P12 E;  3BTG E;  2IN2 A;  4MPV A;  1G32 B;  1GI8 B;  1HIA B;  3KQB A;  4K1T A;  5G4B A;  4X0W U;  2ZU5 A;  5SGA E;  2BX4 A;  2VGC B;  2RA0 A;  1F0T A;  2QY0 B;  1EZX C;  2Y6T A;  1LVM A;  3M7U A;  1KXF A;  3KCG H;  3FFG A;  4K8B A;  1SL3 A;  3ATK A;  1TNI A;  2F4L A;  1RIW C;  3SJO A;  1NZQ H;  7EST E;  1QBV H;  1H9H E;  1MKW H;  4UD9 H;  1GG6 B;  1WDI A;  3ZZD A;  3GYL B;  2A4R A;  1F0R A;  2VB0 A;  4K1E A;  3A8B A;  1C5R A;  1FN8 A;  3RLY H;  5EGM A;  3RML H;  5FCK A;  1EP5 A;  1CBW C;  5A8Y A;  1VJ9 U;  3DSO A;  1UCY E;  3RC5 A;  1ELD E;  1DUE A;  1MMJ N;  2WPM S;  1FX0 B;  5DP9 A;  2BY9 X;  5GWZ A;  1DUA A;  1X7A C;  4NZQ A;  1O2P A;  2EC9 H;  1Q2W A;  4AFZ A;  1WUN H;  5EU8 A;  2AER H;  1QL8 A;  1E37 B;  1MZD A;  4BTT B;  1O5G H;  1AQ7 A;  1ZJK A;  3R3G B;  1TRY A;  1K28 D;  3MO3 A;  1CHO F;  1PPE E;  1BTH H;  4TT3 D;  1VIT F;  1LHC H;  2G4T A;  2THF B;  1KTT B;  2Z3E A;  4WXI A;  3S9C A;  1O3I A;  3PLB A;  1NC6 A;  2ZCL P;  4K69 A;  4CRE A;  2G5N A;  3LGT A;  1FNI A;  3IWM A;  4NIV A;  2EEK A;  3S7H B;  1EZU C;  3QTO H;  4OM9 A;  4AZ2 B;  1NRN H;  4A7I B;  2LEL A;  3BG4 C;  1G3D A;  2ZI2 H;  1QRX A;  1MTU A;  4J1Y A;  3NRL A;  1L4D A;  2HGT H;  4IC5 A;  1GI6 A;  3URC A;  1ANE A;  1Y5B T;  4BAO B;  4Y11 E;  1BTU A;  1VJA U;  1XUJ A;  2Q6F A;  1PYT C;  4PRO A;  2F9U A;  1BQY A;  4JZI A;  2VID A;  3PMB B;  5FX5 A;  3Q77 A;  4CR9 A;  1SG8 B;  1IQE A;  1H9I E;  1XVM A;  3A88 A;  2OQ5 A;  4P00 A;  2KCA A;  4B76 A;  1C5Q A;  1P05 A;  4MTB A;  1AKS A;  1QHR B;  1V2M T;  1QZ8 A;  2VVV A;  3RU4 D;  1QNJ A;  1MAX A;  2A1D B;  3DCL A;  1K22 H;  1O2L A;  4DJZ B;  2ZCH P;  3U98 H;  2Z9K A;  1GMC F;  1C1M A;  1OP0 A;  1CGI E;  2VVU A;  4WVP E;  3SU1 A;  1V2V T;  1O3K A;  2STB E;  2A7H A;  2XWA A;  3TJU A;  2UUF B;  4DOQ A;  4E06 H;  3ATM A;  3PWB A;  5DJ7 A;  1VGC B;  4Z1M D;  1MQ5 A;  4D7G A;  4ZKO U;  2OBQ A;  1CT2 E;  1FAK H;  1O3M A;  5IYT A;  2V3M A;  3I29 A;  1SQR A;  2A5K A;  3UY9 A;  1Y8T A;  1KXD A;  4NCY A;  1SVP A;  1QFK H;  2CF9 H;  2CMY A;  1SKY E;  2VH0 A;  3BTE E;  2VWL A;  5F8T A;  2JET B;  3QK1 A;  1O30 A;  4X2V A;  2BVX H;  6GCH F;  4Q7Z A;  5KEC A;  2EA3 A;  1BRB E;  4X1R U;  1NFW A;  4RI0 A;  1W0J D;  1HXF H;  1GI2 A;  4ZCN A;  1PPC E;  3TVJ B;  2BVS H;  3SUD A;  2PP6 A;  2BOH B;  2W26 A;  3RXP A;  2BXU H;  1KY9 A;  5EXN A;  2ZPS A;  1QRW A;  3SND A;  1TLD A;  3MI4 A;  1YPH E;  2OK5 A;  3AAU A;  1TNK A;  4AFS A;  3ZZ6 A;  4DT7 B;  4XFQ A;  1A5H A;  3MMG A;  5GPI B;  5FAH A;  3LJJ A;  4I8G A;  2VIO A;  5C5N A;  4O3U A;  3SUE A;  3UNQ A;  1GHZ A;  4GCH F;  3RXI A;  1MU8 B;  2O8L A;  2K8I A;  1O5B B;  1W13 U;  4KP0 A;  9EST A;  4O9V A;  3RM2 H;  2JH5 D;  3GY3 A;  4HFP B;  1EJM A;  1UVU H;  1K9O E;  1GBF A;  2BDA A;  3HAT H;  4WY3 A;  4X6N A;  2GT8 A;  2CHA B;  3GY2 A;  1TB6 H;  3EAJ A;  3U8T H;  1O5C B;  2KX4 A;  3M37 A;  4OS7 A;  1AU8 A;  1BRC E;  2ZF0 H;  4D8N A;  1DM4 B;  2NWN A;  1WU1 A;  2L74 A;  1XMN B;  1YPM H;  2XC0 A;  4IBL H;  4KEL A;  1GJ6 A;  1IQG A;  2AEI H;  1G3C A;  2GVF A;  2TGD A;  2Q1J A;  3U69 H;  1THS H;  1YBW A;  2BHG A;  1HRT H;  2XCF A;  1YM0 A;  1MCT A;  1KYN A;  1EKB B;  1HAV A;  1ZHM A;  1XXF A;  3F3B A;  2ZCK P;  1AI8 H;  3W94 A;  1VCW A;  3SI3 H;  2F9N A;  1TPS A;  3PRO A;  3SU2 A;  4XOJ A;  2FOF A;  1QL9 A;  5FBI A;  3H5C B;  1TRM A;  3VPK A;  2HOB A;  4GLY A;  5EXM A;  4CH2 B;  5CHA C;  3D23 A;  2XOK D;  2FX4 A;  1T31 A;  2HNT C;  1QBO A;  2TIO A;  1FDP A;  1DXP A;  2PKS C;  2FZZ A;  1O2G H;  4JK5 A;  2QF5 A;  1HDT H;  1AKS B;  2CGA A;  2ZZU H;  4IS5 A;  5HM9 A;  1AE8 H;  3M3S A;  3RDZ A;  1O3D A;  1ELG A;  1OOK B;  1ZSK A;  1CO7 E;  1Z7K A;  2HNT E;  2PGQ B;  1JBU H;  3PWC A;  1IOE A;  1IQH A;  1VIT G;  2GZ7 A;  2WZQ A;  3LGW A;  2V6N A;  1CU1 A;  1W14 U;  2J38 A;  4ZHM U;  3GCO A;  3QTV H;  5HM2 A;  1UK2 A;  3U1I B;  5HXF A;  5DP7 A;  2AGI X;  3OFN D;  1RTK A;  2R0L A;  1ZGI A;  3UOP A;  1UTO A;  1J8A A;  1HB0 B;  2FI5 E;  2TGP Z;  2AYW A;  2PSX A;  1GDU A;  2BDG A;  3OTP A;  5EOK A;  5DN6 D;  4YLU A;  1C5V A;  1V2T T;  3UUZ A;  3BIV H;  2P93 A;  1EAW A;  3L3T A;  3LH3 A;  1BTP A;  1JIM A;  2J97 A;  1OP8 A;  2ZFP H;  2ZIQ H;  3SW2 B;  1AUT C;  1O5A B;  1CT4 E;  3D65 E;  1EAI A;  1UTK A;  3NPS A;  1HAI H;  4UFF H;  2J95 A;  3EA8 A;  3GDS A;  2BLW A;  2EST E;  3PV4 A;  2Y5F A;  3PTB A;  1C5X B;  2XYA A;  3VXF H;  2ULL A;  2L6O A;  1TGT A;  4NSY A;  4X6M A;  4CR5 A;  1V2L T;  3NKK A;  2BD5 A;  3DT0 H;  3N7D A;  2F83 A;  1TWX B;  1IHT H;  5C17 A;  3L33 A;  1T8M A;  1Z8R A;  2ZDA H;  3TLO A;  1C2K A;  1O3O A;  5EPY A;  1KLJ H;  4NFF A;  3MU5 A;  2WSS D;  2V3O H;  5AF9 H;  3RXC A;  1DWB H;  3H7T A;  1HGT H;  1LMW B;  5C5O A;  1C9T A;  3RC6 A;  4XD7 D;  3TJO A;  1GCT B;  1EJA A;  4B71 A;  2NU1 E;  4JZD H;  4ZAE A;  2FOD A;  4KGA A;  2W3K A;  2ZA5 A;  3M5M A;  3SNB A;  7GCH F;  2JIZ D;  2FOC A;  3ZVE A;  2ZGC A;  2ZTX A;  3C27 B;  3V13 A;  1GJ5 H;  2VIQ A;  2KCP A;  1QJ6 B;  2ZHW H;  3DSP A;  3FZZ A;  1EST A;  3TU7 H;  3PMA B;  2AS9 A;  1YPE H;  2XNI A;  5ESB A;  1S0Q A;  1SLU B;  4AG1 A;  2RG3 A;  1O35 A;  2BD7 A;  3UWJ H;  1GGD C;  4OS6 A;  3UB0 A;  1ZSL A;  1HAV B;  3ZVD A;  1Y3Y A;  2ZFR H;  3O8B A;  2PWX A;  3NXP A;  1KDQ A;  5EOD A;  1ELE E;  1HAZ B;  3AAV A;  3MNS A;  3MWI U;  1TOM H;  4GCH G;  1BHX F;  3TIT A;  3M5L A;  2FO9 A;  1RS0 A;  5HKK D;  2BB4 A;  1EZS C;  3MH4 A;  1AFE H;  2H9H A;  2VWO A;  1L1G A;  2XBV A;  2EQN A;  2J2U A;  2ZHE H;  2BQ6 B;  2QCY A;  1Z6E A;  1GJ4 H;  1FIZ A;  3RM0 H;  3MFJ A;  3BSQ A;  1JRS A;  7KME H;  5IK2 D;  1ELC A;  3ZZ9 A;  3BTK E;  3VB6 A;  1C1V H;  4ISL A;  3QGJ A;  2CF8 H;  4ZKS U;  3P8G A;  3SV9 A;  2OTV A;  1NRP H;  4X8V H;  2AMP A;  1OWH A;  1LHD H;  3PYH A;  2ZDV H;  2PFE A;  2ZTY A;  4BAK B;  1W2K H;  3QX5 H;  2C8X B;  4YOG A;  1FUJ A;  3PTN A;  4LK4 A;  4Q4L A;  4A1V A;  4D7F A;  2SGD E;  2UWP A;  1BMF D;  3A89 A;  5C1U A;  2BY6 X;  3GIS B;  2WPD D;  2ODP A;  1LDT T;  5JYI A;  3BTW E;  1V2Q T;  5C1X A;  1Y3V A;  1QA7 A;  4H6S B;  3V12 A;  3F9F A;  3V0X A;  2VWN A;  1O37 A;  3LGV A;  3UIR A;  4LZ4 B;  2CK3 D;  1BMM H;  2FS8 A;  2ZHQ H;  1AB9 B;  5AFY H;  3WWF A;  3RC4 A;  3DA9 B;  2QAA A;  3MH6 A;  3GCH C;  4Y76 A;  3CS7 A;  2XCN A;  1G2L A;  5T1V A;  1ELA A;  3EYD A;  1YPL H;  3BTF E;  3F9E A;  1SR5 C;  2O8W A;  1P0S H;  1T4U H;  3TK6 A;  1EQ9 A;  4UEH H;  2A0Q B;  5T6D A;  5C0U A;  4YXW D;  1C1N A;  1CA0 C;  2D26 C;  2ZGB H;  2WPH S;  4Y79 A;  2NU0 E;  2YMS B;  1NBM E;  2Z9I A;  3KNX A;  1BRU P;  4J2Y B;  1HAP H;  1NES E;  4SGB E;  2FWW A;  3HGN A;  1SQA A;  3RMN H;  2QC2 A;  4ISO A;  1YLN A;  2CHA C;  2XWB I;  2GCH G;  5A0C A;  2FLR H;  1LHF H;  2F9B H;  4KKD A;  4CRD A;  2K1Q A;  1DAN H;  1GI1 A;  3SU6 A;  1W7G H;  4M7G A;  4UFD H;  1N6X A;  1TIO A;  3TJV A;  3PO1 C;  3UNR A;  4I8J A;  4NA9 H;  1EOJ A;  1P57 B;  2ZFS A;  1Y59 T;  3GIC B;  4YOJ A;  1SQT A;  4ZXY H;  2B7D H;  2F43 B;  2A7J A;  1T4V H;  4MNY A;  2JDI D;  4CHA C;  1JMO H;  2Z6B D;  3M35 A;  1S5S A;  1C5L H;  1J14 A;  2PLX A;  1VCQ A;  1QCP A;  3ZZA A;  4K1S A;  1OX1 A;  1UVT H;  3K65 B;  1WV7 H;  1V2W T;  4THN H;  2R2M B;  1DLE A;  1N8O C;  4GPG A;  4ZXX H;  5B6L A;  2OP9 A;  4WMD A;  3MO9 A;  4JCN A;  3RU4 T;  1FLE E;  1T8O A;  5GND A;  1PJP A;  3O8D A;  2BQW B;  1RTF B;  1EFR D;  1AZZ A;  1Z71 A;  4JMY A;  3F68 H;  5DPA A;  2JH6 D;  4FOU C;  1AY6 H;  3MHW U;  1GJC B;  5F8Z A;  1KDQ B;  2ILN A;  3PLK A;  1UCY K;  4A5T S;  1O3F A;  2A2X H;  3OU0 A;  1ABI H;  1S6F A;  5GXP A;  1DXW A;  2F9V A;  1B0F A;  2FYR A;  1O2H A;  2P8O B;  1ELV A;  4NFE A;  1UW7 A;  4DT4 A;  3LGI A;  1ID5 H;  4I31 A;  5FPY A;  1DWE H;  1TPO A;  4R8T B;  1PPF E;  2BXT H;  4FUC A;  3SJ9 A;  5TCC A;  5DO4 H;  1M9U A;  1F2S E;  1GVZ A;  1Z1I A;  4NIW A;  3A87 A;  3E1X B;  3M61 U;  1KXB A;  3A83 A;  3FP8 E;  1PQ8 A;  3EQ0 H;  2FP7 B;  8LPR A;  1OWK A;  3SQH E;  1ABJ H;  2BLO A;  3A7Y A;  1HJ9 A;  3DD2 H;  2AGG X;  1EAU A;  3SUG A;  1O2U A;  3FP6 E;  2B8O H;  5DKM A;  2AH4 X;  3A85 A;  1RJX B;  5HGG A;  1P2Q A;  3PMJ A;  3MU0 A;  4Y8Z A;  3TGI E;  1KLT A;  2ANY A;  2G52 A;  3ZVF A;  3SHC H;  3P70 B;  4RSP A;  1ZYO A;  1P9S A;  1ZRB A;  1FV9 A;  1GCD A;  4NA7 A;  1XUI A;  1P3E A;  5JPM H;  1EAS A;  3LGU A;  1HAY B;  2BD8 A;  1KXA A;  3GY5 A;  2WPL S;  2IPQ X;  2O8T A;  3MU8 A;  2QN5 T;  1TE0 A;  4B74 A;  2QF3 A;  3GCN A;  4INH A;  1K1J A;  1HFD A;  1WQV H;  1SBW A;  1W8B H;  1TX7 A;  3A7W A;  5EXL A;  3BEU A;  2KR7 A;  1SB1 H;  1P11 E;  4TYD A;  3GY4 A;  2OCV B;  5EJ1 A;  3O8R A;  1GHY H;  1YCP H;  3MU1 A;  3NZI A;  5EJL A;  3STJ A;  2HPP H;  1DE7 H;  2ZU3 A;  2Z9J A;  4X8S H;  2R2W U;  3BG8 A;  4B2B A;  1P06 A;  1GBM A;  4TSF D;  4HG6 A;  4X2Y A;  4I32 A;  1BBR E;  3UWI A;  2ZU4 A;  1V6D A;  3TPI Z;  4ABH A;  2J92 A;  2PUQ H;  2WPI S;  3EE0 B;  1MKX H;  3NK8 A;  1OP2 A;  2A4G A;  1WQS A;  2OXS A;  4D9R A;  4AG2 A;  4JK6 A;  5F53 A;  1AMH A;  1O3P B;  2W7S A;  3BF6 H;  1D9I A;  4Y71 A;  5HYO A;  1K0H A;  2FTL E;  6CHA B;  1V3X A;  4SGA E;  1E1R D;  1O5F H;  3URD A;  3ZVC A;  4WWY A;  3P92 A;  2GZ8 A;  1XKA C;  1SFI A;  3WWB A;  2BM2 A;  3RXL A;  3F2H A;  5AVD A;  2ZHF H;  1LKB A;  3U9A H;  4B6E A;  3B23 B;  1FY4 A;  4HTC H;  1XM1 A;  1BTX A;  5JB8 S;  3M7Q A;  1ZLR A;  2GT7 A;  1IQN A;  3UFA A;  3A8A A;  3LU9 B;  3A8D A;  3LC3 A;  1UTJ A;  2FOM B;  1SC8 U;  3K6Y A;  3BTH E;  1L4Z A;  3ATL A;  4U01 A;  2W3I A;  5EQQ A;  3VB3 A;  1OWE A;  1O3H A;  3RXQ A;  5J4S A;  5L30 H;  4YO9 A;  4ACB A;  1GBH A;  1NS3 A;  3A82 A;  3G01 A;  2EI6 A;  1UTQ A;  1MBQ A;  1C5Y B;  3C1K A;  1J9C H;  4DII H;  4ZHA A;  1MTN B;  4B2C A;  4CRG A;  1GI4 A;  1C2L A;  2F9P A;  3E91 A;  3FKS D;  1HCG A;  2RCE A;  1QB1 A;  2W7U A;  2GX4 A;  3ZZ3 A;  2SGP E;  2OC1 A;  5CE1 A;  1GDQ A;  1UTL M;  3T26 A;  4ASH A;  3RMO H;  1AB9 C;  1G36 A;  1RTL A;  1D4P B;  3TGJ E;  4B2A A;  2ZFF H;  3QWC H;  1EUF A;  2KZ4 A;  5L2Z H;  1Q31 A;  2ZFT A;  5DP8 A;  1BJU A;  1GMD F;  3QUM P;  2J4I A;  1BTY A;  1O2T A;  2PW8 H;  4Z0K A;  3UQV A;  1MQ6 A;  4UE7 H;  3MYW A;  1V2U T;  4FUE A;  7LPR A;  5L6N H;  1GDN A;  1VZQ H;  2VNT A;  3D49 H;  2JH0 D;  3KN2 A;  3N99 A;  1G3B A;  3RXE A;  2EY4 C;  2ZDL A;  1OWD A;  2KM0 A;  1YPH C;  4UFG H;  2O8M A;  2Z9G A;  4QT8 C;  1K2I 1;  1SGR E;  1VR1 H;  5GIB A;  1HAH H;  1LCY A;  3EA7 A;  3ZYD A;  1GI7 B;  1UMA H;  1NBM D;  1K1L A;  2G51 A;  8EST E;  5L2Y H;  1O2J A;  1ZTL A;  1BUI A;  2H1U A;  3DHK H;  4I8H A;  1KXE A;  2RDL A;  3U8R H;  3KYF A;  1WOF A;  1YF4 A;  3K6Z A;  4X1Q U;  4JZ1 A;  1O2O A;  4MLF B;  2BVR H;  3LT3 A;  3UNS A;  2GV6 A;  2A7C A;  1TAB E;  1ZPC A;  2DE9 A;  1TAL A;  4KTU A;  1W10 U;  2C8Y B;  1YP9 A;  1TNG A;  1V2N T;  3B8J A;  4ABF A;  1A5I A;  1Z8G A;  2LNC A;  3F0P A;  2VH6 A;  1NTP A;  1K1O A;  1P2I A;  3ZIA D;  2G5V A;  4VGC C;  3VB7 A;  3DFL A;  1C5W B;  3UPE A;  5A8Z A;  3STI A;  4BAN B;  5E0G A;  4GSO A;  5LPF A;  1MH0 A;  1ZTK A;  1NM6 A;  1A7S A;  1SGE E;  1GI3 A;  1GJB B;  1GJA B;  4Q63 A;  1C1S A;  1ZZZ A;  1O2Z A;  1HYL A;  4JYU H;  5JBB S;  4WF8 A;  1OHH D;  4FUF A;  3QZR A;  1IQK A;  1C4U 2;  2HAL A;  1FPC H;  2YNA A;  3OX7 U;  4UDW H;  1VCP A;  1PFX C;  4AB8 A;  5DP4 A;  1C2H A;  5E8E H;  2GMT B;  1AFQ B;  2BY5 X;  2P8O C;  5C67 A;  5LPR A;  1FXY A;  4E7R G;  1EPT C;  3IG6 B;  4YOI A;  1GPZ A;  1ZJD A;  4CRC A;  2G4U A;  3B9F H;  3MQK C;  3RXS A;  4U2W A;  2IJO B;  4AN7 A;  2PV9 B;  4I86 A;  5EJZ A;  1TPA E;  2CN0 H;  3A86 A;  2ZFQ H;  2FXR A;  1ZHR A;  5FPT A;  1TX6 A;  5F8X A;  5K0H A;  4UFE H;  4ZMA H;  2ANW A;  4NZL A;  1O3B A;  4ACA A;  4M9F A;  1TFX A;  3A84 A;  1D3T B;  2XND D;  5CMX H;  1BMN H;  3VB4 A;  5PTP A;  1O3A A;  3ODF A;  2O9Q A;  3DFJ A;  2PR3 A;  1AVX A;  4I8K A;  1GWA A;  4WH6 A;  3LH1 A;  5LH8 A;  1NRQ H;  2FOG A;  2GCH F;  1BRA A;  2VIW A;  1P04 A;  4IN2 A;  1UHB A;  4AGJ A;  1N6Y A;  1SOZ A;  1A4W H;  4DW2 U;  3VGC B;  1GBT A;  2VGC C;  5E2P A;  2Z7F E;  2WUC A;  1DWC H;  1C4V 2;  5KED A;  1YLC A;  2WYG A;  5KGO A;  1QY6 A;  4INK A;  1ETT H;  4H6T A;  3P8O A;  4KTS A;  3RP2 A;  1AWH B;  2Q6G A;  3W1E A;  1NRR H;  3RXT A;  1WTH D;  1SLX B;  1FY8 E;  1IQI A;  1GG6 C;  3CS0 A;  2PUX B;  4F55 A;  2FYQ A;  3MO6 A;  1BTW A;  4K8Y A;  1TRN A;  2O8U A;  4D9Q A;  1BCU H;  4Y7B A;  3LIW A;  5ABW A;  1TA6 A;  2OLG A;  5A0B A;  2J94 A;  4X6P A;  3VFE A;  1CQQ A;  3AAS A;  2ANM H;  3PRB A;  1NN6 A;  1GBI A;  1GJ7 B;  4ABI A;  2ZO3 H;  1A46 H;  3CNR A;  5DP5 A;  1THR H;  4XE4 A;  5JBT A;  2J34 A;  1C1Q A;  1K1I A;  1O2K A;  1O2R A;  1CGH A;  2WIN I;  3KHV A;  2A4Q A;  3MOC A;  1DY8 A;  4XBC A;  1ESA A;  2GDD A;  1EZQ A;  3ZYE A;  3MH7 A;  4KTC A;  1F92 A;  1C5U A;  1AGJ A;  1WYK A;  6CHA C;  1H9L B;  1K1P A;  1O31 A;  1Z8J B;  3EA9 A;  1AUJ A;  3RXD A;  2FX6 A;  1FY3 A;  4R0I A;  1TQ0 B;  5FHT A;  1ZR0 A;  5C94 A;  3S9B A;  3LPR A;  2ZNK H;  4A6L A;  1V2S T;  2FI3 E;  1MCV A;  1V2J T;  4AFQ A;  1MTS A;  1QRZ A;  5ETX A;  4LZ1 H;  1BIO A;  3ATW A;  2UUK B;  4O03 A;  2F91 A;  2BDH A;  3SGB E;  1GMD G;  3DSG A;  2HLC A;  1K1M A;  2RA3 A;  1J17 T;  2VBC A;  4E7N A;  3EST A;  4AX9 H;  4JZE H;  1O2I A;  4FU7 A;  2XC4 A;  1O2Y A;  2UUJ B;  3IIT A;  5JBC S;  1YWU A;  1YKT A;  5FX6 A;  1CSO E;  2VIN A;  5FBE A;  1C5P A;  1QA0 A;  4UON A;  1GHV H;  4NIX A;  1NFU A;  1V2P T;  2FDA A;  5GCH G;  1C2D A;  3ZVA A;  1XVO A;  1RIW B;  4JZF H;  1W0Z U;  3P6Z B;  3F2F A;  3BIU H;  1SQO A;  3E6P H;  3TGK E;  2ZU2 A;  1DWD H;  3M36 A;  1Y5A T;  4IMZ A;  4IW4 E;  3F9H A;  1SSX A;  1T8N A;  4X1P U;  3O8C A;  4FUD A;  1INC A;  1F5L A;  1EX3 A;  2OQU A;  3A7T A;  2STA E;  1LHE H;  2V7Q D;  4FVD A;  1UJ1 A;  1B5G H;  4OGY A;  1YGC H;  1AHT H;  1ZHP A;  1QUR H;  4GUX A;  1N1L A;  3RXR A;  1D6W A;  1EOL A;  1TGB A;  2H6M A;  4AYV B;  1YPG H;  1VGC C;  2C8Z B;  2TBS A;  3SV2 H;  1UVP A;  1MBM A;  3WY8 A;  1YPJ H;  1DVA H;  2TGA A;  4MG3 A;  1Y3U A;  1ACB E;  3URE A;  1QJ1 B;  5FXL A;  2C3S A;  1OS8 A;  1MKW K;  1P02 A;  4FU9 A;  3SV8 A;  5E0H A;  1GBB A;  2Z94 A;  5DP6 A;  5J4Q A;  2JET C;  1EJN A;  1SFQ B;  2SNV A;  4O97 A;  1FJS A;  3MNB A;  1UHB B;  2WPJ S;  3BG4 B;  1U6Q A;  2SGQ E;  3R0F A;  1Z8I B;  4IMQ A;  1A0J A;  4X2W A;  4NGA H;  1LTO A;  2BTC E;  2P16 A;  2DE8 A;  5B6O A;  3P8N A;  2ZU1 A;  4BXW A;  3SGQ E;  3E0P B;  5C20 A;  1AZ8 A;  2EI8 A;  3PMH B;  1P2M A;  5T6G A;  1D3Q B;  5F03 A;  1LQD B;  3ZZC A;  4X8T H;  5A0A E;  4Q80 A;  2GTB A;  1C2E A;  4K60 A;  2YMS D;  2M2A A;  3E8L A;  3V3M A;  3SJI A;  1B0E A;  4WXV A;  4EST E;  1C1W H;  3SJK A;  4TPY A;  1O2Q A;  1DIT H;  1FAX A;  2HVY B;  2P3T B;  4MVN A;  1OPH B;  2UWO A;  1C2M A;  2CXV A;  4DCD A;  4IN1 A;  1EB2 A;  2V3H H;  1SGI B;  4Z6A H;  4F48 B;  1JOU B;  5EW2 H;  1GJD B;  1V2R T;  1T32 A;  2GD4 B;  1TBZ H;  4GAW A;  3LKW A;  3K9X B;  1S6L A;  4Y8X A;  1MD7 A;  1BT7 A;  1OWJ A;  1ZGV A;  2ODY B;  1Y5U T;  4AFU A;  2NU3 E;  2R3U A;  2ZEC A;  4FU8 A;  1SGD E;  1TNL A;  2FOE A;  3ZVB A;  3LDX H;  1LHG H;  3HGP A;  4ABE A;  3M3T A;  5DSF A;  4GVU A;  1S85 A;  1DPO A;  4AC9 A; 
#chains in the Genus database with same CATH homology
 3WW7 A;  4Q4L A;  2QE7 D;  4A1V A;  2W6I D;  3SV6 A;  2YMS C;  3SU3 A;  2F9V A;  1BMF D;  1DXW A;  1N1L A;  2J5U A;  2L6O A;  3KEE A;  4B75 A;  1COW D;  2WPD D;  3PV2 A;  4B6F A;  3N7D A;  4A1X A;  1MAB B;  3FOA A;  4DT4 A;  3WWB A;  3P8O A;  2F9U A;  4I31 A;  3F2H A;  1A1R A;  5FPY A;  3W1E A;  5C17 A;  2QF4 A;  4FET A;  1RGQ A;  2KCA A;  4R8T B;  4B76 A;  4B6E A;  5EPY A;  1WXR A;  4F55 A;  3F0O A;  3OE7 D;  2AHM E;  2GVF A;  3PV5 A;  3SV7 A;  2CK3 D;  3F0P A;  3SV8 A;  3ZIA D;  2WSS D;  3WWF A;  3RC4 A;  3SU4 A;  2XCF A;  2XCN A;  5T1V A;  4B73 A;  1E1Q D;  2FOM B;  2FP7 B;  2P59 A;  2GGV B;  3EYD A;  3PRB A;  3RC6 A;  2JJ1 D;  3U1J B;  2OC8 A;  3DCL A;  2W6J D;  3F3B A;  4XD7 D;  2YOL A;  4U01 A;  5EQQ A;  4B71 A;  3KF2 A;  3L6P A;  5CHB A;  3PRD A;  3SUF A;  5C0U A;  2OIN A;  4Q63 A;  3F2G A;  3FO8 D;  5EQR A;  3SU2 A;  4YXW D;  3M5N A;  2A4Q A;  1NS3 A;  3SUG A;  1DY8 A;  3SU1 A;  2YMS B;  4WF8 A;  1NBM E;  1OHH D;  3KNX A;  3M5M A;  4KTC A;  3P8N A;  2JIZ D;  4K8B A;  4A1T A;  2OC0 A;  4NWK A;  4Z1M D;  5GJ4 B;  1JXP A;  2K0Q A;  2KCP A;  2F4L A;  3DSP A;  5FL7 D;  2OBQ A;  2XOK D;  5EQS A;  3SU5 A;  2XNI A;  5ESB A;  2A4R A;  2K1Q A;  1DXP A;  2YMS D;  3FKS D;  2HLD D;  1E79 D;  5ETX A;  3SU6 A;  2M2A A;  3LOX A;  2QF5 A;  3OEH D;  3GS9 A;  1SKY E;  3OAA D;  1KMH B;  2OC1 A;  3AK5 A;  3LON A;  3DSO A;  3UB0 A;  1H8H D;  3SZE A;  2VBC A;  3O8B A;  3RC5 A;  2IJO B;  5IDK A;  1RTL A;  2F43 B;  2WV9 A;  4B74 A;  2WZQ A;  4ASU D;  1FX0 B;  1CU1 A;  2KFW A;  4A92 A;  4RI0 A;  1W0K D;  1W0J D;  2JDI D;  2WHX A;  3OYP A;  2KZ4 A;  4ZCN A;  3SUD A;  2KCO A;  3NRL A;  3H09 A;  5EPN A;  5FPT A;  3SU0 A;  3M5L A;  4WH8 A;  3U1I B;  5C0T A;  3OFN D;  5HKK D;  2KR7 A;  4TYD A;  4M9F A;  2OK5 A;  5CDF E;  3O8R A;  2XND D;  5B6L A;  2FM2 A;  3F2F A;  3OTP A;  2JJ2 D;  2OC7 A;  2QV1 A;  4NWL A;  5GPI B;  3LKW A;  3N7E A;  3SYJ A;  5DN6 D;  2KCY A;  3KN2 A;  3N99 A;  4TSF D;  4TT3 D;  5GND A;  3O8D A;  4I32 A;  1S6L A;  3VG8 A;  5IK2 D;  3FN8 A;  1DY9 A;  1H8E D;  3SUE A;  3OEE D;  1BT7 A;  2KM0 A;  1EFR D;  4WH6 A;  2A4G A;  4I33 A;  2O8M A;  2OBO A;  3SV9 A;  4JMY A;  3M5O A;  3O8C A;  1W3C A;  2K8I A;  5F53 A;  4OM9 A;  2LEL A;  5H4I B;  1NBM D;  5DSF A;  2IJD 1;  3E90 B;  2V7Q D;  1E1R D;  5FPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...