4ZCNA

Crystal structure of nvpizza2-s16s58
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
86
structure length
86
Chain Sequence
b'SHMFTGLNTPSGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVLPFTGLNTPSGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nvPizza2-S16S58
publication title Crystal structure of nvPizza2-S16S58
rcsb
molecule tags De novo protein
total genus 12
structure length 86
sequence length 86
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.500 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4zcnA00
5F53A 5CHBA 3WWFA 3WW7A 4ZCNA 3WWBA
chains in the Genus database with same CATH superfamily
1LPGB 3N7EA 2A4GA 5KECA 1HJAB 1GJ8B 2BLOA 1UTLM 1O3LA 1PJPA 5EG4A 3KYFA 3SJKA 2FOGA 1SVPA 1GI1A 2J5UA 4FXGH 5EODA 1TOMH 2GD4B 2W3IA 1ZYOA 1TWXB 1HJ9A 2TPIZ 1MTUA 4CREA 4MNVA 2OP9A 4H42U 2PKSB 2PSYA 5JYIA 4I8JA 1XKBC 1IQKA 1DUAA 1O2WA 2EI7A 2ODYB 1GHYH 3KQ5A 1T32A 4DW2U 1KXEA 1NN6A 2WV4A 2WUCA 4CHAB 2IPQX 3RXAA 5TCCA 1A5GH 3RP2A 2BVXH 4K8BA 4X0WU 4FETA 2KCAA 4X6PA 1AVXA 1N6YA 2ZG0H 3GY6A 3K6ZA 3SHCH 1ELEE 1PPGE 1WV7H 2BY9X 4ZROA 2FX6A 1BTZA 1AFQC 1GJAB 1K2I1 1SMFE 1HAVB 1ELFA 1A2CH 1SI5H 1A0HB 4K2YA 4O3TA 2ALVA 1CO7E 1F0UA 1Q2WA 1XVOA 2FEQH 2VGCC 4X6OA 3E91A 5DO4H 1SQRA 1MCVA 2ZGXH 5EQRA 5AVDA 3ZVAA 2BXTH 5DP9A 5F8ZA 1ZOMA 3T27A 1EAIA 4D7GA 2TIOA 4OS1A 2P93A 4U2WA 4AX9H 1C1PA 3LH1A 2VWNA 2CMYA 5SGAE 2ANYA 1HXFH 3F9EA 3P8GA 5L2ZH 3STJA 1BA8B 1GJ4H 2VIWA 4KTCA 1ZRKA 2IN2A 2VVVA 3LGTA 1O3EA 1YCPH 4FU8A 2NU0E 1TNLA 1BCUH 1LTOA 3A83A 3T28A 3ZZDA 2AFQB 3FP6E 1AUJA 1QB9A 1MCTA 3PV4A 1QB1A 4UONA 4FUJA 4H6TA 2WPDD 1XMNB 1NS3A 1DANH 1SKYE 3KEEA 4X6MA 1NBMD 3TU7H 1W14U 1SQAA 2BM2A 3F9HA 1T4VH 4K1TA 1TGCA 3P92A 3SJOA 3GCHC 3QZQA 2KCOA 3BIUH 3E16B 4RT1A 2KCPA 2STAE 1GCTB 4H4FA 1K22H 3SI4H 1S83A 2JH5D 4I8HA 1P8VC 3GS9A 2C8XB 2PTCE 3RXIA 2G4TA 4AFZA 4CRCA 1DVAH 1F92A 1NO9H 1PPEE 4ZHLU 5C0UA 1HAGE 2HGTH 3DUXH 2IJOB 3STIA 1WOFA 2XC5A 2J38A 1O2VA 3PRDA 1MBQA 1WBGB 1IQJA 4BTTB 3SJIA 3TNSA 2ZA5A 3UTUH 2V3OH 4WH8A 4MLFB 1QCPA 2HPQH 1XUIA 4Z1MD 1EPTC 1BQYA 1GG6B 1UTJA 5HGGA 4RT0A 1ESBA 1TALA 2F4LA 3MQKC 2P8OC 1P3CA 2Y7ZA 2WYJA 2BTCE 1G3EA 1DWDH 1BTPA 3F9FA 1QBOA 1SOTA 1AQ7A 4K5ZA 2J2UA 1V2MT 2IPHA 2O8TA 3ZZ5A 1OWKA 3FFGA 3FVFB 1QY6A 5HMAA 5A0CA 2BZAA 5DKMA 1C1OA 1OP2A 2QV1A 4TWWA 1ESAA 3VGCB 1C5MD 1L1JA 3RC5A 1AN1E 4WY3A 2XXLA 4RI0A 2GDEH 1FY3A 1QJ1B 4X2VA 3OTPA 1JIRA 1UK4A 2ZHFH 8GCHG 2J97A 2JIZD 1C5WB 4O97A 4ASUD 1GDQA 2PUXB 3HKJB 4YT6H 3AVZA 1VCPA 1LKBA 3KN2A 1GI6A 4A1TA 2NU1E 1GBDA 1QFKH 3LGIA 2AMDA 1WYKA 3E0NB 1F0SA 4F49A 2KAIA 1Z71A 1RGQA 2HPPH 1GBJA 1W13U 2Y5FA 5E0GA 2Q6GA 5DK1A 1O2QA 1W7GH 1TA6A 4ABFA 1P9UA 3UNSA 3UREA 3SU1A 3IG6B 1GBHA 4YT7H 3P70B 4X2YA 1GI0A 1O2KA 1G3BA 2XBVA 3LGUA 1GHAF 3TGJE 1GI8B 2OC8A 4ISOA 3TLOA 5EQSA 2ZGJA 4XBBA 1NT1A 3Q3XA 1F0RA 4K60A 1ZMNA 1K21H 1P3EA 1TONA 1U6QA 1ZPCA 1PQ5A 2QE7D 2BDGA 3P17H 2YOLA 1QRWA 1XUFA 4XOJA 2BDYA 1MZDA 4NIVA 6CHAC 1C2DA 3Q3KA 1E37B 4ZKOU 3DFJA 1THRH 1ZLRA 1HBTH 2A7JA 1WXRA 4B6EA 5C17A 3HGNA 4FUIA 3JZ1B 4INLA 2ZTZA 1WAYB 1C5XB 1O2GH 2FS9A 1UJ1A 5A8YA 3NPSA 1ZMJA 3E90B 1ZJKA 2ZP0H 1YY3A 1GDUA 3MU5A 3A84A 7KMEH 4AFUA 2DUCA 1GJBB 4MPWA 4Y0ZE 2VNTA 1CHGA 3ZVBA 1OOKB 3L33A 4IGDA 1GJCB 3TPIZ 3L6PA 1BHXF 4KTSA 1O3JA 1GBCA 4UD9H 1E1QD 1AFQB 1C5TA 3F2GA 2A1DB 1EXFA 3GDVA 1EJNA 2R3UA 2A31A 4AYVB 1TBRH 1FONA 1ID5H 1SGTA 4KGAA 2R9PA 2FLBH 3VB7A 1PQAA 3O8DA 3S69A 1IQLA 1WTHD 5F8XA 1DM4B 4PROA 1GBBA 4YM9A 1TGBA 3E3TA 2ZFQH 1CGHA 1EAUA 1AVGH 2XC0A 2ZHQH 2A4QA 2ILNA 3VG8A 4GAWA 4CRBA 1V2ST 4MG3A 2TBSA 1TA2A 3UFAA 2BDHA 2GCHF 3BF6H 4NCYA 3EGKH 1N8OB 3O8CA 2C93B 2AIQA 2FX4A 1ELTA 1GBEA 1C2IA 2ZDAH 3IWMA 5LPFA 3SGBE 3M61U 1PQ7A 2UUKB 3SORA 1O5FH 2FOCA 1A0LA 3PROA 2EQNA 4A6LA 5F6MA 3UNQA 3SZNA 3RLYH 4YO9A 2JDID 5FPSA 3MH5A 1H9LB 1O5GH 5ETXA 2QCYA 1G30B 4WXVA 1BRBE 4FU7A 4TPYA 2OC0A 3EAJA 4D9RA 1O36A 3LC3A 2BY7X 4DY7B 5C20A 1KXCA 1LCYA 3KQEA 3LPRA 3BV9B 1YKTA 1C5SA 2PR3A 2WPKS 1H9IE 3IITA 4P00A 2JETC 2AGEX 3S7HB 1QBNA 1FPCH 1SG8B 1HJAC 1GHVH 1C2EA 1Y59T 4SGBE 2Y81A 2WPIS 4ASHA 3GY2A 1WTGH 1MTWA 1LMWB 3GYMA 3V12A 2BD2A 2DE8A 2CF9H 4GPGA 1ELCA 4LZ1H 1EPTB 4ZMAH 2M2AA 1O3HA 1SLVB 3SGAE 1ETSH 3ESTA 3SUFA 4NA9H 4TSFD 4UFGH 1TGNA 4JCNA 3QK1A 4CHAC 1BRCE 1TRNA 2QF5A 3PWBA 5DP8A 3SJ8A 2ZGBH 2B0FA 4AC9A 2EA3A 1FUJA 1D6WA 1D9IA 4GSOA 3KQCA 1UHBA 3ATKA 4CRAA 2WPLS 3UOUA 2ZDNA 3HPTB 3PLBA 2W26A 2ZTXA 4UE7H 3SNAA 4WMFA 1O3CA 1WQVH 1YPHE 1T8MA 5T6FA 3DSGA 3LOXA 2F9PA 1QNJA 5FCRA 1GL1A 1GBLA 1O2UA 2LP6A 1OWJA 1B5GH 1FZZA 1K1MA 4CBNA 1KXDA 2WSSD 4NIYA 1NC6A 2OC1A 3A7VA 2C8WB 4YOJA 1GBTA 3SV2H 5JPMH 4DGJA 2WUBA 1BITA 2WPMS 1O2JA 2Z3EA 2YNAA 4I33A 2ZDMA 3EA9A 1O2IA 2FTMA 2G51A 4YLQH 4DT4A 1SR5C 2ZU5A 1B7XB 1GMHF 4E05H 3PV2A 1DLEA 1DXWA 1NESE 2UUJB 3NWUA 5JBTA 2SNWA 2FODA 4XRNA 2VINA 3NK8A 4ISNA 3BEUA 2HVXA 3SJ9A 4YOIA 1ARCA 1TMTH 3TH4H 4JZFH 1LHFH 2QAAA 3F9GA 4OM9A 4I7YH 2WHXA 4GHTA 2Q6FA 1SGPE 1MMJN 1AKSA 5IDKA 1HIAB 1Y3XA 1GBKA 3U1IB 2PLXA 3S9CA 1E0FD 4ESTE 1GCTC 3Q77A 1C1MA 2XCNA 3TH2H 4K8YA 3SU0A 3DSPA 1OKXA 2XNIA 3ZV9A 5A09A 5JB9S 3SQEE 2F43B 2PGQB 1C5UA 3BTHE 4I31A 4DIIH 1G3CA 1SFIA 5GDSH 3SUEA 3K6YA 3JZ2B 1MH0A 1OWDA 3D62A 2ZU1A 3OEHD 2ZQ1A 1BRUP 5CE1A 3Q76A 2Z6BD 4I8LA 5DP3A 1TPOA 1FV9A 3GCNA 3ZVFA 1MU6B 1VITH 1YPHC 4OS2A 3SHAH 3VB3A 1FIWA 1ORFA 3EDXB 1TB6H 3PLPA 1P57B 1GGDC 4ZUHA 3TK9A 2FPZA 4K1SA 1ZHRA 3VB6A 3RC4A 2QF0A 1Y5BT 1NU9A 3RUOA 4THNH 2ZPQA 1O32A 5CMXH 2AIPA 2RDEA 5LGOA 1H8ED 1S0RA 1PPZA 1XVMA 1D3TB 4JZDH 5GCHF 1SLUB 1J14A 3KNXA 1MUEB 4INHA 3RXPA 2AEIH 3SV8A 2FOHA 1H8HD 3TIUA 1YF4A 4K1EA 1V2LT 3ATMA 1SGFG 3SV6A 5A8ZA 3OE7D 2TGTA 3ATLA 4B76A 3ATIA 1RJXB 1ETRH 1ZHMA 4YESB 1OWHA 1TOCB 1GMCF 1ZTLA 4A1XA 5L30H 1THPB 3RMOH 2RDLA 1Z8GA 2H5CA 4FVDA 4UEHH 3MTYA 1KYNA 1MAXA 1UTOA 2Z9JA 3S7KB 1FI8A 3N7DA 1A5HA 1EZXC 2FOEA 1SGQE 1GBAA 1V2VT 4FUHA 3AW0A 1EJMA 1W12U 4NIXA 4FUCA 1HB0B 1GHBF 3TJUA 1C1TA 1V2UT 9ESTA 1EAXA 3MMGA 3ZYDA 1DFPA 3DSOA 1W0KD 2BVRH 4I32A 5JBAS 3A80A 1V2NT 4UFDH 1C5RA 1G2MA 3W1EA 4CRDA 5I25A 5BPEA 1Z8IB 3KQDA 1ANBA 2QYIA 1KXAA 3QZRA 2PTNA 2BD8A 2PW8H 1MKXH 1YPEH 2HLCA 2EEKA 4B75A 4HZHA 4AORA 3LGYA 1C5ZB 1C1WH 4B73A 3AAUA 5GWZA 1LVOA 1HDTH 3DHKH 3GY8A 3BG8A 4WJG2 3BTDE 1OP8A 3DA9B 2GTBA 5GIBA 1GHZA 5CHAC 1NTPA 1FMGA 1NRQH 3KYGA 2OQ5A 1SGRE 2P94A 2Z9IA 1HGTH 2W6JD 1BTHH 1EQ9A 4KELA 1YP9A 2G5NA 2PP6A 3I78A 4Q7YA 1EOJA 5DSFA 1BTXA 2P95A 1UTPA 2EC9H 1G32B 2A2XH 1V2RT 3O8BA 1BHXB 2CN0H 2CXVA 4NFEA 1SGCA 2CV3A 2V7QD 3QTVH 3U1JB 1LHEH 1UVPA 3LIWA 7GCHF 4X1NU 1CGJE 1FIZA 3ZVDA 4E7NA 2Z9LA 2BD9A 2FI4E 3UY9A 1O31A 1IQFA 1IQEA 4O03A 2P3UB 3BTQE 2QIQA 1O2OA 4GLYA 1UK2A 5GPIB 1O3IA 1UTKA 1UVSH 3GY7A 2PKAB 3RDZA 3S9AA 4RKJB 3Q00A 3DFLA 1GBFA 3G01A 1QQUA 3RXGA 4F4OC 2EI8A 2BY8X 1GI3A 1ZTJA 2P59A 3A8BA 2ZCHP 1GMCG 1O5EH 1AI8H 1DE7H 2FMJA 1XXDA 5HYOA 2H5DA 1KMHB 4H6SB 3RLWH 2K1QA 2A7HA 4KTUA 1DPOA 4ZCNA 2XW9A 4D76A 1X7AC 4MNXA 3C27B 3U8OH 4D7FA 2BLWA 1GHBG 1N8OC 5FXLA 1AO5A 1LQEA 1G36A 2ZCKP 1AE5A 1ELGA 1QBVH 1GVZA 3SNEA 3T29A 4CR5A 4X2WA 1O2HA 4X8UH 1KXFA 1GL0E 1K1NA 3FP7E 1C4U2 1SGNE 3B9FH 5FX5A 5L2YH 2QXHA 2G81E 2G52A 2PHBA 1O2LA 1VGCC 1O2XA 1BMAA 2OXSA 4ZAEA 3PO1B 1D3QB 4NSYA 3TK6A 3ODFA 1ZZZA 4B2AA 1J17T 1Z6JH 4NWLA 3RXCA 2BQWB 1W7XH 1C1NA 1OS8A 2H9EH 3HK6B 1B0EA 3N99A 4OGYA 1AHTH 4BTUB 4NA7A 1QURH 1SBWA 3H7OA 2QN5T 2AMPA 2FYRA 1MZAA 1TNJA 1NRPH 4BAKB 1W11U 2L74A 4XBCA 5ESBA 4Y10E 3RMMH 5BRRE 2XOKD 3P8FA 3TGKE 1BJVA 3P8NA 4F55A 3T2NA 2GZ7A 4ZH8A 2IJD1 1P2MA 2XNDD 2XTTB 4UDWH 3OTJE 2VVUA 2Z3CA 1LVMA 2DE9A 3ZIAD 3LGWA 1BMNH 4X1RU 3ZVGA 1K1PA 1RTFB 1Z7KA 2ANWA 1QR3E 4ABJA 1GGDB 3SU4A 4ZHMU 1KSNA 5B6LA 4OS4A 1HLTH 2KX4A 3ZZBA 1GMDF 1B0FA 3M5LA 2FOBA 2YMSC 1O2RA 4JYUH 3W94A 2A45B 3GCTF 1AVWA 4M7GA 4UFEH 2P3TB 3A85A 1S6FA 3LU9B 3RXJA 5C3NA 2BZ6H 4CBOA 1O34A 4OS7A 2F9UA 2FI3E 2AGIX 1Q3XA 2QXGA 4O9VA 1MQ6A 3MNSA 4Q63A 3UR6A 1F0TA 2GKVE 1P2NA 1V2JT 2BQ7B 1TLDA 4IN1A 4JYVH 1HCGA 1KLIH 2VWLA 3OY6U 4IBLH 4OS6A 2HVYB 1QRXA 3BTKE 2V3HH 5FAHA 2YMSD 1C9TA 1TNGA 2BDBA 4Y8ZA 1W0ZU 3P8OA 2RCEA 4JZIA 4J1YA 2J98B 2GMTC 3M7TA 1HPGA 1MKWK 2F3CE 4IMZA 1C2FA 1L2EA 1ZRBA 1A1RA 5LPRA 5A2MH 4MNWA 1ZSLA 4A92A 1YM0A 3VEQB 2Z9KA 1FY1A 1WU1A 2G8TA 3P95A 4NG9H 2ZIQH 1QRZA 3FO8D 1GVKB 2O8UA 5HIYA 3SUDA 1IQGA 1YLCA 3U28C 2F9OA 1A0JA 3T5FH 4J2YB 2F9BH 1PPHE 2JJ2D 1RXPA 4ISIH 5F53A 4U01A 1TMBH 2XRCA 1TNHA 2A4OA 3UWJH 4Y8YA 3UPEA 1HAHH 1C4V2 3ZZ7A 4B71A 2OC7A 4FUBA 1EKBB 1D6RA 3U8RH 1YGCH 1EOLA 1DOJA 5CHAB 3A7XA 4TPIZ 1C5QA 1ZHPA 4U32A 3ZZ8A 3FN8A 4JYTA 3E0PB 1AZ8A 1CT0E 3F3BA 1AIXH 1C2LA 1RIWC 3SO3A 2Y6TA 4M9FA 1QL7A 3A7YA 1KXBA 3KGPA 4B1TA 3EYDA 3WWFA 1HAPH 5FPTA 2FESH 2G5VA 1GJ5H 4HGCA 2JKHA 4K3JA 2A7CA 1V6DA 2ZCLP 4Q7XA 2BX4A 4DURA 1RFNA 7LPRA 4MPUA 1JBUH 3PM3A 1QA7A 1GWAA 1UK3A 9LPRA 4VGCC 1AU8A 1CA0C 1TQ0B 1FQ3A 3HATH 5ABWA 2F9NA 3M5NA 1N6XA 2FI5E 2ZKSA 3BTFE 4CH2B 1SQOA 1BMFD 3EA7A 1HAIH 3SNCA 1H8DH 1GI5A 2QF4A 3KF2A 1EZUC 1W2KH 5PTPA 1FY4A 2ZFTA 2EI6A 1JRTA 1EAWA 1EPTA 1HAZB 1RTLA 2QY0B 2OBQA 2OUAA 1K9OE 2SGDE 1QL9A 3B23B 5IK2D 2D2DA 1EB2A 2BY5X 4ABIA 1OP0A 1K1LA 1DSUA 1ZPBA 3M5MA 1Z8RA 1GHXH 1CSOE 2ZTYA 1GHAG 1L1NA 2C8ZB 2AH4X 1P02A 1V2KT 2OBOA 3SI3H 2ANMH 3RXKA 1QQ4A 3URDA 1LVBA 2ZPRA 2ODPA 2XBYA 2Y7XA 4YXWD 1VGCB 5FHTA 3E8LA 3TGIE 1FN8A 4IW4E 3F2HA 1EZQA 2ZGCA 1VITF 1UTMA 4MQAA 1HAYB 4Q80A 3ZVCA 1UO6A 3URCA 3A86A 1EATA 1V3XA 1DX5M 3LT3A 3FKSD 1TPSA 5C94A 1TE0A 4ACAA 1DY8A 5AFYH 1A3BH 3U8TH 3BIVH 2OQUA 5TCAA 2R0LA 1T4UH 3KIDU 5TJXA 4FUFA 2PWXA 1L0ZA 4FUEA 1OWEA 4GVUA 1O3PB 1ANCA 3QLPH 4GUXA 1N1LA 1XX9A 1BTYA 1NFYA 4JK6A 3MO9A 4MVNA 3OY5U 4TYDA 2XCFA 1ZR0A 5GJ4B 2V6NA 2R0KA 2ZHWH 3LJOA 1KDQB 2YMSB 5EJLA 3LKWA 3TITA 3CENA 3CS7A 1QZ8A 1C9PA 2VH6A 2CF8H 3SNBA 1CT2E 3TJNA 4ZKNU 5AF9H 3M7QA 1P12E 5FBEA 3V13A 4A7IB 1M9UA 4AN7A 2NU3E 1G3DA 2A4RA 2ZHEH 3GICB 5HM2A 1G37A 1UW7A 2GCHG 3K9XB 1YLNA 3LDXH 2W6ID 2PV9B 4SGAE 1GJ6A 1JOUB 1C2MA 1GDNA 1P11E 4YZUA 1IHTH 1BUIA 1C2JA 3E1XB 3FOAA 2FTLE 3GISB 1A61H 2FZZA 2GV6A 1XM1A 5EXMA 5KEDA 4HTCH 4KP0A 1GJ7B 2K0QA 1MTSA 2GMTB 1ESTA 3MU4A 4Y8XA 2WPJS 1CBWB 3HKIB 2GZ8A 3SNDA 3QWCH 1S82A 1SGEE 1V2WT 2BD7A 2PFEA 3TNTA 3UAIC 3QN7A 1IQNA 1BMLA 1TPPA 1VITG 1P0SH 1O0DH 1P01A 2AS9A 2V35A 3VXEH 1H1BA 4X1QU 3LONA 3PO1C 4U30A 2BDCA 3GYLB 3SU5A 1L1GA 2IOTA 1P05A 3SV9A 1A46H 4WF8A 3UWIA 1P9SA 2NU4E 1H4WA 3QGJA 2Y82A 1HFDA 4Z6AH 1L4DA 1P2OA 1YPGH 1VJAU 4Q4LA 2ZFSA 3GY5A 1PQ8A 3ZZAA 5CDFE 2A5KA 3F2FA 3OYPA 1QA0A 1AB9B 3PMAB 2B8OH 3EQ0H 1MD7A 4XE4A 4GCHF 1O30A 1O2YA 2JJ1D 4D9QA 2VVCA 3I77A 3KCGH 1AWFH 1NM6A 1RIWB 1C5VA 2BQ6B 2CGAA 1THSH 1TNIA 3UB0A 1TYNA 2UWPA 3BSQA 3V7TA 1S5SA 1BBRK 1CU1A 4LXBH 1C2KA 1GVLA 2GT8A 1DICA 2I6SA 3PMHB 5KGOA 3U98H 2GVFA 1SL3A 8LPRA 2W3KA 1ABIH 4HG6A 2Z3DA 4AFSA 3GY4A 2R2MB 4D8NA 1FJSA 2LELA 2KM0A 2FM2A 2B7DH 1O2SA 1PFXC 4VGCB 3A7WA 1KTSB 3O8RA 1CA0B 1C2GA 1W0YH 1ZGIA 1UCYK 1KY9A 3BTTE 1JRSA 4DIHH 1C4Y2 1V2QT 2QGRA 4OS5A 1WUNH 3BN9A 1AGJA 1S0QA 1UVTH 5E8EH 1ZMLA 1VCWA 3RXVA 3BTEE 4BAMB 1PPFE 1S81A 3PMBB 5C1XA 1IQMA 3Q3YA 2VIVA 2ZO3H 3F6UH 5H4IB 3PWCA 1GMHG 1GHWH 1TX7A 2GGVB 1TIOA 4X1SU 5DPAA 3AK5A 1O35A 2XBXA 1EP5A 3UUZA 3CNRA 6GCHF 2BDIA 3OX7U 3SU2A 3BEIB 1A7SA 2STBE 2QF3A 3M5OA 4TY7A 1F7ZA 2TGDA 1S6LA 1WCZA 5T1VA 4NA8A 1P2KA 2J94A 1O3NA 1CT4E 2XYAA 1CVWH 2BOHB 1UMAH 5F8TA 1D3DB 1LKAA 1QIXB 3ZZ6A 2J9NA 1PYTC 1HAVA 2PKAA 2P3FH 1QHRB 4CH8B 1ZPZA 1GI9B 4AG2A 4Y71A 1XXFA 3UIRA 2JH6D 2QC2A 3RXBA 1C5YB 4XSKU 2UUFB 3NRLA 5FCKA 1H9HE 2BLVA 1BTWA 3M7UA 3MYWA 1HAOH 3A81A 1BOQA 2BX3A 1NRRH 2K8IA 4GCHG 2ASUB 1YYY1 4AB8A 3PLKA 2O8MA 1OXGA 4P02A 4Y0YE 4B6FA 2FIRH 5F03A 4WMDA 3PMJA 3CP7A 3NCLA 4B2BA 3RXSA 3RXHA 1TBQH 3A8CA 2Z9GA 1P2JA 1ELAA 3D23A 3R0FA 3P6ZB 2D8WA 1TGSZ 2GDDA 1PYTD 1RRKA 3S9BA 4NSVA 1K1IA 4INKA 4ZKSU 1TRYA 1Y5AT 3UR9A 3DT0H 1VKYA 3LH3A 5AFZH 3A82A 2BHGA 3WW7A 2M5TA 2G55A 2FXRA 5DJ7A 3UQOA 5C5OA 1NRSH 5HIZA 4O3UA 2RG3A 1BB0B 1EJAA 1OWIA 5GCHG 1TBZH 3SN8A 1Z8JB 1F5KU 1C5LH 1GCDA 3MNXA 4ABGA 1XUKA 1QB6A 3MH4A 4YTAA 1HAXB 4ACBA 1H8IH 1TQ7B 1TGTA 2WV9A 4Y76A 3FZDA 2A0QB 2ZFPH 5B6OA 4DCDA 3TH3H 2HLDD 4TT3D 1TFXA 3MNBA 3MU8A 1VR1H 2WYGA 1VCQA 1C1SA 2VWOA 1DDJA 2CHAC 5HM9A 2ZWLH 1YCPK 6GCHG 3MH7A 1QTFA 1D4PB 2TRMA 4X8SH 4IMQA 1O5BB 4X1PU 1IHSH 1VZQH 3M3VA 3M37A 1DT2A 2AERH 2FOMB 1CE5A 2ZDVH 3F68H 1OX1A 3PV5A 1EB1H 4NIWA 1MTVA 2V3MA 3BTGE 4MDSA 3D65E 1BIOA 3A7ZA 5A0AE 3V0XA 2TGAA 5EPYA 2SGPE 2SGEE 5K0HA 1OYQA 4B2CA 4BAOB 2ZC9H 1AMHA 2VU8E 5I46H 2KR7A 1SGIB 4FUGA 5A8XA 1DITH 2WINI 3SOSA 1DY9A 2J95A 4IC5A 1T8NA 2FP7B 1SGFA 4X8VH 2AMQA 4I8GA 2UUYA 8GCHF 2HRVA 1QGFA 1O2ZA 1AWHB 1COWD 2AYWA 3F1SB 5DP7A 3PB1E 4Y7AA 3LGVA 3SUGA 1NFUA 1IQIA 4R0IA 4BAQB 1G2LA 4IC6A 2ZF0H 1D3PB 5FL7D 2ALPA 2C4FH 2GT7A 2AGGX 4FUDA 4BNRA 4Y6DA 1MU8B 2OCVB 4Y79A 5DP6A 3U69H 1AD8H 4NWKA 3RXUA 2J98A 3RXOA 3NUMA 3SW2B 2LNCA 1PPCE 1HNEE 2P16A 1CQQA 3ZYEA 4WWYA 5EU8A 2H6MA 7GCHG 2B9LA 2ODQA 1XKAC 2J4IA 1A3EH 2RA0A 3ZV8A 1KLTA 5HKKD 3QTOH 3RMLH 1UTQA 2PUQH 5G4BA 2XBWA 6LPRA 4FU9A 4X2XA 2KCYA 1OHHD 3A88A 2VB0A 3KQBA 5DG6A 3A87A 1E34B 5E0HA 1YLDA 1K1OA 3TVJB 2ZU2A 4ABHA 1O38A 3ZZCA 4FVBA 5E2PA 4BOHA 4NFFA 1E35B 1MABB 1LDTT 1A4WH 1DS2E 5C67A 3GCOA 2Y5HA 1FDPA 2ZQ2A 3FAOA 2FOFA 2W7UA 3MU0A 1JMOH 3VPKA 1O3GA 2BD3A 1OYTH 4ABDA 2BYAX 1WDIA 2Y5GA 3HK3B 3EA8A 4JZEH 1SHYA 1FLEE 1IOEA 1DWEH 4F48B 1ZGVA 2Z94A 1ACBE 2A32A 1FPHH 3KL6A 1LO6A 3BG4B 5EJZA 3FZZA 4ZXYH 2VJ1A 1TRMA 1Y3UA 2GCTB 2SGAA 2FYQA 1CBWC 3SU3A 1W10U 2R3YA 2WZQA 2YNBA 4GHQA 4DG4A 4XDEA 1O2NA 2B5TB 2ANKH 2C8YB 4E06H 2A2QH 2WV5A 1JXPA 4IN2A 1T8LA 3OFND 1JWTA 4YLUA 4YOGA 4B74A 1O2PA 1AZZA 3RM2H 1MQ5A 2BLQA 5K7RA 4I86A 3MWIU 1C1QA 2I6QA 4AYYB 5GXPA 1QJ7B 4QT8C 5DN6D 2CK3D 1YPMH 4Q7ZA 1O5AB 3LC5A 3VB4A 4A5TS 2PSXA 3SZEA 3M36A 2RFKC 5DP5A 1SGDE 2ZFRH 2ZU4A 3H7TA 3SQHE 2GV7A 4TWYA 1SFQB 2F9VA 1T7CA 5EPNA 5FX6A 1AB9C 1F5LA 1P10A 3ELAH 5JBCS 1CA8B 1LQDB 1RS0A 1AE8H 3CS0A 2BDAA 1MKWH 4XD7D 4BTIB 3QO6A 3OSYA 3PTBA 3T62A 5EOKA 5EXLA 1IQHA 1LHDH 2ESTE 5GNDA 1C2HA 1ELDE 1GBMA 1GMDG 1E36B 5AHGH 5C0TA 2L6OA 1KIGH 3AW1A 4ABAA 2F91A 3GCTG 1BRAA 1C5PA 1QJ6B 2BD4A 4UFFH 1IAUA 5FPYA 1WSSH 2UWOA 3MH6A 2HALA 2BY6X 1LHGH 1W3CA 1SOZA 3BEFB 1DWCH 3V3MA 2ZI2H 3A8DA 1Y5UT 1C1UH 1TMUH 1FAXA 1TPAE 3K2UA 5JBBS 1E38B 1EFRD 3ZZ9A 2Q6DA 2VBCA 2FDAA 3NKKA 1T8OA 4OGXA 1S6HA 3ITIA 2OLGA 1FXYA 2OTVA 1O3OA 3A7TA 3F0OA 1CHOF 2CHAB 3OEED 4CRFA 2KAIB 4E7RG 3A8AA 3QDZB 4ABEA 2ZECA 5A0BA 3FP8E 4R8TB 2H9TH 3GOVB 2GJGA 3OU0A 4AGKA 3MNCA 3PRBA 1GI4A 1YCPM 2ZNKH 1HRTH 2XWAA 1UVOA 1KDQA 2WPHS 4DOQA 1UTNA 2R2WU 3BTME 2HNTF 2VGCB 1Y8TA 1SSXA 1G9IE 4AZ2B 1AFEH 2GX4A 1NPMA 2HNTE 2VIPA 1P09A 2A5AA 2O9QA 1E1RD 1FN6A 1WQSA 3MU1A 5EW1H 1ABJH 1YPKH 7ESTE 4RN6A 4FOUC 3BTWE 3W95A 4RSPA 3ZVEA 3RXMA 3TJOA 3LJJA 1HJ8A 4NZQA 4XBDA 1TAWA 3RU4E 3D49H 4BAHB 5J4SA 1BZXE 1NROH 4WVPE 1GJDB 1V2PT 3A89A 1Z1JA 2HWLB 1E79D 3K65B 4JK5A 3QGNB 2VWMA 2W7SA 3PYHA 1SGYE 4KKDA 3ODDA 4JMYA 4WH6A 5IYTA 3RXLA 3RXDA 4I8KA 5DP4A 1GBIA 5T3HA 3B8JA 2BB4A 3GCHB 4JZ1A 3H5CB 2THFB 2OD3B 2D1JA 3TK5A 1Y3YA 1BT7A 3QUMP 4NGAH 1TX8A 4Y11E 1O33A 1YC0A 2W5EA 5JDUB 3UQVA 1GI7B 1MTNC 1F2SE 1S84A 4AB9A 1K28D 1NY22 3KHVA 3S0NA 4WXIA 1OPHB 3MI4A 1HIAA 1O3BA 4X8TH 1JIMA 1O3DA 5DGJA 5E2OA 2VIOA 4XFQA 2KFWA 4ZKRU 2UWLA 3FANA 1K1JA 2JH0D 1ANEA 1BBRE 1NZQH 3RXRA 4CRGA 2PKSC 3NXPA 2OK5A 1Y3VA 3RU4T 2XWBI 1CHOG 2FWWA 3EE7A 1YWUA 3E6PH 1DLKB 2QA9E 1P2QA 2D26C 2P8OB 4HFPB 4DVAU 3SBKA 1MAYA 3MO3A 4ZHAA 4AOQA 3QX5H 1ANDA 1ETTH 2TGPZ 2ZHDA 5C1UA 2HNTC 3NZIA 1UCYE 1W8BH 3WWBA 4Y7BA 3U9AH 4LOYH 1LPKB 4MPVA 1SLWB 3ATWA 1Q31A 2G4UA 1ZTKA 3R3GB 3GDSA 1BDAA 1Z6EA 5CHBA 2CJIA 5EQQA 2HOBA 1NU7B 3M3TA 3AASA 5HXFA 3SU6A 4Q2KA 3VFEA 2O8WA 1A5IA 1YBWA 2PGBB 1TNKA 5EW2H 3DD2H 1INCA 1QL8A 4LZ4B 5EGMA 1VJ9U 2BMGB 2EY4C 5LH8A 4ISLA 2V0BA 2ZGHA 4BXSA 3MHWU 5C2ZA 1J9CH 3I29A 2C90B 1O37A 3T26A 2SNVA 1PPBH 1RD3B 4BXWA 3N7OA 1C5OH 1YPJH 1GI2A 3GDUA 3ZZ4A 1O5CB 1W0JD 2RA3A 3AAVA 2H1UA 1C1RA 1UVUH 3RXTA 5ESTE 4MTBA 1SHHB 3RU4D 2QXJA 2J92A 3HGPA 1ELVA 2ZDKA 3F0PA 5EXNA 3M35A 1XUHA 4HI3A 4AG1A 1FY8E 5C5NA 1TABE 1XUGA 1DUEA 2ZDLA 1YPLH 3VB5A 1UHBB 1O3FA 2H9HA 3RXEA 2GZ9A 3SGQE 1NFXA 2F83A 2NU2E 1FNIA 1BMMH 3RM0H 2H2ZA 1HV7A 3RC6A 6CHAB 1ZSKA 4ZXXH 4AFQA 1O5DH 2BD5A 1O2TA 1J16A 4CR9A 3L3TA 1GJ9B 1P03A 5FBIA 1AY6H 1P04A 1NRNH 1MBMA 4X6NA 1SPJA 1KLJH 1SC8U 2O8LA 4TY6A 2ZU3A 2C3SA 1RTKA 2VIDA 1GG6C 3MO6A 1FX0B 3EE0B 1DSTA 5LPEA 1ARBA 4A1VA 1FY5A 1V2OT 3SYJA 6ESTA 2KZ4A 4IS5A 1LPZB 4ISHH 1FAKH 2SGFE 3TJVA 2J34A 3GY3A 4NZLA 5J4QA 1LHCH 1F5RA 3RMNH 2FO9A 2XC4A 2A5IA 1O39A 1J15A 1ZJDA 2FOAA 2ZPSA 1BBRH 1BTUA 8KME2 3SV7A 2Z7FE 1HUTH 1HXEH 2NWNA 1GPZA 3VGCC 8ESTE 1XUJA 1Z1IA 3BG4C 1SB1H 2VH0A 3UNRA 2SGQE 3RXFA 1DWBH 1AKSB 1O2MA 4MNYA 5E0JA 3VXFH 2GCTC 2ZFFH 2LPRA 5T6GA 2OINA 3ZZ3A 1MKXK 1SLXB 2FS8A 1O3AA 1CGIE 1EASA 1C5NH 1ZSJA 5JB8S 5L6NH 1P06A 1Y3WA 4ABBA 1UCYH 4DT7B 2BOKA 3ENSB 2BXUH 4WMEA 2SFAA 3M3SA 3UOPA 3PTNA 1BJUA 3DCLA 4K69A 3MOCA 1J8AA 1ELBA 1L4ZA 1S85A 2QXIA 5T6DA 3T25A 1KTTB 1OSSA 3OAAD 1EZSC 2Y80A 1V2TT 4AGJA 1LVYA 1NBME 5EJ1A 3C1KA 4DJZB 2ULLA 2AHME 3H09A 2FLRH 3MFJA 1TX6A 1EX3A 3WY8A 4LK4A 4BANB 1K0HA 1EP6A 1NFWA 2ZEBA 1O3KA 4RKOB 1EUFA 1T31A 1C1VH 5EIYA 1HYLA 2VIQA 1MD8A 1SQTA 4MPXA 2GP9B 2G00A 2ZZUH 5C1YA 1DXPA 3RXQA 1P2IA 1MTNB 2Q1JA 1O3MA 2BVSH 1AUTC 2JETB 4Z0KA
chains in the Genus database with same CATH topology
2WHXA 3N7EA 2A4GA 3DSOA 1W0KD 3GS9A 5H4IB 2OC0A 4I32A 5IDKA 2OK5A 2GGVB 3FOAA 5ETXA 1A1RA 2QE7D 2J5UA 3U1IB 3AK5A 3W1EA 5C0UA 2YOLA 3M5MA 2IJOB 2K0QA 3F0OA 3PRDA 4A92A 3OEED 3SU2A 2OBOA 2XCNA 1FX0B 3M5OA 4NWLA 3DSPA 3SU0A 2FOMB 2XNIA 4A1VA 4WH8A 1S6LA 3FO8D 1WXRA 2F43B 3PV5A 3N99A 3SUDA 5T1VA 4I31A 3SYJA 4B6EA 4B75A 4R8TB 4YXWD 2KZ4A 4Z1MD 5C17A 5IK2D 4B73A 3WWBA 3SUEA 2JJ2D 3F2HA 4K8BA 3PRBA 5EPYA 5F53A 4FETA 2KCAA 4U01A 2F4LA 3OEHD 3LONA 5ESBA 2KR7A 3E90B 4B71A 3SU3A 2M2AA 2OC7A 2XOKD 1DY9A 3P8NA 3SU5A 2WZQA 3SUFA 5CHBA 4F55A 2W6JD 5EQQA 3SV7A 2FP7B 3FKSD 4TSFD 3SV9A 4WF8A 2IJD1 3SU6A 2QF5A 2XNDD 3NRLA 5DSFA 4B74A 1JXPA 1DY8A 3OFND 1E1RD 3O8BA 4Q4LA 3FN8A 1COWD 3ZIAD 5CDFE 2QV1A 3L6PA 2K8IA 2OINA 3F2FA 3F3BA 3OYPA 3SUGA 2V7QD 1E1QD 4M9FA 3RC4A 2O8MA 4B6FA 2CK3D 5DN6D 3U1JB 3F2GA 3RC5A 3EYDA 2JJ1D 3WWFA 3SU4A 5FL7D 5FPTA 4RI0A 5B6LA 1N1LA 5EQRA 1H8ED 3SZEA 3LOXA 3OTPA 3M5LA 3KNXA 2YMSC 4NWKA 3UB0A 1W0JD 2JIZD 3DCLA 4ASUD 5EPNA 2F9VA 5GPIB 1CU1A 3O8DA 4TYDA 1E79D 3SV8A 3OAAD 2XCFA 3KN2A 2WSSD 5GJ4B 2OC1A 1H8HD 2GVFA 4A1TA 4JMYA 2YMSB 4KTCA 1NBME 4WH6A 3VG8A 2A4QA 3LKWA 3SV6A 3WW7A 3OE7D 4XD7D 2AHME 2F9UA 2LELA 3H09A 4I33A 2KM0A 2FM2A 2P59A 4B76A 4DT4A 3O8CA 1RGQA 3F0PA 5GNDA 3M5NA 5HKKD 1BT7A 5C0TA 3O8RA 3PV2A 1KMHB 2L6OA 2WPDD 2K1QA 1NS3A 1DXWA 1BMFD 4A1XA 4Q63A 1SKYE 2KCYA 3KEEA 1OHHD 4ZCNA 3SU1A 2QF4A 5FPYA 3KF2A 1NBMD 3N7DA 1DXPA 1W3CA 2WV9A 2A4RA 1MABB 2HLDD 1RTLA 2KCOA 4TT3D 2JDID 2KCPA 5FPSA 3RC6A 2OBQA 2YMSD 2OC8A 2W6ID 1EFRD 5EQSA 2VBCA 3P8OA 2KFWA 4OM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F53 A;  5CHB A;  3WWF A;  3WW7 A;  4ZCN A;  3WWB A; 
#chains in the Genus database with same CATH topology
 1LPG B;  3N7E A;  2A4G A;  5KEC A;  1HJA B;  1GJ8 B;  2BLO A;  1UTL M;  1O3L A;  1PJP A;  5EG4 A;  3KYF A;  3SJK A;  2FOG A;  1SVP A;  1GI1 A;  2J5U A;  4FXG H;  5EOD A;  1TOM H;  2GD4 B;  2W3I A;  1ZYO A;  1TWX B;  1HJ9 A;  2TPI Z;  1MTU A;  4CRE A;  4MNV A;  2OP9 A;  4H42 U;  2PKS B;  2PSY A;  5JYI A;  4I8J A;  1XKB C;  1IQK A;  1DUA A;  1O2W A;  2EI7 A;  2ODY B;  1GHY H;  3KQ5 A;  1T32 A;  4DW2 U;  1KXE A;  1NN6 A;  2WV4 A;  2WUC A;  4CHA B;  2IPQ X;  3RXA A;  5TCC A;  1A5G H;  3RP2 A;  2BVX H;  4K8B A;  4X0W U;  4FET A;  2KCA A;  4X6P A;  1AVX A;  1N6Y A;  2ZG0 H;  3GY6 A;  3K6Z A;  3SHC H;  1ELE E;  1PPG E;  1WV7 H;  2BY9 X;  4ZRO A;  2FX6 A;  1BTZ A;  1AFQ C;  1GJA B;  1K2I 1;  1SMF E;  1HAV B;  1ELF A;  1A2C H;  1SI5 H;  1A0H B;  4K2Y A;  4O3T A;  2ALV A;  1CO7 E;  1F0U A;  1Q2W A;  1XVO A;  2FEQ H;  2VGC C;  4X6O A;  3E91 A;  5DO4 H;  1SQR A;  1MCV A;  2ZGX H;  5EQR A;  5AVD A;  3ZVA A;  2BXT H;  5DP9 A;  5F8Z A;  1ZOM A;  3T27 A;  1EAI A;  4D7G A;  2TIO A;  4OS1 A;  2P93 A;  4U2W A;  4AX9 H;  1C1P A;  3LH1 A;  2VWN A;  2CMY A;  5SGA E;  2ANY A;  1HXF H;  3F9E A;  3P8G A;  5L2Z H;  3STJ A;  1BA8 B;  1GJ4 H;  2VIW A;  4KTC A;  1ZRK A;  2IN2 A;  2VVV A;  3LGT A;  1O3E A;  1YCP H;  4FU8 A;  2NU0 E;  1TNL A;  1BCU H;  1LTO A;  3A83 A;  3T28 A;  3ZZD A;  2AFQ B;  3FP6 E;  1AUJ A;  1QB9 A;  1MCT A;  3PV4 A;  1QB1 A;  4UON A;  4FUJ A;  4H6T A;  2WPD D;  1XMN B;  1NS3 A;  1DAN H;  1SKY E;  3KEE A;  4X6M A;  1NBM D;  3TU7 H;  1W14 U;  1SQA A;  2BM2 A;  3F9H A;  1T4V H;  4K1T A;  1TGC A;  3P92 A;  3SJO A;  3GCH C;  3QZQ A;  2KCO A;  3BIU H;  3E16 B;  4RT1 A;  2KCP A;  2STA E;  1GCT B;  4H4F A;  1K22 H;  3SI4 H;  1S83 A;  2JH5 D;  4I8H A;  1P8V C;  3GS9 A;  2C8X B;  2PTC E;  3RXI A;  2G4T A;  4AFZ A;  4CRC A;  1DVA H;  1F92 A;  1NO9 H;  1PPE E;  4ZHL U;  5C0U A;  1HAG E;  2HGT H;  3DUX H;  2IJO B;  3STI A;  1WOF A;  2XC5 A;  2J38 A;  1O2V A;  3PRD A;  1MBQ A;  1WBG B;  1IQJ A;  4BTT B;  3SJI A;  3TNS A;  2ZA5 A;  3UTU H;  2V3O H;  4WH8 A;  4MLF B;  1QCP A;  2HPQ H;  1XUI A;  4Z1M D;  1EPT C;  1BQY A;  1GG6 B;  1UTJ A;  5HGG A;  4RT0 A;  1ESB A;  1TAL A;  2F4L A;  3MQK C;  2P8O C;  1P3C A;  2Y7Z A;  2WYJ A;  2BTC E;  1G3E A;  1DWD H;  1BTP A;  3F9F A;  1QBO A;  1SOT A;  1AQ7 A;  4K5Z A;  2J2U A;  1V2M T;  2IPH A;  2O8T A;  3ZZ5 A;  1OWK A;  3FFG A;  3FVF B;  1QY6 A;  5HMA A;  5A0C A;  2BZA A;  5DKM A;  1C1O A;  1OP2 A;  2QV1 A;  4TWW A;  1ESA A;  3VGC B;  1C5M D;  1L1J A;  3RC5 A;  1AN1 E;  4WY3 A;  2XXL A;  4RI0 A;  2GDE H;  1FY3 A;  1QJ1 B;  4X2V A;  3OTP A;  1JIR A;  1UK4 A;  2ZHF H;  8GCH G;  2J97 A;  2JIZ D;  1C5W B;  4O97 A;  4ASU D;  1GDQ A;  2PUX B;  3HKJ B;  4YT6 H;  3AVZ A;  1VCP A;  1LKB A;  3KN2 A;  1GI6 A;  4A1T A;  2NU1 E;  1GBD A;  1QFK H;  3LGI A;  2AMD A;  1WYK A;  3E0N B;  1F0S A;  4F49 A;  2KAI A;  1Z71 A;  1RGQ A;  2HPP H;  1GBJ A;  1W13 U;  2Y5F A;  5E0G A;  2Q6G A;  5DK1 A;  1O2Q A;  1W7G H;  1TA6 A;  4ABF A;  1P9U A;  3UNS A;  3URE A;  3SU1 A;  3IG6 B;  1GBH A;  4YT7 H;  3P70 B;  4X2Y A;  1GI0 A;  1O2K A;  1G3B A;  2XBV A;  3LGU A;  1GHA F;  3TGJ E;  1GI8 B;  2OC8 A;  4ISO A;  3TLO A;  5EQS A;  2ZGJ A;  4XBB A;  1NT1 A;  3Q3X A;  1F0R A;  4K60 A;  1ZMN A;  1K21 H;  1P3E A;  1TON A;  1U6Q A;  1ZPC A;  1PQ5 A;  2QE7 D;  2BDG A;  3P17 H;  2YOL A;  1QRW A;  1XUF A;  4XOJ A;  2BDY A;  1MZD A;  4NIV A;  6CHA C;  1C2D A;  3Q3K A;  1E37 B;  4ZKO U;  3DFJ A;  1THR H;  1ZLR A;  1HBT H;  2A7J A;  1WXR A;  4B6E A;  5C17 A;  3HGN A;  4FUI A;  3JZ1 B;  4INL A;  2ZTZ A;  1WAY B;  1C5X B;  1O2G H;  2FS9 A;  1UJ1 A;  5A8Y A;  3NPS A;  1ZMJ A;  3E90 B;  1ZJK A;  2ZP0 H;  1YY3 A;  1GDU A;  3MU5 A;  3A84 A;  7KME H;  4AFU A;  2DUC A;  1GJB B;  4MPW A;  4Y0Z E;  2VNT A;  1CHG A;  3ZVB A;  1OOK B;  3L33 A;  4IGD A;  1GJC B;  3TPI Z;  3L6P A;  1BHX F;  4KTS A;  1O3J A;  1GBC A;  4UD9 H;  1E1Q D;  1AFQ B;  1C5T A;  3F2G A;  2A1D B;  1EXF A;  3GDV A;  1EJN A;  2R3U A;  2A31 A;  4AYV B;  1TBR H;  1FON A;  1ID5 H;  1SGT A;  4KGA A;  2R9P A;  2FLB H;  3VB7 A;  1PQA A;  3O8D A;  3S69 A;  1IQL A;  1WTH D;  5F8X A;  1DM4 B;  4PRO A;  1GBB A;  4YM9 A;  1TGB A;  3E3T A;  2ZFQ H;  1CGH A;  1EAU A;  1AVG H;  2XC0 A;  2ZHQ H;  2A4Q A;  2ILN A;  3VG8 A;  4GAW A;  4CRB A;  1V2S T;  4MG3 A;  2TBS A;  1TA2 A;  3UFA A;  2BDH A;  2GCH F;  3BF6 H;  4NCY A;  3EGK H;  1N8O B;  3O8C A;  2C93 B;  2AIQ A;  2FX4 A;  1ELT A;  1GBE A;  1C2I A;  2ZDA H;  3IWM A;  5LPF A;  3SGB E;  3M61 U;  1PQ7 A;  2UUK B;  3SOR A;  1O5F H;  2FOC A;  1A0L A;  3PRO A;  2EQN A;  4A6L A;  5F6M A;  3UNQ A;  3SZN A;  3RLY H;  4YO9 A;  2JDI D;  5FPS A;  3MH5 A;  1H9L B;  1O5G H;  5ETX A;  2QCY A;  1G30 B;  4WXV A;  1BRB E;  4FU7 A;  4TPY A;  2OC0 A;  3EAJ A;  4D9R A;  1O36 A;  3LC3 A;  2BY7 X;  4DY7 B;  5C20 A;  1KXC A;  1LCY A;  3KQE A;  3LPR A;  3BV9 B;  1YKT A;  1C5S A;  2PR3 A;  2WPK S;  1H9I E;  3IIT A;  4P00 A;  2JET C;  2AGE X;  3S7H B;  1QBN A;  1FPC H;  1SG8 B;  1HJA C;  1GHV H;  1C2E A;  1Y59 T;  4SGB E;  2Y81 A;  2WPI S;  4ASH A;  3GY2 A;  1WTG H;  1MTW A;  1LMW B;  3GYM A;  3V12 A;  2BD2 A;  2DE8 A;  2CF9 H;  4GPG A;  1ELC A;  4LZ1 H;  1EPT B;  4ZMA H;  2M2A A;  1O3H A;  1SLV B;  3SGA E;  1ETS H;  3EST A;  3SUF A;  4NA9 H;  4TSF D;  4UFG H;  1TGN A;  4JCN A;  3QK1 A;  4CHA C;  1BRC E;  1TRN A;  2QF5 A;  3PWB A;  5DP8 A;  3SJ8 A;  2ZGB H;  2B0F A;  4AC9 A;  2EA3 A;  1FUJ A;  1D6W A;  1D9I A;  4GSO A;  3KQC A;  1UHB A;  3ATK A;  4CRA A;  2WPL S;  3UOU A;  2ZDN A;  3HPT B;  3PLB A;  2W26 A;  2ZTX A;  4UE7 H;  3SNA A;  4WMF A;  1O3C A;  1WQV H;  1YPH E;  1T8M A;  5T6F A;  3DSG A;  3LOX A;  2F9P A;  1QNJ A;  5FCR A;  1GL1 A;  1GBL A;  1O2U A;  2LP6 A;  1OWJ A;  1B5G H;  1FZZ A;  1K1M A;  4CBN A;  1KXD A;  2WSS D;  4NIY A;  1NC6 A;  2OC1 A;  3A7V A;  2C8W B;  4YOJ A;  1GBT A;  3SV2 H;  5JPM H;  4DGJ A;  2WUB A;  1BIT A;  2WPM S;  1O2J A;  2Z3E A;  2YNA A;  4I33 A;  2ZDM A;  3EA9 A;  1O2I A;  2FTM A;  2G51 A;  4YLQ H;  4DT4 A;  1SR5 C;  2ZU5 A;  1B7X B;  1GMH F;  4E05 H;  3PV2 A;  1DLE A;  1DXW A;  1NES E;  2UUJ B;  3NWU A;  5JBT A;  2SNW A;  2FOD A;  4XRN A;  2VIN A;  3NK8 A;  4ISN A;  3BEU A;  2HVX A;  3SJ9 A;  4YOI A;  1ARC A;  1TMT H;  3TH4 H;  4JZF H;  1LHF H;  2QAA A;  3F9G A;  4OM9 A;  4I7Y H;  2WHX A;  4GHT A;  2Q6F A;  1SGP E;  1MMJ N;  1AKS A;  5IDK A;  1HIA B;  1Y3X A;  1GBK A;  3U1I B;  2PLX A;  3S9C A;  1E0F D;  4EST E;  1GCT C;  3Q77 A;  1C1M A;  2XCN A;  3TH2 H;  4K8Y A;  3SU0 A;  3DSP A;  1OKX A;  2XNI A;  3ZV9 A;  5A09 A;  5JB9 S;  3SQE E;  2F43 B;  2PGQ B;  1C5U A;  3BTH E;  4I31 A;  4DII H;  1G3C A;  1SFI A;  5GDS H;  3SUE A;  3K6Y A;  3JZ2 B;  1MH0 A;  1OWD A;  3D62 A;  2ZU1 A;  3OEH D;  2ZQ1 A;  1BRU P;  5CE1 A;  3Q76 A;  2Z6B D;  4I8L A;  5DP3 A;  1TPO A;  1FV9 A;  3GCN A;  3ZVF A;  1MU6 B;  1VIT H;  1YPH C;  4OS2 A;  3SHA H;  3VB3 A;  1FIW A;  1ORF A;  3EDX B;  1TB6 H;  3PLP A;  1P57 B;  1GGD C;  4ZUH A;  3TK9 A;  2FPZ A;  4K1S A;  1ZHR A;  3VB6 A;  3RC4 A;  2QF0 A;  1Y5B T;  1NU9 A;  3RUO A;  4THN H;  2ZPQ A;  1O32 A;  5CMX H;  2AIP A;  2RDE A;  5LGO A;  1H8E D;  1S0R A;  1PPZ A;  1XVM A;  1D3T B;  4JZD H;  5GCH F;  1SLU B;  1J14 A;  3KNX A;  1MUE B;  4INH A;  3RXP A;  2AEI H;  3SV8 A;  2FOH A;  1H8H D;  3TIU A;  1YF4 A;  4K1E A;  1V2L T;  3ATM A;  1SGF G;  3SV6 A;  5A8Z A;  3OE7 D;  2TGT A;  3ATL A;  4B76 A;  3ATI A;  1RJX B;  1ETR H;  1ZHM A;  4YES B;  1OWH A;  1TOC B;  1GMC F;  1ZTL A;  4A1X A;  5L30 H;  1THP B;  3RMO H;  2RDL A;  1Z8G A;  2H5C A;  4FVD A;  4UEH H;  3MTY A;  1KYN A;  1MAX A;  1UTO A;  2Z9J A;  3S7K B;  1FI8 A;  3N7D A;  1A5H A;  1EZX C;  2FOE A;  1SGQ E;  1GBA A;  1V2V T;  4FUH A;  3AW0 A;  1EJM A;  1W12 U;  4NIX A;  4FUC A;  1HB0 B;  1GHB F;  3TJU A;  1C1T A;  1V2U T;  9EST A;  1EAX A;  3MMG A;  3ZYD A;  1DFP A;  3DSO A;  1W0K D;  2BVR H;  4I32 A;  5JBA S;  3A80 A;  1V2N T;  4UFD H;  1C5R A;  1G2M A;  3W1E A;  4CRD A;  5I25 A;  5BPE A;  1Z8I B;  3KQD A;  1ANB A;  2QYI A;  1KXA A;  3QZR A;  2PTN A;  2BD8 A;  2PW8 H;  1MKX H;  1YPE H;  2HLC A;  2EEK A;  4B75 A;  4HZH A;  4AOR A;  3LGY A;  1C5Z B;  1C1W H;  4B73 A;  3AAU A;  5GWZ A;  1LVO A;  1HDT H;  3DHK H;  3GY8 A;  3BG8 A;  4WJG 2;  3BTD E;  1OP8 A;  3DA9 B;  2GTB A;  5GIB A;  1GHZ A;  5CHA C;  1NTP A;  1FMG A;  1NRQ H;  3KYG A;  2OQ5 A;  1SGR E;  2P94 A;  2Z9I A;  1HGT H;  2W6J D;  1BTH H;  1EQ9 A;  4KEL A;  1YP9 A;  2G5N A;  2PP6 A;  3I78 A;  4Q7Y A;  1EOJ A;  5DSF A;  1BTX A;  2P95 A;  1UTP A;  2EC9 H;  1G32 B;  2A2X H;  1V2R T;  3O8B A;  1BHX B;  2CN0 H;  2CXV A;  4NFE A;  1SGC A;  2CV3 A;  2V7Q D;  3QTV H;  3U1J B;  1LHE H;  1UVP A;  3LIW A;  7GCH F;  4X1N U;  1CGJ E;  1FIZ A;  3ZVD A;  4E7N A;  2Z9L A;  2BD9 A;  2FI4 E;  3UY9 A;  1O31 A;  1IQF A;  1IQE A;  4O03 A;  2P3U B;  3BTQ E;  2QIQ A;  1O2O A;  4GLY A;  1UK2 A;  5GPI B;  1O3I A;  1UTK A;  1UVS H;  3GY7 A;  2PKA B;  3RDZ A;  3S9A A;  4RKJ B;  3Q00 A;  3DFL A;  1GBF A;  3G01 A;  1QQU A;  3RXG A;  4F4O C;  2EI8 A;  2BY8 X;  1GI3 A;  1ZTJ A;  2P59 A;  3A8B A;  2ZCH P;  1GMC G;  1O5E H;  1AI8 H;  1DE7 H;  2FMJ A;  1XXD A;  5HYO A;  2H5D A;  1KMH B;  4H6S B;  3RLW H;  2K1Q A;  2A7H A;  4KTU A;  1DPO A;  4ZCN A;  2XW9 A;  4D76 A;  1X7A C;  4MNX A;  3C27 B;  3U8O H;  4D7F A;  2BLW A;  1GHB G;  1N8O C;  5FXL A;  1AO5 A;  1LQE A;  1G36 A;  2ZCK P;  1AE5 A;  1ELG A;  1QBV H;  1GVZ A;  3SNE A;  3T29 A;  4CR5 A;  4X2W A;  1O2H A;  4X8U H;  1KXF A;  1GL0 E;  1K1N A;  3FP7 E;  1C4U 2;  1SGN E;  3B9F H;  5FX5 A;  5L2Y H;  2QXH A;  2G81 E;  2G52 A;  2PHB A;  1O2L A;  1VGC C;  1O2X A;  1BMA A;  2OXS A;  4ZAE A;  3PO1 B;  1D3Q B;  4NSY A;  3TK6 A;  3ODF A;  1ZZZ A;  4B2A A;  1J17 T;  1Z6J H;  4NWL A;  3RXC A;  2BQW B;  1W7X H;  1C1N A;  1OS8 A;  2H9E H;  3HK6 B;  1B0E A;  3N99 A;  4OGY A;  1AHT H;  4BTU B;  4NA7 A;  1QUR H;  1SBW A;  3H7O A;  2QN5 T;  2AMP A;  2FYR A;  1MZA A;  1TNJ A;  1NRP H;  4BAK B;  1W11 U;  2L74 A;  4XBC A;  5ESB A;  4Y10 E;  3RMM H;  5BRR E;  2XOK D;  3P8F A;  3TGK E;  1BJV A;  3P8N A;  4F55 A;  3T2N A;  2GZ7 A;  4ZH8 A;  2IJD 1;  1P2M A;  2XND D;  2XTT B;  4UDW H;  3OTJ E;  2VVU A;  2Z3C A;  1LVM A;  2DE9 A;  3ZIA D;  3LGW A;  1BMN H;  4X1R U;  3ZVG A;  1K1P A;  1RTF B;  1Z7K A;  2ANW A;  1QR3 E;  4ABJ A;  1GGD B;  3SU4 A;  4ZHM U;  1KSN A;  5B6L A;  4OS4 A;  1HLT H;  2KX4 A;  3ZZB A;  1GMD F;  1B0F A;  3M5L A;  2FOB A;  2YMS C;  1O2R A;  4JYU H;  3W94 A;  2A45 B;  3GCT F;  1AVW A;  4M7G A;  4UFE H;  2P3T B;  3A85 A;  1S6F A;  3LU9 B;  3RXJ A;  5C3N A;  2BZ6 H;  4CBO A;  1O34 A;  4OS7 A;  2F9U A;  2FI3 E;  2AGI X;  1Q3X A;  2QXG A;  4O9V A;  1MQ6 A;  3MNS A;  4Q63 A;  3UR6 A;  1F0T A;  2GKV E;  1P2N A;  1V2J T;  2BQ7 B;  1TLD A;  4IN1 A;  4JYV H;  1HCG A;  1KLI H;  2VWL A;  3OY6 U;  4IBL H;  4OS6 A;  2HVY B;  1QRX A;  3BTK E;  2V3H H;  5FAH A;  2YMS D;  1C9T A;  1TNG A;  2BDB A;  4Y8Z A;  1W0Z U;  3P8O A;  2RCE A;  4JZI A;  4J1Y A;  2J98 B;  2GMT C;  3M7T A;  1HPG A;  1MKW K;  2F3C E;  4IMZ A;  1C2F A;  1L2E A;  1ZRB A;  1A1R A;  5LPR A;  5A2M H;  4MNW A;  1ZSL A;  4A92 A;  1YM0 A;  3VEQ B;  2Z9K A;  1FY1 A;  1WU1 A;  2G8T A;  3P95 A;  4NG9 H;  2ZIQ H;  1QRZ A;  3FO8 D;  1GVK B;  2O8U A;  5HIY A;  3SUD A;  1IQG A;  1YLC A;  3U28 C;  2F9O A;  1A0J A;  3T5F H;  4J2Y B;  2F9B H;  1PPH E;  2JJ2 D;  1RXP A;  4ISI H;  5F53 A;  4U01 A;  1TMB H;  2XRC A;  1TNH A;  2A4O A;  3UWJ H;  4Y8Y A;  3UPE A;  1HAH H;  1C4V 2;  3ZZ7 A;  4B71 A;  2OC7 A;  4FUB A;  1EKB B;  1D6R A;  3U8R H;  1YGC H;  1EOL A;  1DOJ A;  5CHA B;  3A7X A;  4TPI Z;  1C5Q A;  1ZHP A;  4U32 A;  3ZZ8 A;  3FN8 A;  4JYT A;  3E0P B;  1AZ8 A;  1CT0 E;  3F3B A;  1AIX H;  1C2L A;  1RIW C;  3SO3 A;  2Y6T A;  4M9F A;  1QL7 A;  3A7Y A;  1KXB A;  3KGP A;  4B1T A;  3EYD A;  3WWF A;  1HAP H;  5FPT A;  2FES H;  2G5V A;  1GJ5 H;  4HGC A;  2JKH A;  4K3J A;  2A7C A;  1V6D A;  2ZCL P;  4Q7X A;  2BX4 A;  4DUR A;  1RFN A;  7LPR A;  4MPU A;  1JBU H;  3PM3 A;  1QA7 A;  1GWA A;  1UK3 A;  9LPR A;  4VGC C;  1AU8 A;  1CA0 C;  1TQ0 B;  1FQ3 A;  3HAT H;  5ABW A;  2F9N A;  3M5N A;  1N6X A;  2FI5 E;  2ZKS A;  3BTF E;  4CH2 B;  1SQO A;  1BMF D;  3EA7 A;  1HAI H;  3SNC A;  1H8D H;  1GI5 A;  2QF4 A;  3KF2 A;  1EZU C;  1W2K H;  5PTP A;  1FY4 A;  2ZFT A;  2EI6 A;  1JRT A;  1EAW A;  1EPT A;  1HAZ B;  1RTL A;  2QY0 B;  2OBQ A;  2OUA A;  1K9O E;  2SGD E;  1QL9 A;  3B23 B;  5IK2 D;  2D2D A;  1EB2 A;  2BY5 X;  4ABI A;  1OP0 A;  1K1L A;  1DSU A;  1ZPB A;  3M5M A;  1Z8R A;  1GHX H;  1CSO E;  2ZTY A;  1GHA G;  1L1N A;  2C8Z B;  2AH4 X;  1P02 A;  1V2K T;  2OBO A;  3SI3 H;  2ANM H;  3RXK A;  1QQ4 A;  3URD A;  1LVB A;  2ZPR A;  2ODP A;  2XBY A;  2Y7X A;  4YXW D;  1VGC B;  5FHT A;  3E8L A;  3TGI E;  1FN8 A;  4IW4 E;  3F2H A;  1EZQ A;  2ZGC A;  1VIT F;  1UTM A;  4MQA A;  1HAY B;  4Q80 A;  3ZVC A;  1UO6 A;  3URC A;  3A86 A;  1EAT A;  1V3X A;  1DX5 M;  3LT3 A;  3FKS D;  1TPS A;  5C94 A;  1TE0 A;  4ACA A;  1DY8 A;  5AFY H;  1A3B H;  3U8T H;  3BIV H;  2OQU A;  5TCA A;  2R0L A;  1T4U H;  3KID U;  5TJX A;  4FUF A;  2PWX A;  1L0Z A;  4FUE A;  1OWE A;  4GVU A;  1O3P B;  1ANC A;  3QLP H;  4GUX A;  1N1L A;  1XX9 A;  1BTY A;  1NFY A;  4JK6 A;  3MO9 A;  4MVN A;  3OY5 U;  4TYD A;  2XCF A;  1ZR0 A;  5GJ4 B;  2V6N A;  2R0K A;  2ZHW H;  3LJO A;  1KDQ B;  2YMS B;  5EJL A;  3LKW A;  3TIT A;  3CEN A;  3CS7 A;  1QZ8 A;  1C9P A;  2VH6 A;  2CF8 H;  3SNB A;  1CT2 E;  3TJN A;  4ZKN U;  5AF9 H;  3M7Q A;  1P12 E;  5FBE A;  3V13 A;  4A7I B;  1M9U A;  4AN7 A;  2NU3 E;  1G3D A;  2A4R A;  2ZHE H;  3GIC B;  5HM2 A;  1G37 A;  1UW7 A;  2GCH G;  3K9X B;  1YLN A;  3LDX H;  2W6I D;  2PV9 B;  4SGA E;  1GJ6 A;  1JOU B;  1C2M A;  1GDN A;  1P11 E;  4YZU A;  1IHT H;  1BUI A;  1C2J A;  3E1X B;  3FOA A;  2FTL E;  3GIS B;  1A61 H;  2FZZ A;  2GV6 A;  1XM1 A;  5EXM A;  5KED A;  4HTC H;  4KP0 A;  1GJ7 B;  2K0Q A;  1MTS A;  2GMT B;  1EST A;  3MU4 A;  4Y8X A;  2WPJ S;  1CBW B;  3HKI B;  2GZ8 A;  3SND A;  3QWC H;  1S82 A;  1SGE E;  1V2W T;  2BD7 A;  2PFE A;  3TNT A;  3UAI C;  3QN7 A;  1IQN A;  1BML A;  1TPP A;  1VIT G;  1P0S H;  1O0D H;  1P01 A;  2AS9 A;  2V35 A;  3VXE H;  1H1B A;  4X1Q U;  3LON A;  3PO1 C;  4U30 A;  2BDC A;  3GYL B;  3SU5 A;  1L1G A;  2IOT A;  1P05 A;  3SV9 A;  1A46 H;  4WF8 A;  3UWI A;  1P9S A;  2NU4 E;  1H4W A;  3QGJ A;  2Y82 A;  1HFD A;  4Z6A H;  1L4D A;  1P2O A;  1YPG H;  1VJA U;  4Q4L A;  2ZFS A;  3GY5 A;  1PQ8 A;  3ZZA A;  5CDF E;  2A5K A;  3F2F A;  3OYP A;  1QA0 A;  1AB9 B;  3PMA B;  2B8O H;  3EQ0 H;  1MD7 A;  4XE4 A;  4GCH F;  1O30 A;  1O2Y A;  2JJ1 D;  4D9Q A;  2VVC A;  3I77 A;  3KCG H;  1AWF H;  1NM6 A;  1RIW B;  1C5V A;  2BQ6 B;  2CGA A;  1THS H;  1TNI A;  3UB0 A;  1TYN A;  2UWP A;  3BSQ A;  3V7T A;  1S5S A;  1BBR K;  1CU1 A;  4LXB H;  1C2K A;  1GVL A;  2GT8 A;  1DIC A;  2I6S A;  3PMH B;  5KGO A;  3U98 H;  2GVF A;  1SL3 A;  8LPR A;  2W3K A;  1ABI H;  4HG6 A;  2Z3D A;  4AFS A;  3GY4 A;  2R2M B;  4D8N A;  1FJS A;  2LEL A;  2KM0 A;  2FM2 A;  2B7D H;  1O2S A;  1PFX C;  4VGC B;  3A7W A;  1KTS B;  3O8R A;  1CA0 B;  1C2G A;  1W0Y H;  1ZGI A;  1UCY K;  1KY9 A;  3BTT E;  1JRS A;  4DIH H;  1C4Y 2;  1V2Q T;  2QGR A;  4OS5 A;  1WUN H;  3BN9 A;  1AGJ A;  1S0Q A;  1UVT H;  5E8E H;  1ZML A;  1VCW A;  3RXV A;  3BTE E;  4BAM B;  1PPF E;  1S81 A;  3PMB B;  5C1X A;  1IQM A;  3Q3Y A;  2VIV A;  2ZO3 H;  3F6U H;  5H4I B;  3PWC A;  1GMH G;  1GHW H;  1TX7 A;  2GGV B;  1TIO A;  4X1S U;  5DPA A;  3AK5 A;  1O35 A;  2XBX A;  1EP5 A;  3UUZ A;  3CNR A;  6GCH F;  2BDI A;  3OX7 U;  3SU2 A;  3BEI B;  1A7S A;  2STB E;  2QF3 A;  3M5O A;  4TY7 A;  1F7Z A;  2TGD A;  1S6L A;  1WCZ A;  5T1V A;  4NA8 A;  1P2K A;  2J94 A;  1O3N A;  1CT4 E;  2XYA A;  1CVW H;  2BOH B;  1UMA H;  5F8T A;  1D3D B;  1LKA A;  1QIX B;  3ZZ6 A;  2J9N A;  1PYT C;  1HAV A;  2PKA A;  2P3F H;  1QHR B;  4CH8 B;  1ZPZ A;  1GI9 B;  4AG2 A;  4Y71 A;  1XXF A;  3UIR A;  2JH6 D;  2QC2 A;  3RXB A;  1C5Y B;  4XSK U;  2UUF B;  3NRL A;  5FCK A;  1H9H E;  2BLV A;  1BTW A;  3M7U A;  3MYW A;  1HAO H;  3A81 A;  1BOQ A;  2BX3 A;  1NRR H;  2K8I A;  4GCH G;  2ASU B;  1YYY 1;  4AB8 A;  3PLK A;  2O8M A;  1OXG A;  4P02 A;  4Y0Y E;  4B6F A;  2FIR H;  5F03 A;  4WMD A;  3PMJ A;  3CP7 A;  3NCL A;  4B2B A;  3RXS A;  3RXH A;  1TBQ H;  3A8C A;  2Z9G A;  1P2J A;  1ELA A;  3D23 A;  3R0F A;  3P6Z B;  2D8W A;  1TGS Z;  2GDD A;  1PYT D;  1RRK A;  3S9B A;  4NSV A;  1K1I A;  4INK A;  4ZKS U;  1TRY A;  1Y5A T;  3UR9 A;  3DT0 H;  1VKY A;  3LH3 A;  5AFZ H;  3A82 A;  2BHG A;  3WW7 A;  2M5T A;  2G55 A;  2FXR A;  5DJ7 A;  3UQO A;  5C5O A;  1NRS H;  5HIZ A;  4O3U A;  2RG3 A;  1BB0 B;  1EJA A;  1OWI A;  5GCH G;  1TBZ H;  3SN8 A;  1Z8J B;  1F5K U;  1C5L H;  1GCD A;  3MNX A;  4ABG A;  1XUK A;  1QB6 A;  3MH4 A;  4YTA A;  1HAX B;  4ACB A;  1H8I H;  1TQ7 B;  1TGT A;  2WV9 A;  4Y76 A;  3FZD A;  2A0Q B;  2ZFP H;  5B6O A;  4DCD A;  3TH3 H;  2HLD D;  4TT3 D;  1TFX A;  3MNB A;  3MU8 A;  1VR1 H;  2WYG A;  1VCQ A;  1C1S A;  2VWO A;  1DDJ A;  2CHA C;  5HM9 A;  2ZWL H;  1YCP K;  6GCH G;  3MH7 A;  1QTF A;  1D4P B;  2TRM A;  4X8S H;  4IMQ A;  1O5B B;  4X1P U;  1IHS H;  1VZQ H;  3M3V A;  3M37 A;  1DT2 A;  2AER H;  2FOM B;  1CE5 A;  2ZDV H;  3F68 H;  1OX1 A;  3PV5 A;  1EB1 H;  4NIW A;  1MTV A;  2V3M A;  3BTG E;  4MDS A;  3D65 E;  1BIO A;  3A7Z A;  5A0A E;  3V0X A;  2TGA A;  5EPY A;  2SGP E;  2SGE E;  5K0H A;  1OYQ A;  4B2C A;  4BAO B;  2ZC9 H;  1AMH A;  2VU8 E;  5I46 H;  2KR7 A;  1SGI B;  4FUG A;  5A8X A;  1DIT H;  2WIN I;  3SOS A;  1DY9 A;  2J95 A;  4IC5 A;  1T8N A;  2FP7 B;  1SGF A;  4X8V H;  2AMQ A;  4I8G A;  2UUY A;  8GCH F;  2HRV A;  1QGF A;  1O2Z A;  1AWH B;  1COW D;  2AYW A;  3F1S B;  5DP7 A;  3PB1 E;  4Y7A A;  3LGV A;  3SUG A;  1NFU A;  1IQI A;  4R0I A;  4BAQ B;  1G2L A;  4IC6 A;  2ZF0 H;  1D3P B;  5FL7 D;  2ALP A;  2C4F H;  2GT7 A;  2AGG X;  4FUD A;  4BNR A;  4Y6D A;  1MU8 B;  2OCV B;  4Y79 A;  5DP6 A;  3U69 H;  1AD8 H;  4NWK A;  3RXU A;  2J98 A;  3RXO A;  3NUM A;  3SW2 B;  2LNC A;  1PPC E;  1HNE E;  2P16 A;  1CQQ A;  3ZYE A;  4WWY A;  5EU8 A;  2H6M A;  7GCH G;  2B9L A;  2ODQ A;  1XKA C;  2J4I A;  1A3E H;  2RA0 A;  3ZV8 A;  1KLT A;  5HKK D;  3QTO H;  3RML H;  1UTQ A;  2PUQ H;  5G4B A;  2XBW A;  6LPR A;  4FU9 A;  4X2X A;  2KCY A;  1OHH D;  3A88 A;  2VB0 A;  3KQB A;  5DG6 A;  3A87 A;  1E34 B;  5E0H A;  1YLD A;  1K1O A;  3TVJ B;  2ZU2 A;  4ABH A;  1O38 A;  3ZZC A;  4FVB A;  5E2P A;  4BOH A;  4NFF A;  1E35 B;  1MAB B;  1LDT T;  1A4W H;  1DS2 E;  5C67 A;  3GCO A;  2Y5H A;  1FDP A;  2ZQ2 A;  3FAO A;  2FOF A;  2W7U A;  3MU0 A;  1JMO H;  3VPK A;  1O3G A;  2BD3 A;  1OYT H;  4ABD A;  2BYA X;  1WDI A;  2Y5G A;  3HK3 B;  3EA8 A;  4JZE H;  1SHY A;  1FLE E;  1IOE A;  1DWE H;  4F48 B;  1ZGV A;  2Z94 A;  1ACB E;  2A32 A;  1FPH H;  3KL6 A;  1LO6 A;  3BG4 B;  5EJZ A;  3FZZ A;  4ZXY H;  2VJ1 A;  1TRM A;  1Y3U A;  2GCT B;  2SGA A;  2FYQ A;  1CBW C;  3SU3 A;  1W10 U;  2R3Y A;  2WZQ A;  2YNB A;  4GHQ A;  4DG4 A;  4XDE A;  1O2N A;  2B5T B;  2ANK H;  2C8Y B;  4E06 H;  2A2Q H;  2WV5 A;  1JXP A;  4IN2 A;  1T8L A;  3OFN D;  1JWT A;  4YLU A;  4YOG A;  4B74 A;  1O2P A;  1AZZ A;  3RM2 H;  1MQ5 A;  2BLQ A;  5K7R A;  4I86 A;  3MWI U;  1C1Q A;  2I6Q A;  4AYY B;  5GXP A;  1QJ7 B;  4QT8 C;  5DN6 D;  2CK3 D;  1YPM H;  4Q7Z A;  1O5A B;  3LC5 A;  3VB4 A;  4A5T S;  2PSX A;  3SZE A;  3M36 A;  2RFK C;  5DP5 A;  1SGD E;  2ZFR H;  2ZU4 A;  3H7T A;  3SQH E;  2GV7 A;  4TWY A;  1SFQ B;  2F9V A;  1T7C A;  5EPN A;  5FX6 A;  1AB9 C;  1F5L A;  1P10 A;  3ELA H;  5JBC S;  1CA8 B;  1LQD B;  1RS0 A;  1AE8 H;  3CS0 A;  2BDA A;  1MKW H;  4XD7 D;  4BTI B;  3QO6 A;  3OSY A;  3PTB A;  3T62 A;  5EOK A;  5EXL A;  1IQH A;  1LHD H;  2EST E;  5GND A;  1C2H A;  1ELD E;  1GBM A;  1GMD G;  1E36 B;  5AHG H;  5C0T A;  2L6O A;  1KIG H;  3AW1 A;  4ABA A;  2F91 A;  3GCT G;  1BRA A;  1C5P A;  1QJ6 B;  2BD4 A;  4UFF H;  1IAU A;  5FPY A;  1WSS H;  2UWO A;  3MH6 A;  2HAL A;  2BY6 X;  1LHG H;  1W3C A;  1SOZ A;  3BEF B;  1DWC H;  3V3M A;  2ZI2 H;  3A8D A;  1Y5U T;  1C1U H;  1TMU H;  1FAX A;  1TPA E;  3K2U A;  5JBB S;  1E38 B;  1EFR D;  3ZZ9 A;  2Q6D A;  2VBC A;  2FDA A;  3NKK A;  1T8O A;  4OGX A;  1S6H A;  3ITI A;  2OLG A;  1FXY A;  2OTV A;  1O3O A;  3A7T A;  3F0O A;  1CHO F;  2CHA B;  3OEE D;  4CRF A;  2KAI B;  4E7R G;  3A8A A;  3QDZ B;  4ABE A;  2ZEC A;  5A0B A;  3FP8 E;  4R8T B;  2H9T H;  3GOV B;  2GJG A;  3OU0 A;  4AGK A;  3MNC A;  3PRB A;  1GI4 A;  1YCP M;  2ZNK H;  1HRT H;  2XWA A;  1UVO A;  1KDQ A;  2WPH S;  4DOQ A;  1UTN A;  2R2W U;  3BTM E;  2HNT F;  2VGC B;  1Y8T A;  1SSX A;  1G9I E;  4AZ2 B;  1AFE H;  2GX4 A;  1NPM A;  2HNT E;  2VIP A;  1P09 A;  2A5A A;  2O9Q A;  1E1R D;  1FN6 A;  1WQS A;  3MU1 A;  5EW1 H;  1ABJ H;  1YPK H;  7EST E;  4RN6 A;  4FOU C;  3BTW E;  3W95 A;  4RSP A;  3ZVE A;  3RXM A;  3TJO A;  3LJJ A;  1HJ8 A;  4NZQ A;  4XBD A;  1TAW A;  3RU4 E;  3D49 H;  4BAH B;  5J4S A;  1BZX E;  1NRO H;  4WVP E;  1GJD B;  1V2P T;  3A89 A;  1Z1J A;  2HWL B;  1E79 D;  3K65 B;  4JK5 A;  3QGN B;  2VWM A;  2W7S A;  3PYH A;  1SGY E;  4KKD A;  3ODD A;  4JMY A;  4WH6 A;  5IYT A;  3RXL A;  3RXD A;  4I8K A;  5DP4 A;  1GBI A;  5T3H A;  3B8J A;  2BB4 A;  3GCH B;  4JZ1 A;  3H5C B;  2THF B;  2OD3 B;  2D1J A;  3TK5 A;  1Y3Y A;  1BT7 A;  3QUM P;  4NGA H;  1TX8 A;  4Y11 E;  1O33 A;  1YC0 A;  2W5E A;  5JDU B;  3UQV A;  1GI7 B;  1MTN C;  1F2S E;  1S84 A;  4AB9 A;  1K28 D;  1NY2 2;  3KHV A;  3S0N A;  4WXI A;  1OPH B;  3MI4 A;  1HIA A;  1O3B A;  4X8T H;  1JIM A;  1O3D A;  5DGJ A;  5E2O A;  2VIO A;  4XFQ A;  2KFW A;  4ZKR U;  2UWL A;  3FAN A;  1K1J A;  2JH0 D;  1ANE A;  1BBR E;  1NZQ H;  3RXR A;  4CRG A;  2PKS C;  3NXP A;  2OK5 A;  1Y3V A;  3RU4 T;  2XWB I;  1CHO G;  2FWW A;  3EE7 A;  1YWU A;  3E6P H;  1DLK B;  2QA9 E;  1P2Q A;  2D26 C;  2P8O B;  4HFP B;  4DVA U;  3SBK A;  1MAY A;  3MO3 A;  4ZHA A;  4AOQ A;  3QX5 H;  1AND A;  1ETT H;  2TGP Z;  2ZHD A;  5C1U A;  2HNT C;  3NZI A;  1UCY E;  1W8B H;  3WWB A;  4Y7B A;  3U9A H;  4LOY H;  1LPK B;  4MPV A;  1SLW B;  3ATW A;  1Q31 A;  2G4U A;  1ZTK A;  3R3G B;  3GDS A;  1BDA A;  1Z6E A;  5CHB A;  2CJI A;  5EQQ A;  2HOB A;  1NU7 B;  3M3T A;  3AAS A;  5HXF A;  3SU6 A;  4Q2K A;  3VFE A;  2O8W A;  1A5I A;  1YBW A;  2PGB B;  1TNK A;  5EW2 H;  3DD2 H;  1INC A;  1QL8 A;  4LZ4 B;  5EGM A;  1VJ9 U;  2BMG B;  2EY4 C;  5LH8 A;  4ISL A;  2V0B A;  2ZGH A;  4BXS A;  3MHW U;  5C2Z A;  1J9C H;  3I29 A;  2C90 B;  1O37 A;  3T26 A;  2SNV A;  1PPB H;  1RD3 B;  4BXW A;  3N7O A;  1C5O H;  1YPJ H;  1GI2 A;  3GDU A;  3ZZ4 A;  1O5C B;  1W0J D;  2RA3 A;  3AAV A;  2H1U A;  1C1R A;  1UVU H;  3RXT A;  5EST E;  4MTB A;  1SHH B;  3RU4 D;  2QXJ A;  2J92 A;  3HGP A;  1ELV A;  2ZDK A;  3F0P A;  5EXN A;  3M35 A;  1XUH A;  4HI3 A;  4AG1 A;  1FY8 E;  5C5N A;  1TAB E;  1XUG A;  1DUE A;  2ZDL A;  1YPL H;  3VB5 A;  1UHB B;  1O3F A;  2H9H A;  3RXE A;  2GZ9 A;  3SGQ E;  1NFX A;  2F83 A;  2NU2 E;  1FNI A;  1BMM H;  3RM0 H;  2H2Z A;  1HV7 A;  3RC6 A;  6CHA B;  1ZSK A;  4ZXX H;  4AFQ A;  1O5D H;  2BD5 A;  1O2T A;  1J16 A;  4CR9 A;  3L3T A;  1GJ9 B;  1P03 A;  5FBI A;  1AY6 H;  1P04 A;  1NRN H;  1MBM A;  4X6N A;  1SPJ A;  1KLJ H;  1SC8 U;  2O8L A;  4TY6 A;  2ZU3 A;  2C3S A;  1RTK A;  2VID A;  1GG6 C;  3MO6 A;  1FX0 B;  3EE0 B;  1DST A;  5LPE A;  1ARB A;  4A1V A;  1FY5 A;  1V2O T;  3SYJ A;  6EST A;  2KZ4 A;  4IS5 A;  1LPZ B;  4ISH H;  1FAK H;  2SGF E;  3TJV A;  2J34 A;  3GY3 A;  4NZL A;  5J4Q A;  1LHC H;  1F5R A;  3RMN H;  2FO9 A;  2XC4 A;  2A5I A;  1O39 A;  1J15 A;  1ZJD A;  2FOA A;  2ZPS A;  1BBR H;  1BTU A;  8KME 2;  3SV7 A;  2Z7F E;  1HUT H;  1HXE H;  2NWN A;  1GPZ A;  3VGC C;  8EST E;  1XUJ A;  1Z1I A;  3BG4 C;  1SB1 H;  2VH0 A;  3UNR A;  2SGQ E;  3RXF A;  1DWB H;  1AKS B;  1O2M A;  4MNY A;  5E0J A;  3VXF H;  2GCT C;  2ZFF H;  2LPR A;  5T6G A;  2OIN A;  3ZZ3 A;  1MKX K;  1SLX B;  2FS8 A;  1O3A A;  1CGI E;  1EAS A;  1C5N H;  1ZSJ A;  5JB8 S;  5L6N H;  1P06 A;  1Y3W A;  4ABB A;  1UCY H;  4DT7 B;  2BOK A;  3ENS B;  2BXU H;  4WME A;  2SFA A;  3M3S A;  3UOP A;  3PTN A;  1BJU A;  3DCL A;  4K69 A;  3MOC A;  1J8A A;  1ELB A;  1L4Z A;  1S85 A;  2QXI A;  5T6D A;  3T25 A;  1KTT B;  1OSS A;  3OAA D;  1EZS C;  2Y80 A;  1V2T T;  4AGJ A;  1LVY A;  1NBM E;  5EJ1 A;  3C1K A;  4DJZ B;  2ULL A;  2AHM E;  3H09 A;  2FLR H;  3MFJ A;  1TX6 A;  1EX3 A;  3WY8 A;  4LK4 A;  4BAN B;  1K0H A;  1EP6 A;  1NFW A;  2ZEB A;  1O3K A;  4RKO B;  1EUF A;  1T31 A;  1C1V H;  5EIY A;  1HYL A;  2VIQ A;  1MD8 A;  1SQT A;  4MPX A;  2GP9 B;  2G00 A;  2ZZU H;  5C1Y A;  1DXP A;  3RXQ A;  1P2I A;  1MTN B;  2Q1J A;  1O3M A;  2BVS H;  1AUT C;  2JET B;  4Z0K A; 
#chains in the Genus database with same CATH homology
 2WHX A;  3N7E A;  2A4G A;  3DSO A;  1W0K D;  3GS9 A;  5H4I B;  2OC0 A;  4I32 A;  5IDK A;  2OK5 A;  2GGV B;  3FOA A;  5ETX A;  1A1R A;  2QE7 D;  2J5U A;  3U1I B;  3AK5 A;  3W1E A;  5C0U A;  2YOL A;  3M5M A;  2IJO B;  2K0Q A;  3F0O A;  3PRD A;  4A92 A;  3OEE D;  3SU2 A;  2OBO A;  2XCN A;  1FX0 B;  3M5O A;  4NWL A;  3DSP A;  3SU0 A;  2FOM B;  2XNI A;  4A1V A;  4WH8 A;  1S6L A;  3FO8 D;  1WXR A;  2F43 B;  3PV5 A;  3N99 A;  3SUD A;  5T1V A;  4I31 A;  3SYJ A;  4B6E A;  4B75 A;  4R8T B;  4YXW D;  2KZ4 A;  4Z1M D;  5C17 A;  5IK2 D;  4B73 A;  3WWB A;  3SUE A;  2JJ2 D;  3F2H A;  4K8B A;  3PRB A;  5EPY A;  5F53 A;  4FET A;  2KCA A;  4U01 A;  2F4L A;  3OEH D;  3LON A;  5ESB A;  2KR7 A;  3E90 B;  4B71 A;  3SU3 A;  2M2A A;  2OC7 A;  2XOK D;  1DY9 A;  3P8N A;  3SU5 A;  2WZQ A;  3SUF A;  5CHB A;  4F55 A;  2W6J D;  5EQQ A;  3SV7 A;  2FP7 B;  3FKS D;  4TSF D;  3SV9 A;  4WF8 A;  2IJD 1;  3SU6 A;  2QF5 A;  2XND D;  3NRL A;  5DSF A;  4B74 A;  1JXP A;  1DY8 A;  3OFN D;  1E1R D;  3O8B A;  4Q4L A;  3FN8 A;  1COW D;  3ZIA D;  5CDF E;  2QV1 A;  3L6P A;  2K8I A;  2OIN A;  3F2F A;  3F3B A;  3OYP A;  3SUG A;  2V7Q D;  1E1Q D;  4M9F A;  3RC4 A;  2O8M A;  4B6F A;  2CK3 D;  5DN6 D;  3U1J B;  3F2G A;  3RC5 A;  3EYD A;  2JJ1 D;  3WWF A;  3SU4 A;  5FL7 D;  5FPT A;  4RI0 A;  5B6L A;  1N1L A;  5EQR A;  1H8E D;  3SZE A;  3LOX A;  3OTP A;  3M5L A;  3KNX A;  2YMS C;  4NWK A;  3UB0 A;  1W0J D;  2JIZ D;  3DCL A;  4ASU D;  5EPN A;  2F9V A;  5GPI B;  1CU1 A;  3O8D A;  4TYD A;  1E79 D;  3SV8 A;  3OAA D;  2XCF A;  3KN2 A;  2WSS D;  5GJ4 B;  2OC1 A;  1H8H D;  2GVF A;  4A1T A;  4JMY A;  2YMS B;  4KTC A;  1NBM E;  4WH6 A;  3VG8 A;  2A4Q A;  3LKW A;  3SV6 A;  3WW7 A;  3OE7 D;  4XD7 D;  2AHM E;  2F9U A;  2LEL A;  3H09 A;  4I33 A;  2KM0 A;  2FM2 A;  2P59 A;  4B76 A;  4DT4 A;  3O8C A;  1RGQ A;  3F0P A;  5GND A;  3M5N A;  5HKK D;  1BT7 A;  5C0T A;  3O8R A;  3PV2 A;  1KMH B;  2L6O A;  2WPD D;  2K1Q A;  1NS3 A;  1DXW A;  1BMF D;  4A1X A;  4Q63 A;  1SKY E;  2KCY A;  3KEE A;  1OHH D;  4ZCN A;  3SU1 A;  2QF4 A;  5FPY A;  3KF2 A;  1NBM D;  3N7D A;  1DXP A;  1W3C A;  2WV9 A;  2A4R A;  1MAB B;  2HLD D;  1RTL A;  2KCO A;  4TT3 D;  2JDI D;  2KCP A;  5FPS A;  3RC6 A;  2OBQ A;  2YMS D;  2OC8 A;  2W6I D;  1EFR D;  5EQS A;  2VBC A;  3P8O A;  2KFW A;  4OM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...