4AOQA

Cationic trypsin in complex with mutated spinacia oleracea trypsin inhibitor iii (soti-iii) (f14a)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title Structural Characterization of Spinacia Oleracea Trypsin Inhibitor III (Soti-III)
pubmed doi rcsb
molecule tags Hydrolase/inhibitor
total genus 60
structure length 223
sequence length 223
chains with identical sequence B, C
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4aoqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4aoqA02
3PLKA 5A8YA 1T8OA 3LGTA 3NZIA 2O8UA 2XCNA 3SU3A 5HM2A 2FTLE 3RXHA 1D9IA 1F5RA 2A4GA 2GT7A 4JK5A 4MPWA 4NWKA 4U32A 4B74A 4BAOB 2EI7A 4K8YA 2V35A 1HCGA 3RC4A 1SLXB 3RC6A 1CT0E 1CA0C 1RXPA 1W2KH 1ZHRA 1SQAA 2AMQA 1PYTC 1C2KA 1HAYB 4BTIB 1O34A 4DURA 3S0NA 3TJVA 3QUMP 1GI1A 2D1JA 5FCKA 4XSKU 1P03A 1MUEB 4BAHB 1O3LA 2TPIZ 2ZTYA 2FXRA 1ANCA 1L4ZA 1P01A 6GCHG 1LHEH 2PW8H 1RD3B 4JYTA 3GY4A 1EAIA 5E0JA 5EXMA 2WUCA 1ORFA 3O8CA 4WH8A 2SGFE 3TJNA 2V6NA 4FVBA 1TB6H 2FOEA 1L2EA 2NU3E 2H9HA 4WF8A 2JETB 3TH2H 1TABE 3BF6H 1O2HA 2BY6X 2Q6FA 4R0IA 3C27B 5C1YA 3MU4A 2VVCA 1O38A 2I6QA 4UD9H 3T25A 4KTCA 2FDAA 1QBVH 1XUJA 1GMDF 2BD8A 3E0PB 4OS1A 1DX5M 1A4WH 3A84A 2G5NA 4LK4A 1OOKB 4FUCA 1NRPH 1MKWK 1P2IA 1AVWA 1TMUH 1ETTH 2XW9A 4CH2B 1TX8A 1CHOF 3MOCA 2F3CE 1TNLA 3FZDA 2ZU4A 2FEQH 1IQKA 3VGCC 3S7HB 2EC9H 2ZI2H 3F1SB 2ZU3A 5DP3A 3GCHC 1C5OH 1K1JA 5F8XA 1UCYK 2A7JA 1RS0A 1WQVH 1QTFA 4TWWA 1GBBA 4X2YA 1LHDH 2LPRA 3RXCA 1O2NA 1KDQA 3U1JB 1VITG 1O5DH 1MCVA 1CBWB 1OKXA 5L30H 1L1NA 5EQQA 1V2TT 4X1SU 5JDUB 3PROA 1F5KU 1MAXA 2FI5E 1UCYE 1TGCA 2FYQA 3O8DA 1AIXH 1A0HB 4A1TA 2WPLS 2Q6GA 2FX4A 2O8LA 3TPIZ 4GVUA 1VGCB 3TVJB 1DUAA 4BNRA 1CHOG 4RKJB 1D4PB 3BG8A 1JRTA 1MKXH 1GPZA 2GT8A 2PV9B 2BD5A 1H9LB 3PWBA 1YM0A 1YF4A 2G81E 1EPTB 4X6OA 1QJ7B 1HUTH 1S0RA 3A8BA 3FVFB 1P9SA 3BTWE 2BTCE 1KXFA 3R0FA 2HNTC 5C3NA 1YGCH 4MPVA 2JH0D 2ZHEH 1IQGA 1LDTT 4IW4E 3LU9B 1QHRB 4I8GA 4AFUA 2EI8A 2VWNA 1GJDB 2C8ZB 1HAPH 1VCWA 1EXFA 2A5KA 1O35A 4FU7A 5JB9S 1UMAH 1P06A 1OPHB 1LHGH 1RGQA 2F9UA 3VB4A 3SNBA 4DJZB 1BUIA 2HNTE 3DD2H 1H1BA 1ZHMA 2ZWLH 2ZU5A 4JYUH 4X8SH 1AWHB 4MVNA 1JOUB 3SZNA 1QCPA 5JBTA 5E0HA 2A2XH 1SVPA 3SV2H 3RMLH 2BX3A 4MPXA 3GDUA 2ZG0H 3LKWA 2ZPSA 4E7RG 1O3FA 1O3EA 4DGJA 8LPRA 1DITH 1K28D 3VB5A 1EZSC 1EJAA 1NESE 1HAIH 1HLTH 1KYNA 4IMQA 1HAVB 4ZKRU 1TFXA 3S7KB 3UR9A 1UTJA 4JYVH 1S81A 1FV9A 2VGCB 1HJ8A 3A7YA 1LKBA 1MCTA 1HJAC 5GXPA 2PKAB 4DT7B 3ATIA 1SFIA 1W14U 2EI6A 2GCHF 4I8KA 1WQSA 4ZKNU 3SU6A 4UE7H 1GBMA 5BRRE 4AORA 3RU4D 5A2MH 1QIXB 5E0GA 3Q77A 4A1XA 1GBIA 4YM9A 1BJVA 1G32B 1TLDA 4XOJA 3V13A 1C5SA 3GCNA 2TGAA 1AN1E 1HAGE 3QWCH 2ZFRH 5HYOA 1EUFA 1KY9A 1PPBH 2GZ9A 1YPHC 3E0NB 1Z71A 1TA6A 2C93B 3E91A 1G3CA 1GJBB 3PO1B 2R0LA 2CHAC 5ETXA 4K60A 3RXOA 3M3VA 1HPGA 2G00A 1ABJH 1ZGIA 3PTBA 3SJKA 2FOHA 5ESBA 1BDAA 4RN6A 5JYIA 3HPTB 3QTOH 4NSVA 4K8BA 5EPNA 1AUJA 2OQ5A 4ZHMU 1GBCA 4I33A 3RXMA 2ASUB 1LHFH 3SI3H 2WPJS 2ZHDA 1TRMA 4YO9A 1PYTD 2Z3DA 2VJ1A 1PPFE 3ZZDA 5A09A 1YC0A 2PKSB 4AGJA 1HFDA 1THPB 4BAQB 2FODA 1GJ6A 4FVDA 1YPEH 2F83A 4ABGA 4K1EA 1YCPH 3P6ZB 4Q7ZA 1AZ8A 1H8IH 4ASHA 3U9AH 3MTYA 3LDXH 1OSSA 2WPKS 4AFQA 3ATLA 3F9EA 3U8TH 2Z9IA 4ZHAA 1YPKH 1Z8GA 1W0YH 5F8TA 5FBIA 1GVKB 1P12E 1C1TA 1GHWH 3TK5A 2FLBH 2BY5X 4GSOA 1L1JA 1CE5A 1ANBA 2GX4A 3SGQE 1ANEA 1NM6A 1FZZA 1RIWC 5L6NH 3TLOA 1FY8E 1OWKA 1Y5UT 2QXIA 3GDSA 4ZH8A 3N7OA 2ZHQH 1ZRKA 4ABFA 4FU8A 3FP6E 3HGNA 1VZQH 1AE8H 3RP2A 2CGAA 1Y3UA 4B75A 1V2LT 4ZKSU 1TWXB 5T3HA 1B0EA 3RC5A 1A3EH 3ESTA 3QZRA 2BDYA 1O3JA 2VIDA 1W7XH 2ZPQA 3HK3B 2UWOA 1XMNB 2QYIA 3A88A 4H42U 2ODQA 1O5FH 1IHSH 1TBZH 3SGAE 1D3PB 2IJOB 2ZZUH 2FI4E 2BLQA 1LVMA 6CHAC 5G4BA 2FESH 1MTVA 4BXWA 3UNSA 3BTGE 1Z8IB 4DY7B 1C2LA 3M5NA 5CMXH 4GAWA 2FS9A 2QGRA 1C2GA 4XBBA 2HALA 1HRTH 2NU1E 5EPYA 1DWEH 1UTQA 1UTLM 2P94A 8KME2 3K9XB 1ANDA 1D3QB 3SU5A 3EA7A 2FOMB 4INHA 5ESTE 2VIWA 5T6GA 5E2PA 1AMHA 1QB9A 1O2RA 2BY9X 3M7QA 2A1DB 4GCHF 2H6MA 1HIAB 2TRMA 2Z9LA 3SN8A 4NCYA 3NCLA 1FY3A 1MD7A 4B2CA 1TGTA 7ESTE 2FYRA 2HOBA 2Y7XA 2GCTC 3A86A 3BEUA 5C20A 1GG6B 1AQ7A 1TNIA 2A45B 3DT0H 1C1SA 4ISOA 1JIMA 4YOGA 4CRDA 4A5TS 3SJ8A 1LVYA 3LH3A 3PB1E 4MLFB 3UOUA 1FPCH 2AGIX 1OWDA 3PMHB 3RM0H 3OSYA 1DPOA 5FXLA 1YLDA 1O2UA 2PWXA 1DS2E 4BANB 2FOCA 1IQLA 2FX6A 1QB1A 4CREA 1GHVH 1OS8A 4OS4A 4I7YH 2I6SA 3SNEA 3L33A 1V2MT 3RXIA 1KTSB 2ZCKP 3P8GA 1K9OE 1MBQA 5F8ZA 1JWTA 2V3OH 4GCHG 4NZLA 1NC6A 1WSSH 2A4QA 3FP7E 3SQEE 2WUBA 2P3FH 3Q3XA 1E35B 1B0FA 2J2UA 1FIZA 2Q1JA 3PWCA 1BMNH 1CO7E 4Z6AH 4U01A 1SLUB 2F9OA 1YLCA 4VGCB 1Z1JA 1OWIA 3A89A 3A81A 4UFEH 4ISHH 1TQ0B 1UK3A 1WUNH 4NFFA 1O3IA 2C8WB 2ANKH 2XC5A 1NFUA 2KAIB 3B8JA 1TRNA 1AFQB 2THFB 2ULLA 2R0KA 4FUEA 1HAZB 4FUBA 2ESTE 1ID5H 3ZZ3A 2C3SA 1C5PA 2VH0A 1C5NH 3SOSA 2STAE 3MH4A 1T4UH 1CA0B 2H5CA 3G01A 3ZZCA 4CR9A 1PPGE 1YCPM 5DPAA 5T6DA 1W13U 1SGPE 4LZ1H 2VNTA 3QN7A 4AN7A 1K21H 3BTFE 1OP0A 1TONA 5TCAA 4LOYH 1K22H 1SGIB 2BXUH 4OS2A 1C5ZB 2NU2E 2ZF0H 2F91A 1CVWH 3MHWU 1CA8B 5JBCS 4XBDA 1DWBH 1HXFH 1P04A 1A5HA 3P8OA 4NA7A 1NU9A 2QCYA 2WV4A 1HV7A 1ZTJA 4AOQA 8ESTE 4MNYA 1SG8B 4Y7AA 4AFZA 2PUXB 4DVAU 2B8OH 2CJIA 1IHTH 3UREA 1JXPA 1KXAA 1E38B 4WMEA 1TPOA 1XKBC 4JZ1A 2R2WU 4YOIA 1GHZA 4O3UA 3EDXB 4MPUA 5EG4A 1ZOMA 2TGDA 4X6MA 7KMEH 1BT7A 1N1LA 3RLYH 3VGCB 2XNIA 1ELFA 3MFJA 1UK4A 2Z3CA 1V3XA 3GCHB 3TGJE 3BTHE 2Q6DA 4MG3A 5I25A 3SBKA 3T29A 2C8XB 3SV7A 1FN8A 1TX6A 1T8NA 3LGIA 1C4U2 1EZQA 1FPHH 1NS3A 3JZ2B 4TYDA 1BJUA 3KN2A 2C8YB 1F5LA 3RXLA 1S0QA 2ZU2A 1GMHG 2XC0A 1UO6A 3BG4C 3RXEA 2GMTC 3U69H 4ABIA 1O3HA 1TMTH 3MU5A 1ZTLA 2TBSA 1ZZZA 3RXKA 4KP0A 1O3AA 5FPTA 2BHGA 6LPRA 1UHBB 3MNCA 2J4IA 2XBVA 3LPRA 2CMYA 1WYKA 2M5TA 4MNXA 1AY6H 1SGCA 2ALPA 1SLVB 1UVOA 1HNEE 2QXHA 4XE4A 5K0HA 1BMMH 3STJA 2Y80A 2W3IA 4GPGA 1OP2A 5H4IB 1XUGA 3A82A 2BVXH 1GI6A 3L3TA 2BD9A 3EQ0H 2GV7A 3UWJH 4CH8B 1BITA 3ODFA 3T27A 2FOAA 4R8TB 1CT4E 1XX9A 1SMFE 1VITF 1UTMA 1U6QA 5DP4A 1CT2E 3GDVA 3V7TA 1C4Y2 1TE0A 2D26C 2BQ7B 3QO6A 5EODA 3CS7A 3A7WA 4H4FA 2AS9A 1LPZB 3M5LA 2BDBA 1J9CH 3LC5A 3UNQA 4WJG2 3T2NA 1BBRK 3RMOH 1ZGVA 4JCNA 1SQOA 1FQ3A 4DCDA 1HJAB 2BLWA 1FAXA 4I8JA 4Y7BA 1AD8H 1DDJA 4CHAC 3P17H 5JBBS 3EA8A 1SHYA 1LVBA 1PPEE 4Y0ZE 1ESBA 1BBRE 2JH5D 1O0DH 1B5GH 1VCQA 3EYDA 1TQ7B 2BVSH 3ZVBA 2FOGA 3LH1A 3SJ9A 1EOJA 1BB0B 4B2BA 4SGBE 5DP5A 1O2LA 1O2XA 1GBAA 1UVTH 4NIVA 3ZVFA 2J92A 2ZDMA 2FS8A 1C1WH 3IITA 1OYQA 2P3TB 2RA0A 2EEKA 2VB0A 1QRXA 2YNBA 1C5UA 3VB7A 3F9GA 2ZFTA 3MH6A 1G3BA 1F0UA 3NKKA 1QQ4A 1VITH 1GI0A 1PPZA 1QRWA 3FFGA 5K7RA 1GJ4H 1Z6JH 3V0XA 2VWMA 1KLIH 2CHAB 3TGKE 2OD3B 1F0SA 3K6YA 3RXUA 2O8MA 1PQ8A 1PJPA 3MU8A 1SGTA 4YLQH 3GY5A 3JZ1B 3CS0A 4KTSA 4WMDA 5DP9A 4KGAA 4Y0YE 1SGEE 1RTFB 3RXTA 1ACBE 1SSXA 3ZV9A 2YNAA 5EOKA 5AHGH 3ZZ8A 2Y82A 2GV6A 1D6WA 3UWIA 4WVPE 2Z94A 2SGPE 4TY7A 5TJXA 3A7ZA 2VIQA 1AI8H 1C1NA 1N8OC 3RDZA 2STBE 4Y6DA 3KQBA 5FX5A 4AG2A 2P8OC 1IOEA 1W7GH 1GBHA 1GI2A 3SO3A 3MYWA 4WMFA 4X8VH 4K1SA 2QXGA 3KHVA 3M5MA 2VIPA 4WXVA 1TPPA 1G3EA 2HNTF 3GY7A 1JRSA 1RJXB 1OYTH 1SGFA 1ELBA 3UR6A 2D2DA 3LC3A 5GCHF 1MKWH 1W3CA 2GKVE 3GISB 4YESB 1O5AB 2PGBB 3CENA 3ZV8A 2ANMH 4D9QA 4H6SB 1Y59T 3VB3A 5EGMA 1J14A 2XWBI 1BTZA 1AZZA 3A8DA 4NWLA 1UCYH 2ZQ1A 2Z9GA 1SR5C 1RIWB 1KTTB 4PROA 1O3PB 5FBEA 1O5EH 1O3CA 1KIGH 2ANWA 1CU1A 2BD3A 3V12A 2XXLA 1QNJA 1EAWA 3DFJA 9LPRA 1O3BA 3BSQA 2ZGJA 3HKIB 3GOVB 2QV1A 3A7TA 2SGEE 1XVOA 1HJ9A 1K1MA 3NK8A 3OYPA 5DG6A 5DGJA 3SI4H 1A1RA 4O97A 1OXGA 1GI7B 1O2MA 1CGIE 1KXDA 1Q3XA 1GMCF 1TGNA 2ZTZA 3QK1A 8GCHF 5GCHG 1GI3A 1GJ8B 1C2HA 4CRCA 4X1PU 1T8MA 5J4QA 3F9FA 1GVZA 2FTMA 5EXLA 3RMMH 2AEIH 1PPHE 4M7GA 3UUZA 6CHAB 3MH5A 1CBWC 2R2MB 1J15A 2GVFA 3EGKH 2VVUA 3MO9A 4ZAEA 1H8DH 3A7XA 4WY3A 4ZXXH 3SU0A 3UQVA 4ISLA 2WINI 4D7GA 1Z6EA 4NGAH 1CSOE 4TPYA 1P0SH 1C4V2 1J8AA 1F2SE 1QL7A 1QURH 1XVMA 4A7IB 1GBKA 1QGFA 2B0FA 1C9PA 2NU0E 2P93A 3MNBA 1UTOA 4JK6A 5GWZA 4IS5A 5FAHA 2TGTA 1F0TA 1IQNA 1MU6B 2BD2A 1SGNE 1YPHE 3SUFA 1GMCG 2ZHWH 1W10U 4DG4A 2VU8E 5PTPA 8GCHG 1O5CB 1DSUA 3MH7A 2AMDA 3UOPA 1ELEE 3PTNA 3LT3A 3RM2H 1O2KA 1O3MA 1GCDA 1TNHA 2GCTB 1SGYE 1XUHA 5EQRA 1ZPCA 1EASA 1NRNH 3I78A 4K1TA 5F03A 1YPJH 1T31A 1ELTA 1NTPA 1DT2A 3T62A 1C1OA 2NU4E 2WV5A 4OS7A 3UTUH 1G3DA 4ABEA 1G2LA 1BRUP 2AGGX 3PMJA 1FI8A 3RXBA 2GZ8A 2PFEA 3K2UA 4Q2KA 1PQ5A 3SJOA 3RXPA 1KDQB 2Z3EA 3TNSA 1FDPA 1ZPZA 3OY5U 1RFNA 3LGWA 2OBQA 1K1IA 1QA7A 1GGDC 3ODDA 1Y3WA 2BMGB 2FP7B 2QN5T 1G36A 5E2OA 5LPEA 2A4OA 2HGTH 1P05A 4ZXYH 3W94A 3TH3H 2W26A 3EA9A 1SFQB 3RLWH 4X0WU 4UDWH 2QY0B 1HB0B 3NUMA 3H5CB 4K3JA 5AF9H 1SL3A 4O03A 4THNH 1YBWA 3MI4A 3VB6A 4NFEA 1S83A 3BIUH 3LGVA 4AGKA 3ATMA 1N6YA 3MU0A 1QL8A 2W7UA 3M61U 3GYMA 3STIA 2GGVB 2YOLA 4FUIA 4UFDH 3SHCH 4JZDH 1MQ5A 1C1PA 4CRGA 3BTME 1UVPA 3LONA 4AZ2B 1DLKB 2AYWA 2DUCA 3KIDU 3C1KA 3RXFA 2ZGBH 1PPCE 3RMNH 4UFFH 1G30B 1AKSA 1O3DA 5T6FA 1JMOH 1Y3VA 3ZZ6A 4UONA 3LJJA 1INCA 4TWYA 2UUFB 1BTUA 3A85A 2VIOA 2FIRH 2AIQA 3U1IB 4TPIZ 4CRAA 2PUQH 1A3BH 5LPRA 4J2YB 1S5SA 2ZGHA 4MNVA 3BIVH 3KCGH 1HXEH 2ZDAH 3PM3A 5FPYA 1AB9C 1RTLA 1ZJDA 5C2ZA 5GDSH 1P8VC 5BPEA 4D76A 5A0AE 1O2SA 5L2ZH 3W95A 2C90B 3DA9B 1D3DB 1BTHH 2WYJA 2VIVA 3AAVA 1H4WA 3ELAH 2TGPZ 1S82A 2HLCA 1T4VH 4K5ZA 3SNCA 2ZFQH 5DJ7A 4U30A 1HDTH 2FPZA 1BOQA 5EW1H 2QC2A 1ZSKA 3MO6A 1F0RA 2A4RA 3A80A 3OY6U 1ZJKA 2P59A 4SGAE 4BXSA 4X8TH 1AO5A 3HKJB 2BDHA 4MNWA 1ZSLA 1M9UA 1AVXA 1XUIA 1TAWA 2G55A 1ESTA 1FLEE 5EW2H 2UWPA 4X1RU 3RXJA 1DUEA 4A92A 1S6FA 1VJ9U 3S69A 1DY9A 2V3HH 1BTWA 5C1UA 4D8NA 1YPMH 2VWOA 2H9TH 1AU8A 1TIOA 4HZHA 2P3UB 3QGNB 1P02A 3O8RA 1E36B 2BD4A 3Q00A 3QX5H 4YOJA 1VCPA 2NWNA 1C5MD 3SW2B 1A46H 1O5GH 1VR1H 2SNVA 3BEFB 1BIOA 3MNXA 1WAYB 1EJNA 2O8WA 2QXJA 2XRCA 1GI8B 1SGRE 3RUOA 1YYY1 3BG4B 2GMTB 3LOXA 2OC8A 3U98H 2BDIA 5CHAC 3NPSA 3UY9A 2ZC9H 4OS5A 1G37A 2LNCA 3MMGA 1C5QA 1H9IE 2ZDNA 1BMLA 1SGDE 3D62A 1EP6A 1GDNA 1SB1H 5ABWA 1ZR0A 2ZO3H 1IQMA 1BHXB 4NIWA 4OGYA 1A0JA 3GCTF 1MTUA 1AUTC 4Q7XA 4IBLH 5LGOA 1Y5AT 3I29A 3RXDA 1P2JA 1KXCA 3M7TA 7GCHG 1NROH 4B71A 2GDDA 1QY6A 4DIIH 3KNXA 1C1UH 1O3NA 2GP9B 4HGCA 2XTTB 1LVOA 4YT6H 5CE1A 5EXNA 4INKA 1CQQA 1EPTA 1GHYH 1ESAA 3K65B 3SUGA 5J4SA 5DKMA 1C5LH 1Y3XA 3TK9A 2AFQB 2G5VA 3BTEE 4B1TA 3TITA 1ZSJA 1GBJA 1PFXC 3AASA 1SPJA 1SGQE 2ZTXA 2A7CA 4GHTA 1Q2WA 2G4UA 1ZTKA 1MZDA 1TGBA 2VWLA 1GMHF 3A83A 1LQEA 1SOZA 3SORA 4IC6A 4O9VA 2BOHB 2VH6A 3RXVA 3GCTG 3Q3YA 4A6LA 4CHAB 1WTHD 1MTNC 2FLRH 1YPGH 3EE0B 3SHAH 1KXEA 1FN6A 1LO6A 2G4TA 2OCVB 4FXGH 1A0LA 4JZIA 5IDKA 1T8LA 2OXSA 3QLPH 3ZYDA 3AVZA 2BLVA 2QF3A 1C1MA 4YT7H 1P3CA 4DIHH 2EA3A 1GJCB 2Y81A 1Y5BT 1BA8B 4ABHA 2XBWA 1GCTC 1KLJH 3MU1A 3KGPA 4HTCH 1BRAA 1ELCA 2QIQA 4RKOB 1HAVA 2WYGA 2CN0H 2A5IA 1KXBA 2W5EA 2UWLA 1SGFG 4HFPB 4E7NA 2PKAA 4FUFA 3ZVEA 1BCUH 3E3TA 1GWAA 2BZ6H 3PMBB 3GICB 1V2QT 1AHTH 3QGJA 1X7AC 1ZRBA 1DXPA 4JZFH 1GBDA 1NN6A 4Y10E 2CF8H 3IG6B 1UTPA 1CGHA 3HK6B 1O2ZA 1Y3YA 2PR3A 1P10A 1QQUA 2OLGA 1DXWA 1AFQC 2ODPA 1MBMA 1AGJA 1LHCH 4K69A 5A0BA 4DW2U 3PMAB 1BRBE 1O37A 2UUYA 4NIXA 3H7TA 3WY8A 1TPSA 5L2YH 3BTKE 3SU2A 1CGJE 1PQAA 2OP9A 3BTQE 3OX7U 4F49A 1MKXK 5F6MA 1ELAA 1ETRH 1QB6A 1EP5A 1W11U 4LXBH 1N8OB 1SC8U 2P8OB 4NZQA 1FXYA 1NFWA 1O2WA 4KTUA 1O2YA 2BVRH 1C5TA 3OTJE 2A7HA 4QT8C 1GDQA 3ENSB 4IN2A 3A7VA 5DP8A 5FCRA 4NA8A 5DO4H 1BHXF 1EAUA 1ZYOA 2Y5GA 5TCCA 3ZVGA 1V2WT 3M36A 5HGGA 1P3EA 2W3KA 1L1GA 2FOFA 1GVLA 1CHGA 3GYLB 4AX9H 1LQDB 2WPMS 5GPIB 3RXSA 1BTYA 1XXFA 2BDAA 1O2JA 1A61H 2BXTH 3UPEA 1LKAA 2FWWA 1E34B 4X6NA 4KELA 4XFQA 4CBOA 1EOLA 1V2JT 1FAKH 5LH8A 4NIYA 1B7XB 2ZNKH 2A0QB 1LMWB 1P9UA 1AFEH 3VEQB 4ABDA 4FU9A 3VFEA 1IQJA 2FO9A 3QDZB 1O36A 3DFLA 1UTKA 3SUEA 5A0CA 3P8FA 1V2VT 1NRSH 2VVVA 2WPHS 2P16A 1DLEA 2ZDVH 1HAOH 5A8XA 5C5NA 1DICA 4FUDA 1IQEA 1T32A 4J1YA 1TMBH 4MQAA 1OWHA 4I31A 1GMDG 4IMZA 1SBWA 1TOCB 1GI9B 3AAUA 3K6ZA 2BM2A 1D3TB 2ZGCA 4ZKOU 1GJ5H 1G9IE 2DE9A 3M37A 4Y11E 1V2KT 4FUHA 1SQTA 1NRRH 5HXFA 2O9QA 2PGQB 1O3KA 3S9CA 3B9FH 4BTUB 1W12U 1Y8TA 3KQCA 4UFGH 1S85A 1JBUH 5JPMH 3SNDA 4INLA 2AERH 1EJMA 3PLPA 3GCOA 3VXFH 3ZVAA 3O8BA 1LTOA 4X2VA 1L0ZA 4B76A 2XWAA 3SU1A 3TJUA 4BTTB 2IOTA 1K1OA 4WH6A 1H9HE 2BB4A 3GY3A 3QTVH 1P57B 2G52A 2ZCHP 4CRFA 4KKDA 1C1QA 4YLUA 2AH4X 1BBRH 1J16A 1W0ZU 6ESTA 2XC4A 1O5BB 3TJOA 2JETC 3ATWA 4WWYA 2CXVA 4ZUHA 5GJ4B 1IQFA 2FOBA 2SGQE 1QBOA 4B2AA 1HIAA 2SGDE 4NG9H 2BD7A 3SJIA 4I8HA 2Z7FE 5FX6A 1TNGA 1GGDB 2J34A 1V2OT 1FY5A 1QRZA 1LPKB 1YCPK 5EU8A 1V2ST 1V2PT 1O2QA 1O33A 2HPPH 2UUKB 3FZZA 1SI5H 1Z1IA 4O3TA 1MTWA 1O32A 2Y5HA 3GY2A 4Y71A 5FPSA 2OC7A 2ZFSA 1UVSH 1K1NA 2BDCA 3TIUA 1P11E 5AVDA 1HAXB 4D7FA 1AE5A 5DP6A 4NA9H 5LPFA 3SV6A 1P2KA 3P95A 1OX1A 2ZDKA 5A8ZA 2Z6BD 1DY8A 2JH6D 2Z9KA 4JZEH 2AMPA 1G2MA 4B73A 1GDUA 4GLYA 1QJ6B 1C2EA 1TA2A 1YKTA 2HVXA 2ZIQH 2HWLB 3IWMA 1BZXE 1TBQH 2PLXA 1YPLH 1O2OA 1IQIA 2ZP0H 3E90B 2XBXA 5I46H 3SQHE 1VGCC 3ZVCA 2OC1A 3PV4A 1FIWA 1A7SA 1TYNA 3A8AA 4E05H 3B23B 3F9HA 1EB1H 3BN9A 3RXAA 2BY8X 2PHBA 2GCHG 1EPTC 2G8TA 3E8LA 2A32A 1DWDH 1HBTH 1AB9B 3LGYA 1THSH 3PLBA 1AWFH 1FMGA 2KAIA 2AGEX 3NXPA 1ELGA 1JIRA 1GI5A 1HYLA 1MAYA 2RCEA 3UFAA 1FJSA 4CBNA 4H6TA 2IPHA 1FNIA 2A2QH 1WV7H 2GTBA 1KLTA 1EAXA 4Y8XA 2F9VA 4ISIH 1SHHB 3M35A 4E06H 1C2FA 1XM1A 3RXGA 4JMYA 3GY6A 4FUJA 2AIPA 2FZZA 3UIRA 2PTNA 3SU4A 1ARBA 4I32A 1FONA 3TNTA 2QAAA 2ZECA 1BTPA 1ELDE 2RG3A 3D23A 2BY7X 1NFXA 2O8TA 5DK1A 5DP7A 5GIBA 3AW1A 3QZQA 4MDSA 2OINA 2RDLA 2ZEBA 1NRQH 1A5IA 2R3YA 3E6PH 3M5OA 2ANYA 1C5VA 3KL6A 1OWJA 3RXRA 2ALVA 1GBEA 2F9PA 1DM4B 3TH4H 4ISNA 1UK2A 3FP8E 2VGCC 1FUJA 4XBCA 3SUDA 4AYVB 1DVAH 5HMAA 1DE7H 1MH0A 1O31A 2ZA5A 1GL1A 4MTBA 2SGAA 2XBYA 3S9AA 1NPMA 1KSNA 1GBFA 2ZFPH 1NZQH 2QA9E 2B5TB 2HPQH 1O2PA 4X1NU 2A31A 4IGDA 3M3SA 2ZQ2A 2OC0A 1O2VA 4UEHH 3MWIU 3VPKA 1HAHH 3MO3A 3ZYEA 1K1PA 1BQYA 1RTKA 1TPAE 4OS6A 3R3GB 2B9LA 3H7OA 3LIWA 3TU7H 1GI4A 1P2QA 3OU0A 4BAKB 2SFAA 3KQDA 5CHAB 1EQ9A 1UVUH 2HRVA 1C5XB 2VINA 1TBRH 2FMJA 3V3MA 1NFYA 1NO9H 3NWUA 1C2DA 1T7CA 2FM2A 2GD4B 2ZCLP 4BOHA 1C2MA 2ZU1A 2Y6TA 3SGBE 3LGUA 2J38A 4AG1A 1J17T 3BTTE 3PO1C 2A5AA 2C4FH 4ABAA 2K1QA 5AFZH 5JBAS 2PSYA 1EX3A 1BRCE 4FUGA 1GL0E 2ZHFH 1QFKH 3BV9B 1NY22 5C1XA 1QBNA 4OGXA 2ZKSA 1A2CH 2BLOA 1UJ1A 2ODYB 3GY8A 2CV3A 4BAMB 2JKHA 1UTNA 2Y5FA 3SV8A 1GHBF 1MZAA 1EZXC 3RXQA 4Y8YA 1GHAF 4ZROA 1C9TA 3UNRA 5IYTA 4U2WA 5E8EH 1UHBA 1XUFA 1E37B 1P2OA 3URDA 3F68H 3ZZBA 1V2UT 1GHXH 4AYYB 4GUXA 4ESTE 1TGSZ 2PKSC 1D6RA 1S6HA 1IQHA 1S84A 2F9BH 2R3UA 1ETSH 2J9NA 3Q76A 1Z8RA 3M7UA 1L4DA 4TY6A 4XDEA 3U8OH 2H1UA 5EQSA 2BZAA 4X2WA 1EB2A 3FAOA 1ZMJA 3M3TA 1WCZA 1W8BH 1FY4A 2J94A 3I77A 4X6PA 3DUXH 1THRH 1QA0A 1MTNB 1TNKA 2PTCE 4LZ4B 1O2IA 1C5RA 1BTXA 1GHBG 1Z7KA 1IAUA 1WOFA 1GHAG 2ZFFH 1EATA 3BEIB 4F4OC 1O2GH 4AB9A 1MQ6A 1DWCH 1PQ7A 1NT1A 3E16B 1QJ1B 1O30A 4ZMAH 5JB8S 2B7DH 3DHKH 2UUJB 1TOMH 1XUKA 3PYHA 2OBOA 1QR3E 4IN1A 2R9PA 1O39A 1GCTB 1F7ZA 1N6XA 1QL9A 2Y7ZA 4Z0KA 3ZZ7A 2V0BA 3ZZ9A 1C1VH 1ABIH 7GCHF 2XCFA 2IN2A 3KEEA 4Q7YA 5B6OA 2D8WA 1ARCA 1OWEA 1AVGH 3SNAA 3S9BA 3HATH 1XKAC 2ZDLA 3AW0A 1WBGB 1DFPA 4D9RA 4CRBA 1WU1A 3A8CA 4YTAA 1NU7B 2BX4A 3E1XB 1P2MA 1V6DA 1XXDA 4A1VA 2G51A 1GJAB 1O2TA 4K2YA 3UQOA 1TNJA 2OTVA 3KF2A 3ZZAA 7LPRA 4IC5A 9ESTA 4X1QU 3D49H 3KQEA 5AFYH 1ZPBA 1V2RT 1O3GA 5C5OA 1O3OA 2H9EH 2CF9H 1P09A 1YP9A 3F6UH 3FANA 3T26A 2FI3E 1GBLA 2GZ7A 4Y79A 3BTDE 4GHQA 2W7SA 1A5GH 1F92A 3MNSA 1GBTA 1SLWB 2J95A 2H5DA 1RRKA 2QF0A 2RA3A 2BDGA 1DSTA 3A87A 1DOJA 2F9NA 3P70B 4X2XA 1C2JA 2ZPRA 2OQUA 2ZGXH 2TIOA 3ZVDA 4AFSA 1OP8A 1GG6C 4X8UH 1Q31A 2GDEH 1C1RA 2ILNA 3RU4T 1EKBB 3ZZ5A 1P2NA 1ZLRA 1ELVA 4WXIA 3P92A 4Y8ZA 1C5YB 3ITIA 3URCA 1EZUC 1C2IA 3LJOA 3TK6A 4CR5A 3U8RH 1GJ9B 3VXEH 2BQWB 2DE8A 3EAJA 3ZZ4A 1TRYA 1ZHPA 4ZHLU 3SV9A 1VJAU 2XYAA 1V2NT 1FY1A 1LPGB 1C5WB 5HM9A 1Z8JB 3T28A 1K1LA 1TX7A 5C67A 1ZMNA 4NSYA 3HGPA 1GJ7B 1BMAA 1K2I1 2BYAX 2WPIS 4ABBA 4YZUA 3T5FH 3L6PA 1AKSB 2Z9JA 1DANH 5FHTA 4RSPA 1MU8B 4VGCC 1HGTH 1ZMLA 4I8LA 4ABJA 2H2ZA 4AB8A 1E0FD 2PSXA 3CP7A 3RU4E 3TGIE 4Q80A 2SNWA 1MMJN 2OUAA 2BQ6B 2P95A 5SGAE 1WTGH 6GCHF 4DOQA 1MTSA 2BOKA 4HI3A 3D65E 1LCYA 1MD8A 1SOTA 3P8NA 1TALA 3Q3KA 4Y76A 3ATKA
chains in the Genus database with same CATH superfamily
3PLKA 5A8YA 1T8OA 3LGTA 3NZIA 2O8UA 2XCNA 3SU3A 5HM2A 2FTLE 3RXHA 1D9IA 5IK2D 1F5RA 2A4GA 2GT7A 4JK5A 4MPWA 4NWKA 4U32A 4B74A 4BAOB 2EI7A 4K8YA 2V35A 1HCGA 3RC4A 1SLXB 3RC6A 1CT0E 1CA0C 1RXPA 1W2KH 3PRDA 1ZHRA 1SQAA 2AMQA 1PYTC 1C2KA 1HAYB 4BTIB 1O34A 4B6EA 4DURA 3S0NA 3TJVA 3QUMP 1GI1A 2D1JA 5FCKA 4XSKU 1P03A 1MUEB 4BAHB 1O3LA 2TPIZ 2ZTYA 2FXRA 1ANCA 1L4ZA 1P01A 6GCHG 1LHEH 2PW8H 1RD3B 4JYTA 4XD7D 3GY4A 1EAIA 3F2HA 5E0JA 5EXMA 2WUCA 1ORFA 3O8CA 4WH8A 2SGFE 3TJNA 2V6NA 4FVBA 1TB6H 2FOEA 1L2EA 1E1QD 2NU3E 2H9HA 4WF8A 2JETB 3TH2H 1TABE 3BF6H 1O2HA 2BY6X 2Q6FA 4R0IA 3C27B 5C1YA 3MU4A 2VVCA 1O38A 3N99A 2I6QA 4UD9H 3T25A 4KTCA 2FDAA 1UW7A 1QBVH 1XUJA 1GMDF 2BD8A 3E0PB 4OS1A 1DX5M 1A4WH 3A84A 2G5NA 4ACBA 4LK4A 1OOKB 4FUCA 1NRPH 1MKWK 5EJZA 1P2IA 1AVWA 1TMUH 1ETTH 2XW9A 4CH2B 1TX8A 1CHOF 3MOCA 2F3CE 1TNLA 3FZDA 2ZU4A 2FEQH 3F3BA 1IQKA 3VGCC 3S7HB 2EC9H 2ZI2H 3F1SB 2ZU3A 5DP3A 2LP6A 3GCHC 1C5OH 1K1JA 5F8XA 1UCYK 2A7JA 1RS0A 1WQVH 1QTFA 4TWWA 4YXWD 1GBBA 4X2YA 1LHDH 2LPRA 3RXCA 1O2NA 1KDQA 3U1JB 1VITG 1O5DH 1MCVA 1CBWB 1OKXA 5L30H 1L1NA 5EQQA 1V2TT 4X1SU 5JDUB 3PROA 1F5KU 1MAXA 2FI5E 1UCYE 1TGCA 2FYQA 3O8DA 1AIXH 1A0HB 4A1TA 2WPLS 2Q6GA 2FX4A 2O8LA 3TPIZ 4GVUA 1VGCB 3TVJB 1DUAA 4BNRA 1CHOG 2J98A 4RKJB 1D4PB 3BG8A 1JRTA 3SYJA 1MKXH 1GPZA 2GT8A 2PV9B 2BD5A 1H9LB 3PWBA 1YM0A 1YF4A 2G81E 1EPTB 4X6OA 1QJ7B 1HUTH 2LELA 1S0RA 3A8BA 3FVFB 1P9SA 3BTWE 2BTCE 1KXFA 3R0FA 2HNTC 5C3NA 1YGCH 4MPVA 2JH0D 2ZHEH 1IQGA 1LDTT 4IW4E 3LU9B 2K8IA 1QHRB 4I8GA 4AFUA 2EI8A 2VWNA 1GJDB 2C8ZB 1HAPH 1VCWA 1EXFA 2A5KA 1O35A 4FU7A 5JB9S 1UMAH 1P06A 1OPHB 4ZCNA 1LHGH 1RGQA 2F9UA 3VB4A 2WV9A 3SNBA 4DJZB 1BUIA 2RFKC 2HNTE 3DD2H 1H1BA 1ZHMA 2ZWLH 2ZU5A 4JYUH 4X8SH 1AWHB 4MVNA 1JOUB 3SZNA 1QCPA 5JBTA 5E0HA 2A2XH 1SVPA 3SV2H 3RMLH 2BX3A 4MPXA 3GDUA 2ZG0H 3LKWA 2ZPSA 4E7RG 1O3FA 1O3EA 4DGJA 8LPRA 1DITH 1K28D 3VB5A 1EZSC 1EJAA 1NESE 1HAIH 1HLTH 1KYNA 4IMQA 1HAVB 4ZKRU 1TFXA 3S7KB 3UR9A 1UTJA 4JYVH 1S81A 1FV9A 2VGCB 1HJ8A 3A7YA 1LKBA 1SKYE 1MCTA 1HJAC 5GXPA 3OEHD 2PKAB 4DT7B 3ATIA 1SFIA 1W14U 2EI6A 2GCHF 4I8KA 1WQSA 4ZKNU 3SU6A 4UE7H 1GBMA 5BRRE 4AORA 3RU4D 5A2MH 1QIXB 5E0GA 3Q77A 3NRLA 4A1XA 1GBIA 2V3MA 4YM9A 1BJVA 1G32B 3SZEA 1TLDA 3WWFA 4XOJA 3V13A 1C5SA 3GCNA 2TGAA 1AN1E 1HAGE 3QWCH 2ZFRH 5HYOA 1EUFA 1KY9A 1PPBH 2GZ9A 1YPHC 3E0NB 1Z71A 1TA6A 2C93B 3E91A 1G3CA 1GJBB 3PO1B 2R0LA 2CHAC 5ETXA 4K60A 3RXOA 3M3VA 1HPGA 2G00A 3GS9A 1ABJH 1ZGIA 3PTBA 3SJKA 2FOHA 5ESBA 1BDAA 4RN6A 2HVYB 5JYIA 3HPTB 3QTOH 4NSVA 4K8BA 5EPNA 1AUJA 2OQ5A 4ZHMU 1GBCA 4I33A 3RXMA 2ASUB 1LHFH 3SI3H 2WPJS 2ZHDA 1TRMA 4YO9A 1PYTD 2Z3DA 2VJ1A 1PPFE 3ZZDA 5A09A 1YC0A 2PKSB 4AGJA 1HFDA 1THPB 4BAQB 2FODA 1GJ6A 4FVDA 1YPEH 4AC9A 2F83A 4ABGA 4K1EA 1YCPH 3P6ZB 4Q7ZA 1AZ8A 1H8IH 4ASHA 3U9AH 3MTYA 3LDXH 1OSSA 2WPKS 4AFQA 3ATLA 3F9EA 3U8TH 2Z9IA 4ZHAA 1YPKH 1Z8GA 1W0YH 5F8TA 5FBIA 1GVKB 1P12E 1C1TA 1GHWH 3TK5A 4M9FA 2FLBH 2BY5X 4GSOA 1L1JA 1CE5A 1ANBA 2GX4A 3SGQE 1ANEA 1NM6A 1FZZA 1RIWC 5L6NH 3TLOA 1FY8E 1OWKA 1Y5UT 2QXIA 3GDSA 4ZH8A 3N7OA 2ZHQH 1ZRKA 4ABFA 4FU8A 3FP6E 3HGNA 1VZQH 1AE8H 3RP2A 2CGAA 1Y3UA 4B75A 1V2LT 4ZKSU 1TWXB 5T3HA 1B0EA 3RC5A 1A3EH 3ESTA 3QZRA 2BDYA 1O3JA 2VIDA 1W7XH 2ZPQA 3HK3B 2UWOA 1XMNB 2QYIA 3A88A 4H42U 2ODQA 1O5FH 1IHSH 1TBZH 3SGAE 1D3PB 2IJOB 2ZZUH 2FI4E 2BLQA 1LVMA 6CHAC 5G4BA 2FESH 1MTVA 4BXWA 3UNSA 3BTGE 1Z8IB 4DY7B 1C2LA 3M5NA 5CMXH 4GAWA 2FS9A 2QGRA 1C2GA 4XBBA 2HALA 1HRTH 2NU1E 5EPYA 1DWEH 1UTQA 1UTLM 2P94A 8KME2 3K9XB 1ANDA 1D3QB 3SU5A 3EA7A 2FOMB 4INHA 5ESTE 2VIWA 5T6GA 5E2PA 1AMHA 1QB9A 1O2RA 2BY9X 3M7QA 2A1DB 5C17A 4GCHF 2H6MA 1HIAB 2TRMA 2Z9LA 3SN8A 4NCYA 3NCLA 1FY3A 1MD7A 4B2CA 1TGTA 7ESTE 2FYRA 2HOBA 2Y7XA 2GCTC 2KZ4A 3A86A 3BEUA 5C20A 1GG6B 1AQ7A 1TNIA 2A45B 3DT0H 1C1SA 4ISOA 1JIMA 4YOGA 4CRDA 4A5TS 3SJ8A 1LVYA 3LH3A 3PB1E 4MLFB 3UOUA 1FPCH 2AGIX 1OWDA 3PMHB 3RM0H 3OSYA 1DPOA 5FXLA 1YLDA 1O2UA 2PWXA 1DS2E 4BANB 2FOCA 1IQLA 2FX6A 1QB1A 4P00A 4CREA 1GHVH 1OS8A 4OS4A 4I7YH 2I6SA 3SNEA 3L33A 1V2MT 3RXIA 1KTSB 2ZCKP 3P8GA 1K9OE 5B6LA 1MBQA 5F8ZA 1JWTA 2V3OH 4GCHG 4NZLA 1NC6A 1WSSH 2A4QA 3FP7E 3SQEE 2WUBA 2P3FH 3PRBA 3Q3XA 1E35B 1B0FA 2J2UA 2EY4C 1FIZA 2Q1JA 3PWCA 1BMNH 1CO7E 4F55A 4Z6AH 4U01A 1SLUB 2F9OA 1YLCA 4VGCB 1Z1JA 1OWIA 3A89A 3A81A 4UFEH 4ISHH 1TQ0B 1UK3A 1WUNH 4NFFA 1O3IA 2C8WB 2ANKH 2XC5A 1NFUA 2KAIB 3B8JA 1TRNA 1AFQB 2THFB 2ULLA 2R0KA 4FUEA 3UAIC 1HAZB 4FUBA 2ESTE 1ID5H 3ZZ3A 2C3SA 1C5PA 2VH0A 1C5NH 5FL7D 3SOSA 2STAE 3MH4A 1T4UH 1CA0B 2H5CA 3G01A 3ZZCA 4CR9A 1PPGE 1QZ8A 1YCPM 5DPAA 5T6DA 1W13U 1SGPE 4LZ1H 2VNTA 3QN7A 4AN7A 3PV5A 1K21H 3BTFE 3U28C 1OP0A 1TONA 5TCAA 4LOYH 1K22H 1SGIB 2BXUH 4OS2A 2GJGA 1C5ZB 2L74A 2NU2E 1MABB 2ZF0H 2F91A 1CVWH 3MHWU 1CA8B 5JBCS 4XBDA 1DWBH 1HXFH 1P04A 1A5HA 3P8OA 4NA7A 1NU9A 2QCYA 2WV4A 1HV7A 1ZTJA 4AOQA 8ESTE 3FKSD 1SG8B 4MNYA 4Y7AA 2PUXB 4AFZA 2B8OH 4DVAU 2CJIA 1IHTH 3UREA 1JXPA 1KXAA 1E38B 4WMEA 1TPOA 1XKBC 4JZ1A 2R2WU 4YOIA 1GHZA 4O3UA 3EDXB 4MPUA 5EG4A 1ZOMA 2TGDA 4X6MA 7KMEH 1BT7A 1N1LA 3RLYH 3VGCB 3KYGA 2XNIA 1ELFA 3MFJA 1UK4A 2Z3CA 1V3XA 3GCHB 3TGJE 3BTHE 2Q6DA 4MG3A 5I25A 3DSGA 3SBKA 2F43B 3T29A 2C8XB 3SV7A 1S6LA 1FN8A 1TX6A 1T8NA 3LGIA 1C4U2 1EZQA 1FPHH 1NS3A 2RDEA 3JZ2B 4TYDA 1BJUA 3KN2A 2C8YB 1F5LA 3RXLA 1S0QA 2ZU2A 1GMHG 2XC0A 1UO6A 3BG4C 3RXEA 2GMTC 3U69H 4ABIA 1O3HA 1TMTH 3MU5A 1ZTLA 2TBSA 1E1RD 1ZZZA 3RXKA 4KP0A 1O3AA 5FPTA 2BHGA 3OAAD 6LPRA 3W1EA 1UHBB 3MNCA 2J4IA 2JDID 2XBVA 3LPRA 2CMYA 1WYKA 2M5TA 4MNXA 1AY6H 1SGCA 1W0JD 2ALPA 1SLVB 1UVOA 1HNEE 2QXHA 4XE4A 5K0HA 1BMMH 3STJA 2Y80A 2W3IA 4GPGA 1OP2A 5H4IB 1XUGA 3A82A 2BVXH 1GI6A 3L3TA 2BD9A 2VBCA 3EQ0H 2GV7A 3UWJH 4CH8B 1BITA 3ODFA 3T27A 2FOAA 4R8TB 1CT4E 1XX9A 1SMFE 1VITF 1UTMA 1U6QA 5DP4A 4TSFD 1CT2E 3GDVA 3V7TA 1C4Y2 1TE0A 2D26C 2BQ7B 3QO6A 5EODA 3CS7A 3A7WA 2JJ1D 4I86A 4H4FA 2AS9A 1LPZB 3M5LA 2BDBA 1J9CH 3LC5A 3UNQA 4WJG2 3T2NA 1BBRK 3RMOH 1ZGVA 4JCNA 1SQOA 1FQ3A 4DCDA 1HJAB 2BLWA 1FAXA 4I8JA 2W6ID 4Y7BA 1AD8H 1DDJA 4CHAC 3P17H 2IPQX 5JBBS 3EA8A 1SHYA 1W0KD 4Z1MD 1LVBA 1PPEE 4RT0A 4Y0ZE 1ESBA 1BBRE 2JH5D 1O0DH 1B5GH 1VCQA 3EYDA 1TQ7B 2BVSH 3ZVBA 2FOGA 3LH1A 3SJ9A 1EOJA 1BB0B 4B2BA 4SGBE 5DP5A 1O2LA 4TT3D 1O2XA 1GBAA 1UVTH 4NIVA 3ZVFA 2J92A 2ZDMA 2FS8A 1C1WH 3IITA 1OYQA 2P3TB 2RA0A 2EEKA 2VB0A 1QRXA 2YNBA 1C5UA 3VB7A 3F9GA 2ZFTA 3MH6A 1G3BA 1F0UA 3NKKA 1QQ4A 1VITH 1GI0A 1PPZA 1QRWA 3FFGA 5K7RA 1GJ4H 3OEED 1Z6JH 3V0XA 2VWMA 1KLIH 2CHAB 3TGKE 5HIZA 2OD3B 1F0SA 3K6YA 3RXUA 2O8MA 2EQNA 1PQ8A 1PJPA 3MU8A 2KCOA 3N7EA 1SGTA 4YLQH 3GY5A 3JZ1B 3CS0A 4KTSA 4WMDA 5DP9A 4KGAA 4Y0YE 1SGEE 1RTFB 3RXTA 1ACBE 1SSXA 2WPDD 3ZV9A 2YNAA 5EOKA 5AHGH 3ZZ8A 2Y82A 2GV6A 1D6WA 3UWIA 4WVPE 2Z94A 2SGPE 4TY7A 5TJXA 3A7ZA 4FOUC 2VIQA 1AI8H 1C1NA 1N8OC 3RDZA 2STBE 4Y6DA 3KQBA 5FX5A 4AG2A 1IOEA 1W7GH 1GBHA 1GI2A 2P8OC 3SO3A 3MYWA 4WMFA 4X8VH 4K1SA 2QXGA 3KHVA 3M5MA 2VIPA 4WXVA 1TPPA 1G3EA 2HNTF 3GY7A 1JRSA 1RJXB 1OYTH 1SGFA 1ELBA 3UR6A 2D2DA 3LC3A 5GCHF 1MKWH 1W3CA 2GKVE 3GISB 4YESB 1O5AB 2PGBB 3CENA 3ZV8A 2ANMH 4D9QA 4H6SB 1Y59T 3VB3A 5EGMA 1J14A 1OHHD 2XWBI 1BTZA 1AZZA 1YY3A 3A8DA 3N7DA 4NWLA 1UCYH 2ZQ1A 2Z9GA 1SR5C 1RIWB 1KTTB 4PROA 1O3PB 5FBEA 1O5EH 1O3CA 1KIGH 2ANWA 1CU1A 2BD3A 2KFWA 3V12A 2XXLA 1QNJA 1EAWA 3DFJA 9LPRA 1O3BA 3BSQA 2ZGJA 3HKIB 3GOVB 2QV1A 3A7TA 2SGEE 1XVOA 1HJ9A 1K1MA 3NK8A 3OYPA 5DG6A 1H8HD 5DGJA 3SI4H 1A1RA 4O97A 1OXGA 1GI7B 1O2MA 1CGIE 1KXDA 1Q3XA 3MQKC 1NBMD 1GMCF 1TGNA 2ZTZA 3QK1A 8GCHF 5GCHG 1GI3A 1GJ8B 1C2HA 4CRCA 4X1PU 1T8MA 5J4QA 3F9FA 1GVZA 2FTMA 4RI0A 5EXLA 3RMMH 2AEIH 1PPHE 4M7GA 3UUZA 6CHAB 3MH5A 1CBWC 2R2MB 3DSPA 1J15A 2GVFA 3EGKH 2VVUA 3MO9A 4ZAEA 1H8DH 3A7XA 4WY3A 4ZXXH 3SU0A 5CDFE 3UQVA 4ISLA 2WINI 4D7GA 1Z6EA 4NGAH 1CSOE 4TPYA 1P0SH 1C4V2 1J8AA 1F2SE 1QL7A 1QURH 1XVMA 4A7IB 1GBKA 1QGFA 2B0FA 1C9PA 2NU0E 2P93A 3MNBA 1UTOA 2CK3D 4JK6A 4IS5A 5GWZA 5FAHA 2TGTA 1F0TA 1IQNA 1MU6B 2BD2A 1SGNE 1YPHE 3FN8A 3SUFA 1GMCG 2ZHWH 4Q4LA 1W10U 4DG4A 2VU8E 5PTPA 1H8ED 8GCHG 1O5CB 1DSUA 3MH7A 5EJ1A 2AMDA 3UOPA 1ELEE 3PTNA 3LT3A 3RM2H 1O2KA 1O3MA 1GCDA 1TNHA 2GCTB 1SGYE 1XUHA 5EQRA 1ZPCA 1EASA 1NRNH 3I78A 4K1TA 5F03A 1YPJH 1T31A 1ELTA 1NTPA 1DT2A 3T62A 4B6FA 1C1OA 2NU4E 2WV5A 4OS7A 2V7QD 3UTUH 1G3DA 4ABEA 1G2LA 4DT4A 1BRUP 2AGGX 3PMJA 1FI8A 3RXBA 4XRNA 2GZ8A 2PFEA 3K2UA 4Q2KA 1PQ5A 3SJOA 3RXPA 1KDQB 2Z3EA 3TNSA 1FDPA 1ZPZA 3OY5U 1RFNA 2K0QA 3LGWA 2OBQA 1K1IA 1QA7A 1GGDC 3ODDA 3WW7A 1Y3WA 2BMGB 2FP7B 2QN5T 1G36A 5E2OA 5LPEA 2XNDD 2A4OA 2HGTH 1P05A 4ZXYH 3W94A 3TH3H 2W26A 3EA9A 1SFQB 3RLWH 4X0WU 4UDWH 2QY0B 1HB0B 3NUMA 3H5CB 4K3JA 5AF9H 1SL3A 4O03A 4THNH 1YBWA 3MI4A 3VB6A 2J98B 4NFEA 1S83A 3BIUH 3LGVA 4AGKA 3ATMA 1N6YA 3MU0A 1QL8A 2W7UA 3M61U 3GYMA 3STIA 2GGVB 2YOLA 4FUIA 4UFDH 3SHCH 4JZDH 1MQ5A 1C1PA 4CRGA 3BTME 1UVPA 3LONA 4AZ2B 1DLKB 2AYWA 2DUCA 3KIDU 3C1KA 3RXFA 2ZGBH 1PPCE 3RMNH 4UFFH 1G30B 1AKSA 1O3DA 5T6FA 1JMOH 1Y3VA 3ZZ6A 4UONA 3LJJA 1INCA 4TWYA 5HKKD 2UUFB 1BTUA 3A85A 2VIOA 2FIRH 2AIQA 3U1IB 4TPIZ 4CRAA 2PUQH 1A3BH 2YMSD 5LPRA 4J2YB 1S5SA 2ZGHA 4MNVA 2QF4A 3BIVH 3AK5A 3KCGH 1HXEH 2ZDAH 3PM3A 5FPYA 1AB9C 1RTLA 1ZJDA 5C2ZA 5GDSH 1P8VC 5BPEA 4D76A 5A0AE 1O2SA 5L2ZH 3W95A 2C90B 4P02A 3DA9B 1D3DB 1BTHH 2WYJA 2VIVA 3AAVA 1H4WA 3ELAH 2TGPZ 1S82A 2HLCA 1T4VH 4K5ZA 3SNCA 2ZFQH 5DJ7A 4U30A 1HDTH 2FPZA 1BOQA 5EW1H 4OM9A 2QC2A 1ZSKA 3MO6A 1F0RA 2A4RA 3A80A 3OY6U 1ZJKA 2P59A 2W6JD 4SGAE 4BXSA 4X8TH 1AO5A 3HKJB 2BDHA 4MNWA 1ZSLA 1M9UA 5EJLA 1AVXA 1XUIA 1TAWA 2G55A 1ESTA 1FLEE 5EW2H 2KCYA 2UWPA 4RT1A 4X1RU 3RXJA 1DUEA 4A92A 1S6FA 1VJ9U 3S69A 1DY9A 2V3HH 1BTWA 5C1UA 4D8NA 1YPMH 2VWOA 2H9TH 1AU8A 1TIOA 4HZHA 2P3UB 3QGNB 1P02A 3O8RA 1COWD 1E36B 2BD4A 3Q00A 3QX5H 4YOJA 1VCPA 2NWNA 1C5MD 3SW2B 1A46H 1O5GH 1VR1H 2SNVA 3BEFB 1BIOA 3MNXA 1WAYB 1EJNA 2O8WA 2QXJA 2XRCA 1GI8B 1SGRE 2OK5A 3RUOA 1YYY1 3BG4B 2GMTB 3LOXA 2OC8A 3U98H 2BDIA 5CHAC 3NPSA 3UY9A 2ZC9H 4OS5A 1G37A 2LNCA 3MMGA 1C5QA 3F2FA 1H9IE 2ZDNA 1BMLA 1SGDE 3D62A 1EP6A 1GDNA 1SB1H 5ABWA 1ZR0A 2ZO3H 1IQMA 1BHXB 4NIWA 4OGYA 1WXRA 1A0JA 3GCTF 1MTUA 1AUTC 4Q7XA 4IBLH 5LGOA 1Y5AT 3I29A 3RXDA 1P2JA 1KXCA 3M7TA 7GCHG 1NROH 4B71A 2GDDA 1QY6A 4DIIH 3KNXA 1C1UH 1O3NA 2GP9B 4HGCA 5KGOA 2XTTB 1LVOA 4YT6H 5CE1A 5EXNA 4INKA 1CQQA 1EPTA 1GHYH 4ACAA 1ESAA 3K65B 3SUGA 1EFRD 5J4SA 5DKMA 3FO8D 1C5LH 1Y3XA 3TK9A 2AFQB 2G5VA 3BTEE 4B1TA 3TITA 1ZSJA 1GBJA 1PFXC 3AASA 1SPJA 1SGQE 2ZTXA 2A7CA 4GHTA 1Q2WA 2G4UA 1ZTKA 1MZDA 1TGBA 2VWLA 1GMHF 3A83A 1FX0B 1LQEA 1SOZA 3SORA 4IC6A 4O9VA 2BOHB 2VH6A 3RXVA 3GCTG 3Q3YA 4A6LA 4CHAB 1WTHD 1MTNC 2FLRH 1YPGH 3EE0B 3SHAH 1KXEA 1FN6A 1LO6A 2G4TA 2OCVB 4FXGH 1A0LA 4JZIA 5IDKA 1T8LA 2OXSA 3QLPH 3EE7A 3ZYDA 3AVZA 3H09A 2BLVA 2QF3A 1C1MA 4YT7H 1NBME 1P3CA 4DIHH 2EA3A 1GJCB 2Y81A 1Y5BT 1BA8B 4ABHA 2XBWA 1GCTC 1KLJH 3MU1A 3KGPA 4HTCH 1BRAA 1ELCA 2QIQA 4RKOB 1HAVA 2WYGA 2CN0H 2A5IA 1KXBA 2W5EA 2UWLA 1SGFG 4HFPB 4E7NA 3KYFA 2PKAA 4FUFA 3ZVEA 1BCUH 3E3TA 1GWAA 2BZ6H 3PMBB 3F2GA 3GICB 1V2QT 1AHTH 3QGJA 1X7AC 1ZRBA 1DXPA 4JZFH 1GBDA 1NN6A 4Y10E 2CF8H 3IG6B 1UTPA 1CGHA 3HK6B 1O2ZA 1Y3YA 2PR3A 1P10A 1QQUA 2OLGA 1DXWA 1AFQC 2ODPA 1MBMA 1AGJA 1LHCH 4K69A 5A0BA 4DW2U 3PMAB 1BRBE 1O37A 2UUYA 4NIXA 3H7TA 3WY8A 1TPSA 5L2YH 3BTKE 1YWUA 3SU2A 1CGJE 1PQAA 2OP9A 3BTQE 3OX7U 2JJ2D 4F49A 1MKXK 5F6MA 3WWBA 1ELAA 1ETRH 1QB6A 1EP5A 1W11U 4LXBH 1N8OB 1SC8U 4F48B 2J5UA 2P8OB 4NZQA 1FXYA 1NFWA 1O2WA 4KTUA 1O2YA 2BVRH 1C5TA 3OTJE 2A7HA 4QT8C 1GDQA 3ENSB 4IN2A 3A7VA 5DP8A 5FCRA 4NA8A 2IJD1 5DO4H 1BHXF 1EAUA 1ZYOA 2Y5GA 5TCCA 3ZVGA 1V2WT 3M36A 5HGGA 1P3EA 2W3KA 1L1GA 2FOFA 1GVLA 1CHGA 3GYLB 4AX9H 1LQDB 2WPMS 5GPIB 3RXSA 1K0HA 1BTYA 1XXFA 2BDAA 1O2JA 1A61H 2BXTH 3UPEA 1LKAA 2FWWA 1E34B 4X6NA 4KELA 2F4LA 4XFQA 4ASUD 2KCPA 4CBOA 1EOLA 1V2JT 5HIYA 1FAKH 5LH8A 4NIYA 1B7XB 2ZNKH 2A0QB 1LMWB 1P9UA 1AFEH 3VEQB 4ABDA 4FU9A 3VFEA 1IQJA 2FO9A 3QDZB 1O36A 3DFLA 1UTKA 3SUEA 5A0CA 3P8FA 1V2VT 1NRSH 2VVVA 2WPHS 5CHBA 2HLDD 2P16A 5T1VA 1DLEA 2ZDVH 1HAOH 5A8XA 5C5NA 1DICA 4FUDA 1IQEA 1T32A 2YMSC 4J1YA 1TMBH 4MQAA 1OWHA 4I31A 1GMDG 4IMZA 1SBWA 1TOCB 1GI9B 3AAUA 3K6ZA 2BM2A 1D3TB 2ZGCA 4ZKOU 1GJ5H 1G9IE 2DE9A 3M37A 4Y11E 3OFND 1V2KT 4FUHA 2AHME 1SQTA 1BMFD 1NRRH 5HXFA 2O9QA 2PGQB 1O3KA 3S9CA 3B9FH 4BTUB 1W12U 1Y8TA 3KQCA 4UFGH 1S85A 1JBUH 5JPMH 3SNDA 4INLA 2AERH 1EJMA 3PLPA 3GCOA 3VXFH 3ZVAA 3O8BA 1LTOA 4X2VA 1L0ZA 4B76A 2XWAA 3SU1A 3TJUA 4BTTB 2IOTA 1K1OA 4WH6A 1H9HE 2BB4A 3GY3A 3QTVH 1P57B 2WHXA 2G52A 2ZCHP 4CRFA 4KKDA 1C1QA 4YLUA 2AH4X 1BBRH 1J16A 1SQRA 1W0ZU 6ESTA 2XC4A 1O5BB 3TJOA 2JETC 3ATWA 4WWYA 2CXVA 4ZUHA 5GJ4B 2L6OA 1IQFA 2FOBA 2SGQE 2WSSD 1QBOA 4B2AA 1HIAA 2SGDE 4NG9H 2BD7A 3SJIA 4I8HA 2Z7FE 5FX6A 1TNGA 1GGDB 2J34A 1V2OT 1FY5A 1QRZA 1LPKB 1YCPK 5EU8A 1V2ST 1V2PT 1O2QA 1O33A 2HPPH 2UUKB 3FZZA 1E79D 1SI5H 1Z1IA 4O3TA 1MTWA 1O32A 2Y5HA 3GY2A 4Y71A 5FPSA 2OC7A 2ZFSA 1UVSH 1K1NA 2BDCA 3TIUA 1P11E 5AVDA 1HAXB 4D7FA 1AE5A 5DP6A 4NA9H 5LPFA 3SV6A 1P2KA 3P95A 1OX1A 2ZDKA 5A8ZA 2Z6BD 1DY8A 2JH6D 2Z9KA 4JZEH 2AMPA 1G2MA 4B73A 1GDUA 4GLYA 1QJ6B 5F53A 1C2EA 1TA2A 1YKTA 2HVXA 2ZIQH 2HWLB 3IWMA 1BZXE 1TBQH 2PLXA 1YPLH 1O2OA 1IQIA 2ZP0H 3E90B 2XBXA 5I46H 3SQHE 1VGCC 3ZVCA 2OC1A 3PV4A 1FIWA 5C0UA 1A7SA 1TYNA 3A8AA 4E05H 3B23B 3F9HA 1EB1H 3BN9A 3RXAA 2BY8X 2PHBA 1VKYA 2GCHG 1EPTC 2G8TA 3E8LA 2A32A 1DWDH 1HBTH 1AB9B 3LGYA 1THSH 3PLBA 1AWFH 1FMGA 4FETA 3CNRA 2KAIA 2AGEX 3NXPA 1ELGA 1JIRA 1GI5A 3FOAA 1HYLA 1MAYA 2RCEA 3UFAA 1FJSA 4CBNA 4H6TA 2IPHA 1FNIA 2A2QH 1WV7H 2GTBA 1KLTA 1EAXA 4Y8XA 2F9VA 4ISIH 1SHHB 3M35A 4E06H 1C2FA 1XM1A 3RXGA 4JMYA 3GY6A 4FUJA 2AIPA 2FZZA 3UIRA 5KEDA 2PTNA 3SU4A 1ARBA 4I32A 1FONA 3TNTA 2QAAA 2ZECA 1BTPA 1ELDE 2RG3A 3D23A 2QE7D 2BY7X 1NFXA 2O8TA 5DK1A 5DP7A 5GIBA 3AW1A 3QZQA 4MDSA 2OINA 2RDLA 2ZEBA 1NRQH 1A5IA 2R3YA 3E6PH 3M5OA 2ANYA 1C5VA 2KCAA 3KL6A 1OWJA 3RXRA 2ALVA 1GBEA 2F9PA 1DM4B 3TH4H 4ISNA 1UK2A 3FP8E 2VGCC 1FUJA 4XBCA 3SUDA 4AYVB 1DVAH 5HMAA 1DE7H 1MH0A 1O31A 2ZA5A 1GL1A 4MTBA 2QF5A 2SGAA 2XBYA 3S9AA 1NPMA 1KSNA 1GBFA 2ZFPH 1NZQH 2QA9E 2B5TB 2HPQH 3UB0A 1O2PA 4X1NU 2A31A 4IGDA 3M3SA 2ZQ2A 2OC0A 1O2VA 4UEHH 3MWIU 3VPKA 1HAHH 3MO3A 3ZYEA 1K1PA 1BQYA 1RTKA 1TPAE 4OS6A 3R3GB 2B9LA 3H7OA 3LIWA 3TU7H 1GI4A 1P2QA 3OU0A 4BAKB 2SFAA 3KQDA 5CHAB 1EQ9A 1UVUH 2HRVA 1C5XB 2VINA 1TBRH 3ZIAD 2FMJA 3V3MA 1NFYA 1NO9H 3NWUA 1C2DA 1T7CA 2FM2A 2GD4B 2ZCLP 4BOHA 1C2MA 2ZU1A 2Y6TA 3SGBE 3LGUA 2J38A 4AG1A 1J17T 3BTTE 3PO1C 2A5AA 2C4FH 4ABAA 2K1QA 5AFZH 5JBAS 2PSYA 1EX3A 1BRCE 4FUGA 1GL0E 2ZHFH 3PV2A 1QFKH 3BV9B 1NY22 5C1XA 1QBNA 4OGXA 2ZKSA 1A2CH 2BLOA 1UJ1A 2ODYB 3GY8A 2CV3A 4BAMB 2JKHA 1UTNA 2Y5FA 3SV8A 1GHBF 1MZAA 4HG6A 1EZXC 5DN6D 3RXQA 3OE7D 1GHAF 4Y8YA 4ZROA 3KQ5A 1C9TA 3UNRA 5IYTA 1YLNA 4U2WA 5E8EH 1UHBA 1XUFA 1E37B 1P2OA 3URDA 3F68H 3ZZBA 1V2UT 1GHXH 4AYYB 4GUXA 5KECA 4ESTE 1TGSZ 2PKSC 1D6RA 1S6HA 1IQHA 1S84A 2F9BH 2R3UA 1ETSH 2J9NA 3Q76A 1Z8RA 3M7UA 1L4DA 4TY6A 4XDEA 3U8OH 2H1UA 5EQSA 2BZAA 4X2WA 1EB2A 3FAOA 1ZMJA 3M3TA 1WCZA 1W8BH 1FY4A 2J94A 3I77A 4X6PA 3DUXH 1THRH 1QA0A 1MTNB 1TNKA 2PTCE 4LZ4B 1KMHB 1O2IA 2KX4A 5C94A 1C5RA 1BTXA 1GHBG 1Z7KA 1IAUA 1WOFA 1GHAG 2ZFFH 1EATA 3BEIB 4F4OC 1O2GH 4AB9A 1MQ6A 1DWCH 1PQ7A 1NT1A 3E16B 1QJ1B 1O30A 4ZMAH 5JB8S 2B7DH 3DHKH 2UUJB 5EIYA 1TOMH 1XUKA 3PYHA 2OBOA 1QR3E 4IN1A 2R9PA 1O39A 3OTPA 1GCTB 1F7ZA 1N6XA 2WZQA 3DCLA 1QL9A 2Y7ZA 4Z0KA 3ZZ7A 2V0BA 3ZZ9A 1C1VH 1ABIH 7GCHF 2XCFA 2IN2A 3KEEA 4Q7YA 5B6OA 2D8WA 1ARCA 1OWEA 1AVGH 2KM0A 3SNAA 3S9BA 3HATH 1XKAC 2ZDLA 3AW0A 1WBGB 1DFPA 4D9RA 4CRBA 1WU1A 3A8CA 4YTAA 1NU7B 2BX4A 3E1XB 1P2MA 1V6DA 1XXDA 4A1VA 2G51A 1GJAB 1O2TA 3VG8A 4K2YA 3UQOA 1TNJA 2OTVA 3KF2A 3ZZAA 7LPRA 2M2AA 4IC5A 9ESTA 4X1QU 3D49H 3KQEA 5AFYH 1ZPBA 1V2RT 1O3GA 5C5OA 1O3OA 2H9EH 2CF9H 1P09A 1YP9A 2PP6A 2XOKD 3F6UH 3FANA 3T26A 2FI3E 1GBLA 3DSOA 1WDIA 2GZ7A 4Y79A 3BTDE 4GHQA 2W7SA 1A5GH 1F92A 3MNSA 1GBTA 1SLWB 2J95A 2H5DA 1RRKA 2QF0A 5DSFA 2RA3A 2KR7A 2BDGA 1DSTA 3A87A 1DOJA 2F9NA 3P70B 4X2XA 1C2JA 2ZPRA 2OQUA 2ZGXH 2TIOA 3ZVDA 4AFSA 1OP8A 1GG6C 4X8UH 1Q31A 2GDEH 5GNDA 1C1RA 2ILNA 3RU4T 1EKBB 3ZZ5A 1P2NA 1ZLRA 3F0PA 1ELVA 4WXIA 3P92A 4Y8ZA 1C5YB 3ITIA 3URCA 1EZUC 1C2IA 3LJOA 3TK6A 4CR5A 3U8RH 1GJ9B 3F0OA 3VXEH 4Q63A 2BQWB 2DE8A 3EAJA 3ZZ4A 1TRYA 1ZHPA 4ZHLU 3SV9A 1VJAU 2XYAA 1V2NT 1FY1A 1LPGB 1C5WB 5HM9A 1Z8JB 3T28A 1K1LA 1TX7A 2J97A 5C67A 1ZMNA 4NSYA 3HGPA 1GJ7B 1BMAA 1K2I1 2BYAX 2WPIS 5C0TA 4ABBA 4YZUA 3T5FH 3L6PA 1AKSB 2Z9JA 1DANH 5FHTA 4RSPA 1MU8B 4VGCC 1HGTH 1ZMLA 4I8LA 4ABJA 2H2ZA 4AB8A 1E0FD 2PSXA 3CP7A 2JIZD 3RU4E 3TGIE 4Q80A 2SNWA 1MMJN 2OUAA 2BQ6B 2P95A 5SGAE 2YMSB 1WTGH 6GCHF 4DOQA 1MTSA 2BOKA 4HI3A 3D65E 1LCYA 1MD8A 1SOTA 3P8NA 1TALA 3Q3KA 4Y76A 3ATKA
chains in the Genus database with same CATH topology
3PLKA 5A8YA 1T8OA 3LGTA 3NZIA 2O8UA 2XCNA 3SU3A 5HM2A 2FTLE 3RXHA 1D9IA 1F5RA 2A4GA 2GT7A 4JK5A 4MPWA 4NWKA 4U32A 4B74A 4BAOB 2EI7A 4K8YA 2V35A 1HCGA 3RC4A 1SLXB 3RC6A 1CT0E 1CA0C 1RXPA 1W2KH 1ZHRA 1SQAA 2AMQA 1PYTC 1C2KA 1HAYB 4BTIB 1O34A 4DURA 3S0NA 3TJVA 3QUMP 1GI1A 2D1JA 5FCKA 4XSKU 1P03A 1MUEB 4BAHB 1O3LA 2TPIZ 2ZTYA 2FXRA 1ANCA 1L4ZA 1P01A 6GCHG 1LHEH 2PW8H 1RD3B 4JYTA 3GY4A 1EAIA 5E0JA 5EXMA 2WUCA 1ORFA 3O8CA 4WH8A 2SGFE 3TJNA 2V6NA 4FVBA 1TB6H 2FOEA 1L2EA 2NU3E 2H9HA 4WF8A 2JETB 3TH2H 1TABE 3BF6H 1O2HA 2BY6X 2Q6FA 4R0IA 3C27B 5C1YA 3MU4A 2VVCA 1O38A 2I6QA 4UD9H 3T25A 4KTCA 2FDAA 1QBVH 1XUJA 1GMDF 2BD8A 3E0PB 4OS1A 1DX5M 1A4WH 3A84A 2G5NA 4LK4A 1OOKB 4FUCA 1NRPH 1MKWK 1P2IA 1AVWA 1TMUH 1ETTH 2XW9A 4CH2B 1TX8A 1CHOF 3MOCA 2F3CE 1TNLA 3FZDA 2ZU4A 2FEQH 1IQKA 3VGCC 3S7HB 2EC9H 2ZI2H 3F1SB 2ZU3A 5DP3A 3GCHC 1C5OH 1K1JA 5F8XA 1UCYK 2A7JA 1RS0A 1WQVH 1QTFA 4TWWA 1GBBA 4X2YA 1LHDH 2LPRA 3RXCA 1O2NA 1KDQA 3U1JB 1VITG 1O5DH 1MCVA 1CBWB 1OKXA 5L30H 1L1NA 5EQQA 1V2TT 4X1SU 5JDUB 3PROA 1F5KU 1MAXA 2FI5E 1UCYE 1TGCA 2FYQA 3O8DA 1AIXH 1A0HB 4A1TA 2WPLS 2Q6GA 2FX4A 2O8LA 3TPIZ 4GVUA 1VGCB 3TVJB 1DUAA 4BNRA 1CHOG 4RKJB 1D4PB 3BG8A 1JRTA 1MKXH 1GPZA 2GT8A 2PV9B 2BD5A 1H9LB 3PWBA 1YM0A 1YF4A 2G81E 1EPTB 4X6OA 1QJ7B 1HUTH 1S0RA 3A8BA 3FVFB 1P9SA 3BTWE 2BTCE 1KXFA 3R0FA 2HNTC 5C3NA 1YGCH 4MPVA 2JH0D 2ZHEH 1IQGA 1LDTT 4IW4E 3LU9B 1QHRB 4I8GA 4AFUA 2EI8A 2VWNA 1GJDB 2C8ZB 1HAPH 1VCWA 1EXFA 2A5KA 1O35A 4FU7A 5JB9S 1UMAH 1P06A 1OPHB 1LHGH 1RGQA 2F9UA 3VB4A 3SNBA 4DJZB 1BUIA 2HNTE 3DD2H 1H1BA 1ZHMA 2ZWLH 2ZU5A 4JYUH 4X8SH 1AWHB 4MVNA 1JOUB 3SZNA 1QCPA 5JBTA 5E0HA 2A2XH 1SVPA 3SV2H 3RMLH 2BX3A 4MPXA 3GDUA 2ZG0H 3LKWA 2ZPSA 4E7RG 1O3FA 1O3EA 4DGJA 8LPRA 1DITH 1K28D 3VB5A 1EZSC 1EJAA 1NESE 1HAIH 1HLTH 1KYNA 4IMQA 1HAVB 4ZKRU 1TFXA 3S7KB 3UR9A 1UTJA 4JYVH 1S81A 1FV9A 2VGCB 1HJ8A 3A7YA 1LKBA 1MCTA 1HJAC 5GXPA 2PKAB 4DT7B 3ATIA 1SFIA 1W14U 2EI6A 2GCHF 4I8KA 1WQSA 4ZKNU 3SU6A 4UE7H 1GBMA 5BRRE 4AORA 3RU4D 5A2MH 1QIXB 5E0GA 3Q77A 4A1XA 1GBIA 4YM9A 1BJVA 1G32B 1TLDA 4XOJA 3V13A 1C5SA 3GCNA 2TGAA 1AN1E 1HAGE 3QWCH 2ZFRH 5HYOA 1EUFA 1KY9A 1PPBH 2GZ9A 1YPHC 3E0NB 1Z71A 1TA6A 2C93B 3E91A 1G3CA 1GJBB 3PO1B 2R0LA 2CHAC 5ETXA 4K60A 3RXOA 3M3VA 1HPGA 2G00A 1ABJH 1ZGIA 3PTBA 3SJKA 2FOHA 5ESBA 1BDAA 4RN6A 5JYIA 3HPTB 3QTOH 4NSVA 4K8BA 5EPNA 1AUJA 2OQ5A 4ZHMU 1GBCA 4I33A 3RXMA 2ASUB 1LHFH 3SI3H 2WPJS 2ZHDA 1TRMA 4YO9A 1PYTD 2Z3DA 2VJ1A 1PPFE 3ZZDA 5A09A 1YC0A 2PKSB 4AGJA 1HFDA 1THPB 4BAQB 2FODA 1GJ6A 4FVDA 1YPEH 2F83A 4ABGA 4K1EA 1YCPH 3P6ZB 4Q7ZA 1AZ8A 1H8IH 4ASHA 3U9AH 3MTYA 3LDXH 1OSSA 2WPKS 4AFQA 3ATLA 3F9EA 3U8TH 2Z9IA 4ZHAA 1YPKH 1Z8GA 1W0YH 5F8TA 5FBIA 1GVKB 1P12E 1C1TA 1GHWH 3TK5A 2FLBH 2BY5X 4GSOA 1L1JA 1CE5A 1ANBA 2GX4A 3SGQE 1ANEA 1NM6A 1FZZA 1RIWC 5L6NH 3TLOA 1FY8E 1OWKA 1Y5UT 2QXIA 3GDSA 4ZH8A 3N7OA 2ZHQH 1ZRKA 4ABFA 4FU8A 3FP6E 3HGNA 1VZQH 1AE8H 3RP2A 2CGAA 1Y3UA 4B75A 1V2LT 4ZKSU 1TWXB 5T3HA 1B0EA 3RC5A 1A3EH 3ESTA 3QZRA 2BDYA 1O3JA 2VIDA 1W7XH 2ZPQA 3HK3B 2UWOA 1XMNB 2QYIA 3A88A 4H42U 2ODQA 1O5FH 1IHSH 1TBZH 3SGAE 1D3PB 2IJOB 2ZZUH 2FI4E 2BLQA 1LVMA 6CHAC 5G4BA 2FESH 1MTVA 4BXWA 3UNSA 3BTGE 1Z8IB 4DY7B 1C2LA 3M5NA 5CMXH 4GAWA 2FS9A 2QGRA 1C2GA 4XBBA 2HALA 1HRTH 2NU1E 5EPYA 1DWEH 1UTQA 1UTLM 2P94A 8KME2 3K9XB 1ANDA 1D3QB 3SU5A 3EA7A 2FOMB 4INHA 5ESTE 2VIWA 5T6GA 5E2PA 1AMHA 1QB9A 1O2RA 2BY9X 3M7QA 2A1DB 4GCHF 2H6MA 1HIAB 2TRMA 2Z9LA 3SN8A 4NCYA 3NCLA 1FY3A 1MD7A 4B2CA 1TGTA 7ESTE 2FYRA 2HOBA 2Y7XA 2GCTC 3A86A 3BEUA 5C20A 1GG6B 1AQ7A 1TNIA 2A45B 3DT0H 1C1SA 4ISOA 1JIMA 4YOGA 4CRDA 4A5TS 3SJ8A 1LVYA 3LH3A 3PB1E 4MLFB 3UOUA 1FPCH 2AGIX 1OWDA 3PMHB 3RM0H 3OSYA 1DPOA 5FXLA 1YLDA 1O2UA 2PWXA 1DS2E 4BANB 2FOCA 1IQLA 2FX6A 1QB1A 4CREA 1GHVH 1OS8A 4OS4A 4I7YH 2I6SA 3SNEA 3L33A 1V2MT 3RXIA 1KTSB 2ZCKP 3P8GA 1K9OE 1MBQA 5F8ZA 1JWTA 2V3OH 4GCHG 4NZLA 1NC6A 1WSSH 2A4QA 3FP7E 3SQEE 2WUBA 2P3FH 3Q3XA 1E35B 1B0FA 2J2UA 1FIZA 2Q1JA 3PWCA 1BMNH 1CO7E 4Z6AH 4U01A 1SLUB 2F9OA 1YLCA 4VGCB 1Z1JA 1OWIA 3A89A 3A81A 4UFEH 4ISHH 1TQ0B 1UK3A 1WUNH 4NFFA 1O3IA 2C8WB 2ANKH 2XC5A 1NFUA 2KAIB 3B8JA 1TRNA 1AFQB 2THFB 2ULLA 2R0KA 4FUEA 1HAZB 4FUBA 2ESTE 1ID5H 3ZZ3A 2C3SA 1C5PA 2VH0A 1C5NH 3SOSA 2STAE 3MH4A 1T4UH 1CA0B 2H5CA 3G01A 3ZZCA 4CR9A 1PPGE 1YCPM 5DPAA 5T6DA 1W13U 1SGPE 4LZ1H 2VNTA 3QN7A 4AN7A 1K21H 3BTFE 1OP0A 1TONA 5TCAA 4LOYH 1K22H 1SGIB 2BXUH 4OS2A 1C5ZB 2NU2E 2ZF0H 2F91A 1CVWH 3MHWU 1CA8B 5JBCS 4XBDA 1DWBH 1HXFH 1P04A 1A5HA 3P8OA 4NA7A 1NU9A 2QCYA 2WV4A 1HV7A 1ZTJA 4AOQA 8ESTE 4MNYA 1SG8B 4Y7AA 4AFZA 2PUXB 4DVAU 2B8OH 2CJIA 1IHTH 3UREA 1JXPA 1KXAA 1E38B 4WMEA 1TPOA 1XKBC 4JZ1A 2R2WU 4YOIA 1GHZA 4O3UA 3EDXB 4MPUA 5EG4A 1ZOMA 2TGDA 4X6MA 7KMEH 1BT7A 1N1LA 3RLYH 3VGCB 2XNIA 1ELFA 3MFJA 1UK4A 2Z3CA 1V3XA 3GCHB 3TGJE 3BTHE 2Q6DA 4MG3A 5I25A 3SBKA 3T29A 2C8XB 3SV7A 1FN8A 1TX6A 1T8NA 3LGIA 1C4U2 1EZQA 1FPHH 1NS3A 3JZ2B 4TYDA 1BJUA 3KN2A 2C8YB 1F5LA 3RXLA 1S0QA 2ZU2A 1GMHG 2XC0A 1UO6A 3BG4C 3RXEA 2GMTC 3U69H 4ABIA 1O3HA 1TMTH 3MU5A 1ZTLA 2TBSA 1ZZZA 3RXKA 4KP0A 1O3AA 5FPTA 2BHGA 6LPRA 1UHBB 3MNCA 2J4IA 2XBVA 3LPRA 2CMYA 1WYKA 2M5TA 4MNXA 1AY6H 1SGCA 2ALPA 1SLVB 1UVOA 1HNEE 2QXHA 4XE4A 5K0HA 1BMMH 3STJA 2Y80A 2W3IA 4GPGA 1OP2A 5H4IB 1XUGA 3A82A 2BVXH 1GI6A 3L3TA 2BD9A 3EQ0H 2GV7A 3UWJH 4CH8B 1BITA 3ODFA 3T27A 2FOAA 4R8TB 1CT4E 1XX9A 1SMFE 1VITF 1UTMA 1U6QA 5DP4A 1CT2E 3GDVA 3V7TA 1C4Y2 1TE0A 2D26C 2BQ7B 3QO6A 5EODA 3CS7A 3A7WA 4H4FA 2AS9A 1LPZB 3M5LA 2BDBA 1J9CH 3LC5A 3UNQA 4WJG2 3T2NA 1BBRK 3RMOH 1ZGVA 4JCNA 1SQOA 1FQ3A 4DCDA 1HJAB 2BLWA 1FAXA 4I8JA 4Y7BA 1AD8H 1DDJA 4CHAC 3P17H 5JBBS 3EA8A 1SHYA 1LVBA 1PPEE 4Y0ZE 1ESBA 1BBRE 2JH5D 1O0DH 1B5GH 1VCQA 3EYDA 1TQ7B 2BVSH 3ZVBA 2FOGA 3LH1A 3SJ9A 1EOJA 1BB0B 4B2BA 4SGBE 5DP5A 1O2LA 1O2XA 1GBAA 1UVTH 4NIVA 3ZVFA 2J92A 2ZDMA 2FS8A 1C1WH 3IITA 1OYQA 2P3TB 2RA0A 2EEKA 2VB0A 1QRXA 2YNBA 1C5UA 3VB7A 3F9GA 2ZFTA 3MH6A 1G3BA 1F0UA 3NKKA 1QQ4A 1VITH 1GI0A 1PPZA 1QRWA 3FFGA 5K7RA 1GJ4H 1Z6JH 3V0XA 2VWMA 1KLIH 2CHAB 3TGKE 2OD3B 1F0SA 3K6YA 3RXUA 2O8MA 1PQ8A 1PJPA 3MU8A 1SGTA 4YLQH 3GY5A 3JZ1B 3CS0A 4KTSA 4WMDA 5DP9A 4KGAA 4Y0YE 1SGEE 1RTFB 3RXTA 1ACBE 1SSXA 3ZV9A 2YNAA 5EOKA 5AHGH 3ZZ8A 2Y82A 2GV6A 1D6WA 3UWIA 4WVPE 2Z94A 2SGPE 4TY7A 5TJXA 3A7ZA 2VIQA 1AI8H 1C1NA 1N8OC 3RDZA 2STBE 4Y6DA 3KQBA 5FX5A 4AG2A 2P8OC 1IOEA 1W7GH 1GBHA 1GI2A 3SO3A 3MYWA 4WMFA 4X8VH 4K1SA 2QXGA 3KHVA 3M5MA 2VIPA 4WXVA 1TPPA 1G3EA 2HNTF 3GY7A 1JRSA 1RJXB 1OYTH 1SGFA 1ELBA 3UR6A 2D2DA 3LC3A 5GCHF 1MKWH 1W3CA 2GKVE 3GISB 4YESB 1O5AB 2PGBB 3CENA 3ZV8A 2ANMH 4D9QA 4H6SB 1Y59T 3VB3A 5EGMA 1J14A 2XWBI 1BTZA 1AZZA 3A8DA 4NWLA 1UCYH 2ZQ1A 2Z9GA 1SR5C 1RIWB 1KTTB 4PROA 1O3PB 5FBEA 1O5EH 1O3CA 1KIGH 2ANWA 1CU1A 2BD3A 3V12A 2XXLA 1QNJA 1EAWA 3DFJA 9LPRA 1O3BA 3BSQA 2ZGJA 3HKIB 3GOVB 2QV1A 3A7TA 2SGEE 1XVOA 1HJ9A 1K1MA 3NK8A 3OYPA 5DG6A 5DGJA 3SI4H 1A1RA 4O97A 1OXGA 1GI7B 1O2MA 1CGIE 1KXDA 1Q3XA 1GMCF 1TGNA 2ZTZA 3QK1A 8GCHF 5GCHG 1GI3A 1GJ8B 1C2HA 4CRCA 4X1PU 1T8MA 5J4QA 3F9FA 1GVZA 2FTMA 5EXLA 3RMMH 2AEIH 1PPHE 4M7GA 3UUZA 6CHAB 3MH5A 1CBWC 2R2MB 1J15A 2GVFA 3EGKH 2VVUA 3MO9A 4ZAEA 1H8DH 3A7XA 4WY3A 4ZXXH 3SU0A 3UQVA 4ISLA 2WINI 4D7GA 1Z6EA 4NGAH 1CSOE 4TPYA 1P0SH 1C4V2 1J8AA 1F2SE 1QL7A 1QURH 1XVMA 4A7IB 1GBKA 1QGFA 2B0FA 1C9PA 2NU0E 2P93A 3MNBA 1UTOA 4JK6A 5GWZA 4IS5A 5FAHA 2TGTA 1F0TA 1IQNA 1MU6B 2BD2A 1SGNE 1YPHE 3SUFA 1GMCG 2ZHWH 1W10U 4DG4A 2VU8E 5PTPA 8GCHG 1O5CB 1DSUA 3MH7A 2AMDA 3UOPA 1ELEE 3PTNA 3LT3A 3RM2H 1O2KA 1O3MA 1GCDA 1TNHA 2GCTB 1SGYE 1XUHA 5EQRA 1ZPCA 1EASA 1NRNH 3I78A 4K1TA 5F03A 1YPJH 1T31A 1ELTA 1NTPA 1DT2A 3T62A 1C1OA 2NU4E 2WV5A 4OS7A 3UTUH 1G3DA 4ABEA 1G2LA 1BRUP 2AGGX 3PMJA 1FI8A 3RXBA 2GZ8A 2PFEA 3K2UA 4Q2KA 1PQ5A 3SJOA 3RXPA 1KDQB 2Z3EA 3TNSA 1FDPA 1ZPZA 3OY5U 1RFNA 3LGWA 2OBQA 1K1IA 1QA7A 1GGDC 3ODDA 1Y3WA 2BMGB 2FP7B 2QN5T 1G36A 5E2OA 5LPEA 2A4OA 2HGTH 1P05A 4ZXYH 3W94A