4AOQA

Cationic trypsin in complex with mutated spinacia oleracea trypsin inhibitor iii (soti-iii) (f14a)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/inhibitor
molecule keywords CATIONIC TRYPSIN
publication title Structural Characterization of Spinacia Oleracea Trypsin Inhibitor III (Soti-III)
pubmed doi rcsb
total genus 60
structure length 223
sequence length 223
chains with identical sequence B, C
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4aoqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4aoqA02
1TIOA 4TPYA 1GI5A 2FOGA 2YNBA 1T8MA 1O30A 4B2CA 4AG1A 2ODYB 1P03A 3BSQA 3PLBA 4YT7H 2A32A 3LJOA 2XCFA 1C1SA 2YOLA 1B7XB 2ZGJA 4O3UA 1FY3A 5L30H 2WUCA 2OCVB 1QJ6B 2ZHDA 1NRRH 1BITA 1IQNA 2A31A 2AIQA 1IQIA 1NFXA 2BVRH 3DFJA 3S7KB 1B0EA 1OXGA 3MH4A 2GCTC 3M37A 1YPEH 3GY6A 1FDPA 3MH5A 3FP6E 3FP8E 3SHCH 3V0XA 3NK8A 1AFQC 1PQ8A 2O9QA 1GBKA 1HB0B 2RCEA 3C27B 4NZQA 2R0LA 2VH0A 2NU0E 2H9HA 2HALA 2BDYA 1C1WH 1SG8B 3SHAH 1A7SA 2FOMB 3LIWA 3RXIA 1EJMA 2BLQA 4WH8A 1XXDA 4GUXA 1LHEH 2DUCA 5EOKA 2ZCLP 2BD9A 1SOTA 3TJNA 1A5IA 1O0DH 3P6ZB 4WXVA 1HDTH 2AMDA 2W5EA 3BTTE 3ZVCA 4U32A 1VJ9U 5EQQA 1QQUA 1V2PT 2FEQH 3TGKE 2A0QB 1OWJA 2VIQA 2A4QA 3Q3KA 3A7YA 3RM2H 1GI1A 1XUKA 1QJ1B 1TGNA 5AHGH 3IG6B 3CENA 2THFB 2VIPA 1FJSA 5FPTA 1GJ8B 1UTPA 1S83A 1QFKH 4WF8A 1RIWB 5FCRA 5FHTA 1EP6A 1FMGA 2V0BA 1EAXA 3SW2B 1P01A 4CRBA 1BMMH 1LHFH 1PPGE 1C2JA 3Q77A 3ZYDA 3BTFE 2XC4A 4ISHH 3SUGA 2ALPA 4YESB 1IAUA 3P8FA 1WTGH 1ELTA 3T25A 3MWIU 1MCVA 4K8YA 4Y7BA 2CV3A 3E16B 2XWBI 3FZZA 2HOBA 2TBSA 1C5LH 2EC9H 1ELDE 1ETRH 7ESTE 1TBQH 3UIRA 4DJZB 2F3CE 3KF2A 1PPFE 1O2UA 1AKSB 4CHAC 2WV5A 2VU8E 4AGJA 1EJNA 4F4OC 2Q6DA 3UPEA 1OWIA 1DXWA 3RXUA 4ZH8A 4BXSA 1HAOH 4CREA 1UVSH 4NA7A 2A2XH 1CQQA 2ZNKH 1KXEA 1HAIH 1T31A 4I32A 2STAE 1HIAA 2ZDLA 1ZTLA 1P2OA 4CRDA 2CMYA 4IC6A 5E0HA 3H5CB 1VITG 2ZU2A 1NRPH 1UCYK 4DIIH 4U30A 1G3BA 1GVKB 2HNTE 2ZF0H 1HJAC 2ZCKP 3FZDA 1EZUC 4GAWA 3RXJA 1VCWA 4IN2A 4JZ1A 4X2XA 3BIVH 2A7CA 2ZI2H 1S0RA 1TMTH 3SI4H 1Z8JB 4AB8A 3T26A 1OX1A 2BLWA 2VJ1A 3FP7E 5FBIA 3RC5A 2WPKS 1LKAA 4SGBE 1ESAA 3GCTF 1KXAA 1GBBA 1O5FH 3S69A 1DUAA 1VGCB 2C8YB 2NU4E 4Y8XA 1H9HE 1V2QT 3U8TH 1QURH 3SU4A 1V2NT 5EODA 1Y3WA 1TNJA 3M7QA 4X1QU 1C5ZB 1J14A 1O2PA 1NU9A 2BXUH 4BTIB 4JCNA 3F9EA 4CR9A 1SGFG 3RXPA 1C1MA 1ZSJA 2G51A 1TX7A 1Z7KA 2EEKA 3NKKA 3BG8A 2QAAA 2ZFQH 1GHZA 2J38A 3QX5H 2WYGA 1ELEE 1K1NA 2FLBH 3TK9A 1AB9B 1NESE 1ZOMA 3PWCA 3SJ8A 3PMAB 5FPSA 3PLPA 3A7ZA 1OKXA 1S5SA 2QA9E 2GMTB 5L6NH 1ID5H 2BM2A 1UTMA 3B23B 3PYHA 2G5VA 1NY22 3UNQA 2PFEA 3QZQA 4UFGH 1ETSH 1IQFA 1O5BB 2W3IA 3KIDU 3STJA 4I8KA 2J94A 3SI3H 1ZR0A 5EW2H 1DLEA 1FV9A 3MNCA 1PYTC 1SPJA 1G2LA 3K9XB 3RXBA 1SGEE 1ELFA 1C2GA 4XFQA 3GCHB 1CHOF 6GCHF 1BJVA 4AZ2B 4GPGA 1EUFA 4X2VA 1MTUA 2VINA 2PR3A 4MPWA 3UOUA 1B0FA 1MU8B 2BOKA 2F9PA 1AE5A 1VZQH 2XNIA 2OQUA 2J9NA 5J4QA 4O3TA 2PKAB 2A7HA 2J34A 3ITIA 1E0FD 3LPRA 4YM9A 1TB6H 1YPHE 1WQVH 5EQSA 1EX3A 1KXFA 1ZYOA 2BD4A 5E0JA 5LPRA 2QXIA 1AKSA 4TY7A 3TGIE 1ZJKA 4Y7AA 4K1TA 1NU7B 2QIQA 3PO1C 1O38A 1GI0A 1WOFA 2GT7A 1GG6B 1H9IE 1F5KU 3OSYA 2GV6A 3SU6A 4ABFA 2OINA 1C5OH 1BBRE 3BTWE 1ZSKA 8ESTE 1AUTC 4ZXYH 3PTNA 1O2WA 1A61H 1XUIA 1LQEA 5EQRA 2JETC 1O35A 1EB2A 4UEHH 2FX6A 2G8TA 1DUEA 3PV4A 3UFAA 2GZ9A 1GMDF 4NFFA 2BDAA 2G4TA 4I33A 1W3CA 1P0SH 2ZCHP 1ZTKA 5FX6A 1AVXA 1P3CA 3E90B 1KLJH 3O8DA 2OBQA 4XDEA 1LHCH 1GMHF 1O3NA 1PPCE 3I77A 3M35A 4H6SB 2F9UA 4IS5A 1SQAA 2AYWA 1JIMA 1A4WH 1EOLA 3LONA 4D9RA 2H5DA 3SNBA 4X8SH 2ZDAH 4AYYB 1OWDA 1T32A 1YYY1 1B5GH 2SGEE 5TCCA 4MDSA 2PSXA 3EA7A 3RU4T 3O8RA 1V2WT 4TPIZ 3KGPA 1OS8A 3SO3A 1SI5H 3RXRA 2FOHA 2WPHS 1FONA 3MMGA 1JOUB 5HMAA 4OS5A 1A2CH 1O37A 1BUIA 3F9GA 3GDUA 2R3YA 3QWCH 2BXTH 3GY4A 1DOJA 4MPUA 1DFPA 1F7ZA 1T4UH 2A2QH 5F8ZA 4ZROA 5F03A 1O3KA 1WUNH 1O3CA 2H9EH 3GY3A 3SU5A 1AQ7A 1UTJA 2UUJB 3ZVAA 4K8BA 1W10U 2G81E 3ZZ8A 3BTME 1L2EA 1GHWH 2P8OB 1EQ9A 4D7FA 1N6YA 1BMAA 1XVMA 1K1PA 1V2MT 1EKBB 3UREA 1TOCB 1MTWA 3NCLA 1CGHA 3E0NB 4GCHG 3UTUH 1OP2A 1P3EA 2A4GA 1QR3E 1OYQA 2B5TB 4JZDH 1FN6A 4A1XA 9ESTA 1W2KH 3SGQE 1MKXH 3SNDA 3SU3A 4BAHB 3SGAE 1UVOA 3PLKA 3O8CA 1V2KT 1ZMNA 2HVXA 1UTLM 2G4UA 7GCHG 4B2BA 4RN6A 4Y11E 2Z9GA 1BTUA 1XKBC 3A8CA 2PKAA 1UTQA 4VGCC 3GDSA 5DP6A 4FUBA 2ZWLH 1TFXA 1FAXA 1BQYA 2AIPA 3HGNA 2P3FH 4MVNA 3QTOH 5A2MH 4M7GA 4XSKU 4ZXXH 1C5XB 2SGFE 1K28D 1BIOA 1V2UT 3VFEA 4ZHLU 2FOEA 1GDNA 1JXPA 1Y3UA 5HGGA 1N1LA 1S0QA 3ZVBA 4HTCH 2OP9A 5EPNA 2K1QA 2VVCA 2P3TB 1V2TT 1CT0E 1SLUB 1F2SE 5C1YA 4JK6A 1OWHA 1W8BH 4ABBA 3L6PA 4K1EA 4I8JA 3TH2H 1QL9A 4Y6DA 4I31A 5JBBS 1O2NA 3U1JB 1AVGH 5DP5A 1FAKH 1O3AA 1MBMA 3E0PB 4ZKSU 3EAJA 3FFGA 4B73A 5AVDA 1LVMA 4TYDA 3B8JA 2BLVA 1TA2A 2A7JA 2ZHFH 1GJDB 1NM6A 2QGRA 2AGIX 1XX9A 2ZTZA 3BEUA 1EPTB 2ZDKA 3M7TA 4Y8YA 1UO6A 3NXPA 1N8OC 1Y3XA 3BG4B 4Z0KA 4ZKRU 3QDZB 2ZG0H 1P57B 2HGTH 1IHSH 3RC6A 1HAPH 1S84A 1PQ5A 1WV7H 2SFAA 2ESTE 2D1JA 4YTAA 3P8NA 4IMQA 4X2WA 3S0NA 1AUJA 4JYVH 4BAMB 1G30B 1DX5M 1HAGE 3ZVEA 2BOHB 1IQJA 1O2KA 4X1NU 4WMDA 3BF6H 3GY7A 2B9LA 2XW9A 2PTCE 3BTDE 4KGAA 2FDAA 2Y82A 2HNTC 3HK3B 4ZMAH 3GOVB 1TRMA 3IITA 1GJ5H 1TPPA 2F91A 3MHWU 2ZTYA 3E6PH 1O3BA 3ZZ6A 1BA8B 2O8UA 1TX6A 1P2QA 3RXTA 1KXBA 2XYAA 1Z8GA 2ULLA 2Y5GA 1ZLRA 3A80A 4UE7H 1OOKB 1Z71A 2EI6A 2HPQH 2ZU3A 5JBAS 1GHAG 1FPCH 1MD8A 5A09A 2PKSB 1BCUH 3DUXH 4JYUH 3AAVA 2FODA 4FUEA 1F0SA 2NU3E 4JZEH 4XBCA 1CU1A 1C1UH 2WPLS 1CT2E 1A5HA 2QN5T 3RXAA 1Z8IB 5GIBA 2ZU1A 3SJKA 3ZV9A 3MU5A 4AX9H 3A7TA 1NC6A 3GY2A 1GWAA 3T27A 1MZDA 4Y8ZA 4BXWA 4Y10E 3ODFA 3RUOA 3SNCA 2C8WB 3A81A 3TGJE 2BX3A 2ALVA 1JRSA 3VEQB 2AS9A 3LGTA 1KTTB 1OP8A 2FOAA 1QTFA 4Q80A 1MTSA 1BTZA 4JYTA 2OUAA 3A82A 2AEIH 2BD3A 3L3TA 4X8VH 2QCYA 1D3QB 1FY1A 3DD2H 1JWTA 4FU8A 4JZFH 5EU8A 3Q3YA 3EGKH 3A7XA 1C1QA 1O2HA 1TYNA 2TPIZ 5HM2A 5GWZA 3P17H 5CHAC 1HRTH 1C4U2 4DT7B 1GL1A 1HXEH 1DWCH 1RRKA 4ABAA 4I8LA 1DXPA 4R0IA 3P95A 1HFDA 3RXSA 3MYWA 4UONA 2C4FH 1SLXB 4BOHA 1KY9A 3RMOH 2A5AA 3U69H 1GHXH 4ZKNU 1KXDA 3MI4A 3NWUA 2BDIA 3I78A 1HUTH 3GDVA 2RA3A 2ANYA 2A4RA 1L1NA 1XKAC 3RXGA 3VGCB 2Y7XA 1V2LT 4KP0A 1XVOA 6CHAB 7LPRA 4CRAA 5JYIA 3MFJA 2PLXA 1YPHC 2PUXB 2BY6X 4ABEA 1MKWH 2ZPQA 4DURA 3NUMA 1EPTA 3TJUA 1TOMH 3V13A 2C3SA 5K0HA 3HKIB 1YF4A 2ZHWH 1DPOA 1BHXB 1TQ0B 3D62A 1ZHPA 1C1PA 2GZ8A 2ZGCA 2OC8A 1ETTH 1KYNA 1O3GA 2CF8H 1YCPH 1O31A 2FS8A 2OXSA 1CE5A 2Y80A 3SUEA 2OC0A 3ZZDA 2Z6BD 3KQCA 1QHRB 2STBE 5C5NA 3KCGH 2H5CA 5EXNA 1TPOA 2Q6FA 7GCHF 1TGSZ 2BLOA 2VIWA 2SNWA 3TU7H 3PROA 1AI8H 1T8OA 1NRSH 1P04A 3SUFA 3VB3A 4NFEA 3E8LA 4BAQB 4MLFB 2PGBB 4BAKB 2ODQA 1C5TA 1OYTH 1KIGH 2ZFTA 2FP7B 3D65E 3IWMA 3SJ9A 1O2IA 4U01A 1IQMA 1PPZA 1GI4A 5T6FA 4AYVB 4CRGA 2ZFPH 1H1BA 1GCTB 2SGAA 1ARBA 1TALA 4MPXA 1BTWA 1TGCA 2XCNA 2BMGB 1JMOH 1YPKH 1J17T 1A0HB 1GJ6A 2KAIB 2BZ6H 2SNVA 1RTLA 4WVPE 1F5LA 5E2PA 2P59A 3BTHE 1KDQB 1GG6C 2WYJA 2V35A 1GJCB 5F8TA 4AORA 1M9UA 5FXLA 5E0GA 2CHAB 4AN7A 1O3IA 2VVUA 2FZZA 4UD9H 4Q7YA 4PROA 3A8DA 2CF9H 3Q00A 1AY6H 3PB1E 2VGCC 5I46H 1EJAA 4RSPA 4THNH 2GCHG 3OY6U 3RM0H 1CA0B 4YO9A 4Z6AH 4OGXA 3ATMA 3BTQE 1K1IA 3STIA 3ESTA 2ZFRH 3GISB 2I6SA 2CJIA 1LHDH 1SR5C 3LJJA 2ZDNA 1EAUA 3V3MA 1HJ8A 1GMCF 1T8NA 1EATA 1L4DA 2PGQB 4A7IB 2OC7A 2UWOA 1A5GH 4LXBH 2FXRA 1GHBF 3A84A 4FVDA 5E8EH 2HWLB 1K1LA 3ZYEA 1CBWB 1P8VC 3AW1A 2CXVA 1AIXH 2TGDA 3LH3A 1QL7A 3ZZ9A 1CA8B 1O2YA 2ZU5A 5C1UA 1W11U 1ZPZA 4NIVA 1P05A 1TBRH 1BHXF 4O97A 4OS7A 3NZIA 3EYDA 4Y0ZE 1DY8A 3A85A 3S9AA 2GZ7A 2Y5HA 3DA9B 3ZVFA 5F6MA 4Q7ZA 8GCHG 3LGVA 1ANEA 2BDGA 1Q3XA 2VWOA 4MTBA 1EP5A 4WY3A 1A0LA 4OS1A 3M3TA 1G36A 2ZIQH 3GCNA 4NWKA 1HBTH 3LGWA 3QO6A 1WCZA 4LZ4B 1K9OE 4WMEA 1UCYE 1ZHMA 1LPKB 3ATIA 1GBTA 4WMFA 1E38B 3HATH 1BTXA 4D7GA 2PSYA 3T28A 5BPEA 2F9OA 3F1SB 1C1OA 2BQWB 2GCTB 3RC4A 1TWXB 3RMLH 1DDJA 4MNXA 2FYQA 5EGMA 2BHGA 4A5TS 5JPMH 1ZJDA 1AFQB 1SQOA 2UWLA 4AFUA 1HAYB 2XWAA 2F9BH 2Z3CA 2J4IA 2ZQ2A 4UFFH 1TMBH 3SBKA 1J8AA 1GJ9B 3M7UA 1A0JA 4FUJA 5G4BA 2BTCE 2G55A 3FAOA 4D76A 2BDCA 4GHTA 2TRMA 3NPSA 1QGFA 3ZZ5A 3T2NA 4X6MA 3RXEA 1DWDH 1GDUA 3SQEE 3TK6A 2PUQH 2VWLA 4RKJB 5JDUB 2TIOA 1L1GA 1RXPA 1ZHRA 3UR9A 1QBNA 1XUGA 1UK2A 4O9VA 1NS3A 3QUMP 1TPSA 2KAIA 1WTHD 4NCYA 1RFNA 3M5LA 2P95A 3U9AH 1YPGH 8LPRA 1KDQA 3VXEH 2VNTA 1O5AB 4BTUB 1MD7A 2V6NA 3M5MA 4ISNA 2VB0A 3URDA 1BJUA 1HYLA 2P3UB 1FPHH 4XBDA 1S85A 5C20A 1ESBA 3SNEA 2P93A 3RXMA 1O2QA 1QB9A 1PPBH 2VIVA 3RDZA 1Z1IA 1G3DA 2UUKB 5AFYH 2SGDE 2CN0H 3KHVA 3TJOA 3G01A 4FUIA 4NIYA 1YKTA 1J16A 1BT7A 1WSSH 4A1TA 3C1KA 1Y5UT 3RXDA 3SUDA 2B8OH 2Z9LA 2OD3B 3SV7A 1CO7E 4TWYA 1U6QA 1Y5BT 1O32A 3B9FH 4U2WA 3LU9B 4HI3A 1J9CH 3LT3A 3W94A 4K1SA 4ISOA 1YP9A 2EI7A 5C1XA 1ZPBA 4KTUA 1UTOA 1QY6A 1P2IA 1DSTA 1N6XA 3HK6B 1X7AC 3BV9B 1K22H 1DT2A 2W26A 4I8HA 1UTKA 1GBCA 2PV9B 1FZZA 1SB1H 2AH4X 4ABIA 1ZRKA 4DY7B 4AFZA 3AASA 2Y6TA 3JZ1B 4HGCA 3FANA 1V2OT 1SSXA 3PM3A 5A8XA 1H9LB 2XTTB 1HJAB 1DSUA 4MNYA 5TJXA 1LVBA 4LK4A 3QGNB 1L4ZA 2NU2E 4K60A 1RTKA 1DVAH 5J4SA 1NFUA 2CGAA 1QB1A 1P12E 3TK5A 1OWEA 1GI6A 3ENSB 2BY8X 2R2MB 4CBNA 1SHYA 1SGDE 2VWMA 1C1NA 1RJXB 1C2FA 2PKSC 1DWEH 2Z94A 5AFZH 2FTMA 3S9CA 4ESTE 5DP9A 1MKWK 2BB4A 3A8AA 5B6OA 3UQOA 1O2JA 3TITA 2O8WA 4KTCA 1PYTD 1O3FA 1ESTA 3A8BA 2BDHA 3LOXA 3SGBE 3PWBA 2JH6D 1SFQB 1MBQA 2Z3DA 5GPIB 1FY8E 1V6DA 1LKBA 1O2LA 1YCPK 3QTVH 3M5OA 1UK4A 1ZGIA 4NSYA 2H1UA 5ETXA 2J92A 1YLDA 3MO6A 1D3DB 4YLQH 2GX4A 1MCTA 3F9HA 5FAHA 4X8UH 1SBWA 1D3PB 1VITF 2Z9JA 3ODDA 3KNXA 1AGJA 1GI3A 1CT4E 1GCDA 3RMNH 3BIUH 1LHGH 2BD2A 1C5NH 4OS4A 2F9NA 3GYMA 2Q6GA 3JZ2B 1XUJA 4JK5A 2FI3E 3TPIZ 2NWNA 4KELA 3EQ0H 1ZRBA 4QT8C 1T8LA 1JBUH 2FI4E 3F68H 3U98H 1CSOE 1V2JT 1F0TA 3MTYA 4FUGA 2BVXH 4DCDA 1L0ZA 4I7YH 1GBMA 1RGQA 1W13U 2FOCA 3DT0H 1EASA 1GBDA 1D4PB 3RLWH 1FN8A 2F9VA 3M5NA 1C2EA 1TNIA 1AE8H 1GI2A 2FX4A 6LPRA 1WBGB 4A6LA 1Z1JA 4ABJA 4DIHH 2WV4A 1QNJA 4MNWA 1SGPE 1SQTA 1WAYB 3MU0A 4FXGH 3D49H 4HZHA 1DE7H 1T4VH 1ELBA 1C2MA 1TPAE 3PO1B 2V3OH 3SJOA 1TNGA 1BTYA 1GHYH 1SGFA 3GYLB 3VB5A 2ZKSA 5ESBA 1SGTA 4E06H 3QK1A 1ORFA 1O36A 2V3HH 2ODPA 1IQHA 5DO4H 1ACBE 3BEFB 1AU8A 2ASUB 2JETB 1MAXA 2ILNA 1XXFA 3A89A 4ZHAA 3W95A 1RIWC 1MU6B 1RD3B 1EXFA 1GJBB 2BYAX 2H2ZA 3VB7A 2VVVA 1HXFH 1ZMJA 2FM2A 2G5NA 4DGJA 1Y3YA 5EW1H 1UVTH 1GBAA 3ATKA 2ZDMA 3KQBA 2XBXA 1BBRH 1GDQA 1NO9H 3T29A 3ZZ7A 3KQDA 1SVPA 1C5YB 3LC3A 3GCTG 3K65B 3HPTB 1AO5A 5C5OA 3PMJA 1HAZB 4FUFA 1UVPA 1K1JA 3E1XB 2ANMH 3PMHB 2VH6A 3K6YA 2G00A 3SV9A 2BZAA 4B75A 1LVOA 1VITH 3UR6A 2FIRH 2CHAC 2FS9A 1V2VT 1V2RT 4INHA 3RXQA 1UVUH 8KME2 1BRBE 4CRFA 1CHGA 1BDAA 1YPLH 1TABE 1DM4B 5T3HA 4K2YA 1KLTA 2TGPZ 3OU0A 3PMBB 2R3UA 4GHQA 4INKA 1C9TA 2FO9A 5FX5A 1SLVB 3TLOA 2C8XB 1IQGA 3V12A 4K3JA 1LMWB 2ANKH 1DS2E 1ZSLA 4CH2B 3SV8A 1SGCA 4CH8B 3L33A 4B74A 4KKDA 1C1TA 1TMUH 3RU4D 1PJPA 1H8IH 3DHKH 1HAVB 1TRYA 4GVUA 3S9BA 1C4V2 2ZGBH 2C93B 3VB6A 2GGVB 1MAYA 1C2IA 5LPEA 1C1VH 1S6FA 1VGCC 1CHOG 1FY4A 1Z6JH 6GCHG 3MH6A 4E7RG 3UNRA 5PTPA 3ZVGA 4YT6H 4AOQA 4H42U 4E05H 3UWIA 4WH6A 1G32B 2ZZUH 5JBCS 5LPFA 1MZAA 1KSNA 1QL8A 4IN1A 1W0YH 3CS7A 4VGCB 3ZZ4A 1NT1A 1IQLA 2D2DA 5HXFA 4J2YB 1GVLA 3GCOA 2Z9IA 2IOTA 5EXLA 3URCA 1SL3A 1AN1E 2Z9KA 4RKOB 1AB9C 1QIXB 2D26C 1C1RA 1O39A 2GVFA 5CMXH 1AZZA 1FIWA 1C4Y2 4MNVA 2BDBA 4B1TA 1EAWA 2FOBA 5DP7A 3KL6A 2IJOB 2GMTC 3T62A 4O03A 1VR1H 1C5SA 1O5GH 3KQEA 3RXCA 4D8NA 3WY8A 1Y59T 2GP9B 4ABDA 3DFLA 1Q31A 4GCHF 4XE4A 3SV2H 3MH7A 1O5DH 1GMDG 1C5VA 1TAWA 4IW4E 3LKWA 1E34B 1GGDB 2JH5D 3GCHC 1NN6A 2W7UA 1GJAB 3EE0B 5ESTE 1RS0A 4OS6A 3A87A 2QF0A 3H7OA 2A5KA 1W12U 1C5QA 1A1RA 1BRUP 5BRRE 1GMHG 1PQ7A 1TNHA 2BQ6B 3ZV8A 1TA6A 1N8OB 4X6NA 1XMNB 1PQAA 5DP3A 3MOCA 2D8WA 1HJ9A 1NFWA 1GBIA 1TGTA 3UNSA 3LGUA 2SGPE 3RU4E 1K1MA 5T6DA 2FI5E 5TCAA 1TONA 4XOJA 3CS0A 2YNAA 3M3VA 3AVZA 5FPYA 3HKJB 1O3LA 2A45B 1THSH 1Y3VA 5HYOA 1D6WA 5DJ7A 3F9FA 1QJ7B 1EOJA 4WWYA 2ZA5A 2QYIA 1IOEA 1O2XA 4CBOA 1ABJH 1TLDA 3RXFA 4IBLH 1C9PA 4YZUA 2ZP0H 4ZKOU 3GY8A 1GHVH 1F5RA 1GJ4H 3SORA 5L2YH 3A7WA 4X6OA 1F92A 4AG2A 4B2AA 1YC0A 3LDXH 3A83A 1WU1A 1TRNA 1MKXK 4AB9A 1C2HA 5GJ4B 1THRH 4I8GA 1GBLA 4H6TA 2C90B 5JB8S 2BY5X 4K69A 1MTNB 2RG3A 3HGPA 3OTJE 1HAVA 3TIUA 3O8BA 1G9IE 1AD8H 1NFYA 4OGYA 1NRNH 1KLIH 3MO3A 2PHBA 1WYKA 2ZC9H 4NWLA 3AW0A 1ELCA 4NA9H 1S81A 1O33A 3SU0A 1W7XH 1TGBA 4Y0YE 4YOIA 1BOQA 1A3BH 1GBHA 1KXCA 1FUJA 3OYPA 4ABGA 1ARCA 2BY9X 1D3TB 2FMJA 3EA9A 3Q76A 2BX4A 1O5EH 1ELGA 3UUZA 2ZFFH 1IHTH 4NSVA 1SC8U 2Z3EA 4NIWA 1TE0A 3K6ZA 4B71A 1CVWH 1O3JA 3BTKE 1GI8B 5DGJA 1LO6A 1Y8TA 1QRZA 4JMYA 1INCA 1S82A 3U8RH 4XBBA 2ZO3H 4K5ZA 1EZXC 3OY5U 3RXOA 3UOPA 5CE1A 5CHAB 2P8OC 4UFDH 2ZFSA 1GHAF 1YLCA 1ABIH 3EA8A 1E37B 1Z6EA 1UJ1A 3BTEE 3ZVDA 2ZHEH 2R0KA 4J1YA 5DP4A 4YLUA 2FYRA 1OWKA 1NPMA 5EPYA 2ZTXA 1FQ3A 5DP8A 2ANWA 3MU1A 1C2DA 2PTNA 5HM9A 3SU2A 3SU1A 1VJAU 1GBEA 1YPJH 1SGYE 4X2YA 1ANCA 2FTLE 1DLKB 5F8XA 1G3CA 2AERH 2FOFA 4AGKA 2HNTF 2VIOA 2EA3A 2ZPSA 1GL0E 3AAUA 1BRAA 3E3TA 1BBRK 2ZEBA 4FU9A 5DK1A 1VCQA 4FUDA 4DVAU 3RXLA 3T5FH 2TGTA 5A8ZA 1BB0B 1ZGVA 1OSSA 1DITH 2GDEH 3M36A 4SGAE 4D9QA 3MNSA 1UTNA 5A0AE 1BTPA 4NIXA 3TNSA 5JBTA 1P2MA 1QB6A 1F0RA 4TY6A 2GT8A 2WUBA 4MG3A 1ELAA 3TNTA 4WXIA 1ANBA 4NA8A 1G3EA 3MO9A 5GCHG 1LPZB 5E2OA 9LPRA 2R9PA 1P10A 1C2KA 2Q1JA 4YOGA 2BVSH 2O8LA 3ATWA 2WPMS 1DICA 1D6RA 4IGDA 1NRQH 3BN9A 3QLPH 4X0WU 3KN2A 1QRWA 2SGQE 1CGJE 1EZSC 2FESH 1P9UA 1NZQH 1O5CB 1SGNE 1PPHE 3M3SA 1A3EH 2GV7A 4CHAB 1GI9B 1EPTC 1SFIA 2GDDA 4ZHMU 1H4WA 3BTGE 1T7CA 2OC1A 1O2GH 2FLRH 1BTHH 3BG4C 4ZAEA 2OBOA 1W0ZU 3D23A 1O3EA 4KTSA 1OPHB 1ELVA 3Q3XA 1HGTH 1C5UA 2VGCB 1O3HA 1CGIE 2BY7X 2XBWA 5SGAE 2OTVA 1EAIA 3H7TA 1K1OA 1OP0A 1IQEA 1XUHA 4UDWH 1DANH 4BANB 2O8MA 1Z8RA 3RXHA 4LOYH 2ZHQH 1MQ5A 1P11E 1C5PA 3MNXA 2HRVA 1W14U 1FI8A 3V7TA 5C67A 5L2ZH 2QF3A 2IPHA 1BMLA 3K2UA 2W7SA 3RXVA 1LCYA 1JIRA 3LH1A 2FPZA 3SZNA 2R2WU 4OS2A 1O2MA 4CRCA 2HPPH 3QN7A 5DKMA 1P2NA 5EG4A 2P16A 3OX7U 5IYTA 1O3MA 3QGJA 3TJVA 4BNRA 3TH3H 4LZ1H 1J15A 2J95A 4FVBA 4NZLA 1IQKA 1ZPCA 4X1RU 3VPKA 1UMAH 1VCPA 5K7RA 3EDXB 5GDSH 3QZRA 2I6QA 5ABWA 4A92A 1G37A 4GLYA 5I25A 1QRXA 1UHBB 1O3OA 3SNAA 4X1PU 3UWJH 1SGIB 2AGGX 1K2I1 3TVJB 2QC2A 3SV6A 1SHHB 3ZZBA 1SOZA 4IC5A 4MPVA 2ZU4A 2LNCA 1HAHH 4X8TH 2Z7FE 1MMJN 3RP2A 2UUFB 5GXPA 1GPZA 4CR5A 2HLCA 1H8DH 2B0FA 3MU4A 2PWXA 1A46H 1QCPA 2GCHF 1P09A 1XM1A 2LPRA 3PTBA 2PW8H 4R8TB 4ABHA 1P2KA 1YPMH 4BTTB 3KEEA 5A0CA 2JKHA 1HLTH 2BD5A 1NTPA 4Y79A 3UQVA 1C5MD 5AF9H 1AHTH 4FUCA 2B7DH 1O2RA 2UWPA 5H4IB 2EI8A 2Y5FA 5FCKA 1FY5A 3VXFH 6ESTA 1AZ8A 3ATLA 3I29A 1O2OA 1P2JA 3SOSA 2BD8A 3S7HB 2XBVA 3P8OA 1HAXB 4WJG2 3R3GB 2G52A 3ZZAA 2QXHA 1HCGA 4ISLA 2QV1A 3P70B 2XC0A 1O34A 5DG6A 2XC5A 1UCYH 4NGAH 4A1VA 1BRCE 1V2ST 3TH4H 2QY0B 4MQAA 4X6PA 3ZZ3A 2GKVE 1HPGA 1GJ7B 1LDTT 3SN8A 4H4FA 3ELAH 2RDLA 2Y7ZA 3U1IB 1LQDB 1UK3A 5C3NA 5DPAA 1F0UA 1FIZA 3VGCC 6CHAC 8GCHF 2QXGA 3GICB 4DOQA 1SGQE 3E91A 2XBYA 3CP7A 2GTBA 2M5TA 3RXKA 4YOJA 2AGEX 4AFSA 2FWWA 1L1JA 2O8TA 1G2MA 3RLYH 1QQ4A 3A86A 1P06A 1W7GH 4HFPB 1FXYA 2ZPRA 1DWBH 2IN2A 5JB9S 1YBWA 2UUYA 1GI7B 3MNBA 1LVYA 5A0BA 3U8OH 4NG9H 4Y76A 1MH0A 1Q2WA 1D9IA 2F83A 1S6HA 1GGDC 1DY9A 1Y5AT 1O2SA 2DE9A 3BEIB 1AWHB 2ZDVH 3F6UH 3R0FA 4FUHA 5LGOA 1C5RA 1XUFA 1YM0A 1E36B 1TNLA 4ISIH 2P94A 3SQHE 5C2ZA 3UY9A 1P02A 5T6GA 3P8GA 2A4OA 1GMCG 2VIDA 4E7NA 2JH0D 3P92A 1AFEH 1BMNH 1GHBG 1YGCH 2GD4B 4X1SU 4ZUHA 5EXMA 1O2TA 2NU1E 3N7OA 4Q7XA 2QXJA 1MQ6A 1O2VA 2ZECA 1SMFE 2AFQB 1AWFH 1GCTC 1O3DA 3RMMH 1MTVA 1K21H 4FU7A 1NROH 2WPJS 4TWWA 3MU8A 1GBJA 2W3KA 1UHBA 2ZQ1A 5FBEA 3FVFB 1PPEE 1TNKA 1ZTJA 1E35B 1ZZZA 4DG4A 1FLEE 1EB1H 3LGYA 1SGRE 2BQ7B 7KMEH 2Y81A 2ZGHA 5LH8A 1TX8A 2WINI 1THPB 4F49A 5GCHF 2TGAA 3SJIA 2RA0A 5A8YA 3A88A 1O2ZA 1QA7A 4DW2U 1KTSB 1O3PB 1WQSA 1LPGB 3A7VA 3ZZCA 4UFEH 4AFQA 1CA0C 5IDKA 2OQ5A 2H9TH 1MUEB 2VWNA 1LTOA 1RTFB 2WPIS 1MTNC 2C8ZB 1V3XA 2A5IA 4ASHA 2XRCA 1HNEE 3M61U 1BZXE 1QBVH 4JZIA 1QA0A 1C2LA 2DE8A 1PFXC 1SLWB 1ANDA 1YCPM 1EZQA 1GBFA 1GVZA 2XXLA 1P9SA 2AMQA 3LGIA 2J2UA 1AMHA 1TQ7B 3GY5A 3VB4A 2ZGXH 1TBZH 1HV7A 1QBOA 4Y71A 1CBWC 1JRTA 3LC5A 2OLGA 2BD7A 4Q2KA 1ZMLA 4BAOB 1C5WB 1HIAB 4INLA 1FNIA 4GSOA 2H6MA 2A1DB 4IMZA 4B76A 1AVWA 2AMPA
chains in the Genus database with same CATH superfamily
1TIOA 4TPYA 1GI5A 2FOGA 2YNBA 1T8MA 1O30A 4B2CA 4AG1A 2IJD1 2ODYB 1P03A 3BSQA 3PLBA 4YT7H 2A32A 3LJOA 2XCFA 5FL7D 1C1SA 2YOLA 1B7XB 2ZGJA 4O3UA 1FY3A 5L30H 2WUCA 2OCVB 1QJ6B 2ZHDA 1NRRH 4OM9A 1BITA 1IQNA 2A31A 2AIQA 1IQIA 1NFXA 2BVRH 3DFJA 3S7KB 1B0EA 1OXGA 3MH4A 2GCTC 3M37A 2WZQA 1YPEH 3GY6A 2J98B 1FDPA 3MH5A 3FP6E 3FP8E 3SHCH 3V0XA 3NK8A 1AFQC 1PQ8A 2O9QA 1GBKA 1HB0B 2RCEA 3C27B 4NZQA 2R0LA 2VH0A 2NU0E 2H9HA 2HALA 4HG6A 2BDYA 1C1WH 1SG8B 3SHAH 1A7SA 2FOMB 3LIWA 3RXIA 1EJMA 2BLQA 4WH8A 1XXDA 4GUXA 1LHEH 2DUCA 5EOKA 2ZCLP 2BD9A 1SOTA 3TJNA 1A5IA 1O0DH 3P6ZB 4WXVA 4Q63A 1HDTH 2AMDA 2W5EA 3BTTE 3ZVCA 4U32A 1VJ9U 5EQQA 1QQUA 1V2PT 2FEQH 3TGKE 3H09A 3FO8D 2A0QB 1OWJA 2VIQA 2A4QA 3Q3KA 3A7YA 3RM2H 1GI1A 4B6FA 1XUKA 3UAIC 1QJ1B 1TGNA 5AHGH 3IG6B 3CENA 2THFB 2VIPA 4ZCNA 1FJSA 5FPTA 1GJ8B 1UTPA 1S83A 1QFKH 4WF8A 1RIWB 5FCRA 5FHTA 1EP6A 1FMGA 2V0BA 1EAXA 3SW2B 1P01A 4CRBA 1BMMH 1LHFH 1PPGE 1C2JA 3Q77A 3ZYDA 3BTFE 2XC4A 4ISHH 3SUGA 2ALPA 4YESB 1IAUA 3P8FA 1WTGH 1ELTA 3PV5A 3T25A 3MWIU 3VG8A 1MCVA 4K8YA 4Y7BA 2CV3A 3E16B 2XWBI 3FZZA 2HOBA 2TBSA 1C5LH 2EC9H 1ELDE 1ETRH 7ESTE 1TBQH 3UIRA 4DJZB 2F3CE 3KF2A 1PPFE 1O2UA 1AKSB 3F2FA 4CHAC 2WV5A 2VU8E 3GS9A 4AGJA 1EJNA 1COWD 2Q6DA 3UPEA 4F4OC 1OWIA 1DXWA 3RXUA 4ZH8A 4RT0A 4BXSA 1HAOH 4CREA 1UVSH 4NA7A 2V3MA 2A2XH 1CQQA 1BMFD 2ZNKH 1KXEA 1HAIH 1T31A 4I32A 2STAE 1HIAA 2ZDLA 1ZTLA 1P2OA 4CRDA 1WDIA 2CMYA 4IC6A 5E0HA 3H5CB 1VITG 2ZU2A 1NRPH 1UCYK 4DIIH 4U30A 1G3BA 1GVKB 2HNTE 2ZF0H 1HJAC 2ZCKP 3FZDA 1EZUC 4GAWA 3RXJA 1VCWA 4IN2A 4JZ1A 4X2XA 3BIVH 2A7CA 2ZI2H 3N7EA 1S0RA 1TMTH 3SI4H 1Z8JB 4AB8A 3T26A 1OX1A 2BLWA 2VJ1A 3FP7E 5FBIA 3RC5A 2WPKS 1LKAA 4SGBE 1ESAA 3GCTF 1KXAA 2XOKD 1GBBA 1O5FH 3S69A 1DUAA 1VGCB 2C8YB 2NU4E 4Y8XA 1H9HE 1V2QT 3U8TH 1QURH 3MQKC 3SU4A 1V2NT 5EODA 1Y3WA 1TNJA 3M7QA 4X1QU 1C5ZB 1J14A 1O2PA 1NU9A 2BXUH 4BTIB 4JCNA 3F9EA 4CR9A 1SGFG 3RXPA 1C1MA 1ZSJA 2QE7D 2G51A 1TX7A 1Z7KA 2EEKA 3NKKA 3BG8A 2QAAA 2ZFQH 1GHZA 2J38A 3QX5H 2WYGA 1ELEE 1K1NA 2FLBH 3TK9A 1AB9B 1NESE 1ZOMA 3PWCA 3SJ8A 3PMAB 5FPSA 3PLPA 3A7ZA 1OKXA 1S5SA 2QA9E 2GMTB 5L6NH 1ID5H 2BM2A 1UTMA 3B23B 3PRDA 3PYHA 2G5VA 5KEDA 1NY22 3UNQA 2PFEA 3QZQA 4UFGH 1ETSH 1IQFA 1O5BB 1VKYA 2W3IA 3KIDU 3STJA 4I8KA 2J94A 3SI3H 1ZR0A 5EW2H 1DLEA 1FV9A 3MNCA 1PYTC 1SPJA 1G2LA 3K9XB 3RXBA 1SGEE 1ELFA 1C2GA 4XFQA 3GCHB 1CHOF 6GCHF 1BJVA 4AZ2B 4GPGA 1EUFA 4X2VA 1MTUA 2VINA 2PR3A 4MPWA 3UOUA 2J5UA 1B0FA 1MU8B 2BOKA 2F9PA 1AE5A 1VZQH 2XNIA 2OQUA 2J9NA 5J4QA 4O3TA 2PKAB 2A7HA 2J34A 3ITIA 1E0FD 5C94A 3LPRA 4YM9A 1TB6H 1YPHE 1WQVH 1OHHD 5EQSA 1EX3A 1KXFA 1ZYOA 2BD4A 5E0JA 5LPRA 2QXIA 1AKSA 4TY7A 3TGIE 1ZJKA 4Y7AA 4K1TA 1NU7B 2QIQA 3PO1C 1O38A 1GI0A 1WOFA 2GT7A 1GG6B 1H9IE 1F5KU 3OSYA 2GV6A 3SU6A 4ABFA 2OINA 1C5OH 1BBRE 3BTWE 1ZSKA 8ESTE 1AUTC 4ZXYH 3PTNA 1O2WA 1A61H 1XUIA 1LQEA 5EQRA 2JETC 1O35A 1EB2A 4UEHH 2FX6A 2G8TA 1DUEA 3PV4A 3UFAA 2GZ9A 1GMDF 4NFFA 2BDAA 2G4TA 4I33A 1W3CA 1P0SH 2ZCHP 1ZTKA 5FX6A 1AVXA 1P3CA 3E90B 1KLJH 3O8DA 2OBQA 4ACAA 4XDEA 1LHCH 1GMHF 1O3NA 1PPCE 3I77A 3M35A 4H6SB 4DT4A 2F9UA 4IS5A 1SQAA 2AYWA 1JIMA 1A4WH 1EOLA 3LONA 4D9RA 2H5DA 3SNBA 4X8SH 2ZDAH 4AYYB 1OWDA 1T32A 1YYY1 1B5GH 2SGEE 5TCCA 4MDSA 2PSXA 3EA7A 3RU4T 3O8RA 1V2WT 4TPIZ 3KGPA 1OS8A 3SO3A 1SI5H 3RXRA 2FOHA 2WPHS 1FONA 3MMGA 1JOUB 4XRNA 5HMAA 4OS5A 1A2CH 1O37A 1BUIA 3F9GA 3GDUA 2R3YA 3QWCH 2BXTH 3GY4A 1DOJA 4MPUA 1DFPA 1F7ZA 1T4UH 2A2QH 5F8ZA 4ZROA 5F03A 1O3KA 1WUNH 1O3CA 2H9EH 3GY3A 3SU5A 1AQ7A 1UTJA 2UUJB 3ZVAA 4K8BA 1YY3A 1W10U 2G81E 3ZZ8A 3BTME 1L2EA 1GHWH 2P8OB 1EQ9A 4D7FA 1N6YA 1BMAA 1XVMA 1K1PA 1V2MT 1EKBB 3UREA 1TOCB 1MTWA 3NCLA 1CGHA 3E0NB 4GCHG 3UTUH 1OP2A 1P3EA 2A4GA 1QR3E 1OYQA 2B5TB 4JZDH 1FN6A 4A1XA 9ESTA 1W2KH 3SGQE 1MKXH 3SNDA 3SU3A 4BAHB 3SGAE 1UVOA 3PLKA 3O8CA 1V2KT 1ZMNA 2KM0A 2HVXA 1UTLM 2G4UA 7GCHG 4B2BA 4RN6A 4Y11E 2Z9GA 1BTUA 2YMSD 1XKBC 3A8CA 2PKAA 1UTQA 4VGCC 3GDSA 5DP6A 5EJ1A 3OE7D 4FUBA 2ZWLH 1TFXA 1FAXA 1BQYA 2AIPA 3HGNA 2P3FH 4MVNA 3QTOH 5A2MH 4M7GA 4XSKU 4ZXXH 1C5XB 2SGFE 1K28D 1BIOA 1V2UT 4ASUD 3VFEA 4ZHLU 2FOEA 5IK2D 1GDNA 1JXPA 1Y3UA 5HGGA 1N1LA 1S0QA 3ZVBA 4HTCH 2OP9A 5EPNA 2K1QA 2VVCA 2P3TB 1V2TT 1CT0E 1SLUB 1F2SE 5C1YA 4JK6A 1OWHA 1W8BH 3F2GA 4ABBA 3L6PA 4K1EA 4I8JA 3TH2H 1QL9A 4Y6DA 4I31A 5JBBS 1O2NA 3U1JB 1AVGH 5DP5A 1FAKH 1O3AA 2YMSB 1MBMA 3E0PB 4ZKSU 3EAJA 3FFGA 4B73A 5AVDA 5C0TA 1LVMA 4TYDA 3B8JA 2BLVA 1TA2A 2OK5A 2A7JA 2ZHFH 1GJDB 1NM6A 2QGRA 2AGIX 1XX9A 2ZTZA 3BEUA 1EPTB 2ZDKA 3M7TA 4Y8YA 1UO6A 3NXPA 1N8OC 1Y3XA 3BG4B 4Z0KA 4ZKRU 2HVYB 3QDZB 2ZG0H 1P57B 2HGTH 1IHSH 3RC6A 1HAPH 1S84A 1PQ5A 1WV7H 2SFAA 2LP6A 2QF5A 3F2HA 2ESTE 2D1JA 4YTAA 3P8NA 4IMQA 4X2WA 3S0NA 1AUJA 4JYVH 4BAMB 1G30B 1DX5M 1HAGE 3ZVEA 2BOHB 1IQJA 1O2KA 4X1NU 4WMDA 3BF6H 3GY7A 2B9LA 2XW9A 2PTCE 3BTDE 4KGAA 3PV2A 2FDAA 2Y82A 2HNTC 3HK3B 4ZMAH 3GOVB 1TRMA 2KCPA 3IITA 1GJ5H 1TPPA 2F91A 3MHWU 2ZTYA 3E6PH 1O3BA 3ZZ6A 1BA8B 2O8UA 1TX6A 1P2QA 3RXTA 1KXBA 2XYAA 1Z8GA 2ULLA 2Y5GA 1ZLRA 3A80A 4UE7H 1OOKB 1Z71A 2EI6A 2HPQH 2ZU3A 5JBAS 1GHAG 1FPCH 1MD8A 5A09A 2PKSB 1BCUH 3DUXH 4JYUH 3AAVA 2FODA 4FUEA 1F0SA 2NU3E 4JZEH 1W0KD 4XBCA 1CU1A 1C1UH 2WPLS 1CT2E 1A5HA 2QN5T 3RXAA 1Z8IB 5GIBA 2ZU1A 3SJKA 3ZV9A 3MU5A 4AX9H 3A7TA 1NC6A 3GY2A 1GWAA 3T27A 1MZDA 4Y8ZA 4BXWA 4Y10E 3ODFA 3RUOA 3SNCA 2C8WB 3A81A 3TGJE 2BX3A 2ALVA 1JRSA 3VEQB 2AS9A 3EE7A 3LGTA 1KTTB 1OP8A 2FOAA 1QTFA 4Q80A 1MTSA 1BTZA 4JYTA 2JIZD 2OUAA 3A82A 2AEIH 2BD3A 3L3TA 4X8VH 2QCYA 1D3QB 1FY1A 3DD2H 1JWTA 4FU8A 4JZFH 5EU8A 3Q3YA 3EGKH 3A7XA 2L6OA 1C1QA 1O2HA 1TYNA 2TPIZ 5HM2A 3UB0A 5GWZA 3P17H 5CHAC 1HRTH 1C4U2 4DT7B 1GL1A 1HXEH 1DWCH 1RRKA 2V7QD 2VBCA 4ABAA 4I8LA 1DXPA 4R0IA 3P95A 1HFDA 4F55A 3RXSA 3MYWA 4UONA 2C4FH 1SLXB 4BOHA 1KY9A 3RMOH 2A5AA 3U69H 1GHXH 4ZKNU 1KXDA 3MI4A 3NWUA 2BDIA 5EJLA 3I78A 1HUTH 3GDVA 2RA3A 2ANYA 2A4RA 5EJZA 1L1NA 1XKAC 2AHME 3RXGA 3VGCB 2Y7XA 1V2LT 4KP0A 1XVOA 6CHAB 7LPRA 4CRAA 5JYIA 3MFJA 2PLXA 1YPHC 2PUXB 2BY6X 5DSFA 4ABEA 1MKWH 2ZPQA 3WWBA 3NUMA 4DURA 1EPTA 3TJUA 1TOMH 3V13A 2C3SA 5K0HA 3HKIB 1YF4A 4RT1A 2ZHWH 1DPOA 1BHXB 1TQ0B 3D62A 1ZHPA 1C1PA 2GZ8A 2ZGCA 2OC8A 1ETTH 1KYNA 1O3GA 2CF8H 1YCPH 1O31A 2FS8A 2OXSA 1CE5A 2Y80A 3SUEA 5HIZA 2OC0A 3ZZDA 2Z6BD 3KQCA 1QHRB 2STBE 5C5NA 3KCGH 2H5CA 5EXNA 1TPOA 2Q6FA 4P00A 7GCHF 1TGSZ 2BLOA 2VIWA 2SNWA 2W6ID 3TU7H 2K0QA 3PROA 1AI8H 1T8OA 1NRSH 1P04A 3SUFA 3VB3A 4NFEA 3E8LA 4BAQB 2KZ4A 4MLFB 2PGBB 4BAKB 2ODQA 1C5TA 1OYTH 1KIGH 2ZFTA 2FP7B 3D65E 3IWMA 3SJ9A 1O2IA 4U01A 1IQMA 1PPZA 1GI4A 5T6FA 4AYVB 4CRGA 2ZFPH 1H1BA 1GCTB 2SGAA 1ARBA 1TALA 4MPXA 1BTWA 1TGCA 2XCNA 2BMGB 1JMOH 1YPKH 1J17T 1A0HB 1GJ6A 2KAIB 2BZ6H 2SNVA 1RTLA 4WVPE 1F5LA 5E2PA 2P59A 3BTHE 1KDQB 1GG6C 2WYJA 2V35A 1GJCB 5F8TA 4AORA 3KYGA 1M9UA 5FXLA 5E0GA 2CHAB 4AN7A 1O3IA 5CHBA 2VVUA 2FZZA 4UD9H 4Q7YA 4PROA 3A8DA 1H8ED 2CF9H 3Q00A 1AY6H 3PB1E 2VGCC 5I46H 1EJAA 4RSPA 4THNH 2GCHG 3OY6U 3RM0H 1CA0B 4YO9A 4Z6AH 4OGXA 3ATMA 3BTQE 1K1IA 3STIA 3ESTA 2ZFRH 3GISB 2I6SA 2CJIA 1LHDH 2JJ1D 1SR5C 3LJJA 2ZDNA 1EAUA 3V3MA 1HJ8A 1GMCF 1T8NA 1EATA 1L4DA 2PGQB 4A7IB 4RI0A 2OC7A 2UWOA 1A5GH 4LXBH 2FXRA 1GHBF 3A84A 4FVDA 3FOAA 5E8EH 2HWLB 1K1LA 3ZYEA 2LELA 1CBWB 1P8VC 3AW1A 2CXVA 1AIXH 2WHXA 2TGDA 3LH3A 1QL7A 3ZZ9A 1CA8B 1O2YA 2ZU5A 5C1UA 1W11U 1ZPZA 4NIVA 1P05A 1TBRH 1BHXF 4O97A 4OS7A 3NZIA 3EYDA 4Y0ZE 1DY8A 3A85A 3S9AA 2GZ7A 2Y5HA 3DA9B 3ZVFA 5F6MA 4Q7ZA 8GCHG 3LGVA 1ANEA 2BDGA 1Q3XA 2VWOA 4MTBA 1EP5A 4WY3A 1A0LA 4OS1A 3M3TA 1G36A 2ZIQH 3GCNA 4NWKA 1HBTH 3LGWA 3QO6A 1WCZA 4LZ4B 1K9OE 4WMEA 1UCYE 1ZHMA 1LPKB 3ATIA 1GBTA 4WMFA 1E38B 3HATH 1BTXA 4D7GA 2PSYA 3T28A 5BPEA 2F9OA 4Z1MD 3F1SB 1C1OA 2BQWB 2GCTB 3RC4A 1TWXB 3RMLH 1DDJA 4MNXA 2FYQA 5EGMA 2BHGA 2KCOA 4A5TS 5JPMH 1ZJDA 1AFQB 1SQOA 2UWLA 3ZIAD 4AFUA 1HAYB 2XWAA 2F9BH 2Z3CA 2J4IA 2ZQ2A 4UFFH 1TMBH 3SBKA 1J8AA 1GJ9B 3M7UA 1A0JA 4FUJA 5G4BA 2BTCE 2G55A 3FAOA 4D76A 2BDCA 4GHTA 2TRMA 3NPSA 1QGFA 3ZZ5A 3T2NA 4X6MA 3RXEA 1DWDH 1YLNA 1S6LA 1GDUA 3SQEE 3TK6A 2PUQH 2VWLA 4RKJB 5JDUB 2TIOA 1L1GA 1RXPA 1ZHRA 3UR9A 1QBNA 1XUGA 1UK2A 4O9VA 1NS3A 3QUMP 1TPSA 2KAIA 1WTHD 3DSPA 4B6EA 4NCYA 1RFNA 3M5LA 2P95A 3U9AH 1YPGH 8LPRA 1KDQA 2EY4C 3VXEH 2VNTA 1O5AB 4BTUB 1MABB 1MD7A 2V6NA 3M5MA 4ISNA 2VB0A 3URDA 4ACBA 1BJUA 1HYLA 2P3UB 1FPHH 4XBDA 1S85A 5C20A 1ESBA 3SNEA 2P93A 3RXMA 1O2QA 1QB9A 1PPBH 2F4LA 2PP6A 2VIVA 1KMHB 3RDZA 1Z1IA 1G3DA 2UUKB 5AFYH 2SGDE 2CN0H 3KHVA 3TJOA 3G01A 4FUIA 4NIYA 2XNDD 1YKTA 1J16A 1BT7A 1WSSH 4A1TA 3C1KA 1Y5UT 3RXDA 3SUDA 2B8OH 2Z9LA 2OD3B 3SV7A 1CO7E 4TWYA 1U6QA 1Y5BT 1O32A 3B9FH 4U2WA 3LU9B 4HI3A 1J9CH 3LT3A 3W94A 1NBMD 4K1SA 4ISOA 1YP9A 2EI7A 5C1XA 1ZPBA 4KTUA 1UTOA 1QY6A 1P2IA 1DSTA 1N6XA 3HK6B 1X7AC 3BV9B 1K22H 1DT2A 2W26A 4I8HA 1UTKA 2K8IA 1GBCA 2PV9B 1FZZA 1SB1H 2AH4X 4ABIA 1ZRKA 4DY7B 4AFZA 3AASA 2Y6TA 3JZ1B 4HGCA 3FANA 1V2OT 1SSXA 3PM3A 5A8XA 1H9LB 2XTTB 1HJAB 1DSUA 4MNYA 5TJXA 1LVBA 4LK4A 3QGNB 1W0JD 1L4ZA 5C17A 2NU2E 4K60A 1RTKA 1DVAH 5J4SA 1NFUA 2CGAA 1QB1A 1P12E 3TK5A 1OWEA 1GI6A 3ENSB 2BY8X 2R2MB 4CBNA 1SHYA 1SGDE 2VWMA 1C1NA 1RJXB 1C2FA 2PKSC 1DWEH 2Z94A 5AFZH 2FTMA 3S9CA 4ESTE 5DP9A 1MKWK 2BB4A 3A8AA 5B6OA 3UQOA 1O2JA 3TITA 2O8WA 4KTCA 1PYTD 1O3FA 1ESTA 3A8BA 2BDHA 3LOXA 3SGBE 3PWBA 2JH6D 1SFQB 1MBQA 2Z3DA 5GPIB 1FY8E 1V6DA 1LKBA 1O2LA 1YCPK 3QTVH 3M5OA 1UK4A 1ZGIA 4NSYA 2H1UA 5ETXA 2J92A 1YLDA 3MO6A 1D3DB 4YLQH 2GX4A 1MCTA 3F9HA 5FAHA 4X8UH 1E1RD 1SBWA 1D3PB 1VITF 2Z9JA 3ODDA 3KNXA 1AGJA 1GI3A 1CT4E 1GCDA 3RMNH 3BIUH 1LHGH 2BD2A 1C5NH 4OS4A 2F9NA 3GYMA 2Q6GA 3JZ2B 1XUJA 4JK5A 2FI3E 2HLDD 3TPIZ 2NWNA 4KELA 3EQ0H 1ZRBA 4QT8C 1T8LA 1JBUH 2FI4E 3F68H 3U98H 1CSOE 1V2JT 1F0TA 3MTYA 4FUGA 2BVXH 4DCDA 1L0ZA 4I7YH 1K0HA 1GBMA 1RGQA 1W13U 2FOCA 3DT0H 5DN6D 1EASA 1GBDA 2F43B 1D4PB 3RLWH 1FN8A 2F9VA 3M5NA 1C2EA 1TNIA 1AE8H 1GI2A 3DSOA 2FX4A 6LPRA 1WBGB 4A6LA 1QZ8A 1Z1JA 3OEED 4ABJA 4DIHH 2WV4A 1QNJA 4MNWA 1SGPE 1SQTA 3OAAD 1WAYB 3MU0A 4F48B 4FXGH 3D49H 4HZHA 5B6LA 1DE7H 1T4VH 1ELBA 1C2MA 1TPAE 3PO1B 2V3OH 3SJOA 1TNGA 1BTYA 1GHYH 1SGFA 3GYLB 3VB5A 2ZKSA 5ESBA 1E1QD 1SGTA 4E06H 3QK1A 1ORFA 1O36A 2V3HH 2ODPA 1IQHA 5DO4H 1ACBE 3BEFB 1AU8A 2ASUB 2JETB 1MAXA 2ILNA 1XXFA 3A89A 4TT3D 4ZHAA 3W95A 1RIWC 1MU6B 1RD3B 1EXFA 1GJBB 2BYAX 2H2ZA 3VB7A 2VVVA 3DSGA 1HXFH 1ZMJA 2FM2A 2G5NA 2WSSD 4DGJA 1Y3YA 5EW1H 1UVTH 1GBAA 3ATKA 2ZDMA 3KQBA 2XBXA 1BBRH 1GDQA 1NO9H 2JJ2D 3T29A 3ZZ7A 3KQDA 1SVPA 3OFND 1C5YB 3LC3A 3GCTG 3K65B 3HPTB 1AO5A 5C5OA 3PMJA 1HAZB 2KFWA 4FUFA 1UVPA 1K1JA 3E1XB 2ANMH 3PMHB 2VH6A 3K6YA 2G00A 3SV9A 2BZAA 4B75A 1LVOA 1VITH 3UR6A 2FIRH 2CHAC 2FS9A 1V2VT 1V2RT 4INHA 3RXQA 1UVUH 8KME2 1BRBE 4CRFA 1CHGA 1BDAA 1YPLH 1TABE 1DM4B 5T3HA 4K2YA 1KLTA 2TGPZ 3OU0A 3PMBB 2R3UA 4GHQA 4INKA 1C9TA 2FO9A 5FX5A 1SLVB 3TLOA 2C8XB 1IQGA 3V12A 4K3JA 1LMWB 2ANKH 1DS2E 1ZSLA 4CH2B 3SV8A 1FX0B 1SGCA 4CH8B 3L33A 4B74A 4KKDA 1C1TA 1TMUH 3RU4D 1PJPA 1H8IH 3DHKH 1HAVB 1TRYA 4GVUA 3S9BA 1C4V2 3AK5A 2ZGBH 2C93B 3VB6A 2GGVB 1MAYA 1C2IA 5LPEA 1C1VH 1S6FA 1VGCC 1CHOG 1FY4A 3DCLA 1Z6JH 6GCHG 3MH6A 4E7RG 3UNRA 5PTPA 3ZVGA 1E79D 4YT6H 4AOQA 4H42U 4E05H 3UWIA 4WH6A 1G32B 2ZZUH 5JBCS 5LPFA 1MZAA 1KSNA 1QL8A 4IN1A 1W0YH 3CS7A 4VGCB 3ZZ4A 1NT1A 1IQLA 2D2DA 5HXFA 4J2YB 1GVLA 3GCOA 2Z9IA 2IOTA 5EXLA 3URCA 1SL3A 1AN1E 2Z9KA 2L74A 4RKOB 1AB9C 1QIXB 2D26C 1C1RA 1O39A 2GVFA 5CMXH 1AZZA 1FIWA 3F3BA 1C4Y2 4MNVA 2BDBA 4B1TA 1EAWA 2FOBA 5DP7A 3KL6A 2IJOB 2GMTC 3T62A 4O03A 1VR1H 1C5SA 1O5GH 3KQEA 3RXCA 4D8NA 3KQ5A 3WY8A 1Y59T 2GP9B 4ABDA 3DFLA 3SZEA 1Q31A 4GCHF 4XE4A 3SV2H 3MH7A 3OEHD 1O5DH 1GMDG 1C5VA 1TAWA 4IW4E 3LKWA 1E34B 1GGDB 2JH5D 2IPQX 3GCHC 1NN6A 2W7UA 1GJAB 3EE0B 5ESTE 1RS0A 4OS6A 3A87A 2QF0A 3H7OA 2A5KA 1W12U 1C5QA 1A1RA 1BRUP 5BRRE 1GMHG 1PQ7A 1TNHA 2BQ6B 3ZV8A 1TA6A 1N8OB 4X6NA 3WW7A 1XMNB 1PQAA 5DP3A 3MOCA 2D8WA 1HJ9A 1NFWA 1GBIA 1TGTA 3UNSA 3LGUA 2EQNA 5T1VA 2SGPE 3RU4E 1K1MA 5T6DA 2FI5E 5TCAA 1TONA 4XOJA 2JDID 3CS0A 2YNAA 3M3VA 3AVZA 5FPYA 3HKJB 1O3LA 2A45B 1THSH 1Y3VA 5HYOA 1D6WA 5DJ7A 3F9FA 1QJ7B 5GNDA 1EOJA 4WWYA 2ZA5A 2QYIA 1IOEA 1O2XA 4CBOA 1ABJH 1TLDA 3RXFA 2M2AA 4IBLH 1C9PA 4YZUA 2ZP0H 4ZKOU 3GY8A 1GHVH 1F5RA 1GJ4H 3SORA 5L2YH 2WPDD 3A7WA 4X6OA 1F92A 4AG2A 4B2AA 1YC0A 3LDXH 3A83A 1WU1A 1TRNA 1MKXK 4AB9A 1C2HA 5GJ4B 1THRH 4I8GA 1GBLA 4H6TA 2C90B 5JB8S 2BY5X 4K69A 1MTNB 2RG3A 3HGPA 3OTJE 1HAVA 3TIUA 4AC9A 3O8BA 1G9IE 1AD8H 1NFYA 4OGYA 1NRNH 1KLIH 5F53A 3MO3A 2PHBA 1WYKA 2ZC9H 4NWLA 3AW0A 1ELCA 4NA9H 1S81A 1O33A 3SU0A 1W7XH 1TGBA 4Y0YE 4YOIA 1BOQA 1A3BH 1GBHA 1KXCA 1FUJA 3OYPA 4ABGA 1ARCA 2BY9X 1D3TB 2FMJA 3EA9A 3Q76A 2BX4A 1O5EH 1ELGA 3UUZA 2ZFFH 1IHTH 4NSVA 1SC8U 2Z3EA 4NIWA 1TE0A 3K6ZA 4B71A 1CVWH 1O3JA 3BTKE 1GI8B 5DGJA 1LO6A 1Y8TA 3F0PA 1QRZA 4JMYA 1INCA 1S82A 3U8RH 4XBBA 2ZO3H 4K5ZA 1EZXC 3OY5U 3RXOA 3UOPA 5CE1A 5CHAB 2W6JD 2P8OC 4UFDH 2ZFSA 1GHAF 1YLCA 1ABIH 3EA8A 2J98A 1E37B 1Z6EA 1UJ1A 3BTEE 3PRBA 3ZVDA 2ZHEH 2R0KA 4J1YA 5DP4A 4YLUA 2FYRA 1OWKA 4FOUC 1NPMA 5EPYA 2ZTXA 1FQ3A 5DP8A 2ANWA 3MU1A 4YXWD 1C2DA 2PTNA 5HM9A 3SU2A 3KYFA 2GJGA 3SU1A 1VJAU 1GBEA 1YPJH 1SGYE 4X2YA 1ANCA 2FTLE 1DLKB 5F8XA 1G3CA 2AERH 2FOFA 4AGKA 2HNTF 2VIOA 2EA3A 1SKYE 2ZPSA 1GL0E 3AAUA 1BRAA 3E3TA 1BBRK 2ZEBA 4FU9A 5DK1A 1VCQA 4FUDA 4DVAU 3RXLA 3T5FH 2TGTA 5A8ZA 1BB0B 1ZGVA 1OSSA 1DITH 2GDEH 5CDFE 3M36A 4SGAE 4M9FA 4D9QA 3MNSA 1UTNA 5A0AE 1BTPA 4NIXA 3TNSA 5JBTA 1P2MA 1QB6A 1F0RA 4TY6A 2GT8A 2WUBA 4MG3A 1ELAA 3TNTA 4WXIA 1ANBA 4NA8A 1G3EA 3MO9A 5GCHG 1LPZB 5E2OA 9LPRA 2R9PA 1P10A 1C2KA 2Q1JA 4YOGA 2BVSH 2O8LA 2YMSC 3ATWA 2WPMS 1DICA 1D6RA 4IGDA 1NRQH 3BN9A 3QLPH 4X0WU 3KN2A 1QRWA 2SGQE 1CGJE 1EZSC 2FESH 1P9UA 2WV9A 1NZQH 1O5CB 1SGNE 1PPHE 3M3SA 1A3EH 2GV7A 4CHAB 1GI9B 1EPTC 1SFIA 2GDDA 4ZHMU 1H4WA 3BTGE 1T7CA 2OC1A 1O2GH 2FLRH 1BTHH 3BG4C 3F0OA 2OBOA 4ZAEA 1W0ZU 3D23A 1O3EA 4KTSA 1OPHB 1ELVA 3OTPA 3Q3XA 1HGTH 2KCYA 1C5UA 2VGCB 1O3HA 1CGIE 2BY7X 2XBWA 5SGAE 2OTVA 1EAIA 3H7TA 1K1OA 1OP0A 1IQEA 1XUHA 4Q4LA 4UDWH 1DANH 4BANB 2O8MA 1Z8RA 3RXHA 4LOYH 2ZHQH 1MQ5A 1P11E 1C5PA 3MNXA 3WWFA 2HRVA 1W14U 1FI8A 3V7TA 1EFRD 5C67A 5L2ZH 2QF3A 2IPHA 1BMLA 3K2UA 2W7SA 3RXVA 1LCYA 1JIRA 3LH1A 5KGOA 2FPZA 3SZNA 2R2WU 4OS2A 1O2MA 4CRCA 2HPPH 3QN7A 5DKMA 2RDEA 1P2NA 5EG4A 2P16A 3OX7U 5IYTA 1O3MA 3QGJA 3TJVA 4BNRA 3TH3H 4LZ1H 1J15A 2J95A 4FVBA 4NZLA 1IQKA 1ZPCA 4TSFD 4X1RU 3VPKA 1UMAH 1VCPA 5K7RA 3EDXB 5GDSH 3QZRA 2I6QA 5ABWA 4A92A 1G37A 2KCAA 4GLYA 5I25A 1QRXA 1UHBB 1O3OA 3SNAA 4X1PU 3UWJH 1SGIB 2AGGX 1K2I1 3TVJB 2QC2A 3SV6A 1SHHB 3ZZBA 1SOZA 4IC5A 4MPVA 2ZU4A 2LNCA 1HAHH 4X8TH 2Z7FE 1MMJN 3RP2A 2UUFB 5GXPA 1GPZA 4CR5A 2HLCA 1H8DH 2B0FA 3MU4A 2PWXA 1A46H 1QCPA 2GCHF 1P09A 1XM1A 2LPRA 3PTBA 2QF4A 2PW8H 1YWUA 4R8TB 4ABHA 1P2KA 1YPMH 4BTTB 3KEEA 5A0CA 2JKHA 1HLTH 2BD5A 1NTPA 4Y79A 3UQVA 1C5MD 5AF9H 1AHTH 4FETA 4FUCA 3FKSD 2B7DH 1O2RA 2UWPA 5H4IB 2EI8A 2Y5FA 5FCKA 1FY5A 3VXFH 6ESTA 1AZ8A 3ATLA 3I29A 1O2OA 1P2JA 3SOSA 2BD8A 3S7HB 1NBME 2XBVA 3P8OA 1HAXB 2KR7A 4WJG2 3R3GB 2G52A 3ZZAA 2QXHA 1HCGA 4ISLA 2QV1A 3N7DA 3P70B 3NRLA 2XC0A 1O34A 5DG6A 2XC5A 1UCYH 4NGAH 4A1VA 3SYJA 1BRCE 1V2ST 3TH4H 2QY0B 4MQAA 4X6PA 3ZZ3A 2GKVE 1HPGA 1GJ7B 1LDTT 3SN8A 2RFKC 4H4FA 3ELAH 2RDLA 2Y7ZA 3U1IB 1LQDB 1UK3A 5C3NA 5DPAA 1F0UA 1FIZA 3VGCC 6CHAC 8GCHF 2QXGA 3GICB 4DOQA 1SGQE 3E91A 2XBYA 3CP7A 2GTBA 2M5TA 3RXKA 4YOJA 2AGEX 4AFSA 2FWWA 1L1JA 2O8TA 1G2MA 3RLYH 1QQ4A 3A86A 1P06A 1W7GH 4HFPB 1FXYA 2ZPRA 1DWBH 2IN2A 5JB9S 1YBWA 2UUYA 1GI7B 3MNBA 1LVYA 1UW7A 5A0BA 3U8OH 4NG9H 4Y76A 1MH0A 1Q2WA 1SQRA 1D9IA 2F83A 1S6HA 1GGDC 1DY9A 1Y5AT 1O2SA 2DE9A 3BEIB 1AWHB 2ZDVH 2KX4A 3F6UH 3R0FA 4FUHA 5LGOA 1C5RA 1XUFA 1YM0A 1E36B 1TNLA 4ISIH 2P94A 3SQHE 5C2ZA 3UY9A 1P02A 4XD7D 5T6GA 3P8GA 2A4OA 1GMCG 2VIDA 3FN8A 4E7NA 4P02A 2JH0D 3P92A 1AFEH 1BMNH 1GHBG 1YGCH 2GD4B 4X1SU 4ZUHA 5EXMA 3N99A 1O2TA 2NU1E 3N7OA 4Q7XA 2QXJA 1MQ6A 1O2VA 2ZECA 1SMFE 2AFQB 1AWFH 1GCTC 1O3DA 3RMMH 1MTVA 1K21H 5C0UA 4FU7A 3W1EA 1NROH 2CK3D 2WPJS 4TWWA 3MU8A 1GBJA 2W3KA 1UHBA 2ZQ1A 5FBEA 3FVFB 4I86A 1PPEE 1TNKA 1ZTJA 1E35B 1ZZZA 4DG4A 1FLEE 1EB1H 3LGYA 1SGRE 2BQ7B 7KMEH 2Y81A 2ZGHA 5LH8A 1TX8A 2WINI 1THPB 4F49A 5GCHF 2TGAA 3SJIA 3U28C 2RA0A 5A8YA 3A88A 1O2ZA 1QA7A 4DW2U 1KTSB 1O3PB 1WQSA 1LPGB 3A7VA 3ZZCA 4UFEH 4AFQA 1CA0C 5IDKA 2OQ5A 2H9TH 1MUEB 2VWNA 1LTOA 1RTFB 2WPIS 1MTNC 5HIYA 2C8ZB 1V3XA 2A5IA 4ASHA 5EIYA 2XRCA 1HNEE 3M61U 1BZXE 1QBVH 4JZIA 1QA0A 1C2LA 2DE8A 5HKKD 1PFXC 5KECA 1SLWB 1ANDA 1YCPM 1EZQA 1GBFA 2J97A 3CNRA 1GVZA 2XXLA 1P9SA 2AMQA 3LGIA 2J2UA 1AMHA 1TQ7B 3GY5A 3VB4A 2ZGXH 1TBZH 1HV7A 1WXRA 1H8HD 1QBOA 4Y71A 1CBWC 1JRTA 3LC5A 2OLGA 2BD7A 4Q2KA 1ZMLA 4BAOB 1C5WB 1HIAB 4INLA 1FNIA 4GSOA 2H6MA 2A1DB 4IMZA 4B76A 1AVWA 2AMPA
chains in the Genus database with same CATH topology
1TIOA 4TPYA 1GI5A 2FOGA 2YNBA 1T8MA 1O30A 4B2CA 4AG1A 2ODYB 1P03A 3BSQA 3PLBA 4YT7H 2A32A 3LJOA 2XCFA 1C1SA 2YOLA 1B7XB 2ZGJA 4O3UA 1FY3A 5L30H 2WUCA 2OCVB 1QJ6B 2ZHDA 1NRRH 1BITA 1IQNA 2A31A 2AIQA 1IQIA 1NFXA 2BVRH 3DFJA 3S7KB 1B0EA 1OXGA 3MH4A 2GCTC 3M37A 1YPEH 3GY6A 1FDPA 3MH5A 3FP6E 3FP8E 3SHCH 3V0XA 3NK8A 1AFQC 1PQ8A 2O9QA 1GBKA 1HB0B 2RCEA 3C27B 4NZQA 2R0LA 2VH0A 2NU0E 2H9HA 2HALA 2BDYA 1C1WH 1SG8B 3SHAH 1A7SA 2FOMB 3LIWA 3RXIA 1EJMA 2BLQA 4WH8A 1XXDA 4GUXA 1LHEH 2DUCA 5EOKA 2ZCLP 2BD9A 1SOTA 3TJNA 1A5IA 1O0DH 3P6ZB 4WXVA 1HDTH 2AMDA 2W5EA 3BTTE 3ZVCA 4U32A 1VJ9U 5EQQA 1QQUA 1V2PT 2FEQH 3TGKE 2A0QB 1OWJA 2VIQA 2A4QA 3Q3KA 3A7YA 3RM2H 1GI1A 1XUKA 1QJ1B 1TGNA 5AHGH 3IG6B 3CENA 2THFB 2VIPA 1FJSA 5FPTA 1GJ8B 1UTPA 1S83A 1QFKH 4WF8A 1RIWB 5FCRA 5FHTA 1EP6A 1FMGA 2V0BA 1EAXA 3SW2B 1P01A 4CRBA 1BMMH 1LHFH 1PPGE 1C2JA 3Q77A 3ZYDA 3BTFE 2XC4A 4ISHH 3SUGA 2ALPA 4YESB 1IAUA 3P8FA 1WTGH 1ELTA 3T25A 3MWIU 1MCVA 4K8YA 4Y7BA 2CV3A 3E16B 2XWBI 3FZZA 2HOBA 2TBSA 1C5LH 2EC9H 1ELDE 1ETRH 7ESTE 1TBQH 3UIRA 4DJZB 2F3CE 3KF2A 1PPFE 1O2UA 1AKSB 4CHAC 2WV5A 2VU8E 4AGJA 1EJNA 4F4OC 2Q6DA 3UPEA 1OWIA 1DXWA 3RXUA 4ZH8A 4BXSA 1HAOH 4CREA 1UVSH 4NA7A 2A2XH 1CQQA 2ZNKH 1KXEA 1HAIH 1T31A 4I32A 2STAE 1HIAA 2ZDLA 1ZTLA 1P2OA 4CRDA 2CMYA 4IC6A 5E0HA 3H5CB 1VITG 2ZU2A 1NRPH 1UCYK 4DIIH 4U30A 1G3BA 1GVKB 2HNTE 2ZF0H 1HJAC 2ZCKP 3FZDA 1EZUC 4GAWA 3RXJA 1VCWA 4IN2A 4JZ1A 4X2XA 3BIVH 2A7CA 2ZI2H 1S0RA 1TMTH 3SI4H 1Z8JB 4AB8A 3T26A 1OX1A 2BLWA 2VJ1A 3FP7E 5FBIA 3RC5A 2WPKS 1LKAA 4SGBE 1ESAA 3GCTF 1KXAA 1GBBA 1O5FH 3S69A 1DUAA 1VGCB 2C8YB 2NU4E 4Y8XA 1H9HE 1V2QT 3U8TH 1QURH 3SU4A 1V2NT 5EODA 1Y3WA 1TNJA 3M7QA 4X1QU 1C5ZB 1J14A 1O2PA 1NU9A 2BXUH 4BTIB 4JCNA 3F9EA 4CR9A 1SGFG 3RXPA 1C1MA 1ZSJA 2G51A 1TX7A 1Z7KA 2EEKA 3NKKA 3BG8A 2QAAA 2ZFQH 1GHZA 2J38A 3QX5H 2WYGA 1ELEE 1K1NA 2FLBH 3TK9A 1AB9B 1NESE 1ZOMA 3PWCA 3SJ8A 3PMAB 5FPSA 3PLPA 3A7ZA 1OKXA 1S5SA 2QA9E 2GMTB 5L6NH 1ID5H 2BM2A 1UTMA 3B23B 3PYHA 2G5VA 1NY22 3UNQA 2PFEA 3QZQA 4UFGH 1ETSH 1IQFA 1O5BB 2W3IA 3KIDU 3STJA 4I8KA 2J94A 3SI3H 1ZR0A 5EW2H 1DLEA 1FV9A 3MNCA 1PYTC 1SPJA 1G2LA 3K9XB 3RXBA 1SGEE 1ELFA 1C2GA 4XFQA 3GCHB 1CHOF 6GCHF 1BJVA 4AZ2B 4GPGA 1EUFA 4X2VA 1MTUA 2VINA 2PR3A 4MPWA 3UOUA 1B0FA 1MU8B 2BOKA 2F9PA 1AE5A 1VZQH 2XNIA 2OQUA 2J9NA 5J4QA 4O3TA 2PKAB 2A7HA 2J34A 3ITIA 1E0FD 3LPRA 4YM9A 1TB6H 1YPHE 1WQVH 5EQSA 1EX3A 1KXFA 1ZYOA 2BD4A 5E0JA 5LPRA 2QXIA 1AKSA 4TY7A 3TGIE 1ZJKA 4Y7AA 4K1TA 1NU7B 2QIQA 3PO1C 1O38A 1GI0A 1WOFA 2GT7A 1GG6B 1H9IE 1F5KU 3OSYA 2GV6A 3SU6A 4ABFA 2OINA 1C5OH 1BBRE 3BTWE 1ZSKA 8ESTE 1AUTC 4ZXYH 3PTNA 1O2WA 1A61H 1XUIA 1LQEA 5EQRA 2JETC 1O35A 1EB2A 4UEHH 2FX6A 2G8TA 1DUEA 3PV4A 3UFAA 2GZ9A 1GMDF 4NFFA 2BDAA 2G4TA 4I33A 1W3CA 1P0SH 2ZCHP 1ZTKA 5FX6A 1AVXA 1P3CA 3E90B 1KLJH 3O8DA 2OBQA 4XDEA 1LHCH 1GMHF 1O3NA 1PPCE 3I77A 3M35A 4H6SB 2F9UA 4IS5A 1SQAA 2AYWA 1JIMA 1A4WH 1EOLA 3LONA 4D9RA 2H5DA 3SNBA 4X8SH 2ZDAH 4AYYB 1OWDA 1T32A 1YYY1 1B5GH 2SGEE 5TCCA 4MDSA 2PSXA 3EA7A 3RU4T 3O8RA 1V2WT 4TPIZ 3KGPA 1OS8A 3SO3A 1SI5H 3RXRA 2FOHA 2WPHS 1FONA 3MMGA 1JOUB 5HMAA 4OS5A 1A2CH 1O37A 1BUIA 3F9GA 3GDUA 2R3YA 3QWCH 2BXTH 3GY4A 1DOJA 4MPUA 1DFPA 1F7ZA 1T4UH 2A2QH 5F8ZA 4ZROA 5F03A 1O3KA 1WUNH 1O3CA 2H9EH 3GY3A 3SU5A 1AQ7A 1UTJA 2UUJB 3ZVAA 4K8BA 1W10U 2G81E 3ZZ8A 3BTME 1L2EA 1GHWH 2P8OB 1EQ9A 4D7FA 1N6YA 1BMAA 1XVMA 1K1PA 1V2MT 1EKBB 3UREA 1TOCB 1MTWA 3NCLA 1CGHA 3E0NB 4GCHG 3UTUH 1OP2A 1P3EA 2A4GA 1QR3E 1OYQA 2B5TB 4JZDH 1FN6A 4A1XA 9ESTA 1W2KH 3SGQE 1MKXH 3SNDA 3SU3A 4BAHB 3SGAE 1UVOA 3PLKA 3O8CA 1V2KT 1ZMNA 2HVXA 1UTLM 2G4UA 7GCHG 4B2BA 4RN6A 4Y11E 2Z9GA 1BTUA 1XKBC 3A8CA 2PKAA 1UTQA 4VGCC 3GDSA 5DP6A 4FUBA 2ZWLH 1TFXA 1FAXA 1BQYA 2AIPA 3HGNA 2P3FH 4MVNA 3QTOH 5A2MH 4M7GA 4XSKU 4ZXXH 1C5XB 2SGFE 1K28D 1BIOA 1V2UT 3VFEA 4ZHLU 2FOEA 1GDNA 1JXPA 1Y3UA 5HGGA 1N1LA 1S0QA 3ZVBA 4HTCH 2OP9A 5EPNA 2K1QA 2VVCA 2P3TB 1V2TT 1CT0E 1SLUB 1F2SE 5C1YA 4JK6A 1OWHA 1W8BH 4ABBA 3L6PA 4K1EA 4I8JA 3TH2H 1QL9A 4Y6DA 4I31A 5JBBS 1O2NA 3U1JB 1AVGH 5DP5A 1FAKH 1O3AA 1MBMA 3E0PB 4ZKSU 3EAJA 3FFGA 4B73A 5AVDA 1LVMA 4TYDA 3B8JA 2BLVA 1TA2A 2A7JA 2ZHFH 1GJDB 1NM6A 2QGRA 2AGIX 1XX9A 2ZTZA 3BEUA 1EPTB 2ZDKA 3M7TA 4Y8YA 1UO6A 3NXPA 1N8OC 1Y3XA 3BG4B 4Z0KA 4ZKRU 3QDZB 2ZG0H 1P57B 2HGTH 1IHSH 3RC6A 1HAPH 1S84A 1PQ5A 1WV7H 2SFAA 2ESTE 2D1JA 4YTAA 3P8NA 4IMQA 4X2WA 3S0NA 1AUJA 4JYVH 4BAMB 1G30B 1DX5M 1HAGE 3ZVEA 2BOHB 1IQJA 1O2KA 4X1NU 4WMDA 3BF6H 3GY7A 2B9LA 2XW9A 2PTCE 3BTDE 4KGAA 2FDAA 2Y82A 2HNTC 3HK3B 4ZMAH 3GOVB 1TRMA 3IITA 1GJ5H 1TPPA 2F91A 3MHWU 2ZTYA 3E6PH 1O3BA 3ZZ6A 1BA8B 2O8UA 1TX6A 1P2QA 3RXTA 1KXBA 2XYAA 1Z8GA 2ULLA 2Y5GA 1ZLRA 3A80A 4UE7H 1OOKB 1Z71A 2EI6A 2HPQH 2ZU3A 5JBAS 1GHAG 1FPCH 1MD8A 5A09A 2PKSB 1BCUH 3DUXH 4JYUH 3AAVA 2FODA 4FUEA 1F0SA 2NU3E 4JZEH 4XBCA 1CU1A 1C1UH 2WPLS 1CT2E 1A5HA 2QN5T 3RXAA 1Z8IB 5GIBA 2ZU1A 3SJKA 3ZV9A 3MU5A 4AX9H 3A7TA 1NC6A 3GY2A 1GWAA 3T27A 1MZDA 4Y8ZA 4BXWA 4Y10E 3ODFA 3RUOA 3SNCA 2C8WB 3A81A 3TGJE 2BX3A 2ALVA 1JRSA 3VEQB 2AS9A 3LGTA 1KTTB 1OP8A 2FOAA 1QTFA 4Q80A 1MTSA 1BTZA 4JYTA 2OUAA 3A82A 2AEIH 2BD3A 3L3TA 4X8VH 2QCYA 1D3QB 1FY1A 3DD2H 1JWTA 4FU8A 4JZFH 5EU8A 3Q3YA 3EGKH 3A7XA 1C1QA 1O2HA 1TYNA 2TPIZ 5HM2A 5GWZA 3P17H 5CHAC 1HRTH 1C4U2 4DT7B 1GL1A 1HXEH 1DWCH 1RRKA 4ABAA 4I8LA 1DXPA 4R0IA 3P95A 1HFDA 3RXSA 3MYWA 4UONA 2C4FH 1SLXB 4BOHA 1KY9A 3RMOH 2A5AA 3U69H 1GHXH 4ZKNU 1KXDA 3MI4A 3NWUA 2BDIA 3I78A 1HUTH 3GDVA 2RA3A 2ANYA 2A4RA 1L1NA 1XKAC 3RXGA 3VGCB 2Y7XA 1V2LT 4KP0A 1XVOA 6CHAB 7LPRA 4CRAA 5JYIA 3MFJA 2PLXA 1YPHC 2PUXB 2BY6X 4ABEA 1MKWH 2ZPQA 4DURA 3NUMA 1EPTA 3TJUA 1TOMH 3V13A 2C3SA 5K0HA 3HKIB 1YF4A 2ZHWH 1DPOA 1BHXB 1TQ0B 3D62A 1ZHPA 1C1PA 2GZ8A 2ZGCA 2OC8A 1ETTH 1KYNA 1O3GA 2CF8H 1YCPH 1O31A 2FS8A 2OXSA 1CE5A 2Y80A 3SUEA 2OC0A 3ZZDA 2Z6BD 3KQCA 1QHRB 2STBE 5C5NA 3KCGH 2H5CA 5EXNA 1TPOA 2Q6FA 7GCHF 1TGSZ 2BLOA 2VIWA 2SNWA 3TU7H 3PROA 1AI8H 1T8OA 1NRSH 1P04A 3SUFA 3VB3A 4NFEA 3E8LA 4BAQB 4MLFB 2PGBB 4BAKB 2ODQA 1C5TA 1OYTH 1KIGH 2ZFTA 2FP7B 3D65E 3IWMA 3SJ9A 1O2IA 4U01A 1IQMA 1PPZA 1GI4A 5T6FA 4AYVB 4CRGA 2ZFPH 1H1BA 1GCTB 2SGAA 1ARBA 1TALA 4MPXA 1BTWA 1TGCA 2XCNA 2BMGB 1JMOH 1YPKH 1J17T 1A0HB 1GJ6A 2KAIB 2BZ6H 2SNVA 1RTLA 4WVPE 1F5LA 5E2PA 2P59A 3BTHE 1KDQB 1GG6C 2WYJA 2V35A 1GJCB 5F8TA 4AORA 1M9UA 5FXLA 5E0GA 2CHAB 4AN7A 1O3IA 2VVUA 2FZZA 4UD9H 4Q7YA 4PROA 3A8DA 2CF9H 3Q00A 1AY6H 3PB1E 2VGCC 5I46H 1EJAA 4RSPA 4THNH 2GCHG 3OY6U 3RM0H 1CA0B 4YO9A 4Z6AH 4OGXA 3ATMA 3BTQE 1K1IA 3STIA 3ESTA 2ZFRH 3GISB 2I6SA 2CJIA 1LHDH 1SR5C 3LJJA 2ZDNA 1EAUA 3V3MA 1HJ8A 1GMCF 1T8NA 1EATA 1L4DA 2PGQB 4A7IB 2OC7A 2UWOA 1A5GH 4LXBH 2FXRA 1GHBF 3A84A 4FVDA 5E8EH 2HWLB 1K1LA 3ZYEA 1CBWB 1P8VC 3AW1A 2CXVA 1AIXH 2TGDA 3LH3A 1QL7A 3ZZ9A 1CA8B 1O2YA 2ZU5A 5C1UA 1W11U 1ZPZA 4NIVA 1P05A 1TBRH 1BHXF 4O97A 4OS7A 3NZIA 3EYDA 4Y0ZE 1DY8A 3A85A 3S9AA 2GZ7A 2Y5HA 3DA9B 3ZVFA 5F6MA 4Q7ZA 8GCHG 3LGVA 1ANEA 2BDGA 1Q3XA 2VWOA 4MTBA 1EP5A 4WY3A 1A0LA 4OS1A 3M3TA 1G36A 2ZIQH 3GCNA 4NWKA 1HBTH 3LGWA 3QO6A 1WCZA 4LZ4B 1K9OE 4WMEA 1UCYE 1ZHMA 1LPKB 3ATIA 1GBTA 4WMFA 1E38B 3HATH 1BTXA 4D7GA 2PSYA 3T28A 5BPEA 2F9OA 3F1SB 1C1OA 2BQWB 2GCTB 3RC4A 1TWXB 3RMLH 1DDJA 4MNXA 2FYQA 5EGMA 2BHGA 4A5TS 5JPMH 1ZJDA 1AFQB 1SQOA 2UWLA 4AFUA 1HAYB 2XWAA 2F9BH 2Z3CA 2J4IA 2ZQ2A 4UFFH 1TMBH 3SBKA 1J8AA 1GJ9B 3M7UA 1A0JA 4FUJA 5G4BA 2BTCE 2G55A 3FAOA 4D76A 2BDCA 4GHTA 2TRMA 3NPSA 1QGFA 3ZZ5A 3T2NA 4X6MA 3RXEA 1DWDH 1GDUA 3SQEE 3TK6A 2PUQH 2VWLA 4RKJB 5JDUB 2TIOA 1L1GA 1RXPA 1ZHRA 3UR9A 1QBNA 1XUGA 1UK2A 4O9VA 1NS3A 3QUMP 1TPSA 2KAIA 1WTHD 4NCYA 1RFNA 3M5LA 2P95A 3U9AH 1YPGH 8LPRA 1KDQA 3VXEH 2VNTA 1O5AB 4BTUB 1MD7A 2V6NA 3M5MA 4ISNA 2VB0A 3URDA 1BJUA 1HYLA 2P3UB 1FPHH 4XBDA 1S85A 5C20A 1ESBA 3SNEA 2P93A 3RXMA 1O2QA 1QB9A 1PPBH 2VIVA 3RDZA 1Z1IA 1G3DA 2UUKB 5AFYH 2SGDE 2CN0H 3KHVA 3TJOA 3G01A 4FUIA 4NIYA 1YKTA 1J16A 1BT7A 1WSSH 4A1TA 3C1KA 1Y5UT