1O38A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o38A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o38A02
1C1RA 3AVZA 3PMBB 3TU7H 2CF8H 3SJKA 2BDCA 1BT7A 2BZ6H 1O34A 1T31A 1YPGH 5CHAC 4XBBA 4ZROA 4ZKNU 3LDXH 2A45B 3TH2H 2ZI2H 1UHBB 2OQ5A 1QBNA 3LGUA 4B2BA 4LZ4B 1CO7E 1TB6H 2QIQA 5FHTA 1HXEH 4NSYA 1Y8TA 1YPJH 1O5AB 4FU8A 2QXIA 2BXUH 5C5OA 2CF9H 4K1SA 2OP9A 1PPGE 4Y7AA 1K21H 3OU0A 3U9AH 3SORA 5A0CA 3GYLB 1SQOA 3SI3H 2ZHDA 2PSXA 2W3IA 2OC1A 3RUOA 1C4U2 4DGJA 1AZZA 2FX4A 4KGAA 1A4WH 2ZECA 2BDHA 2WPKS 3M61U 1P01A 2BVRH 1EAWA 3TVJB 5EU8A 4GCHG 2BDGA 5T6FA 4K60A 1W3CA 1NFWA 3F6UH 4DURA 2FP7B 1OYQA 1F2SE 1INCA 2GDEH 2Y7ZA 5JDUB 1K28D 2C8WB 1BTPA 1EOJA 4DCDA 1O2LA 2P3UB 2R9PA 1BUIA 5A8ZA 1KDQA 1XUIA 3BEIB 1O37A 1HBTH 1GHBF 2NU0E 3UPEA 1Q2WA 4X2VA 1GDNA 1PQAA 1EPTA 1DANH 1K1MA 1TABE 2XW9A 1SGQE 1OWDA 3RXUA 3URCA 5DP9A 3LGTA 5H4IB 1P0SH 1F0SA 1MTVA 3V12A 1Y3YA 5AF9H 2ODQA 3A84A 1LO6A 1FIWA 2P3TB 1OX1A 1GI7B 1D6WA 6GCHG 1LQDB 3A80A 1ZHMA 2NU3E 1DXWA 1PQ5A 2OCVB 1S84A 3AAUA 4NIWA 5AFZH 1TPPA 3LJJA 2PUQH 3RXLA 2ZGCA 5EOKA 1HAVB 3VB5A 3ZV8A 5HYOA 2BLWA 1VR1H 2HNTF 5FX6A 3STIA 1GBBA 3U69H 1WV7H 1IQMA 4IC6A 3MU0A 2BDIA 4X1NU 4ZAEA 1O2NA 3TK6A 2ZWLH 3F9EA 1NPMA 4A1XA 3BTFE 1V2RT 1KIGH 4NZLA 1O2JA 3O8RA 2BY5X 1C1MA 2TGDA 2ZA5A 1GWAA 1HGTH 4WJG2 2Z3EA 1SGTA 2FOGA 1TRNA 5F8TA 2SGFE 1SG8B 1A2CH 1YP9A 3GCHC 3U8RH 3QDZB 1YCPH 3BTGE 3PB1E 3URDA 2FOFA 2IPHA 4YESB 3M7TA 1MCTA 2P8OB 1QRWA 1WTHD 4AFUA 1AY6H 3ZZ6A 3RXMA 3PLBA 5IYTA 2BD2A 2ULLA 4I8JA 2RCEA 2ZU4A 4YLUA 1RRKA 1OPHB 4MQAA 2UUFB 4GAWA 1O3IA 1YPMH 1C4Y2 1GHBG 4MNVA 3RXHA 3UREA 1SFIA 1C2GA 1ZYOA 3RLYH 1JWTA 2ZKSA 2ZDAH 4D76A 1GHYH 1O5CB 2DUCA 1WQVH 1FAKH 1N6YA 1YPHE 2A1DB 1O32A 2AS9A 1P9UA 4NG9H 2BQ7B 1GG6C 4KP0A 3FZDA 4GPGA 1C1NA 2ZG0H 2P16A 1UJ1A 1P2JA 1IHSH 2BY8X 2Q6FA 3S0NA 1W12U 3ZYDA 1HIAA 3A7VA 1TNGA 3SZNA 2XBXA 4X1PU 1J15A 3E3TA 2G51A 4MG3A 2ZPQA 5ETXA 3RXTA 2H5CA 2ZHFH 4FXGH 1C5NH 3M5MA 3MH7A 2FO9A 1GCTC 3VB4A 1OWHA 4H4FA 1PQ7A 2BHGA 4UDWH 1A7SA 1QFKH 3RXCA 1KYNA 3GY7A 4CBOA 1YPEH 2ALPA 2BXTH 1OYTH 2PLXA 2V0BA 1HJ8A 2A5AA 3OY5U 3P8OA 1WUNH 4AG1A 1BTUA 2QF3A 4ZKSU 4WH8A 4UEHH 1SOZA 1QHRB 3GDVA 2HRVA 1LVBA 1BMMH 2ZFFH 1QURH 1QB1A 1GBTA 2BY6X 1C5MD 2V3OH 1GJCB 3M35A 1ETTH 1YM0A 1KXAA 3R3GB 5GWZA 2XBVA 1QGFA 5LH8A 4DIIH 1OP2A 1SL3A 1S5SA 1QJ7B 1E35B 1W13U 2WPLS 5GIBA 2ZCKP 1BTWA 2Q6DA 2CN0H 3T28A 2R2MB 1J17T 1GVLA 1F5RA 1P10A 1F7ZA 2BD4A 1P12E 3ESTA 3DT0H 4H6SB 3TGKE 1THSH 4TPYA 4X1QU 3RLWH 1NESE 3PV4A 3MMGA 1ZJKA 1NRPH 3GOVB 1T8NA 1O3PB 2W5EA 1IQNA 3BF6H 2GGVB 2XC5A 2QN5T 3QZQA 2ZPSA 1A5IA 1FNIA 1G3DA 3RXRA 1AU8A 2XWBI 1HUTH 3I29A 4XFQA 4JK6A 3LJOA 1CU1A 4IC5A 2AGIX 2PGQB 2YNBA 3CS0A 5HM2A 4ABJA 4DW2U 5AFYH 3UNRA 1RXPA 4IMZA 5K0HA 4O03A 1YLDA 3SOSA 2VIDA 2TRMA 3T2NA 5FBIA 3FP8E 3T62A 2O8UA 1ELTA 1HPGA 3HK3B 1MKXK 5JB9S 1RD3B 5HXFA 3QZRA 4DOQA 2BD9A 1J16A 1O3JA 1MQ6A 3GCTF 3LPRA 3QWCH 2HPPH 1ZSLA 4E05H 2GT7A 1EZXC 2GV7A 3A7ZA 1SLXB 3V13A 1FV9A 1VZQH 2Z3DA 2TBSA 3HKJB 1MKWH 3RU4T 4A92A 1XUFA 2BOKA 3BTDE 3LC5A 1O39A 1ZRBA 1FQ3A 1MAYA 3M5OA 4ISHH 1UTPA 3SU4A 2BD3A 2FEQH 1TNIA 5DP7A 1AFEH 2ZGHA 3ZVDA 2V6NA 4BTTB 2R3YA 5DPAA 1JRTA 1T32A 4AGKA 1TMUH 3SNCA 3SHAH 4ZKOU 2SGDE 5EQQA 1G32B 2ZNKH 3GY8A 1TPOA 5JBCS 4ESTE 9ESTA 4MPVA 2RG3A 1RTKA 3E0NB 3RMNH 1AE5A 1SQTA 2FTMA 1ESTA 3A7XA 1DWBH 3VB3A 4WH6A 2Q6GA 1YYY1 3QGJA 3SV9A 2QXGA 3GY5A 1GJAB 1CHOF 3M7UA 5EXNA 1ZSJA 1G36A 1D6RA 3P8GA 7ESTE 1JXPA 1HNEE 2VIOA 1V2VT 1PFXC 3RXSA 1BMAA 1UTMA 1DLEA 3TJUA 3EA9A 1AKSB 2CHAB 3Q3KA 1G3CA 2C8YB 3E0PB 1AD8H 4GUXA 5E2PA 1ANEA 4BNRA 1P2MA 2GCHF 1NC6A 2HPQH 1SGYE 3RMLH 3ZZ9A 2FXRA 4I33A 4NGAH 4Y71A 3GCNA 1HAGE 1O5BB 3V0XA 2OXSA 3ATMA 1V2JT 1Q31A 3GY2A 3F9GA 1IOEA 1SGFG 1Y5UT 1O3EA 1S0QA 2LPRA 1SBWA 1W10U 2VB0A 4RN6A 2FTLE 1BHXB 2VWNA 4ZHAA 2A32A 2TIOA 1FMGA 2H6MA 3VXEH 1DWCH 1NRQH 1CGIE 1P11E 1EXFA 2D1JA 4BXWA 3A8CA 1SMFE 5AVDA 1NTPA 4B76A 2AGEX 2B5TB 2Z3CA 3QUMP 4FUFA 1KTTB 2R0KA 2OLGA 1JMOH 2CHAC 1P2IA 3WY8A 1UTNA 3A85A 3A88A 1O38A 3HKIB 3SUGA 4NIVA 1TLDA 3BN9A 1GJ9B 1EP6A 1ABIH 4Q7ZA 3MTYA 1C1PA 5C20A 1DSUA 1J14A 3SNAA 3PMJA 1O0DH 1LPZB 4GHQA 3GY6A 1O33A 1LHEH 1H8DH 4INHA 1FPCH 1LVOA 1TBRH 4FVDA 2PW8H 2FS8A 3SGBE 4Y7BA 2FYQA 2SGPE 4JCNA 4YTAA 3ZVEA 2F9PA 1C4V2 1ZTKA 1IQIA 1CHOG 3LH1A 3TLOA 5C67A 1Y3XA 2PWXA 2EI8A 1AKSA 3MU5A 1B5GH 1GVZA 1O31A 1QL7A 3KGPA 4DT7B 3RMOH 2FOHA 1BITA 1FI8A 1MMJN 2OBQA 5LPEA 1FY4A 4FU9A 1BRAA 1C5OH 1E34B 1LHDH 1YC0A 2ZF0H 3UUZA 3VXFH 5DKMA 3G01A 3D62A 3LGYA 3EA7A 1THRH 2OTVA 2HWLB 4AB9A 3KNXA 1GGDB 2Z9IA 4Z0KA 4D9RA 3PTBA 3Q77A 1ZGIA 1W8BH 5HM9A 1A0HB 1UK3A 1FUJA 2ZDKA 1BQYA 3ZZ7A 1C5SA 1OP0A 5DJ7A 2G4TA 1UVOA 2VGCC 3SGAE 2D2DA 3KQCA 1ELDE 1Z8GA 1UVSH 1TPSA 2FODA 1LMWB 2UUJB 4JYUH 2W7UA 1TQ7B 1C5RA 1ZR0A 2GKVE 4UE7H 1S85A 4YT6H 1N8OB 4XDEA 1MUEB 3HPTB 3SGQE 2VH0A 3TJNA 1RIWB 4JK5A 2BX4A 2ZHQH 1GPZA 3LT3A 1GVKB 4NWLA 1BB0B 4IMQA 1VCPA 3PMAB 3TK9A 3Q3YA 1GGDC 4FVBA 2BMGB 3T29A 1H9HE 1A46H 1DX5M 1ZGVA 2PHBA 3HGNA 4AORA 1OWJA 3SUFA 3OTJE 2BD5A 3GY3A 1EUFA 8KME2 1V2TT 2C4FH 1EATA 1JBUH 4GSOA 1TX8A 1SLUB 5E0GA 1AUJA 2ALVA 3KCGH 1ELVA 1C1VH 3E6PH 4X6OA 3K6YA 5DP3A 1N8OC 3PLKA 1QRZA 3PROA 5DP8A 1ZLRA 1CA0C 4KTUA 1RIWC 2A5IA 1C5TA 2VWLA 3LOXA 2SGAA 1P2QA 5A8XA 1C5WB 1QQ4A 1DICA 2WPJS 1AGJA 3EE0B 3MNCA 1FLEE 1SLVB 3SW2B 2ODYB 1AB9B 5FPYA 4K8BA 4I32A 1ZZZA 3ATLA 5E2OA 1SGDE 1CGHA 3E1XB 4X6NA 2I6QA 2J95A 2JETB 3FANA 1HAZB 1L1GA 2BVXH 1SGPE 2BB4A 3S7KB 1C5LH 1BBRE 1JIMA 4NIXA 2Z6BD 1GI0A 3A83A 1O2ZA 1EQ9A 4INLA 1D3DB 2WYGA 1UCYE 1O36A 5FPTA 1ELBA 1EPTC 5SGAE 4BAKB 1GI9B 1BMNH 5TCCA 4WXIA 4Q80A 2BZAA 1DUAA 2VJ1A 6CHAC 1O2YA 5G4BA 3U1IB 1GBAA 1HV7A 2QXHA 3HATH 3ODFA 1BZXE 1SC8U 3TGJE 1AB9C 4FUJA 1MH0A 5JBAS 2Y82A 3NCLA 3ZZCA 4GLYA 1P03A 1K22H 1GDQA 4IN1A 1FAXA 3SU3A 2F9NA 1UK2A 4MNWA 1GJBB 3NXPA 2JETC 2ZDMA 1UTLM 3TJOA 1F5LA 1HFDA 4CH8B 1Z8JB 2ZP0H 2VH6A 3GCHB 2CXVA 3CS7A 3MNBA 4BOHA 1GMHF 4IBLH 8GCHF 3RM0H 2BOHB 4NFEA 4X2XA 1KXFA 3AASA 1UHBA 1MTSA 3SU5A 5LGOA 4Z6AH 5DG6A 1ETRH 1XM1A 1O3NA 1WQSA 1C1SA 1BJUA 2F3CE 1LPKB 3NWUA 1OWEA 3ENSB 1TOMH 1J8AA 2IJOB 1GL1A 2G52A 3I77A 2FWWA 4A1TA 4B75A 2VWMA 3SV7A 3NZIA 1AN1E 2G55A 1SB1H 4CR5A 4K8YA 2R0LA 4AFZA 4K69A 2GZ7A 5EODA 2H2ZA 2STAE 1HYLA 2QV1A 1AO5A 1O2MA 1T8MA 6ESTA 3RXDA 1QRXA 1OXGA 1GG6B 4UONA 1O3FA 5EQRA 5EPNA 3T25A 2FOCA 4ISLA 1UO6A 4Y79A 2H9EH 1Y3WA 1ELFA 4K3JA 4SGBE 1C1TA 4AB8A 1C9PA 1GJ4H 2BD7A 2WV5A 3S9CA 3ZZDA 1ZHRA 1LKBA 3ODDA 1GCTB 1C1QA 3KEEA 5I25A 1OWKA 5DP6A 1A61H 2J9NA 1NZQH 5A0BA 1GHWH 2Q1JA 2QF0A 2KAIB 4FUBA 1SLWB 1F0TA 3MU8A 4YZUA 2CMYA 1YF4A 1NRRH 3DFLA 1ARBA 1GJDB 1GDUA 2Z9KA 3TK5A 2EC9H 1PQ8A 2XC0A 1GI6A 2A4RA 4D7FA 2WUBA 1T8LA 5DP5A 3RXOA 1GHVH 1HAVA 3FVFB 4K2YA 2A4OA 2ZU2A 5DGJA 4NA8A 2VIQA 4SGAE 4R0IA 4MNXA 5T3HA 3UR6A 1DFPA 2P94A 3GDUA 3EQ0H 4X8VH 3K9XB 3E90B 3TNSA 3SO3A 2A5KA 1LQEA 5A2MH 1O5EH 4CH2B 3MNXA 1PPEE 3SNBA 2A2QH 1KXCA 4O9VA 5HMAA 3UQVA 1D4PB 3KN2A 1ZOMA 4WMFA 4DJZB 4OS7A 2GTBA 3ELAH 3TJVA 1GBDA 3SNDA 5EG4A 1CA8B 2G8TA 1MTNB 1FJSA 1GHAF 1MU8B 4M7GA 2VU8E 1O2TA 4TY6A 1BRBE 1AE8H 5TCAA 2ZFQH 5L2ZH 1NFUA 1F0UA 1C1OA 2R3UA 1L0ZA 1DY9A 1ORFA 1Y59T 1RJXB 1KSNA 1FXYA 2J4IA 4XBCA 1QJ6B 3H7TA 1T8OA 2DE9A 2UWOA 2J94A 3IG6B 4Y10E 1IQJA 1T4VH 1HB0B 2NWNA 1XUHA 3GYMA 4AGJA 5J4QA 2ANWA 1TIOA 2J34A 4B73A 7GCHF 3S9BA 1TMTH 2GMTC 4ABAA 3Q00A 2ILNA 3DUXH 1SGCA 1MTWA 2Z94A 1QJ1B 1H9IE 1E38B 2NU1E 2UWLA 4B2CA 1F92A 1ID5H 2BQ6B 1MTNC 1FPHH 3RU4E 2PTNA 1TGCA 3MNSA 1C2MA 3SV6A 1UVTH 1O2WA 3M37A 2IN2A 4ZHLU 3P70B 3SU2A 1W0ZU 3VB7A 4XBDA 1HAYB 3KQBA 1GI5A 3A7YA 3S7HB 2HNTC 4HGCA 1L1NA 4CRFA 1HAIH 1QB9A 2CJIA 4ZKRU 1N6XA 1VITF 1MAXA 1VCWA 4O3UA 1MBMA 5EGMA 2XXLA 1AWFH 1ESAA 1CQQA 4FUEA 4WXVA 4X2WA 3QLPH 4I8GA 4JZFH 4LZ1H 2PR3A 3O8BA 1DY8A 4K1EA 1ANBA 1P3EA 1GJ6A 1O2KA 1C5VA 4CRCA 1D9IA 3MWIU 3LGWA 1TA2A 1ZMNA 1VCQA 2WV4A 1QBOA 2NU2E 1A3EH 5C5NA 1EASA 1GJ8B 3PYHA 5EPYA 3U98H 4INKA 1GHAG 1OP8A 5C1UA 2XTTB 3A8AA 3LGIA 4XE4A 1C2KA 4NA9H 1AFQB 1WAYB 1TGSZ 3RXGA 5L30H 5C1YA 3SUDA 2Y7XA 3M36A 3LU9B 1BIOA 3E8LA 1ANCA 1O2RA 1W0YH 1YCPK 1SGNE 3ZZ5A 2B9LA 3LKWA 1GL0E 1O2IA 3QK1A 1HJ9A 2V3HH 1GJ7B 3BTHE 2ZU1A 4VGCB 3O8CA 1QIXB 7GCHG 4BAHB 1TX7A 5C1XA 1P06A 1T4UH 5GPIB 4Q7XA 4MPUA 3RU4D 1IQHA 1QCPA 3SHCH 2Z9JA 1PYTC 3FP6E 3BV9B 1C1WH 3EAJA 1Z1JA 3MH6A 4A7IB 2FX6A 3MHWU 3MH4A 3SN8A 1AFQC 1HAPH 1Q3XA 4I8LA 2Y5HA 1CT2E 3MU1A 3CENA 3MOCA 1SPJA 7KMEH 1S83A 4OGXA 2BM2A 1Z8RA 3NUMA 4MPXA 2FESH 4MLFB 4CRGA 4F49A 1YBWA 2Y80A 1WTGH 3UR9A 1P2OA 1CBWB 4AOQA 2ZU5A 4MPWA 1E36B 1DT2A 4VGCC 1O2GH 3NKKA 3PLPA 4E7RG 4KTCA 1EZSC 2ZFRH 2ZQ1A 2VNTA 3TITA 1LCYA 2D26C 1K2I1 3ATWA 1O2OA 3GCTG 3ZVFA 1JIRA 3LONA 4CBNA 3RXAA 3U1JB 1GBLA 4MDSA 2A4QA 1IQFA 2XWAA 2ESTE 1Z7KA 2WPHS 1B0EA 1GBHA 2BY9X 1SHYA 2H5DA 4X2YA 1GBFA 2HVXA 4CRAA 1HXFH 5A0AE 8ESTE 1TALA 1SI5H 1O5GH 2A31A 4NA7A 1K1IA 3PM3A 4WWYA 5GXPA 1S6FA 5E0JA 1C2HA 1V2QT 3A87A 2LNCA 1CBWC 5ESBA 4JZEH 3L3TA 3BTKE 1ELCA 1O3MA 2IOTA 4TYDA 4OS6A 1CHGA 1EOLA 3PWCA 3ZZ4A 1GI1A 3RXPA 1JOUB 2ZTZA 1Z8IB 2B8OH 2ZFSA 1AMHA 4WY3A 1ESBA 1O2UA 1FN8A 3SV2H 1YLCA 1ETSH 4IW4E 4BTIB 1A5GH 5I46H 1UVUH 2H9HA 2Y5FA 4RSPA 1KLJH 5GJ4B 4XSKU 2VGCB 5JPMH 3CP7A 1RS0A 1SGEE 1DUEA 2BD8A 4OS2A 2JH6D 1MBQA 4ZHMU 2WYJA 1GMCF 1K1NA 2Z9GA 3B8JA 3P8FA 4OS5A 1RGQA 4ZUHA 1O3LA 2F9BH 1PPHE 1BTYA 1DXPA 2FOMB 2UUYA 1ZHPA 2AIQA 2P59A 2OINA 5ABWA 2GCHG 3TH3H 4AX9H 3H5CB 3ZVGA 1TRYA 5PTPA 4ABFA 1VJ9U 1EAIA 3T27A 4ABDA 2VIPA 3QX5H 4O3TA 1TFXA 3BG8A 2BDAA 1TOCB 1PPCE 1TGNA 1G2MA 1EB1H 4I8KA 2XCFA 4JMYA 2C8XB 1OKXA 1FY5A 1SVPA 1O2VA 5A8YA 2O8MA 1SSXA 1K1JA 1MKWK 1BCUH 1S82A 2GCTB 4BANB 4AN7A 1V6DA 2GD4B 3OY6U 3BIVH 1NRSH 5L2YH 1O2HA 1BJVA 2JKHA 1SGFA 1O3HA 1CA0B 2I6SA 1GBKA 3QN7A 4AFSA 4ISIH 1PYTD 2Y5GA 2FI5E 3UWIA 1AVGH 1BBRK 1W7XH 1HJAB 3SU6A 2SNVA 1MD7A 2BDYA 2WPMS 2JH5D 1UCYK 2B0FA 2ZGXH 3ATIA 1F0RA 2PKAB 3FAOA 4MVNA 4CRDA 4YT7H 3ATKA 5DP4A 2EA3A 3OX7U 4GVUA 8LPRA 3M5LA 3IWMA 2RA0A 2OC8A 1E0FD 1RTFB 1V2MT 4H6TA 1LVMA 1ELGA 1FZZA 3ZZAA 3RXEA 1O2QA 4OS4A 4Y0YE 2GCTC 2ZTXA 3RXVA 1FY3A 5DK1A 2AGGX 2ZU3A 4X6PA 3M5NA 1SGIB 3RMMH 4B1TA 2QA9E 1PPFE 2PUXB 4JZDH 1ELEE 1GI2A 3BG4B 3W94A 1EPTB 1MD8A 2JH0D 2TGTA 4I7YH 2VIVA 3SJ9A 1B7XB 1EZUC 1SOTA 1Y5BT 2PTCE 4LXBH 1XXFA 2FLRH 6GCHF 6CHAB 4ABEA 2TPIZ 3N7OA 3A86A 1HJAC 4MTBA 2SNWA 1QR3E 1OWIA 1TNLA 5BRRE 2VINA 3ZZ8A 1EB2A 1LKAA 2ZC9H 9LPRA 1AVXA 1NRNH 2CV3A 1NT1A 3E91A 3MI4A 4JYVH 1S6HA 1TX6A 1LHFH 1RFNA 1O3GA 4ABHA 4ISOA 2WPIS 1YGCH 1WOFA 2FOBA 3Q76A 1AWHB 3P17H 4J2YB 2GV6A 1EJAA 2FPZA 1FDPA 2BY7X 3BG4C 2EEKA 2XC4A 5T6GA 5EW1H 1Z6JH 3DD2H 3RC5A 1QNJA 3LC3A 3UOUA 2ZFTA 1UTKA 1QB6A 4JZ1A 1KY9A 1TRMA 2J38A 4NIYA 1O3KA 1V2UT 1V2PT 1BTZA 2GZ8A 3KL6A 1L2EA 1THPB 2PKAA 4J1YA 3RP2A 1BTHH 1V2WT 3RXKA 1NU9A 1DDJA 1P02A 2A7JA 2BVSH 3P95A 2YNAA 3L6PA 2QXJA 2ZPRA 3FFGA 4NCYA 3GY4A 2AMQA 1V2ST 3B9FH 1UVPA 3AW1A 3AAVA 1G2LA 3OYPA 3BEFB 1VGCB 1GHXH 4UD9H 2A4GA 4LK4A 1ABJH 2ZDNA 1G37A 3AW0A 3TH4H 4AYYB 4D9QA 2XNIA 1YPKH 2BLVA 2UUKB 1BTXA 3A8DA 1EX3A 1HRTH 1NFXA 1ZTLA 4FUDA 2FOEA 1NO9H 1QA7A 2FIRH 2Y6TA 3ZV9A 2XYAA 2XCNA 1B0FA 3ZVCA 1FIZA 4K5ZA 1TONA 1Z1IA 3U8TH 1H4WA 4KTSA 3MO6A 1C2EA 3RXJA 1UTJA 2FMJA 3MO3A 4Y6DA 5T6DA 1YPHC 4I31A 4O97A 4Y8YA 3ZYEA 2C3SA 1IHTH 4FUHA 4BAQB 2ZDLA 5DO4H 1TYNA 3RXQA 2QC2A 2C93B 3QGNB 1G3EA 1IQGA 1FN6A 1HIAB 4XOJA 1W2KH 1JRSA 1AZ8A 5GDSH 2AERH 2W3KA 2J2UA 1MKXH 2OC7A 2VIWA 1HLTH 2BQWB 3GCOA 1VGCC 1AVWA 4KKDA 5JBBS 5FXLA 2BLQA 1KXEA 2R2WU 1H9LB 3UIRA 2H1UA 2PV9B 3Q3XA 2O8TA 1GBMA 2ZZUH 3MFJA 3FZZA 2J92A 1HAHH 1EAUA 1HCGA 4H42U 1XKBC 1LHCH 3M3SA 4IGDA 3F9FA 5LPRA 4WF8A 4B71A 3VGCB 4Q7YA 2QCYA 3M7QA 5CMXH 4DVAU 1DSTA 3F1SB 1L1JA 2P93A 4X1RU 3KF2A 1V2KT 1TMBH 1ZJDA 4YOJA 1DM4B 2HOBA 2ZCHP 3HGPA 1TA6A 2FOAA 3TGIE 1DOJA 5CE1A 1LHGH 4ZH8A 1LVYA 3U8OH 4DIHH 4X8UH 5K7RA 1P05A 4R8TB 3BIUH 2THFB 1WYKA 1DS2E 1L4DA 2AMPA 2AFQB 4WMDA 2ODPA 5AHGH 3F9HA 3M3VA 2ZEBA 1GMHG 1NS3A 2G00A 2ZO3H 8GCHG 2BX3A 2ZCLP 3MU4A 2H9TH 1VJAU 1XUKA 1KXDA 2ZQ2A 1CGJE 2STBE 3O8DA 2HALA 4AYVB 1WU1A 1Y5AT 4I8HA 1WCZA 2GMTB 3VGCC 3SI4H 1FONA 2FI4E 2G4UA 1P2KA 3EYDA 2FYRA 2P8OC 3PO1B 1ZPCA 2P3FH 4JZIA 1GBIA 1IQKA 3BTEE 1UMAH 3BTTE 4K1TA 4PROA 4DY7B 3UNSA 1O30A 5IDKA 1CT4E 2QY0B 3C1KA 1TGTA 1SR5C 2WUCA 3QTOH 3SU1A 4AZ2B 7LPRA 4CRBA 4Y8ZA 3GISB 3EA8A 1XUJA 5BPEA 3QTVH 4F4OC 1GBEA 4D8NA 3PWBA 2W7SA 3BSQA 2ASUB 1GI3A 1O3DA 3GDSA 3FP7E 5A09A 4U32A 1C9TA 3BTWE 4A1VA 4AG2A 5ESTE 3UTUH 3S69A 1XX9A 3K6ZA 1BA8B 1GBJA 4HFPB 2GDDA 1SGRE 1ELAA 1S81A 5FBEA 3E16B 3PO1C 2KAIA 2Z9LA 4WVPE 5JB8S 1Y3VA 4BAMB 1Z6EA 3LGVA 2ZDVH 1O3OA 3UQOA 3KQEA 1ZMLA 3M3TA 4X6MA 4CREA 1C5YB 1D3PB 1HDTH 2V35A 4A6LA 1A5HA 5TJXA 3L33A 1N1LA 2TGPZ 1UK4A 4GHTA 4X1SU 1K1OA 1K1LA 4HI3A 5E8EH 2FS9A 1QTFA 1OS8A 2RA3A 3A81A 1M9UA 1NU7B 3ITIA 1PPBH 3VPKA 2OD3B 1BHXF 3V7TA 1LTOA 2Y81A 1GBCA 2ANYA 2PFEA 2M5TA 4ISNA 4NFFA 1VITH 4U2WA 1DE7H 4KELA 3RC4A 1ZPBA 4ABIA 2O8WA 3MO9A 3ZZBA 1TAWA 4BXSA 2GZ9A 1O35A 5EQSA 1GCDA 3RXBA 2F9OA 2BLOA 1WSSH 2P95A 1XVMA 1HAOH 4E06H 1HAXB 1TBZH 3JZ2B 1AQ7A 1P8VC 3UNQA 2XRCA 1C2IA 1H1BA 4TY7A 3SJIA 1QY6A 2SFAA 4ABBA 1P2NA 1EZQA 1GHZA 1O5FH 1A0JA 1O3AA 3BEUA 3S9AA 4HTCH 1D3TB 2F83A 4LOYH 2ZHWH 5EXLA 3NK8A 2PSYA 1XUGA 2B7DH 1IAUA 5FPSA 1YCPM 3LH3A 3UFAA 1GMDF 5HGGA 1MZAA 4ZMAH 4D7GA 3SJ8A 1UTOA 3BTME 4TWYA 1AHTH 1FY1A 4ZXXH 3R0FA 1ACBE 4ASHA 1EAXA 1DITH 1C5PA 4YO9A 4UFGH 1BRUP 2FM2A 4YLQH 1EJNA 4THNH 3RC6A 2QAAA 1XKAC 1BOQA 4YOGA 3K2UA 1NY22 2ZTYA 1LDTT 3A8BA 1F5KU 2WINI 4MNYA 1O3CA 4CHAB 1XVOA 1QBVH 2HNTE 2XBWA 1IQLA 3LIWA 1BBRH 1EKBB 4E7NA 1ANDA 1TNKA 3SV8A 1J9CH 1O2XA 1UCYH 1MZDA 1TWXB 1DVAH 1MQ5A 2A7CA 4BAOB 5EW2H 2AMDA 4ABGA 3P6ZB 3H7OA 2ZFPH 1NM6A 1SQAA 4NSVA 2VWOA 2OQUA 4IN2A 4U01A 1VITG 1KLIH 1U6QA 2ZGBH 3MH5A 1ZTJA 3RM2H 5GCHF 1AIXH 1C2DA 1C5UA 3KIDU 2F91A 2XBYA 4RKJB 3BTQE 1PJPA 1ZPZA 2RDLA 3SQEE 3KQDA 3SNEA 4JYTA 5C3NA 1TE0A 1O5DH 4UFEH 2F9UA 1ZSKA 2FLBH 1A0LA 1W7GH 2Z7FE 4X8SH 1GJ5H 3TIUA 1MTUA 4CHAC 2G81E 3B23B 1C2LA 4A5TS 2OUAA 1CSOE 1CT0E 1P09A 4UFDH 1YKTA 1CE5A 3SU0A 3UWJH 1V2OT 5F6MA 1YPLH 4YM9A 3GICB 1DWEH 2OC0A 3MYWA 4ZXYH 1DLKB 2BDBA 3IITA 5FX5A 2FDAA 1NROH 1O3BA 3C27B 4Y76A 2GT8A 3VB6A 4OS1A 4CR9A 1G9IE 2CGAA 5FCKA 3TPIZ 1SFQB 2O9QA 1MCVA 1P04A 1QA0A 1WBGB 5F8XA 1GMDG 5EXMA 5LPFA 2FZZA 2ZGJA 5C2ZA 4FUCA 4NWKA 1UTQA 1P9SA 3OSYA 2OBOA 2A0QB 2O8LA 5F8ZA 3RXFA 2EI6A 2QGRA 3W95A 1BRCE 2YOLA 3P92A 5FAHA 1W14U 2DE8A 2AIPA 3T5FH 1L4ZA 2ZHEH 4NZQA 1QQUA 4Y8XA 4FUIA 2EI7A 4Y0ZE 3PMHB 3T26A 1H8IH 2C90B 2ZIQH 2SGQE 1W11U 1K9OE 6LPRA 1TNJA 1XMNB 1C1UH 3F68H 4BTUB 4TWWA 3STJA 2BYAX 4YOIA 2ANKH 2UWPA 5JBTA 4RKOB 1V2NT 1S0RA 2VVCA 4IS5A 1C5QA 2FI3E 1TGBA 1ZMJA 1XXDA 1TBQH 1ARCA 1P3CA 4FUGA 4OGYA 1C2JA 1K1PA 2VVVA 2F9VA 1ZRKA 1DPOA 2ANMH 1C2FA 3D23A 3I78A 3D65E 2BTCE 5GCHG 1KXBA 1BDAA 1V2LT 2C8ZB 4B74A 3SUEA 4DG4A 1T7CA 2PKSB 1C5ZB 1G30B 4QT8C 3DFJA 4X8TH 3ZVBA 1RTLA 2A2XH 2AEIH 2AH4X 3RDZA 5F03A 2GX4A 2HGTH 3A7WA 3EGKH 4HZHA 3P8NA 1A3BH 3ZVAA 1X7AC 1LPGB 2QYIA 1CVWH 2PGBB 3RXIA 4X0WU 1C5XB 1TNHA 2AYWA 1D3QB 4FU7A 3A7TA 3SBKA 1TQ0B 5E0HA 4U30A 3SJOA 1P57B 1KTSB 2VVUA 1SHHB 1EJMA 3DHKH 3HK6B 4TPIZ 3UY9A 5B6OA 1MU6B 2A7HA 2D8WA 4GCHF 3EDXB 4UFFH 5FCRA 4Q2KA 1O2PA 5L6NH 1A1RA 1TPAE 4B2AA 3V3MA 1GI4A 2G5NA 5JYIA 2G5VA 5CHAB 2NU4E 1QL8A 2PKSC 1E37B 2GVFA 3K65B 1IQEA 1O2SA 1AI8H 3VFEA 1OSSA 3ZZ3A 1V3XA 1BMLA 3KHVA 1FY8E 2HLCA 3PTNA 1EP5A 1PPZA 3A89A 3DA9B 3NPSA 1G3BA 4WMEA 3SQHE 4AFQA 1KDQB 2K1QA 1Y3UA 1DWDH 2SGEE 3VEQB 3UOPA 5J4SA 1NN6A 4Y11E 2W26A 1QL9A 1AUTC 3QO6A 1Z71A 2TGAA 1NFYA 1GMCG 1KLTA 3D49H 1OOKB 2GP9B 3TNTA 3A82A 3JZ1B 1GI8B
chains in the Genus database with same CATH superfamily
1C1RA 3AVZA 3DSGA 3PMBB 3TU7H 2CF8H 4HG6A 3SJKA 2BDCA 1BT7A 2BZ6H 1O34A 1T31A 1YPGH 5CHAC 4XBBA 4ZROA 4ZKNU 3LDXH 2A45B 3TH2H 2ZI2H 1UHBB 2OQ5A 1QBNA 3LGUA 4Q63A 4B2BA 4LZ4B 1CO7E 1TB6H 2QIQA 5FHTA 1HXEH 4NSYA 1Y8TA 1YPJH 1O5AB 4FU8A 2QXIA 2BXUH 5C5OA 2CF9H 4K1SA 2OP9A 1PPGE 4Y7AA 1K21H 3OU0A 3U9AH 3SORA 5A0CA 3GYLB 1SQOA 3SI3H 2ZHDA 2PSXA 2W3IA 2OC1A 3RUOA 1C4U2 4DGJA 1AZZA 2FX4A 3EE7A 4FOUC 4KGAA 1A4WH 1YLNA 2ZECA 2BDHA 2WPKS 3M61U 1P01A 2BVRH 1EAWA 3TVJB 5EU8A 4GCHG 2BDGA 5T6FA 4K60A 1W3CA 1NFWA 3F0OA 3F6UH 4DURA 2FP7B 1OYQA 1F2SE 1INCA 2GDEH 2Y7ZA 5JDUB 1K28D 2C8WB 1BTPA 1EOJA 4DCDA 1O2LA 2EQNA 2P3UB 2R9PA 1BUIA 5A8ZA 1KDQA 1XUIA 3BEIB 1O37A 1HBTH 1GHBF 2NU0E 3UPEA 1Q2WA 4X2VA 1GDNA 1PQAA 1EPTA 1DANH 1K1MA 1TABE 1VKYA 1SGQE 2XW9A 1OWDA 3FO8D 3RXUA 3URCA 5DP9A 3LGTA 5H4IB 1P0SH 1F0SA 1MTVA 3V12A 1Y3YA 5AF9H 2ODQA 3A84A 1LO6A 1FIWA 2P3TB 1OX1A 1GI7B 4B6FA 1D6WA 6GCHG 1LQDB 3A80A 1ZHMA 2NU3E 1DXWA 5GNDA 1PQ5A 2OCVB 1S84A 3AAUA 4NIWA 5AFZH 1TPPA 3LJJA 2PUQH 3RXLA 2ZGCA 5EOKA 1HAVB 3VB5A 3ZV8A 5HYOA 2BLWA 1VR1H 2HNTF 5FX6A 2WSSD 3STIA 1GBBA 3U69H 1WV7H 2PP6A 1IQMA 4IC6A 3MU0A 2BDIA 4X1NU 4ZAEA 1O2NA 3TK6A 2ZWLH 3F9EA 1NPMA 4A1XA 3BTFE 2HVYB 1V2RT 1KIGH 4NZLA 1O2JA 3O8RA 2BY5X 1C1MA 2TGDA 2ZA5A 1GWAA 1HGTH 2QE7D 4WJG2 2Z3EA 1SGTA 2FOGA 1TRNA 5F8TA 2SGFE 4ZCNA 1SG8B 1A2CH 1YP9A 3GCHC 3U8RH 3QDZB 1YCPH 3BTGE 3PB1E 3URDA 2FOFA 2IPHA 4YESB 3M7TA 1MCTA 2P8OB 1QRWA 1WTHD 4AFUA 1AY6H 3ZZ6A 3FKSD 3RXMA 2EY4C 3PLBA 5IYTA 2BD2A 2ULLA 4I8JA 2RCEA 2ZU4A 5B6LA 4YLUA 2YMSD 1RRKA 1OPHB 1WXRA 4MQAA 2UUFB 4GAWA 1O3IA 1YPMH 1C4Y2 1GHBG 4MNVA 3RXHA 3U28C 3UREA 1SFIA 1C2GA 2QF5A 1ZYOA 3RLYH 1JWTA 2ZKSA 2ZDAH 4D76A 1GHYH 1O5CB 2DUCA 1WQVH 1FAKH 1N6YA 1YPHE 2A1DB 3N99A 1O32A 2AS9A 1P9UA 4NG9H 2BQ7B 1GG6C 2LP6A 4KP0A 3FZDA 3GS9A 4GPGA 5KGOA 1C1NA 2ZG0H 2P16A 1UJ1A 1P2JA 1IHSH 2BY8X 2Q6FA 3S0NA 1W12U 3ZYDA 1HIAA 3A7VA 3VG8A 1TNGA 3SZNA 2XBXA 4X1PU 1J15A 3E3TA 2G51A 4MG3A 2ZPQA 2K8IA 5ETXA 3RXTA 2H5CA 2ZHFH 4FXGH 1C5NH 3M5MA 3MH7A 2FO9A 1GCTC 3VB4A 1OWHA 4H4FA 1PQ7A 2BHGA 4UDWH 1A7SA 1QFKH 3RXCA 1KYNA 5IK2D 3GY7A 4CBOA 1YPEH 2ALPA 2BXTH 1OYTH 2PLXA 2V0BA 1HJ8A 2A5AA 3OY5U 3P8OA 1WUNH 4AG1A 3PRDA 1BTUA 2QF3A 4ZKSU 4WH8A 4UEHH 1SOZA 1QHRB 3GDVA 2HRVA 1LVBA 1BMMH 2ZFFH 1QURH 2KCAA 1QB1A 1GBTA 2BY6X 1C5MD 2V3OH 1GJCB 3M35A 1ETTH 1YM0A 5HKKD 1KXAA 5EIYA 3R3GB 5GWZA 2XBVA 1QGFA 5LH8A 4DIIH 1OP2A 1SL3A 1S5SA 1QJ7B 1E35B 1W13U 2WPLS 4XRNA 5GIBA 2ZCKP 1BTWA 2Q6DA 2CN0H 3T28A 2R2MB 1J17T 1GVLA 1F5RA 1P10A 1F7ZA 2BD4A 1P12E 3ESTA 3DT0H 4H6SB 3TGKE 1THSH 4TPYA 4X1QU 3RLWH 1NESE 3PV4A 3MMGA 1ZJKA 1NRPH 3GOVB 1T8NA 1O3PB 2W5EA 1IQNA 3BF6H 2GGVB 2XC5A 2QN5T 3QZQA 2ZPSA 1A5IA 1FNIA 1G3DA 3RXRA 1AU8A 2XWBI 1HUTH 2JJ2D 1NBME 3I29A 4XFQA 4JK6A 3LJOA 1CU1A 4IC5A 2AGIX 2PGQB 2YNBA 3CS0A 5HM2A 4ABJA 4DW2U 5AFYH 3UNRA 1RXPA 4IMZA 5K0HA 4O03A 1YLDA 3SOSA 2VIDA 4ASUD 2TRMA 3T2NA 5FBIA 3FP8E 3T62A 2O8UA 1ELTA 1HPGA 3HK3B 1MKXK 5JB9S 1RD3B 5HXFA 3QZRA 4DOQA 2BD9A 1J16A 1O3JA 1MQ6A 2WHXA 3GCTF 3LPRA 3QWCH 2HPPH 1ZSLA 4E05H 2GT7A 1EZXC 2GV7A 3A7ZA 1SLXB 3V13A 1FV9A 1VZQH 2Z3DA 2TBSA 3HKJB 1MKWH 3RU4T 4A92A 1XUFA 2BOKA 3BTDE 3LC5A 1O39A 3F2FA 1ZRBA 1FQ3A 1MAYA 3M5OA 4ISHH 1UTPA 3SU4A 5DN6D 2BD3A 2FEQH 1TNIA 5DP7A 1AFEH 2ZGHA 3ZVDA 2V6NA 4BTTB 2R3YA 5DPAA 2F4LA 5KECA 1JRTA 1T32A 4AGKA 1TMUH 3SNCA 3SHAH 4ZKOU 2SGDE 5EQQA 1G32B 2ZNKH 3GY8A 1TPOA 5JBCS 4ESTE 9ESTA 4MPVA 2RG3A 1RTKA 3E0NB 3RMNH 1AE5A 1SQTA 2FTMA 1ESTA 3A7XA 1DWBH 3VB3A 4WH6A 2Q6GA 1YYY1 3QGJA 3SV9A 2QXGA 3GY5A 2AHME 1GJAB 1CHOF 3M7UA 5EXNA 1ZSJA 1G36A 1D6RA 2JJ1D 3P8GA 4YXWD 1JXPA 1HNEE 7ESTE 2VIOA 1V2VT 1PFXC 3RXSA 1BMAA 1UTMA 1DLEA 3TJUA 4M9FA 3EA9A 1AKSB 2CHAB 3Q3KA 1G3CA 2C8YB 3E0PB 1AD8H 4GUXA 5E2PA 1ANEA 4BNRA 1P2MA 5CHBA 2GCHF 1NC6A 2HPQH 1SGYE 3RMLH 3ZZ9A 2FXRA 4I33A 2J5UA 4NGAH 4Y71A 3GCNA 1HAGE 1O5BB 3V0XA 2OXSA 3ATMA 3PV5A 1V2JT 1Q31A 3GY2A 3F9GA 1IOEA 1SGFG 2WZQA 1Y5UT 1O3EA 1S0QA 2LPRA 1SBWA 1W10U 2VB0A 4RN6A 2FTLE 1BHXB 2VWNA 4ZHAA 2A32A 1W0KD 2TIOA 1FMGA 2H6MA 3VXEH 4TSFD 1DWCH 1NRQH 1CGIE 1P11E 1EXFA 2D1JA 4BXWA 3A8CA 1SMFE 5AVDA 1NTPA 4B76A 2AGEX 2B5TB 2Z3CA 3QUMP 4FUFA 1KTTB 2R0KA 2OLGA 1JMOH 2CHAC 1P2IA 3WY8A 1UTNA 3A85A 3A88A 1O38A 3HKIB 3SUGA 4NIVA 1TLDA 3BN9A 1GJ9B 1EP6A 1ABIH 4Q7ZA 3MTYA 1C1PA 5C20A 1DSUA 1J14A 3SNAA 3PMJA 1O0DH 1LPZB 4GHQA 3GY6A 1O33A 1LHEH 1H8DH 4INHA 1FPCH 1LVOA 1TBRH 4FVDA 2PW8H 2FS8A 3SGBE 4Y7BA 2FYQA 2SGPE 4JCNA 4YTAA 3ZVEA 2F9PA 1C4V2 2IJD1 1ZTKA 1IQIA 1CHOG 3LH1A 3TLOA 5C67A 1Y3XA 2PWXA 2EI8A 1AKSA 3MU5A 1B5GH 1GVZA 1O31A 1QL7A 3KGPA 4DT7B 3RMOH 2FOHA 1BITA 1FI8A 1MMJN 2OBQA 5LPEA 1FY4A 4FU9A 1BRAA 1C5OH 1E34B 1LHDH 1YC0A 2ZF0H 3UUZA 3VXFH 5DKMA 3N7EA 3G01A 3D62A 3LGYA 3EA7A 1THRH 2OTVA 2HWLB 4AB9A 3KNXA 1GGDB 2Z9IA 4Z0KA 4D9RA 3PTBA 3Q77A 1ZGIA 1W8BH 2YMSB 5HM9A 3KYFA 1A0HB 1UK3A 1FUJA 2ZDKA 1BQYA 3ZZ7A 1C5SA 1OP0A 5DJ7A 2G4TA 1UVOA 2VGCC 3SGAE 2D2DA 3KQCA 2W6JD 1ELDE 1Z8GA 1UVSH 1TPSA 2FODA 1LMWB 2UUJB 4JYUH 2W7UA 1TQ7B 1C5RA 1ZR0A 2GKVE 4UE7H 1S85A 4YT6H 1N8OB 4XDEA 1MUEB 3HPTB 3SGQE 2VH0A 3TJNA 1RIWB 4JK5A 2BX4A 2ZHQH 1GPZA 3LT3A 1GVKB 4NWLA 1BB0B 4IMQA 1VCPA 3PMAB 3TK9A 3Q3YA 1GGDC 2KFWA 4FVBA 2BMGB 3T29A 1H9HE 1A46H 1DX5M 1ZGVA 2PHBA 3HGNA 4AORA 5DSFA 1OWJA 3SUFA 3OTJE 2BD5A 3GY3A 1EUFA 8KME2 1V2TT 2C4FH 1EATA 3DCLA 1JBUH 4GSOA 1TX8A 1SLUB 5E0GA 1AUJA 2ALVA 3KCGH 1ELVA 1C1VH 3E6PH 4X6OA 3K6YA 5DP3A 1N8OC 3PLKA 1QRZA 3PROA 5DP8A 1ZLRA 1CA0C 4KTUA 1RIWC 2A5IA 1C5TA 2VWLA 3LOXA 2SGAA 1P2QA 5A8XA 1C5WB 1QQ4A 1DICA 2WPJS 1AGJA 3EE0B 3MNCA 1FLEE 1SLVB 3SW2B 2ODYB 1AB9B 5FPYA 4K8BA 4I32A 1ZZZA 3ATLA 5E2OA 5C17A 1SGDE 1CGHA 3E1XB 4X6NA 3H09A 2I6QA 2J95A 2JETB 3FANA 1HAZB 1L1GA 2BVXH 1SGPE 2BB4A 3S7KB 1C5LH 1BBRE 1JIMA 4NIXA 2Z6BD 1GI0A 3A83A 1O2ZA 1EQ9A 4INLA 1D3DB 2WYGA 1UCYE 1O36A 5FPTA 1ELBA 1EPTC 5SGAE 3OFND 4BAKB 1GI9B 1BMNH 2WPDD 5TCCA 4WXIA 4Q80A 2V3MA 2BZAA 1DUAA 2VJ1A 6CHAC 1O2YA 5G4BA 3U1IB 1GBAA 1HV7A 2QXHA 3HATH 3ODFA 1BZXE 1SC8U 3TGJE 1AB9C 2XOKD 4FUJA 1MH0A 5JBAS 2Y82A 3NCLA 3ZZCA 4GLYA 1P03A 1K22H 1GDQA 4IN1A 1FAXA 3SU3A 2F9NA 1UK2A 4MNWA 1GJBB 3NXPA 2JETC 2ZDMA 1UTLM 3TJOA 1F5LA 1HFDA 3CNRA 1Z8JB 2ZP0H 4CH8B 2VH6A 3GCHB 2CXVA 3CS7A 3MNBA 4BOHA 1GMHF 4IBLH 8GCHF 2V7QD 3RM0H 2BOHB 4NFEA 4X2XA 1KXFA 3AASA 1UHBA 1MTSA 3SU5A 5LGOA 4Z6AH 5DG6A 1ETRH 1XM1A 1O3NA 1WQSA 1C1SA 1BJUA 2F3CE 1LPKB 3NWUA 1OWEA 3ENSB 1TOMH 1J8AA 5EJ1A 2IJOB 1GL1A 2G52A 3I77A 2FWWA 4A1TA 3MQKC 3N7DA 4B75A 2VWMA 3SV7A 3NZIA 1AN1E 2G55A 1SB1H 4CR5A 4K8YA 2R0LA 4AFZA 4K69A 2GZ7A 5EODA 2H2ZA 2STAE 1HYLA 3SYJA 2QV1A 1AO5A 1O2MA 1T8MA 6ESTA 1YWUA 3RXDA 1QRXA 1OXGA 1GG6B 3DSOA 4UONA 1O3FA 5EQRA 5EPNA 3T25A 2FOCA 4ISLA 1UO6A 4Y79A 2H9EH 1Y3WA 1ELFA 4K3JA 4SGBE 1C1TA 4AB8A 1C9PA 1GJ4H 2BD7A 2WV5A 3S9CA 3ZZDA 1ZHRA 1LKBA 3ODDA 1GCTB 2GJGA 1C1QA 3KEEA 5I25A 1OWKA 5DP6A 1A61H 2J9NA 1NZQH 5A0BA 1GHWH 2Q1JA 2QF0A 2KAIB 4RT1A 4FUBA 1SLWB 1F0TA 3MU8A 4YZUA 2CMYA 1YF4A 1NRRH 3DFLA 1ARBA 1GJDB 1GDUA 1OHHD 2Z9KA 3TK5A 2EC9H 1PQ8A 2XC0A 1GI6A 2A4RA 4D7FA 4DT4A 2WUBA 1T8LA 5DP5A 3RXOA 1GHVH 1HAVA 1E1QD 3FVFB 4K2YA 2A4OA 2ZU2A 5DGJA 4NA8A 2VIQA 2IPQX 4SGAE 2L6OA 4R0IA 4MNXA 5T3HA 3UR6A 1DFPA 2P94A 3GDUA 2J98B 3EQ0H 4X8VH 3K9XB 3E90B 3TNSA 3SO3A 2A5KA 1LQEA 5A2MH 1O5EH 4CH2B 3MNXA 1PPEE 3SNBA 2A2QH 1KXCA 4O9VA 5HMAA 3UQVA 1D4PB 3KN2A 1ZOMA 4WMFA 4DJZB 4OS7A 2GTBA 3ELAH 3TJVA 1GBDA 3SNDA 5EG4A 1CA8B 2G8TA 2KM0A 1MTNB 1FJSA 1GHAF 1MU8B 4M7GA 4TT3D 2VU8E 2KX4A 1O2TA 4TY6A 5CDFE 1BRBE 1AE8H 5TCAA 2ZFQH 5L2ZH 1NFUA 1F0UA 1C1OA 2R3UA 3KYGA 1L0ZA 1DY9A 1ORFA 1Y59T 1RJXB 3UAIC 1KSNA 1FXYA 2J4IA 4XBCA 1H8ED 1QJ6B 3H7TA 1T8OA 2DE9A 2UWOA 2J94A 3IG6B 4Y10E 1IQJA 1T4VH 1HB0B 2NWNA 1XUHA 3GYMA 4AGJA 5J4QA 2ANWA 1TIOA 2J34A 4B73A 7GCHF 3S9BA 1TMTH 2GMTC 4ABAA 3Q00A 2ILNA 3DUXH 1SGCA 1MTWA 2Z94A 1QJ1B 1H9IE 1E38B 2NU1E 2UWLA 4B2CA 2VBCA 1F92A 1ID5H 2BQ6B 1MTNC 1FPHH 3RU4E 2PTNA 1TGCA 3MNSA 1C2MA 3SV6A 1UVTH 5C0TA 1O2WA 3M37A 2IN2A 4ZHLU 3P70B 3SU2A 1W0ZU 3VB7A 4XBDA 1HAYB 3KQBA 1GI5A 3A7YA 3S7HB 2HNTC 4HGCA 1L1NA 4CRFA 1HAIH 1QB9A 2CJIA 2CK3D 4ZKRU 1N6XA 1VITF 1MAXA 1VCWA 4O3UA 1MBMA 5EGMA 2XXLA 1AWFH 1ESAA 4Z1MD 1CQQA 4FUEA 4WXVA 4X2WA 3QLPH 4I8GA 4JZFH 4LZ1H 2PR3A 3O8BA 4P02A 1DY8A 4K1EA 1ANBA 1P3EA 1GJ6A 1O2KA 1C5VA 4CRCA 1D9IA 3MWIU 3LGWA 1TA2A 4ACBA 1ZMNA 1VCQA 2WV4A 1QBOA 2NU2E 1A3EH 5C5NA 1EASA 1GJ8B 2RFKC 3PYHA 5EPYA 3U98H 4INKA 1GHAG 1OP8A 5C1UA 2XTTB 3A8AA 3LGIA 4XE4A 1C2KA 4NA9H 1AFQB 1WAYB 5T1VA 3DSPA 1TGSZ 3RXGA 5L30H 5C1YA 3SUDA 2Y7XA 3M36A 3LU9B 1BIOA 3E8LA 1ANCA 1O2RA 1W0YH 1YCPK 2XNDD 1SGNE 3ZZ5A 2B9LA 3LKWA 5EJZA 1GL0E 1O2IA 3QK1A 4AC9A 1HJ9A 2V3HH 1GJ7B 2KZ4A 3BTHE 2ZU1A 4VGCB 3O8CA 1QIXB 7GCHG 4BAHB 1TX7A 5C1XA 1P06A 1T4UH 5GPIB 4Q7XA 4MPUA 3RU4D 1IQHA 1QCPA 3SHCH 2Z9JA 1PYTC 3FP6E 3BV9B 1C1WH 3EAJA 1Z1JA 3MH6A 4A7IB 2FX6A 3MHWU 3MH4A 3SN8A 1AFQC 1HAPH 1Q3XA 4I8LA 2Y5HA 1CT2E 3MU1A 3CENA 3MOCA 1SPJA 7KMEH 1S83A 4OGXA 2BM2A 1Z8RA 3NUMA 4MPXA 2FESH 4MLFB 4CRGA 4F49A 1YBWA 2Y80A 1WTGH 5EJLA 3UR9A 1P2OA 1CBWB 4AOQA 2ZU5A 4MPWA 1E36B 1DT2A 4VGCC 1O2GH 3NKKA 3PLPA 4E7RG 4KTCA 1EZSC 2ZFRH 2ZQ1A 2VNTA 3TITA 1LCYA 2D26C 1K2I1 3ATWA 1O2OA 3GCTG 3ZVFA 1JIRA 3LONA 4CBNA 3RXAA 3U1JB 1GBLA 4MDSA 2A4QA 1IQFA 2XWAA 2ESTE 1Z7KA 2WPHS 1B0EA 1GBHA 2BY9X 1SHYA 2H5DA 4X2YA 1GBFA 2HVXA 1FX0B 1HXFH 4CRAA 5A0AE 8ESTE 1TALA 1SI5H 1O5GH 2A31A 4NA7A 1K1IA 1UW7A 3PM3A 4WWYA 5GXPA 1S6FA 5E0JA 1C2HA 1V2QT 3A87A 2LNCA 1CBWC 2J97A 5ESBA 4JZEH 3L3TA 3BTKE 1ELCA 1O3MA 2IOTA 4TYDA 4OS6A 1CHGA 1EOLA 3PWCA 3ZZ4A 1GI1A 1EFRD 3RXPA 1JOUB 2ZTZA 1Z8IB 2B8OH 2ZFSA 1AMHA 4WY3A 1ESBA 1O2UA 1FN8A 3SV2H 1YLCA 1ETSH 4IW4E 4BTIB 1A5GH 5I46H 1UVUH 2H9HA 2Y5FA 4RSPA 1KLJH 5GJ4B 4XSKU 2VGCB 5JPMH 3CP7A 1RS0A 4RT0A 1SGEE 1DUEA 2BD8A 4OS2A 2JH6D 1MBQA 4ZHMU 5FL7D 2WYJA 1GMCF 1K1NA 2Z9GA 3B8JA 3P8FA 4OS5A 1RGQA 4ZUHA 1O3LA 2F9BH 1PPHE 1BTYA 1DXPA 2FOMB 2UUYA 1ZHPA 2AIQA 2P59A 2OINA 5ABWA 2GCHG 3TH3H 4AX9H 3H5CB 3ZVGA 1TRYA 5PTPA 4ABFA 3OAAD 1VJ9U 1EAIA 3T27A 4ABDA 3ZIAD 2VIPA 3QX5H 4O3TA 1TFXA 3BG8A 2BDAA 3F2GA 3OEHD 1TOCB 1PPCE 1TGNA 1G2MA 1EB1H 4I8KA 2XCFA 4JMYA 2C8XB 1OKXA 1FY5A 1SVPA 2HLDD 1O2VA 5A8YA 2O8MA 1SSXA 1K1JA 1MKWK 1BCUH 1S82A 2GCTB 4P00A 4BANB 4AN7A 1V6DA 2GD4B 3OY6U 3BIVH 1NRSH 5L2YH 1O2HA 1BJVA 2JKHA 1SGFA 2JDID 1O3HA 1CA0B 2I6SA 1GBKA 3QN7A 1BMFD 4ISIH 4AFSA 1PYTD 2Y5GA 2FI5E 3UWIA 1AVGH 3FOAA 1BBRK 1W7XH 1HJAB 3SU6A 2SNVA 1MD7A 2BDYA 2WPMS 3UB0A 2JH5D 1UCYK 2B0FA 2ZGXH 3ATIA 1F0RA 2PKAB 3FAOA 4MVNA 4CRDA 4YT7H 3ATKA 5DP4A 2EA3A 3OX7U 4GVUA 8LPRA 3M5LA 3IWMA 2RA0A 2F43B 2OC8A 1E0FD 1RTFB 1V2MT 4H6TA 1LVMA 1ELGA 1FZZA 3ZZAA 3RXEA 1O2QA 4OS4A 4Y0YE 2GCTC 2ZTXA 3RXVA 1FY3A 5DK1A 2AGGX 2ZU3A 4X6PA 3M5NA 1SGIB 3RMMH 4B1TA 2KCYA 2QA9E 1PPFE 2PUXB 4JZDH 1ELEE 1GI2A 3BG4B 3W94A 1EPTB 1MD8A 2JH0D 2TGTA 3WWFA 4I7YH 2VIVA 4F55A 3SJ9A 1B7XB 3F3BA 1EZUC 1SOTA 1Y5BT 2PTCE 4LXBH 1XXFA 2FLRH 6GCHF 6CHAB 3WW7A 4ABEA 2TPIZ 3NRLA 3N7OA 3A86A 1HJAC 4MTBA 2SNWA 1QR3E 1OWIA 1TNLA 5BRRE 2VINA 3ZZ8A 1EB2A 1LKAA 2ZC9H 9LPRA 1AVXA 1NRNH 2CV3A 1NT1A 3E91A 3MI4A 4JYVH 1S6HA 1TX6A 1LHFH 1RFNA 1O3GA 4ABHA 4ISOA 2WPIS 1YGCH 1WOFA 2FOBA 3Q76A 1AWHB 5C94A 3P17H 4J2YB 1MABB 2GV6A 1EJAA 2FPZA 1FDPA 2BY7X 3BG4C 2W6ID 2EEKA 2JIZD 2XC4A 5T6GA 5EW1H 1Z6JH 3DD2H 3RC5A 1QNJA 3LC3A 3UOUA 2ZFTA 1UTKA 1QB6A 3OE7D 3F0PA 4JZ1A 1KY9A 1TRMA 2J38A 1E1RD 4NIYA 1O3KA 1V2UT 1V2PT 1BTZA 2GZ8A 3KL6A 4B6EA 1L2EA 1THPB 2PKAA 4J1YA 3RP2A 1BTHH 1V2WT 3RXKA 1NU9A 1DDJA 1P02A 2A7JA 2BVSH 3P95A 2YNAA 3L6PA 2QXJA 2ZPRA 3FFGA 4NCYA 3GY4A 2AMQA 1V2ST 3B9FH 1UVPA 5C0UA 3AW1A 3AAVA 1G2LA 3OYPA 2L74A 3BEFB 1VGCB 1GHXH 4UD9H 2A4GA 4LK4A 1ABJH 2ZDNA 1G37A 3AW0A 3TH4H 4AYYB 4D9QA 2XNIA 1YPKH 2BLVA 2UUKB 1BTXA 3A8DA 1EX3A 1HRTH 1NFXA 1ZTLA 4FUDA 2FOEA 1NO9H 1QA7A 2FIRH 2Y6TA 3ZV9A 2XYAA 2XCNA 1B0FA 3OEED 3ZVCA 1FIZA 4K5ZA 1TONA 1Z1IA 3U8TH 1H4WA 4KTSA 3MO6A 1C2EA 3RXJA 1UTJA 2FMJA 3MO3A 4Y6DA 5T6DA 1YPHC 4I31A 4O97A 4Y8YA 3ZYEA 2C3SA 1IHTH 4FETA 4FUHA 4BAQB 2ZDLA 5DO4H 1TYNA 3RXQA 2QC2A 2C93B 3QGNB 1G3EA 1IQGA 1FN6A 1HIAB 4XOJA 1W2KH 1JRSA 1AZ8A 5GDSH 2KR7A 2AERH 2W3KA 2J2UA 1MKXH 2OC7A 2VIWA 1HLTH 2BQWB 3GCOA 1VGCC 1AVWA 4KKDA 5JBBS 5FXLA 3PRBA 2BLQA 1KXEA 2R2WU 1H9LB 3UIRA 2H1UA 2PV9B 3Q3XA 2O8TA 1GBMA 2ZZUH 3MFJA 3FZZA 2J92A 5HIYA 1HAHH 1EAUA 1HCGA 4F48B 4H42U 1XKBC 1LHCH 3M3SA 4IGDA 3F9FA 5LPRA 4WF8A 4B71A 3VGCB 4Q7YA 2QCYA 3M7QA 5CMXH 4DVAU 1DSTA 3F1SB 3SZEA 1L1JA 2P93A 4X1RU 3KF2A 1V2KT 1TMBH 1ZJDA 4YOJA 1DM4B 2HOBA 2ZCHP 2M2AA 3HGPA 1TA6A 2FOAA 5HIZA 1DOJA 4XD7D 5CE1A 3TGIE 1LHGH 4ZH8A 1LVYA 3U8OH 4DIHH 4X8UH 5K7RA 1P05A 4R8TB 2QF4A 5F53A 3BIUH 2THFB 1WYKA 1DS2E 1L4DA 2AMPA 2AFQB 4WMDA 1H8HD 2ODPA 5AHGH 3F9HA 3M3VA 2ZEBA 1GMHG 1NS3A 2G00A 2ZO3H 8GCHG 2BX3A 2ZCLP 3MU4A 2H9TH 1VJAU 1XUKA 1KXDA 2ZQ2A 1CGJE 2STBE 3O8DA 2HALA 2KCPA 4AYVB 1WU1A 1Y5AT 4I8HA 1WCZA 2GMTB 3VGCC 3SI4H 1FONA 2FI4E 2G4UA 1P2KA 3EYDA 2FYRA 2P8OC 3PO1B 1ZPCA 2P3FH 4JZIA 1GBIA 1IQKA 3BTEE 1UMAH 3BTTE 4K1TA 4PROA 4DY7B 3UNSA 1O30A 5IDKA 1CT4E 2QY0B 3C1KA 1TGTA 1SR5C 2WUCA 3QTOH 3SU1A 4AZ2B 7LPRA 1YY3A 4CRBA 4Y8ZA 3GISB 3EA8A 4I86A 1XUJA 5BPEA 3QTVH 4F4OC 1GBEA 4D8NA 3PWBA 2W7SA 3BSQA 2ASUB 1GI3A 1O3DA 3GDSA 3FP7E 5A09A 4U32A 3WWBA 1C9TA 3BTWE 4A1VA 4AG2A 5ESTE 3UTUH 3S69A 1XX9A 3K6ZA 1BA8B 1GBJA 4HFPB 2GDDA 1SGRE 1ELAA 1S81A 2K0QA 5FBEA 3E16B 3PO1C 2KAIA 2Z9LA 4WVPE 5JB8S 1Y3VA 4BAMB 1Z6EA 3LGVA 2ZDVH 1O3OA 3UQOA 3KQEA 1ZMLA 3M3TA 4X6MA 4CREA 1C5YB 1D3PB 1HDTH 2V35A 3F2HA 4A6LA 1A5HA 5TJXA 3L33A 1N1LA 2TGPZ 1UK4A 4GHTA 4X1SU 1K1OA 1K1LA 4HI3A 5E8EH 2FS9A 1QTFA 4RI0A 1OS8A 2RA3A 3A81A 1M9UA 1NU7B 3ITIA 1PPBH 2RDEA 4Q4LA 3VPKA 2OD3B 1BHXF 2J98A 3V7TA 1LTOA 2Y81A 1GBCA 2ANYA 2PFEA 2M5TA 1K0HA 4ISNA 4NFFA 1VITH 4U2WA 1DE7H 1SQRA 4KELA 3RC4A 1ZPBA 4ABIA 1S6LA 2O8WA 3MO9A 3ZZBA 1TAWA 4BXSA 1E79D 2GZ9A 1O35A 5EQSA 1GCDA 3RXBA 2F9OA 2BLOA 1WSSH 2P95A 1XVMA 1HAOH 4E06H 1HAXB 1TBZH 3JZ2B 1AQ7A 1P8VC 3UNQA 2XRCA 1C2IA 1H1BA 1COWD 4TY7A 2OK5A 3SJIA 1QY6A 2SFAA 4ABBA 1P2NA 1EZQA 1GHZA 1O5FH 1A0JA 1O3AA 3BEUA 4ACAA 3S9AA 4HTCH 1D3TB 2F83A 4LOYH 2ZHWH 5EXLA 3NK8A 2PSYA 1XUGA 2B7DH 1IAUA 5FPSA 1YCPM 3LH3A 3UFAA 1GMDF 5HGGA 3AK5A 1MZAA 4ZMAH 4D7GA 3SJ8A 1UTOA 3BTME 4TWYA 1AHTH 1FY1A 4ZXXH 3R0FA 1ACBE 4ASHA 1EAXA 1DITH 2WV9A 1C5PA 4YO9A 4UFGH 1BRUP 2FM2A 4YLQH 1EJNA 4THNH 3RC6A 2QAAA 1XKAC 1BOQA 4YOGA 3K2UA 1NY22 2ZTYA 1LDTT 3A8BA 1F5KU 2WINI 4MNYA 1O3CA 4CHAB 1XVOA 1QBVH 2HNTE 2XBWA 1IQLA 3LIWA 1BBRH 1EKBB 3FN8A 4E7NA 1ANDA 1TNKA 1KMHB 1J9CH 3SV8A 1O2XA 1UCYH 3W1EA 1MZDA 1TWXB 1DVAH 1MQ5A 2A7CA 2KCOA 4BAOB 5EW2H 2AMDA 4ABGA 3P6ZB 3H7OA 2ZFPH 1NM6A 1SQAA 4NSVA 2VWOA 2OQUA 4IN2A 4U01A 1VITG 1KLIH 1U6QA 2ZGBH 3MH5A 1ZTJA 3RM2H 5GCHF 1NBMD 1AIXH 1C2DA 1C5UA 3KIDU 5KEDA 2F91A 2XBYA 4RKJB 3BTQE 1PJPA 1ZPZA 2RDLA 3SQEE 3KQDA 3SNEA 4JYTA 5C3NA 1TE0A 1O5DH 1QZ8A 4UFEH 2F9UA 1ZSKA 2FLBH 1A0LA 1W7GH 2Z7FE 4X8SH 1GJ5H 3TIUA 1MTUA 4CHAC 2G81E 3B23B 1C2LA 4A5TS 2OUAA 1CSOE 1CT0E 1P09A 4UFDH 1YKTA 1CE5A 3SU0A 3UWJH 1V2OT 5F6MA 1YPLH 4YM9A 3GICB 4OM9A 1DWEH 2OC0A 3MYWA 4ZXYH 1SKYE 1DLKB 2BDBA 3PV2A 3IITA 5FX5A 2FDAA 1NROH 1O3BA 3C27B 4Y76A 2GT8A 3VB6A 4OS1A 4CR9A 1G9IE 2CGAA 1W0JD 5FCKA 3TPIZ 1SFQB 2O9QA 1MCVA 1P04A 1QA0A 1WBGB 5F8XA 1WDIA 1GMDG 5EXMA 5LPFA 2FZZA 2ZGJA 5C2ZA 4FUCA 4NWKA 1UTQA 1P9SA 3OSYA 2OBOA 2A0QB 2O8LA 5F8ZA 3RXFA 2EI6A 2QGRA 3W95A 1BRCE 2YOLA 3P92A 5FAHA 1W14U 2DE8A 2AIPA 3T5FH 1L4ZA 2ZHEH 4NZQA 3KQ5A 1QQUA 4Y8XA 4FUIA 2EI7A 4Y0ZE 3PMHB 3T26A 1H8IH 2C90B 2ZIQH 2SGQE 1W11U 1K9OE 6LPRA 1TNJA 1XMNB 1C1UH 3F68H 4BTUB 4TWWA 3STJA 2BYAX 4YOIA 2ANKH 2UWPA 5JBTA 4RKOB 1V2NT 1S0RA 2VVCA 4IS5A 1C5QA 2FI3E 1TGBA 1ZMJA 1XXDA 1TBQH 1ARCA 1P3CA 4FUGA 4OGYA 1C2JA 1K1PA 2VVVA 2F9VA 1ZRKA 1DPOA 2ANMH 1C2FA 3D23A 3I78A 3D65E 2BTCE 3OTPA 5GCHG 1KXBA 1BDAA 1V2LT 2C8ZB 4B74A 3SUEA 4DG4A 1T7CA 2PKSB 1C5ZB 1G30B 4QT8C 3DFJA 4X8TH 3ZVBA 1RTLA 2A2XH 2AEIH 2AH4X 3RDZA 5F03A 2GX4A 2HGTH 3A7WA 3EGKH 4HZHA 3P8NA 1A3BH 3ZVAA 1X7AC 1LPGB 2QYIA 1CVWH 2PGBB 3RXIA 4X0WU 1C5XB 1TNHA 2AYWA 1D3QB 4FU7A 3A7TA 3SBKA 1TQ0B 5E0HA 4U30A 3SJOA 1P57B 1KTSB 2VVUA 1SHHB 1EJMA 3DHKH 3HK6B 4TPIZ 3UY9A 5B6OA 1MU6B 2A7HA 2D8WA 4GCHF 3EDXB 4UFFH 5FCRA 4Q2KA 1O2PA 5L6NH 1A1RA 1TPAE 4B2AA 3V3MA 1GI4A 2G5NA 5JYIA 2G5VA 5CHAB 2NU4E 1QL8A 2PKSC 1E37B 2GVFA 3K65B 1IQEA 1O2SA 1AI8H 2LELA 3VFEA 1OSSA 3ZZ3A 1V3XA 1BMLA 3KHVA 1FY8E 2HLCA 3PTNA 1EP5A 1PPZA 3A89A 3DA9B 3NPSA 1G3BA 4WMEA 3SQHE 4AFQA 1KDQB 2K1QA 1Y3UA 1DWDH 2SGEE 3VEQB 3UOPA 5J4SA 1NN6A 4Y11E 2W26A 1QL9A 1AUTC 3QO6A 1Z71A 2TGAA 1NFYA 1GMCG 2YMSC 1KLTA 3D49H 1OOKB 2GP9B 3TNTA 3A82A 3JZ1B 1GI8B
chains in the Genus database with same CATH topology
1C1RA 3AVZA 3PMBB 3TU7H 2CF8H 3SJKA 2BDCA 1BT7A 2BZ6H 1O34A 1T31A 1YPGH 5CHAC 4XBBA 4ZROA 4ZKNU 3LDXH 2A45B 3TH2H 2ZI2H 1UHBB 2OQ5A 1QBNA 3LGUA 4B2BA 4LZ4B 1CO7E 1TB6H 2QIQA 5FHTA 1HXEH 4NSYA 1Y8TA 1YPJH 1O5AB 4FU8A 2QXIA 2BXUH 5C5OA 2CF9H 4K1SA 2OP9A 1PPGE 4Y7AA 1K21H 3OU0A 3U9AH 3SORA 5A0CA 3GYLB 1SQOA 3SI3H 2ZHDA 2PSXA 2W3IA 2OC1A 3RUOA 1C4U2 4DGJA 1AZZA 2FX4A 4KGAA 1A4WH 2ZECA 2BDHA 2WPKS 3M61U 1P01A 2BVRH 1EAWA 3TVJB 5EU8A 4GCHG 2BDGA 5T6FA 4K60A 1W3CA 1NFWA 3F6UH 4DURA 2FP7B 1OYQA 1F2SE 1INCA 2GDEH 2Y7ZA 5JDUB 1K28D 2C8WB 1BTPA 1EOJA 4DCDA 1O2LA 2P3UB 2R9PA 1BUIA 5A8ZA 1KDQA 1XUIA 3BEIB 1O37A 1HBTH 1GHBF 2NU0E 3UPEA 1Q2WA 4X2VA 1GDNA 1PQAA 1EPTA 1DANH 1K1MA 1TABE 2XW9A 1SGQE 1OWDA 3RXUA 3URCA 5DP9A 3LGTA 5H4IB 1P0SH 1F0SA 1MTVA 3V12A 1Y3YA 5AF9H 2ODQA 3A84A 1LO6A 1FIWA 2P3TB 1OX1A 1GI7B 1D6WA 6GCHG 1LQDB 3A80A 1ZHMA 2NU3E 1DXWA 1PQ5A 2OCVB 1S84A 3AAUA 4NIWA 5AFZH 1TPPA 3LJJA 2PUQH 3RXLA 2ZGCA 5EOKA 1HAVB 3VB5A 3ZV8A 5HYOA 2BLWA 1VR1H 2HNTF 5FX6A 3STIA 1GBBA 3U69H 1WV7H 1IQMA 4IC6A 3MU0A 2BDIA 4X1NU 4ZAEA 1O2NA 3TK6A 2ZWLH 3F9EA 1NPMA 4A1XA 3BTFE 1V2RT 1KIGH 4NZLA 1O2JA 3O8RA 2BY5X 1C1MA 2TGDA 2ZA5A 1GWAA 1HGTH 4WJG2 2Z3EA 1SGTA 2FOGA 1TRNA 5F8TA 2SGFE 1SG8B 1A2CH 1YP9A 3GCHC 3U8RH 3QDZB 1YCPH 3BTGE 3PB1E 3URDA 2FOFA 2IPHA 4YESB 3M7TA 1MCTA 2P8OB 1QRWA 1WTHD 4AFUA 1AY6H 3ZZ6A 3RXMA 3PLBA 5IYTA 2BD2A 2ULLA 4I8JA 2RCEA 2ZU4A 4YLUA 1RRKA 1OPHB 4MQAA 2UUFB 4GAWA 1O3IA 1YPMH 1C4Y2 1GHBG 4MNVA 3RXHA 3UREA 1SFIA 1C2GA 1ZYOA 3RLYH 1JWTA 2ZKSA 2ZDAH 4D76A 1GHYH 1O5CB 2DUCA 1WQVH 1FAKH 1N6YA 1YPHE 2A1DB 1O32A 2AS9A 1P9UA 4NG9H 2BQ7B 1GG6C 4KP0A 3FZDA 4GPGA 1C1NA 2ZG0H 2P16A 1UJ1A 1P2JA 1IHSH 2BY8X 2Q6FA 3S0NA 1W12U 3ZYDA 1HIAA 3A7VA 1TNGA 3SZNA 2XBXA 4X1PU 1J15A 3E3TA 2G51A 4MG3A 2ZPQA 5ETXA 3RXTA 2H5CA 2ZHFH 4FXGH 1C5NH 3M5MA 3MH7A 2FO9A 1GCTC 3VB4A 1OWHA 4H4FA 1PQ7A 2BHGA 4UDWH 1A7SA 1QFKH 3RXCA 1KYNA 3GY7A 4CBOA 1YPEH 2ALPA 2BXTH 1OYTH 2PLXA 2V0BA 1HJ8A 2A5AA 3OY5U 3P8OA 1WUNH 4AG1A 1BTUA 2QF3A 4ZKSU 4WH8A 4UEHH 1SOZA 1QHRB 3GDVA 2HRVA 1LVBA 1BMMH 2ZFFH 1QURH 1QB1A 1GBTA 2BY6X 1C5MD 2V3OH 1GJCB 3M35A 1ETTH 1YM0A 1KXAA 3R3GB 5GWZA 2XBVA 1QGFA 5LH8A 4DIIH 1OP2A 1SL3A 1S5SA 1QJ7B 1E35B 1W13U 2WPLS 5GIBA 2ZCKP 1BTWA 2Q6DA 2CN0H 3T28A 2R2MB 1J17T 1GVLA 1F5RA 1P10A 1F7ZA 2BD4A 1P12E 3ESTA 3DT0H 4H6SB 3TGKE 1THSH 4TPYA 4X1QU 3RLWH 1NESE 3PV4A 3MMGA 1ZJKA 1NRPH 3GOVB 1T8NA 1O3PB 2W5EA 1IQNA 3BF6H 2GGVB 2XC5A 2QN5T 3QZQA 2ZPSA 1A5IA 1FNIA 1G3DA 3RXRA 1AU8A 2XWBI 1HUTH 3I29A 4XFQA 4JK6A 3LJOA 1CU1A 4IC5A 2AGIX 2PGQB 2YNBA 3CS0A 5HM2A 4ABJA 4DW2U 5AFYH 3UNRA 1RXPA 4IMZA 5K0HA 4O03A 1YLDA 3SOSA 2VIDA 2TRMA 3T2NA 5FBIA 3FP8E 3T62A 2O8UA 1ELTA 1HPGA 3HK3B 1MKXK 5JB9S 1RD3B 5HXFA 3QZRA 4DOQA 2BD9A 1J16A 1O3JA 1MQ6A 3GCTF 3LPRA 3QWCH 2HPPH 1ZSLA 4E05H 2GT7A 1EZXC 2GV7A 3A7ZA 1SLXB 3V13A 1FV9A 1VZQH 2Z3DA 2TBSA 3HKJB 1MKWH 3RU4T 4A92A 1XUFA 2BOKA 3BTDE 3LC5A 1O39A 1ZRBA 1FQ3A 1MAYA 3M5OA 4ISHH 1UTPA 3SU4A 2BD3A 2FEQH 1TNIA 5DP7A 1AFEH 2ZGHA 3ZVDA 2V6NA 4BTTB 2R3YA 5DPAA 1JRTA 1T32A 4AGKA 1TMUH 3SNCA 3SHAH 4ZKOU 2SGDE 5EQQA 1G32B 2ZNKH 3GY8A 1TPOA 5JBCS 4ESTE 9ESTA 4MPVA 2RG3A 1RTKA 3E0NB 3RMNH 1AE5A 1SQTA 2FTMA 1ESTA 3A7XA 1DWBH 3VB3A 4WH6A 2Q6GA 1YYY1 3QGJA 3SV9A 2QXGA 3GY5A 1GJAB 1CHOF 3M7UA 5EXNA 1ZSJA 1G36A 1D6RA 3P8GA 7ESTE 1JXPA 1HNEE 2VIOA 1V2VT 1PFXC 3RXSA 1BMAA 1UTMA 1DLEA 3TJUA 3EA9A 1AKSB 2CHAB 3Q3KA 1G3CA 2C8YB 3E0PB 1AD8H 4GUXA 5E2PA 1ANEA 4BNRA 1P2MA 2GCHF 1NC6A 2HPQH 1SGYE 3RMLH 3ZZ9A 2FXRA 4I33A 4NGAH 4Y71A 3GCNA 1HAGE 1O5BB 3V0XA 2OXSA 3ATMA 1V2JT 1Q31A 3GY2A 3F9GA 1IOEA 1SGFG 1Y5UT 1O3EA 1S0QA 2LPRA 1SBWA 1W10U 2VB0A 4RN6A 2FTLE 1BHXB 2VWNA 4ZHAA 2A32A 2TIOA 1FMGA 2H6MA 3VXEH 1DWCH 1NRQH 1CGIE 1P11E 1EXFA 2D1JA 4BXWA 3A8CA 1SMFE 5AVDA 1NTPA 4B76A 2AGEX 2B5TB 2Z3CA 3QUMP 4FUFA 1KTTB 2R0KA 2OLGA 1JMOH 2CHAC 1P2IA 3WY8A 1UTNA 3A85A 3A88A 1O38A 3HKIB 3SUGA 4NIVA 1TLDA 3BN9A 1GJ9B 1EP6A 1ABIH 4Q7ZA 3MTYA 1C1PA 5C20A 1DSUA 1J14A 3SNAA 3PMJA 1O0DH 1LPZB 4GHQA 3GY6A 1O33A 1LHEH 1H8DH 4INHA 1FPCH 1LVOA 1TBRH 4FVDA 2PW8H 2FS8A 3SGBE 4Y7BA 2FYQA 2SGPE 4JCNA 4YTAA 3ZVEA 2F9PA 1C4V2 1ZTKA 1IQIA 1CHOG 3LH1A 3TLOA 5C67A 1Y3XA 2PWXA 2EI8A 1AKSA 3MU5A 1B5GH 1GVZA 1O31A 1QL7A 3KGPA 4DT7B 3RMOH 2FOHA 1BITA 1FI8A 1MMJN 2OBQA 5LPEA 1FY4A 4FU9A 1BRAA 1C5OH 1E34B 1LHDH 1YC0A 2ZF0H 3UUZA 3VXFH 5DKMA 3G01A 3D62A 3LGYA 3EA7A 1THRH 2OTVA 2HWLB 4AB9A 3KNXA 1GGDB 2Z9IA 4Z0KA 4D9RA 3PTBA 3Q77A 1ZGIA 1W8BH 5HM9A 1A0HB 1UK3A 1FUJA 2ZDKA 1BQYA 3ZZ7A 1C5SA 1OP0A 5DJ7A 2G4TA 1UVOA 2VGCC 3SGAE 2D2DA 3KQCA 1ELDE 1Z8GA 1UVSH 1TPSA 2FODA 1LMWB 2UUJB 4JYUH 2W7UA 1TQ7B 1C5RA 1ZR0A 2GKVE 4UE7H 1S85A 4YT6H 1N8OB 4XDEA 1MUEB 3HPTB 3SGQE 2VH0A 3TJNA 1RIWB 4JK5A 2BX4A 2ZHQH 1GPZA 3LT3A 1GVKB 4NWLA 1BB0B 4IMQA 1VCPA 3PMAB 3TK9A 3Q3YA 1GGDC 4FVBA 2BMGB 3T29A 1H9HE 1A46H 1DX5M 1ZGVA 2PHBA 3HGNA 4AORA 1OWJA 3SUFA 3OTJE 2BD5A 3GY3A 1EUFA 8KME2 1V2TT 2C4FH 1EATA 1JBUH 4GSOA 1TX8A 1SLUB 5E0GA 1AUJA 2ALVA 3KCGH 1ELVA 1C1VH 3E6PH 4X6OA 3K6YA 5DP3A 1N8OC 3PLKA 1QRZA 3PROA 5DP8A 1ZLRA 1CA0C 4KTUA 1RIWC 2A5IA 1C5TA 2VWLA 3LOXA 2SGAA 1P2QA 5A8XA 1C5WB 1QQ4A 1DICA 2WPJS 1AGJA 3EE0B 3MNCA 1FLEE 1SLVB 3SW2B 2ODYB 1AB9B 5FPYA 4K8BA 4I32A 1ZZZA 3ATLA 5E2OA 1SGDE 1CGHA 3E1XB 4X6NA 2I6QA 2J95A 2JETB 3FANA 1HAZB 1L1GA 2BVXH 1SGPE 2BB4A 3S7KB 1C5LH 1BBRE 1JIMA 4NIXA 2Z6BD 1GI0A 3A83A 1O2ZA 1EQ9A 4INLA 1D3DB 2WYGA 1UCYE 1O36A 5FPTA 1ELBA 1EPTC 5SGAE 4BAKB 1GI9B 1BMNH 5TCCA 4WXIA 4Q80A 2BZAA 1DUAA 2VJ1A 6CHAC 1O2YA 5G4BA 3U1IB 1GBAA 1HV7A 2QXHA 3HATH 3ODFA 1BZXE 1SC8U 3TGJE 1AB9C 4FUJA 1MH0A 5JBAS 2Y82A 3NCLA 3ZZCA 4GLYA 1P03A 1K22H 1GDQA 4IN1A 1FAXA 3SU3A 2F9NA 1UK2A 4MNWA 1GJBB 3NXPA 2JETC 2ZDMA 1UTLM 3TJOA 1F5LA 1HFDA 4CH8B 1Z8JB 2ZP0H 2VH6A 3GCHB 2CXVA 3CS7A 3MNBA 4BOHA 1GMHF 4IBLH 8GCHF 3RM0H 2BOHB 4NFEA 4X2XA 1KXFA 3AASA 1UHBA 1MTSA 3SU5A 5LGOA 4Z6AH 5DG6A 1ETRH 1XM1A 1O3NA 1WQSA 1C1SA 1BJUA 2F3CE 1LPKB 3NWUA 1OWEA 3ENSB 1TOMH 1J8AA 2IJOB 1GL1A 2G52A 3I77A 2FWWA 4A1TA 4B75A 2VWMA 3SV7A 3NZIA 1AN1E 2G55A 1SB1H 4CR5A 4K8YA 2R0LA 4AFZA 4K69A 2GZ7A 5EODA 2H2ZA 2STAE 1HYLA 2QV1A 1AO5A 1O2MA 1T8MA 6ESTA 3RXDA 1QRXA 1OXGA 1GG6B 4UONA 1O3FA 5EQRA 5EPNA 3T25A 2FOCA 4ISLA 1UO6A 4Y79A 2H9EH 1Y3WA 1ELFA 4K3JA 4SGBE 1C1TA 4AB8A 1C9PA 1GJ4H 2BD7A 2WV5A 3S9CA 3ZZDA 1ZHRA 1LKBA 3ODDA 1GCTB 1C1QA 3KEEA 5I25A 1OWKA 5DP6A 1A61H 2J9NA 1NZQH 5A0BA 1GHWH 2Q1JA 2QF0A 2KAIB 4FUBA 1SLWB 1F0TA 3MU8A 4YZUA 2CMYA 1YF4A 1NRRH 3DFLA 1ARBA 1GJDB 1GDUA 2Z9KA 3TK5A 2EC9H 1PQ8A 2XC0A 1GI6A 2A4RA 4D7FA 2WUBA 1T8LA 5DP5A 3RXOA 1GHVH 1HAVA 3FVFB 4K2YA 2A4OA 2ZU2A 5DGJA 4NA8A 2VIQA 4SGAE 4R0IA 4MNXA 5T3HA 3UR6A 1DFPA 2P94A 3GDUA 3EQ0H 4X8VH 3K9XB 3E90B 3TNSA 3SO3A 2A5KA 1LQEA 5A2MH 1O5EH 4CH2B 3MNXA 1PPEE 3SNBA 2A2QH 1KXCA 4O9VA 5HMAA 3UQVA 1D4PB 3KN2A 1ZOMA 4WMFA 4DJZB 4OS7A 2GTBA 3ELAH 3TJVA 1GBDA 3SNDA 5EG4A 1CA8B 2G8TA 1MTNB 1FJSA 1GHAF 1MU8B 4M7GA 2VU8E 1O2TA 4TY6A 1BRBE 1AE8H 5TCAA 2ZFQH 5L2ZH 1NFUA 1F0UA 1C1OA 2R3UA 1L0ZA 1DY9A 1ORFA 1Y59T 1RJXB 1KSNA 1FXYA 2J4IA 4XBCA 1QJ6B 3H7TA 1T8OA 2DE9A 2UWOA 2J94A 3IG6B 4Y10E 1IQJA 1T4VH 1HB0B 2NWNA 1XUHA 3GYMA 4AGJA 5J4QA 2ANWA 1TIOA 2J34A 4B73A 7GCHF 3S9BA 1TMTH 2GMTC 4ABAA 3Q00A 2ILNA 3DUXH 1SGCA 1MTWA 2Z94A 1QJ1B 1H9IE 1E38B 2NU1E 2UWLA 4B2CA 1F92A 1ID5H 2BQ6B 1MTNC 1FPHH 3RU4E 2PTNA 1TGCA 3MNSA 1C2MA 3SV6A 1UVTH 1O2WA 3M37A 2IN2A 4ZHLU 3P70B 3SU2A 1W0ZU 3VB7A 4XBDA 1HAYB 3KQBA 1GI5A 3A7YA 3S7HB 2HNTC 4HGCA 1L1NA 4CRFA 1HAIH 1QB9A 2CJIA 4ZKRU 1N6XA 1VITF 1MAXA 1VCWA 4O3UA 1MBMA 5EGMA 2XXLA 1AWFH 1ESAA 1CQQA 4FUEA 4WXVA 4X2WA 3QLPH 4I8GA 4JZFH 4LZ1H 2PR3A 3O8BA 1DY8A 4K1EA 1ANBA 1P3EA 1GJ6A 1O2KA 1C5VA 4CRCA 1D9IA 3MWIU 3LGWA 1TA2A 1ZMNA 1VCQA 2WV4A 1QBOA 2NU2E 1A3EH 5C5NA 1EASA 1GJ8B 3PYHA 5EPYA 3U98H 4INKA 1GHAG 1OP8A 5C1UA 2XTTB 3A8AA 3LGIA 4XE4A 1C2KA 4NA9H 1AFQB 1WAYB 1TGSZ 3RXGA 5L30H 5C1YA 3SUDA 2Y7XA 3M36A