4MPWA

Human beta-tryptase co-crystal structure with [(1,1,3,3-tetramethyldisiloxane-1,3-diyl)di-1-benzofuran-3,5-diyl]bis({4-[3-(aminomethyl)phenyl]piperidin-1-yl}methanone)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
243
structure length
243
Chain Sequence
b'IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase alpha/beta-1
publication title Target-directed self-assembly of homodimeric drugs
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 243
sequence length 243
chains with identical sequence B
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mpwA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mpwA01
1BTXA 4I8KA 1EPTA 1BMAA 1YPHC 1O0DH 1BJUA 3V13A 2ZTYA 5JPMH 1PPBH 3SUDA 3RMLH 1VITG 2H5DA 1K1PA 4X6OA 1H9LB 3LGVA 3B8JA 3LJOA 1XUKA 1TWXB 3E90B 1C2JA 1V2LT 3SHAH 3FP8E 3SV9A 1RFNA 1ARCA 3ZVCA 1PPCE 1ESBA 1TIOA 3E0NB 2ZU5A 3UIRA 3GY3A 4OS6A 2VH0A 1GHBG 1W0YH 3A7YA 3M7TA 5A8XA 1BOQA 3F9FA 3SGBE 3S7HB 2QCYA 1TNLA 1TA2A 1AI8H 3F6UH 1C2MA 3RU4D 1S81A 1P2OA 1DWDH 3LGWA 3N7OA 2BY8X 1YPEH 4D9RA 1OWHA 2V35A 4X1NU 1GBLA 2QYIA 5EXLA 3BTME 3CENA 3AAUA 1QY6A 1UVSH 1EAXA 1JIMA 1TQ0B 3L3TA 4AGJA 3GDSA 3RXTA 3PV4A 1P12E 1C1UH 1O5BB 3FP6E 3W95A 5L2YH 1OX1A 4CR9A 4X6MA 2G52A 3MTYA 1CBWC 5EGMA 4XE4A 3SQHE 4D9QA 2ZHEH 1OOKB 4A1TA 1CGJE 4NWLA 7ESTE 2W26A 1VJAU 2BXUH 1OXGA 2Z9JA 1ZSJA 1LDTT 2P95A 4JZ1A 1WBGB 5DP9A 4CRGA 2NWNA 1P01A 4K2YA 1O5DH 3FFGA 3Q3YA 3RXGA 4E7NA 1MKXK 1UJ1A 2FESH 1O2GH 3T5FH 2FM2A 2BY7X 1V2WT 1D6RA 3PLKA 1FMGA 1GGDB 3B23B 3QZRA 4ASHA 2VU8E 3VB4A 2HPQH 3RDZA 3K65B 2FOAA 1FN8A 4I7YH 1C5QA 3D23A 3KQDA 3BEUA 3KQEA 3EDXB 1O2SA 2BX3A 1V2NT 4ZH8A 1RGQA 2BY9X 4UFFH 1QFKH 1EZQA 1V2VT 9LPRA 3HATH 1SHYA 2BDHA 3PROA 3RXIA 4BXSA 1D3TB 5HYOA 2Z9KA 2EC9H 2AIQA 4INKA 2RDLA 3QTVH 4YZUA 2STBE 4UFGH 1TPSA 2VIPA 3MMGA 4Y8YA 2BOHB 1G9IE 1PQAA 4HI3A 4Y10E 3MNXA 2Y81A 3L33A 3BV9B 1JBUH 1QJ1B 1W8BH 3RXSA 2BD9A 1LCYA 1MU6B 4MPUA 4ZUHA 4E7RG 2P93A 1TGCA 4DW2U 2ALPA 1ANCA 2OC1A 2VWMA 1RTLA 2GMTB 1BUIA 5EW1H 2F9PA 1FAXA 1C1PA 1AFEH 4DURA 1BRCE 2FOHA 3BTDE 1THSH 4R8TB 1DWBH 4Y7BA 5FPSA 4LOYH 5T6FA 1O5CB 1VITH 4X8TH 1DANH 1GBKA 1THPB 5GCHF 3RXVA 1SLWB 1EJMA 2XBVA 3S69A 3NXPA 2BQWB 1P9UA 4B2AA 2FZZA 4I8JA 2WYJA 3LGYA 4KP0A 1SVPA 1HPGA 3SNAA 4Y0YE 3MH6A 1W2KH 3O8DA 1FN6A 4RKOB 1BHXB 4ZKOU 3IG6B 2P8OB 4I8GA 4YT7H 1GI1A 3UOPA 1GG6B 1TE0A 1C2LA 1O3CA 1QBNA 5I25A 1ELTA 3SBKA 1SGCA 2BDIA 4YLUA 1HIAA 1AKSA 1EJNA 1OP8A 2CHAC 1TNHA 2FPZA 2DUCA 1B0FA 1VCPA 1BMMH 1HGTH 1M9UA 4I8HA 2ZPSA 4ABBA 1LHDH 3VXFH 3RXDA 1PJPA 2BD2A 4JZFH 1HAOH 3A8AA 1DUAA 1ZSKA 1EKBB 2Y7XA 1P3EA 1E34B 1HAVA 2ZFPH 5GXPA 1V2PT 5JBCS 1QRWA 1IQNA 4LXBH 1DE7H 1GMDF 2BDAA 1LVYA 2ZDNA 1C1VH 1ELBA 1NFWA 5DP5A 1O3PB 2Y80A 1C5YB 1IQFA 1ZTLA 4YOIA 1Y59T 3VXEH 2AGGX 2BXTH 4XOJA 4CRFA 1O2KA 4FVBA 4X8SH 3UWIA 5EXMA 1G32B 4UONA 1JOUB 1YP9A 4THNH 1E0FD 3SU5A 4F4OC 1GJCB 3QTOH 3ZZ4A 1GBDA 1P3CA 5C20A 5TCAA 2AEIH 1Z8RA 1QTFA 2PGBB 1FIZA 5LPRA 1ZPCA 4XBBA 1HAIH 3RC5A 1BCUH 3SU4A 4QT8C 2UUJB 2FIRH 1CBWB 2ZIQH 2ZO3H 3MHWU 5BPEA 1TBQH 3BEFB 5K0HA 2BZAA 1SGDE 1O2TA 4UFEH 1C2FA 3F9GA 3TJUA 1YM0A 1YPJH 3TJVA 4MPVA 2GX4A 2H9TH 5L30H 1NRSH 2ZU2A 3DUXH 1EJAA 1Y3YA 1EZUC 3WY8A 2BVSH 1SOTA 4NCYA 1ID5H 1P0SH 2J2UA 2ZU4A 5DGJA 2RCEA 3Q77A 1LKBA 1QB9A 4CRCA 2ASUB 1GI0A 2RA3A 1C5OH 1XUIA 4JK6A 3PWBA 3ZVGA 3P8OA 2C8ZB 3S9AA 1SMFE 2LPRA 1XUFA 1O30A 2WUCA 1H9HE 2BLOA 1NC6A 2FS8A 3D65E 2D8WA 2P3FH 4OS5A 1MTWA 3TK5A 1MUEB 4UFDH 2FX4A 3RXEA 3TIUA 1PPEE 5GJ4B 1U6QA 4CRBA 5L6NH 1O2RA 2FOEA 3E8LA 1ZTJA 4BAMB 2JH6D 4ZHLU 5DP4A 2B5TB 1AE5A 4U30A 2FTMA 2OP9A 1Y3UA 5A8YA 2FO9A 2W3KA 1SSXA 1MCVA 1UTKA 1GJAB 3TLOA 3AAVA 5L2ZH 1TPPA 4X2XA 3EYDA 1O2WA 4NIWA 1QHRB 6GCHF 2WUBA 1DITH 1GHVH 3ZVEA 4DOQA 2BQ7B 2PHBA 5DP8A 1JRTA 1F0RA 3JZ1B 1SHHB 1ZHRA 1SGFA 2A31A 5T6GA 1NY22 3A7TA 1G36A 3MO3A 1C1MA 1PYTD 3GCHC 4GAWA 1FJSA 4ABGA 1QJ6B 2ZGCA 3QN7A 1ZZZA 1GBIA 2R9PA 3UWJH 1BJVA 1XXFA 1TA6A 2FLRH 1DY9A 1KDQB 2AGIX 2D1JA 3FVFB 4IMZA 5GPIB 1AVGH 1EP5A 4MPXA 3MYWA 3BG8A 1TNGA 1A0HB 1L0ZA 2Y82A 2BD7A 1AWFH 2AMQA 1TBZH 2Y5HA 1LQEA 1XXDA 2HOBA 1O3AA 3CS0A 1EPTC 5FPTA 1TGSZ 1XVOA 3NZIA 1KIGH 1MU8B 2WV5A 4DY7B 4JCNA 2A4OA 1KY9A 2RG3A 3A7WA 5ETXA 1O3DA 2F9NA 3KL6A 3U8TH 1GJ8B 3QZQA 2ODQA 2P3UB 4X2WA 3BEIB 1ZJKA 1G30B 4Y0ZE 3SGAE 3CS7A 1OWKA 1G3EA 1O3LA 1RJXB 2TGDA 2XXLA 1C9PA 3F9EA 9ESTA 2ZDVH 1AMHA 4GCHF 2C8YB 4WMDA 1DXWA 5LH8A 4Q2KA 1V2UT 4AFZA 1TBRH 2CHAB 2ZFRH 1Z71A 1P2JA 2ZCKP 2KAIB 2ESTE 1MMJN 2O9QA 5DO4H 2F9OA 1WTGH 1HAHH 3ATLA 3K6ZA 1Q2WA 1LHFH 1WQSA 1A5HA 3SI3H 4B74A 3HK3B 3CP7A 2XBXA 3EQ0H 1D6WA 3I29A 2R2WU 1A2CH 2LNCA 1GI3A 1MZDA 1PPFE 2SNWA 1O3NA 5EPNA 1S6FA 1GCTC 1TABE 3NUMA 1MQ6A 5F8ZA 4XBDA 2HALA 2B8OH 1HDTH 2FI3E 2ZDLA 1JIRA 2IPHA 1GJ4H 1KLIH 7GCHF 1P2QA 3GDUA 3P8NA 5C1YA 1O36A 2FXRA 3S0NA 3NWUA 1MCTA 1TOMH 3SJKA 1GHYH 5J4SA 2Y5FA 1KXBA 2FYRA 3P8GA 1TONA 1DLEA 1YKTA 1NRPH 2GCHF 5FX6A 4ZKRU 3RXJA 2WPIS 4TYDA 1KXFA 2G55A 1UK3A 1XUJA 5C5NA 1IQGA 4KTSA 3TH4H 4HGCA 8ESTE 4IC6A 2XCFA 1TRNA 3ZVBA 5F8TA 2BD8A 1ACBE 1PFXC 1EXFA 1O5FH 1SQTA 5E2PA 2HNTF 1PQ8A 4NFEA 1DUEA 1T31A 3TPIZ 3UOUA 1H8DH 2ZQ2A 4A1XA 1K28D 1AB9C 3E1XB 3MU0A 2V3HH 4IGDA 2SNVA 3TGKE 5I46H 1P2NA 3SZNA 3P92A 3NK8A 1SGIB 3QUMP 1NROH 2ZFTA 1CQQA 2CGAA 2VWLA 4WY3A 2ZP0H 3LC3A 1GI5A 4FUJA 4X8VH 1ZRBA 4NG9H 3SNDA 4YOGA 2BHGA 1SGPE 1Z6EA 1GPZA 2BB4A 5DPAA 1T8MA 4I8LA 1J16A 1S0QA 3HKJB 5A8ZA 1SGEE 3KF2A 1ZPZA 1C5TA 3T62A 2Z9GA 5GCHG 4XFQA 3ESTA 2CF8H 5FHTA 1MAXA 4ZXYH 4TPIZ 2H5CA 1YCPH 1TMTH 2A0QB 2CV3A 4CHAB 4MNWA 1O3FA 1D3QB 3PWCA 1O2NA 3A83A 1Z8IB 2G5VA 1BIOA 1XKAC 2WPHS 3P17H 2H2ZA 3PB1E 3A86A 3LH3A 1IQLA 2H6MA 4M7GA 2BX4A 4Z6AH 3PYHA 1O2JA 4X1SU 5JB9S 1C4U2 1BRAA 2FTLE 2D2DA 1ANDA 1B0EA 2W3IA 3T28A 1A0JA 2PR3A 2FOBA 2AS9A 4KELA 3LGUA 2XC5A 1K9OE 1UMAH 2XNIA 4I32A 3MOCA 3ATWA 3D62A 3DD2H 1C1QA 1ZGVA 2GT7A 2G8TA 1BRBE 4FU8A 4ABAA 3D49H 4HTCH 2NU4E 2FOGA 1SGYE 5ABWA 1SPJA 3GY5A 4R0IA 3I78A 3KHVA 1UVUH 4BANB 4D76A 2HNTC 1K1JA 3ITIA 1K1LA 1AD8H 2W7UA 2F9BH 2OBQA 1TX7A 3IITA 1SB1H 3ZZAA 1VJ9U 3URCA 3RXFA 1GMCF 5JDUB 2UWPA 4IN2A 1ZHMA 4BOHA 1K1MA 4YO9A 4FUGA 2OXSA 4FUCA 3M7QA 1GCDA 2O8LA 1P06A 1HUTH 2B0FA 1YGCH 3PMBB 1GMHG 1J14A 4KTUA 3FAOA 1G2LA 4YT6H 3M5NA 5HXFA 3BF6H 1BQYA 2ULLA 1WTHD 2Y6TA 1OYTH 3GCTF 2C93B 4AG1A 1O2IA 2PKAA 1CT2E 4FUIA 3RXAA 1WSSH 4CBNA 2SFAA 1CA0B 2V3OH 4ZAEA 4JK5A 4SGAE 1GVKB 3ZV8A 4D7GA 2FWWA 2TGPZ 1GBAA 1ORFA 1LMWB 1V2KT 3M5LA 2PKAB 3MNSA 3U1JB 1O32A 1LQDB 4KTCA 1KLTA 1Z8GA 1HJ9A 1DWCH 4INHA 1F92A 5TJXA 3RXBA 2PKSC 2Q6FA 2WV4A 1ANBA 1DX5M 1NM6A 4J2YB 4ZROA 4ZHAA 4DG4A 2OQ5A 4F49A 4MNYA 3ENSB 2XWBI 1FPHH 1YLDA 2TIOA 2VVVA 3DFJA 4MNXA 4D8NA 1F0TA 1F2SE 2A45B 1OWDA 2GZ7A 3E6PH 2QGRA 3LPRA 3MO6A 1ELCA 2ZHWH 1O2XA 3GY7A 2FODA 1ELAA 1C5VA 4FU9A 2VJ1A 3PMAB 2J34A 4JZEH 4MTBA 1MTNB 1K22H 1KTTB 4OGYA 4AGKA 1F5RA 3RU4T 1DXPA 2HLCA 1QL7A 1A5GH 3UNSA 4O3UA 2A4GA 3G01A 2GKVE 1NFYA 2OUAA 1C2HA 2D26C 5FXLA 2GDEH 1DWEH 1UHBB 4X0WU 4O97A 2ZHDA 1C1TA 4RSPA 2A4RA 4JYUH 1ANEA 1O5GH 2CJIA 5DP3A 2G5NA 3SU6A 1V2QT 2J95A 1K21H 1O2QA 1CA8B 1INCA 4XBCA 1C4Y2 1GJBB 4FVDA 2ZDAH 3Q3KA 2Z3EA 2HWLB 2O8TA 2G51A 4NFFA 2ZDKA 3I77A 2QXHA 1C2EA 1HJAB 1OSSA 2WINI 4HFPB 3T26A 1TRMA 5F03A 4DJZB 1O3JA 3VB6A 3SV8A 1O37A 3SU1A 1NZQH 1DT2A 4B75A 6GCHG 1EB2A 1L1JA 1O5EH 3ZZDA 2VINA 4VGCB 5AHGH 1S85A 1ELDE 2BD3A 1GBCA 5PTPA 3MU8A 1NRQH 2AH4X 1FUJA 1P05A 2BOKA 5E0GA 5C1UA 1GL1A 4WXVA 1BBRH 1TPAE 2BDCA 1A3BH 1LTOA 1C5PA 2O8MA 2RA0A 4YLQH 5EQSA 2YNBA 5EXNA 4GLYA 2SGFE 1PPZA 1N8OB 3A88A 3SV6A 1EZSC 1GWAA 1O2YA 5E8EH 4ESTE 2GD4B 2ZEBA 3SJ8A 4AB9A 2ZU1A 4B73A 3ZZ5A 1HXEH 3RLWH 1J17T 3M3SA 3EE0B 4I33A 2AGEX 1ABIH 1PQ5A 3SN8A 4XSKU 3BTFE 3U98H 3BG4C 4IC5A 4TY7A 1NU9A 2OLGA 1C1RA 1IAUA 2FI4E 4SGBE 3A8DA 3VGCC 3TVJB 2QIQA 2A5KA 4BAQB 2VIVA 3SJOA 3A8BA 3NPSA 3SUGA 2QXGA 5FAHA 4ABIA 4CH2B 3FP7E 3E16B 3LJJA 1LPGB 3GOVB 4LK4A 1UTLM 4GCHG 3V3MA 2G81E 4X2YA 4B71A 2OQUA 1SQOA 2F9UA 3KCGH 2Z94A 2ANKH 2VGCC 3LT3A 3MNBA 2CMYA 1JMOH 2Z6BD 1O38A 3F9HA 4GSOA 4GUXA 1ZGIA 4IW4E 3RXKA 4B76A 1YCPK 4I31A 1DLKB 1IHTH 1W12U 4H4FA 2BLWA 4IN1A 1C1WH 4U01A 2FMJA 4K1SA 4O03A 2W7SA 6CHAC 1QURH 1XUHA 1GDNA 2AMPA 2VIQA 2Z9IA 5T6DA 2A5AA 4X6PA 2H9HA 2P16A 1LPZB 5DK1A 5ESTE 4WXIA 2PFEA 2ZA5A 1XM1A 2VVCA 1V3XA 1GVZA 5HM2A 2B7DH 4YM9A 1T4UH 2OC8A 1Z1IA 1F7ZA 1UTMA 4JYVH 1S6HA 3A7VA 3UPEA 3NCLA 1ZYOA 3QLPH 4KGAA 3O8RA 1C2KA 4WMEA 1P04A 3UFAA 1UVPA 7GCHG 1DOJA 1VGCC 1AZ8A 3UR9A 1BB0B 3PMHB 2HPPH 1OS8A 2FDAA 1Q3XA 3ZZBA 4NWKA 1AHTH 5CE1A 1E38B 1H1BA 1FAKH 4Y76A 2BD5A 1KXEA 1W11U 5DP7A 1W7XH 1AVXA 1BTZA 1SI5H 4Y6DA 4Q7ZA 1QNJA 1HLTH 1S84A 1BTPA 5HGGA 2A5IA 1H8IH 1UTQA 1WQVH 4K1TA 5E0HA 1AN1E 3GY6A 2OBOA 1YLCA 2W5EA 2ZQ1A 1AFQC 1ELVA 1ZR0A 1D3PB 1KSNA 1H9IE 1X7AC 2ZF0H 4A1VA 3C27B 1QQUA 4Q7YA 4AFUA 5FX5A 4OS1A 1HCGA 1GBTA 1O2UA 3TNSA 1YBWA 3MO9A 5A0CA 3BTHE 1TX6A 3AW1A 1WUNH 1O3HA 2BVXH 3ODDA 2QAAA 1RIWC 3PMJA 3TJOA 2NU2E 3EA7A 1MZAA 4K69A 1FQ3A 1BT7A 5CHAC 2PSXA 2A7CA 1FY1A 1O2LA 3Q00A 1KDQA 2GV7A 3T29A 1ZTKA 3PO1C 1VZQH 4K60A 4CRAA 5EU8A 2BLVA 4IBLH 1AE8H 2FX6A 2UUYA 5AF9H 2ZTZA 2B9LA 3QO6A 1T4VH 2QXJA 3QK1A 5EODA 2IJOB 3TITA 2JH5D 1CGHA 3PLPA 1W14U 2WYGA 1HNEE 4HZHA 3ZZ7A 2FOMB 1KXAA 4AB8A 1C5WB 1C1SA 3SJ9A 5E2OA 4NA7A 3A7ZA 2TGTA 1Z6JH 3STIA 2BQ6B 3URDA 3OY6U 2ZGJA 4OS7A 1D9IA 5AVDA 4YOJA 1BTUA 1WCZA 1XUGA 2GCTC 2XTTB 3RXOA 2CN0H 2ZU3A 1SFQB 2KAIA 2Z3CA 2AFQB 3HK6B 1BITA 3BIVH 1RXPA 1GI4A 3RU4E 1J9CH 1Z1JA 4BXWA 2VB0A 3E3TA 1G3BA 2I6QA 3BTKE 4ABHA 1BA8B 1W0ZU 1NN6A 1V2MT 3GY2A 5AFYH 1T8OA 3SHCH 1EX3A 1AU8A 1WYKA 1W3CA 1GHXH 1F5LA 2YOLA 1SR5C 3KN2A 2BD4A 1OP0A 1GL0E 3QX5H 4ISIH 1SL3A 1TX8A 4WVPE 5C3NA 1N1LA 1A46H 3HKIB 4GPGA 4GVUA 1HV7A 1RTKA 3MNCA 1GMCG 3VPKA 3SNBA 5DKMA 1HFDA 2UUFB 3UNRA 3TU7H 2QA9E 1ESAA 3UQOA 1NT1A 2GDDA 3ZVDA 1BBRK 5E0JA 1GJ7B 5GWZA 1SGNE 1RS0A 2JETC 3GCTG 1TFXA 1AZZA 3LGIA 5C2ZA 3E91A 1ABJH 3U8OH 2VGCB 3H5CB 4JZDH 1UVTH 3GDVA 1C2DA 1AQ7A 3A84A 2NU1E 2I6SA 4OGXA 4U32A 3L6PA 2AYWA 2OC0A 3VEQB 4ZMAH 1EQ9A 4DIIH 4K5ZA 1IQMA 1C5XB 1QR3E 1SGTA 3U9AH 1JWTA 1BHXF 4A5TS 5JBAS 2ZWLH 1AWHB 3MH5A 1C5NH 3HGPA 3LH1A 1CHOF 3TK9A 4B1TA 5HM9A 3NKKA 6CHAB 1CHGA 1OP2A 3DHKH 3P95A 2GT8A 3F1SB 2OINA 2GZ8A 2C8XB 3P6ZB 2ZNKH 1CT0E 3M35A 1PPHE 5F6MA 2F9VA 3T27A 4MPWA 2GVFA 1B5GH 2STAE 4MDSA 4K1EA 1O3BA 2IN2A 2ZECA 4UE7H 1KTSB 3A81A 1TRYA 2A7HA 3KQCA 1XVMA 1DY8A 3BTGE 2SGAA 1TB6H 3MFJA 1SGQE 2VIWA 1A3EH 4KKDA 1C5ZB 1ETTH 1T7CA 1LPKB 1TQ7B 2GP9B 3BN9A 4FUFA 4AOQA 4AYYB 1ZJDA 1TLDA 1ZPBA 4JYTA 1O3IA 2XBYA 4X8UH 1ZMNA 1L1GA 1A5IA 1BBRE 1QJ7B 2ZFSA 3LC5A 3OYPA 1ETSH 3BSQA 2EI6A 4Y7AA 1ETRH 1LHEH 3M36A 1EOJA 4BNRA 3TH3H 2PUQH 3A7XA 1GI9B 5EG4A 2UWOA 1AUJA 5FCRA 1UTOA 1C2IA 5FBEA 3KEEA 1L2EA 1YYY1 1SLUB 1V2TT 8KME2 4FUEA 5EW2H 1HXFH 3DT0H 3ELAH 1GI6A 3W94A 1YF4A 3E0PB 4ISOA 2C8WB 2ZDMA 3M3TA 2ZCHP 1P8VC 3HGNA 1YC0A 3SV7A 4JZIA 2ZTXA 3K6YA 3EAJA 5G4BA 3SI4H 2Z9LA 2PLXA 5FCKA 4Y8ZA 1HAGE 1O2ZA 3Q76A 1Y3VA 3VFEA 2JH0D 5LPEA 1EAWA 2ZHQH 3LGTA 1TGBA 1FXYA 4TWWA 1GJ5H 3A8CA 3LONA 2QV1A 2WPJS 2P8OC 3VB7A 1HBTH 1GG6C 1ZMLA 2XC0A 1EUFA 3JZ2B 1DPOA 2ZKSA 2ANMH 3T2NA 3BTQE 3LU9B 1O35A 1C5RA 3GCHB 4MQAA 5A2MH 3GISB 2OD3B 3DFLA 4AORA 1W7GH 2OCVB 2K1QA 3ZVAA 1T8NA 1CO7E 3MU4A 4FUHA 1AGJA 4ZXXH 4CR5A 3MU1A 4CREA 2XC4A 1BRUP 2PSYA 4PROA 2Y5GA 1FY3A 4ABJA 2EA3A 1O2OA 2O8UA 3ZV9A 1QBVH 2OC7A 4X1PU 1F5KU 2F3CE 3SU0A 1EPTB 4JMYA 1QA7A 2XW9A 2BTCE 3RXMA 4TY6A 3OU0A 3RM2H 1O3MA 5JBBS 1TGNA 2GCTB 1XKBC 1QB1A 1BMLA 2FI5E 3RXLA 4BTTB 1GMDG 5C1XA 3C1KA 3MI4A 3SUFA 1MBMA 1DDJA 1E36B 2EEKA 3P70B 1AUTC 2G4UA 1BZXE 1O2VA 3OTJE 1CSOE 1OKXA 4DIHH 1UCYH 1ZLRA 4ZHMU 2R3UA 1C1NA 1SQAA 1ZHPA 2ZG0H 1BDAA 5EOKA 1TNKA 1B7XB 4UD9H 1A0LA 3BTTE 1F0UA 1A7SA 1C5UA 1ZOMA 2ZZUH 2TGAA 3LOXA 1C4V2 1NPMA 1GDQA 2CF9H 2HGTH 1O2PA 2J9NA 5AFZH 1LVMA 4Q7XA 1PQ7A 1WAYB 1O2HA 1DVAH 3P8FA 2BLQA 3BTEE 3VB3A 2JETB 2M5TA 3PM3A 1FDPA 1BMNH 2ZGBH 1O2MA 1NU7B 1GHAF 4ISLA 1GBJA 2A7JA 4OS4A 1GCTB 2G00A 8GCHF 1T32A 2CXVA 4Z0KA 1GBBA 1UHBA 2BMGB 2Y7ZA 3SU3A 1DS2E 2Q6DA 1UTJA 2ZFFH 2WPMS 3M3VA 3UR6A 3MH7A 3RXPA 3S9BA 2GV6A 4D7FA 1Y5BT 1HAZB 1GI2A 4NZLA 2A4QA 2BDBA 4Y79A 3V0XA 1D4PB 1ZRKA 3AVZA 4MG3A 4X6NA 3RXQA 1CE5A 2BVRH 2P3TB 4E06H 1MD7A 2ALVA 3MU5A 3TH2H 3UQVA 1L4DA 3VB5A 4DGJA 1SFIA 4ZKNU 4DT7B 2XBWA 1UO6A 2ZC9H 1LHGH 1O3GA 1GVLA 4NIXA 5DP6A 5T3HA 4Y71A 4IS5A 1GI8B 1QRXA 5IYTA 1BTYA 4ABDA 1MH0A 4RN6A 1AB9B 2THFB 3M7UA 3LKWA 4Y8XA 1P2KA 1YPLH 2G4TA 4ABEA 4Y11E 3GCOA 4AFQA 1L4ZA 1NS3A 1YCPM 3M5MA 1SBWA 2BY6X 1EAUA 1P09A 1S5SA 2HRVA 4K3JA 1LKAA 1D3DB 3SQEE 4E05H 4NA9H 1DFPA 1Y3WA 1JXPA 1MTVA 4IMQA 5ESBA 3UUZA 2Q1JA 1YPGH 5DJ7A 2ANWA 3RMNH 1SLVB 3LIWA 1ELFA 1O34A 3RXCA 1E35B 1EOLA 1TALA 2BDGA 2QY0B 5C5OA 1RD3B 1IQHA 2XRCA 1MQ5A 2GGVB 4WF8A 1BTHH 2R0LA 2R3YA 1SG8B 2PGQB 3K2UA 1YPHE 3SO3A 1V2JT 4O3TA 2A2XH 1XX9A 1VITF 3H7TA 1YPKH 4GHTA 5DG6A 1S82A 1OWIA 4WH8A 2VIOA 1ELEE 3GYMA 5JBTA 2WPLS 3EA8A 2JKHA 1AO5A 1OWEA 1MD8A 2PW8H 1P9SA 5EQQA 3T25A 1HAPH 3U8RH 2FEQH 2Z7FE 3SNEA 2PUXB 1GHBF 2VIDA 5LPFA 1BTWA 3ZZ8A 2FOCA 1V2ST 1P10A 1Z7KA 4XDEA 1FNIA 1TAWA 1DICA 1KYNA 3ZZ6A 2Z3DA 1KXCA 1HIAB 3KQBA 4UEHH 1AKSB 2HNTE 3AASA 4DCDA 2QC2A 3SGQE 2C90B 1LVBA 1YPMH 1GBEA 1O3OA 1HB0B 1NRNH 3MWIU 3TJNA 4ISNA 1V6DA 1N6XA 3A89A 6ESTA 2ZFQH 2R2MB 2BYAX 2QF0A 3RC6A 1GMHF 1O39A 1O33A 1HAVB 1WU1A 2NU3E 4UDWH 5GDSH 4LZ1H 2J92A 5FPYA 2BM2A 4ABFA 4K8YA 1ARBA 1L1NA 3PLBA 1P57B 4WJG2 2O8WA 2C4FH 2TRMA 1FONA 4AZ2B 4FUDA 1A1RA 3A80A 1AIXH 4TPYA 4TWYA 4B2CA 4H42U 1P03A 2PV9B 4MNVA 3A87A 2PTCE 4BAKB 1CHOG 1MKWH 1XMNB 4AX9H 2SGPE 8LPRA 3A82A 2NU0E 3V7TA 1GDUA 4NZQA 1PPGE 1P2MA 3QDZB 1HYLA 2A2QH 2UWLA 5EPYA 5A0AE 1J8AA 1ZMJA 1GJ9B 2GCHG 1C2GA 2FYQA 3SU2A 3SNCA 1G3DA 4J1YA 1TMBH 2PKSB 2ODYB 1C9TA 1MTSA 3RXUA 4YESB 1FPCH 3QWCH 4OS2A 4AG2A 2ODPA 4WWYA 1CGIE 1UCYK 2VVUA 1GBMA 2J38A 5GIBA 4AFSA 3M5OA 2F83A 1NFXA 2V6NA 1SGRE 4ZKSU 2HVXA 3RC4A 4MVNA 4BTUB 1FI8A 3RP2A 4B2BA 1MBQA 2V0BA 3GY8A 3ZYDA 2DE8A 1EASA 1O3KA 1C5SA 3O8CA 3PTNA 3Q3XA 1TGTA 3H7OA 3RM0H 3F68H 3OX7U 3R0FA 1S83A 3BTWE 4GHQA 1NRRH 3MH4A 2BDYA 2FLBH 3PTBA 2J4IA 1HJ8A 1HAYB 4CRDA 3FZZA 5A09A 1K2I1 1O31A 3UNQA 4BAOB 1QIXB 1P11E 3ZZCA 4FXGH 1IQEA 2QN5T 1NESE 3GCNA 4RKJB 1OYQA 1DSUA 1C5LH 1VCQA 1ELGA 1EATA 4CHAC 4LZ4B 3FANA 2DE9A 1QA0A 2UUKB 1TOCB 4CBOA 1C5MD 1QGFA 4H6TA 1IQIA 3IWMA 5JYIA 1OWJA 1W13U 1FY5A 4CH8B 4H6SB 2VWNA 2ZCLP 1F0SA 2ZGHA 1GI7B 1VCWA 4Q80A 4A7IB 1UCYE 2A32A 1K1OA 4FU7A 1ESTA 1SLXB 2ZPQA 1SOZA 5JB8S 1UVOA 3RUOA 5C67A 3S7KB 1N6YA 5J4QA 1FY4A 2XWAA 3GICB 4DVAU 1TPOA 2OTVA 2P94A 2J94A 3HPTB 1MKXH 2AIPA 3K9XB 4ISHH 4X1QU 4BAHB 3BIUH 2PWXA 1MAYA 1K1IA 3KIDU 1Z8JB 1GHZA 3LDXH 4X1RU 1OPHB 2EI7A 4X2VA 1V2RT 3QGJA 2ANYA 3SORA 1EZXC 2IOTA 7KMEH 1C1OA 2ZI2H 3OY5U 5FBIA 3TGIE 1UTNA 3BG4B 2VWOA 3ATMA 2TBSA 2EI8A 1CU1A 2SGQE 3VGCB 1G37A 1LVOA 2GTBA 2YNAA 3EGKH 1K1NA 3STJA 3GY4A 2GZ9A 1CVWH 3UTUH 3S9CA 2H9EH 4A92A 1LO6A 1QCPA 1CA0C 2F91A 1HRTH 3RXHA 5LGOA 3ZVFA 3ZZ9A 1NTPA 5H4IB 1KLJH 2XYAA 4K8BA 5CMXH 4NSVA 5EQRA 1TNJA 3U69H 1FLEE 1NO9H 1NFUA 1IQJA 1TMUH 2P59A 1IOEA 1E37B 3TGJE 4BTIB 6LPRA 1O5AB 3EA9A 2AMDA 1AVWA 1P2IA 3M61U 1G3CA 1QL9A 1SGFG 1GGDC 1UK2A 1J15A 2A1DB 2QF3A 2ILNA 1IHSH 1WOFA 3RXRA 4NA8A 3SJIA 4NSYA 2H1UA 5IDKA 1DSTA 3SW2B 3U1IB 1S0RA 2SGEE 1TYNA 1GJ6A 1FZZA 3UREA 1Y5UT 1TNIA 4MLFB 1GHAG 1V2OT 2TPIZ 5F8XA 5SGAE 2Q6GA 8GCHG 1Y8TA 2C3SA 1KXDA 1QRZA 1MTNC 3QGNB 1SC8U 3RMOH 1LHCH 1RTFB 2BY5X 3ATIA 3ATKA 1QB6A 3TNTA 2QXIA 4NGAH 1T8LA 4O9VA 2FP7B 3ODFA 2R0KA 1VGCB 2WPKS 1GHWH 1EAIA 1MTUA 1Y3XA 1QQ4A 1FY8E 3ZYEA 1O3EA 4INLA 1IQKA 5HMAA 7LPRA 3R3GB 5K7RA 1GBHA 4WH6A 3TK6A 1RRKA 1VR1H 4FUBA 1Y5AT 4NIYA 3AW0A 2XCNA 1Q31A 1FV9A 5BRRE 2GMTC 5A0BA 1HAXB 5B6OA 2FOFA 1HJAC 3GYLB 1A61H 4YTAA 3UY9A 1A4WH 4A6LA 1AFQB 3KGPA 3V12A 3FZDA 3DA9B 4AYVB 1FIWA 1P02A 1QL8A 4U2WA 1CT4E 1JRSA 3O8BA 1G2MA 3ZZ3A 3B9FH 3SUEA 3A85A 2PTNA 1MKWK 4VGCC 1GJDB 1WV7H 3KNXA 2VH6A 2VNTA 1QBOA 1W10U 1RIWB 1GBFA 2ZGXH 1PYTC 4AN7A 2ZPRA 2FS9A 5CHAB 1DM4B 1ZSLA 1EP6A 3SV2H 2SGDE 1UTPA 1UK4A 3M37A 1H4WA 3RLYH 3OSYA 1N8OC 3PO1B 1EB1H 1AY6H 4WMFA 2AERH 1THRH 2BZ6H 4NIVA 5TCCA 3RMMH 2ZHFH 3SOSA
chains in the Genus database with same CATH superfamily
1BTXA 4I8KA 1EPTA 1BMAA 1YPHC 1O0DH 1BJUA 3V13A 2ZTYA 5JPMH 3KQ5A 1PPBH 3SUDA 1SKYE 4XRNA 3RMLH 1VITG 2H5DA 1K1PA 4X6OA 1H9LB 3LGVA 3B8JA 3DSGA 3LJOA 1XUKA 1TWXB 3E90B 1C2JA 1V2LT 3SHAH 3FP8E 3SV9A 1RFNA 1ARCA 1H8HD 3ZVCA 1PPCE 1ESBA 1TIOA 2JJ2D 2V3MA 2ZU5A 3E0NB 3PRBA 3UIRA 3GY3A 4OS6A 2VH0A 3KYFA 1GHBG 1W0YH 3A7YA 3M7TA 2IPQX 5A8XA 1BOQA 3F9FA 3SGBE 3S7HB 2QCYA 1TNLA 1TA2A 1AI8H 3F6UH 1C2MA 3RU4D 1S81A 1P2OA 1DWDH 3LGWA 3N7OA 2BY8X 1YPEH 4D9RA 1OWHA 2V35A 3F2GA 4X1NU 1GBLA 2QYIA 5EXLA 3BTME 3CENA 3AAUA 1QY6A 1UVSH 2KM0A 1EAXA 1K0HA 1JIMA 1TQ0B 3L3TA 4AGJA 3GDSA 3RXTA 3PV4A 1P12E 4RI0A 1C1UH 1O5BB 3FP6E 3W95A 5L2YH 1OX1A 4CR9A 4X6MA 2G52A 3MTYA 5DN6D 1CBWC 5EGMA 4XE4A 3SQHE 4D9QA 2ZHEH 1OOKB 4A1TA 1CGJE 3UAIC 4NWLA 7ESTE 2W26A 1VJAU 4Q63A 2BXUH 1OXGA 2Z9JA 1ZSJA 1LDTT 2P95A 4JZ1A 1WBGB 5DP9A 4CRGA 2NWNA 2JIZD 1P01A 4K2YA 1O5DH 3FFGA 3Q3YA 3RXGA 4E7NA 1MKXK 1UJ1A 2FESH 4F55A 1O2GH 3T5FH 2KZ4A 2FM2A 2BY7X 1V2WT 1D6RA 1NBMD 3PLKA 1FMGA 1GGDB 3B23B 3N99A 3QZRA 4ASHA 2VU8E 4I86A 3VB4A 2HPQH 3RDZA 3K65B 2FOAA 1FN8A 4I7YH 1C5QA 3D23A 3KQDA 3BEUA 3KQEA 3EDXB 1O2SA 2BX3A 1V2NT 4ZH8A 1RGQA 2BY9X 4UFFH 3DCLA 1BMFD 1QFKH 1EZQA 1SQRA 1V2VT 9LPRA 3HATH 1SHYA 2BDHA 3PROA 3RXIA 4BXSA 1D3TB 5HYOA 2Z9KA 2EC9H 2AIQA 4INKA 2RDLA 3QTVH 4YZUA 2STBE 4UFGH 1TPSA 2VIPA 3MMGA 4Y8YA 2BOHB 1G9IE 1PQAA 2W6JD 4HI3A 4Y10E 3MNXA 2Y81A 3L33A 3BV9B 1JBUH 1QJ1B 1W8BH 3RXSA 2BD9A 1LCYA 1MU6B 4MPUA 4ZUHA 4E7RG 2P93A 1TGCA 4DW2U 2ALPA 1ANCA 2OC1A 2VWMA 5IK2D 1RTLA 2GMTB 1BUIA 5EW1H 2F9PA 1FAXA 1C1PA 1AFEH 4DURA 1BRCE 2WHXA 2FOHA 3BTDE 1THSH 4R8TB 1DWBH 4Y7BA 5FPSA 4LOYH 5T6FA 1O5CB 1VITH 4X8TH 1DANH 1GBKA 1THPB 5GCHF 3RXVA 1SLWB 4B6EA 1EJMA 2XBVA 3S69A 3NXPA 2VBCA 2BQWB 1P9UA 3AK5A 4B2AA 2FZZA 4I8JA 2WYJA 3LGYA 4KP0A 1SVPA 1HPGA 3SNAA 4Y0YE 3MH6A 1W2KH 3O8DA 1FN6A 4RKOB 1BHXB 4ZKOU 3IG6B 2P8OB 4I8GA 4YT7H 1GI1A 3UOPA 1GG6B 1TE0A 1C2LA 1O3CA 1QBNA 5I25A 2K8IA 1ELTA 3SBKA 1SGCA 2BDIA 4YLUA 1HIAA 1AKSA 1EJNA 1OP8A 2CHAC 1TNHA 2FPZA 2DUCA 1B0FA 1VCPA 2AHME 1BMMH 1HGTH 1M9UA 4I8HA 2ZPSA 4ABBA 1LHDH 3VXFH 3RXDA 1PJPA 2BD2A 3SZEA 4JZFH 5EIYA 1HAOH 3A8AA 1DUAA 1ZSKA 1EKBB 2Y7XA 1P3EA 1E34B 1HAVA 2ZFPH 5GXPA 1V2PT 5JBCS 1QRWA 2WPDD 1IQNA 4LXBH 1DE7H 1GMDF 2BDAA 1LVYA 2ZDNA 1C1VH 1ELBA 1NFWA 5DP5A 1O3PB 2Y80A 1C5YB 1IQFA 1ZTLA 4YOIA 1Y59T 3VXEH 2AGGX 2BXTH 4XOJA 4CRFA 1O2KA 4FVBA 4X8SH 3UWIA 5EXMA 1G32B 4UONA 1JOUB 1YP9A 4THNH 1E0FD 3SU5A 4F4OC 1GJCB 3NRLA 3QTOH 3ZZ4A 1GBDA 1P3CA 4ASUD 5C20A 5TCAA 2AEIH 1Z8RA 1E79D 1QTFA 2PGBB 1FIZA 5LPRA 1ZPCA 4XBBA 1HAIH 3RC5A 1BCUH 3SU4A 4QT8C 2UUJB 2FIRH 1CBWB 2ZIQH 2ZO3H 3MHWU 5BPEA 1TBQH 3BEFB 5K0HA 2BZAA 1SGDE 1O2TA 4UFEH 1C2FA 3F9GA 3TJUA 1YM0A 1YPJH 3TJVA 4MPVA 2GX4A 2H9TH 5L30H 1NRSH 2ZU2A 3DUXH 2F4LA 1EJAA 1Y3YA 1EZUC 3PRDA 3WY8A 2BVSH 1SOTA 4NCYA 1ID5H 1P0SH 2J2UA 2ZU4A 5DGJA 5CDFE 3FN8A 2RCEA 3Q77A 1LKBA 1QB9A 4CRCA 2ASUB 1GI0A 2RA3A 1C5OH 1XUIA 4JK6A 3PWBA 3ZVGA 3P8OA 2C8ZB 4FETA 3S9AA 1SMFE 2LPRA 1XUFA 1O30A 2WUCA 1H9HE 2BLOA 1NC6A 2FS8A 2JDID 3D65E 2D8WA 2P3FH 4OS5A 1MTWA 3TK5A 1MUEB 4UFDH 2FX4A 3RXEA 2RDEA 3TIUA 1PPEE 5GJ4B 1U6QA 4CRBA 5L6NH 1O2RA 2FOEA 3E8LA 1ZTJA 4BAMB 2JH6D 4ZHLU 5DP4A 2B5TB 1AE5A 4U30A 2FTMA 2OP9A 1Y3UA 5A8YA 2FO9A 2W3KA 1SSXA 1MCVA 1UTKA 1GJAB 3TLOA 3AAVA 5L2ZH 1TPPA 5T1VA 4X2XA 3EYDA 1O2WA 4NIWA 1QHRB 6GCHF 2HLDD 2WUBA 1DITH 1GHVH 3ZVEA 4DOQA 2BQ7B 2PHBA 5DP8A 1JRTA 1F0RA 3JZ1B 1SHHB 1ZHRA 1SGFA 2A31A 5T6GA 1NY22 3A7TA 1G36A 3MO3A 1C1MA 1PYTD 3GCHC 4GAWA 1FJSA 4ABGA 1QJ6B 4ZCNA 2ZGCA 3QN7A 1ZZZA 1GBIA 2R9PA 3UWJH 1BJVA 1XXFA 1TA6A 2FLRH 1DY9A 1KDQB 2AGIX 2D1JA 3FVFB 4IMZA 5GPIB 1AVGH 1EP5A 4MPXA 3MYWA 3BG8A 3F2HA 1TNGA 1A0HB 1L0ZA 2Y82A 2BD7A 1AWFH 2AMQA 1TBZH 2Y5HA 1LQEA 1XXDA 2HOBA 1O3AA 3CS0A 1EPTC 5FPTA 1TGSZ 1XVOA 3NZIA 1KIGH 1MU8B 2WV5A 4Q4LA 5GNDA 4DY7B 4JCNA 2A4OA 1KY9A 2RG3A 3A7WA 5ETXA 1O3DA 2F9NA 3KL6A 3U8TH 1GJ8B 3QZQA 2ODQA 2P3UB 4X2WA 3BEIB 3OE7D 1ZJKA 4M9FA 1G30B 4Y0ZE 3SGAE 3CS7A 1OWKA 1G3EA 1O3LA 1RJXB 2TGDA 2XXLA 3CNRA 1C9PA 3F9EA 9ESTA 2ZDVH 1AMHA 4GCHF 2KCYA 2C8YB 4WMDA 5KEDA 5LH8A 1DXWA 4Q2KA 1V2UT 3OTPA 1TBRH 2CHAB 2ZFRH 4AFZA 3H09A 4TSFD 1Z71A 1P2JA 2ZCKP 2KAIB 2ESTE 1MMJN 2O9QA 5DO4H 2F9OA 1WTGH 1HAHH 3ATLA 3K6ZA 1Q2WA 1LHFH 1WQSA 1A5HA 3SI3H 4B74A 2LELA 3HK3B 3CP7A 2XBXA 3EQ0H 1D6WA 3I29A 1EFRD 2R2WU 1A2CH 2LNCA 1GI3A 1MZDA 1PPFE 2SNWA 1O3NA 5EPNA 1S6FA 1GCTC 1TABE 3NUMA 1MQ6A 5F8ZA 1S6LA 4XBDA 2HALA 2L74A 2B8OH 1HDTH 2FI3E 2ZDLA 1JIRA 2IPHA 1GJ4H 1KLIH 7GCHF 1P2QA 3GDUA 3P8NA 5C1YA 1NBME 1O36A 2FXRA 3S0NA 3NWUA 1MCTA 1TOMH 3SJKA 1GHYH 4TT3D 5J4SA 2Y5FA 1KXBA 2FYRA 3P8GA 1TONA 1DLEA 1YKTA 1NRPH 2GCHF 5FX6A 4ZKRU 3RXJA 2WPIS 4TYDA 1KXFA 2G55A 1UK3A 1XUJA 5C5NA 1IQGA 4KTSA 3TH4H 4HGCA 8ESTE 4IC6A 2XCFA 1TRNA 3ZVBA 5F8TA 2YMSC 2BD8A 1ACBE 1PFXC 1UW7A 1EXFA 1O5FH 1SQTA 5E2PA 2HNTF 1PQ8A 4NFEA 1DUEA 1T31A 3TPIZ 3UOUA 1H8DH 2ZQ2A 4A1XA 1K28D 1AB9C 3E1XB 3MU0A 2V3HH 4IGDA 2SNVA 3TGKE 5I46H 1P2NA 3SZNA 3P92A 3NK8A 1SGIB 3QUMP 1NROH 2ZFTA 1CQQA 2CGAA 2VWLA 4WY3A 2ZP0H 3LC3A 1GI5A 4FUJA 4X8VH 1ZRBA 4NG9H 3SNDA 4YOGA 2BHGA 1SGPE 1Z6EA 1GPZA 2BB4A 5DPAA 1T8MA 4I8LA 1J16A 1S0QA 3HKJB 5A8ZA 1SGEE 3KF2A 1ZPZA 1C5TA 3T62A 2Z9GA 5GCHG 4XFQA 3ESTA 2CF8H 5FHTA 1MAXA 4ZXYH 4TPIZ 2H5CA 4HG6A 1YCPH 1KMHB 1TMTH 2A0QB 2CV3A 4CHAB 4MNWA 1O3FA 1D3QB 3PWCA 2XNDD 4OM9A 1O2NA 3A83A 1Z8IB 2G5VA 1BIOA 1XKAC 2WPHS 3P17H 2H2ZA 3PB1E 3A86A 3LH3A 1IQLA 2H6MA 4M7GA 2BX4A 4Z6AH 3PYHA 1O2JA 4X1SU 5JB9S 1C4U2 1BRAA 2FTLE 2D2DA 1ANDA 1B0EA 2W3IA 3T28A 2KFWA 1A0JA 2PR3A 2FOBA 2AS9A 4KELA 3LGUA 2XC5A 1K9OE 1UMAH 2XNIA 4I32A 3MOCA 3ATWA 3D62A 3DD2H 1C1QA 1ZGVA 2GT7A 2G8TA 1BRBE 4FU8A 4ABAA 3D49H 4HTCH 2NU4E 2FOGA 1SGYE 5ABWA 1SPJA 3GY5A 4R0IA 3I78A 3KHVA 1UVUH 4BANB 4D76A 2HNTC 1K1JA 3ITIA 1K1LA 1AD8H 2W7UA 2F9BH 2OBQA 1TX7A 3IITA 1SB1H 3ZZAA 1VJ9U 5FL7D 3URCA 3RXFA 1GMCF 5JDUB 2UWPA 4IN2A 1ZHMA 4BOHA 1K1MA 4YO9A 4FUGA 2OXSA 4FUCA 3M7QA 1GCDA 2O8LA 1P06A 1HUTH 2B0FA 1YGCH 3PMBB 1GMHG 3EE7A 1J14A 4KTUA 3FAOA 1G2LA 4YT6H 3M5NA 5HXFA 3BF6H 1BQYA 2ULLA 1WTHD 2Y6TA 1OYTH 3GCTF 2C93B 4AG1A 1O2IA 2PKAA 2EY4C 1CT2E 4FUIA 3RXAA 1WSSH 4CBNA 2SFAA 1CA0B 2V3OH 4ZAEA 4JK5A 4SGAE 1GVKB 3ZV8A 4D7GA 2L6OA 2FWWA 2TGPZ 1GBAA 1ORFA 1YLNA 1LMWB 1V2KT 3M5LA 3WWBA 2PKAB 3MNSA 3U1JB 1O32A 1LQDB 4KTCA 1KLTA 1Z8GA 1HJ9A 3DSOA 1DWCH 4INHA 1F92A 5TJXA 1E1QD 3RXBA 2PKSC 2Q6FA 2WV4A 1ANBA 1DX5M 1NM6A 4J2YB 4ZROA 4ZHAA 4DG4A 2OQ5A 4F49A 4MNYA 3ENSB 2XWBI 1FPHH 1YLDA 2TIOA 2VVVA 3DFJA 4MNXA 4D8NA 1F0TA 1F2SE 2A45B 1OWDA 2GZ7A 3E6PH 2QGRA 3LPRA 3MO6A 1ELCA 2ZHWH 1O2XA 3GY7A 2FODA 1ELAA 1C5VA 4FU9A 2VJ1A 3PMAB 2J34A 4JZEH 4MTBA 1MTNB 3FO8D 1K22H 1KTTB 4OGYA 4ACBA 1F5RA 3RU4T 1DXPA 2HLCA 4AGKA 1QL7A 1A5GH 3UNSA 4O3UA 2A4GA 3G01A 2GKVE 1NFYA 2OUAA 1C2HA 2D26C 5FXLA 2GDEH 1DWEH 1UHBB 4X0WU 3FOAA 3SYJA 4O97A 2ZHDA 1C1TA 4RSPA 2A4RA 4JYUH 1ANEA 1O5GH 2CJIA 5DP3A 2G5NA 3SU6A 1V2QT 2J95A 1K21H 1O2QA 1CA8B 1INCA 4XBCA 1C4Y2 1GJBB 4FVDA 2ZDAH 3Q3KA 2Z3EA 2HWLB 2JJ1D 2O8TA 2G51A 4NFFA 1W0JD 2ZDKA 3I77A 2QXHA 1C2EA 1HJAB 1OSSA 2KCPA 2WINI 4HFPB 3T26A 1TRMA 5F03A 3OEED 4DJZB 1O3JA 3VB6A 3SV8A 1O37A 3SU1A 1NZQH 1DT2A 4B75A 6GCHG 1EB2A 1L1JA 1O5EH 3ZZDA 2VINA 4VGCB 5AHGH 1S85A 1ELDE 2BD3A 1GBCA 5PTPA 3MU8A 1NRQH 2AH4X 1FUJA 1P05A 2BOKA 5E0GA 5C1UA 1GL1A 4WXVA 1BBRH 1TPAE 2BDCA 1A3BH 1LTOA 1C5PA 2O8MA 2RA0A 4YLQH 5EQSA 2YNBA 5EXNA 4GLYA 2SGFE 1PPZA 1N8OB 3A88A 3SV6A 1EZSC 1GWAA 1O2YA 5E8EH 4ESTE 2GD4B 2ZEBA 3SJ8A 4AB9A 2ZU1A 4B73A 3ZZ5A 1HXEH 3RLWH 1J17T 3M3SA 3EE0B 4I33A 2AGEX 1ABIH 1OHHD 1PQ5A 3SN8A 4XSKU 3BTFE 2XOKD 3U98H 3BG4C 4IC5A 4TY7A 1NU9A 1VKYA 2OLGA 5EJLA 2FI4E 1C1RA 1IAUA 4SGBE 3A8DA 3VGCC 3TVJB 2QIQA 2A5KA 4BAQB 2VIVA 3SJOA 3A8BA 3NPSA 3SUGA 2QXGA 5FAHA 4ABIA 4CH2B 3FP7E 3E16B 3LJJA 1LPGB 3GOVB 4LK4A 1UTLM 4GCHG 3V3MA 2G81E 4X2YA 4B71A 2OQUA 1SQOA 2F9UA 3KCGH 2Z94A 2ANKH 2VGCC 3LT3A 3MNBA 2CMYA 1JMOH 2Z6BD 1O38A 3F9HA 4GSOA 4GUXA 1ZGIA 4IW4E 3RXKA 4B76A 1YCPK 4I31A 3KYGA 1DLKB 1IHTH 1W12U 4H4FA 2BLWA 4IN1A 1C1WH 4U01A 2FMJA 1E1RD 4K1SA 4O03A 2W7SA 6CHAC 2GJGA 1QURH 1XUHA 1GDNA 2AMPA 2VIQA 2Z9IA 3MQKC 5T6DA 2A5AA 4X6PA 2H9HA 2P16A 1LPZB 5DK1A 5ESTE 4WXIA 2PFEA 2ZA5A 1XM1A 2VVCA 1V3XA 1GVZA 5HM2A 2B7DH 4YM9A 1T4UH 2OC8A 1Z1IA 1F7ZA 1UTMA 4JYVH 1S6HA 3A7VA 3UPEA 3NCLA 1ZYOA 3QLPH 4KGAA 3O8RA 1C2KA 3PV5A 4WMEA 1P04A 3UFAA 1UVPA 7GCHG 1DOJA 1VGCC 1AZ8A 3UR9A 1BB0B 3PMHB 2HPPH 1OS8A 2FDAA 1Q3XA 3ZZBA 4NWKA 1AHTH 5CE1A 5KECA 1E38B 1H1BA 1FAKH 4Y76A 2BD5A 1KXEA 1W11U 5DP7A 1W7XH 1AVXA 1BTZA 1SI5H 4Y6DA 4Q7ZA 3F3BA 1QNJA 1HLTH 1S84A 5C0TA 1BTPA 5HGGA 2A5IA 1H8IH 1UTQA 1WQVH 4K1TA 5E0HA 1AN1E 3GY6A 2OBOA 1YLCA 2W5EA 2ZQ1A 1AFQC 1ELVA 1ZR0A 1D3PB 1KSNA 1H9IE 1X7AC 2ZF0H 4A1VA 3C27B 1QQUA 4Q7YA 4AFUA 5FX5A 4OS1A 1HCGA 1GBTA 1O2UA 3TNSA 1YBWA 3MO9A 5A0CA 2EQNA 3BTHE 1TX6A 3AW1A 1WUNH 1WXRA 1O3HA 2BVXH 1MABB 3ODDA 2WSSD 2QAAA 1RIWC 3PMJA 3TJOA 4B6FA 2NU2E 3EA7A 1MZAA 4K69A 1FQ3A 1BT7A 1WDIA 1QZ8A 5CHAC 2PSXA 5HIZA 2A7CA 1FY1A 1O2LA 3Q00A 1KDQA 2GV7A 3T29A 1ZTKA 3PO1C 1VZQH 4K60A 4CRAA 5EU8A 2BLVA 4IBLH 1AE8H 1YWUA 2FX6A 2UUYA 5AF9H 2ZTZA 2B9LA 3QO6A 1T4VH 2QXJA 3QK1A 5EODA 2IJOB 3TITA 3W1EA 2JH5D 1CGHA 3PLPA 1W14U 2WYGA 1HNEE 4HZHA 3ZZ7A 2FOMB 1KXAA 4AB8A 1C5WB 1C1SA 3SJ9A 5E2OA 4NA7A 3A7ZA 2TGTA 3U28C 1Z6JH 3OEHD 2BQ6B 3STIA 4FOUC 3URDA 3OY6U 2ZGJA 4OS7A 1D9IA 5AVDA 4YOJA 1BTUA 1WCZA 1XUGA 2GCTC 2XTTB 5KGOA 3RXOA 2CN0H 2ZU3A 1SFQB 2KAIA 2Z3CA 2AFQB 3HK6B 1BITA 3BIVH 1RXPA 1GI4A 2KCOA 3RU4E 1J9CH 1Z1JA 4BXWA 2VB0A 3E3TA 1G3BA 2I6QA 3BTKE 4ABHA 1BA8B 1W0ZU 1NN6A 1V2MT 3GY2A 5AFYH 1T8OA 3SHCH 1EX3A 1AU8A 1WYKA 1W3CA 1GHXH 1F5LA 2YOLA 1SR5C 3KN2A 2BD4A 1OP0A 1GL0E 3QX5H 4ISIH 3DSPA 1SL3A 1TX8A 4WVPE 5C3NA 1N1LA 1A46H 3HKIB 4GPGA 4GVUA 1HV7A 1RTKA 2KX4A 3MNCA 1GMCG 3VPKA 3SNBA 4YXWD 5DKMA 1HFDA 2UUFB 3UNRA 3TU7H 2QA9E 1ESAA 3UQOA 1NT1A 2GDDA 3UB0A 3ZVDA 1BBRK 5E0JA 1GJ7B 5GWZA 1SGNE 1RS0A 2JETC 3GCTG 1TFXA 1AZZA 3LGIA 5C2ZA 3E91A 1ABJH 3U8OH 2VGCB 3H5CB 4JZDH 1UVTH 3GDVA 1C2DA 1AQ7A 3A84A 2NU1E 2I6SA 4OGXA 4U32A 2WZQA 2AYWA 2OC0A 3L6PA 3VEQB 1EQ9A 4ZMAH 4DIIH 4K5ZA 1IQMA 1C5XB 1QR3E 1SGTA 3U9AH 1JWTA 1BHXF 4A5TS 5JBAS 3F0PA 2ZWLH 1AWHB 3MH5A 1C5NH 3HGPA 3LH1A 1CHOF 3TK9A 4B1TA 5HM9A 3NKKA 6CHAB 1CHGA 1OP2A 3DHKH 3P95A 2GT8A 3F1SB 2OINA 2GZ8A 2C8XB 3P6ZB 2ZNKH 1CT0E 3M35A 1PPHE 5CHBA 5F6MA 2F9VA 3T27A 4MPWA 2GVFA 1B5GH 2STAE 4MDSA 4K1EA 1O3BA 2IN2A 2ZECA 4UE7H 1KTSB 3A81A 1TRYA 2A7HA 3OAAD 3KQCA 1XVMA 1DY8A 4RT1A 3BTGE 3N7DA 2SGAA 1TB6H 3MFJA 1SGQE 2VIWA 1A3EH 4KKDA 1C5ZB 1ETTH 1T7CA 1LPKB 1TQ7B 2GP9B 3BN9A 4FUFA 4AOQA 4AYYB 1ZJDA 1TLDA 3VG8A 1ZPBA 4JYTA 1O3IA 2XBYA 4X8UH 1ZMNA 1L1GA 1A5IA 1BBRE 1QJ7B 2ZFSA 3LC5A 3OYPA 1ETSH 3BSQA 5HKKD 2EI6A 4Y7AA 4AC9A 1ETRH 1LHEH 3M36A 1EOJA 4BNRA 3TH3H 2PUQH 3A7XA 1GI9B 5EG4A 2UWOA 1AUJA 5FCRA 1UTOA 1C2IA 5FBEA 3KEEA 1L2EA 1YYY1 1SLUB 1V2TT 8KME2 4FUEA 5EW2H 1HXFH 3DT0H 3ELAH 1GI6A 3W94A 1YF4A 5C17A 3E0PB 4ISOA 2C8WB 2ZDMA 3M3TA 2ZCHP 1P8VC 3HGNA 1YC0A 3SV7A 4JZIA 2ZTXA 3K6YA 3EAJA 5G4BA 3SI4H 2Z9LA 2PLXA 5FCKA 4Y8ZA 1HAGE 1O2ZA 3Q76A 1Y3VA 3VFEA 2JH0D 5LPEA 1EAWA 2ZHQH 3LGTA 2J5UA 1TGBA 1FXYA 4TWWA 1GJ5H 3A8CA 3WW7A 3LONA 2QV1A 2WPJS 2P8OC 3VB7A 1HBTH 1GG6C 1ZMLA 2XC0A 1EUFA 3JZ2B 1DPOA 2ZKSA 2ANMH 3T2NA 3BTQE 3LU9B 1O35A 1C5RA 3GCHB 4MQAA 5A2MH 3GISB 2OD3B 3DFLA 4AORA 1W7GH 2OCVB 2K1QA 3ZVAA 1T8NA 1CO7E 3MU4A 4FUHA 1AGJA 4ZXXH 4CR5A 2PP6A 3MU1A 4CREA 2XC4A 1BRUP 2PSYA 4PROA 2Y5GA 1FY3A 4ABJA 2EA3A 1O2OA 2O8UA 3ZV9A 2J98A 1QBVH 2OC7A 4X1PU 1F5KU 5C0UA 2F3CE 3SU0A 1EPTB 4JMYA 1QA7A 2XW9A 2BTCE 3RXMA 4TY6A 3OU0A 3N7EA 3RM2H 1O3MA 2J98B 5JBBS 1TGNA 2GCTB 1XKBC 1QB1A 1BMLA 2FI5E 3RXLA 4BTTB 1GMDG 5C1XA 3C1KA 3MI4A 3FKSD 3SUFA 1MBMA 1DDJA 1E36B 2EEKA 3P70B 1AUTC 2G4UA 1BZXE 1O2VA 3OTJE 1CSOE 1OKXA 4DIHH 1UCYH 1ZLRA 4ZHMU 2R3UA 1C1NA 1SQAA 1ZHPA 2KR7A 2ZG0H 1BDAA 5EOKA 1TNKA 1B7XB 4UD9H 1A0LA 3BTTE 1F0UA 1A7SA 1C5UA 1ZOMA 2ZZUH 4F48B 2TGAA 2KCAA 1C4V2 2W6ID 3LOXA 1NPMA 1GDQA 2CF9H 2HGTH 1O2PA 2J9NA 5AFZH 4ACAA 1LVMA 4Q7XA 1PQ7A 1WAYB 1O2HA 1DVAH 3P8FA 2BLQA 3BTEE 1W0KD 3VB3A 2F43B 2JETB 2M5TA 3PM3A 1FDPA 1BMNH 2ZGBH 1O2MA 1NU7B 1GHAF 4ISLA 1GBJA 2A7JA 4OS4A 1GCTB 2G00A 8GCHF 1T32A 2CXVA 4Z0KA 1GBBA 1UHBA 2BMGB 2Y7ZA 3SU3A 1DS2E 2Q6DA 1UTJA 2ZFFH 2WPMS 3M3VA 3UR6A 3MH7A 3RXPA 3S9BA 2GV6A 4D7FA 1Y5BT 1HAZB 5F53A 1GI2A 4NZLA 2A4QA 2BDBA 4Y79A 3V0XA 1D4PB 1ZRKA 3AVZA 4MG3A 4X6NA 3RXQA 5B6LA 1CE5A 2BVRH 2P3TB 4E06H 1MD7A 2ALVA 3MU5A 3TH2H 3UQVA 1L4DA 3VB5A 4DGJA 1SFIA 4ZKNU 4DT7B 2XBWA 2YMSB 1UO6A 2ZC9H 1LHGH 1O3GA 1GVLA 4NIXA 5DP6A 5T3HA 4Y71A 4IS5A 1GI8B 1QRXA 5IYTA 1BTYA 4ABDA 2J97A 1MH0A 4RN6A 1AB9B 2THFB 3M7UA 3LKWA 4Y8XA 1P2KA 1YPLH 2G4TA 4ABEA 4Y11E 3GCOA 4AFQA 1L4ZA 1NS3A 1YCPM 3M5MA 1SBWA 2BY6X 1EAUA 1P09A 2LP6A 1S5SA 2HRVA 5DSFA 4K3JA 1LKAA 3ZIAD 1D3DB 3SQEE 4E05H 4NA9H 1DFPA 1Y3WA 1JXPA 1MTVA 4IMQA 5ESBA 3UUZA 2Q1JA 1YPGH 5DJ7A 2ANWA 3RMNH 1SLVB 3LIWA 1ELFA 1O34A 3RXCA 1E35B 1EOLA 1TALA 2BDGA 2QY0B 5C5OA 1RD3B 5C94A 1IQHA 2XRCA 1MQ5A 2GGVB 4WF8A 3WWFA 1BTHH 2R0LA 2R3YA 1SG8B 2PGQB 3K2UA 1YPHE 3SO3A 1V2JT 4O3TA 2A2XH 1XX9A 1VITF 3H7TA 1YPKH 4GHTA 5DG6A 1S82A 1OWIA 4WH8A 2VIOA 1ELEE 3GYMA 5JBTA 2WPLS 3EA8A 2JKHA 1AO5A 1OWEA 1MD8A 2PW8H 1P9SA 5EQQA 3T25A 1HAPH 3U8RH 2FEQH 2Z7FE 3SNEA 2PUXB 1GHBF 2VIDA 5EJZA 5LPFA 1BTWA 3ZZ8A 2FOCA 1V2ST 1P10A 1Z7KA 4XDEA 1FNIA 1TAWA 1DICA 1KYNA 3ZZ6A 2Z3DA 1KXCA 1HIAB 3KQBA 4UEHH 1AKSB 2HNTE 3AASA 4DCDA 2QC2A 3SGQE 2C90B 1LVBA 1YPMH 1GBEA 1O3OA 1FX0B 1HB0B 1NRNH 3MWIU 3TJNA 4ISNA 1V6DA 1N6XA 3A89A 6ESTA 2ZFQH 2R2MB 2BYAX 2QF0A 3RC6A 1GMHF 1O39A 1O33A 1HAVB 1WU1A 2NU3E 4UDWH 5GDSH 4LZ1H 2J92A 5FPYA 2BM2A 4ABFA 4K8YA 1ARBA 1L1NA 2K0QA 3PLBA 1P57B 4WJG2 2O8WA 2C4FH 2TRMA 1FONA 4AZ2B 4FUDA 1A1RA 3A80A 1AIXH 4TPYA 4TWYA 4B2CA 4H42U 1P03A 2PV9B 4MNVA 3A87A 2PTCE 4BAKB 1CHOG 1MKWH 1XMNB 4AX9H 2SGPE 8LPRA 3A82A 2NU0E 3V7TA 1GDUA 4NZQA 1PPGE 1P2MA 3QDZB 1HYLA 2A2QH 2UWLA 5EPYA 5A0AE 1J8AA 1ZMJA 1GJ9B 2GCHG 1C2GA 2FYQA 3SU2A 3SNCA 1G3DA 4J1YA 1TMBH 2PKSB 2ODYB 4Z1MD 1C9TA 1MTSA 3RXUA 4YESB 1FPCH 3QWCH 4OS2A 4AG2A 2ODPA 3GS9A 4WWYA 1CGIE 2YMSD 4RT0A 1UCYK 2VVUA 1GBMA 2J38A 5GIBA 4AFSA 3M5OA 2F83A 1NFXA 2V6NA 1SGRE 4ZKSU 2HVXA 3RC4A 4MVNA 4BTUB 1FI8A 3RP2A 4B2BA 1MBQA 2V0BA 3GY8A 3ZYDA 2DE8A 1EASA 1O3KA 1C5SA 3O8CA 3PTNA 3Q3XA 1TGTA 3H7OA 3RM0H 3F68H 3OX7U 3R0FA 1S83A 2CK3D 3BTWE 2WV9A 4GHQA 1NRRH 3MH4A 2BDYA 2FLBH 3PTBA 2J4IA 1HJ8A 1HAYB 4CRDA 3FZZA 5A09A 1COWD 1K2I1 1O31A 3OFND 3UNQA 4BAOB 1QIXB 1P11E 3ZZCA 4FXGH 1IQEA 2QN5T 1NESE 3GCNA 4RKJB 1OYQA 1DSUA 1C5LH 1VCQA 1ELGA 1EATA 4CHAC 4LZ4B 3FANA 2DE9A 1QA0A 2UUKB 1TOCB 4CBOA 1C5MD 1QGFA 4H6TA 1IQIA 3IWMA 5JYIA 1OWJA 1W13U 1FY5A 4CH8B 4H6SB 4DT4A 2VWNA 2ZCLP 1F0SA 2ZGHA 1GI7B 1VCWA 4Q80A 4A7IB 1UCYE 2A32A 1K1OA 4FU7A 1ESTA 1SLXB 2ZPQA 1SOZA 5JB8S 1UVOA 3RUOA 5C67A 3S7KB 1N6YA 5J4QA 1FY4A 2XWAA 3GICB 4DVAU 1TPOA 2OTVA 2P94A 2J94A 3HPTB 1MKXH 2AIPA 3K9XB 4ISHH 4X1QU 4BAHB 3BIUH 2PWXA 1MAYA 1K1IA 3KIDU 1Z8JB 1GHZA 3LDXH 4X1RU 1OPHB 2EI7A 4X2VA 1V2RT 3QGJA 2ANYA 5HIYA 3SORA 1EZXC 2IOTA 7KMEH 1C1OA 5EJ1A 2ZI2H 3OY5U 5FBIA 3TGIE 1UTNA 3BG4B 2VWOA 3ATMA 2TBSA 2EI8A 1CU1A 2SGQE 4P02A 3VGCB 1G37A 1LVOA 2GTBA 2YNAA 3EGKH 1K1NA 2RFKC 2V7QD 3STJA 3GY4A 2GZ9A 1CVWH 3UTUH 3S9CA 2H9EH 4A92A 1LO6A 1QCPA 1CA0C 2F91A 1HRTH 3RXHA 5LGOA 4XD7D 3ZVFA 3ZZ9A 1NTPA 5H4IB 1KLJH 2XYAA 4K8BA 5CMXH 4NSVA 5EQRA 1TNJA 3U69H 1FLEE 1NO9H 1NFUA 1IQJA 1TMUH 2P59A 1IOEA 1E37B 3TGJE 4BTIB 6LPRA 1O5AB 3EA9A 2AMDA 1AVWA 1P2IA 3M61U 2QF5A 1G3CA 1QL9A 1SGFG 1GGDC 1UK2A 1J15A 2A1DB 2IJD1 2ILNA 2QF3A 1IHSH 1WOFA 3F2FA 3RXRA 2HVYB 4NA8A 3SJIA 4NSYA 2H1UA 5IDKA 1DSTA 3F0OA 3SW2B 3U1IB 1S0RA 2SGEE 1TYNA 1GJ6A 1FZZA 3UREA 1Y5UT 1TNIA 4P00A 4MLFB 1GHAG 1V2OT 2TPIZ 2OK5A 5F8XA 5SGAE 2Q6GA 1H8ED 8GCHG 1Y8TA 2C3SA 1KXDA 1QRZA 1YY3A 1MTNC 3QGNB 1SC8U 3RMOH 1LHCH 1RTFB 2BY5X 3ATIA 3ATKA 1QB6A 3TNTA 2QXIA 4NGAH 1T8LA 4O9VA 2FP7B 3ODFA 2R0KA 1VGCB 2WPKS 1GHWH 1EAIA 1MTUA 1Y3XA 1QQ4A 1FY8E 3ZYEA 1O3EA 4INLA 1IQKA 5HMAA 7LPRA 3R3GB 5K7RA 1GBHA 4WH6A 3TK6A 1RRKA 1VR1H 4FUBA 1Y5AT 4NIYA 3AW0A 2XCNA 1Q31A 1FV9A 5BRRE 2GMTC 5A0BA 2M2AA 1HAXB 5B6OA 2FOFA 1HJAC 3GYLB 1A61H 4YTAA 3UY9A 1A4WH 4A6LA 1AFQB 3KGPA 3V12A 3FZDA 3DA9B 4AYVB 2QE7D 1FIWA 1P02A 1QL8A 4U2WA 1CT4E 1JRSA 3O8BA 1G2MA 3ZZ3A 3B9FH 3SUEA 3A85A 2PTNA 1MKWK 4VGCC 1GJDB 1WV7H 3KNXA 2VH6A 2VNTA 1QBOA 1W10U 1RIWB 1GBFA 2ZGXH 1PYTC 4AN7A 2ZPRA 2QF4A 2FS9A 5CHAB 1DM4B 1ZSLA 1EP6A 3SV2H 3PV2A 2SGDE 1UTPA 1UK4A 3M37A 1H4WA 3RLYH 3OSYA 1N8OC 3PO1B 1EB1H 1AY6H 4WMFA 2AERH 1THRH 2BZ6H 4NIVA 5TCCA 3RMMH 2ZHFH 3SOSA
chains in the Genus database with same CATH topology
1BTXA 4I8KA 1EPTA 1BMAA 1YPHC 1O0DH 1BJUA 3V13A 2ZTYA 5JPMH 1PPBH 3SUDA 3RMLH 1VITG 2H5DA 1K1PA 4X6OA 1H9LB 3LGVA 3B8JA 3LJOA 1XUKA 1TWXB 3E90B 1C2JA 1V2LT 3SHAH 3FP8E 3SV9A 1RFNA 1ARCA 3ZVCA 1PPCE 1ESBA 1TIOA 3E0NB 2ZU5A 3UIRA 3GY3A 4OS6A 2VH0A 1GHBG 1W0YH 3A7YA 3M7TA 5A8XA 1BOQA 3F9FA 3SGBE 3S7HB 2QCYA 1TNLA 1TA2A 1AI8H 3F6UH 1C2MA 3RU4D 1S81A 1P2OA 1DWDH 3LGWA 3N7OA 2BY8X 1YPEH 4D9RA 1OWHA 2V35A 4X1NU 1GBLA 2QYIA 5EXLA 3BTME 3CENA 3AAUA 1QY6A 1UVSH 1EAXA 1JIMA 1TQ0B 3L3TA 4AGJA 3GDSA 3RXTA 3PV4A 1P12E 1C1UH 1O5BB 3FP6E 3W95A 5L2YH 1OX1A 4CR9A 4X6MA 2G52A 3MTYA 1CBWC 5EGMA 4XE4A 3SQHE 4D9QA 2ZHEH 1OOKB 4A1TA 1CGJE 4NWLA 7ESTE 2W26A 1VJAU 2BXUH 1OXGA 2Z9JA 1ZSJA 1LDTT 2P95A 4JZ1A 1WBGB 5DP9A 4CRGA 2NWNA 1P01A 4K2YA 1O5DH 3FFGA 3Q3YA 3RXGA 4E7NA 1MKXK 1UJ1A 2FESH 1O2GH 3T5FH 2FM2A 2BY7X 1V2WT 1D6RA 3PLKA 1FMGA 1GGDB 3B23B 3QZRA 4ASHA 2VU8E 3VB4A 2HPQH 3RDZA 3K65B 2FOAA 1FN8A 4I7YH 1C5QA 3D23A 3KQDA 3BEUA 3KQEA 3EDXB 1O2SA 2BX3A 1V2NT 4ZH8A 1RGQA 2BY9X 4UFFH 1QFKH 1EZQA 1V2VT 9LPRA 3HATH 1SHYA 2BDHA 3PROA 3RXIA 4BXSA 1D3TB 5HYOA 2Z9KA 2EC9H 2AIQA 4INKA 2RDLA 3QTVH 4YZUA 2STBE 4UFGH 1TPSA 2VIPA 3MMGA 4Y8YA 2BOHB 1G9IE 1PQAA 4HI3A 4Y10E 3MNXA 2Y81A 3L33A 3BV9B 1JBUH 1QJ1B 1W8BH 3RXSA 2BD9A 1LCYA 1MU6B 4MPUA 4ZUHA 4E7RG 2P93A 1TGCA 4DW2U 2ALPA 1ANCA 2OC1A 2VWMA 1RTLA 2GMTB 1BUIA 5EW1H 2F9PA 1FAXA 1C1PA 1AFEH 4DURA 1BRCE 2FOHA 3BTDE 1THSH 4R8TB 1DWBH 4Y7BA 5FPSA 4LOYH 5T6FA 1O5CB 1VITH 4X8TH 1DANH 1GBKA 1THPB 5GCHF 3RXVA 1SLWB 1EJMA 2XBVA 3S69A 3NXPA 2BQWB 1P9UA 4B2AA 2FZZA 4I8JA 2WYJA 3LGYA 4KP0A 1SVPA 1HPGA 3SNAA 4Y0YE 3MH6A 1W2KH 3O8DA 1FN6A 4RKOB 1BHXB 4ZKOU 3IG6B 2P8OB 4I8GA 4YT7H 1GI1A 3UOPA 1GG6B 1TE0A 1C2LA 1O3CA 1QBNA 5I25A 1ELTA 3SBKA 1SGCA 2BDIA 4YLUA 1HIAA 1AKSA 1EJNA 1OP8A 2CHAC 1TNHA 2FPZA 2DUCA 1B0FA 1VCPA 1BMMH 1HGTH 1M9UA 4I8HA 2ZPSA 4ABBA 1LHDH 3VXFH 3RXDA 1PJPA 2BD2A 4JZFH 1HAOH 3A8AA 1DUAA 1ZSKA 1EKBB 2Y7XA 1P3EA 1E34B 1HAVA 2ZFPH 5GXPA 1V2PT 5JBCS 1QRWA 1IQNA 4LXBH 1DE7H 1GMDF 2BDAA 1LVYA 2ZDNA 1C1VH 1ELBA 1NFWA 5DP5A 1O3PB 2Y80A 1C5YB 1IQFA 1ZTLA 4YOIA 1Y59T 3VXEH 2AGGX 2BXTH 4XOJA 4CRFA 1O2KA 4FVBA 4X8SH 3UWIA 5EXMA 1G32B 4UONA 1JOUB 1YP9A 4THNH 1E0FD 3SU5A 4F4OC 1GJCB 3QTOH 3ZZ4A 1GBDA 1P3CA 5C20A 5TCAA 2AEIH 1Z8RA 1QTFA 2PGBB 1FIZA 5LPRA 1ZPCA 4XBBA 1HAIH 3RC5A 1BCUH 3SU4A 4QT8C 2UUJB 2FIRH 1CBWB 2ZIQH 2ZO3H 3MHWU 5BPEA 1TBQH 3BEFB 5K0HA 2BZAA 1SGDE 1O2TA 4UFEH 1C2FA 3F9GA 3TJUA 1YM0A 1YPJH 3TJVA 4MPVA 2GX4A 2H9TH 5L30H 1NRSH 2ZU2A 3DUXH 1EJAA 1Y3YA 1EZUC 3WY8A 2BVSH 1SOTA 4NCYA 1ID5H 1P0SH 2J2UA 2ZU4A 5DGJA 2RCEA 3Q77A 1LKBA 1QB9A 4CRCA 2ASUB 1GI0A 2RA3A 1C5OH 1XUIA 4JK6A 3PWBA 3ZVGA 3P8OA 2C8ZB 3S9AA 1SMFE 2LPRA 1XUFA 1O30A 2WUCA 1H9HE 2BLOA 1NC6A 2FS8A 3D65E 2D8WA 2P3FH 4OS5A 1MTWA 3TK5A 1MUEB 4UFDH 2FX4A 3RXEA 3TIUA 1PPEE 5GJ4B 1U6QA 4CRBA 5L6NH 1O2RA 2FOEA 3E8LA 1ZTJA 4BAMB 2JH6D 4ZHLU 5DP4A 2B5TB 1AE5A 4U30A 2FTMA 2OP9A 1Y3UA 5A8YA 2FO9A 2W3KA 1SSXA 1MCVA 1UTKA 1GJAB 3TLOA 3AAVA 5L2ZH 1TPPA 4X2XA 3EYDA 1O2WA 4NIWA 1QHRB 6GCHF 2WUBA 1DITH 1GHVH 3ZVEA 4DOQA 2BQ7B 2PHBA 5DP8A 1JRTA 1F0RA 3JZ1B 1SHHB 1ZHRA 1SGFA 2A31A 5T6GA 1NY22 3A7TA 1G36A 3MO3A 1C1MA 1PYTD 3GCHC 4GAWA 1FJSA 4ABGA 1QJ6B 2ZGCA 3QN7A 1ZZZA 1GBIA 2R9PA 3UWJH 1BJVA 1XXFA 1TA6A 2FLRH 1DY9A 1KDQB 2AGIX 2D1JA 3FVFB 4IMZA 5GPIB 1AVGH 1EP5A 4MPXA 3MYWA 3BG8A 1TNGA 1A0HB 1L0ZA 2Y82A 2BD7A 1AWFH 2AMQA 1TBZH 2Y5HA 1LQEA 1XXDA 2HOBA 1O3AA 3CS0A 1EPTC 5FPTA 1TGSZ 1XVOA 3NZIA 1KIGH 1MU8B 2WV5A 4DY7B 4JCNA 2A4OA 1KY9A 2RG3A 3A7WA 5ETXA 1O3DA 2F9NA 3KL6A 3U8TH 1GJ8B 3QZQA 2ODQA 2P3UB 4X2WA 3BEIB 1ZJKA 1G30B 4Y0ZE 3SGAE 3CS7A 1OWKA 1G3EA 1O3LA 1RJXB 2TGDA 2XXLA 1C9PA 3F9EA 9ESTA 2ZDVH 1AMHA 4GCHF 2C8YB 4WMDA 1DXWA 5LH8A 4Q2KA 1V2UT 4AFZA 1TBRH 2CHAB 2ZFRH 1Z71A 1P2JA 2ZCKP 2KAIB 2ESTE 1MMJN 2O9QA 5DO4H 2F9OA 1WTGH 1HAHH 3ATLA 3K6ZA 1Q2WA 1LHFH 1WQSA 1A5HA 3SI3H 4B74A 3HK3B 3CP7A 2XBXA 3EQ0H 1D6WA 3I29A 2R2WU 1A2CH 2LNCA 1GI3A 1MZDA 1PPFE 2SNWA 1O3NA 5EPNA 1S6FA 1GCTC 1TABE 3NUMA 1MQ6A 5F8ZA 4XBDA 2HALA 2B8OH 1HDTH 2FI3E 2ZDLA 1JIRA 2IPHA 1GJ4H 1KLIH 7GCHF 1P2QA 3GDUA 3P8NA 5C1YA 1O36A 2FXRA 3S0NA 3NWUA 1MCTA 1TOMH 3SJKA 1GHYH 5J4SA 2Y5FA 1KXBA 2FYRA 3P8GA 1TONA 1DLEA 1YKTA 1NRPH 2GCHF 5FX6A 4ZKRU 3RXJA 2WPIS 4TYDA 1KXFA 2G55A 1UK3A 1XUJA 5C5NA 1IQGA 4KTSA 3TH4H 4HGCA 8ESTE 4IC6A 2XCFA 1TRNA 3ZVBA 5F8TA 2BD8A 1ACBE 1PFXC 1EXFA 1O5FH 1SQTA 5E2PA 2HNTF 1PQ8A 4NFEA 1DUEA 1T31A 3TPIZ 3UOUA 1H8DH 2ZQ2A 4A1XA 1K28D 1AB9C 3E1XB 3MU0A 2V3HH 4IGDA 2SNVA 3TGKE 5I46H 1P2NA 3SZNA 3P92A 3NK8A 1SGIB 3QUMP 1NROH 2ZFTA 1CQQA 2CGAA 2VWLA 4WY3A 2ZP0H 3LC3A 1GI5A 4FUJA 4X8VH 1ZRBA 4NG9H 3SNDA 4YOGA 2BHGA 1SGPE 1Z6EA 1GPZA 2BB4A 5DPAA 1T8MA 4I8LA 1J16A 1S0QA 3HKJB 5A8ZA 1SGEE 3KF2A 1ZPZA 1C5TA 3T62A 2Z9GA 5GCHG 4XFQA 3ESTA 2CF8H 5FHTA 1MAXA 4ZXYH 4TPIZ 2H5CA 1YCPH 1TMTH 2A0QB 2CV3A 4CHAB 4MNWA 1O3FA 1D3QB 3PWCA 1O2NA 3A83A 1Z8IB 2G5VA 1BIOA 1XKAC 2WPHS 3P17H 2H2ZA 3PB1E 3A86A 3LH3A 1IQLA 2H6MA 4M7GA 2BX4A 4Z6AH 3PYHA 1O2JA 4X1SU 5JB9S 1C4U2 1BRAA 2FTLE 2D2DA 1ANDA 1B0EA 2W3IA 3T28A 1A0JA 2PR3A 2FOBA 2AS9A 4KELA 3LGUA 2XC5A 1K9OE 1UMAH 2XNIA 4I32A 3MOCA 3ATWA 3D62A 3DD2H 1C1QA 1ZGVA 2GT7A 2G8TA 1BRBE 4FU8A 4ABAA 3D49H 4HTCH 2NU4E 2FOGA 1SGYE 5ABWA 1SPJA 3GY5A 4R0IA 3I78A 3KHVA 1UVUH 4BANB 4D76A 2HNTC 1K1JA 3ITIA 1K1LA 1AD8H 2W7UA 2F9BH 2OBQA 1TX7A 3IITA 1SB1H 3ZZAA 1VJ9U 3URCA 3RXFA 1GMCF 5JDUB 2UWPA 4IN2A 1ZHMA 4BOHA 1K1MA 4YO9A 4FUGA 2OXSA 4FUCA 3M7QA 1GCDA 2O8LA 1P06A 1HUTH 2B0FA 1YGCH 3PMBB 1GMHG 1J14A 4KTUA 3FAOA 1G2LA 4YT6H 3M5NA 5HXFA 3BF6H 1BQYA 2ULLA 1WTHD 2Y6TA 1OYTH 3GCTF 2C93B 4AG1A 1O2IA 2PKAA 1CT2E 4FUIA 3RXAA 1WSSH 4CBNA 2SFAA 1CA0B 2V3OH 4ZAEA 4JK5A 4SGAE 1GVKB 3ZV8A 4D7GA 2FWWA 2TGPZ 1GBAA 1ORFA 1LMWB 1V2KT 3M5LA 2PKAB 3MNSA 3U1JB 1O32A 1LQDB 4KTCA 1KLTA 1Z8GA 1HJ9A 1DWCH 4INHA 1F92A 5TJXA 3RXBA 2PKSC 2Q6FA 2WV4A 1ANBA 1DX5M 1NM6A 4J2YB 4ZROA 4ZHAA 4DG4A 2OQ5A 4F49A 4MNYA 3ENSB 2XWBI 1FPHH 1YLDA 2TIOA 2VVVA 3DFJA 4MNXA 4D8NA 1F0TA 1F2SE 2A45B 1OWDA 2GZ7A 3E6PH 2QGRA 3LPRA 3MO6A 1ELCA 2ZHWH 1O2XA 3GY7A 2FODA 1ELAA 1C5VA 4FU9A 2VJ1A 3PMAB 2J34A 4JZEH 4MTBA 1MTNB 1K22H 1KTTB 4OGYA 4AGKA 1F5RA 3RU4T 1DXPA 2HLCA 1QL7A 1A5GH 3UNSA 4O3UA 2A4GA 3G01A 2GKVE 1NFYA 2OUAA 1C2HA 2D26C 5FXLA 2GDEH 1DWEH 1UHBB 4X0WU 4O97A 2ZHDA 1C1TA 4RSPA 2A4RA 4JYUH 1ANEA 1O5GH 2CJIA 5DP3A 2G5NA 3SU6A 1V2QT 2J95A 1K21H 1O2QA 1CA8B 1INCA 4XBCA 1C4Y2 1GJBB 4FVDA 2ZDAH 3Q3KA 2Z3EA 2HWLB 2O8TA 2G51A 4NFFA 2ZDKA 3I77A 2QXHA 1C2EA 1HJAB 1OSSA 2WINI 4HFPB 3T26A 1TRMA 5F03A 4DJZB 1O3JA 3VB6A 3SV8A 1O37A 3SU1A 1NZQH 1DT2A 4B75A 6GCHG 1EB2A 1L1JA 1O5EH 3ZZDA 2VINA 4VGCB 5AHGH 1S85A 1ELDE 2BD3A 1GBCA 5PTPA 3MU8A 1NRQH 2AH4X 1FUJA 1P05A 2BOKA 5E0GA 5C1UA 1GL1A 4WXVA 1BBRH 1TPAE 2BDCA 1A3BH 1LTOA 1C5PA 2O8MA 2RA0A 4YLQH 5EQSA 2YNBA 5EXNA 4GLYA 2SGFE 1PPZA 1N8OB 3A88A 3SV6A 1EZSC 1GWAA 1O2YA 5E8EH 4ESTE 2GD4B 2ZEBA 3SJ8A 4AB9A 2ZU1A 4B73A 3ZZ5A 1HXEH 3RLWH 1J17T 3M3SA 3EE0B 4I33A 2AGEX 1ABIH 1PQ5A 3SN8A 4XSKU 3BTFE 3U98H 3BG4C 4IC5A 4TY7A 1NU9A 2OLGA 1C1RA 1IAUA 2FI4E 4SGBE 3A8DA 3VGCC 3TVJB 2QIQA 2A5KA 4BAQB 2VIVA 3SJOA 3A8BA 3NPSA 3SUGA 2QXGA 5FAHA 4ABIA 4CH2B 3FP7E 3E16B 3LJJA 1LPGB 3GOVB 4LK4A 1UTLM 4GCHG 3V3MA 2G81E 4X2YA 4B71A 2OQUA 1SQOA 2F9UA 3KCGH 2Z94A 2ANKH 2VGCC 3LT3A 3MNBA 2CMYA 1JMOH 2Z6BD 1O38A 3F9HA 4GSOA 4GUXA 1ZGIA 4IW4E 3RXKA 4B76A 1YCPK 4I31A 1DLKB 1IHTH 1W12U 4H4FA 2BLWA 4IN1A 1C1WH 4U01A 2FMJA 4K1SA 4O03A 2W7SA 6CHAC 1QURH 1XUHA 1GDNA 2AMPA 2VIQA 2Z9IA 5T6DA 2A5AA 4X6PA 2H9HA 2P16A 1LPZB 5DK1A 5ESTE 4WXIA 2PFEA 2ZA5A 1XM1A 2VVCA 1V3XA 1GVZA 5HM2A 2B7DH 4YM9A 1T4UH 2OC8A 1Z1IA 1F7ZA 1UTMA 4JYVH 1S6HA 3A7VA 3UPEA 3NCLA 1ZYOA 3QLPH 4KGAA 3O8RA 1C2KA 4WMEA 1P04A 3UFAA 1UVPA 7GCHG 1DOJA 1VGCC 1AZ8A 3UR9A 1BB0B 3PMHB 2HPPH 1OS8A 2FDAA 1Q3XA 3ZZBA 4NWKA 1AHTH 5CE1A 1E38B 1H1BA 1FAKH 4Y76A 2BD5A 1KXEA 1W11U