4MPWA

Human beta-tryptase co-crystal structure with [(1,1,3,3-tetramethyldisiloxane-1,3-diyl)di-1-benzofuran-3,5-diyl]bis({4-[3-(aminomethyl)phenyl]piperidin-1-yl}methanone)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Target-directed self-assembly of homodimeric drugs
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Tryptase alpha/beta-1
total genus 53
structure length 243
sequence length 243
chains with identical sequence B
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mpwA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mpwA01
4FUCA 2NU2E 1GL0E 1GJ8B 3O8DA 2GZ8A 2HWLB 1GBJA 2TGDA 3F9FA 1Z7KA 2WV5A 2BD9A 1O2LA 1TAWA 3SJIA 2Z9JA 3QWCH 4A1VA 3RC5A 4B74A 2AS9A 1TNGA 4BANB 1DLEA 1GI1A 2ZHFH 3RXFA 1Z1IA 1NRSH 3MH4A 5TJXA 3T28A 3LH3A 1XKAC 4NFFA 4D7GA 1OP2A 2STAE 1VCPA 1W7XH 1K1IA 2Z3EA 5JBBS 4ABAA 1HIAB 2HNTF 1TBZH 1CHGA 4HZHA 1Y5UT 2BVSH 2Q6GA 3BTTE 1FNIA 1GBKA 5FBIA 1O5CB 1LKBA 1C5PA 1A3EH 1GG6C 1MMJN 3AW0A 1G30B 3HK3B 4NZQA 1BRCE 3GY3A 3SU1A 1TOCB 5HMAA 1QFKH 1BTWA 3GY6A 2GVFA 2VWOA 1DFPA 2NWNA 3BEIB 3ZZ8A 2J95A 1FAXA 4KKDA 1GBBA 3A82A 1K1PA 2H5DA 2GT7A 2C3SA 2KAIA 3MNXA 4HI3A 4ISHH 3GCNA 3RXQA 4FXGH 1BQYA 1XVMA 3A7VA 1IQGA 1MKXH 4TYDA 1G3EA 3KQDA 2TGTA 1AFQC 2G00A 3E6PH 4XBBA 1F2SE 4M7GA 2FIRH 5L6NH 5C2ZA 1C1PA 1CBWC 2BDAA 2D26C 3ITIA 3NPSA 1UTOA 5CHAB 4YOJA 1FAKH 1A5HA 1GI4A 1Y3XA 2O9QA 3A86A 2C8XB 1YCPM 2WPJS 2BD2A 1SGCA 4DOQA 5A2MH 4X6PA 1UCYE 1O3GA 2SGQE 2A5IA 1MTVA 1RD3B 1MU8B 1VCWA 1GL1A 1ESBA 1YCPH 2BOHB 1E34B 1GI2A 3E91A 1C1MA 3P92A 1G32B 4K8YA 1YP9A 1O3HA 3UOUA 3LGYA 1IQFA 1PPHE 3MH7A 1TOMH 3H5CB 3ZZ4A 1V2VT 3RXCA 3SV7A 2VVVA 1UO6A 3EQ0H 4Y8ZA 1B5GH 5B6OA 4NIYA 4I8KA 1MTSA 3GCTG 5F8ZA 4MNWA 4GUXA 2CV3A 5JBTA 1O5FH 2Y7ZA 1O34A 4FUDA 3PYHA 2GD4B 1TPPA 1KLJH 2W26A 4ZHMU 1L4ZA 2CHAB 3PWCA 3UWIA 3LIWA 2FOFA 1IQIA 2ZHEH 3HPTB 1DM4B 2FXRA 2HRVA 1S6HA 3FZDA 3PV4A 2QAAA 1RTLA 1L1JA 1EPTA 2M5TA 4X8UH 2Z3DA 4XBDA 1J8AA 1X7AC 4INHA 2SFAA 4QT8C 1TNLA 1UTLM 1G36A 4Y7BA 4NSVA 1HAOH 1CE5A 5GJ4B 5DP7A 3VXFH 1ZTKA 1GCTB 1HJAC 1YGCH 5EU8A 2PKAB 1GHAG 3BTKE 1UMAH 4I8GA 5EW2H 5LH8A 1HIAA 3OX7U 1AFEH 2GTBA 4K1SA 2Y5FA 3GYMA 1DXWA 1B0EA 1U6QA 3PO1B 1HPGA 1C5TA 1NRQH 4INKA 5DP8A 2A7JA 1P2IA 1TRMA 2JH6D 3ZVAA 3L3TA 2ZU3A 1EAUA 2G5NA 1C5OH 1TWXB 3TJVA 3ZVCA 2F9VA 4ISOA 1SQOA 4I8HA 1F92A 1VITF 2B7DH 2WINI 5E2OA 1GBFA 1GHZA 1S0QA 3UFAA 2PKSC 1P57B 3M5MA 1A2CH 5L2ZH 2O8UA 3EGKH 4Q80A 1HJ8A 7GCHG 3BV9B 2P16A 1O3MA 3QTOH 2GCTB 1NM6A 3UNSA 1MKWK 1F5RA 2A1DB 1EX3A 2ZU5A 3RXAA 5T6DA 2A2QH 4WF8A 4LZ4B 1UVTH 1UHBB 4X8TH 1EP5A 1EZSC 1GI7B 2TIOA 1GG6B 4CRGA 2WUBA 3OU0A 4WMFA 1E36B 2OC7A 1O2QA 1O3BA 3IG6B 1GDUA 3SI4H 3EA9A 3URCA 1N8OC 2VH0A 1TNIA 1MCTA 1YLCA 4H42U 3IWMA 4JZEH 1C5UA 2IN2A 4FUBA 1C1VH 1EASA 3KF2A 1A0LA 1OPHB 2PV9B 4A5TS 5EXNA 3F68H 3PLBA 2BVRH 3QO6A 3RU4T 1C2IA 1S6FA 1S85A 1UVUH 2C8YB 1GDQA 2LNCA 3RC4A 2Z7FE 1T32A 2FPZA 1W8BH 3BIUH 3FP7E 4YLUA 3SHCH 4AOQA 4YOIA 3RXLA 2ZP0H 2R3UA 2UUKB 1NFYA 4AB9A 1C2MA 5CHAC 1BTUA 1CHOG 2FI5E 1K28D 1AU8A 4CHAB 3HGNA 3RMNH 4BAKB 4NIXA 3ATMA 3UNQA 2TGPZ 1M9UA 1GMHG 1ZHRA 3VXEH 1EJNA 2VIOA 4ABDA 1AD8H 3SNBA 3S9CA 1FN6A 1D9IA 3Q3XA 1MQ6A 1PYTD 2UWLA 4VGCC 1EUFA 1L1GA 1YPEH 2OLGA 2ZPSA 1LDTT 2WUCA 1IHTH 1DPOA 3NKKA 5DP9A 4TPIZ 1HAXB 3SNAA 1KY9A 1LPGB 3GDSA 2V35A 1ZRBA 2BZ6H 5TCCA 1SC8U 1UTPA 2HGTH 5GCHF 1AB9C 4NSYA 1A0JA 4FUEA 1CHOF 1NS3A 3RXVA 1KYNA 1GMCF 1L1NA 4IC6A 1MD8A 3SU0A 5GXPA 1SG8B 3W95A 3ELAH 1LHDH 3K65B 4JK6A 4ZKRU 2AERH 3P8OA 3A8DA 4XDEA 3MO3A 2QYIA 1SGDE 3UOPA 1P3EA 4X6MA 3UY9A 1MZAA 1EXFA 5JBCS 1T7CA 1OYQA 1UTJA 4K3JA 4K1EA 1AQ7A 4TWYA 1HJAB 1NPMA 1K9OE 1W10U 3A7WA 3MO9A 3SW2B 4ESTE 1VJ9U 1SBWA 1GI8B 1P12E 1RTFB 1OWKA 1Q31A 3BTEE 5E0HA 2RG3A 1O35A 1DICA 1AKSB 3PO1C 1RXPA 5A8ZA 1N6XA 2ZHDA 1KXCA 4A7IB 4DT7B 1WUNH 3E0NB 2ZFQH 1BHXF 3EAJA 3M61U 3GY4A 3KQEA 4FU9A 3PTNA 2XXLA 2GZ7A 1TE0A 2H5CA 4WH8A 3ZYDA 2BLQA 3C27B 3SNDA 1QBVH 2BD8A 4D9QA 3S69A 3F9HA 1C2HA 1TMUH 3TU7H 2JH5D 3TPIZ 1MQ5A 1OWDA 2OBOA 3TK9A 3KCGH 1Z8RA 1F7ZA 1V2JT 3HATH 5EPYA 5K0HA 1LHEH 1MUEB 1GVKB 1FONA 5EXLA 1P2QA 3SGAE 1P03A 1XXDA 3P70B 1VITG 1SQTA 2BDIA 1CSOE 1ZGVA 1F5KU 3MU5A 1YPLH 2OQ5A 1BMLA 4BXSA 1H8DH 1NROH 3GY8A 1EP6A 2F91A 4TY6A 1GJCB 1PQAA 3K2UA 5HXFA 2ESTE 1O2HA 1O33A 3PLKA 2FS9A 4ISLA 3OY5U 1TNJA 1AFQB 3ZZDA 1N8OB 2BB4A 1GBLA 1LPZB 4OGXA 5L30H 1G3BA 3M3VA 1FMGA 1SLWB 4LZ1H 1O2XA 1CBWB 2XRCA 5GWZA 3RLWH 3I77A 1SHYA 1DT2A 1ZJDA 1V2QT 1WTGH 2I6QA 1T8LA 5HYOA 1OP0A 1BIOA 3RXDA 3DA9B 1QNJA 1RRKA 1UK4A 3ZVFA 1GPZA 1C2JA 2BY8X 4MPVA 2HNTE 1SGFA 4DW2U 3QGJA 2ZDNA 6CHAB 4X1RU 3RLYH 1O38A 8GCHG 4AFSA 4X1NU 2ZGBH 3ZZCA 2F9BH 4ISIH 1Z8GA 1MAXA 2GMTC 2SNWA 1O3AA 4B75A 3UR9A 2G81E 4MQAA 3GDUA 4SGAE 4IN1A 3MNCA 1PPCE 4IMZA 1QRZA 1VGCB 3VGCC 3BN9A 3VFEA 2QGRA 4YT7H 1O2MA 1GBIA 2P3FH 4E7NA 2ZGHA 1HGTH 1DLKB 3RXEA 4VGCB 1TQ0B 3EDXB 4ISNA 1AE5A 1C1OA 3T27A 3C1KA 2G55A 4X2VA 2AH4X 3A81A 1K2I1 2HPQH 1GJ7B 3QK1A 3KHVA 1AMHA 2ZCLP 4Q7ZA 2WV4A 4D7FA 1ZR0A 1QA0A 3RXIA 5E0JA 1O2SA 2H9HA 2IPHA 3NWUA 2WYJA 3LH1A 3MU1A 2VIVA 3MI4A 1AIXH 1GBMA 2FS8A 2P59A 2P8OB 3LT3A 2BLVA 2H6MA 1A5GH 2G51A 3PMAB 1YPHC 1VITH 1Z6JH 2EEKA 4CH2B 1Y3YA 2FI3E 2PSXA 5IYTA 1BTPA 4OS5A 3AASA 3E0PB 1J15A 3A85A 3M7TA 3VB6A 3SO3A 3SOSA 2HVXA 2KAIB 4I31A 2JH0D 3LC3A 1DX5M 2DE9A 3TGJE 1SPJA 3RM0H 3ZVGA 3T25A 2OC8A 2XBYA 3GDVA 2H2ZA 1WYKA 5A0CA 1BUIA 1A5IA 1TA6A 5JYIA 3A7ZA 1D3QB 2SNVA 3S0NA 1OOKB 5ETXA 1RS0A 2QXGA 3PWBA 1SMFE 1YPHE 2VH6A 5EG4A 1XXFA 1ANBA 3Q3YA 1GJ9B 1QBNA 2AIPA 1PPBH 1A4WH 4B2AA 3M7UA 2J38A 3F9GA 2OC0A 1ANDA 1KIGH 1THSH 1EOJA 2P94A 3U69H 1ESTA 5FCKA 3ZVBA 1LHGH 1EOLA 1O0DH 1GJDB 4WH6A 1THPB 2GDEH 3P6ZB 3LGWA 1C5YB 2V6NA 3DUXH 3UWJH 5A0BA 2OQUA 3GY7A 2ZCKP 4LK4A 1HXEH 2ZI2H 1TQ7B 3B23B 1FN8A 1HAGE 2CMYA 1D3DB 3SBKA 3B8JA 5F6MA 5SGAE 1EKBB 3S9BA 1UTQA 4NCYA 4CREA 3BSQA 5DP5A 5BRRE 1HRTH 1ANEA 1ELBA 1EAXA 1O3PB 1GDNA 4I7YH 4GCHF 4SGBE 6ESTA 1O2VA 1UVOA 1C5WB 4ABHA 3TJNA 2FEQH 3LGTA 1MU6B 1J9CH 3GCHC 1VJAU 2R2MB 1HBTH 4JZFH 2ZQ1A 1K1MA 4MPUA 5DPAA 1GHAF 4HFPB 1O31A 2NU4E 1O3EA 4GLYA 4CHAC 3U1JB 4AG2A 2AIQA 3P8NA 3PMBB 1YF4A 2Y81A 1O3JA 1TPAE 4MTBA 2VGCC 3RMMH 1V2OT 2ZU4A 1AHTH 2PR3A 4CRCA 4MNXA 1NY22 2C8WB 1P01A 4NA7A 1C1NA 2GMTB 5J4SA 3U8RH 1O2TA 4FUIA 4NWKA 2FOGA 1O3OA 4INLA 2FMJA 3GCOA 4BAQB 3T29A 5DK1A 3AVZA 1VGCC 3VGCB 3ZVEA 2QA9E 2BX3A 1HXFH 4IC5A 1W14U 1FY3A 3V0XA 4D76A 5I46H 8ESTE 1GHBF 1J14A 2ANYA 4OS7A 1ZJKA 3EYDA 3SGQE 3TJUA 3UQVA 1P9SA 3CENA 1MTUA 1A1RA 3BTGE 3ZZ6A 3RXSA 3RXTA 4XFQA 1THRH 1O2OA 3SJOA 1XX9A 1DSUA 1O39A 1OWJA 1P06A 1OWIA 5K7RA 4JYUH 1D4PB 2ZTXA 3BTFE 1G3DA 2R3YA 1FY8E 5C67A 1P02A 1TIOA 1XVOA 5HM9A 4JMYA 4OS2A 1FIWA 1TB6H 3IITA 2ZIQH 4B1TA 1ESAA 1TFXA 3V7TA 2BZAA 1F0UA 1LHFH 3A8CA 3MOCA 1GHBG 1RFNA 3RXJA 2ASUB 3ATLA 1GI3A 3ZVDA 1HAZB 1GBHA 2GV7A 4NG9H 4AX9H 4Y79A 1GGDC 2ANWA 2Y5HA 4Y8YA 1TMTH 1GHXH 2W3KA 4BTUB 1O30A 4TY7A 4FUGA 3ZV8A 4NWLA 1EB1H 1O3IA 4Y0ZE 1EZUC 1CGJE 1KXEA 4O3UA 3STIA 1YPMH 2BQ6B 1EJMA 1KTSB 3BG4C 1HLTH 5EOKA 1OXGA 2Y80A 2W7SA 1S5SA 1K1NA 3SI3H 4ASHA 2CJIA 3FP6E 1NFUA 2F9NA 2QY0B 3BTHE 4I8JA 1WQVH 3ZZ9A 1BRUP 2IJOB 3T2NA 1W0YH 1FQ3A 1V2TT 2FOEA 2I6SA 1CT0E 1C2KA 1TGBA 2J2UA 3TNTA 2VWLA 3SQHE 4OS1A 4YZUA 2BDBA 1NESE 2XC0A 3RU4E 1EB2A 1AI8H 3N7OA 2G8TA 3MU8A 1Z6EA 4UFDH 1Q3XA 1JIMA 1GMHF 3AAVA 3P8FA 3ZV9A 4ZXXH 3RXRA 1QR3E 3MH6A 1OWHA 1IQEA 2GDDA 1BJVA 2G5VA 1C1RA 2HALA 5A0AE 4R0IA 1W0ZU 3RMOH 2H9EH 4BXWA 3LU9B 1ARCA 1E38B 1PQ8A 1EAIA 2IOTA 3RUOA 3D23A 1BRBE 6CHAC 1CA0C 2A5AA 2A4QA 3NCLA 3Q76A 1BTZA 4JCNA 4JYTA 5AFZH 2TPIZ 4AZ2B 3OYPA 3A89A 4YM9A 2V3HH 2Z9GA 1GBAA 4GCHG 2R0LA 5JDUB 2QF3A 1FIZA 2ZU1A 1UCYK 2YOLA 1UJ1A 1Y5BT 1QL9A 4ABIA 4I33A 3UUZA 1KXDA 1W3CA 3PB1E 2QXJA 3BEFB 3E8LA 4PROA 1MZDA 1PPZA 3KL6A 3HGPA 4CH8B 2SGDE 1K22H 4CRAA 1ZSKA 1GJ6A 3O8BA 4D8NA 1H8IH 2RA3A 1LTOA 4FU8A 4WY3A 3TLOA 3LJJA 1OWEA 4ZHLU 1ZYOA 1P2MA 1C5ZB 2AMDA 4UE7H 4U01A 5C20A 1C4V2 1ZSLA 1FLEE 2ZCHP 3PLPA 4CRDA 1UVPA 2XWAA 1JMOH 1FZZA 1H4WA 4FUFA 4DGJA 3A87A 3GYLB 2HNTC 2AGEX 1GBTA 1GI5A 1BZXE 1MBQA 3OTJE 2PW8H 1DSTA 4MPWA 3TITA 1XUJA 5C5OA 3MU0A 1BOQA 3SUGA 2P8OC 1LVOA 4WMDA 3RXKA 2BQWB 1GWAA 3CP7A 3SU2A 2STBE 3TH3H 2BQ7B 1J17T 1GHYH 1IQHA 5BPEA 2C90B 3RXMA 3QZQA 1GVLA 1Y8TA 5LPRA 1AUJA 1LPKB 3E3TA 1TONA 4KTSA 5IDKA 1FPHH 4YT6H 1UK3A 3RXOA 1V2UT 1SFIA 2ZTYA 5FAHA 5EXMA 1C1TA 1VZQH 3QUMP 1WV7H 1NU9A 1O5EH 1DUAA 1K1OA 3SV8A 3FP8E 1HYLA 1CQQA 4UFEH 2P93A 2D1JA 1ELEE 2XWBI 2XNIA 2A4OA 4BAHB 3TIUA 4B2BA 2ZDKA 1Y59T 2XTTB 1GGDB 1XM1A 1C2LA 2PSYA 1GMDG 1LCYA 1BHXB 4KELA 2ZG0H 3RXHA 3FANA 4AYYB 1GBCA 2VU8E 4MNYA 4CR5A 1FY5A 1NT1A 2ZFTA 2SGAA 1PYTC 4DG4A 2WPIS 4WJG2 1AE8H 1YC0A 3E16B 2O8LA 3T26A 5A8YA 1UTNA 4UEHH 1D6RA 3U1IB 1GI0A 2ODQA 2FX6A 1VCQA 2NU0E 4DJZB 1XMNB 4Y71A 5LPFA 1TPSA 3ZZ5A 1JIRA 1C2GA 2J94A 1SI5H 4GHQA 5G4BA 1IOEA 1UTKA 4MNVA 3RP2A 1AVXA 3LGIA 1SHHB 5HGGA 1MTWA 2GX4A 5DJ7A 2EA3A 1BBRE 2FLRH 4X6OA 1ELGA 1O3LA 4MLFB 3EE0B 1SR5C 2VINA 1EPTC 3ODDA 5C1YA 2THFB 5F8XA 1MTNB 3GCHB 1UTMA 3D65E 4GHTA 1P2JA 3BTME 1QHRB 1P8VC 4CBOA 2BM2A 3PM3A 1PPGE 4B73A 2BDGA 1QJ6B 4WWYA 4DIIH 1ELDE 5T6GA 1W2KH 4RN6A 2BMGB 3NXPA 2ALPA 1O3DA 1KDQB 2AGIX 4NZLA 4X2YA 1P0SH 3TNSA 1EZQA 4JK5A 2JKHA 3UNRA 1CA0B 2VGCB 4HTCH 4TWWA 2V3OH 1INCA 8KME2 3HK6B 4XBCA 3VB5A 2GCHG 8LPRA 1D3PB 1T4UH 1NFXA 2WPLS 3BF6H 2P3UB 4NA9H 3BTDE 3TVJB 4X2XA 4OGYA 5T6FA 1VR1H 2BDHA 1Y3UA 4O3TA 4U32A 3LKWA 2BXUH 4Z6AH 1DS2E 3RU4D 2Z94A 2SGEE 1KSNA 4AB8A 3B9FH 4YESB 1JBUH 3KGPA 4X2WA 5JBAS 1AO5A 3SU3A 2FOAA 1TRYA 2J34A 4K2YA 2GZ9A 1G2MA 3ZZBA 4THNH 1UHBA 1S0RA 2B9LA 2BY7X 2A31A 1QGFA 1T8OA 5FPTA 2C4FH 4AFZA 2VB0A 1QRWA 2ZZUH 1F0TA 1LO6A 5LPEA 2Y82A 4YO9A 1GJAB 2FESH 1O2RA 2ZGXH 3U98H 1EAWA 2FDAA 2FO9A 1WSSH 1XUKA 5DP6A 2ANKH 2TRMA 4ZKSU 4ZAEA 1SGPE 3BEUA 1AN1E 1P2NA 2QC2A 4AFUA 2CN0H 2GGVB 1BDAA 5DKMA 3NZIA 1SVPA 1B7XB 3TJOA 7KMEH 4ZMAH 2FOMB 1PJPA 4HGCA 2ZA5A 3URDA 5I25A 2VIDA 1QB6A 2K1QA 3MNBA 3RXPA 4IW4E 1HAYB 2J4IA 2GKVE 1SFQB 2CGAA 1DE7H 1RIWB 3UQOA 1O2NA 4BOHA 4YOGA 1HAIH 5AVDA 4LOYH 1LMWB 1NC6A 2BLOA 2QCYA 1O2JA 4AGKA 1ETRH 1W13U 1BTYA 3DFJA 5FX6A 1ZTLA 9ESTA 1TBRH 1CO7E 1SGYE 2J92A 3BG4B 1HFDA 1ELVA 3EA7A 1TGNA 4CRFA 1W11U 1EQ9A 1NTPA 2AGGX 1D6WA 2PTCE 1C5XB 1WQSA 1AKSA 2HOBA 4X0WU 2AYWA 2WYGA 5AHGH 1NU7B 3D62A 3MO6A 2OD3B 5C3NA 2HLCA 1O32A 3H7TA 3ENSB 3F1SB 1F0RA 4MVNA 3SJKA 4Q7YA 2PKAA 4Y0YE 1BMAA 3RDZA 1E0FD 2A7HA 2O8TA 2BVXH 1JOUB 3PROA 2ZDVH 1W12U 2W3IA 1CGIE 4Q2KA 5EGMA 2ZFSA 1BCUH 4RKJB 4KGAA 1CGHA 4K1TA 3M3TA 2P3TB 2C8ZB 1JRSA 2ZDMA 3ATWA 1V2PT 3P8GA 2ZFFH 1CA8B 1FI8A 3I29A 1FXYA 1HAVA 1MCVA 1ELCA 1ELFA 1O5DH 2A45B 3SJ8A 3SV2H 4A1TA 1YM0A 4NFEA 2FYRA 1AUTC 2D8WA 2SGFE 2BY5X 3K6ZA 1K21H 2TGAA 1FV9A 1BBRK 1QA7A 4IS5A 3KQBA 3RXUA 4A92A 1C5VA 5DO4H 5C1XA 4OS4A 1C1SA 1TA2A 4CRBA 3WY8A 5EQRA 2B8OH 4ABJA 3GICB 3EA8A 1QQUA 2OC1A 4WVPE 2F83A 3O8RA 1CT2E 2EI7A 3V13A 4K60A 5EW1H 1Y5AT 2ODYB 3E1XB 2FOHA 3SORA 1D3TB 1IQMA 1F0SA 1BMMH 1V2KT 3SUDA 1IHSH 2ZGCA 2GT8A 1XUGA 2BDYA 3M37A 2ALVA 1PQ7A 1O2UA 2JETC 2UUYA 2A2XH 2BY6X 1C5LH 4KTCA 1TX6A 2R9PA 4WXVA 1O3CA 1N1LA 5DP3A 3M35A 4U2WA 1C1UH 2ODPA 1DWEH 2PTNA 1TBQH 1ZPCA 3SZNA 3FAOA 4GSOA 1MKXK 1Y3VA 3UREA 4K69A 2ZHWH 1AVWA 1O5AB 1DWDH 4B76A 2WPKS 1KXBA 1IAUA 1BT7A 1J16A 3LJOA 1S84A 2BHGA 2VWNA 3W94A 4Y7AA 1QL8A 5H4IB 1C9PA 4AGJA 3M5OA 4DURA 3AW1A 1NRNH 1NZQH 4E06H 1KDQA 1TX8A 3A84A 2RDLA 1ETSH 2ZPRA 1O2GH 1YPKH 3QX5H 2BY9X 1SQAA 1NN6A 1O36A 4Z0KA 4AN7A 2CXVA 2BX4A 4ZKOU 1MAYA 3VEQB 2ANMH 1ZMJA 2QF0A 4GPGA 5FX5A 4F49A 2OTVA 1K1JA 3T5FH 1DY9A 2WPMS 3SUFA 1TALA 3UR6A 2P95A 1MD7A 4DVAU 3MTYA 3M3SA 3LONA 1O2WA 1LQDB 2ULLA 5C5NA 1HJ9A 2BD3A 1C5SA 2BD4A 1IQKA 4ABGA 2UWPA 2F3CE 4NIWA 1O5BB 3SGBE 4IMQA 3ZZ7A 4RKOB 1LVMA 4UD9H 1FY1A 4JYVH 4AYVB 1BITA 4AORA 3R3GB 1ABIH 1SLUB 4X1QU 4IBLH 3O8CA 3LGUA 1TABE 2H9TH 4NA8A 1GHWH 1KXAA 3STJA 1Y3WA 4UDWH 5ABWA 3OY6U 4IN2A 1P9UA 3FZZA 2F9UA 1DITH 4FU7A 1FJSA 2OXSA 1SGEE 1QIXB 4CBNA 2XCNA 6LPRA 5F8TA 3HKIB 3TK5A 1AWFH 2ZQ2A 1ELTA 1Z71A 1CU1A 3SJ9A 1DANH 3LGVA 1EZXC 2PWXA 2ZWLH 1P11E 1PPFE 4FUHA 2Y6TA 6GCHF 2XYAA 1O2KA 2Z9KA 2QXHA 1EPTB 1IQJA 5HM2A 1OP8A 1MTNC 2XBVA 1C5QA 3ZZAA 3LPRA 1Z8JB 1H9IE 1MKWH 5FHTA 4Q7XA 2GCHF 2ZTZA 3MHWU 1C4Y2 4CR9A 1P04A 4E7RG 5JB9S 2ZFPH 1V3XA 1UK2A 3QZRA 3A83A 1TNHA 3RM2H 4H6SB 3QTVH 4YTAA 4YLQH 1WCZA 1DOJA 1DWBH 2ZPQA 9LPRA 2ZC9H 2BD5A 2NU1E 1C1WH 1BTXA 1ZPBA 5FPSA 3MYWA 2G4TA 2QXIA 4J1YA 3BTWE 2EI6A 1YYY1 5FBEA 2VVCA 1DDJA 5ESTE 3FVFB 1C2DA 6GCHG 2SGPE 1CVWH 2WPHS 3TGIE 3I78A 3ATKA 2ZEBA 4IGDA 2Z9LA 5DG6A 5EQQA 1YPJH 5JB8S 2OBQA 2BDCA 5C1UA 3KIDU 1AZZA 2XBWA 1WU1A 1BB0B 1K1LA 1V2LT 2ZO3H 2ILNA 1DWCH 1A46H 3QGNB 5FPYA 1O37A 3E90B 4O97A 2R0KA 1A3BH 3F6UH 2A4GA 1JXPA 1HV7A 4Y10E 1GMDF 1SGQE 1WAYB 3K9XB 4JZIA 3UIRA 1L2EA 2XW9A 2A0QB 5L2YH 2AEIH 2Y5GA 2A4RA 1O2YA 3CS7A 3HKJB 1IQNA 1HAHH 1KXFA 2QIQA 2FP7B 1ABJH 2XBXA 5GDSH 1HAVB 1G9IE 2C93B 2YNBA 4O03A 1L0ZA 1SOTA 1G37A 4ZROA 3A8BA 4ZHAA 3TH2H 3ZYEA 3BG8A 1BMNH 4BAMB 1XUFA 2FWWA 4AG1A 3JZ2B 1GI9B 5EPNA 2O8WA 3SU6A 3MH5A 2PGQB 3SHAH 1KLIH 3A7TA 1SL3A 1S81A 4JZ1A 1ETTH 2PGBB 5JPMH 3VB7A 1RIWC 1GI6A 1P05A 1FY4A 1O3NA 1DXPA 2UWOA 1AVGH 4JZDH 5AFYH 1SSXA 2H1UA 1SLXB 1LHCH 2FODA 3SV6A 1C5MD 4A1XA 3GY2A 2FOBA 1P2KA 1PQ5A 1FDPA 5A8XA 5TCAA 1V6DA 1RJXB 1SGRE 3L33A 1RTKA 1ZRKA 4AFQA 3PTBA 5LGOA 4F4OC 1A0HB 3U8TH 1V2ST 2VNTA 1QBOA 4RSPA 2F9OA 4ABBA 5DP4A 1AWHB 1T8MA 2A32A 1BA8B 5F03A 1O3KA 1V2RT 2TBSA 4NIVA 3Q00A 2Q6DA 2FTLE 1ZPZA 1B0FA 2Z6BD 1O2PA 2FM2A 1NFWA 5PTPA 1A61H 2RCEA 2ZKSA 4J2YB 3AAUA 2PLXA 3M36A 3OSYA 3LOXA 2XC5A 1BJUA 1SLVB 2EI8A 1OSSA 3M7QA 1DY8A 3ESTA 3GOVB 3TH4H 1AY6H 1ANCA 1SGTA 4A6LA 3MNSA 4WMEA 1XUIA 1F5LA 2EC9H 1HAPH 3VB4A 1LVBA 2HPPH 4FUJA 1SGNE 2AMPA 1ZGIA 1JRTA 2OUAA 1T8NA 1SGIB 3MMGA 1SOZA 2QV1A 4UONA 1KTTB 2RA0A 1GBDA 3DFLA 3UPEA 3P17H 2ZF0H 1OKXA 2ZHQH 1WBGB 3Q77A 4KTUA 3DT0H 3SV9A 1YCPK 3GY5A 2Z3CA 1V2MT 2F9PA 3ZZ3A 1C2EA 4ZXYH 1OYTH 1TRNA 1TYNA 3F9EA 3U8OH 2PHBA 4ZKNU 3T62A 4OS6A 4X1PU 1C5NH 4BTIB 5E2PA 1T31A 1T4VH 4Y8XA 3DD2H 5CE1A 3S9AA 1A7SA 4D9RA 1YLDA 2ZFRH 2VIPA 4K5ZA 3A7XA 1ORFA 1G3CA 2O8MA 4K8BA 2FX4A 1LVYA 4X6NA 2JETB 1ZZZA 1HNEE 1ZMNA 3KEEA 3G01A 3H7OA 3LC5A 2BXTH 2G52A 3SUEA 2GV6A 2AMQA 4KP0A 4H4FA 3S7KB 1QJ7B 1S82A 4XSKU 2VJ1A 1C4U2 3LDXH 1GCTC 2OINA 1GCDA 1QJ1B 1EATA 2CF8H 3ODFA 4I32A 3A7YA 1QTFA 1YBWA 4U30A 1MBMA 3MU4A 2VIQA 1GJBB 2Y7XA 5GCHG 1PFXC 3S7HB 1HCGA 3CS0A 4NGAH 4DY7B 3GCTF 1O2ZA 1TGTA 4ZH8A 1FPCH 2A5KA 2VWMA 4B71A 1TPOA 4X1SU 3VPKA 5GPIB 1O2IA 2DE8A 5A09A 2OCVB 1BBRH 1P2OA 1C2FA 4Y6DA 2PKSB 2AFQB 1TGSZ 3P95A 1SB1H 2PUQH 1JWTA 1ZHPA 2B0FA 3GISB 1BRAA 3SNCA 2BD7A 7LPRA 1ACBE 3KN2A 5J4QA 2LPRA 1OX1A 2CF9H 1Z1JA 5E0GA 2G4UA 4XOJA 1XUHA 1E35B 2BYAX 2ZDLA 2Q6FA 3RXGA 2BTCE 1GHVH 1P3CA 1TNKA 2BOKA 1H9HE 2GCTC 1W7GH 1C1QA 1HB0B 2FYQA 4E05H 1ZOMA 1OS8A 1AGJA 1MH0A 1DUEA 1LKAA 2YNAA 3Q3KA 4ZUHA 4BTTB 1EJAA 3JZ1B 1UVSH 1O3FA 2ZECA 4LXBH 3D49H 1PPEE 2W5EA 1TMBH 4X8SH 4ABFA 3DHKH 1NRPH 4TPYA 3A88A 2FZZA 3A80A 2J9NA 1L4DA 2ZGJA 2R2WU 2FOCA 5FCRA 1TX7A 5E8EH 2B5TB 3R0FA 4MPXA 3M5LA 4MG3A 1HDTH 1Q2WA 2QN5T 2XCFA 1YPGH 1ZHMA 1QQ4A 3V3MA 4H6TA 1QRXA 1TGCA 3SNEA 1NO9H 4UFGH 4UFFH 1S83A 3BTQE 3QLPH 2UUFB 2VVUA 1QURH 1SGFG 4FVBA 3U9AH 3MFJA 1Z8IB 2PUXB 1H9LB 3SN8A 2ZDAH 1ELAA 4X8VH 1KLTA 5EQSA 4BAOB 4FVDA 1P09A 3A8AA 3MWIU 1NRRH 2OP9A 1WTHD 3NUMA 1GJ5H 1QL7A 4DIHH 5EODA 2ZNKH 1XKBC 2A7CA 7ESTE 2DUCA 1E37B 1GJ4H 3PMJA 2D2DA 3KQCA 5CMXH 3UTUH 3TGKE 1ZTJA 1G2LA 2VIWA 1ZSJA 3RMLH 3SU4A 2NU3E 4Y11E 4B2CA 1HUTH 2CHAC 2GP9B 4DCDA 1O5GH 1GBEA 1LQEA 3NK8A 4GVUA 1YKTA 2XC4A 4ABEA 5AF9H 4BNRA 8GCHF 3RC6A 3M5NA 1P10A 4Y76A 4O9VA 5ESBA 2Q1JA 2UUJB 3K6YA 1DVAH 4R8TB 1N6YA 5T3HA 5FXLA 1AB9B 1RGQA 1QCPA 2BLWA 5GIBA 1ZLRA 1C9TA 1WOFA 2FI4E 4XE4A 1V2WT 3PMHB 3QN7A 1ZMLA 1IQLA 3TK6A 1UCYH 1AZ8A 3KNXA 1C5RA 2FLBH 3L6PA 1V2NT 1ID5H 2W7UA 3FFGA 3QDZB 3ATIA 1GVZA 2Z9IA 1GMCG 1BTHH 3V12A 2PFEA 4WXIA 1ARBA 3RXBA 3SQEE 3SU5A 3VB3A 1TLDA 1QY6A 2ZU2A 3BIVH 7GCHF 1QB9A 1FUJA 2FTMA 2V0BA 1QB1A 4MDSA 1H1BA 4GAWA 1CT4E 5DGJA 4I8LA
chains in the Genus database with same CATH superfamily
4FUCA 2NU2E 1GL0E 2GJGA 1GJ8B 3O8DA 2GZ8A 2HWLB 1GBJA 2TGDA 3F9FA 1Z7KA 2WV5A 2BD9A 1O2LA 1TAWA 3SJIA 2QF5A 2Z9JA 3QWCH 4A1VA 3RC5A 4B74A 2AS9A 1TNGA 3DCLA 4BANB 1DLEA 1GI1A 2ZHFH 3RXFA 1Z1IA 1NRSH 3MH4A 5TJXA 3T28A 3LH3A 1XKAC 4NFFA 4D7GA 1OP2A 2STAE 1VCPA 1W7XH 1K1IA 1WDIA 2Z3EA 5JBBS 4ABAA 1HIAB 2HNTF 1TBZH 1CHGA 4HZHA 4Z1MD 1Y5UT 2BVSH 2Q6GA 3BTTE 1FNIA 1GBKA 5FBIA 1O5CB 1LKBA 1C5PA 1A3EH 1GG6C 1MMJN 3AW0A 1G30B 3HK3B 4NZQA 2VBCA 1BRCE 3GY3A 3SU1A 1TOCB 5HMAA 1QFKH 1BTWA 1NBME 1YY3A 3GY6A 2GVFA 1NBMD 2VWOA 1DFPA 2NWNA 3BEIB 3ZZ8A 2J95A 3KYFA 1FAXA 2IJD1 4KKDA 1GBBA 3A82A 1K1PA 2H5DA 2GT7A 2C3SA 2KAIA 3MNXA 4HI3A 4ISHH 3GCNA 3RXQA 4FXGH 1BQYA 1XVMA 3A7VA 1IQGA 1MKXH 4TYDA 1G3EA 3KQDA 2TGTA 1AFQC 2G00A 4OM9A 3E6PH 4XBBA 1F2SE 4M7GA 2FIRH 5L6NH 5C2ZA 1C1PA 1CBWC 2BDAA 2D26C 3OFND 3ITIA 3NPSA 1UTOA 5CHAB 4YOJA 1FAKH 1A5HA 1GI4A 1Y3XA 2O9QA 3A86A 2C8XB 1YCPM 2WPJS 2BD2A 1SGCA 4ACBA 4DOQA 5A2MH 4X6PA 1UCYE 1O3GA 2SGQE 2A5IA 1MTVA 1RD3B 1MU8B 1VCWA 1GL1A 5EJLA 1ESBA 1YCPH 2BOHB 1E34B 1GI2A 3E91A 1C1MA 2KM0A 1G32B 3P92A 4K8YA 1YP9A 1O3HA 3UOUA 3LGYA 1IQFA 1PPHE 3MH7A 1TOMH 3H5CB 3ZZ4A 1V2VT 3RXCA 1EFRD 3SV7A 2VVVA 1UO6A 3EQ0H 4Y8ZA 1B5GH 5B6OA 4NIYA 4I8KA 1MTSA 3GCTG 5F8ZA 4MNWA 4GUXA 2CV3A 5JBTA 1O5FH 2Y7ZA 2JJ2D 1O34A 4FUDA 3PYHA 2GD4B 1TPPA 1KLJH 2W26A 4ZHMU 1L4ZA 2CHAB 3PWCA 3UWIA 3LIWA 2FOFA 1IQIA 2ZHEH 3HPTB 1DM4B 2FXRA 2HRVA 1S6HA 3FZDA 3PV4A 2QAAA 1RTLA 1L1JA 1EPTA 2M5TA 4X8UH 2Z3DA 4XBDA 1J8AA 1X7AC 4INHA 2SFAA 4QT8C 1TNLA 1UTLM 1G36A 4Y7BA 4NSVA 1HAOH 1CE5A 5GJ4B 5DP7A 3VXFH 1ZTKA 1GCTB 1HJAC 1YGCH 5EU8A 2PKAB 1GHAG 3BTKE 1UMAH 4I8GA 5EW2H 4B6FA 5LH8A 1HIAA 2F4LA 3OX7U 1AFEH 2GTBA 4K1SA 2Y5FA 3GYMA 1DXWA 1B0EA 1U6QA 3PO1B 1HPGA 1C5TA 1NRQH 4INKA 5DP8A 2A7JA 1P2IA 1TRMA 2JH6D 3ZVAA 3L3TA 2ZU3A 1EAUA 2G5NA 1C5OH 1TWXB 3TJVA 3ZVCA 2F9VA 4ISOA 1SQOA 4I8HA 1F92A 1VITF 2B7DH 2WINI 2KCPA 5E2OA 1GBFA 1GHZA 1S0QA 3UFAA 2PKSC 1P57B 3M5MA 1A2CH 5L2ZH 2O8UA 3EGKH 4Q80A 1HJ8A 7GCHG 4B6EA 3BV9B 2P16A 1O3MA 3QTOH 2GCTB 1NM6A 3UNSA 1MKWK 1F5RA 2A1DB 1EX3A 2ZU5A 3RXAA 5T6DA 2A2QH 4RT1A 4WF8A 4LZ4B 1UVTH 1UHBB 4X8TH 1EP5A 1EZSC 1GI7B 1MABB 2TIOA 3F2HA 1GG6B 4CRGA 2WV9A 2WUBA 3OU0A 4WMFA 1E36B 2OC7A 1O2QA 1O3BA 1VKYA 2WHXA 2LP6A 3IG6B 1GDUA 3SI4H 3EA9A 3URCA 1N8OC 2VH0A 1TNIA 1MCTA 1YLCA 4H42U 3IWMA 4JZEH 1C5UA 2IN2A 4FUBA 1C1VH 1EASA 3U28C 3KF2A 1A0LA 1OPHB 2PV9B 4A5TS 5EXNA 3F68H 3PLBA 2BVRH 3QO6A 3RU4T 1C2IA 1S6FA 1S85A 1UVUH 2C8YB 1GDQA 2LNCA 3RC4A 2Z7FE 1T32A 2FPZA 1W8BH 5CDFE 3BIUH 3FP7E 4YLUA 3SHCH 4AOQA 4YOIA 3RXLA 2ZP0H 2R3UA 2UUKB 1NFYA 4AB9A 4ACAA 1C2MA 5CHAC 1BTUA 1CHOG 2FI5E 1K28D 1AU8A 4CHAB 3HGNA 3RMNH 4BAKB 4NIXA 3ATMA 5EJ1A 3UNQA 2TGPZ 1M9UA 1GMHG 1ZHRA 3VXEH 1EJNA 2VIOA 4ABDA 5EIYA 1AD8H 3SNBA 3S9CA 1FN6A 1D9IA 3Q3XA 1MQ6A 1PYTD 2UWLA 2QE7D 4VGCC 1EUFA 1L1GA 1YPEH 3SYJA 2OLGA 2ZPSA 1LDTT 2WUCA 1IHTH 1DPOA 3NKKA 1E79D 5DP9A 4TPIZ 1HAXB 4TT3D 3SNAA 1BMFD 1KY9A 1LPGB 2V35A 3GDSA 1ZRBA 2BZ6H 5TCCA 1SC8U 1UTPA 2HGTH 5GCHF 1AB9C 4NSYA 1A0JA 4FUEA 1CHOF 1NS3A 3RXVA 1KYNA 1GMCF 1L1NA 1UW7A 4IC6A 1MD8A 3SU0A 5GXPA 1SG8B 3W95A 3ELAH 3UAIC 1LHDH 3K65B 4JK6A 4ZKRU 2AERH 3P8OA 3A8DA 4XDEA 3MO3A 2QYIA 1SGDE 3UOPA 1P3EA 4X6MA 3UY9A 1MZAA 1EXFA 5JBCS 1T7CA 1OYQA 1UTJA 4K3JA 3DSGA 4K1EA 1AQ7A 4TWYA 1SKYE 1HJAB 1NPMA 1K9OE 4F55A 1W10U 3A7WA 3MO9A 3SW2B 4ESTE 1VJ9U 1SBWA 1GI8B 1P12E 1RTFB 1OWKA 1Q31A 3BTEE 5E0HA 2RG3A 1O35A 1DICA 1AKSB 3PO1C 1RXPA 5A8ZA 1N6XA 2ZHDA 1KXCA 4A7IB 4DT7B 1WUNH 3E0NB 2ZFQH 1BHXF 3EAJA 3M61U 3GY4A 3KQEA 4FU9A 3PTNA 2XXLA 2GZ7A 1TE0A 2H5CA 4WH8A 3ZYDA 2BLQA 2CK3D 3C27B 1QBVH 2BD8A 3SNDA 4D9QA 3S69A 3F9HA 1C2HA 1TMUH 3TU7H 2JH5D 3TPIZ 1MQ5A 1OWDA 2OBOA 3TK9A 3KCGH 1Z8RA 1F7ZA 1V2JT 3HATH 3OTPA 5EPYA 5K0HA 1LHEH 1MUEB 1GVKB 1FONA 5EXLA 1P2QA 3SGAE 2KX4A 1P03A 1XXDA 3P70B 1VITG 1SQTA 2BDIA 1CSOE 2V3MA 1ZGVA 1F5KU 3MU5A 1YPLH 2OQ5A 1BMLA 4BXSA 1H8DH 1NROH 3GY8A 1EP6A 2F91A 4TY6A 1GJCB 1PQAA 3K2UA 5HXFA 2ESTE 1O2HA 1O33A 3PLKA 2FS9A 4ISLA 3OY5U 1TNJA 3DSOA 1AFQB 3ZZDA 1N8OB 2KR7A 2BB4A 1GBLA 1LPZB 4OGXA 5L30H 1G3BA 3M3VA 1FMGA 1SLWB 4LZ1H 1O2XA 1CBWB 2XRCA 5GWZA 3RLWH 3I77A 1SHYA 1DT2A 1ZJDA 1V2QT 1WTGH 2I6QA 1T8LA 5HYOA 1OP0A 1BIOA 3RXDA 3DA9B 1QNJA 1RRKA 1UK4A 3ZVFA 1GPZA 1C2JA 2BY8X 4MPVA 2HNTE 1SGFA 4DW2U 3QGJA 2ZDNA 6CHAB 4X1RU 3RLYH 1O38A 8GCHG 1W0KD 4AFSA 4X1NU 2ZGBH 3ZZCA 2F9BH 4ISIH 1Z8GA 1MAXA 2GMTC 2SNWA 1O3AA 4B75A 3UR9A 2G81E 2KCYA 4MQAA 3GDUA 4SGAE 4IN1A 3MNCA 1PPCE 4IMZA 1QRZA 1VGCB 3VGCC 3BN9A 3VFEA 2QGRA 4YT7H 1O2MA 4F48B 1GBIA 2P3FH 4E7NA 2ZGHA 1HGTH 1DLKB 3RXEA 4VGCB 3PV5A 1TQ0B 3EDXB 4ISNA 1AE5A 1C1OA 2WZQA 3T27A 3C1KA 2G55A 3FN8A 4X2VA 2AH4X 3A81A 1K2I1 2HPQH 1SQRA 1GJ7B 3QK1A 3KHVA 1AMHA 2ZCLP 4Q7ZA 2WV4A 4D7FA 1ZR0A 1QA0A 3RXIA 5E0JA 3PV2A 1O2SA 2H9HA 2IPHA 3NWUA 2WYJA 3LH1A 3MU1A 2VIVA 3MI4A 1AIXH 1GBMA 2FS8A 2P59A 2P8OB 3LT3A 2BLVA 2H6MA 1A5GH 2G51A 3PMAB 1YPHC 1VITH 1Z6JH 2EEKA 4CH2B 1Y3YA 2FI3E 2PSXA 5IYTA 2QF4A 1BTPA 4OS5A 3AASA 4RT0A 3E0PB 1J15A 3A85A 3M7TA 3VB6A 3SO3A 3SOSA 2HVXA 2KAIB 4I31A 2JH0D 3LC3A 1DX5M 2DE9A 3TGJE 1SPJA 3RM0H 3ZVGA 3T25A 2OC8A 2XBYA 3GDVA 2H2ZA 1WYKA 3FOAA 1BUIA 5A0CA 1A5IA 1TA6A 5JYIA 3A7ZA 1D3QB 2SNVA 3S0NA 1OOKB 5ETXA 1WXRA 1RS0A 2QXGA 3PWBA 1SMFE 3H09A 1YPHE 2VH6A 5EG4A 1XXFA 1ANBA 3Q3YA 1GJ9B 1QBNA 2AIPA 1PPBH 1A4WH 4B2AA 3M7UA 2J38A 3F9GA 2OC0A 1ANDA 1KIGH 1THSH 1EOJA 2P94A 3U69H 1ESTA 5FCKA 3ZVBA 1LHGH 1EOLA 1O0DH 1GJDB 4WH6A 1THPB 2GDEH 3VG8A 3P6ZB 3LGWA 1C5YB 2V6NA 3DUXH 3UWJH 5A0BA 2OQUA 3GY7A 2ZCKP 4LK4A 1HXEH 2ZI2H 1TQ7B 3B23B 1FN8A 1HAGE 2CMYA 1D3DB 5GNDA 3SBKA 3B8JA 5F6MA 5SGAE 1EKBB 3S9BA 1UTQA 4NCYA 4CREA 3BSQA 2KZ4A 5DP5A 5BRRE 1HRTH 1ANEA 1ELBA 1EAXA 3N99A 1O3PB 1GDNA 4I7YH 4GCHF 4SGBE 6ESTA 1O2VA 1UVOA 1C5WB 4ABHA 3TJNA 2FEQH 3LGTA 1MU6B 1K0HA 1J9CH 3GCHC 1VJAU 2R2MB 1HBTH 4JZFH 2ZQ1A 1K1MA 4MPUA 5DPAA 1GHAF 4HFPB 1O31A 2NU4E 1O3EA 4GLYA 4CHAC 3U1JB 4AG2A 2AIQA 3P8NA 3PMBB 1YF4A 2Y81A 1O3JA 1TPAE 4MTBA 2VGCC 3RMMH 1V2OT 2ZU4A 1AHTH 2PR3A 4CRCA 4MNXA 1NY22 2C8WB 1P01A 4NA7A 1C1NA 2GMTB 5J4SA 3U8RH 1O2TA 4FUIA 4NWKA 2FOGA 1O3OA 4INLA 2FMJA 3GCOA 2HLDD 4BAQB 3T29A 5DK1A 3AVZA 3F0PA 1VGCC 3VGCB 3ZVEA 2QA9E 2BX3A 1HXFH 4IC5A 1W14U 1FY3A 3V0XA 4D76A 5DN6D 5I46H 2YMSB 8ESTE 1GHBF 1J14A 2ANYA 4OS7A 1ZJKA 3EYDA 3SGQE 3TJUA 3MQKC 3UQVA 1P9SA 3CENA 1MTUA 1A1RA 3FKSD 3BTGE 3ZZ6A 3RXSA 3RXTA 4XFQA 1THRH 2EY4C 1O2OA 3SJOA 1XX9A 1DSUA 1O39A 1OWJA 1P06A 1OWIA 5K7RA 4JYUH 1D4PB 2ZTXA 3BTFE 1G3DA 2JIZD 2R3YA 1FY8E 3ZIAD 1P02A 1TIOA 1XVOA 5C67A 5HM9A 4JMYA 4OS2A 1FIWA 1TB6H 3IITA 2ZIQH 5CHBA 2V7QD 4B1TA 1ESAA 1TFXA 3V7TA 2BZAA 1F0UA 1LHFH 3A8CA 3WWBA 3MOCA 1GHBG 1RFNA 3RXJA 4P00A 2ASUB 3ATLA 1GI3A 3ZVDA 1HAZB 1GBHA 2GV7A 4NG9H 4AX9H 4Y79A 1GGDC 2ANWA 2Y5HA 4Y8YA 1TMTH 1GHXH 2W3KA 4BTUB 1O30A 4TY7A 4FUGA 3ZV8A 4NWLA 1EB1H 1O3IA 4Y0ZE 1EZUC 1CGJE 3GS9A 1KXEA 4O3UA 3STIA 1YPMH 2BQ6B 1EJMA 4M9FA 1KTSB 3BG4C 1HLTH 5EOKA 1OXGA 2Y80A 2W7SA 1S5SA 1K1NA 3SI3H 4ASHA 2CJIA 3FP6E 1NFUA 2F9NA 2QY0B 3BTHE 4I8JA 1WQVH 3ZZ9A 1BRUP 2IJOB 5DSFA 3T2NA 1W0YH 1FQ3A 1V2TT 2K0QA 2FOEA 2I6SA 1CT0E 1C2KA 1TGBA 2J5UA 2J2UA 5HIZA 3TNTA 2VWLA 3SQHE 4OS1A 4YZUA 2BDBA 1NESE 2XC0A 3RU4E 1EB2A 1AI8H 3DSPA 3N7OA 2G8TA 3MU8A 1Z6EA 4UFDH 1Q3XA 1JIMA 1GMHF 3AAVA 3P8FA 3ZV9A 4ZXXH 3RXRA 1QR3E 3MH6A 1OWHA 1IQEA 2GDDA 1BJVA 2G5VA 1C1RA 2HALA 5A0AE 4R0IA 1W0ZU 3RMOH 2H9EH 4BXWA 3LU9B 5F53A 1ARCA 1E38B 1PQ8A 2KFWA 2AHME 1EAIA 2IOTA 3RUOA 3D23A 1BRBE 6CHAC 1CA0C 2A5AA 2A4QA 2M2AA 3NCLA 3Q76A 1BTZA 4JCNA 4JYTA 5AFZH 2TPIZ 4AZ2B 3OYPA 3A89A 4YM9A 2V3HH 2Z9GA 1GBAA 4FOUC 4GCHG 2R0LA 3OE7D 5JDUB 2QF3A 1FIZA 2ZU1A 1UCYK 2YOLA 1UJ1A 1Y5BT 1QL9A 4ABIA 4I33A 3UUZA 1KXDA 1W3CA 3PB1E 2QXJA 2RFKC 3BEFB 3E8LA 4PROA 1MZDA 1PPZA 3KL6A 3HGPA 4CH8B 2SGDE 1K22H 2K8IA 4CRAA 1ZSKA 1GJ6A 3O8BA 4D8NA 1H8IH 2RA3A 1LTOA 4FU8A 4WY3A 3TLOA 3LJJA 1OWEA 4ZHLU 1ZYOA 1P2MA 1C5ZB 2AMDA 4UE7H 4U01A 5C20A 1C4V2 1ZSLA 1FLEE 2ZCHP 3PLPA 4CRDA 1UVPA 2XWAA 1JMOH 1FZZA 1H4WA 4FUFA 4DGJA 3A87A 3GYLB 2HNTC 2AGEX 1GBTA 1GI5A 1BZXE 1MBQA 3OTJE 2PW8H 1DSTA 4MPWA 3TITA 1XUJA 5C5OA 3MU0A 1BOQA 3SUGA 2P8OC 1LVOA 4WMDA 3RXKA 2BQWB 1GWAA 3CP7A 2J98A 3SU2A 2STBE 3TH3H 2BQ7B 1J17T 1GHYH 1IQHA 5BPEA 2C90B 4Q4LA 3RXMA 3QZQA 1GVLA 1Y8TA 5LPRA 1AUJA 1LPKB 3E3TA 3WW7A 1TONA 4KTSA 5IDKA 1FPHH 5C0TA 4YT6H 1UK3A 2WPDD 3RXOA 1V2UT 1SFIA 2ZTYA 5FAHA 5EXMA 1C1TA 1VZQH 3QUMP 1WV7H 1NU9A 1O5EH 1DUAA 1K1OA 3SV8A 3FP8E 1HYLA 1CQQA 4UFEH 2P93A 2D1JA 1ELEE 2XWBI 2XNIA 2A4OA 4BAHB 3TIUA 4B2BA 2ZDKA 1Y59T 2XTTB 1GGDB 1XM1A 1C2LA 2PSYA 1GMDG 1LCYA 1BHXB 4KELA 2ZG0H 3RXHA 3FANA 4AYYB 1GBCA 2VU8E 4MNYA 4CR5A 1FY5A 1NT1A 2ZFTA 2SGAA 1PYTC 2KCAA 4DG4A 2WPIS 4WJG2 1AE8H 1YC0A 3E16B 2O8LA 3T26A 5C17A 5A8YA 1UTNA 4UEHH 1D6RA 3U1IB 1GI0A 2ODQA 2FX6A 1VCQA 2NU0E 4DJZB 1XMNB 4Y71A 5LPFA 2J97A 1TPSA 3ZZ5A 1JIRA 1C2GA 2J94A 1SI5H 4GHQA 5G4BA 1IOEA 1UTKA 4MNVA 3RP2A 1AVXA 3LGIA 1SHHB 5HGGA 1MTWA 2GX4A 5DJ7A 2EA3A 2FLRH 1BBRE 4X6OA 1ELGA 1O3LA 4MLFB 3EE0B 1SR5C 2VINA 1EPTC 3ODDA 2RDEA 4P02A 5C1YA 2THFB 5F8XA 1MTNB 3GCHB 1UTMA 3D65E 4GHTA 2LELA 1P2JA 3BTME 1QHRB 1P8VC 4CBOA 2BM2A 3PM3A 1PPGE 4B73A 2BDGA 1QJ6B 4WWYA 4DIIH 1ELDE 5T6GA 1W2KH 4RN6A 2BMGB 3NXPA 2ALPA 1O3DA 1KDQB 2AGIX 4NZLA 4X2YA 1P0SH 3TNSA 1EZQA 4JK5A 2JKHA 3UNRA 1CA0B 2VGCB 4HTCH 4TWWA 5HKKD 2V3OH 1INCA 3F2GA 8KME2 3HK6B 4XBCA 3VB5A 2GCHG 8LPRA 1D3PB 1T4UH 1NFXA 2WPLS 3BF6H 2P3UB 4NA9H 3BTDE 3TVJB 4X2XA 4OGYA 5T6FA 1VR1H 2BDHA 1Y3UA 4O3TA 4U32A 3LKWA 2BXUH 4Z6AH 1DS2E 3RU4D 2Z94A 2SGEE 1KSNA 4AB8A 3B9FH 4YESB 1JBUH 3KGPA 4X2WA 5JBAS 1AO5A 3SU3A 2FOAA 1TRYA 2J34A 2YMSC 2GZ9A 4K2YA 1G2MA 3ZZBA 4THNH 1UHBA 1S0RA 2B9LA 2BY7X 2A31A 1QGFA 1T8OA 5FPTA 2C4FH 4AFZA 2VB0A 1QRWA 2ZZUH 1F0TA 1LO6A 5LPEA 2Y82A 4YO9A 1GJAB 2FESH 1O2RA 2ZGXH 3NRLA 1EAWA 2FDAA 2FO9A 3U98H 1OHHD 1WSSH 1XUKA 5DP6A 2ANKH 2TRMA 4ZKSU 2L74A 4ZAEA 1SGPE 3BEUA 2HVYB 1AN1E 1P2NA 2QC2A 4AFUA 2CN0H 2GGVB 1BDAA 5DKMA 3NZIA 1SVPA 1B7XB 3TJOA 7KMEH 4ZMAH 2FOMB 5B6LA 1PJPA 4HGCA 2ZA5A 3URDA 5I25A 2VIDA 1QB6A 2K1QA 3MNBA 3RXPA 4IW4E 1HAYB 2J4IA 1KMHB 1SFQB 2GKVE 2CGAA 1DE7H 1RIWB 3UQOA 1O2NA 4BOHA 4YOGA 1HAIH 5AVDA 4LOYH 1LMWB 1NC6A 2BLOA 2QCYA 1O2JA 4AGKA 1ETRH 1W13U 1BTYA 3DFJA 5FX6A 1ZTLA 9ESTA 1TBRH 1CO7E 1SGYE 2J92A 1FX0B 3BG4B 1HFDA 1ELVA 3EA7A 1TGNA 4CRFA 1W11U 1EQ9A 1NTPA 2AGGX 1D6WA 2PTCE 1C5XB 1WQSA 1AKSA 2HOBA 4X0WU 2AYWA 2WYGA 5AHGH 1NU7B 3D62A 3MO6A 2OD3B 5C3NA 2HLCA 1O32A 3H7TA 3ENSB 3F1SB 1F0RA 4MVNA 4DT4A 3SJKA 4Q7YA 2PKAA 4Y0YE 5C0UA 1BMAA 3RDZA 1E0FD 2A7HA 2O8TA 2BVXH 1JOUB 3PROA 2ZDVH 1W12U 2W3IA 1CGIE 3CNRA 4Q2KA 5EGMA 2ZFSA 1BCUH 4RKJB 4KGAA 1CGHA 4K1TA 3M3TA 2P3TB 2C8ZB 1JRSA 2ZDMA 3ATWA 1V2PT 3P8GA 5HIYA 2ZFFH 1CA8B 1FI8A 3I29A 1FXYA 1HAVA 1MCVA 3OAAD 1ELCA 1ELFA 1O5DH 2A45B 3SJ8A 3SV2H 4A1TA 1YM0A 4NFEA 2FYRA 1AUTC 2D8WA 2SGFE 2BY5X 3K6ZA 1K21H 2TGAA 1FV9A 1BBRK 1QA7A 4IS5A 3KQBA 3RXUA 4A92A 1C5VA 5DO4H 5C1XA 4OS4A 1C1SA 1TA2A 4CRBA 3WY8A 5EQRA 2B8OH 4ABJA 3GICB 3EA8A 1QQUA 2OC1A 4WVPE 2F83A 3O8RA 1CT2E 2EI7A 3V13A 4K60A 2YMSD 5EW1H 1Y5AT 2ODYB 3E1XB 2FOHA 3SORA 1D3TB 1IQMA 1F0SA 1BMMH 1V2KT 3SUDA 1IHSH 2ZGCA 2GT8A 1XUGA 2BDYA 3M37A 2ALVA 1PQ7A 1O2UA 2JETC 2UUYA 2A2XH 2BY6X 1C5LH 2PP6A 4KTCA 1TX6A 2R9PA 4WXVA 1O3CA 1N1LA 5DP3A 3M35A 4U2WA 1C1UH 2ODPA 1DWEH 2PTNA 1TBQH 1ZPCA 3SZNA 3FAOA 4GSOA 1MKXK 1Y3VA 3UREA 4K69A 2ZHWH 1AVWA 1O5AB 4AC9A 1DWDH 4B76A 2WPKS 1KXBA 1IAUA 1BT7A 1J16A 3LJOA 1S84A 2BHGA 2VWNA 3W94A 4Y7AA 1QL8A 5H4IB 1C9PA 4AGJA 3M5OA 4DURA 3AW1A 1NRNH 1NZQH 4E06H 1KDQA 1TX8A 3A84A 2RDLA 1ETSH 2ZPRA 1O2GH 1YPKH 3QX5H 2BY9X 1SQAA 1NN6A 1O36A 4Z0KA 4AN7A 2CXVA 2BX4A 4ZKOU 1MAYA 3VEQB 2ANMH 1ZMJA 2QF0A 4GPGA 5FX5A 4F49A 2OTVA 1K1JA 3T5FH 1DY9A 2WPMS 3SUFA 1TALA 3UR6A 2P95A 1MD7A 4DVAU 3MTYA 3M3SA 1QZ8A 3EE7A 3LONA 1O2WA 3PRDA 1LQDB 2ULLA 5C5NA 1HJ9A 2BD3A 1C5SA 2BD4A 1IQKA 4HG6A 4ABGA 2UWPA 2F3CE 4NIWA 1W0JD 1O5BB 3SGBE 4IMQA 3ZZ7A 4RKOB 1LVMA 4UD9H 1FY1A 4JYVH 4AYVB 1BITA 4AORA 3R3GB 1ABIH 1SLUB 4X1QU 4IBLH 3O8CA 3LGUA 1TABE 2H9TH 4NA8A 1GHWH 1KXAA 3STJA 1Y3WA 4UDWH 5ABWA 3OY6U 4IN2A 1P9UA 3FZZA 2F9UA 3OEED 1DITH 4FU7A 3F0OA 1FJSA 2OXSA 1SGEE 1QIXB 4CBNA 2XCNA 6LPRA 5F8TA 3HKIB 3TK5A 1AWFH 2IPQX 2ZQ2A 1ELTA 1Z71A 1CU1A 4I86A 3SJ9A 1DANH 3LGVA 1EZXC 2PWXA 2W6ID 1COWD 1P11E 2ZWLH 1PPFE 4FUHA 2Y6TA 2WSSD 6GCHF 2XYAA 1O2KA 2Z9KA 2QXHA 1EPTB 1IQJA 5HM2A 1OP8A 1MTNC 1C5QA 2XBVA 3ZZAA 3LPRA 1Z8JB 1H9IE 1MKWH 5FHTA 4Q7XA 2GCHF 2ZTZA 3MHWU 1C4Y2 4CR9A 1P04A 4E7RG 5JB9S 2ZFPH 1V3XA 1UK2A 3QZRA 3A83A 1TNHA 3RM2H 4H6SB 3QTVH 4YTAA 4YLQH 1WCZA 1DOJA 1DWBH 2ZPQA 9LPRA 2ZC9H 2BD5A 2NU1E 1C1WH 1BTXA 1ZPBA 5FPSA 3MYWA 2G4TA 2QXIA 2JJ1D 4J1YA 3BTWE 2EI6A 1YYY1 5FBEA 2VVCA 1DDJA 5C94A 5ESTE 3FVFB 1C2DA 6GCHG 2SGPE 1CVWH 2WPHS 3TGIE 3I78A 3ATKA 2ZEBA 1H8HD 2Z9LA 4IGDA 5DG6A 5EQQA 1YPJH 5JB8S 2OBQA 2BDCA 5C1UA 3KIDU 1AZZA 2XBWA 1WU1A 1BB0B 1K1LA 1V2LT 2ZO3H 2ILNA 1DWCH 1A46H 3QGNB 5FPYA 1O37A 3E90B 4O97A 2R0KA 1A3BH 3F6UH 2A4GA 1JXPA 1HV7A 4Y10E 1GMDF 1SGQE 1WAYB 3K9XB 4JZIA 3UIRA 1L2EA 2XW9A 2A0QB 5L2YH 2AEIH 2Y5GA 2A4RA 1O2YA 3CS7A 3HKJB 1IQNA 1HAHH 1KXFA 2QIQA 2FP7B 1ABJH 2XBXA 5GDSH 1HAVB 1G9IE 2C93B 2YNBA 4O03A 1E1RD 1L0ZA 1SOTA 1G37A 4ZROA 3A8BA 4ZHAA 3TH2H 3ZYEA 3BG8A 1BMNH 4BAMB 1XUFA 2FWWA 4AG1A 1H8ED 1GI9B 3JZ2B 5EPNA 4FETA 2O8WA 3SU6A 3MH5A 5IK2D 2PGQB 3SHAH 1KLIH 3A7TA 1SL3A 1S81A 3KYGA 4JZ1A 1ETTH 2PGBB 5JPMH 3VB7A 1RIWC 3F3BA 1GI6A 1P05A 1FY4A 1O3NA 1DXPA 2UWOA 1AVGH 4TSFD 4JZDH 5AFYH 1SSXA 2H1UA 1SLXB 1LHCH 2FODA 3SV6A 1C5MD 4A1XA 3GY2A 2FOBA 1P2KA 1PQ5A 1FDPA 5A8XA 5TCAA 2KCOA 1RJXB 1V6DA 4ASUD 1SGRE 3L33A 1RTKA 1ZRKA 4AFQA 2J98B 3PTBA 4F4OC 5LGOA 1A0HB 3U8TH 1V2ST 2VNTA 4XRNA 1QBOA 4Q63A 4RSPA 2F9OA 4ABBA 5DP4A 1AWHB 1T8MA 2A32A 2OK5A 1BA8B 4XD7D 5F03A 1O3KA 1V2RT 2TBSA 4NIVA 3Q00A 2Q6DA 2FTLE 1ZPZA 1B0FA 2Z6BD 1O2PA 2FM2A 1NFWA 5PTPA 1A61H 2RCEA 2ZKSA 4J2YB 3AAUA 2PLXA 3M36A 3OSYA 3LOXA 2XC5A 3N7EA 1BJUA 1SLVB 2EI8A 1OSSA 3M7QA 1DY8A 3ESTA 3GOVB 3TH4H 1AY6H 1ANCA 1SGTA 4A6LA 3MNSA 4WMEA 1XUIA 1F5LA 2EC9H 1HAPH 3VB4A 1LVBA 2HPPH 4FUJA 1SGNE 2AMPA 1ZGIA 1JRTA 2OUAA 1T8NA 1SGIB 3MMGA 1SOZA 2QV1A 4UONA 1KTTB 2RA0A 4YXWD 1GBDA 3DFLA 3UPEA 3P17H 1YLNA 2ZF0H 1OKXA 2ZHQH 1WBGB 3Q77A 4KTUA 3DT0H 3SV9A 2F43B 1YCPK 3GY5A 2Z3CA 1V2MT 2F9PA 3ZZ3A 1C2EA 4ZXYH 1OYTH 1TRNA 1TYNA 3F9EA 3U8OH 2PHBA 4ZKNU 3T62A 4OS6A 4X1PU 1C5NH 2EQNA 4BTIB 5E2PA 1T31A 1T4VH 4Y8XA 3DD2H 5CE1A 3S9AA 1A7SA 4D9RA 1YLDA 2ZFRH 2VIPA 4K5ZA 3A7XA 1ORFA 1G3CA 2O8MA 2W6JD 3KQ5A 4K8BA 2FX4A 5KGOA 1LVYA 4X6NA 2JETB 1ZZZA 1HNEE 1ZMNA 3KEEA 2XOKD 3G01A 3H7OA 3LC5A 2BXTH 2G52A 3SUEA 2GV6A 2AMQA 4KP0A 4H4FA 3S7KB 1QJ7B 1S82A 4XSKU 2VJ1A 1C4U2 3LDXH 1GCTC 3AK5A 2OINA 1GCDA 1QJ1B 1EATA 2XNDD 2CF8H 3ODFA 4I32A 3A7YA 1QTFA 1YBWA 1S6LA 4U30A 1MBMA 3MU4A 2VIQA 1YWUA 1GJBB 2Y7XA 5GCHG 1E1QD 1PFXC 3S7HB 1HCGA 3CS0A 4NGAH 4DY7B 3GCTF 1O2ZA 1TGTA 4ZH8A 1FPCH 4ZCNA 2A5KA 2VWMA 3PRBA 4B71A 1TPOA 4RI0A 4X1SU 3VPKA 5GPIB 1O2IA 2DE8A 5A09A 2OCVB 1BBRH 1P2OA 1C2FA 4Y6DA 2PKSB 2AFQB 3UB0A 1TGSZ 5KECA 3P95A 1SB1H 2PUQH 1JWTA 1ZHPA 2B0FA 3GISB 1BRAA 3SNCA 2BD7A 7LPRA 1ACBE 5FL7D 3KN2A 5J4QA 2LPRA 1OX1A 2CF9H 1Z1JA 5E0GA 2G4UA 4XOJA 1XUHA 1E35B 2BYAX 2ZDLA 2Q6FA 3RXGA 2BTCE 3FO8D 1GHVH 1P3CA 1TNKA 2BOKA 1H9HE 2GCTC 1W7GH 1C1QA 1HB0B 2FYQA 4E05H 1ZOMA 1OS8A 1AGJA 1MH0A 1DUEA 1LKAA 2YNAA 3N7DA 3Q3KA 4ZUHA 4BTTB 1EJAA 3JZ1B 1UVSH 1O3FA 2ZECA 4LXBH 3D49H 1PPEE 2W5EA 1TMBH 4X8SH 5T1VA 4ABFA 3DHKH 1NRPH 4TPYA 3A88A 2FZZA 3A80A 2J9NA 5EJZA 1L4DA 2JDID 2ZGJA 2R2WU 2FOCA 5FCRA 1TX7A 5E8EH 2B5TB 3R0FA 4MPXA 3M5LA 4MG3A 1HDTH 1Q2WA 2QN5T 2XCFA 1YPGH 1ZHMA 1QQ4A 3V3MA 4H6TA 1QRXA 1TGCA 3SNEA 1NO9H 3OEHD 4UFGH 3F2FA 4UFFH 1S83A 3BTQE 3QLPH 3WWFA 2UUFB 2VVUA 1QURH 1SGFG 4FVBA 3U9AH 3MFJA 1Z8IB 2PUXB 1H9LB 3SN8A 2ZDAH 1ELAA 4X8VH 1KLTA 5EQSA 4BAOB 4FVDA 1P09A 3A8AA 3MWIU 1NRRH 2OP9A 1WTHD 3NUMA 1GJ5H 1QL7A 4DIHH 5EODA 3W1EA 2ZNKH 1XKBC 2A7CA 7ESTE 2DUCA 1E37B 1GJ4H 3PMJA 2D2DA 3KQCA 5CMXH 3UTUH 3TGKE 1ZTJA 1G2LA 2VIWA 1ZSJA 3RMLH 3SU4A 2NU3E 4Y11E 4B2CA 1HUTH 3SZEA 2CHAC 2GP9B 4DCDA 1O5GH 1GBEA 1LQEA 3NK8A 4GVUA 1YKTA 2XC4A 4ABEA 5AF9H 4BNRA 8GCHF 3RC6A 3M5NA 1P10A 4Y76A 4O9VA 5ESBA 2Q1JA 2UUJB 3K6YA 1DVAH 4R8TB 1N6YA 5T3HA 5FXLA 1AB9B 1RGQA 1QCPA 2BLWA 5GIBA 5KEDA 1ZLRA 1C9TA 1WOFA 2FI4E 4XE4A 1V2WT 3PMHB 3QN7A 1ZMLA 1IQLA 3TK6A 2L6OA 1UCYH 1AZ8A 3KNXA 1C5RA 2FLBH 3L6PA 1V2NT 1ID5H 2W7UA 3FFGA 3QDZB 3ATIA 1GVZA 2Z9IA 1GMCG 1BTHH 3V12A 2PFEA 4WXIA 1ARBA 3RXBA 3SQEE 3SU5A 3VB3A 1TLDA 1QY6A 2ZU2A 3BIVH 7GCHF 1QB9A 1FUJA 2FTMA 2V0BA 1QB1A 4MDSA 1H1BA 4GAWA 1CT4E 5DGJA 4I8LA
chains in the Genus database with same CATH topology
4FUCA 2NU2E 1GL0E 1GJ8B 3O8DA 2GZ8A 2HWLB 1GBJA 2TGDA 3F9FA 1Z7KA 2WV5A 2BD9A 1O2LA 1TAWA 3SJIA 2Z9JA 3QWCH 4A1VA 3RC5A 4B74A 2AS9A 1TNGA 4BANB 1DLEA 1GI1A 2ZHFH 3RXFA 1Z1IA 1NRSH 3MH4A 5TJXA 3T28A 3LH3A 1XKAC 4NFFA 4D7GA 1OP2A 2STAE 1VCPA 1W7XH 1K1IA 2Z3EA 5JBBS 4ABAA 1HIAB 2HNTF 1TBZH 1CHGA 4HZHA 1Y5UT 2BVSH 2Q6GA 3BTTE 1FNIA 1GBKA 5FBIA 1O5CB 1LKBA 1C5PA 1A3EH 1GG6C 1MMJN 3AW0A 1G30B 3HK3B 4NZQA 1BRCE 3GY3A 3SU1A 1TOCB 5HMAA 1QFKH 1BTWA 3GY6A 2GVFA 2VWOA 1DFPA 2NWNA 3BEIB 3ZZ8A 2J95A 1FAXA 4KKDA 1GBBA 3A82A 1K1PA 2H5DA 2GT7A 2C3SA 2KAIA 3MNXA 4HI3A 4ISHH 3GCNA 3RXQA 4FXGH 1BQYA 1XVMA 3A7VA 1IQGA 1MKXH 4TYDA 1G3EA 3KQDA 2TGTA 1AFQC 2G00A 3E6PH 4XBBA 1F2SE 4M7GA 2FIRH 5L6NH 5C2ZA 1C1PA 1CBWC 2BDAA 2D26C 3ITIA 3NPSA 1UTOA 5CHAB 4YOJA 1FAKH 1A5HA 1GI4A 1Y3XA 2O9QA 3A86A 2C8XB 1YCPM 2WPJS 2BD2A 1SGCA 4DOQA 5A2MH 4X6PA 1UCYE 1O3GA 2SGQE 2A5IA 1MTVA 1RD3B 1MU8B 1VCWA 1GL1A 1ESBA 1YCPH 2BOHB 1E34B 1GI2A 3E91A 1C1MA 3P92A 1G32B 4K8YA 1YP9A 1O3HA 3UOUA 3LGYA 1IQFA 1PPHE 3MH7A 1TOMH 3H5CB 3ZZ4A 1V2VT 3RXCA 3SV7A 2VVVA 1UO6A 3EQ0H 4Y8ZA 1B5GH 5B6OA 4NIYA 4I8KA 1MTSA 3GCTG 5F8ZA 4MNWA 4GUXA 2CV3A 5JBTA 1O5FH 2Y7ZA 1O34A 4FUDA 3PYHA 2GD4B 1TPPA 1KLJH 2W26A 4ZHMU 1L4ZA 2CHAB 3PWCA 3UWIA 3LIWA 2FOFA 1IQIA 2ZHEH 3HPTB 1DM4B 2FXRA 2HRVA 1S6HA 3FZDA 3PV4A 2QAAA 1RTLA 1L1JA 1EPTA 2M5TA 4X8UH 2Z3DA 4XBDA 1J8AA 1X7AC 4INHA 2SFAA 4QT8C 1TNLA 1UTLM 1G36A 4Y7BA 4NSVA 1HAOH 1CE5A 5GJ4B 5DP7A 3VXFH 1ZTKA 1GCTB 1HJAC 1YGCH 5EU8A 2PKAB 1GHAG 3BTKE 1UMAH 4I8GA 5EW2H 5LH8A 1HIAA 3OX7U 1AFEH 2GTBA 4K1SA 2Y5FA 3GYMA 1DXWA 1B0EA 1U6QA 3PO1B 1HPGA 1C5TA 1NRQH 4INKA 5DP8A 2A7JA 1P2IA 1TRMA 2JH6D 3ZVAA 3L3TA 2ZU3A 1EAUA 2G5NA 1C5OH 1TWXB 3TJVA 3ZVCA 2F9VA 4ISOA 1SQOA 4I8HA 1F92A 1VITF 2B7DH 2WINI 5E2OA 1GBFA 1GHZA 1S0QA 3UFAA 2PKSC 1P57B 3M5MA 1A2CH 5L2ZH 2O8UA 3EGKH 4Q80A 1HJ8A 7GCHG 3BV9B 2P16A 1O3MA 3QTOH 2GCTB 1NM6A 3UNSA 1MKWK 1F5RA 2A1DB 1EX3A 2ZU5A 3RXAA 5T6DA 2A2QH 4WF8A 4LZ4B 1UVTH 1UHBB 4X8TH 1EP5A 1EZSC 1GI7B 2TIOA 1GG6B 4CRGA 2WUBA 3OU0A 4WMFA 1E36B 2OC7A 1O2QA 1O3BA 3IG6B 1GDUA 3SI4H 3EA9A 3URCA 1N8OC 2VH0A 1TNIA 1MCTA 1YLCA 4H42U 3IWMA 4JZEH 1C5UA 2IN2A 4FUBA 1C1VH 1EASA 3KF2A 1A0LA 1OPHB 2PV9B 4A5TS 5EXNA 3F68H 3PLBA 2BVRH 3QO6A 3RU4T 1C2IA 1S6FA 1S85A 1UVUH 2C8YB 1GDQA 2LNCA 3RC4A 2Z7FE 1T32A 2FPZA 1W8BH 3BIUH 3FP7E 4YLUA 3SHCH 4AOQA 4YOIA 3RXLA 2ZP0H 2R3UA 2UUKB 1NFYA 4AB9A 1C2MA 5CHAC 1BTUA 1CHOG 2FI5E 1K28D 1AU8A 4CHAB 3HGNA 3RMNH 4BAKB 4NIXA 3ATMA 3UNQA 2TGPZ 1M9UA 1GMHG 1ZHRA 3VXEH 1EJNA 2VIOA 4ABDA 1AD8H 3SNBA 3S9CA 1FN6A 1D9IA 3Q3XA 1MQ6A 1PYTD 2UWLA 4VGCC 1EUFA 1L1GA 1YPEH 2OLGA 2ZPSA 1LDTT 2WUCA 1IHTH 1DPOA 3NKKA 5DP9A 4TPIZ 1HAXB 3SNAA 1KY9A 1LPGB 3GDSA 2V35A 1ZRBA 2BZ6H 5TCCA 1SC8U 1UTPA 2HGTH 5GCHF 1AB9C 4NSYA 1A0JA 4FUEA 1CHOF 1NS3A 3RXVA 1KYNA 1GMCF 1L1NA 4IC6A 1MD8A 3SU0A 5GXPA 1SG8B 3W95A 3ELAH 1LHDH 3K65B 4JK6A 4ZKRU 2AERH 3P8OA 3A8DA 4XDEA 3MO3A 2QYIA 1SGDE 3UOPA 1P3EA 4X6MA 3UY9A 1MZAA 1EXFA 5JBCS 1T7CA 1OYQA 1UTJA 4K3JA 4K1EA 1AQ7A 4TWYA 1HJAB 1NPMA 1K9OE 1W10U 3A7WA 3MO9A 3SW2B 4ESTE 1VJ9U 1SBWA 1GI8B 1P12E 1RTFB 1OWKA 1Q31A 3BTEE 5E0HA 2RG3A 1O35A 1DICA 1AKSB 3PO1C 1RXPA 5A8ZA 1N6XA 2ZHDA 1KXCA 4A7IB 4DT7B 1WUNH 3E0NB 2ZFQH 1BHXF 3EAJA 3M61U 3GY4A 3KQEA 4FU9A 3PTNA 2XXLA 2GZ7A 1TE0A 2H5CA 4WH8A 3ZYDA 2BLQA 3C27B 3SNDA 1QBVH 2BD8A 4D9QA 3S69A 3F9HA 1C2HA 1TMUH 3TU7H 2JH5D 3TPIZ 1MQ5A 1OWDA 2OBOA 3TK9A 3KCGH 1Z8RA 1F7ZA 1V2JT 3HATH 5EPYA 5K0HA 1LHEH 1MUEB 1GVKB 1FONA 5EXLA 1P2QA 3SGAE 1P03A 1XXDA 3P70B 1VITG 1SQTA 2BDIA 1CSOE 1ZGVA 1F5KU 3MU5A 1YPLH 2OQ5A 1BMLA 4BXSA 1H8DH 1NROH 3GY8A 1EP6A 2F91A 4TY6A 1GJCB 1PQAA 3K2UA 5HXFA 2ESTE 1O2HA 1O33A 3PLKA 2FS9A 4ISLA 3OY5U 1TNJA 1AFQB 3ZZDA 1N8OB 2BB4A 1GBLA 1LPZB 4OGXA 5L30H 1G3BA 3M3VA 1FMGA 1SLWB 4LZ1H 1O2XA 1CBWB 2XRCA 5GWZA 3RLWH 3I77A 1SHYA 1DT2A 1ZJDA 1V2QT 1WTGH 2I6QA 1T8LA 5HYOA 1OP0A 1BIOA 3RXDA 3DA9B 1QNJA 1RRKA 1UK4A 3ZVFA 1GPZA 1C2JA 2BY8X 4MPVA 2HNTE 1SGFA 4DW2U 3QGJA 2ZDNA 6CHAB 4X1RU 3RLYH 1O38A 8GCHG 4AFSA 4X1NU 2ZGBH 3ZZCA 2F9BH 4ISIH 1Z8GA 1MAXA 2GMTC 2SNWA 1O3AA 4B75A 3UR9A 2G81E 4MQAA 3GDUA 4SGAE 4IN1A 3MNCA 1PPCE 4IMZA 1QRZA 1VGCB 3VGCC 3BN9A 3VFEA 2QGRA 4YT7H 1O2MA 1GBIA 2P3FH 4E7NA 2ZGHA 1HGTH 1DLKB 3RXEA 4VGCB 1TQ0B 3EDXB 4ISNA 1AE5A 1C1OA 3T27A 3C1KA 2G55A 4X2VA 2AH4X 3A81A 1K2I1 2HPQH 1GJ7B 3QK1A 3KHVA 1AMHA 2ZCLP 4Q7ZA 2WV4A 4D7FA 1ZR0A 1QA0A 3RXIA 5E0JA 1O2SA 2H9HA 2IPHA 3NWUA 2WYJA 3LH1A 3MU1A 2VIVA 3MI4A 1AIXH 1GBMA 2FS8A 2P59A 2P8OB 3LT3A 2BLVA 2H6MA 1A5GH 2G51A 3PMAB 1YPHC 1VITH 1Z6JH 2EEKA 4CH2B 1Y3YA 2FI3E 2PSXA 5IYTA 1BTPA 4OS5A 3AASA 3E0PB 1J15A 3A85A 3M7TA 3VB6A 3SO3A 3SOSA 2HVXA 2KAIB 4I31A 2JH0D 3LC3A 1DX5M 2DE9A 3TGJE 1SPJA 3RM0H 3ZVGA 3T25A 2OC8A 2XBYA 3GDVA 2H2ZA 1WYKA 5A0CA 1BUIA 1A5IA 1TA6A 5JYIA 3A7ZA 1D3QB 2SNVA 3S0NA 1OOKB 5ETXA 1RS0A 2QXGA 3PWBA 1SMFE 1YPHE 2VH6A 5EG4A 1XXFA 1ANBA 3Q3YA 1GJ9B 1QBNA 2AIPA 1PPBH 1A4WH 4B2AA 3M7UA 2J38A 3F9GA 2OC0A 1ANDA 1KIGH 1THSH 1EOJA 2P94A 3U69H 1ESTA 5FCKA 3ZVBA 1LHGH 1EOLA 1O0DH 1GJDB 4WH6A 1THPB 2GDEH 3P6ZB 3LGWA 1C5YB 2V6NA 3DUXH 3UWJH 5A0BA 2OQUA 3GY7A 2ZCKP 4LK4A 1HXEH 2ZI2H 1TQ7B 3B23B 1FN8A 1HAGE 2CMYA 1D3DB 3SBKA 3B8JA 5F6MA 5SGAE 1EKBB 3S9BA 1UTQA 4NCYA 4CREA 3BSQA 5DP5A 5BRRE 1HRTH 1ANEA 1ELBA 1EAXA 1O3PB 1GDNA 4I7YH 4GCHF 4SGBE 6ESTA 1O2VA 1UVOA 1C5WB 4ABHA 3TJNA 2FEQH 3LGTA 1MU6B 1J9CH 3GCHC 1VJAU 2R2MB 1HBTH 4JZFH 2ZQ1A 1K1MA 4MPUA 5DPAA 1GHAF 4HFPB 1O31A 2NU4E 1O3EA 4GLYA 4CHAC 3U1JB 4AG2A 2AIQA 3P8NA 3PMBB 1YF4A 2Y81A 1O3JA 1TPAE 4MTBA 2VGCC 3RMMH 1V2OT 2ZU4A 1AHTH 2PR3A 4CRCA 4MNXA 1NY22 2C8WB 1P01A 4NA7A 1C1NA 2GMTB 5J4SA 3U8RH 1O2TA 4FUIA 4NWKA 2FOGA 1O3OA 4INLA 2FMJA 3GCOA 4BAQB 3T29A 5DK1A 3AVZA 1VGCC 3VGCB 3ZVEA 2QA9E 2BX3A 1HXFH 4IC5A 1W14U 1FY3A 3V0XA 4D76A 5I46H 8ESTE 1GHBF 1J14A 2ANYA 4OS7A 1ZJKA 3EYDA 3SGQE 3TJUA 3UQVA 1P9SA 3CENA 1MTUA 1A1RA 3BTGE 3ZZ6A 3RXSA 3RXTA 4XFQA 1THRH 1O2OA 3SJOA 1XX9A 1DSUA 1O39A 1OWJA 1P06A 1OWIA 5K7RA 4JYUH 1D4PB 2ZTXA 3BTFE 1G3DA 2R3YA 1FY8E 5C67A 1P02A 1TIOA 1XVOA 5HM9A 4JMYA 4OS2A 1FIWA 1TB6H 3IITA 2ZIQH 4B1TA 1ESAA 1TFXA 3V7TA 2BZAA 1F0UA 1LHFH 3A8CA 3MOCA 1GHBG 1RFNA 3RXJA 2ASUB 3ATLA 1GI3A 3ZVDA 1HAZB 1GBHA 2GV7A 4NG9H 4AX9H 4Y79A 1GGDC 2ANWA 2Y5HA 4Y8YA 1TMTH 1GHXH 2W3KA 4BTUB 1O30A 4TY7A 4FUGA 3ZV8A 4NWLA 1EB1H 1O3IA 4Y0ZE 1EZUC 1CGJE 1KXEA 4O3UA 3STIA 1YPMH 2BQ6B 1EJMA 1KTSB 3BG4C 1HLTH 5EOKA 1OXGA 2Y80A 2W7SA 1S5SA 1K1NA 3SI3H 4ASHA 2CJIA 3FP6E 1NFUA 2F9NA 2QY0B 3BTHE 4I8JA 1WQVH 3ZZ9A 1BRUP 2IJOB 3T2NA 1W0YH 1FQ3A 1V2TT 2FOEA 2I6SA 1CT0E 1C2KA 1TGBA 2J2UA 3TNTA 2VWLA 3SQHE 4OS1A 4YZUA 2BDBA 1NESE 2XC0A 3RU4E 1EB2A 1AI8H 3N7OA 2G8TA 3MU8A 1Z6EA 4UFDH 1Q3XA 1JIMA 1GMHF 3AAVA 3P8FA 3ZV9A 4ZXXH 3RXRA 1QR3E 3MH6A 1OWHA 1IQEA 2GDDA 1BJVA 2G5VA 1C1RA 2HALA 5A0AE 4R0IA 1W0ZU 3RMOH 2H9EH 4BXWA 3LU9B 1ARCA 1E38B 1PQ8A 1EAIA 2IOTA 3RUOA 3D23A 1BRBE 6CHAC 1CA0C 2A5AA 2A4QA 3NCLA 3Q76A 1BTZA 4JCNA 4JYTA 5AFZH 2TPIZ 4AZ2B 3OYPA 3A89A 4YM9A 2V3HH 2Z9GA 1GBAA 4GCHG 2R0LA 5JDUB 2QF3A 1FIZA 2ZU1A 1UCYK 2YOLA 1UJ1A 1Y5BT 1QL9A 4ABIA 4I33A 3UUZA 1KXDA 1W3CA 3PB1E 2QXJA 3BEFB 3E8LA 4PROA 1MZDA 1PPZA 3KL6A 3HGPA 4CH8B 2SGDE 1K22H 4CRAA 1ZSKA 1GJ6A 3O8BA 4D8NA 1H8IH 2RA3A 1LTOA 4FU8A 4WY3A 3TLOA 3LJJA 1OWEA 4ZHLU 1ZYOA 1P2MA 1C5ZB 2AMDA 4UE7H 4U01A 5C20A 1C4V2 1ZSLA 1FLEE 2ZCHP 3PLPA 4CRDA 1UVPA 2XWAA 1JMOH 1FZZA 1H4WA 4FUFA 4DGJA 3A87A 3GYLB 2HNTC 2AGEX 1GBTA 1GI5A 1BZXE 1MBQA 3OTJE 2PW8H 1DSTA 4MPWA 3TITA 1XUJA 5C5OA 3MU0A 1BOQA 3SUGA 2P8OC 1LVOA 4WMDA 3RXKA 2BQWB 1GWAA 3CP7A 3SU2A 2STBE 3TH3H 2BQ7B 1J17T 1GHYH 1IQHA 5BPEA 2C90B 3RXMA 3QZQA 1GVLA 1Y8TA 5LPRA 1AUJA 1LPKB 3E3TA 1TONA 4KTSA 5IDKA 1FPHH 4YT6H 1UK3A 3RXOA 1V2UT 1SFIA 2ZTYA 5FAHA 5EXMA 1C1TA 1VZQH 3QUMP 1WV7H 1NU9A 1O5EH 1DUAA 1K1OA 3SV8A 3FP8E 1HYLA 1CQQA 4UFEH 2P93A 2D1JA 1ELEE 2XWBI 2XNIA 2A4OA 4BAHB 3TIUA