4MPWA

Human beta-tryptase co-crystal structure with [(1,1,3,3-tetramethyldisiloxane-1,3-diyl)di-1-benzofuran-3,5-diyl]bis({4-[3-(aminomethyl)phenyl]piperidin-1-yl}methanone)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Tryptase alpha/beta-1
publication title Target-directed self-assembly of homodimeric drugs
rcsb
source organism Homo sapiens
total genus 53
structure length 243
sequence length 243
chains with identical sequence B
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mpwA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mpwA01
1JBUH 3BG4B 1O5DH 3ZZ8A 1UK4A 3B9FH 1NU9A 1ZPBA 3ZZCA 4I7YH 2FZZA 8GCHF 2UWLA 2R2WU 2YNBA 5A0AE 3A88A 4KGAA 4ZXYH 5ESBA 2HLCA 3M35A 4K3JA 1HLTH 4LXBH 4AG2A 8ESTE 5DG6A 4I8KA 1D3QB 3UREA 2GDEH 1PYTD 1XXDA 1C1SA 3IG6B 8KME2 1F5KU 3FFGA 3AAUA 3FANA 3SU6A 5EPYA 4RKJB 1ZSLA 1O3MA 1TPPA 2FOMB 4UFEH 4A6LA 3TH3H 1D9IA 2ZQ2A 1Y3YA 4DIHH 1FY1A 1ZGVA 1K9OE 2ZDMA 2PHBA 1O5FH 3MH4A 1AFEH 1XXFA 3U9AH 3OSYA 3KF2A 4M7GA 3L3TA 2ZU1A 4K8YA 1ZPZA 2ZHWH 1CVWH 1LHCH 1O2WA 3TGKE 1YPGH 5AHGH 1ELEE 5EW2H 1C5PA 3EA7A 5C2ZA 1O5BB 2PFEA 2A7JA 4CRFA 3P95A 1TIOA 1P57B 4X1PU 1DITH 4TY7A 5EU8A 1S85A 4B2AA 3RXVA 2G4UA 1NFYA 4JZIA 3ZVBA 1EOJA 5HYOA 4ISHH 3BF6H 4B1TA 1P01A 1J8AA 4TPIZ 1BOQA 1YPLH 2P8OB 2GCHG 1CA8B 1V2WT 5C1UA 3BTME 3F9EA 3P8OA 4Y0ZE 3ODFA 1MBMA 4UFGH 3MU4A 3ESTA 1V3XA 1LKBA 3NZIA 4NA8A 1PPGE 1PPEE 2VIVA 3S7HB 1Q2WA 1U6QA 4UFDH 4DOQA 5E2PA 2W3IA 1Y8TA 1GBEA 4AOQA 1ELGA 3Q77A 2Z3DA 3SJKA 3SUGA 1AQ7A 1SGRE 4H6TA 5L2ZH 1F5LA 3LJJA 2VWNA 3NKKA 5F03A 1BUIA 4XDEA 1GBMA 4WY3A 1SGYE 1O3JA 1TX6A 2PKSC 1KIGH 1TRNA 3R0FA 2QIQA 1GGDB 1Y59T 2PKAA 2BZ6H 1AZ8A 4ZKNU 1BIOA 1C5TA 1Z6JH 5IYTA 1O34A 3BTHE 1UCYK 1CT0E 5EXLA 1B0FA 1W0ZU 1ELVA 2VVUA 2XWAA 5CHAB 2WPIS 3PROA 4NSYA 3FZZA 1KYNA 1IHTH 2XNIA 4X1RU 1ELAA 3HPTB 4TWYA 4D76A 1DY9A 2FO9A 5A2MH 1ZZZA 3A80A 2TGDA 5FBEA 1DE7H 1F7ZA 3F9GA 2WV4A 1G3EA 1A4WH 3MHWU 3ATKA 1UVSH 2A32A 3A7YA 1G30B 2XWBI 1AHTH 1FUJA 1AWFH 1EB1H 4YZUA 1GCDA 1O2TA 1S0QA 2Y6TA 3STJA 4AN7A 4TPYA 2H1UA 1PPBH 1INCA 2ODQA 2OC8A 2C4FH 1L4ZA 4DGJA 3Q76A 4Y6DA 1THPB 2D1JA 1IQJA 2OTVA 3A85A 4TY6A 3RXRA 1BQYA 2FOHA 1O37A 1W11U 3VB5A 2A5AA 5FXLA 1EATA 1UTKA 2VINA 2F91A 4FUIA 3TPIZ 3MNSA 1O36A 3U8OH 1GMDF 1ZMJA 3TITA 1BMMH 2VH6A 2AIQA 1BMLA 2EC9H 2R3UA 1NRQH 3QZQA 5DP5A 5JBTA 2G55A 2QXJA 1C1QA 3UIRA 2GT7A 1H8DH 2FX6A 3GCHB 4MPUA 1TE0A 1UTQA 1HGTH 4AB8A 1K2I1 5C5OA 3CP7A 1C5UA 4I8LA 1G2MA 2OQ5A 1HV7A 3SV6A 1UK3A 3RC5A 4XSKU 3LOXA 4JK5A 2GGVB 2FOCA 1BB0B 2GP9B 2OINA 1B7XB 1JOUB 1OWHA 3O8RA 1Z71A 3TK6A 2JKHA 1MCVA 4ABHA 1C2EA 5LPRA 1V6DA 1ZSKA 1DWDH 3RU4T 3RXUA 4B2BA 2HNTE 1GI6A 1GHZA 4Y8YA 2ZTXA 1P2QA 3NPSA 2FPZA 4IMQA 4ASHA 1CHOF 2VWOA 2WV5A 1PQ8A 3ZZDA 1O2JA 4OS2A 1BBRH 1THRH 4NZQA 2F9PA 2WPHS 1GDUA 3SU2A 1SLWB 3RXQA 2PKAB 3RXSA 1TALA 1LVMA 3ZVGA 1IQFA 2AGGX 2ZCLP 3QLPH 2F3CE 1QCPA 1LQDB 2KAIA 3RMOH 1NROH 2TPIZ 1L4DA 4X6PA 1DFPA 2VGCC 2FX4A 1FPCH 4BAHB 3F9FA 4BAQB 3EQ0H 1WQVH 2SGQE 3U1IB 4ABGA 1RJXB 3FVFB 1GHYH 3MWIU 1K1NA 2O8UA 1HAIH 4X8VH 5JBBS 1P10A 2OC7A 1FI8A 5LPEA 1DICA 1GMCG 1QB6A 1L1GA 2BD4A 1NT1A 1MU8B 2FTMA 1W0YH 4FVDA 2RG3A 2Z94A 1DWBH 1O5AB 2BY6X 4A7IB 1ZHMA 3SJOA 1EKBB 1AVWA 3A87A 1C5MD 1QJ6B 3RDZA 2BY5X 1CBWC 2FOFA 4DCDA 3ZVDA 1AZZA 1K1LA 4K2YA 2CF9H 3ATWA 4BTUB 1ELDE 1O2KA 3SU1A 1A5HA 4CRDA 1DVAH 2BLWA 3KIDU 1C1VH 3VGCB 2JH6D 3V12A 5T3HA 3F1SB 3VB7A 3DD2H 2GX4A 2ZO3H 2C8ZB 4LOYH 2THFB 4VGCB 2J95A 1FONA 5LPFA 3M5LA 4SGBE 4X0WU 2EI8A 3SU3A 4AORA 2J2UA 4RN6A 1P12E 3GOVB 5GWZA 1TB6H 4KP0A 4AYYB 1IQHA 5DP9A 1W3CA 1GG6C 5F8ZA 3PMJA 2G5VA 3KN2A 4TYDA 3M3TA 4O3UA 2A5KA 2VIPA 1O2OA 2PTNA 1XM1A 5B6OA 1HXFH 3BTWE 5EQSA 2VNTA 4WJG2 3RXOA 5EQRA 3F6UH 3ZZBA 2UWPA 4WXVA 1L0ZA 1HIAA 4DVAU 5DGJA 1PPCE 3ATMA 1H1BA 3KEEA 1KXFA 1FIZA 1JRTA 2QXGA 3M5OA 1GHBF 1KXEA 3U8TH 1E34B 2ASUB 1T8LA 4R8TB 1OP0A 3LJOA 1YPMH 1EX3A 4YT6H 2YNAA 1HYLA 4NWLA 4NGAH 2QCYA 5GPIB 2BMGB 2KAIB 1FPHH 3D62A 3TK9A 1BTUA 1HCGA 1ZJDA 1MTVA 2W26A 1P2KA 1A1RA 1D4PB 4WMFA 1PFXC 6ESTA 3EAJA 2NU1E 4OS4A 2C3SA 1K21H 3UTUH 2FLBH 3V13A 1NPMA 4IBLH 1O3LA 3M37A 4X6MA 4BTIB 1Z8RA 1FY4A 4XE4A 2IJOB 2BD3A 4ZKRU 1V2OT 1KTSB 3QO6A 3ZZ4A 3SV2H 2HOBA 3M61U 3PMHB 3T28A 1S81A 1Q3XA 1G2LA 1ESAA 1NRRH 5E0GA 2XCNA 3SU5A 2FI4E 1UTLM 1HUTH 4BXSA 1OWIA 1YP9A 1PQAA 1ZTJA 4UEHH 1ZHRA 1P04A 1KXBA 5F6MA 4E06H 2ODYB 4YLQH 1C1RA 2B9LA 1P11E 3QK1A 2BLVA 1QIXB 3P8NA 1GJ7B 2XC5A 2ZFSA 4DW2U 4ZXXH 3LKWA 4CREA 1K28D 4HZHA 1FV9A 4I8JA 2XW9A 2ZA5A 1TQ0B 3A8CA 3RC4A 4FU7A 4NIVA 4X2YA 1GBJA 2Z9JA 1SHYA 1QFKH 3V3MA 2NU2E 2QYIA 4YOGA 1BTXA 1HAVA 2Z7FE 2AGEX 2WUCA 3BTTE 1ZLRA 3GCTG 3GY3A 4CH8B 3OY5U 4FUGA 3U69H 1A2CH 1D3DB 2GVFA 1W14U 2A7CA 1FN6A 3GY2A 2ZGCA 4CRAA 3L6PA 3VB4A 1Z7KA 3K2UA 3LGIA 1HBTH 2FYQA 3PM3A 4JYTA 4GLYA 1UTNA 1TGNA 3RXKA 1DUEA 5IDKA 2GMTC 2ZHFH 2EI6A 4ABAA 4OS1A 1FY8E 1P02A 4JZDH 1QQ4A 3F9HA 4LZ1H 3EGKH 1BHXF 7GCHG 3EE0B 5ESTE 1BBRE 1MCTA 1KLTA 2D26C 2AMPA 5F8XA 1LDTT 1XVMA 2ZP0H 1XUHA 1HIAB 2PSXA 5T6FA 3LDXH 3MU1A 1FXYA 3SI3H 1DWCH 3QTOH 5F8TA 2GCTC 1ESBA 1GI5A 4AFZA 2G8TA 5HM9A 4CRGA 1M9UA 1ANDA 1W12U 1DM4B 3H7TA 1O30A 4Q7ZA 2EEKA 1HRTH 2QC2A 1SQAA 3ZZ3A 1QL8A 2JH5D 1BA8B 1TNKA 2RDLA 1S6FA 1FAKH 1H9IE 1MKWK 4U01A 5AFZH 1KY9A 1ID5H 1V2KT 1V2VT 3P6ZB 2VIDA 3SW2B 8GCHG 1UVOA 2STAE 1LHEH 1XUIA 1CGJE 5TCAA 3SZNA 4XFQA 1OWKA 2HPQH 1IQGA 2TIOA 3CS0A 1SGQE 2PWXA 2GZ7A 2Y80A 4K69A 1N8OB 1LHDH 1NRNH 2ZDLA 2ZIQH 4E05H 1AO5A 5A09A 2FMJA 4ZKSU 2P94A 1LHGH 4U2WA 1Z1IA 1ZTLA 1AB9C 2ZPQA 3V7TA 1QQUA 1SLVB 1SOTA 7ESTE 4BAOB 4FUJA 5DP8A 1C2HA 1TNIA 2G51A 2VIOA 2H9TH 5AFYH 2CHAC 1SHHB 3ZZ6A 4IC6A 2TGPZ 4Q2KA 4YTAA 1VGCC 4TWWA 4Y11E 4GCHF 2BLQA 3ZVFA 1Y3WA 3P17H 4BNRA 2VWMA 5J4QA 5A0BA 2BHGA 5C1XA 3MU5A 1UVPA 5JPMH 2IOTA 1GBTA 1GHAF 1HAVB 1C5WB 2WPMS 1EJNA 1LKAA 3NCLA 2SGDE 1HJAB 5EPNA 2F9NA 2P59A 4THNH 3ZVEA 2FDAA 2V6NA 5CMXH 1P8VC 3ENSB 3Q00A 1KLJH 4OGXA 1ZOMA 2A4RA 1C1UH 4H6SB 1SGFA 3SUFA 1XUJA 3GCOA 1E38B 3ATLA 4KELA 1QRWA 2PUXB 1TMBH 5TCCA 5DK1A 2C8YB 2ODPA 3GYMA 3LH1A 3A7VA 3UR6A 3RXLA 3BEIB 1YLCA 5FPYA 3ZZ7A 4JYVH 1DX5M 1A61H 3M7UA 1WQSA 2A2QH 4K1TA 1TMTH 1O33A 4JCNA 4CHAB 4YO9A 1D6WA 4Y76A 1ACBE 4KTUA 1O2ZA 1CHGA 3PB1E 2ZDNA 1B5GH 3H5CB 1MKXK 1P2OA 1KTTB 2XBWA 3EA8A 1QNJA 1UVUH 1C5OH 4FU8A 1TNGA 1BJVA 9ESTA 1J17T 4GPGA 3RXEA 2XC4A 4ZUHA 1HAOH 5C20A 2SNVA 2PGQB 1C2IA 1SGCA 5HM2A 3JZ2B 3UR9A 2ANKH 2PW8H 2PV9B 2GZ8A 2AGIX 3VXEH 1TBQH 3K65B 2M5TA 4JK6A 2OQUA 1C2LA 4FUFA 1SQOA 1PPFE 1VITH 2TGTA 2ZECA 1O2YA 1TX8A 1MTUA 3SORA 1UHBA 1IQEA 5C1YA 2OC1A 3EDXB 1SGPE 1CE5A 2XBYA 2QF3A 2WUBA 3GYLB 3Q3KA 3LONA 4I33A 3KCGH 3TGIE 2GMTB 1QB9A 2O8TA 2SGEE 1ETRH 4YT7H 5EXNA 1RGQA 4X1SU 4B75A 2RA0A 1NFXA 2Z6BD 1TOCB 4IN1A 2BVSH 1HJ9A 3SNAA 3LIWA 2G00A 4FUCA 4OGYA 3NWUA 3S9CA 5L6NH 1MTWA 2A4OA 3CENA 4XBBA 3UNQA 2OC0A 2GCTB 3A8BA 3SGAE 5JDUB 2ZTYA 2ZWLH 1E35B 5G4BA 2GZ9A 2XBXA 2GV7A 1DXWA 3SUEA 4OS6A 1CT2E 3A7XA 1RFNA 4FXGH 3W94A 1CGHA 4ABEA 3RMNH 4K60A 1A7SA 2H6MA 1AE5A 1OWJA 3ZYEA 1C5SA 1V2RT 1O2QA 2Z9GA 3PV4A 2LNCA 2ZI2H 2UWOA 4BANB 4CH2B 3S69A 3A84A 3AW0A 1MD7A 1ETSH 5EW1H 3QN7A 1FMGA 5DP7A 1O2LA 1RIWC 2ZDAH 3AVZA 1L2EA 2GCHF 5AVDA 1RRKA 2ALVA 1T8OA 3SHAH 1A3BH 3SU4A 1P05A 2BVXH 2J9NA 1N6YA 1G36A 1KXAA 1LVYA 1SI5H 3L33A 3TIUA 2CJIA 1GJ5H 1OWEA 3EYDA 3SQEE 1AB9B 3PWBA 1GI7B 1C2FA 4BTTB 1LO6A 1T4UH 1G3CA 1BCUH 1MBQA 3MH6A 1NFUA 3BTGE 1O39A 1WV7H 9LPRA 1JMOH 4GHQA 4HFPB 1C5LH 2UUKB 1XKBC 4B73A 3P8GA 2OUAA 3SN8A 1G3BA 2XXLA 1EZUC 3PO1C 1C1WH 1YCPM 1S82A 3WY8A 2A4QA 1NESE 1T8MA 3N7OA 2YOLA 1FLEE 1GCTC 1C9PA 1H4WA 2TRMA 2FOEA 2FOBA 1NU7B 1NC6A 3T2NA 5SGAE 4Z6AH 3GICB 1GBKA 2SGAA 2ZGJA 1UHBB 1G32B 4ESTE 1QY6A 5T6DA 2OXSA 1LTOA 3ITIA 3IWMA 4WF8A 1F0SA 2ANYA 3SOSA 1J9CH 2FOAA 1K1MA 3E0PB 5FCKA 1TFXA 3RXIA 4X8TH 4K8BA 1WCZA 3VEQB 5A8ZA 5C3NA 3UNSA 4ZAEA 5EG4A 1AUTC 5JYIA 3C1KA 2OCVB 3QX5H 2BX3A 2BD2A 4IN2A 3DHKH 4IGDA 1HNEE 4IMZA 1HAGE 1JXPA 3B8JA 4X2WA 4X6NA 1EPTC 4MNWA 3ODDA 2OLGA 4GVUA 4ISLA 1EP6A 2BD5A 4ABDA 1EB2A 2BB4A 1GJAB 1H8IH 3QGJA 2DUCA 3NK8A 3ZYDA 1P9SA 1X7AC 3BEUA 3IITA 4ZH8A 1WOFA 1JRSA 1DT2A 2GD4B 1BRUP 2O8MA 3MU8A 1WTHD 1DLEA 5EGMA 1W7XH 5ETXA 5GJ4B 3GCNA 1RTLA 2O9QA 3A8DA 3RXJA 4WWYA 4YOJA 3SJ9A 3I29A 3MNBA 4DURA 1HJ8A 1L1NA 3DA9B 4BXWA 2QAAA 4X8UH 3ZZ5A 4CR5A 1FJSA 5HMAA 6LPRA 1GHXH 1JWTA 3GDUA 2FTLE 1YKTA 4INLA 1ABIH 5GIBA 2W5EA 1GVZA 4A1VA 1C1PA 3UUZA 2WPJS 1SB1H 2CXVA 2VVVA 4I8GA 1ZR0A 1BRAA 1P2JA 3HGNA 1LHFH 1O3FA 1DSUA 2CGAA 4WXIA 3SGQE 3UWIA 1SGDE 2PKSB 1IQNA 4RSPA 1F5RA 3M7TA 5CE1A 2H9EH 1GBLA 5GDSH 2IPHA 2HGTH 4GUXA 4AX9H 2BQWB 1MTSA 1EPTA 4K5ZA 1AWHB 4Z0KA 1F0TA 2G5NA 2O8LA 1EUFA 3SGBE 1OWDA 4HGCA 5FCRA 3T26A 4ISIH 1TMUH 1ZMNA 1C5NH 2AS9A 1SFIA 1GL0E 2VU8E 4B76A 4AFUA 3SI4H 1ABJH 4ZKOU 1TX7A 2WPLS 1C2JA 1O2NA 4XBCA 3QDZB 1LQEA 1UMAH 4D8NA 2F9OA 1LVBA 1QJ7B 2HRVA 1UVTH 3K6YA 3TJOA 1A46H 3LPRA 1ETTH 3HK6B 1PQ5A 2A31A 2WPKS 3LGYA 1UTJA 8LPRA 3SNBA 3C27B 1GBBA 3TJVA 1O3CA 1N1LA 4Q7YA 1ORFA 1G9IE 1ZSJA 2J34A 2FM2A 2A7HA 3QTVH 4LZ4B 1CA0C 3UOPA 4UD9H 1O35A 3PLKA 5EQQA 1A0HB 2QXHA 2R3YA 1O3OA 2ZHQH 1O3AA 1TBZH 4MVNA 4MTBA 4QT8C 3ZVAA 2WYGA 1Y3XA 1EAIA 1HPGA 4Y8ZA 1FY3A 4Q7XA 3PO1B 1HAHH 3DFLA 3HK3B 1VJ9U 1VCQA 1E37B 2A0QB 3GY8A 3A82A 4FU9A 1HAPH 2FWWA 4F4OC 1GCTB 2ZQ1A 1D3PB 1BTHH 1UO6A 2ZKSA 1RS0A 4A1TA 1MQ5A 2SGFE 2ZEBA 3O8CA 2ZPSA 3TK5A 1S5SA 1V2LT 3GDSA 1TAWA 1QRZA 3AAVA 2GTBA 3URCA 5J4SA 2BXUH 3MOCA 2ZDKA 2NWNA 3MU0A 4NFEA 2Z9KA 1SFQB 1AIXH 3LC5A 2QY0B 2GV6A 4ISNA 1BITA 3ELAH 4F49A 1SGIB 3BEFB 1KDQA 3M3VA 2HPPH 4UONA 3MMGA 4AB9A 2FODA 4SGAE 2Q6DA 1DANH 3RXGA 4YOIA 2G4TA 1YF4A 3PMAB 3T27A 1HXEH 2XYAA 1YPJH 1IQIA 3E0NB 2AIPA 2ZCKP 1IQLA 1AD8H 2FI5E 3TGJE 4CBNA 2ZGXH 1F2SE 1EZXC 2J94A 3D23A 1C9TA 1BJUA 3VB3A 2VGCB 3U8RH 1BBRK 3URDA 2ZHDA 1ARBA 1WSSH 1O2MA 2FLRH 3MNCA 4DY7B 1FDPA 1NFWA 1JIRA 1GWAA 3SUDA 3SO3A 1QL9A 3UNRA 2FS9A 1SGNE 1P2MA 1C4V2 2QXIA 1NRSH 3D49H 1GHVH 2BOHB 1T7CA 1GL1A 3E16B 3RLYH 1D6RA 1K1IA 1P3CA 1SGFG 2BDBA 2H5DA 2NU4E 2C8WB 1VITG 6GCHF 3PYHA 1PJPA 1WU1A 2VWLA 4Y7AA 3K6ZA 1BTZA 1CBWB 4MNXA 3S7KB 4ISOA 2JH0D 5DPAA 4DJZB 1SLUB 2ANMH 5JB9S 3OY6U 2PGBB 3VPKA 3I78A 2ULLA 4J2YB 4Y79A 1OX1A 4FVBA 1GJDB 1UCYH 1BZXE 4NG9H 4UFFH 4GCHG 1GI8B 2AMDA 1O2SA 1W7GH 1DDJA 1H9HE 1W2KH 1GMHF 3BV9B 1THSH 5GCHG 1LMWB 1EAXA 2HALA 2ZU4A 5JBCS 3AASA 5A0CA 2Y81A 4O3TA 1PQ7A 1TPAE 1GHAG 1UJ1A 4X1QU 1L1JA 2BDIA 2ZCHP 3NXPA 2G52A 2VH0A 1C1NA 2SGPE 1A5GH 1Z6EA 4YESB 2F9BH 3MO6A 1TGSZ 1RD3B 3ATIA 1CQQA 1E0FD 1EJAA 1P2IA 1YCPK 3GCTF 1H9LB 1AE8H 1AVXA 1XMNB 2PSYA 4WMEA 3SHCH 3KQDA 1AGJA 1BRCE 3F68H 2BDGA 1LPGB 2ZU5A 1V2NT 3FZDA 1YPHC 1GG6B 2BD9A 1GVKB 4MNYA 5DP3A 5T6GA 1MMJN 1RTKA 1V2TT 2JETC 3KNXA 3TVJB 3S0NA 1YC0A 4ABIA 1LVOA 2VIQA 1EZQA 5FPTA 3TLOA 1ESTA 1O0DH 4U30A 5L2YH 1BTYA 3KQCA 1GJ9B 2RA3A 3SNDA 4HI3A 1W10U 7GCHF 1HAZB 4NIXA 3SU0A 1KDQB 1VZQH 2P3FH 1P9UA 1A3EH 3HKIB 1TA6A 1P2NA 2BLOA 1SG8B 3RLWH 3E90B 2R9PA 2TGAA 4NZLA 3M5NA 2B7DH 1QR3E 1TOMH 2QN5T 5FX5A 4UDWH 1GBFA 2ZFQH 1YGCH 1NS3A 4A1XA 4BAMB 1O3BA 3VFEA 1ZGIA 1BRBE 4O9VA 1K1JA 3RXPA 2OBOA 1C5YB 3GDVA 3W95A 3VXFH 1PPHE 3QUMP 1DLKB 1UTOA 3GCHC 2Y5FA 5E0JA 1MH0A 4Y71A 2Z9IA 4IC5A 1TGCA 2BQ7B 1GJBB 3PWCA 2AEIH 3A7ZA 4OS5A 1WYKA 1FAXA 3I77A 1OP2A 1O38A 3QGNB 2QV1A 1OOKB 1EXFA 2RCEA 1F0RA 1SSXA 5K0HA 2G81E 3RMMH 2ZFRH 5FAHA 2ZF0H 1O2RA 2BD8A 4AFQA 2UUJB 1HB0B 1AFQC 1WAYB 2ZTZA 5DO4H 4OS7A 4K1EA 1T4VH 1VCWA 2R0KA 1SGTA 3GY7A 2FXRA 2ZU2A 1LCYA 3T29A 1Z1JA 3SJIA 4PROA 4HTCH 2V3OH 4I32A 1V2QT 4D7FA 2D8WA 2ZFFH 3GY6A 4AGJA 1RXPA 4D9RA 4H42U 1O2XA 2QF0A 3OTJE 1EP5A 1KSNA 1MU6B 3BTFE 3RMLH 2V0BA 1O3GA 2P3TB 2J4IA 4MPWA 5BRRE 1TYNA 3ZZAA 2BVRH 5H4IB 2QGRA 1NY22 5E2OA 4AYVB 1A0JA 1P3EA 3BTQE 4A92A 3OU0A 4MLFB 1XVOA 1V2JT 3TJUA 2DE9A 2W3KA 4R0IA 2XBVA 1SOZA 3LGWA 1C2KA 2HVXA 1DSTA 1BHXB 1ZHPA 2BOKA 1IQKA 3RM2H 3UQOA 1S83A 2FEQH 3PMBB 1XKAC 4JYUH 1LPKB 1T31A 2P95A 3UQVA 3BIVH 2FP7B 4O97A 3SNEA 3CS7A 3UY9A 4I8HA 4ZHMU 1TGBA 1QBNA 3U98H 4J1YA 1QA7A 1ARCA 1Q31A 2CMYA 2BYAX 3FAOA 5BPEA 3RXMA 1O2VA 3LGUA 2I6QA 2UUYA 1MQ6A 1O3NA 1A0LA 1CT4E 1AU8A 1QHRB 1ZPCA 1GBHA 2ZGHA 1CSOE 4Y0YE 1HAYB 5JB8S 1SMFE 4NIYA 3VGCC 1GMDG 4A5TS 3MFJA 1TRYA 2BDCA 1V2ST 3ZV9A 2B8OH 1O3HA 4VGCC 3RXBA 1Z8IB 1F92A 4D7GA 4B71A 1MUEB 4ABFA 2EA3A 6CHAC 1HDTH 2NU3E 1IQMA 1TONA 1K1PA 1WBGB 2Q6FA 2P3UB 1NN6A 1K22H 1ANCA 2FYRA 4BOHA 3GY4A 3TJNA 4NA7A 5HGGA 1C5QA 1V2MT 2BTCE 1UCYE 3M5MA 2ESTE 2B0FA 1BT7A 1VCPA 1CHOG 3U1JB 2JETB 3Q3YA 3LT3A 4FUEA 4DIIH 2A4GA 4NCYA 1BMNH 2AYWA 2CHAB 3RXAA 1C1MA 1GBDA 2Q6GA 1TRMA 1C4Y2 1UK2A 1KLIH 1VGCB 4I31A 3KHVA 2SFAA 1O32A 4B74A 3MNXA 4NSVA 2BDHA 3UPEA 3KGPA 1P09A 1GDNA 5EOKA 1AY6H 4WMDA 5EXMA 2A45B 3UFAA 3RC6A 4CRCA 1AKSA 1FQ3A 5FX6A 4Q80A 3FP6E 3G01A 3FP7E 4D9QA 1O3EA 3NUMA 4X2VA 1SBWA 4UE7H 2BY9X 4JZ1A 5LGOA 3E1XB 1EAUA 3A8AA 2P93A 1E36B 3QZRA 4AG1A 5DJ7A 1QBVH 1QURH 1LPZB 4WH8A 2J38A 1XUFA 1XUKA 3FP8E 3UOUA 4XOJA 2ANWA 2ZHEH 3BTDE 1T32A 1VJAU 1B0EA 3RU4D 1N6XA 2Y82A 4H4FA 1O5CB 4INHA 1T8NA 2ZFTA 1C2DA 3OYPA 1ZTKA 1EOLA 2CV3A 1A5IA 4INKA 4YLUA 2H9HA 3TNTA 1K1OA 4GSOA 1AFQB 4GAWA 3RU4E 3S9BA 1PYTC 2BXTH 1HFDA 2A2XH 1MAYA 3KQBA 4ZROA 1DS2E 3M36A 2OD3B 3TNSA 4GHTA 2GKVE 1C1TA 3P92A 1NTPA 1GI2A 1CU1A 1OSSA 1TPOA 1OKXA 1ZRBA 3BSQA 5K7RA 3MH7A 4WVPE 1O3KA 1EASA 1CGIE 1JIMA 4RKOB 2BZAA 1ANBA 2F83A 3P70B 1TA2A 1MZAA 3E6PH 3LH3A 2I6SA 3PLPA 1QB1A 2XCFA 2ZG0H 2D2DA 4LK4A 5TJXA 1OXGA 2BX4A 4IS5A 1OP8A 1C1OA 3SV7A 1RTFB 2V35A 2ZU3A 3GY5A 3QWCH 3MI4A 1S0RA 1YPKH 2STBE 1DOJA 2GDDA 3GISB 1TPSA 3HKJB 5PTPA 4FUDA 4E7NA 3RXCA 1GHBG 4FUHA 3E3TA 1O2PA 4FUBA 2CN0H 2H5CA 1BTPA 2Y7XA 3SNCA 2Z3CA 1Y5BT 2ZZUH 4JZFH 1P0SH 2BY8X 2R0LA 1S84A 2VJ1A 1GVLA 1ZYOA 5A8YA 1MKWH 1Y5UT 3KQEA 1XUGA 4BAKB 3TH2H 1TLDA 1TNHA 3RXFA 1XX9A 3AW1A 3TH4H 2B5TB 4NWKA 2Y7ZA 2W7SA 1TNLA 1OYQA 1O2GH 5I46H 1YCPH 1MTNC 1ZRKA 1AKSB 1AUJA 1MZDA 1NZQH 1ELCA 2ZGBH 2AH4X 5DP4A 3T25A 1C5VA 1DPOA 3T62A 4JMYA 1ZMLA 4ABBA 2A1DB 1YPHE 2XRCA 3LC3A 4ZHLU 5JBAS 2PLXA 4KKDA 4U32A 6CHAB 1AVGH 3SBKA 1O5EH 1GMCF 2BDAA 1FZZA 1YM0A 1C2MA 2DE8A 1SLXB 1RIWB 3EA9A 2P16A 1D3TB 1N8OC 5L30H 4X8SH 1DUAA 1O5GH 2WYJA 1GI1A 3RM0H 1TABE 4Y8XA 3MO9A 1CO7E 3R3GB 4DG4A 3A83A 3Q3XA 1OS8A 1J16A 1FIWA 4MG3A 1GJ8B 1YPEH 3LGVA 3BN9A 1Z8GA 1SR5C 2VVCA 3M7QA 1C5RA 1AMHA 1YBWA 1TWXB 1BDAA 4MDSA 3DUXH 1C4U2 2Q1JA 1Y5AT 1AI8H 1MAXA 2ALPA 2V3HH 1Y3UA 3T5FH 2OP9A 1GI4A 1SQTA 2XTTB 3RXDA 3BG4C 2IN2A 1QGFA 2FOGA 3E8LA 3O8DA 2C8XB 1G37A 2R2MB 5HXFA 1G3DA 3HGPA 3K9XB 1QTFA 1UTPA 2Z9LA 2VIWA 5A8XA 3ZZ9A 1W8BH 1HJAC 1WUNH 2BM2A 1GJ4H 3SJ8A 4Y7BA 5C5NA 1TGTA 3S9AA 4ZHAA 5ABWA 1KXCA 2C93B 1PPZA 2BD7A 1SL3A 3ZVCA 1NM6A 4MNVA 5AF9H 1O3IA 2LPRA 3E91A 1W13U 6GCHG 1EZSC 1IAUA 1DY8A 4CBOA 5C67A 1P03A 4MPXA 1V2PT 1MKXH 3DFJA 3LGTA 1EJMA 5EODA 4KTSA 1NRPH 4JZEH 2CF8H 5E0HA 1QL7A 4AFSA 1YYY1 5LH8A 2F9VA 5FBIA 4CHAC 4B2CA 2BDYA 3UWJH 1EQ9A 2C90B 2FI3E 5I25A 2HNTC 1EAWA 1O2HA 1GI9B 3HATH 2VB0A 5FPSA 1GMHG 1O31A 2J92A 2FIRH 2NU0E 1O2IA 1S6HA 3M3SA 3MO3A 4ABJA 3OX7U 1EPTB 5DKMA 1QJ1B 2O8WA 2AERH 1QBOA 2FESH 3MTYA 3A89A 4NIWA 2ILNA 2PUQH 2ZC9H 3LU9B 3SV9A 2ZDVH 4ZMAH 2HNTF 3RXTA 3RP2A 2QA9E 1GJ6A 2P8OC 4NFFA 1NO9H 1OPHB 4K1SA 3SV8A 2AMQA 1OYTH 1UTMA 3PTNA 1HAXB 3BTEE 2H2ZA 1FN8A 3STIA 7KMEH 4X2XA 4AZ2B 3MYWA 2AFQB 4KTCA 2PR3A 2F9UA 3BG8A 4E7RG 2GT8A 3DT0H 4CRBA 3RUOA 4XBDA 1GBAA 2ZNKH 1BMAA 2HWLB 1ANEA 1VR1H 4AGKA 7LPRA 3VB6A 1O3DA 3TU7H 3A7WA 5DP6A 1GGDC 2PTCE 1Y3VA 2BQ6B 3PTBA 1IHSH 3KL6A 5FHTA 1C5ZB 1F0UA 5CHAC 3BIUH 3BTKE 4WH6A 1GBCA 3ZV8A 2Z3EA 1GPZA 4NA9H 2SNWA 2ZPRA 4X1NU 3D65E 1C2GA 1J14A 2TBSA 3O8BA 4X6OA 3A86A 1GHWH 3A81A 1P06A 1MTNB 3A7TA 4YM9A 1ELTA 1SC8U 2FS8A 1GDQA 4IW4E 1AN1E 3MH5A 4MPVA 2WINI 2BY7X 2A5IA 1O2UA 1DWEH 1ZJKA 1TBRH 3B23B 4DT7B 1O3PB 1GJCB 1C5XB 1TQ7B 5E8EH 2ZFPH 3P8FA 4MQAA 1GI3A 1GBIA 1KXDA 2OBQA 1QA0A 1YLDA 1VITF 1SGEE 1V2UT 3RXHA 1ELFA 3PLBA 1Z8JB 1J15A 1GI0A 4O03A 1DXPA 1FNIA 4Y10E 1IOEA 1WTGH 1SPJA 3JZ1B 3V0XA 5GXPA 1BTWA 1CA0B 1FY5A 2W7UA 3H7OA 4CR9A 2K1QA 1ELBA 1TNJA 1QRXA 3SQHE 5GCHF 2EI7A 2XC0A 2UUFB 2Y5GA 2Y5HA 1MD8A 1SVPA
chains in the Genus database with same CATH superfamily
1JBUH 3BG4B 1O5DH 3ZZ8A 1UK4A 3B9FH 1NU9A 1ZPBA 3ZZCA 4I7YH 2FZZA 8GCHF 2UWLA 2R2WU 2YNBA 5A0AE 3A88A 4KGAA 4ZXYH 5ESBA 2HLCA 3SZEA 3M35A 4K3JA 1HLTH 4LXBH 4AG2A 8ESTE 5DG6A 4I8KA 1D3QB 3UREA 2GDEH 1PYTD 1XXDA 1C1SA 3IG6B 8KME2 1F5KU 1H8ED 3AAUA 3FANA 3FFGA 3SU6A 5EPYA 4RKJB 1ZSLA 1O3MA 1TPPA 2FOMB 4UFEH 4A6LA 3TH3H 1D9IA 2ZQ2A 1Y3YA 4DIHH 1FY1A 1ZGVA 1K9OE 2ZDMA 2PHBA 1O5FH 3MH4A 1AFEH 1XXFA 3U9AH 3OSYA 3KF2A 4M7GA 3L3TA 3EE7A 2ZU1A 4K8YA 1ZPZA 2ZHWH 1CVWH 1LHCH 1O2WA 3TGKE 1YPGH 5AHGH 1ELEE 5EW2H 1C5PA 3EA7A 5C2ZA 1O5BB 2KCPA 2PFEA 2A7JA 4CRFA 3P95A 1TIOA 1P57B 4X1PU 1DITH 4TY7A 5EU8A 1S85A 4B2AA 3RXVA 2G4UA 2QF5A 1NFYA 4JZIA 1E1RD 3ZVBA 1EOJA 5HYOA 4ISHH 3BF6H 4B1TA 1P01A 1J8AA 4TPIZ 5GNDA 1BOQA 1YPLH 2P8OB 2GCHG 1CA8B 1V2WT 5C1UA 3BTME 3F9EA 3P8OA 4Y0ZE 3ODFA 1MBMA 4UFGH 5DSFA 3MU4A 3ESTA 1V3XA 1LKBA 3NZIA 4NA8A 1PPGE 1PPEE 2VIVA 3S7HB 1Q2WA 1U6QA 4UFDH 4DOQA 5E2PA 2W3IA 3ZIAD 1Y8TA 1GBEA 4AOQA 1ELGA 3Q77A 2Z3DA 3SJKA 3SUGA 1AQ7A 1SGRE 4H6TA 5L2ZH 1F5LA 3LJJA 2VWNA 3NKKA 5F03A 5FL7D 1BUIA 4XDEA 1GBMA 4WY3A 1SGYE 1O3JA 1TX6A 2PKSC 1KIGH 1TRNA 3R0FA 2QIQA 1GGDB 1Y59T 2PKAA 2BZ6H 1AZ8A 3OAAD 4ZKNU 1BIOA 1C5TA 1Z6JH 2KFWA 5IYTA 1O34A 3BTHE 1UCYK 1CT0E 5EXLA 1B0FA 1W0ZU 1ELVA 2VVUA 2XWAA 5CHAB 2WPIS 3PROA 4NSYA 3FZZA 3OFND 1KYNA 1IHTH 2XNIA 4X1RU 1ELAA 2YMSC 3HPTB 4TWYA 4D76A 1DY9A 2FO9A 5A2MH 1ZZZA 3FOAA 3A80A 2TGDA 4F55A 5FBEA 1DE7H 1F7ZA 3F9GA 2WV4A 1G3EA 1A4WH 3MHWU 3ATKA 1UVSH 2A32A 3A7YA 1G30B 2XWBI 1AHTH 1FUJA 1AWFH 1EB1H 4YZUA 1GCDA 1O2TA 1S0QA 2XOKD 2Y6TA 3STJA 4AN7A 4TPYA 1VKYA 2H1UA 1PPBH 1INCA 2OC8A 2ODQA 2C4FH 1L4ZA 4DGJA 3Q76A 4Y6DA 1THPB 2D1JA 1IQJA 2OTVA 3A85A 4TY6A 3RXRA 1BQYA 2FOHA 1O37A 1W11U 3VB5A 2A5AA 5FXLA 1EATA 1UTKA 2VINA 2F91A 4FUIA 3TPIZ 3MNSA 1O36A 3U8OH 1GMDF 1ZMJA 3TITA 1BMMH 2VH6A 2AIQA 1BMLA 2EC9H 2R3UA 1NRQH 3QZQA 5DP5A 5JBTA 2G55A 2QXJA 1C1QA 3UIRA 2GT7A 1COWD 1H8DH 2FX6A 3GCHB 4MPUA 1TE0A 1UTQA 1HGTH 4AB8A 1K2I1 5C5OA 3CP7A 1C5UA 4I8LA 1G2MA 2OQ5A 1HV7A 3SV6A 5F53A 1UK3A 3RC5A 4XSKU 3LOXA 4JK5A 2GGVB 2FOCA 1BB0B 2GP9B 2OINA 1B7XB 1JOUB 1OWHA 3O8RA 1Z71A 3TK6A 2JKHA 1MCVA 4ABHA 1C2EA 5LPRA 1V6DA 1ZSKA 1DWDH 3RU4T 3RXUA 4B2BA 2HNTE 1GI6A 1GHZA 4Y8YA 1NBMD 2ZTXA 1P2QA 2JJ1D 3NPSA 3AK5A 2FPZA 4IMQA 4ASHA 1CHOF 2VWOA 2WV5A 1PQ8A 4P02A 3ZZDA 1O2JA 4OS2A 1BBRH 5EIYA 1THRH 4NZQA 2F9PA 2WPHS 1GDUA 1NBME 1SLWB 3RXQA 3SU2A 2PKAB 3RXSA 1TALA 1LVMA 3ZVGA 1IQFA 2AGGX 2ZCLP 3QLPH 2F3CE 1QCPA 1LQDB 2KAIA 3RMOH 1NROH 2TPIZ 1L4DA 4X6PA 1DFPA 2VGCC 2FX4A 1FPCH 4BAHB 3F9FA 4BAQB 3EQ0H 1WQVH 2SGQE 3U1IB 4ABGA 1RJXB 2KX4A 3FVFB 1GHYH 3MWIU 1K1NA 2O8UA 1HAIH 4X8VH 5JBBS 1P10A 2OC7A 1FI8A 5LPEA 1DICA 2AHME 1GMCG 1QB6A 1L1GA 2BD4A 1NT1A 1MU8B 2FTMA 1W0YH 2J97A 4FVDA 2RG3A 2Z94A 1DWBH 1O5AB 2BY6X 3F0PA 4A7IB 1ZHMA 3SJOA 1EKBB 1AVWA 3A87A 1C5MD 1QJ6B 3RDZA 2BY5X 1CBWC 2FOFA 4DCDA 3ZVDA 1AZZA 1K1LA 4K2YA 2CF9H 3ATWA 4BTUB 1SQRA 1ELDE 4DT4A 1O2KA 3SU1A 1A5HA 4CRDA 1DVAH 2BLWA 3KIDU 1C1VH 3VGCB 2JH6D 3V12A 5T3HA 3F1SB 3VB7A 3DD2H 2GX4A 2ZO3H 2C8ZB 4LOYH 2THFB 4VGCB 2J95A 1FONA 5LPFA 3M5LA 4SGBE 4X0WU 2EI8A 3SU3A 4AORA 2J2UA 4RN6A 1P12E 3GOVB 2HVYB 5GWZA 1TB6H 4KP0A 4AYYB 1IQHA 5DP9A 1W3CA 1GG6C 5F8ZA 3PMJA 2G5VA 3KN2A 4TYDA 3M3TA 4O3UA 2A5KA 2VIPA 1O2OA 2PTNA 1XM1A 5B6OA 1HXFH 3BTWE 5EQSA 2VNTA 4WJG2 3RXOA 5EQRA 3F6UH 3ZZBA 2UWPA 4WXVA 1L0ZA 1HIAA 4DVAU 5DGJA 1PPCE 3ATMA 1H1BA 3KEEA 1KXFA 1FIZA 1JRTA 2QXGA 3M5OA 1GHBF 1KXEA 3U8TH 1E34B 2ASUB 1T8LA 4R8TB 1OP0A 3LJOA 1YPMH 1EX3A 4YT6H 2YNAA 1HYLA 4NWLA 4NGAH 2QCYA 5GPIB 2BMGB 2KAIB 1FPHH 3D62A 3TK9A 1BTUA 1HCGA 1ZJDA 1MTVA 2W26A 1P2KA 1A1RA 1D4PB 4WMFA 1PFXC 6ESTA 2WSSD 3EAJA 2NU1E 5KEDA 4OS4A 2C3SA 1K21H 2V7QD 2FLBH 3UTUH 3V13A 2W6ID 1NPMA 4IBLH 1O3LA 3M37A 4X6MA 4BTIB 1Z8RA 3U28C 1FY4A 4XE4A 2IJOB 2BD3A 4ZKRU 1V2OT 1KTSB 3QO6A 3ZZ4A 3SV2H 2HOBA 3M61U 5KECA 3PMHB 3T28A 1S81A 1Q3XA 1G2LA 1ESAA 1NRRH 5E0GA 2XCNA 3FKSD 3SU5A 2FI4E 1UTLM 1HUTH 4BXSA 1OWIA 1YP9A 1PQAA 1ZTJA 4UEHH 1ZHRA 1P04A 1KXBA 4TT3D 5F6MA 4E06H 2ODYB 4YLQH 1C1RA 2B9LA 1P11E 3QK1A 2BLVA 1QIXB 3P8NA 1GJ7B 2XC5A 2ZFSA 3FO8D 4DW2U 4ZXXH 3LKWA 4CREA 1K28D 4HZHA 1FV9A 4FETA 4I8JA 2XW9A 2ZA5A 1TQ0B 3A8CA 3RC4A 4FU7A 4NIVA 4X2YA 1GBJA 2Z9JA 2EY4C 1E79D 1SHYA 1QFKH 3V3MA 2NU2E 2QYIA 4YOGA 1BTXA 1HAVA 2Z7FE 5EJ1A 2AGEX 2WUCA 3BTTE 1ZLRA 3GCTG 3GY3A 4CH8B 3OY5U 4FUGA 3U69H 1A2CH 1D3DB 2GVFA 1W14U 2A7CA 1FN6A 3GY2A 2ZGCA 4CRAA 3L6PA 3VB4A 1Z7KA 3K2UA 3LGIA 2KCYA 1HBTH 2FYQA 3PM3A 4JYTA 4GLYA 1UTNA 1TGNA 3RXKA 1DUEA 5IDKA 2GMTC 2ZHFH 2EI6A 4ABAA 2QF4A 4OS1A 1FY8E 1P02A 4JZDH 1QQ4A 3F9HA 4LZ1H 3EGKH 1BHXF 7GCHG 3EE0B 5ESTE 1BBRE 1MCTA 1KLTA 2D26C 2AMPA 5F8XA 1LDTT 1XVMA 3SYJA 2ZP0H 3F2GA 1XUHA 1HIAB 2PSXA 5T6FA 3LDXH 3MU1A 1FXYA 3SI3H 1DWCH 3QTOH 5F8TA 2YMSD 2GCTC 1ESBA 1GI5A 4AFZA 2G8TA 5HM9A 4CRGA 4Z1MD 1M9UA 1ANDA 1W12U 1DM4B 3H7TA 1O30A 4Q7ZA 2EEKA 1HRTH 2QC2A 1SQAA 3ZZ3A 1QL8A 1YWUA 2JH5D 1BA8B 1TNKA 2RDLA 1S6FA 1FAKH 1H9IE 1MKWK 4U01A 5AFZH 1KY9A 1ID5H 1V2KT 1V2VT 3P6ZB 2VIDA 3SW2B 8GCHG 1UVOA 2STAE 1LHEH 1XUIA 1CGJE 3OEHD 5TCAA 3SZNA 4XFQA 1OWKA 2HPQH 1IQGA 2TIOA 2XNDD 3CS0A 1SGQE 2PWXA 2GZ7A 2Y80A 4K69A 1N8OB 1LHDH 1NRNH 2ZDLA 2ZIQH 4E05H 4TSFD 1AO5A 5A09A 2FMJA 4I86A 4ZKSU 2P94A 1LHGH 4U2WA 1Z1IA 1ZTLA 1AB9C 2ZPQA 3V7TA 1QQUA 1SLVB 1SOTA 7ESTE 4BAOB 4FUJA 5DP8A 1C2HA 1TNIA 2G51A 2VIOA 2H9TH 5AFYH 2CHAC 1SHHB 3ZZ6A 4IC6A 2TGPZ 4Q2KA 4YTAA 1VGCC 4TWWA 4Y11E 4GCHF 2BLQA 3ZVFA 1Y3WA 3P17H 4BNRA 2VWMA 5J4QA 2KZ4A 5A0BA 5C0UA 2BHGA 5C1XA 3MU5A 1UVPA 5JPMH 2IOTA 1GBTA 1GHAF 1HAVB 1C5WB 2WPMS 1EJNA 1LKAA 3NCLA 2SGDE 3F2FA 1HJAB 5EPNA 2F9NA 2P59A 4THNH 3ZVEA 2FDAA 2V6NA 5CMXH 1P8VC 1OHHD 3ENSB 3Q00A 1KLJH 4OGXA 1ZOMA 2A4RA 1C1UH 4H6SB 1SGFA 3SUFA 1XUJA 3GCOA 1E38B 3ATLA 4KELA 1QRWA 2PUXB 1TMBH 5TCCA 5DK1A 2C8YB 1QZ8A 2ODPA 3GYMA 3LH1A 3A7VA 3UR6A 3RXLA 3BEIB 1YLCA 5FPYA 3ZZ7A 4JYVH 4B6FA 1DX5M 1A61H 3M7UA 1WQSA 2A2QH 4K1TA 1TMTH 1O33A 4JCNA 4CHAB 4YO9A 1D6WA 4Y76A 1ACBE 4KTUA 1O2ZA 1CHGA 3PB1E 2ZDNA 1B5GH 3H5CB 1MKXK 1P2OA 1KTTB 2XBWA 3EA8A 1QNJA 1UVUH 5EJZA 1C5OH 4FU8A 1TNGA 1BJVA 9ESTA 1J17T 4GPGA 3RXEA 2XC4A 4ZUHA 1HAOH 4Q4LA 5C20A 2SNVA 2PGQB 1C2IA 1SGCA 5HM2A 3JZ2B 3UR9A 2ANKH 2PW8H 1H8HD 2PV9B 2GZ8A 2AGIX 3VXEH 1TBQH 3K65B 2M5TA 4JK6A 2OQUA 1C2LA 4FUFA 1SQOA 1PPFE 1VITH 2TGTA 2ZECA 1O2YA 1TX8A 1MTUA 3SORA 1UHBA 1IQEA 5C1YA 2OC1A 3EDXB 1SGPE 1CE5A 2XBYA 2QF3A 2WUBA 3GYLB 3Q3KA 3LONA 4I33A 3KCGH 3TGIE 2GMTB 4ACBA 1QB9A 2O8TA 2SGEE 1ETRH 5EJLA 4YT7H 5EXNA 1RGQA 4X1SU 4B75A 2RA0A 1NFXA 2Z6BD 3VG8A 1TOCB 4IN1A 2BVSH 1HJ9A 3SNAA 3LIWA 2G00A 4FUCA 4Q63A 4OGYA 3NWUA 3S9CA 5L6NH 1MTWA 3F3BA 2A4OA 3CENA 4XBBA 3UNQA 2OC0A 2GCTB 3A8BA 3SGAE 5JDUB 2ZTYA 2ZWLH 1E35B 5G4BA 2GZ9A 2XBXA 2GV7A 1DXWA 3SUEA 4OS6A 1CT2E 3A7XA 1RFNA 4FXGH 3W94A 1CGHA 4ABEA 3RMNH 4K60A 1A7SA 2H6MA 1AE5A 1OWJA 3ZYEA 1C5SA 1V2RT 1O2QA 2Z9GA 3PV4A 2LNCA 2ZI2H 2UWOA 4BANB 4CH2B 3S69A 3A84A 3AW0A 1MD7A 1ETSH 5EW1H 3QN7A 1FMGA 5DP7A 1O2LA 1RIWC 2ZDAH 3AVZA 1L2EA 2GCHF 5AVDA 4YXWD 1RRKA 2ALVA 2KR7A 1T8OA 3SHAH 1A3BH 3SU4A 1P05A 2BVXH 2J9NA 1N6YA 1G36A 1KXAA 1LVYA 1SI5H 3L33A 3TIUA 2CJIA 1GJ5H 1OWEA 3EYDA 3SQEE 1AB9B 1FX0B 3PWBA 1GI7B 1C2FA 4BTTB 1LO6A 1T4UH 1G3CA 1BCUH 1MBQA 3MH6A 1NFUA 3BTGE 2F4LA 1O39A 1WV7H 9LPRA 1JMOH 4GHQA 4HFPB 1C5LH 2UUKB 1XKBC 4B73A 3P8GA 1WXRA 3MQKC 2OUAA 3SN8A 1G3BA 2XXLA 1EZUC 3PO1C 1C1WH 1YCPM 1S82A 5KGOA 3WY8A 2A4QA 1NESE 1T8MA 3N7OA 2YOLA 1FLEE 1GCTC 1C9PA 1H4WA 1W0KD 2TRMA 2FOEA 2FOBA 1NU7B 1NC6A 2OK5A 3T2NA 5SGAE 4Z6AH 3GICB 1GBKA 2SGAA 2ZGJA 1UHBB 2W6JD 1G32B 4ESTE 1QY6A 5T6DA 2OXSA 2J98A 1LTOA 3ITIA 3IWMA 2WV9A 4WF8A 1F0SA 2KCOA 2ANYA 3SOSA 1J9CH 2FOAA 1K1MA 3E0PB 5FCKA 1TFXA 3RXIA 4X8TH 4K8BA 1WCZA 3VEQB 5A8ZA 5C3NA 3UNSA 4ZAEA 5EG4A 1AUTC 5JYIA 3C1KA 2OCVB 3QX5H 2BX3A 2BD2A 4IN2A 3DHKH 2RDEA 4IGDA 1HNEE 4IMZA 1HAGE 1JXPA 3B8JA 4X2WA 2V3MA 4X6NA 1EPTC 4MNWA 3ODDA 2OLGA 4GVUA 4ISLA 1EP6A 2BD5A 4ABDA 1EB2A 2BB4A 1GJAB 1H8IH 3QGJA 4XRNA 2DUCA 3NK8A 1E1QD 3ZYDA 1P9SA 1X7AC 3BEUA 3IITA 4ZH8A 1WOFA 1JRSA 1DT2A 2GD4B 1BRUP 2O8MA 3MU8A 1WTHD 1DLEA 5EGMA 1W7XH 5ETXA 5GJ4B 3GCNA 1RTLA 2O9QA 3A8DA 3RXJA 4WWYA 4YOJA 3SJ9A 3I29A 3MNBA 4DURA 1HJ8A 1L1NA 3DA9B 4BXWA 2QAAA 4X8UH 3ZZ5A 4CR5A 1FJSA 5HMAA 6LPRA 1GHXH 1JWTA 3GDUA 2FTLE 1YKTA 4INLA 1ABIH 5GIBA 2W5EA 1GVZA 4A1VA 1C1PA 3UUZA 2WPJS 1SB1H 2QE7D 2CXVA 2VVVA 4I8GA 1ZR0A 1BRAA 1P2JA 3HGNA 1LHFH 1O3FA 1DSUA 2CGAA 4WXIA 3SGQE 3UWIA 1SGDE 2PKSB 1IQNA 4RSPA 1F5RA 3M7TA 5CE1A 3OTPA 2H9EH 1GBLA 5GDSH 2IPHA 2HGTH 4GUXA 4AX9H 2BQWB 1MTSA 1EPTA 4K5ZA 1AWHB 4Z0KA 1F0TA 2G5NA 2O8LA 1EUFA 2YMSB 3SGBE 1OWDA 4HGCA 5FCRA 3T26A 3KYFA 4ISIH 1TMUH 1ZMNA 2JDID 1C5NH 2AS9A 1SFIA 1SKYE 1GL0E 2VU8E 4B76A 4AFUA 3SI4H 1ABJH 4ZKOU 1TX7A 2WPLS 1C2JA 1O2NA 4XBCA 3QDZB 1LQEA 2J98B 1UMAH 4D8NA 2F9OA 1LVBA 1QJ7B 2HRVA 1UVTH 3K6YA 3TJOA 1A46H 3LPRA 1ETTH 3HK6B 1PQ5A 2A31A 2WPKS 3LGYA 1UTJA 8LPRA 3SNBA 3C27B 2CK3D 1GBBA 3TJVA 1O3CA 1N1LA 5IK2D 4Q7YA 1ORFA 1G9IE 1ZSJA 2J34A 3N7DA 2FM2A 2A7HA 4ASUD 3QTVH 4LZ4B 1CA0C 3UOPA 4UD9H 1O35A 3PLKA 5EQQA 1A0HB 3UB0A 2QXHA 2R3YA 1O3OA 2ZHQH 1O3AA 1TBZH 4MVNA 4MTBA 4QT8C 3ZVAA 2WYGA 1Y3XA 1EAIA 1HPGA 4Y8ZA 1FY3A 4Q7XA 3PO1B 1HAHH 3DFLA 3HK3B 1VJ9U 1VCQA 1E37B 2A0QB 3GY8A 1K0HA 3A82A 4FU9A 1HAPH 2FWWA 4F4OC 1GCTB 2ZQ1A 3PRDA 1D3PB 1BTHH 1UO6A 2ZKSA 1RS0A 4A1TA 1MQ5A 2SGFE 2ZEBA 3O8CA 2ZPSA 3TK5A 1S5SA 1V2LT 3GDSA 1TAWA 1QRZA 3AAVA 2GTBA 3URCA 5J4SA 2BXUH 3MOCA 2ZDKA 2NWNA 3MU0A 4NFEA 2Z9KA 1SFQB 1AIXH 4FOUC 2KCAA 3LC5A 2QY0B 2GV6A 2IPQX 1BITA 4ISNA 3ELAH 5CDFE 4F49A 1SGIB 3BEFB 1KDQA 3M3VA 2HPPH 4UONA 3MMGA 4AB9A 2FODA 4SGAE 2Q6DA 1DANH 3RXGA 4YOIA 2G4TA 1YF4A 3F0OA 3PMAB 3T27A 1UW7A 1HXEH 2XYAA 2GJGA 1YPJH 1IQIA 3E0NB 2AIPA 2ZCKP 1IQLA 1AD8H 2FI5E 3TGJE 4CBNA 2ZGXH 1F2SE 1EZXC 2J94A 3D23A 1C9TA 1BJUA 3VB3A 2VGCB 3U8RH 1BBRK 3URDA 2ZHDA 1ARBA 1WSSH 1O2MA 2FLRH 3MNCA 4DY7B 1FDPA 1NFWA 1JIRA 1GWAA 3SUDA 3SO3A 1QL9A 3UNRA 2FS9A 1SGNE 1P2MA 1C4V2 2QXIA 1NRSH 3D49H 1GHVH 2BOHB 1T7CA 1GL1A 3E16B 3RLYH 1D6RA 1K1IA 1P3CA 1SGFG 2BDBA 2H5DA 2NU4E 2C8WB 1VITG 6GCHF 3PYHA 3PV5A 4B6EA 1PJPA 1WU1A 2VWLA 4Y7AA 3N7EA 3K6ZA 1BTZA 1CBWB 4MNXA 3S7KB 4ISOA 2JH0D 5DPAA 4DJZB 1SLUB 2ANMH 5JB9S 3OY6U 2PGBB 3VPKA 3I78A 2ULLA 4J2YB 4Y79A 1OX1A 4FVBA 1GJDB 1UCYH 1BZXE 4NG9H 4UFFH 4GCHG 1GI8B 2AMDA 1O2SA 1W7GH 1DDJA 1H9HE 1W2KH 1GMHF 3BV9B 1THSH 5GCHG 1LMWB 1EAXA 2HALA 2ZU4A 5JBCS 1EFRD 3AASA 5A0CA 2Y81A 2JIZD 4O3TA 1PQ7A 1TPAE 1GHAG 3F2HA 1UJ1A 4X1QU 1L1JA 2BDIA 2ZCHP 3NXPA 2G52A 2VH0A 1C1NA 2SGPE 1A5GH 1Z6EA 4YESB 2F9BH 3MO6A 1TGSZ 1RD3B 3ATIA 1CQQA 1E0FD 1EJAA 1P2IA 1YCPK 3GCTF 1H9LB 1AE8H 1AVXA 1XMNB 2PSYA 4WMEA 3SHCH 3KQDA 1AGJA 1BRCE 3F68H 2BDGA 1LPGB 2ZU5A 1V2NT 3FZDA 5B6LA 1YPHC 1GG6B 2BD9A 1GVKB 4MNYA 5DP3A 5T6GA 1MMJN 1RTKA 1V2TT 2JETC 3KNXA 3TVJB 3S0NA 1YC0A 4ABIA 1LVOA 2VIQA 1EZQA 4RT1A 5FPTA 3TLOA 1ESTA 1O0DH 4U30A 4M9FA 5L2YH 1BTYA 3KQCA 1GJ9B 2RA3A 3SNDA 4HI3A 1W10U 7GCHF 1HAZB 4NIXA 3SU0A 1KDQB 1VZQH 2P3FH 1P9UA 1A3EH 3HKIB 1TA6A 1P2NA 2BLOA 1SG8B 3RLWH 3E90B 2R9PA 2TGAA 4NZLA 3M5NA 2B7DH 1QR3E 1TOMH 2QN5T 5FX5A 4UDWH 1GBFA 2ZFQH 1YGCH 1NS3A 4A1XA 4BAMB 1O3BA 3VFEA 1ZGIA 1BRBE 4O9VA 1K1JA 3RXPA 2OBOA 1C5YB 3GDVA 3W95A 3VXFH 1PPHE 3QUMP 1DLKB 1UTOA 3GCHC 2Y5FA 5E0JA 3GS9A 1MH0A 4Y71A 3KQ5A 2Z9IA 4IC5A 1TGCA 2BQ7B 1GJBB 3PWCA 2AEIH 3A7ZA 4OS5A 1WYKA 1FAXA 3I77A 1OP2A 3CNRA 1O38A 3QGNB 2QV1A 5C94A 1OOKB 1EXFA 2RCEA 1F0RA 1SSXA 5K0HA 2G81E 3RMMH 1S6LA 2ZFRH 5FAHA 2ZF0H 3WWFA 1O2RA 2BD8A 4AFQA 2UUJB 1HB0B 1AFQC 1WAYB 2ZTZA 5DO4H 4OS7A 4K1EA 1T4VH 1VCWA 2R0KA 1SGTA 3GY7A 2L74A 2FXRA 2ZU2A 1LCYA 3T29A 1Z1JA 3SJIA 4PROA 4HTCH 2V3OH 4I32A 1V2QT 4D7FA 2D8WA 2ZFFH 5HIZA 3GY6A 4AGJA 1RXPA 4D9RA 4H42U 1O2XA 2QF0A 2VBCA 3OTJE 1EP5A 1KSNA 1MU6B 3BTFE 3RMLH 2V0BA 1O3GA 2P3TB 1KMHB 2J4IA 4MPWA 5BRRE 1TYNA 3ZZAA 2BVRH 5H4IB 2QGRA 1NY22 5E2OA 4AYVB 1A0JA 1BMFD 1P3EA 3BTQE 4A92A 3OU0A 4MLFB 4ACAA 1XVOA 1V2JT 3TJUA 2M2AA 2DE9A 2F43B 2W3KA 2XBVA 4R0IA 1SOZA 3LGWA 1C2KA 2HVXA 1DSTA 1BHXB 1ZHPA 2BOKA 1IQKA 2WZQA 3RM2H 3UQOA 3N99A 1S83A 2FEQH 3PMBB 1XKAC 4JYUH 1LPKB 1T31A 2P95A 3UQVA 3BIVH 2FP7B 4O97A 3SNEA 3DCLA 3CS7A 3UY9A 4I8HA 4ZHMU 1TGBA 1QBNA 3U98H 4J1YA 1QA7A 1ARCA 1YY3A 1Q31A 2CMYA 2BYAX 3FAOA 5BPEA 3RXMA 1O2VA 2RFKC 3LGUA 2I6QA 2UUYA 1MQ6A 1O3NA 1A0LA 1CT4E 1AU8A 1QHRB 2KM0A 1ZPCA 1GBHA 2ZGHA 1CSOE 4Y0YE 1HAYB 5JB8S 1SMFE 5C0TA 4NIYA 3VGCC 1GMDG 4A5TS 3MFJA 1TRYA 2BDCA 2PP6A 1V2ST 3ZV9A 2B8OH 1O3HA 4VGCC 3RXBA 1Z8IB 1F92A 4D7GA 4B71A 1MUEB 4ABFA 2EA3A 6CHAC 1HDTH 2NU3E 1IQMA 1TONA 1K1PA 1WBGB 2Q6FA 2P3UB 1NN6A 1K22H 1ANCA 2FYRA 4BOHA 4P00A 3GY4A 3TJNA 4NA7A 3WWBA 4RT0A 5HGGA 1C5QA 1V2MT 2BTCE 1UCYE 3M5MA 2ESTE 2B0FA 1BT7A 1W0JD 1VCPA 1CHOG 3U1JB 2JETB 3Q3YA 3LT3A 4FUEA 4DIIH 2A4GA 4NCYA 1BMNH 2AYWA 2CHAB 2WHXA 3RXAA 1C1MA 1GBDA 2Q6GA 1TRMA 1C4Y2 1UK2A 1KLIH 1VGCB 4I31A 3KHVA 2SFAA 1O32A 4B74A 3MNXA 4NSVA 2BDHA 3OE7D 3UPEA 3NRLA 3KGPA 1P09A 1GDNA 3DSPA 5EOKA 2LELA 1AY6H 4WMDA 5EXMA 2A45B 3UFAA 3RC6A 4CRCA 1AKSA 1FQ3A 5FX6A 4Q80A 3FP6E 3G01A 3FP7E 4D9QA 1O3EA 3NUMA 4X2VA 1SBWA 4UE7H 2BY9X 4JZ1A 5LGOA 3E1XB 1EAUA 3A8AA 2P93A 1E36B 3QZRA 4AG1A 5DJ7A 2JJ2D 1QBVH 1QURH 1LPZB 4WH8A 2J38A 1XUFA 1XUKA 3FP8E 3UOUA 4XOJA 2ANWA 2ZHEH 3BTDE 1T32A 1VJAU 1B0EA 3RU4D 1N6XA 2Y82A 4H4FA 1O5CB 4INHA 1T8NA 2ZFTA 1C2DA 3OYPA 1ZTKA 1EOLA 3DSOA 2CV3A 1A5IA 4INKA 4YLUA 2H9HA 3TNTA 1K1OA 4GSOA 1AFQB 4GAWA 3RU4E 3S9BA 1PYTC 2BXTH 1HFDA 2A2XH 1MAYA 3KQBA 4ZROA 3DSGA 1DS2E 3M36A 2OD3B 3TNSA 4GHTA 1MABB 2GKVE 1C1TA 3P92A 1NTPA 1GI2A 1CU1A 3PV2A 1OSSA 1WDIA 1TPOA 1OKXA 1ZRBA 3BSQA 5K7RA 3MH7A 4WVPE 1O3KA 1EASA 4HG6A 1CGIE 1JIMA 4RKOB 2BZAA 1ANBA 2F83A 3P70B 1TA2A 1MZAA 3E6PH 3LH3A 2I6SA 3PLPA 1QB1A 2XCFA 2ZG0H 2D2DA 4LK4A 5TJXA 1OXGA 2BX4A 4IS5A 1OP8A 1C1OA 3SV7A 1RTFB 2V35A 2ZU3A 3GY5A 3QWCH 3MI4A 1S0RA 2LP6A 1YPKH 2STBE 1DOJA 2GDDA 3GISB 1TPSA 3HKJB 5PTPA 4RI0A 4FUDA 4E7NA 5DN6D 3RXCA 1GHBG 4FUHA 3E3TA 1O2PA 4FUBA 2CN0H 2H5CA 1BTPA 2Y7XA 3SNCA 2Z3CA 1Y5BT 2ZZUH 4JZFH 1P0SH 2BY8X 2R0LA 1S84A 2VJ1A 1GVLA 1ZYOA 5A8YA 1MKWH 1Y5UT 3KQEA 1XUGA 4BAKB 3TH2H 1TLDA 1TNHA 3RXFA 1XX9A 3AW1A 3TH4H 2B5TB 4NWKA 2Y7ZA 2W7SA 1TNLA 1OYQA 2HLDD 1O2GH 5I46H 1YCPH 1MTNC 3W1EA 1ZRKA 1AKSB 1AUJA 1MZDA 1NZQH 1ELCA 2ZGBH 2AH4X 5DP4A 3T25A 1C5VA 1DPOA 3T62A 4JMYA 1ZMLA 4ABBA 2A1DB 1YPHE 2XRCA 3LC3A 4ZHLU 5JBAS 2PLXA 4KKDA 4U32A 6CHAB 1AVGH 3SBKA 1O5EH 1GMCF 2BDAA 1FZZA 1YM0A 1C2MA 2DE8A 1SLXB 1RIWB 3EA9A 2P16A 1D3TB 1N8OC 5L30H 4X8SH 1DUAA 1O5GH 1YLNA 2WYJA 1GI1A 3RM0H 1TABE 4Y8XA 3MO9A 1CO7E 3R3GB 4DG4A 3A83A 3Q3XA 2L6OA 4XD7D 3FN8A 1OS8A 1J16A 1FIWA 4MG3A 1GJ8B 1YPEH 3LGVA 3BN9A 1Z8GA 1SR5C 2VVCA 3M7QA 1C5RA 1AMHA 1YBWA 1TWXB 1BDAA 4MDSA 3DUXH 1C4U2 2Q1JA 1Y5AT 1AI8H 1MAXA 2ALPA 2V3HH 1Y3UA 3T5FH 2OP9A 1GI4A 1SQTA 2XTTB 3RXDA 3BG4C 2IN2A 1QGFA 2FOGA 3E8LA 3O8DA 2C8XB 1G37A 2R2MB 5HXFA 1G3DA 3HGPA 3K9XB 1QTFA 1UTPA 2Z9LA 2VIWA 5A8XA 3ZZ9A 1W8BH 1HJAC 1WUNH 2BM2A 1GJ4H 3SJ8A 4Y7BA 5C5NA 1TGTA 3S9AA 4ZHAA 5ABWA 1KXCA 2C93B 1PPZA 2BD7A 3UAIC 1SL3A 3ZVCA 1NM6A 2J5UA 4MNVA 5AF9H 1O3IA 2LPRA 3E91A 1W13U 4AC9A 1EZSC 6GCHG 1IAUA 5C17A 1DY8A 4CBOA 5C67A 1P03A 4MPXA 1V2PT 1MKXH 3DFJA 3LGTA 1EJMA 5EODA 4KTSA 1NRPH 4JZEH 2CF8H 4F48B 5E0HA 4ZCNA 1QL7A 4AFSA 1YYY1 5LH8A 2F9VA 5FBIA 4CHAC 4B2CA 2BDYA 3UWJH 1EQ9A 2C90B 2FI3E 5I25A 2HNTC 1EAWA 1O2HA 1GI9B 3HATH 2VB0A 5FPSA 1GMHG 1O31A 2J92A 2FIRH 2NU0E 1O2IA 1S6HA 3M3SA 3MO3A 4ABJA 3OX7U 1EPTB 2WPDD 5DKMA 2K8IA 1QJ1B 2O8WA 2AERH 1QBOA 2FESH 3MTYA 3A89A 4NIWA 2ILNA 2PUQH 2ZC9H 3LU9B 3SV9A 2ZDVH 4ZMAH 2HNTF 5T1VA 3RXTA 3RP2A 2QA9E 1GJ6A 2P8OC 2K0QA 4NFFA 1NO9H 1OPHB 4K1SA 3SV8A 2AMQA 1OYTH 1UTMA 3PTNA 1HAXB 3BTEE 2H2ZA 1FN8A 3KYGA 3STIA 7KMEH 4X2XA 4AZ2B 3MYWA 5CHBA 2AFQB 4KTCA 3H09A 2PR3A 2F9UA 3BG8A 4E7RG 2GT8A 3DT0H 4CRBA 3RUOA 4XBDA 1GBAA 2ZNKH 1BMAA 2HWLB 1ANEA 1VR1H 4AGKA 7LPRA 3VB6A 1O3DA 3TU7H 3A7WA 5DP6A 1GGDC 2PTCE 1Y3VA 2BQ6B 3PTBA 1IHSH 3KL6A 3WW7A 5FHTA 1C5ZB 1F0UA 5CHAC 3BIUH 3BTKE 4WH6A 1GBCA 3ZV8A 2Z3EA 2IJD1 1GPZA 4NA9H 2SNWA 2ZPRA 4X1NU 4OM9A 3D65E 1C2GA 1J14A 2TBSA 3O8BA 4X6OA 3A86A 5HIYA 1GHWH 3A81A 1P06A 1MTNB 3A7TA 4YM9A 1ELTA 1SC8U 2FS8A 1GDQA 3OEED 4IW4E 1AN1E 3MH5A 4MPVA 2WINI 2BY7X 2A5IA 1O2UA 1DWEH 1ZJKA 1TBRH 3B23B 4DT7B 1O3PB 1GJCB 1C5XB 1TQ7B 5E8EH 2ZFPH 3P8FA 4MQAA 1GI3A 1GBIA 1KXDA 2OBQA 1QA0A 1YLDA 1VITF 1SGEE 1V2UT 3RXHA 1ELFA 2EQNA 3PLBA 1Z8JB 1J15A 1GI0A 4O03A 1DXPA 3PRBA 1FNIA 4Y10E 1IOEA 1WTGH 1SPJA 3JZ1B 3V0XA 5GXPA 1BTWA 1CA0B 1FY5A 2W7UA 3H7OA 4CR9A 2K1QA 1ELBA 1TNJA 1QRXA 3SQHE 5GCHF 2EI7A 2XC0A 2UUFB 5HKKD 2Y5GA 2Y5HA 1MD8A 1SVPA
chains in the Genus database with same CATH topology
1JBUH 3BG4B 1O5DH 3ZZ8A 1UK4A 3B9FH 1NU9A 1ZPBA 3ZZCA 4I7YH 2FZZA 8GCHF 2UWLA 2R2WU 2YNBA 5A0AE 3A88A 4KGAA 4ZXYH 5ESBA 2HLCA 3M35A 4K3JA 1HLTH 4LXBH 4AG2A 8ESTE 5DG6A 4I8KA 1D3QB 3UREA 2GDEH 1PYTD 1XXDA 1C1SA 3IG6B 8KME2 1F5KU 3FFGA 3AAUA 3FANA 3SU6A 5EPYA 4RKJB 1ZSLA 1O3MA 1TPPA 2FOMB 4UFEH 4A6LA 3TH3H 1D9IA 2ZQ2A 1Y3YA 4DIHH 1FY1A 1ZGVA 1K9OE 2ZDMA 2PHBA 1O5FH 3MH4A 1AFEH 1XXFA 3U9AH 3OSYA 3KF2A 4M7GA 3L3TA 2ZU1A 4K8YA 1ZPZA 2ZHWH 1CVWH 1LHCH 1O2WA 3TGKE 1YPGH 5AHGH 1ELEE 5EW2H 1C5PA 3EA7A 5C2ZA 1O5BB 2PFEA 2A7JA 4CRFA 3P95A 1TIOA 1P57B 4X1PU 1DITH 4TY7A 5EU8A 1S85A 4B2AA 3RXVA 2G4UA 1NFYA 4JZIA 3ZVBA 1EOJA 5HYOA 4ISHH 3BF6H 4B1TA 1P01A 1J8AA 4TPIZ 1BOQA 1YPLH 2P8OB 2GCHG 1CA8B 1V2WT 5C1UA 3BTME 3F9EA 3P8OA 4Y0ZE 3ODFA 1MBMA 4UFGH 3MU4A 3ESTA 1V3XA 1LKBA 3NZIA 4NA8A 1PPGE 1PPEE 2VIVA 3S7HB 1Q2WA 1U6QA 4UFDH 4DOQA 5E2PA 2W3IA 1Y8TA 1GBEA 4AOQA 1ELGA 3Q77A 2Z3DA 3SJKA 3SUGA 1AQ7A 1SGRE 4H6TA 5L2ZH 1F5LA 3LJJA 2VWNA 3NKKA 5F03A 1BUIA 4XDEA 1GBMA 4WY3A 1SGYE 1O3JA 1TX6A 2PKSC 1KIGH 1TRNA 3R0FA 2QIQA 1GGDB 1Y59T 2PKAA 2BZ6H 1AZ8A 4ZKNU 1BIOA 1C5TA 1Z6JH 5IYTA 1O34A 3BTHE 1UCYK 1CT0E 5EXLA 1B0FA 1W0ZU 1ELVA 2VVUA 2XWAA 5CHAB 2WPIS 3PROA 4NSYA 3FZZA 1KYNA 1IHTH 2XNIA 4X1RU 1ELAA 3HPTB 4TWYA 4D76A 1DY9A 2FO9A 5A2MH 1ZZZA 3A80A 2TGDA 5FBEA 1DE7H 1F7ZA 3F9GA 2WV4A 1G3EA 1A4WH 3MHWU 3ATKA 1UVSH 2A32A 3A7YA 1G30B 2XWBI 1AHTH 1FUJA 1AWFH 1EB1H 4YZUA 1GCDA 1O2TA 1S0QA 2Y6TA 3STJA 4AN7A 4TPYA 2H1UA 1PPBH 1INCA 2ODQA 2OC8A 2C4FH 1L4ZA 4DGJA 3Q76A 4Y6DA 1THPB 2D1JA 1IQJA 2OTVA 3A85A 4TY6A 3RXRA 1BQYA 2FOHA 1O37A 1W11U 3VB5A 2A5AA 5FXLA 1EATA 1UTKA 2VINA 2F91A 4FUIA 3TPIZ 3MNSA 1O36A 3U8OH 1GMDF 1ZMJA 3TITA 1BMMH 2VH6A 2AIQA 1BMLA 2EC9H 2R3UA 1NRQH 3QZQA 5DP5A 5JBTA 2G55A 2QXJA 1C1QA 3UIRA 2GT7A 1H8DH 2FX6A 3GCHB 4MPUA 1TE0A 1UTQA 1HGTH 4AB8A 1K2I1 5C5OA 3CP7A 1C5UA 4I8LA 1G2MA 2OQ5A 1HV7A 3SV6A 1UK3A 3RC5A 4XSKU 3LOXA 4JK5A 2GGVB 2FOCA 1BB0B 2GP9B 2OINA 1B7XB 1JOUB 1OWHA 3O8RA 1Z71A 3TK6A 2JKHA 1MCVA 4ABHA 1C2EA 5LPRA 1V6DA 1ZSKA 1DWDH 3RU4T 3RXUA 4B2BA 2HNTE 1GI6A 1GHZA 4Y8YA 2ZTXA 1P2QA 3NPSA 2FPZA 4IMQA 4ASHA 1CHOF 2VWOA 2WV5A 1PQ8A 3ZZDA 1O2JA 4OS2A 1BBRH 1THRH 4NZQA 2F9PA 2WPHS 1GDUA 3SU2A 1SLWB 3RXQA 2PKAB 3RXSA 1TALA 1LVMA 3ZVGA 1IQFA 2AGGX 2ZCLP 3QLPH 2F3CE 1QCPA 1LQDB 2KAIA 3RMOH 1NROH 2TPIZ 1L4DA 4X6PA 1DFPA 2VGCC 2FX4A 1FPCH 4BAHB 3F9FA 4BAQB 3EQ0H 1WQVH 2SGQE 3U1IB 4ABGA 1RJXB 3FVFB 1GHYH 3MWIU 1K1NA 2O8UA 1HAIH 4X8VH 5JBBS 1P10A 2OC7A 1FI8A 5LPEA 1DICA 1GMCG 1QB6A 1L1GA 2BD4A 1NT1A 1MU8B 2FTMA 1W0YH 4FVDA 2RG3A 2Z94A 1DWBH 1O5AB 2BY6X 4A7IB 1ZHMA 3SJOA 1EKBB 1AVWA 3A87A 1C5MD 1QJ6B 3RDZA 2BY5X 1CBWC 2FOFA 4DCDA 3ZVDA 1AZZA 1K1LA 4K2YA 2CF9H 3ATWA 4BTUB 1ELDE 1O2KA 3SU1A 1A5HA 4CRDA 1DVAH 2BLWA 3KIDU 1C1VH 3VGCB 2JH6D 3V12A 5T3HA 3F1SB 3VB7A 3DD2H 2GX4A 2ZO3H 2C8ZB 4LOYH 2THFB 4VGCB 2J95A 1FONA 5LPFA 3M5LA 4SGBE 4X0WU 2EI8A 3SU3A 4AORA 2J2UA 4RN6A 1P12E 3GOVB 5GWZA 1TB6H 4KP0A 4AYYB 1IQHA 5DP9A 1W3CA 1GG6C 5F8ZA 3PMJA 2G5VA 3KN2A 4TYDA 3M3TA 4O3UA 2A5KA 2VIPA 1O2OA 2PTNA 1XM1A 5B6OA 1HXFH 3BTWE 5EQSA 2VNTA 4WJG2 3RXOA 5EQRA 3F6UH 3ZZBA 2UWPA 4WXVA 1L0ZA 1HIAA 4DVAU 5DGJA 1PPCE 3ATMA 1H1BA 3KEEA 1KXFA 1FIZA 1JRTA 2QXGA 3M5OA 1GHBF 1KXEA 3U8TH 1E34B 2ASUB 1T8LA 4R8TB 1OP0A 3LJOA 1YPMH 1EX3A 4YT6H 2YNAA 1HYLA 4NWLA 4NGAH 2QCYA 5GPIB 2BMGB 2KAIB 1FPHH 3D62A 3TK9A 1BTUA 1HCGA 1ZJDA 1MTVA 2W26A 1P2KA 1A1RA 1D4PB 4WMFA 1PFXC 6ESTA 3EAJA 2NU1E 4OS4A 2C3SA 1K21H 3UTUH 2FLBH 3V13A 1NPMA 4IBLH 1O3LA 3M37A 4X6MA 4BTIB 1Z8RA 1FY4A 4XE4A 2IJOB 2BD3A 4ZKRU 1V2OT 1KTSB 3QO6A 3ZZ4A 3SV2H 2HOBA 3M61U 3PMHB 3T28A 1S81A 1Q3XA 1G2LA 1ESAA 1NRRH 5E0GA 2XCNA 3SU5A 2FI4E 1UTLM 1HUTH 4BXSA 1OWIA 1YP9A 1PQAA 1ZTJA 4UEHH 1ZHRA 1P04A 1KXBA 5F6MA 4E06H 2ODYB 4YLQH 1C1RA 2B9LA 1P11E 3QK1A 2BLVA 1QIXB 3P8NA 1GJ7B 2XC5A 2ZFSA 4DW2U 4ZXXH 3LKWA 4CREA 1K28D 4HZHA 1FV9A 4I8JA 2XW9A 2ZA5A 1TQ0B 3A8CA 3RC4A 4FU7A 4NIVA 4X2YA 1GBJA 2Z9JA 1SHYA 1QFKH 3V3MA 2NU2E 2QYIA 4YOGA 1BTXA 1HAVA 2Z7FE 2AGEX 2WUCA 3BTTE 1ZLRA 3GCTG 3GY3A 4CH8B 3OY5U 4FUGA 3U69H 1A2CH 1D3DB 2GVFA 1W14U 2A7CA 1FN6A 3GY2A 2ZGCA 4CRAA 3L6PA 3VB4A 1Z7KA 3K2UA 3LGIA 1HBTH 2FYQA 3PM3A 4JYTA 4GLYA 1UTNA 1TGNA 3RXKA 1DUEA 5IDKA 2GMTC 2ZHFH 2EI6A 4ABAA 4OS1A 1FY8E 1P02A 4JZDH 1QQ4A 3F9HA 4LZ1H 3EGKH 1BHXF 7GCHG 3EE0B 5ESTE 1BBRE 1MCTA 1KLTA 2D26C 2AMPA 5F8XA 1LDTT 1XVMA 2ZP0H 1XUHA 1HIAB 2PSXA 5T6FA 3LDXH 3MU1A 1FXYA 3SI3H 1DWCH 3QTOH 5F8TA 2GCTC 1ESBA 1GI5A 4AFZA 2G8TA 5HM9A 4CRGA 1M9UA 1ANDA 1W12U 1DM4B 3H7TA 1O30A 4Q7ZA 2EEKA 1HRTH 2QC2A 1SQAA 3ZZ3A 1QL8A 2JH5D 1BA8B 1TNKA 2RDLA 1S6FA 1FAKH 1H9IE 1MKWK 4U01A 5AFZH 1KY9A 1ID5H 1V2KT 1V2VT 3P6ZB 2VIDA 3SW2B 8GCHG 1UVOA 2STAE 1LHEH 1XUIA 1CGJE 5TCAA 3SZNA 4XFQA 1OWKA 2HPQH 1IQGA 2TIOA 3CS0A 1SGQE 2PWXA 2GZ7A 2Y80A 4K69A 1N8OB 1LHDH 1NRNH 2ZDLA 2ZIQH 4E05H 1AO5A 5A09A 2FMJA 4ZKSU 2P94A 1LHGH 4U2WA 1Z1IA 1ZTLA 1AB9C 2ZPQA 3V7TA 1QQUA 1SLVB 1SOTA 7ESTE 4BAOB 4FUJA 5DP8A 1C2HA 1TNIA 2G51A 2VIOA 2H9TH 5AFYH 2CHAC 1SHHB 3ZZ6A 4IC6A 2TGPZ 4Q2KA 4YTAA 1VGCC 4TWWA 4Y11E 4GCHF 2BLQA 3ZVFA 1Y3WA 3P17H 4BNRA 2VWMA 5J4QA 5A0BA 2BHGA 5C1XA 3MU5A 1UVPA 5JPMH 2IOTA 1GBTA 1GHAF 1HAVB 1C5WB 2WPMS 1EJNA 1LKAA 3NCLA 2SGDE 1HJAB 5EPNA 2F9NA 2P59A 4THNH 3ZVEA 2FDAA 2V6NA 5CMXH 1P8VC 3ENSB 3Q00A 1KLJH 4OGXA 1ZOMA 2A4RA 1C1UH 4H6SB 1SGFA 3SUFA 1XUJA 3GCOA 1E38B 3ATLA 4KELA 1QRWA 2PUXB 1TMBH 5TCCA 5DK1A 2C8YB 2ODPA 3GYMA 3LH1A 3A7VA 3UR6A 3RXLA 3BEIB 1YLCA 5FPYA 3ZZ7A 4JYVH 1DX5M 1A61H 3M7UA 1WQSA 2A2QH 4K1TA 1TMTH 1O33A 4JCNA 4CHAB 4YO9A 1D6WA 4Y76A 1ACBE 4KTUA 1O2ZA 1CHGA 3PB1E 2ZDNA 1B5GH 3H5CB 1MKXK 1P2OA 1KTTB 2XBWA 3EA8A 1QNJA 1UVUH 1C5OH 4FU8A 1TNGA 1BJVA 9ESTA 1J17T 4GPGA 3RXEA 2XC4A 4ZUHA 1HAOH 5C20A 2SNVA 2PGQB 1C2IA 1SGCA 5HM2A 3JZ2B 3UR9A 2ANKH 2PW8H 2PV9B 2GZ8A 2AGIX 3VXEH 1TBQH 3K65B 2M5TA 4JK6A 2OQUA 1C2LA 4FUFA 1SQOA 1PPFE 1VITH 2TGTA 2ZECA 1O2YA 1TX8A 1MTUA 3SORA 1UHBA 1IQEA 5C1YA 2OC1A 3EDXB 1SGPE 1CE5A 2XBYA 2QF3A 2WUBA 3GYLB 3Q3KA 3LONA 4I33A 3KCGH 3TGIE 2GMTB 1QB9A 2O8TA 2SGEE 1ETRH 4YT7H 5EXNA 1RGQA 4X1SU 4B75A 2RA0A 1NFXA 2Z6BD 1TOCB 4IN1A 2BVSH 1HJ9A 3SNAA 3LIWA 2G00A 4FUCA 4OGYA 3NWUA 3S9CA 5L6NH 1MTWA 2A4OA 3CENA 4XBBA 3UNQA 2OC0A 2GCTB 3A8BA 3SGAE 5JDUB 2ZTYA 2ZWLH 1E35B 5G4BA 2GZ9A 2XBXA 2GV7A 1DXWA 3SUEA 4OS6A 1CT2E 3A7XA 1RFNA 4FXGH 3W94A 1CGHA 4ABEA 3RMNH 4K60A 1A7SA 2H6MA 1AE5A 1OWJA 3ZYEA 1C5SA 1V2RT 1O2QA 2Z9GA 3PV4A 2LNCA 2ZI2H 2UWOA 4BANB 4CH2B 3S69A 3A84A 3AW0A 1MD7A 1ETSH 5EW1H 3QN7A 1FMGA 5DP7A 1O2LA 1RIWC 2ZDAH 3AVZA 1L2EA 2GCHF 5AVDA 1RRKA 2ALVA 1T8OA 3SHAH 1A3BH 3SU4A 1P05A 2BVXH 2J9NA 1N6YA 1G36A 1KXAA 1LVYA 1SI5H 3L33A 3TIUA 2CJIA 1GJ5H 1OWEA 3EYDA 3SQEE 1AB9B 3PWBA 1GI7B 1C2FA 4BTTB 1LO6A 1T4UH 1G3CA 1BCUH 1MBQA 3MH6A 1NFUA 3BTGE 1O39A 1WV7H 9LPRA 1JMOH 4GHQA 4HFPB 1C5LH 2UUKB 1XKBC 4B73A 3P8GA 2OUAA 3SN8A 1G3BA 2XXLA 1EZUC 3PO1C 1C1WH 1YCPM 1S82A 3WY8A 2A4QA 1NESE 1T8MA 3N7OA 2YOLA 1FLEE 1GCTC 1C9PA 1H4WA 2TRMA 2FOEA 2FOBA 1NU7B 1NC6A 3T2NA 5SGAE 4Z6AH 3GICB 1GBKA 2SGAA 2ZGJA 1UHBB 1G32B 4ESTE 1QY6A 5T6DA 2OXSA 1LTOA 3ITIA 3IWMA 4WF8A 1F0SA 2ANYA 3SOSA 1J9CH 2FOAA 1K1MA 3E0PB 5FCKA 1TFXA 3RXIA 4X8TH 4K8BA 1WCZA 3VEQB 5A8ZA 5C3NA 3UNSA 4ZAEA 5EG4A 1AUTC 5JYIA 3C1KA 2OCVB 3QX5H 2BX3A 2BD2A 4IN2A 3DHKH 4IGDA 1HNEE 4IMZA 1HAGE 1JXPA 3B8JA 4X2WA 4X6NA 1EPTC 4MNWA 3ODDA 2OLGA 4GVUA 4ISLA 1EP6A 2BD5A 4ABDA 1EB2A 2BB4A 1GJAB 1H8IH 3QGJA 2DUCA 3NK8A 3ZYDA 1P9SA 1X7AC 3BEUA 3IITA 4ZH8A 1WOFA 1JRSA 1DT2A 2GD4B 1BRUP 2O8MA 3MU8A 1WTHD 1DLEA 5EGMA 1W7XH 5ETXA 5GJ4B 3GCNA 1RTLA 2O9QA 3A8DA 3RXJA 4WWYA 4YOJA 3SJ9A 3I29A 3MNBA 4DURA 1HJ8A 1L1NA 3DA9B 4BXWA 2QAAA 4X8UH 3ZZ5A 4CR5A 1FJSA 5HMAA 6LPRA 1GHXH 1JWTA 3GDUA 2FTLE 1YKTA 4INLA 1ABIH 5GIBA 2W5EA 1GVZA 4A1VA 1C1PA 3UUZA 2WPJS 1SB1H 2CXVA 2VVVA 4I8GA 1ZR0A 1BRAA 1P2JA 3HGNA 1LHFH 1O3FA 1DSUA 2CGAA 4WXIA 3SGQE 3UWIA