2VINA

Fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
247
structure length
247
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR CHAIN B
publication title Fragment-Based Discovery of Mexiletine Derivatives as Orally Bioavailable Inhibitors of Urokinase-Type Plasminogen Activator
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 61
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vinA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vinA01
2UUKB 1BTXA 5EPYA 5K7RA 1IHSH 2BZAA 2FS8A 1V6DA 1TWXB 4INHA 2OC1A 3P8GA 4FUFA 2WPMS 1HJAC 2YOLA 1A7SA 4MG3A 1ZHPA 5GXPA 1CA0C 1P2JA 1H8IH 2GGVB 1AB9B 2ZF0H 3SHCH 4K60A 4D8NA 1OWDA 4WMFA 2FLBH 3EA8A 4X1NU 3VPKA 4U32A 3MNSA 1YPMH 1CBWC 5F03A 2W7UA 1AN1E 3KNXA 5AVDA 4I33A 1C5ZB 1BHXB 4Y6DA 1BBRH 2ZGCA 1MMJN 3A8CA 2F9NA 1ZR0A 3FAOA 4ABEA 4CRDA 3RC6A 4AN7A 1RIWB 3TNTA 1O2RA 1Z8JB 1TIOA 1KIGH 1TNKA 3RMLH 3L3TA 1O2GH 2VVCA 4FU9A 4JZIA 2IPHA 2VH0A 3BEUA 5HM2A 1VITH 5T6FA 5DP6A 3I78A 3SI3H 3M35A 4IC6A 2A32A 1YLDA 3FZZA 3ZYDA 4YLUA 1LVMA 1V2LT 1D3PB 2ZFQH 1Z8IB 1OWIA 1LTOA 1H1BA 1YGCH 1O2MA 5JB9S 1O3JA 4CR5A 1TONA 2C3SA 2OD3B 1C4V2 3SI4H 1QA7A 3M7TA 3T62A 1HAIH 1SQAA 2OP9A 2ZGBH 2Z9KA 4IW4E 5C3NA 1ELEE 4IGDA 2ZFTA 1C2MA 3F68H 1O3KA 2WINI 1DXPA 1E37B 3PLPA 1NM6A 1PQAA 4ZROA 2I6SA 3OX7U 4AZ2B 1V3XA 2ODPA 1ETTH 3UR6A 4FUCA 4NIXA 1D6RA 1MTVA 3QGNB 3PV4A 4IMQA 4Y8XA 3S0NA 3F6UH 3F9EA 3UQOA 2FOGA 2EI8A 4K8YA 1GJBB 2GMTC 2CV3A 1C5XB 1MH0A 1C1VH 2XCNA 6ESTA 4FUBA 4XOJA 3A84A 2RA0A 3O8RA 2TRMA 2PR3A 1GMDG 1DY9A 3RXBA 1KYNA 4AORA 1P2MA 1BZXE 2A5KA 1KDQA 3GYMA 4DG4A 3PM3A 1WU1A 4WH6A 1WV7H 2R3YA 5A0CA 2QXIA 3A7TA 1GL1A 2FTLE 1UTNA 1Z8RA 4I7YH 7GCHF 1P8VC 4K1TA 1C5OH 3M3VA 2ZU5A 3HKIB 3NZIA 1O2UA 4TWYA 1NFYA 1GPZA 3QUMP 1EKBB 4U30A 2F9OA 2ANMH 4AB9A 5HXFA 1GGDB 1THPB 4KELA 1ABJH 2FTMA 2FIRH 3IG6B 4HI3A 1A46H 1T8LA 1RRKA 2PTCE 4X1PU 1G3BA 2UUYA 1TGBA 3PO1C 1JIMA 4Q2KA 1B5GH 1G3EA 1CA8B 1GMHF 2HVXA 1HAOH 1C1QA 1OXGA 2ANKH 1L4DA 3TU7H 1UHBA 1MZDA 4MNXA 4WH8A 3RMNH 3M5OA 3ATLA 1QL7A 2J9NA 3FFGA 1Z6EA 3K65B 2QAAA 2BD5A 3DFLA 5E0JA 1DOJA 5CHAC 1D6WA 3SQEE 1YCPM 3TNSA 1GJCB 3KEEA 1HV7A 1TFXA 1PQ7A 3VXFH 1MD7A 4THNH 1VCQA 1G36A 5GCHG 2BX3A 2ZFRH 1P01A 3SOSA 1PPFE 1TNLA 2ZPSA 3TGIE 1C2GA 1ELCA 2FOMB 3KQDA 1E35B 4J2YB 2A0QB 1ARBA 1K9OE 4Y76A 2AERH 2B0FA 3SNCA 1GI7B 2ANYA 3MO9A 2ZU4A 3P8FA 1LPZB 4X8SH 4AGKA 1F5KU 5AFZH 3TK6A 2VIPA 1P3CA 1TQ7B 3KN2A 1IQGA 2JH5D 1F92A 2BD2A 2UUJB 3BIVH 3SJ9A 3NWUA 2EI7A 1A5GH 1HAGE 3SU0A 1C2LA 1P09A 4OS5A 5ESBA 4B2CA 4BTTB 1ELVA 1SL3A 3A7YA 1CHOG 4AYYB 1ELFA 1PPGE 1L1GA 5DJ7A 1VITG 4BNRA 1GHZA 4AG1A 1BJVA 1FY4A 2RA3A 1O2KA 2GCTC 1DWDH 4GUXA 2NU1E 4AG2A 2A4GA 1FONA 2CGAA 1QQ4A 1N6XA 1UTOA 2ZU2A 1QFKH 1GHBF 1ZLRA 1C5SA 1PPCE 1Y5AT 4YT6H 2J38A 3QO6A 4Y0YE 1AZ8A 1JWTA 1BQYA 1GBLA 2BY6X 4O97A 2PFEA 2UWLA 1QQUA 4PROA 5K0HA 4IN2A 4X0WU 2H6MA 4B76A 1O5GH 4WXIA 2FEQH 2BQ6B 4WMEA 1YPEH 1KLTA 3H7TA 3QGJA 2DE9A 2GCHG 3QX5H 1EJAA 1EP6A 1ZYOA 2AIPA 4DIIH 1O3NA 1A61H 1C5WB 4BXWA 1SI5H 2FOFA 3BSQA 1AQ7A 1W11U 2XBXA 3BN9A 3MFJA 1EPTB 1W2KH 3HGNA 4TY6A 3SJKA 3SZNA 1LKBA 5LH8A 3SV7A 2AH4X 3U1IB 2ZDAH 2PGQB 2IN2A 1X7AC 3VFEA 1O3HA 1O3OA 1RS0A 5F8TA 4J1YA 1ZPBA 2J4IA 3K2UA 3DUXH 1JRSA 2P16A 4YTAA 4ZXXH 2GKVE 5BPEA 1TMUH 3TJVA 4BTUB 1O31A 1VJAU 1BB0B 1ACBE 1TMTH 1TQ0B 1V2TT 1TA6A 2BLQA 2BVSH 3Q3KA 3Q3XA 3QK1A 4I32A 1Z71A 5A0BA 3RXHA 4AGJA 1C5LH 4AFUA 2VWLA 1EB2A 3TLOA 1C4Y2 3HPTB 4AB8A 5TCCA 2RCEA 4MNVA 1ESTA 1Y3WA 5H4IB 4TY7A 1ID5H 1DWCH 4O9VA 1A3EH 2NWNA 2GV7A 1A3BH 1GBCA 2FX6A 3ZZ6A 4SGBE 2QIQA 1O2ZA 2R0LA 1VR1H 3LU9B 4MVNA 1BTWA 3U8TH 2Q6FA 3A8BA 1MQ6A 1LHCH 2VNTA 2RDLA 2O8TA 1NRNH 4FU7A 1UVUH 1SGFA 1KSNA 5FX5A 1O35A 1O2TA 5LPRA 2PKSB 2FLRH 4FUGA 1CVWH 3BTDE 1CT0E 1SVPA 1C2KA 2G5NA 2XRCA 1TYNA 3Q77A 4NWLA 3LDXH 4YOGA 2Y5HA 1BMNH 1TGNA 4FUDA 2P8OC 1GI0A 4Z6AH 2Z7FE 3RXSA 3QWCH 5EQQA 1AI8H 3RLYH 4X6PA 1QNJA 2BVRH 5DKMA 3GY5A 3NK8A 1AFEH 3V3MA 3M5NA 4K3JA 3BTFE 3DD2H 5E8EH 2ALPA 1DY8A 4YZUA 3SHAH 1QCPA 1UJ1A 3GCHC 1QRZA 1L0ZA 1O0DH 2OC0A 3K9XB 1T4UH 3ZVFA 1GCTC 3OSYA 1TNJA 2B5TB 2Y82A 3L33A 1SGNE 3P92A 1ZMJA 1S81A 1J14A 1O5AB 2A31A 4NWKA 1AE8H 4KP0A 2FYRA 3RXTA 3TK9A 4Q7XA 1QB9A 1UTPA 2CHAB 5EGMA 2P94A 1GBFA 2TGDA 4UDWH 8GCHF 1TX7A 4CBOA 1FJSA 4MPVA 2YNAA 3VEQB 3B9FH 2H9HA 1GHXH 1DM4B 2Z94A 4CHAB 1F5RA 1YLCA 3UREA 3SJIA 2AIQA 2Y5GA 4DOQA 3A7WA 3ATMA 1ELGA 4D9RA 1QHRB 2PTNA 3VB5A 1ZRBA 1AVXA 1C2JA 3JZ2B 3RXFA 4E05H 6CHAC 1RTKA 1D3TB 4JK5A 2HPQH 1K1OA 5HMAA 1AUJA 1LVYA 1O3CA 1TA2A 2BD4A 4D9QA 2BD7A 3HKJB 2OINA 1HPGA 3BG4C 3HK6B 1B0FA 2ZC9H 2Y7ZA 3ZVAA 2JETB 2WPIS 1BJUA 1CGHA 4X2VA 2ZU3A 1HJAB 3RXKA 2SGQE 3PLBA 1CQQA 4KTUA 2A4RA 1QIXB 1TOMH 5A8XA 5DP7A 1O3GA 1ANBA 2ZCHP 3FVFB 1PPHE 4XBDA 4LK4A 1CBWB 1RGQA 1TE0A 3IWMA 4AOQA 1KTTB 3E90B 1ORFA 4JMYA 5JDUB 1SPJA 5IYTA 1LKAA 1EZSC 1AFQB 2Y7XA 2FM2A 4GHQA 2R9PA 4Y7AA 1P3EA 5FPTA 1O2SA 3T27A 4ZHAA 1O30A 1GBJA 1GI8B 5J4SA 2BLOA 2ZCLP 1AU8A 1O2JA 4AFSA 1MTNB 1UVPA 2BD9A 1GBEA 3PTNA 1C5TA 5CMXH 3SV2H 5F8XA 5JBBS 5EXMA 1GG6B 4OGXA 3UFAA 4I8GA 2BQWB 1C1TA 1EZXC 2QF3A 2OTVA 1QB1A 3M61U 3SGBE 1ETSH 1SLUB 3ZVEA 4Y10E 1K21H 1SFQB 4DY7B 1QTFA 4IBLH 5DP4A 3A88A 3QTOH 3RXAA 3KHVA 1O2OA 1C1SA 1RXPA 3LONA 5C1XA 1A5HA 3SNBA 1UCYE 4OS2A 3BEIB 3ZZ7A 1L4ZA 3LH3A 1S6HA 3LGVA 3UUZA 3ZZ4A 3T29A 4UD9H 3SU2A 5LPFA 2ZDNA 5FCRA 3EAJA 2BY5X 4GCHF 1O5CB 4TYDA 3RMOH 4MNWA 5EQSA 4K5ZA 4NG9H 2PKAB 2WV5A 1LDTT 1Q2WA 1TRMA 1JMOH 4IMZA 1GJDB 1OP8A 2BY7X 1F7ZA 1SGQE 1QJ6B 3SUEA 2WUCA 1WTHD 2WV4A 4DCDA 4FVDA 4LXBH 2W3IA 3E6PH 1VCWA 2V3OH 1C2DA 2VVUA 3ATWA 3RM0H 3ZVGA 4A6LA 1TPSA 5G4BA 3S9AA 1J9CH 1HIAA 1M9UA 4ISLA 4ZKOU 3SU5A 4VGCC 1SOZA 1EAWA 4DIHH 5I25A 3KGPA 1V2NT 3MNBA 2QV1A 1E38B 2O8MA 1QL9A 1XMNB 1MKWH 1SGPE 1XKAC 4E7NA 1LO6A 4GAWA 1S0QA 1DVAH 4LOYH 3RXMA 3AW0A 1TBQH 6LPRA 1SHYA 4NCYA 2WYJA 5F8ZA 1NESE 1DX5M 1SOTA 4XBBA 2OLGA 1C2EA 1FY5A 4XDEA 3T28A 3UNSA 1JRTA 1DLEA 1IQIA 1K2I1 1ELTA 1AKSB 3GDSA 3MO3A 1SGCA 1HGTH 3LGIA 1GBAA 5GJ4B 3TIUA 1UK4A 2HGTH 2XTTB 2VIWA 1TMBH 3URDA 5EPNA 1NTPA 1Z7KA 2DUCA 1XUFA 1C5UA 1SLXB 2WUBA 1YM0A 5C20A 3KIDU 1ZTLA 1RFNA 1FIZA 5BRRE 3MH6A 1NFXA 1TALA 2HRVA 3GYLB 3TJOA 5TJXA 1GBDA 4XE4A 1O5DH 1FN8A 5GPIB 3A87A 2VWOA 1PYTD 2LPRA 1SG8B 1DICA 3LH1A 3T5FH 3QTVH 3VB6A 4RSPA 4LZ4B 1K1NA 1Z6JH 3BTGE 4I8HA 1FUJA 4KTCA 1INCA 3MMGA 1OS8A 1O2QA 5JBCS 1F0RA 3M37A 3TH2H 1O2WA 4GVUA 1Y3XA 2FYQA 1MKXK 3ATKA 3UOPA 3LPRA 3ELAH 4I8LA 1O33A 1IQMA 4YOJA 1THRH 3RXJA 3FP7E 1XXFA 5E0GA 2AMDA 4FU8A 1F2SE 1EX3A 3PROA 4X8VH 1BBRK 1ANEA 1ZJDA 4CRGA 4A1VA 1WCZA 3ATIA 1L2EA 5EXNA 5AHGH 1HNEE 1OSSA 1XUGA 3GDVA 2PSXA 4A1TA 5IDKA 1GJ9B 4GHTA 3S9BA 1W8BH 3VB3A 2OCVB 1CT4E 4ZKNU 1AWHB 3VXEH 2FWWA 2CXVA 3RXEA 2BMGB 3P8NA 4ZXYH 1MUEB 4B74A 3UQVA 1V2QT 1P05A 1C1NA 3Q00A 2ZECA 1ELAA 1CT2E 2W26A 2Z9JA 2A7CA 1WQSA 1ZOMA 3KQBA 5F6MA 2ZIQH 3PWCA 7ESTE 3PMHB 1O2LA 3CS7A 3SQHE 1EJMA 2ZNKH 1T8NA 2JH0D 1J17T 4DT7B 3UNRA 1O3LA 5JYIA 1KLJH 4D7FA 2EI6A 1Y3VA 3AASA 3ENSB 1GMCF 5E2OA 1C5MD 4NFFA 1AUTC 4BAOB 2H1UA 4RKJB 2PW8H 1NZQH 1BMAA 1PYTC 1GWAA 1AB9C 3RXPA 2BDGA 2K1QA 4IN1A 1O39A 1FAKH 1IHTH 3LC3A 4ABHA 4ZUHA 3H5CB 5HGGA 1LCYA 5EG4A 1NROH 2A5IA 4X1SU 2ZFPH 2AEIH 1SSXA 3GY7A 5DP3A 3A7XA 1RD3B 1TNHA 4MNYA 4X1QU 1T31A 4MPXA 3UWJH 2ZI2H 3KQEA 4CR9A 3V7TA 2PHBA 1HAYB 1O32A 1GJ7B 2HWLB 3ZV9A 7GCHG 1GJ6A 1ZSKA 1QRXA 1GDUA 2A4OA 2C8ZB 1VJ9U 3MH5A 4R0IA 1V2WT 1MU8B 5FBIA 1ETRH 1NS3A 1YPJH 1N8OC 3V13A 1LVOA 1EJNA 2SGFE 1LHGH 3SN8A 2D8WA 1A0JA 2F91A 3BG8A 2G55A 1TBZH 3GCNA 2KAIB 1ANDA 1GMHG 1GHVH 2HOBA 1SC8U 3GY4A 4NSYA 2P8OB 3UR9A 5A09A 4ZHMU 1LHFH 1SGTA 2OC7A 3NUMA 2EEKA 1CGIE 1RJXB 4RKOB 1AIXH 5J4QA 1EATA 1NFUA 3I29A 1TGSZ 2XWAA 3PTBA 1BDAA 2FMJA 2Z3CA 4AFQA 2ZGJA 3A86A 9LPRA 4JCNA 4ABGA 1KXBA 3UPEA 1YKTA 3GCHB 1EPTA 3RXLA 1GBTA 1TNIA 2A5AA 3DFJA 4B73A 4SGAE 1TRYA 1GCTB 1SGRE 1TNGA 1TOCB 2VGCB 5T6DA 3ZZBA 1LQEA 2ZHQH 3G01A 1GBIA 1PPEE 4Y0ZE 1BCUH 3SBKA 3BTWE 2H5CA 1YPKH 1BIOA 5A2MH 2GT8A 2FS9A 2FXRA 1KY9A 2AMPA 2F9VA 4OS6A 2BZ6H 1XM1A 2NU3E 2PWXA 1O2NA 1DT2A 1O3IA 1O5FH 1SGYE 1GBKA 1QBVH 1WBGB 3RC5A 1S83A 4I8JA 2SGAA 1FQ3A 1UTKA 3MU0A 3GY2A 1IQEA 2BHGA 1NPMA 1XVOA 4ABIA 1GGDC 4FXGH 1Y5UT 1C2FA 1O5BB 1Q3XA 2SGPE 5T3HA 1V2MT 1MAXA 2XC5A 3SNDA 1A0LA 1MU6B 2ZTZA 4Y11E 5L6NH 1KXEA 1KXDA 3S69A 1HCGA 1O2XA 2FOEA 1BHXF 5ABWA 2C8WB 3RU4E 1SQTA 1GHBG 3SV9A 1PQ5A 3OYPA 1O3PB 1UVSH 4F49A 1UVOA 3RXUA 1GJ4H 2F83A 1MTUA 2ZU1A 2V0BA 5FPYA 1OP2A 2NU2E 1ESAA 3E0NB 3RXVA 1FNIA 2VH6A 3SU1A 1P57B 3AAUA 2J2UA 1O2PA 3E16B 1QB6A 1GHAF 3SJ8A 5C1UA 1GBBA 1UK3A 3V0XA 3A89A 2QY0B 1GVKB 1S85A 5PTPA 3AAVA 1DUAA 4YM9A 2R2WU 4Q7ZA 3GCTF 4R8TB 3SU4A 2Z3DA 3P17H 5L2YH 1HJ8A 2XBVA 1OOKB 2Q6DA 1H8DH 2XNIA 1HDTH 1S6FA 4YESB 4TPYA 2ZCKP 4DJZB 3VB7A 3WY8A 2ZQ1A 1XUHA 2STAE 2BX4A 5A0AE 2VIVA 2W3KA 5EW1H 5DG6A 2QXGA 3U69H 2O9QA 1YCPH 2BM2A 1P0SH 1AWFH 5EU8A 2B9LA 1HAPH 2UWOA 3NKKA 2FX4A 5DP9A 1XUKA 3FANA 4CRFA 1W3CA 1G3DA 3C27B 3EYDA 5EW2H 2VJ1A 4WF8A 2Z9LA 3M7QA 1AZZA 1N1LA 1U6QA 2GT7A 1PQ8A 3MU8A 4NIWA 1C9TA 1GI3A 1OX1A 1C1UH 4B1TA 3D49H 1BA8B 1XXDA 1MTWA 4JZFH 2G00A 2BVXH 1FDPA 3SUDA 3E0PB 4MPUA 5FBEA 1C2IA 6GCHF 1LPGB 1GL0E 3W94A 1WYKA 4K8BA 4AFZA 1NRRH 1C4U2 1T32A 1TPAE 2XCFA 5ETXA 4CH2B 1W0ZU 4Q80A 1P02A 1BMLA 1C1MA 3A7ZA 3M3TA 4M7GA 2LNCA 1EZUC 3W95A 2D1JA 2EA3A 3SW2B 4NA8A 1BRAA 1EPTC 2QC2A 1FPHH 2F9UA 5GWZA 2V35A 2SGDE 1SLWB 1UCYH 3LGWA 4X2XA 5E2PA 3QDZB 1MBMA 1G3CA 1J8AA 2O8UA 1OWJA 3TH4H 5DGJA 2QGRA 1O5EH 2Y5FA 1QBOA 3A8AA 2FDAA 1CA0B 4I31A 2QA9E 2YNBA 3RXDA 4B2BA 1CGJE 1SGDE 5EQRA 1OKXA 1ZGVA 2ASUB 1YPHC 3UTUH 4BXSA 4CH8B 2BDHA 3BIUH 3EDXB 1TPPA 8GCHG 3TPIZ 1V2RT 2G52A 3PMAB 1CE5A 1C1OA 2Y81A 1NU7B 1IQNA 1FXYA 4NIYA 3PWBA 4K69A 1NRSH 2OC8A 2A1DB 3ZZ8A 5C1YA 6GCHG 1DITH 1FLEE 3PYHA 4ABFA 4H6TA 2ZZUH 1UTMA 3EQ0H 5SGAE 3TGKE 3KQCA 4ZKSU 3E8LA 1W7GH 2H9EH 1C5YB 4U01A 1MD8A 3CS0A 3KF2A 1E0FD 2WPLS 2F9BH 3MWIU 2PKSC 3M36A 4NA9H 2XWBI 4DW2U 4KGAA 2AFQB 2PKAA 3EA9A 3UIRA 1TBRH 1ZGIA 4ISNA 1XVMA 1HYLA 3B23B 3MU1A 2PUXB 3U1JB 1V2OT 4JZ1A 4WY3A 3ZZ5A 2C8YB 3GY8A 2Q6GA 1F5LA 1S5SA 2ALVA 3OY5U 3U8RH 1G2LA 1HUTH 2FPZA 3T2NA 1G30B 1FAXA 5C5OA 4E7RG 1ZRKA 1K1JA 1E36B 1ZMLA 3OTJE 4Y8ZA 2VINA 1TX8A 1PFXC 4NZLA 1W0YH 1Y3YA 3RC4A 4HZHA 1HAZB 3EGKH 4ESTE 1OWKA 1QJ7B 2HALA 5GDSH 5EODA 4ABAA 1GVLA 2GMTB 3ZYEA 5FPSA 3O8BA 1V2JT 1HAVB 2A2XH 2ZO3H 2NU0E 4X8UH 1Z1IA 2CJIA 4RN6A 4Y7BA 2F9PA 2ZTYA 1T8MA 1LMWB 2Q1JA 2GZ9A 3E91A 4B71A 1ELDE 4NGAH 1YPHE 1VZQH 3B8JA 5L30H 4CHAC 3F1SB 3EE0B 3RP2A 3TVJB 3RXQA 2AS9A 3FZDA 1NT1A 2QYIA 2ZWLH 2QF0A 3RUOA 4BOHA 3A82A 1ZMNA 1IAUA 3NCLA 1AKSA 2XC4A 3BTEE 4K1EA 3VGCC 2AMQA 1GI6A 3QN7A 3R3GB 1UO6A 1LHEH 4GPGA 4X6NA 4WVPE 2QCYA 1ZPZA 2BLWA 3BEFB 2G51A 5A8ZA 4ZH8A 3GY3A 3SO3A 2VWNA 1BTHH 1QGFA 4GCHG 4JZEH 1UTJA 1K1MA 2JETC 2F3CE 3PO1B 5DPAA 4UFDH 4ISHH 2O8WA 2A7HA 1LVBA 4K2YA 3P6ZB 2ZEBA 1UK2A 1NU9A 1TX6A 1P2IA 4BANB 1HIAB 3RXGA 2A2QH 1MKXH 1D3QB 1XUJA 1TABE 3GOVB 1EXFA 5AF9H 5CHAB 1EQ9A 3UY9A 4JK6A 1NN6A 1NO9H 4TPIZ 1GJ8B 4XBCA 1F0TA 3A80A 3MTYA 4CRAA 4E06H 3ODDA 1K22H 3H7OA 3GCOA 4BAHB 1AFQC 1C1PA 1TGTA 1GJAB 8ESTE 1W12U 3ZV8A 1JBUH 2Y6TA 4AX9H 1Y5BT 1D4PB 1GMDF 3A7VA 1V2ST 4YOIA 4TWWA 3PMJA 3DT0H 1O2HA 5EOKA 2ZQ2A 3MH7A 1MTNC 3RXIA 3ZVDA 4GSOA 4ABBA 3S7HB 2XBWA 2GZ7A 2FO9A 1GG6C 2FOBA 3MI4A 5C67A 1TAWA 1MKWK 3VB4A 1FV9A 4KKDA 2P93A 1GVZA 3BTHE 3RLWH 2TGTA 2G8TA 1N8OB 3HATH 2ZHWH 2Z3EA 5ESTE 1YPGH 1CSOE 1D3DB 2GTBA 1IQHA 1P10A 2ZA5A 2AGGX 3K6ZA 3TITA 4INKA 3N7OA 1P06A 4OS1A 1ABIH 3TJNA 1SGEE 2ZGXH 2FOAA 3HK3B 1H9IE 3U9AH 1GHYH 4UEHH 2GDEH 4BAMB 3SORA 3BTTE 3SGQE 2V3HH 1VGCC 1RTLA 1O2VA 2BDIA 2GVFA 4A1XA 1BITA 4I8KA 2GCTB 4A7IB 4OS7A 3TK5A 1C1RA 1V2VT 1C9PA 1WSSH 2V6NA 1H4WA 1HB0B 2C8XB 2STBE 4UONA 2FOHA 3MU5A 2H5DA 1P12E 3OU0A 1BBRE 2ZG0H 1GJ5H 2J95A 1O3EA 2ZDKA 2ILNA 4UFGH 1FPCH 1RTFB 2TBSA 3RU4D 1FZZA 3U8OH 3T26A 2PLXA 4NIVA 5GCHF 2BYAX 2OBOA 3ESTA 3QZRA 3P95A 2BTCE 5B6OA 5C2ZA 4OGYA 3M5MA 1HJ9A 1PJPA 1W7XH 2FODA 2A7JA 1P2QA 3F9HA 2BLVA 1C1WH 3UOUA 4O03A 3E3TA 1SGFG 3I77A 2BD3A 4H4FA 1GBHA 5TCAA 1DSUA 1ARCA 2R2MB 2BDBA 3ZZDA 4ISIH 2VWMA 3GISB 3RDZA 2QN5T 3SJOA 1KDQB 1KTSB 3L6PA 1KLIH 3F9GA 5FXLA 3RM2H 3ZZ9A 1Z1JA 7LPRA 1SB1H 3AW1A 1WQVH 2RG3A 1HAHH 1AGJA 4FUEA 3STIA 1TB6H 1BRCE 2FOCA 3Q3YA 1DANH 1CHOF 2ESTE 1HLTH 4YO9A 5EXLA 5LGOA 1MCTA 1P2OA 5JBTA 1PPBH 4ASHA 1ZPCA 1VITF 3M7UA 1RIWC 1G37A 5A8YA 2B7DH 1JOUB 1O34A 1UTLM 3MU4A 2OUAA 4FUHA 1P2KA 1DUEA 1HFDA 4WXVA 2KAIA 1FN6A 2ZDVH 1O2IA 3A85A 1J16A 3C1KA 2OQ5A 1OWEA 3E1XB 2C90B 1KXCA 3A81A 1ZJKA 1JXPA 3LGUA 1K1PA 2R0KA 3FP8E 3MH4A 1NC6A 2ODYB 4AYVB 3D65E 2WPKS 1O3MA 1XX9A 2ZHEH 4X2WA 1KXFA 1SFIA 2OBQA 1J15A 3LKWA 4X8TH 4XSKU 1UHBB 3OY6U 2XXLA 3GICB 1DSTA 2ZFFH 4XFQA 1TPOA 4X6OA 1XUIA 5DK1A 1OWHA 2GCHF 3LC5A 1GMCG 4O3TA 2GV6A 4NFEA 1QL8A 2EC9H 2BDAA 2G4UA 4DGJA 1CO7E 1DE7H 1MQ5A 2H9TH 1DLKB 1UVTH 1ZTJA 2VIDA 2ZPQA 2CF9H 2TIOA 4MLFB 4Y71A 1QY6A 1FMGA 1K1LA 3URCA 3O8CA 1O38A 1VCPA 1IQLA 1DS2E 3MYWA 1P9SA 2GD4B 1T7CA 3RXCA 4IS5A 1SMFE 2BXTH 3ZZAA 3D23A 2ULLA 2PGBB 3S9CA 2C4FH 4Y8YA 1C5VA 4JYVH 2OQUA 1O37A 4OS4A 8LPRA 5HYOA 4HTCH 2FP7B 3Q76A 8KME2 1HAXB 1FY3A 2BOKA 1FIWA 4WMDA 5I46H 1A4WH 4DURA 3ZZ3A 3SUFA 1KXAA 3LIWA 1EAUA 3A8DA 2VIOA 1F0SA 4A92A 3PB1E 4BAQB 1IOEA 1OYQA 1S82A 2TGAA 2H2ZA 2VU8E 2ANWA 1O3BA 1BMMH 1BOQA 2FZZA 1DDJA 3SNEA 1BTPA 3LT3A 3NPSA 1ELBA 3UNQA 1OYTH 1QR3E 1O36A 1D9IA 2BOHB 2ZTXA 2UUFB 4NZQA 2HPPH 4CRCA 6CHAB 4BAKB 2ZPRA 2VVVA 2JKHA 3ODFA 7KMEH 1QBNA 3M5LA 1A5IA 3BG4B 1ESBA 4Q7YA 2PUQH 3QLPH 1H9LB 1FY8E 4FUJA 5DO4H 5E0HA 3S7KB 3P8OA 2XBYA 4DVAU 1YPLH 4FVBA 1MTSA 3F9FA 3FP6E 1MBQA 2XYAA 4LZ1H 1FY1A 1DFPA 1N6YA 3RXRA 1IQFA 4X1RU 1IQJA 2G5VA 4Y79A 1UTQA 4MQAA 3KCGH 1BTUA 5T6GA 1JIRA 1BRBE 1P9UA 1YP9A 2P3UB 1C5NH 3GDUA 3EA7A 1G2MA 4CRBA 1K28D 4K1SA 1L1JA 2D26C 3TGJE 3MHWU 2WPJS 3KL6A 5FCKA 3PMBB 2QXHA 2I6QA 1TRNA 3MO6A 1EASA 1B7XB 1SLVB 1YYY1 2AYWA 1GI5A 2J94A 2VIQA 1O3DA 2SNWA 1ZZZA 2ZDLA 3O8DA 4D7GA 2Z9IA 1YC0A 2BY9X 4ABDA 1QURH 4UFFH 3P70B 1FI8A 1ZSJA 3BF6H 2ODQA 1T4VH 3TJUA 1TGCA 4YLQH 3DA9B 2WPHS 1G32B 2P3FH 1A2CH 3RXOA 3BV9B 3PLKA 1GI2A 2Y80A 2CN0H 2W7SA 1P2NA 4HFPB 2HNTC 1C5RA 1GBMA 4H6SB 2C93B 2FI5E 4ZHLU 1QRWA 3LGTA 2UWPA 3V12A 2GP9B 2SNVA 2WYGA 2TPIZ 3ZZCA 3BTME 2BXUH 4F4OC 1EZQA 3T25A 1SGIB 4D76A 2ZFSA 4CBNA 1GHAG 3BTKE 4UFEH 1EUFA 1EAXA 1GCDA 1UMAH 2VGCC 4Z0KA 2J92A 1AY6H 1ZHRA 2D2DA 1EOLA 1B0EA 2GDDA 3SU3A 1Y59T 2IOTA 2QXJA 1GHWH 1ZSLA 3GCTG 3IITA 3TH3H 1LQDB 3CP7A 1HBTH 2P3TB 2M5TA 4UE7H 4NA7A 1AO5A 3LGYA 4MPWA 2O8LA 1V2KT 5FHTA 2B8OH 3LOXA 1O3FA 1NY22 1QA0A 1HRTH 3A83A 4VGCB 1P03A 1BUIA 1PPZA 2ZKSA 2XW9A 3R0FA 1IQKA 2FESH 1S0RA 2XC0A 1AVWA 1EB1H 4U2WA 2CMYA 1DXWA 1H9HE 1YCPK 2W5EA 1BTZA 4H42U 3GY6A 5FX6A 3ITIA 3VGCB 2PV9B 1MZAA 1AMHA 2ZHDA 1ZTKA 1W10U 2PSYA 1A0HB 4X2YA 4CREA 2ZP0H 5JBAS 4ISOA 1DPOA 2GX4A 3MNCA 4ZAEA 4MTBA 5JB8S 1LHDH 2BY8X 3CENA 4QT8C 1HXFH 3SV8A 4YT7H 3NXPA 3SV6A 1MAYA 4ZMAH 2NU4E 5LPEA 1GDQA 1THSH 1DWEH 1AD8H 1AE5A 2HNTE 1E34B 2A4QA 1EOJA 1BT7A 1WOFA 3HGPA 1CU1A 5DP5A 3LJOA 1EAIA 1MCVA 2CF8H 1K1IA 2IJOB 1V2UT 3SNAA 1OP0A 1Z8GA 3SGAE 1SBWA 3BTQE 2BD8A 4KTSA 3MOCA 1LPKB 1AHTH 3MNXA 9ESTA 1BRUP 2HLCA 1XKBC 2JH6D 4IC5A 1C5PA 1W13U 4MDSA 1L1NA 1WTGH 1GI9B 2ZGHA 5HM9A 5AFYH 1Q31A 1V2PT 2DE8A 1BTYA 2BDYA 2AGEX 4A5TS 1WUNH 3STJA 3SUGA 2OXSA 1HAVA 1UCYK 1ZHMA 1C2HA 2ZDMA 2HNTF 1AVGH 1Y3UA 2BQ7B 4B75A 1NRPH 2G4TA 5CE1A 1W14U 2Z6BD 1EP5A 5DP8A 4ABJA 2J34A 1SQOA 1YBWA 4O3UA 3ZVBA 1C5QA 2ZHFH 3D62A 1GI4A 2AGIX 4BTIB 1GDNA 2P95A 3QZQA 1Y8TA 1G9IE 1QJ1B 2FI3E 3DHKH 1NRQH 1VGCB 2THFB 4WJG2 5C5NA 3M3SA 1GI1A 3U98H 3UWIA 2CHAC 1SR5C 4JYTA 1WAYB 4JYUH 3K6YA 2G81E 2FI4E 1P04A 3AVZA 1A1RA 1ANCA 2SGEE 3RMMH 5JPMH 2R3UA 2Z9GA 5GIBA 1T8OA 1HXEH 2VB0A 2BDCA 1O3AA 1P11E 1SHHB 2P59A 1CHGA 5FAHA 1S84A 2A45B 2BB4A 5L2ZH 1TLDA 1OPHB 4B2AA 4HGCA 2SFAA 4FUIA 2GZ8A 1DWBH 3RU4T 4ZKRU 4INLA 2TGPZ 1NFWA 4X6MA 1F0UA 4GLYA 3SU6A 3JZ1B 4NSVA 4WWYA 1YF4A 3LJJA 4JZDH 1O2YA 3ZVCA
chains in the Genus database with same CATH superfamily
2UUKB 1BTXA 5EPYA 5K7RA 1IHSH 2BZAA 2FS8A 1V6DA 3OE7D 1TWXB 4INHA 2OC1A 3P8GA 4AC9A 4FUFA 2WPMS 1HJAC 2YOLA 1A7SA 4MG3A 1ZHPA 5GXPA 1CA0C 1P2JA 1H8IH 2GGVB 1AB9B 2ZF0H 3SHCH 4K60A 4D8NA 1OWDA 4WMFA 2FLBH 3EA8A 4X1NU 3VPKA 4U32A 3MNSA 1YPMH 1CBWC 5F03A 2W7UA 1AN1E 3KNXA 5AVDA 4I33A 1C5ZB 1BHXB 4Y6DA 1BBRH 2ZGCA 1MMJN 3A8CA 2F9NA 1E1QD 1ZR0A 3FAOA 4ABEA 4CRDA 3RC6A 4AN7A 1RIWB 3TNTA 1O2RA 1Z8JB 1TIOA 1KIGH 1TNKA 3RMLH 3L3TA 1O2GH 2VVCA 4FU9A 4JZIA 2IPHA 2VH0A 3BEUA 5HM2A 1VITH 5T6FA 5DP6A 3I78A 3SI3H 3M35A 4IC6A 2A32A 1YLDA 3FZZA 3ZYDA 4YLUA 1LVMA 1V2LT 1D3PB 2ZFQH 1Z8IB 1OWIA 1LTOA 1H1BA 1YGCH 3F0PA 1O2MA 5JB9S 1O3JA 4CR5A 1TONA 2C3SA 2OD3B 1C4V2 3DCLA 3SI4H 5DSFA 1QA7A 3M7TA 3T62A 1HAIH 1SQAA 2OP9A 2ZGBH 3FOAA 2Z9KA 4IW4E 5C3NA 1ELEE 4IGDA 2ZFTA 1C2MA 3F68H 1O3KA 2WINI 1DXPA 1E37B 3PLPA 1NM6A 1PQAA 4ZROA 2I6SA 3OX7U 4AZ2B 1V3XA 2ODPA 1ETTH 3UR6A 4FUCA 4NIXA 1D6RA 1FX0B 1MTVA 3QGNB 3PV4A 4IMQA 4Y8XA 5IK2D 3S0NA 3F6UH 3F9EA 3UQOA 2FOGA 2EI8A 4K8YA 1GJBB 2GMTC 1W0JD 2CV3A 1C5XB 1MH0A 1C1VH 2XCNA 6ESTA 4FUBA 1KMHB 4XOJA 3A84A 2RA0A 3O8RA 2TRMA 2PR3A 1GMDG 1DY9A 3RXBA 1KYNA 4AORA 1P2MA 1BZXE 2A5KA 1KDQA 3GYMA 4DG4A 3PM3A 1WU1A 4WH6A 1WV7H 2JJ1D 5C0TA 2R3YA 5A0CA 2QXIA 3A7TA 1GL1A 2FTLE 1UTNA 4YXWD 1Z8RA 4I7YH 7GCHF 1P8VC 4K1TA 1C5OH 3M3VA 2ZU5A 3HKIB 3NZIA 2HLDD 1O2UA 4TWYA 1NFYA 1GPZA 3QUMP 1EKBB 4U30A 2F9OA 2ANMH 4AB9A 5HXFA 1GGDB 1THPB 4KELA 5EIYA 1ABJH 2FTMA 2FIRH 3IG6B 4HI3A 1A46H 1T8LA 1RRKA 2PTCE 4X1PU 1G3BA 2UUYA 1TGBA 3PO1C 1JIMA 4Q2KA 1B5GH 1G3EA 1CA8B 1GMHF 2HVXA 1HAOH 1C1QA 1OXGA 2ANKH 1L4DA 3TU7H 1UHBA 5EJLA 1MZDA 4MNXA 4WH8A 3RMNH 3M5OA 3ATLA 1QL7A 2J9NA 3FFGA 1Z6EA 3K65B 2QAAA 2BD5A 3DFLA 5E0JA 1DOJA 5CHAC 1D6WA 3SQEE 1YCPM 3TNSA 1GJCB 3KEEA 1HV7A 1TFXA 1PQ7A 3F3BA 3VXFH 1MD7A 4THNH 1VCQA 1G36A 3UAIC 5GCHG 2BX3A 2ZFRH 1P01A 3SOSA 1PPFE 2KCOA 1TNLA 2ZPSA 3TGIE 1C2GA 1ELCA 2FOMB 3KQDA 1E35B 4J2YB 2A0QB 1ARBA 1K9OE 4Y76A 2AERH 3GS9A 2B0FA 3SNCA 1GI7B 2ANYA 3MO9A 2ZU4A 3P8FA 1LPZB 4X8SH 4ZCNA 4AGKA 1F5KU 5AFZH 3TK6A 2VIPA 5CDFE 1P3CA 1TQ7B 3KN2A 1IQGA 2JH5D 1F92A 2BD2A 2UUJB 3BIVH 3SJ9A 3NWUA 2EI7A 1A5GH 1HAGE 1H8ED 1C2LA 3SU0A 1P09A 4OS5A 5ESBA 1S6LA 4B2CA 4BTTB 1ELVA 1SL3A 3A7YA 1CHOG 2AHME 4AYYB 1ELFA 1PPGE 1L1GA 5DJ7A 1VITG 4BNRA 1GHZA 4AG1A 1BJVA 4XD7D 1FY4A 2RA3A 2IJD1 1O2KA 2GCTC 1DWDH 4GUXA 2NU1E 4AG2A 2A4GA 1FONA 2CGAA 1QQ4A 1N6XA 1UTOA 2ZU2A 4RT1A 1QFKH 1GHBF 1ZLRA 1C5SA 1PPCE 1Y5AT 4YT6H 2J38A 3QO6A 4Y0YE 1AZ8A 1JWTA 1BQYA 1GBLA 2BY6X 4O97A 2PFEA 2UWLA 1QQUA 4PROA 5K0HA 4IN2A 4X0WU 2H6MA 4B76A 1O5GH 3DSOA 4WXIA 2FEQH 2BQ6B 4WMEA 1YPEH 1KLTA 3H7TA 3QGJA 2DE9A 2GCHG 3QX5H 1EJAA 1EP6A 1ZYOA 2AIPA 4DIIH 1O3NA 1A61H 1C5WB 4BXWA 1SI5H 2FOFA 3BSQA 2RFKC 1AQ7A 1W11U 4RT0A 2XBXA 3BN9A 3MFJA 1EPTB 1W2KH 3HGNA 4TY6A 3SJKA 3SZNA 1LKBA 5LH8A 3SV7A 2AH4X 3U1IB 2ZDAH 2PGQB 2IN2A 3UB0A 1X7AC 1OHHD 3VFEA 1O3HA 1O3OA 1RS0A 5F8TA 4J1YA 1ZPBA 3CNRA 2J4IA 3K2UA 3DUXH 1JRSA 2P16A 4YTAA 4ZXXH 2GKVE 5BPEA 1TMUH 3TJVA 4BTUB 1O31A 1VJAU 1BB0B 4F55A 1ACBE 1TMTH 1TQ0B 1V2TT 1TA6A 1W0KD 2BLQA 2BVSH 3Q3KA 3Q3XA 3QK1A 4ASUD 4I32A 2HVYB 1Z71A 5A0BA 3RXHA 4AGJA 1C5LH 4AFUA 2VWLA 1EB2A 3TLOA 1C4Y2 3HPTB 4AB8A 5TCCA 2RCEA 4MNVA 1ESTA 1Y3WA 5H4IB 4TY7A 1ID5H 1DWCH 4O9VA 1A3EH 2NWNA 2GV7A 1A3BH 1GBCA 2FX6A 3ZZ6A 4SGBE 2QIQA 1O2ZA 5GNDA 2R0LA 1VR1H 3LU9B 4MVNA 1BTWA 3U8TH 2Q6FA 3A8BA 1MQ6A 1LHCH 2LELA 2VNTA 2RDLA 2O8TA 1NRNH 4FU7A 1UVUH 1SGFA 2J98B 1WXRA 1KSNA 5FX5A 1O35A 1O2TA 5LPRA 2PKSB 2FLRH 4FUGA 1CVWH 3BTDE 1CT0E 1SVPA 1C2KA 2G5NA 2XRCA 1TYNA 3Q77A 4NWLA 3LDXH 4YOGA 2Y5HA 1BMNH 1TGNA 4FUDA 2P8OC 1GI0A 4Z6AH 2Z7FE 3RXSA 3QWCH 5EQQA 1AI8H 3RLYH 4X6PA 1QNJA 2BVRH 5DKMA 3GY5A 3NK8A 1AFEH 3V3MA 3M5NA 4K3JA 2VBCA 3BTFE 3DD2H 5E8EH 2ALPA 1DY8A 3F2FA 4YZUA 3SHAH 1QCPA 1UJ1A 3GCHC 1QRZA 1L0ZA 1O0DH 2OC0A 3K9XB 1T4UH 3ZVFA 1GCTC 3OSYA 1TNJA 2B5TB 2Y82A 3L33A 1SGNE 3P92A 1ZMJA 1S81A 1J14A 1O5AB 2A31A 4NWKA 1AE8H 4FOUC 4KP0A 2FYRA 3RXTA 3TK9A 4Q7XA 1QB9A 1UTPA 2CHAB 5EGMA 2P94A 1GBFA 2YMSB 2TGDA 2XNDD 4UDWH 1TX7A 8GCHF 4CBOA 2KCAA 1FJSA 4MPVA 2YNAA 5HIZA 3B9FH 3VEQB 2H9HA 1GHXH 1DM4B 2Z94A 4CHAB 1F5RA 1YLCA 3UREA 3SJIA 2AIQA 2Y5GA 4DOQA 3A7WA 3ATMA 1ELGA 4D9RA 1QHRB 2PTNA 3VB5A 1ZRBA 1AVXA 1C2JA 2J97A 5EJ1A 3JZ2B 3RXFA 4E05H 6CHAC 1RTKA 1D3TB 3N7DA 4JK5A 2HPQH 1K1OA 5HMAA 1AUJA 1LVYA 1O3CA 1TA2A 2BD4A 4D9QA 2BD7A 3HKJB 2OINA 1HPGA 3BG4C 3HK6B 1B0FA 2ZC9H 2Y7ZA 3ZVAA 2JETB 2WPIS 1BJUA 1CGHA 4X2VA 2ZU3A 3KYFA 1HJAB 3RXKA 2SGQE 3PLBA 1CQQA 4KTUA 2A4RA 1QIXB 1TOMH 5A8XA 5DP7A 1O3GA 1ANBA 2ZCHP 3FVFB 1PPHE 4XBDA 4LK4A 2OK5A 1CBWB 3W1EA 1RGQA 1TE0A 3IWMA 4AOQA 1KTTB 3E90B 1ORFA 4JMYA 5JDUB 1SPJA 5IYTA 1LKAA 1EZSC 1AFQB 2Y7XA 2FM2A 4GHQA 2R9PA 4Y7AA 1P3EA 5FPTA 1O2SA 3T27A 1YLNA 1COWD 4ZHAA 1O30A 1GBJA 1GI8B 5J4SA 2BLOA 2ZCLP 1AU8A 1O2JA 4AFSA 1MTNB 1UVPA 2BD9A 1GBEA 3PTNA 1C5TA 5CMXH 3SV2H 5F8XA 5JBBS 5EXMA 1GG6B 4OGXA 3UFAA 4I8GA 2BQWB 1C1TA 1EZXC 2QF3A 2OTVA 1QB1A 2J5UA 3M61U 3SGBE 1ETSH 1SLUB 3ZVEA 4Y10E 1K21H 1SFQB 4DY7B 1QTFA 4IBLH 5DP4A 3A88A 3QTOH 3RXAA 3KHVA 1O2OA 4B6FA 1C1SA 1RXPA 3LONA 5C1XA 1A5HA 3SNBA 1UCYE 4OS2A 3BEIB 3ZZ7A 1L4ZA 3LH3A 1S6HA 3LGVA 3UUZA 3ZZ4A 3T29A 3WW7A 4UD9H 3SU2A 5LPFA 2ZDNA 5FCRA 3EAJA 2BY5X 4GCHF 1O5CB 4TYDA 3RMOH 4MNWA 5EQSA 4K5ZA 4NG9H 2PKAB 2WV5A 1LDTT 1Q2WA 1TRMA 1JMOH 4IMZA 1GJDB 1OP8A 2BY7X 1F7ZA 1SGQE 1QJ6B 3SUEA 2WUCA 1WTHD 2WV4A 4DCDA 2W6ID 4FVDA 4LXBH 2W3IA 3E6PH 1VCWA 2V3OH 1C2DA 2VVUA 3ATWA 3F2HA 3RM0H 3ZVGA 4A6LA 1TPSA 5G4BA 3S9AA 1J9CH 1HIAA 1M9UA 4ISLA 4ZKOU 3SU5A 4VGCC 1SOZA 1EAWA 4DIHH 5I25A 3KGPA 1V2NT 3MNBA 2QV1A 1E38B 2O8MA 1QL9A 1XMNB 1MKWH 1SGPE 1XKAC 4E7NA 1LO6A 4GAWA 1S0QA 1DVAH 4LOYH 3RXMA 3AW0A 1TBQH 6LPRA 1SHYA 4NCYA 2WYJA 5F8ZA 1NESE 1DX5M 1SOTA 4XBBA 2OLGA 1C2EA 1FY5A 4XDEA 3T28A 3UNSA 1JRTA 1DLEA 1IQIA 1K2I1 1ELTA 1E1RD 1AKSB 3GDSA 3MO3A 1SGCA 3ZIAD 1HGTH 3LGIA 1GBAA 5GJ4B 3TIUA 1H8HD 1UK4A 2HGTH 2XTTB 2VIWA 1TMBH 3URDA 5EPNA 2L6OA 1NTPA 1Z7KA 2DUCA 1XUFA 1C5UA 1SLXB 2WUBA 1YM0A 5C20A 3KIDU 1ZTLA 1RFNA 1FIZA 5BRRE 3MH6A 1NFXA 1TALA 2HRVA 3GYLB 3TJOA 5TJXA 1GBDA 4XE4A 1O5DH 1FN8A 5GPIB 3A87A 2VWOA 1PYTD 2LPRA 1SG8B 1DICA 3LH1A 3T5FH 3QTVH 3VB6A 4RSPA 4LZ4B 1K1NA 1Z6JH 3BTGE 4I8HA 1FUJA 4KTCA 1INCA 3MMGA 1OS8A 1O2QA 5JBCS 1F0RA 3M37A 3TH2H 1O2WA 4GVUA 1Y3XA 2FYQA 1MKXK 3ATKA 3UOPA 1NBMD 3LPRA 3ELAH 4I8LA 1O33A 1IQMA 4YOJA 1THRH 3RXJA 3FP7E 1XXFA 5E0GA 2AMDA 4FU8A 1F2SE 1EX3A 3PROA 4X8VH 1BBRK 1ANEA 1ZJDA 4CRGA 4A1VA 1WCZA 3ATIA 1L2EA 5EXNA 1EFRD 5AHGH 1HNEE 1OSSA 1XUGA 3GDVA 2PSXA 4A1TA 5IDKA 1GJ9B 4GHTA 3S9BA 1W8BH 3VB3A 2OCVB 1CT4E 4ZKNU 1AWHB 3VXEH 2WSSD 2FWWA 2CXVA 3RXEA 2BMGB 3P8NA 3OAAD 4ZXYH 1MUEB 4B74A 3UQVA 1V2QT 1P05A 1C1NA 3Q00A 2ZECA 1ELAA 1CT2E 2W26A 2Z9JA 2A7CA 1WQSA 1ZOMA 3KQBA 5F6MA 2ZIQH 5EJZA 3PWCA 7ESTE 3PMHB 1O2LA 3CS7A 3SQHE 1EJMA 2ZNKH 1T8NA 2JH0D 1J17T 3N7EA 4DT7B 3UNRA 1O3LA 5JYIA 1KLJH 4D7FA 2EI6A 1Y3VA 3AASA 3ENSB 1GMCF 5E2OA 1C5MD 4NFFA 1AUTC 4BAOB 2H1UA 4RKJB 2QF5A 2PW8H 1NZQH 1BMAA 1PYTC 1GWAA 1AB9C 3RXPA 2BDGA 2K1QA 4IN1A 1O39A 1FAKH 1IHTH 3LC3A 4ABHA 4ZUHA 3H5CB 5HGGA 1LCYA 3DSGA 5EG4A 1NROH 2A5IA 4X1SU 2ZFPH 2AEIH 1SSXA 3GY7A 5DP3A 2F4LA 3A7XA 1RD3B 1TNHA 4MNYA 4X1QU 1T31A 4MPXA 3UWJH 2ZI2H 2XOKD 3KQEA 4CR9A 5T1VA 3V7TA 2PHBA 1HAYB 5C94A 1O32A 1GJ7B 2HWLB 3FN8A 3ZV9A 7GCHG 1GJ6A 1ZSKA 1QRXA 1GDUA 2A4OA 2C8ZB 1VJ9U 3MH5A 4R0IA 1V2WT 1MU8B 5FBIA 1ETRH 1NS3A 1YPJH 1N8OC 3F2GA 1LVOA 3V13A 4P00A 1EJNA 2SGFE 1LHGH 3SN8A 2D8WA 1A0JA 2F91A 3BG8A 2G55A 1TBZH 3GCNA 2KAIB 4Z1MD 1ANDA 1GMHG 2K0QA 1GHVH 2HOBA 1SC8U 3GY4A 4NSYA 2P8OB 3UR9A 5A09A 4ZHMU 1LHFH 1SGTA 2KCPA 2OC7A 3NUMA 2EEKA 1CGIE 1RJXB 4RKOB 1AIXH 5J4QA 1EATA 1NFUA 3I29A 1TGSZ 2XWAA 3PTBA 1BDAA 2FMJA 2Z3CA 4AFQA 2ZGJA 2WZQA 3OEED 3A86A 9LPRA 4JCNA 4ABGA 1KXBA 3UPEA 1YKTA 3GCHB 1EPTA 3RXLA 1GBTA 2PP6A 1TNIA 2A5AA 3DFJA 4B73A 4SGAE 1TRYA 1GCTB 1SGRE 1TNGA 1TOCB 2VGCB 5T6DA 3ZZBA 1LQEA 2ZHQH 3G01A 1GBIA 5DN6D 2L74A 1PPEE 4Y0ZE 4B6EA 1BCUH 3SBKA 3BTWE 2H5CA 1YPKH 1BIOA 5A2MH 2GT8A 2FS9A 2FXRA 1KY9A 2AMPA 2F9VA 4OS6A 2BZ6H 1XM1A 2NU3E 2PWXA 1O2NA 1DT2A 1NBME 1O3IA 1O5FH 1SGYE 1GBKA 1QBVH 1WBGB 3RC5A 3OTPA 1S83A 4I8JA 2SGAA 1FQ3A 1UTKA 3MU0A 3GY2A 1IQEA 2BHGA 1NPMA 1XVOA 4ABIA 1GGDC 4FXGH 1Y5UT 1C2FA 1O5BB 1Q3XA 2SGPE 5T3HA 1V2MT 1MAXA 2XC5A 3SNDA 1A0LA 1MU6B 2ZTZA 4Y11E 5L6NH 1KXEA 5C0UA 1KXDA 4TSFD 1HCGA 1O2XA 2EY4C 3S69A 2FOEA 1BHXF 5ABWA 2WPDD 2C8WB 2J98A 1SQTA 3RU4E 1GHBG 3SV9A 1PQ5A 3OYPA 1O3PB 1UVSH 4F49A 1UVOA 3RXUA 1GJ4H 2F83A 1MTUA 2ZU1A 2V0BA 5FPYA 1OP2A 2JIZD 2NU2E 1ESAA 2IPQX 3E0NB 3RXVA 1FNIA 2VH6A 3SU1A 1P57B 3AAUA 2J2UA 1O2PA 3E16B 1QB6A 1GHAF 3SJ8A 5C1UA 4XRNA 1GBBA 3F0OA 1UK3A 3V0XA 3A89A 2QY0B 1GVKB 1S85A 5PTPA 3AAVA 1DUAA 4YM9A 2R2WU 4Q7ZA 3GCTF 4R8TB 3SU4A 2Z3DA 3P17H 5L2YH 1HJ8A 2XBVA 1OOKB 2Q6DA 1H8DH 2XNIA 1HDTH 1S6FA 4YESB 4TPYA 2ZCKP 4DJZB 3VB7A 3WWBA 3WY8A 2ZQ1A 1XUHA 2STAE 2BX4A 5A0AE 2VIVA 2W3KA 5EW1H 5DG6A 2QXGA 3U69H 2O9QA 1YCPH 2BM2A 1P0SH 1AWFH 5EU8A 1YWUA 2B9LA 1HAPH 1MABB 2UWOA 3NKKA 2FX4A 5DP9A 1XUKA 3FANA 4CRFA 1W3CA 1G3DA 3C27B 3EYDA 5EW2H 2VJ1A 4WF8A 2Z9LA 1WDIA 3M7QA 1AZZA 1N1LA 1U6QA 2GT7A 1PQ8A 3MU8A 4NIWA 1C9TA 1GI3A 1OX1A 1C1UH 4B1TA 3D49H 1BA8B 3KQ5A 1XXDA 1MTWA 3EE7A 4JZFH 2G00A 2BVXH 1FDPA 3SUDA 5FL7D 3E0PB 4MPUA 5FBEA 1C2IA 6GCHF 1LPGB 1GL0E 3W94A 1WYKA 4K8BA 4AFZA 1NRRH 1C4U2 1T32A 1TPAE 2XCFA 5ETXA 4CH2B 1W0ZU 4Q80A 1SKYE 1P02A 1VKYA 1BMLA 1C1MA 3A7ZA 3M3TA 4M7GA 5KGOA 2CK3D 2LNCA 1EZUC 3W95A 2D1JA 2EA3A 3SW2B 4NA8A 1BRAA 1EPTC 2QC2A 1FPHH 2F9UA 5GWZA 2V35A 2SGDE 1SLWB 1UCYH 3LGWA 4X2XA 5E2PA 3QDZB 2F43B 1MBMA 1G3CA 1J8AA 2O8UA 1OWJA 3TH4H 5DGJA 2QGRA 1O5EH 3PV2A 2Y5FA 1QBOA 3A8AA 2FDAA 1CA0B 4I31A 2QA9E 2YNBA 3RXDA 4B2BA 1CGJE 1SGDE 5EQRA 1OKXA 1ZGVA 2ASUB 1YPHC 3UTUH 4BXSA 4CH8B 2BDHA 3BIUH 3EDXB 1TPPA 3VG8A 8GCHG 4ACAA 3TPIZ 1V2RT 2G52A 3PMAB 1CE5A 1C1OA 2Y81A 1NU7B 1IQNA 1FXYA 4NIYA 5KECA 3PWBA 4K69A 1NRSH 2OC8A 2A1DB 3ZZ8A 2W6JD 5C1YA 6GCHG 1DITH 1FLEE 3PYHA 4ABFA 4H6TA 2ZZUH 1UTMA 3EQ0H 5SGAE 3TGKE 3KQCA 4ZKSU 3E8LA 1W7GH 2H9EH 1C5YB 4U01A 1MD8A 3CS0A 3KF2A 1E0FD 2WPLS 2F9BH 3MWIU 2PKSC 3M36A 4NA9H 2XWBI 4DW2U 4KGAA 4P02A 2AFQB 2PKAA 3EA9A 3UIRA 1TBRH 1ZGIA 4ISNA 1XVMA 1HYLA 3B23B 3MU1A 2PUXB 3U1JB 1V2OT 3OEHD 4JZ1A 4WY3A 3ZZ5A 2C8YB 3GY8A 2Q6GA 1F5LA 1S5SA 2ALVA 3OY5U 3U8RH 1G2LA 1HUTH 2FPZA 3T2NA 1G30B 1FAXA 5C5OA 4E7RG 1ZRKA 1K1JA 1E36B 1ZMLA 3OTJE 4Y8ZA 2VINA 1TX8A 1PFXC 4NZLA 1W0YH 2KR7A 1Y3YA 3RC4A 4HZHA 1HAZB 3EGKH 4ESTE 1OWKA 1QJ7B 2HALA 5GDSH 5EODA 4ABAA 1GVLA 2GMTB 3ZYEA 5FPSA 3O8BA 1V2JT 1HAVB 2A2XH 2ZO3H 2NU0E 4X8UH 1Z1IA 2CJIA 4RN6A 4Y7BA 2F9PA 2ZTYA 1T8MA 2YMSC 1LMWB 2Q1JA 2GZ9A 3E91A 4B71A 1ELDE 4NGAH 1YPHE 1VZQH 3B8JA 5L30H 4CHAC 3F1SB 3EE0B 3RP2A 3TVJB 3RXQA 2AS9A 3FZDA 1NT1A 2QYIA 2ZWLH 2QF0A 3RUOA 4BOHA 3A82A 4DT4A 1ZMNA 1IAUA 3NCLA 1AKSA 2XC4A 3BTEE 4K1EA 3VGCC 2AMQA 1BMFD 1GI6A 3QN7A 3R3GB 1UO6A 1LHEH 4GPGA 4X6NA 4WVPE 2QCYA 3DSPA 1ZPZA 2BLWA 3BEFB 2G51A 5A8ZA 4ZH8A 3GY3A 3SO3A 3MQKC 2VWNA 1BTHH 1QGFA 4GCHG 4JZEH 1UTJA 1K1MA 2JETC 2F3CE 3PO1B 5DPAA 4UFDH 4ISHH 2O8WA 2A7HA 1LVBA 4K2YA 3P6ZB 2ZEBA 1UK2A 1NU9A 1TX6A 1P2IA 4BANB 1HIAB 3RXGA 2A2QH 1MKXH 1D3QB 1XUJA 1TABE 3GOVB 1EXFA 5AF9H 5CHAB 1EQ9A 3UY9A 4JK6A 3PV5A 1NN6A 1NO9H 4TPIZ 2JJ2D 2QE7D 1GJ8B 4XBCA 1F0TA 3A80A 4Q63A 3MTYA 4CRAA 4E06H 3ODDA 1K22H 3H7OA 3GCOA 4BAHB 1AFQC 1C1PA 1TGTA 1GJAB 8ESTE 1W12U 3ZV8A 1JBUH 2Y6TA 4AX9H 1Y5BT 1D4PB 1GMDF 3A7VA 1V2ST 4YOIA 4TWWA 3PMJA 3DT0H 1O2HA 5EOKA 2ZQ2A 3MH7A 1MTNC 3RXIA 3ZVDA 4GSOA 4ABBA 3S7HB 2XBWA 2GZ7A 2FO9A 1GG6C 2FOBA 3MI4A 5C67A 1TAWA 1MKWK 3VB4A 1FV9A 4KKDA 2P93A 1GVZA 3BTHE 3RLWH 2TGTA 2G8TA 1N8OB 3HATH 2ZHWH 2Z3EA 5ESTE 1YPGH 1CSOE 1D3DB 2GTBA 1IQHA 1P10A 2ZA5A 2AGGX 3K6ZA 3TITA 4INKA 3N7OA 1P06A 4OS1A 1ABIH 3TJNA 1SGEE 2ZGXH 2FOAA 3HK3B 1H9IE 3U9AH 1GHYH 4UEHH 2GDEH 4BAMB 3SORA 3BTTE 3SGQE 2V3HH 1VGCC 2JDID 1RTLA 1O2VA 2BDIA 2GVFA 4A1XA 1BITA 4I8KA 2KFWA 3FKSD 2GCTB 4A7IB 4OS7A 3TK5A 1C1RA 1V2VT 1C9PA 1WSSH 2V6NA 1H4WA 2KM0A 1HB0B 2C8XB 2STBE 4UONA 2FOHA 3MU5A 2H5DA 1P12E 3OU0A 1BBRE 2ZG0H 1GJ5H 2J95A 1O3EA 2ZDKA 2ILNA 4UFGH 1FPCH 1RTFB 2TBSA 3RU4D 1FZZA 3U8OH 3T26A 2PLXA 4NIVA 5GCHF 2BYAX 2OBOA 3ESTA 3QZRA 3P95A 2BTCE 5B6OA 5C2ZA 4OGYA 3M5MA 1HJ9A 3PRBA 1PJPA 1W7XH 2FODA 2A7JA 1P2QA 3F9HA 2BLVA 1C1WH 3UOUA 4O03A 3E3TA 1SGFG 3I77A 2BD3A 4H4FA 1GBHA 5TCAA 1DSUA 1ARCA 2R2MB 2BDBA 3ZZDA 4ISIH 2VWMA 3GISB 3RDZA 2QN5T 2V7QD 3SJOA 1KDQB 1KTSB 3L6PA 1KLIH 3F9GA 5FXLA 3RM2H 3ZZ9A 1Z1JA 7LPRA 1SB1H 3AW1A 1WQVH 2RG3A 3PRDA 1HAHH 1AGJA 4FUEA 3STIA 1TB6H 1BRCE 2FOCA 3Q3YA 1DANH 1CHOF 2ESTE 1HLTH 4YO9A 5EXLA 5LGOA 1MCTA 1P2OA 5JBTA 1PPBH 4ASHA 1ZPCA 1VITF 2KZ4A 3M7UA 1RIWC 1G37A 5A8YA 2B7DH 1JOUB 1O34A 1UTLM 3MU4A 2OUAA 4FUHA 1P2KA 1DUEA 1HFDA 4WXVA 2KAIA 1FN6A 2ZDVH 1O2IA 3A85A 5HKKD 1J16A 3C1KA 2OQ5A 2V3MA 1OWEA 3E1XB 2C90B 1KXCA 3A81A 1ZJKA 1JXPA 2KCYA 3LGUA 1K1PA 2R0KA 3FP8E 3MH4A 1NC6A 2ODYB 4AYVB 3D65E 2WPKS 1O3MA 4OM9A 1XX9A 2ZHEH 4X2WA 1KXFA 1SFIA 2OBQA 1J15A 3LKWA 4X8TH 4XSKU 1UHBB 3OY6U 2XXLA 3GICB 1DSTA 2ZFFH 4XFQA 1TPOA 4X6OA 1XUIA 5DK1A 1OWHA 2GCHF 3LC5A 1GMCG 4O3TA 2GV6A 4NFEA 1QL8A 2EC9H 4ACBA 2BDAA 2G4UA 4DGJA 1CO7E 1DE7H 1MQ5A 2H9TH 1DLKB 1UVTH 1ZTJA 2VIDA 2ZPQA 2CF9H 2TIOA 4MLFB 4Y71A 1QY6A 2QF4A 1FMGA 1K1LA 3URCA 3O8CA 1O38A 1VCPA 1IQLA 1DS2E 3MYWA 1P9SA 2GD4B 1T7CA 3RXCA 4IS5A 1SMFE 2BXTH 3ZZAA 3D23A 2ULLA 2PGBB 3S9CA 2C4FH 4Y8YA 1C5VA 4JYVH 2OQUA 1O37A 4OS4A 8LPRA 5HYOA 4HTCH 2WHXA 2FP7B 3Q76A 4FETA 8KME2 1HAXB 1FY3A 2BOKA 1FIWA 4WMDA 5I46H 1A4WH 4DURA 3ZZ3A 3SUFA 1KXAA 3LIWA 1EAUA 3A8DA 2VIOA 5B6LA 1F0SA 2GJGA 4A92A 3PB1E 4RI0A 4BAQB 2M2AA 1IOEA 1OYQA 1S82A 2TGAA 2H2ZA 2VU8E 2ANWA 2K8IA 1O3BA 1BMMH 1BOQA 3AK5A 2FZZA 1DDJA 3SNEA 1BTPA 3LT3A 3NPSA 1K0HA 1ELBA 3UNQA 1OYTH 1QR3E 1O36A 1D9IA 2BOHB 2ZTXA 2UUFB 4NZQA 2HPPH 4CRCA 6CHAB 4BAKB 2ZPRA 2VVVA 2JKHA 3ODFA 7KMEH 1QBNA 3M5LA 1A5IA 3BG4B 1ESBA 4Q7YA 2PUQH 3QLPH 1H9LB 1QZ8A 1FY8E 4FUJA 5DO4H 5E0HA 3S7KB 3P8OA 2XBYA 4DVAU 1YPLH 4FVBA 1MTSA 3F9FA 3FP6E 3FO8D 1MBQA 2XYAA 4LZ1H 1FY1A 1DFPA 1N6YA 3RXRA 1IQFA 4X1RU 1IQJA 2G5VA 4Y79A 5CHBA 1UTQA 4MQAA 3KCGH 1BTUA 5T6GA 1JIRA 1BRBE 1P9UA 1YP9A 2P3UB 1C5NH 3GDUA 3EA7A 1G2MA 4CRBA 1K28D 4K1SA 1L1JA 2D26C 3TGJE 3MHWU 2WPJS 3KL6A 5FCKA 3PMBB 2QXHA 2I6QA 3KYGA 1TRNA 3MO6A 1EASA 1B7XB 1SLVB 1YYY1 2AYWA 1GI5A 2J94A 2VIQA 1O3DA 2SNWA 1ZZZA 2ZDLA 5F53A 3O8DA 4D7GA 2Z9IA 1YC0A 2BY9X 4ABDA 1QURH 4UFFH 3P70B 1FI8A 1ZSJA 1YY3A 3BF6H 2ODQA 1T4VH 3TJUA 1TGCA 4YLQH 4HG6A 3DA9B 2WPHS 1G32B 2P3FH 1A2CH 1E79D 3RXOA 3BV9B 3PLKA 1GI2A 2Y80A 2CN0H 2W7SA 1P2NA 4HFPB 2HNTC 1C5RA 4F48B 1GBMA 4H6SB 2C93B 2FI5E 3WWFA 4ZHLU 1QRWA 3LGTA 2UWPA 3V12A 2GP9B 2SNVA 2WYGA 2TPIZ 3ZZCA 3BTME 2BXUH 4F4OC 1EZQA 3T25A 1SGIB 4D76A 2ZFSA 4CBNA 1GHAG 3BTKE 4UFEH 1EUFA 1EAXA 1GCDA 1UMAH 2VGCC 4Z0KA 2J92A 1AY6H 1ZHRA 2D2DA 1EOLA 1B0EA 2GDDA 3SU3A 1Y59T 2IOTA 2QXJA 1GHWH 1ZSLA 3GCTG 3IITA 3TH3H 1LQDB 3CP7A 1HBTH 2P3TB 2M5TA 3NRLA 4UE7H 4NA7A 1AO5A 3LGYA 4MPWA 2O8LA 1V2KT 5FHTA 2B8OH 3LOXA 1O3FA 1NY22 1QA0A 1HRTH 3A83A 4VGCB 1P03A 1BUIA 1PPZA 2ZKSA 2XW9A 3R0FA 1IQKA 2FESH 1S0RA 2XC0A 1AVWA 1EB1H 4U2WA 2CMYA 1DXWA 1H9HE 1YCPK 2EQNA 2W5EA 1BTZA 4H42U 3GY6A 5FX6A 3ITIA 3VGCB 2PV9B 1MZAA 1AMHA 2ZHDA 1ZTKA 1W10U 2PSYA 1A0HB 4X2YA 2YMSD 4CREA 2ZP0H 5JBAS 4ISOA 1DPOA 2GX4A 3MNCA 4ZAEA 4MTBA 5JB8S 1LHDH 2BY8X 3CENA 4QT8C 1HXFH 3H09A 3SV8A 4YT7H 3NXPA 3SV6A 1MAYA 4ZMAH 2NU4E 5LPEA 1GDQA 2LP6A 1THSH 1DWEH 1AD8H 1AE5A 2HNTE 1E34B 3U28C 2A4QA 1EOJA 1BT7A 4Q4LA 4TT3D 1WOFA 3HGPA 1CU1A 5DP5A 3LJOA 1EAIA 1MCVA 2CF8H 1K1IA 2IJOB 1V2UT 3SNAA 1OP0A 1Z8GA 3SGAE 1SBWA 3BTQE 2BD8A 4KTSA 3MOCA 1LPKB 1AHTH 3MNXA 9ESTA 1BRUP 2HLCA 5HIYA 1XKBC 2JH6D 4IC5A 1C5PA 1W13U 4MDSA 1L1NA 1WTGH 1GI9B 2ZGHA 5HM9A 5AFYH 1Q31A 1V2PT 2DE8A 1BTYA 2BDYA 2AGEX 3SYJA 4A5TS 1WUNH 3STJA 3SUGA 1UCYK 1HAVA 2OXSA 1ZHMA 1C2HA 3N99A 2ZDMA 2HNTF 1AVGH 1Y3UA 4M9FA 2BQ7B 4B75A 5KEDA 1NRPH 2G4TA 4I86A 5CE1A 1W14U 2Z6BD 1EP5A 5DP8A 4ABJA 2J34A 2RDEA 1SQOA 1YBWA 4O3UA 3ZVBA 1C5QA 2ZHFH 3D62A 1GI4A 2KX4A 2AGIX 4BTIB 1GDNA 2P95A 3QZQA 2WV9A 1Y8TA 1G9IE 1QJ1B 3SZEA 2FI3E 3DHKH 1NRQH 1VGCB 2THFB 4WJG2 5C5NA 3M3SA 1GI1A 3U98H 3UWIA 2CHAC 1SR5C 4JYTA 1WAYB 4JYUH 3K6YA 2G81E 2FI4E 1P04A 3AVZA 1A1RA 1ANCA 2SGEE 3RMMH 5JPMH 2R3UA 2Z9GA 5GIBA 1T8OA 1HXEH 2VB0A 2BDCA 1O3AA 1P11E 1SHHB 2P59A 1CHGA 5FAHA 1S84A 2A45B 2BB4A 5L2ZH 1TLDA 1OPHB 4B2AA 4HGCA 2SFAA 1UW7A 4FUIA 1SQRA 2GZ8A 1DWBH 3RU4T 4ZKRU 3OFND 4INLA 2TGPZ 1NFWA 4X6MA 5C17A 1F0UA 4GLYA 3SU6A 3JZ1B 4NSVA 4WWYA 1YF4A 3LJJA 4JZDH 1O2YA 3ZVCA
chains in the Genus database with same CATH topology
2UUKB 1BTXA 5EPYA 5K7RA 1IHSH 2BZAA 2FS8A 1V6DA 1TWXB 4INHA 2OC1A 3P8GA 4FUFA 2WPMS 1HJAC 2YOLA 1A7SA 4MG3A 1ZHPA 5GXPA 1CA0C 1P2JA 1H8IH 2GGVB 1AB9B 2ZF0H 3SHCH 4K60A 4D8NA 1OWDA 4WMFA 2FLBH 3EA8A 4X1NU 3VPKA 4U32A 3MNSA 1YPMH 1CBWC 5F03A 2W7UA 1AN1E 3KNXA 5AVDA 4I33A 1C5ZB 1BHXB 4Y6DA 1BBRH 2ZGCA 1MMJN 3A8CA 2F9NA 1ZR0A 3FAOA 4ABEA 4CRDA 3RC6A 4AN7A 1RIWB 3TNTA 1O2RA 1Z8JB 1TIOA 1KIGH 1TNKA 3RMLH 3L3TA 1O2GH 2VVCA 4FU9A 4JZIA 2IPHA 2VH0A 3BEUA 5HM2A 1VITH 5T6FA 5DP6A 3I78A 3SI3H 3M35A 4IC6A 2A32A 1YLDA 3FZZA 3ZYDA 4YLUA 1LVMA 1V2LT 1D3PB 2ZFQH 1Z8IB 1OWIA 1LTOA 1H1BA 1YGCH 1O2MA 5JB9S 1O3JA 4CR5A 1TONA 2C3SA 2OD3B 1C4V2 3SI4H 1QA7A 3M7TA 3T62A 1HAIH 1SQAA 2OP9A 2ZGBH 2Z9KA 4IW4E 5C3NA 1ELEE 4IGDA 2ZFTA 1C2MA 3F68H 1O3KA 2WINI 1DXPA 1E37B 3PLPA 1NM6A 1PQAA 4ZROA 2I6SA 3OX7U 4AZ2B 1V3XA 2ODPA 1ETTH 3UR6A 4FUCA 4NIXA 1D6RA 1MTVA 3QGNB 3PV4A 4IMQA 4Y8XA 3S0NA 3F6UH 3F9EA 3UQOA 2FOGA 2EI8A 4K8YA 1GJBB 2GMTC 2CV3A 1C5XB 1MH0A 1C1VH 2XCNA 6ESTA 4FUBA 4XOJA 3A84A 2RA0A 3O8RA 2TRMA 2PR3A 1GMDG 1DY9A 3RXBA 1KYNA 4AORA 1P2MA 1BZXE 2A5KA 1KDQA 3GYMA 4DG4A 3PM3A 1WU1A 4WH6A 1WV7H 2R3YA 5A0CA 2QXIA 3A7TA 1GL1A 2FTLE 1UTNA 1Z8RA 4I7YH 7GCHF 1P8VC 4K1TA 1C5OH 3M3VA 2ZU5A 3HKIB 3NZIA 1O2UA 4TWYA 1NFYA 1GPZA 3QUMP 1EKBB 4U30A 2F9OA 2ANMH 4AB9A 5HXFA 1GGDB 1THPB 4KELA 1ABJH 2FTMA 2FIRH 3IG6B 4HI3A 1A46H 1T8LA 1RRKA 2PTCE 4X1PU 1G3BA 2UUYA 1TGBA 3PO1C 1JIMA 4Q2KA 1B5GH 1G3EA 1CA8B 1GMHF 2HVXA 1HAOH 1C1QA 1OXGA 2ANKH 1L4DA 3TU7H 1UHBA 1MZDA 4MNXA 4WH8A 3RMNH 3M5OA 3ATLA 1QL7A 2J9NA 3FFGA 1Z6EA 3K65B 2QAAA 2BD5A 3DFLA 5E0JA 1DOJA 5CHAC 1D6WA 3SQEE 1YCPM 3TNSA 1GJCB 3KEEA 1HV7A 1TFXA 1PQ7A 3VXFH 1MD7A 4THNH 1VCQA 1G36A 5GCHG 2BX3A 2ZFRH 1P01A 3SOSA 1PPFE 1TNLA 2ZPSA 3TGIE 1C2GA 1ELCA 2FOMB 3KQDA 1E35B 4J2YB 2A0QB 1ARBA 1K9OE 4Y76A 2AERH 2B0FA 3SNCA 1GI7B 2ANYA 3MO9A 2ZU4A 3P8FA 1LPZB 4X8SH 4AGKA 1F5KU 5AFZH 3TK6A 2VIPA 1P3CA 1TQ7B 3KN2A 1IQGA 2JH5D 1F92A 2BD2A 2UUJB 3BIVH 3SJ9A 3NWUA 2EI7A 1A5GH 1HAGE 3SU0A 1C2LA 1P09A 4OS5A 5ESBA 4B2CA 4BTTB 1ELVA 1SL3A 3A7YA 1CHOG 4AYYB 1ELFA 1PPGE 1L1GA 5DJ7A 1VITG 4BNRA 1GHZA 4AG1A 1BJVA 1FY4A 2RA3A 1O2KA 2GCTC 1DWDH 4GUXA 2NU1E 4AG2A 2A4GA 1FONA 2CGAA 1QQ4A 1N6XA 1UTOA 2ZU2A 1QFKH 1GHBF 1ZLRA 1C5SA 1PPCE 1Y5AT 4YT6H 2J38A 3QO6A 4Y0YE 1AZ8A 1JWTA 1BQYA 1GBLA 2BY6X 4O97A 2PFEA 2UWLA 1QQUA 4PROA 5K0HA 4IN2A 4X0WU 2H6MA 4B76A 1O5GH 4WXIA 2FEQH 2BQ6B 4WMEA 1YPEH 1KLTA 3H7TA 3QGJA 2DE9A 2GCHG 3QX5H 1EJAA 1EP6A 1ZYOA 2AIPA 4DIIH 1O3NA 1A61H 1C5WB 4BXWA 1SI5H 2FOFA 3BSQA 1AQ7A 1W11U 2XBXA 3BN9A 3MFJA 1EPTB 1W2KH 3HGNA 4TY6A 3SJKA 3SZNA 1LKBA 5LH8A 3SV7A 2AH4X 3U1IB 2ZDAH 2PGQB 2IN2A 1X7AC 3VFEA 1O3HA 1O3OA 1RS0A 5F8TA 4J1YA 1ZPBA 2J4IA 3K2UA 3DUXH 1JRSA 2P16A 4YTAA 4ZXXH 2GKVE 5BPEA 1TMUH 3TJVA 4BTUB 1O31A 1VJAU 1BB0B 1ACBE 1TMTH 1TQ0B 1V2TT 1TA6A 2BLQA 2BVSH 3Q3KA 3Q3XA 3QK1A 4I32A 1Z71A 5A0BA 3RXHA 4AGJA 1C5LH 4AFUA 2VWLA 1EB2A 3TLOA 1C4Y2 3HPTB 4AB8A 5TCCA 2RCEA 4MNVA 1ESTA 1Y3WA 5H4IB 4TY7A 1ID5H 1DWCH 4O9VA 1A3EH 2NWNA 2GV7A 1A3BH 1GBCA 2FX6A 3ZZ6A 4SGBE 2QIQA 1O2ZA 2R0LA 1VR1H 3LU9B 4MVNA 1BTWA 3U8TH 2Q6FA 3A8BA 1MQ6A 1LHCH 2VNTA 2RDLA 2O8TA 1NRNH 4FU7A 1UVUH 1SGFA 1KSNA 5FX5A 1O35A 1O2TA 5LPRA 2PKSB 2FLRH 4FUGA 1CVWH 3BTDE 1CT0E 1SVPA 1C2KA 2G5NA 2XRCA 1TYNA 3Q77A 4NWLA 3LDXH 4YOGA 2Y5HA 1BMNH 1TGNA 4FUDA 2P8OC 1GI0A 4Z6AH 2Z7FE 3RXSA 3QWCH 5EQQA 1AI8H 3RLYH 4X6PA 1QNJA 2BVRH 5DKMA 3GY5A 3NK8A 1AFEH 3V3MA 3M5NA 4K3JA 3BTFE 3DD2H 5E8EH 2ALPA 1DY8A 4YZUA 3SHAH 1QCPA 1UJ1A 3GCHC 1QRZA 1L0ZA 1O0DH 2OC0A 3K9XB 1T4UH 3ZVFA 1GCTC 3OSYA 1TNJA 2B5TB 2Y82A 3L33A 1SGNE 3P92A 1ZMJA 1S81A 1J14A 1O5AB 2A31A 4NWKA 1AE8H 4KP0A 2FYRA 3RXTA 3TK9A 4Q7XA 1QB9A 1UTPA 2CHAB 5EGMA 2P94A 1GBFA 2TGDA 4UDWH 8GCHF 1TX7A 4CBOA 1FJSA 4MPVA 2YNAA 3VEQB 3B9FH 2H9HA 1GHXH 1DM4B 2Z94A 4CHAB 1F5RA 1YLCA 3UREA 3SJIA 2AIQA 2Y5GA 4DOQA 3A7WA 3ATMA 1ELGA 4D9RA 1QHRB 2PTNA 3VB5A 1ZRBA 1AVXA 1C2JA 3JZ2B 3RXFA 4E05H 6CHAC 1RTKA 1D3TB 4JK5A 2HPQH 1K1OA 5HMAA 1AUJA 1LVYA 1O3CA 1TA2A 2BD4A 4D9QA 2BD7A 3HKJB 2OINA 1HPGA 3BG4C 3HK6B 1B0FA 2ZC9H 2Y7ZA 3ZVAA 2JETB 2WPIS 1BJUA 1CGHA 4X2VA 2ZU3A 1HJAB 3RXKA 2SGQE 3PLBA 1CQQA 4KTUA 2A4RA 1QIXB 1TOMH 5A8XA 5DP7A 1O3GA 1ANBA 2ZCHP 3FVFB 1PPHE 4XBDA 4LK4A 1CBWB 1RGQA 1TE0A 3IWMA 4AOQA 1KTTB 3E90B 1ORFA 4JMYA 5JDUB 1SPJA 5IYTA 1LKAA 1EZSC 1AFQB 2Y7XA 2FM2A 4GHQA 2R9PA 4Y7AA 1P3EA 5FPTA 1O2SA 3T27A 4ZHAA 1O30A 1GBJA 1GI8B 5J4SA 2BLOA 2ZCLP 1AU8A 1O2JA 4AFSA 1MTNB 1UVPA 2BD9A 1GBEA 3PTNA 1C5TA 5CMXH 3SV2H 5F8XA 5JBBS 5EXMA 1GG6B 4OGXA 3UFAA 4I8GA 2BQWB 1C1TA 1EZXC 2QF3A 2OTVA 1QB1A 3M61U 3SGBE 1ETSH 1SLUB 3ZVEA 4Y10E 1K21H 1SFQB 4DY7B 1QTFA 4IBLH 5DP4A 3A88A 3QTOH 3RXAA 3KHVA 1O2OA 1C1SA 1RXPA 3LONA 5C1XA 1A5HA 3SNBA 1UCYE 4OS2A 3BEIB 3ZZ7A 1L4ZA 3LH3A 1S6HA 3LGVA 3UUZA 3ZZ4A 3T29A 4UD9H 3SU2A 5LPFA 2ZDNA 5FCRA 3EAJA 2BY5X 4GCHF 1O5CB 4TYDA 3RMOH 4MNWA 5EQSA 4K5ZA 4NG9H 2PKAB 2WV5A 1LDTT 1Q2WA 1TRMA 1JMOH 4IMZA 1GJDB 1OP8A 2BY7X 1F7ZA 1SGQE 1QJ6B 3SUEA 2WUCA 1WTHD 2WV4A 4DCDA 4FVDA 4LXBH 2W3IA 3E6PH 1VCWA 2V3OH 1C2DA 2VVUA 3ATWA 3RM0H 3ZVGA 4A6LA 1TPSA 5G4BA 3S9AA 1J9CH 1HIAA 1M9UA 4ISLA 4ZKOU 3SU5A 4VGCC 1SOZA 1EAWA 4DIHH 5I25A 3KGPA 1V2NT 3MNBA 2QV1A 1E38B 2O8MA 1QL9A 1XMNB 1MKWH 1SGPE 1XKAC 4E7NA 1LO6A 4GAWA 1S0QA 1DVAH 4LOYH 3RXMA 3AW0A 1TBQH 6LPRA 1SHYA 4NCYA 2WYJA 5F8ZA 1NESE 1DX5M 1SOTA 4XBBA 2OLGA 1C2EA 1FY5A 4XDEA 3T28A 3UNSA 1JRTA 1DLEA 1IQIA 1K2I1 1ELTA 1AKSB 3GDSA 3MO3A 1SGCA 1HGTH 3LGIA 1GBAA 5GJ4B 3TIUA 1UK4A 2HGTH 2XTTB 2VIWA 1TMBH 3URDA 5EPNA 1NTPA 1Z7KA 2DUCA 1XUFA 1C5UA 1SLXB 2WUBA 1YM0A 5C20A 3KIDU 1ZTLA 1RFNA 1FIZA 5BRRE 3MH6A 1NFXA 1TALA 2HRVA 3GYLB 3TJOA 5TJXA 1GBDA 4XE4A 1O5DH 1FN8A 5GPIB 3A87A 2VWOA 1PYTD 2LPRA 1SG8B 1DICA 3LH1A 3T5FH 3QTVH 3VB6A 4RSPA 4LZ4B 1K1NA 1Z6JH 3BTGE 4I8HA 1FUJA 4KTCA 1INCA 3MMGA 1OS8A 1O2QA 5JBCS 1F0RA 3M37A 3TH2H 1O2WA 4GVUA 1Y3XA 2FYQA 1MKXK 3ATKA 3UOPA 3LPRA 3ELAH 4I8LA 1O33A 1IQMA 4YOJA 1THRH 3RXJA 3FP7E 1XXFA 5E0GA 2AMDA 4FU8A 1F2SE 1EX3A 3PROA 4X8VH 1BBRK 1ANEA 1ZJDA 4CRGA 4A1VA 1WCZA 3ATIA 1L2EA 5EXNA 5AHGH 1HNEE 1OSSA 1XUGA 3GDVA 2PSXA 4A1TA 5IDKA 1GJ9B 4GHTA 3S9BA 1W8BH 3VB3A 2OCVB 1CT4E 4ZKNU 1AWHB 3VXEH 2FWWA 2CXVA 3RXEA 2BMGB 3P8NA 4ZXYH 1MUEB 4B74A 3UQVA 1V2QT 1P05A 1C1NA 3Q00A 2ZECA 1ELAA 1CT2E 2W26A 2Z9JA 2A7CA 1WQSA 1ZOMA 3KQBA 5F6MA 2ZIQH 3PWCA 7ESTE 3PMHB 1O2LA 3CS7A 3SQHE 1EJMA 2ZNKH 1T8NA 2JH0D 1J17T 4DT7B 3UNRA 1O3LA 5JYIA 1KLJH 4D7FA 2EI6A 1Y3VA 3AASA 3ENSB 1GMCF 5E2OA 1C5MD 4NFFA 1AUTC 4BAOB 2H1UA 4RKJB 2PW8H 1NZQH 1BMAA 1PYTC 1GWAA 1AB9C 3RXPA 2BDGA 2K1QA 4IN1A 1O39A 1FAKH 1IHTH 3LC3A 4ABHA 4ZUHA 3H5CB 5HGGA 1LCYA 5EG4A 1NROH 2A5IA 4X1SU 2ZFPH 2AEIH 1SSXA 3GY7A 5DP3A 3A7XA 1RD3B 1TNHA 4MNYA 4X1QU 1T31A 4MPXA 3UWJH 2ZI2H 3KQEA 4CR9A 3V7TA 2PHBA 1HAYB 1O32A 1GJ7B 2HWLB 3ZV9A 7GCHG 1GJ6A 1ZSKA 1QRXA 1GDUA 2A4OA 2C8ZB 1VJ9U 3MH5A 4R0IA 1V2WT 1MU8B 5FBIA 1ETRH 1NS3A 1YPJH 1N8OC 3V13A 1LVOA 1EJNA 2SGFE 1LHGH 3SN8A 2D8WA 1A0JA 2F91A 3BG8A 2G55A 1TBZH 3GCNA 2KAIB 1ANDA 1GMHG 1GHVH 2HOBA 1SC8U 3GY4A 4NSYA 2P8OB 3UR9A 5A09A 4ZHMU 1LHFH 1SGTA 2OC7A 3NUMA 2EEKA 1CGIE 1RJXB 4RKOB 1AIXH 5J4QA 1EATA 1NFUA 3I29A 1TGSZ 2XWAA 3PTBA 1BDAA 2FMJA 2Z3CA 4AFQA 2ZGJA 3A86A 9LPRA 4JCNA 4ABGA 1KXBA 3UPEA 1YKTA 3GCHB 1EPTA 3RXLA 1GBTA 1TNIA 2A5AA 3DFJA 4B73A 4SGAE 1TRYA 1GCTB 1SGRE 1TNGA 1TOCB 2VGCB 5T6DA 3ZZBA 1LQEA 2ZHQH 3G01A 1GBIA 1PPEE 4Y0ZE 1BCUH 3SBKA 3BTWE 2H5CA 1YPKH 1BIOA 5A2MH 2GT8A 2FS9A 2FXRA 1KY9A 2AMPA 2F9VA 4OS6A 2BZ6H 1XM1A 2NU3E 2PWXA 1O2NA 1DT2A 1O3IA 1O5FH 1SGYE 1GBKA 1QBVH 1WBGB 3RC5A 1S83A 4I8JA 2SGAA 1FQ3A 1UTKA 3MU0A 3GY2A 1IQEA 2BHGA 1NPMA 1XVOA 4ABIA 1GGDC 4FXGH 1Y5UT 1C2FA 1O5BB 1Q3XA 2SGPE 5T3HA 1V2MT 1MAXA 2XC5A 3SNDA 1A0LA 1MU6B 2ZTZA 4Y11E 5L6NH 1KXEA 1KXDA 3S69A 1HCGA 1O2XA 2FOEA 1BHXF 5ABWA 2C8WB 3RU4E 1SQTA 1GHBG 3SV9A 1PQ5A 3OYPA 1O3PB 1UVSH 4F49A 1UVOA<