2VINA

Fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR CHAIN B
publication title Fragment-Based Discovery of Mexiletine Derivatives as Orally Bioavailable Inhibitors of Urokinase-Type Plasminogen Activator
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vinA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vinA01
5DG6A 3ZYDA 3PO1C 1PFXC 3BIUH 2A45B 1GHYH 1GMHG 1SGYE 5E0GA 4OGYA 1C2FA 2CMYA 1IQLA 4XFQA 2O8TA 4YLUA 1ELTA 3OTJE 2PR3A 4D9RA 4CHAC 5BPEA 4NZLA 4XBDA 1F2SE 2A2XH 3ZVGA 4KGAA 2GV6A 2ZFTA 1LDTT 1RJXB 2CHAC 4BTTB 1GBFA 8LPRA 5FCRA 2ZHFH 3GDSA 4H4FA 2J94A 1GJCB 1UK2A 1ELEE 1FIWA 5T6GA 4CRCA 1C5NH 2EI8A 3U1JB 2ULLA 1ELFA 1IQFA 5EQSA 3GDVA 3LT3A 1F5RA 1V2PT 3S9BA 1FY4A 1V2JT 3A84A 4Y71A 2J2UA 3A89A 1QL8A 1MCVA 5DO4H 4OGXA 1P06A 1Y3UA 1SGPE 3B9FH 2ZPSA 1FMGA 2SGPE 3RMLH 3QGJA 1Z6EA 1TABE 2ZGCA 1AZ8A 2ZHEH 1NN6A 1EJNA 1C2KA 1QY6A 2A5KA 3NPSA 3PWBA 3R0FA 4MG3A 3RMMH 3RXCA 4YLQH 3RXSA 3MU4A 1P3CA 3CENA 2M5TA 2C3SA 5EXNA 2Z3DA 3Q77A 1UHBB 1QCPA 1BA8B 1FN6A 1DY9A 5E2PA 1TRYA 1O2OA 1T8OA 9ESTA 1GI4A 4MPWA 2BVRH 1O2MA 2IJOB 2TRMA 4B2BA 1Y3XA 1S0RA 4ISNA 1HLTH 3NWUA 3PV4A 3E91A 1NTPA 2A5IA 4HI3A 2ODYB 2QGRA 1ZPCA 1ZJKA 1C1UH 1MKWH 4U01A 1DLEA 3A7ZA 5LPFA 1A0LA 3UQOA 2BD7A 1GBDA 1UMAH 4ASHA 1IQNA 1IHSH 2W7SA 1HB0B 4K2YA 2FODA 1PQ5A 4ZH8A 3RMOH 5LH8A 2OUAA 1C2IA 1J8AA 1G3DA 1JMOH 1FY3A 3ZVBA 1CT0E 1LKBA 1SGCA 3RUOA 3SJIA 1RRKA 3T28A 1ZPBA 3SQEE 4ZHLU 4KKDA 1Z71A 3VB4A 2FESH 1DT2A 3TJOA 1P05A 1GBBA 4A7IB 4ABAA 1MMJN 1DVAH 3A83A 3Q3YA 1ZSKA 4BTUB 1Z6JH 1MTVA 1O5DH 5EXMA 4Q7YA 2O9QA 2QA9E 2BX3A 3M7TA 1O38A 2J38A 4WMEA 1EATA 1SGIB 1TNJA 2W7UA 3MNBA 1GVLA 2A4GA 5G4BA 4MQAA 1TWXB 3AAVA 2PW8H 2BDYA 1BB0B 3F9FA 3VB6A 3NCLA 1W12U 3PLBA 3MFJA 1BBRH 3BEUA 2YOLA 4IN2A 3UUZA 3QWCH 3MH7A 3ZV9A 1GJBB 4I8JA 1TNHA 1ZHRA 1LQDB 3RXPA 3F9HA 3MO6A 1DXPA 1ETSH 3BSQA 3TIUA 1P9UA 3FAOA 5L6NH 2F3CE 2P3FH 2STBE 4I33A 3UFAA 2NWNA 2ZECA 4IW4E 2H5DA 4K5ZA 2BM2A 3KEEA 1DOJA 4E7NA 1MBMA 2BLQA 3V0XA 3SO3A 3LIWA 5E0JA 1QB6A 1O2ZA 1CT2E 5L2YH 1GI8B 2ZQ1A 2AMDA 1AVWA 1P01A 1AY6H 3I78A 3SJOA 4B2AA 1AGJA 1DWDH 1LHCH 1C5QA 4QT8C 4D7GA 2GCTB 1V2RT 5GCHG 1O37A 5DKMA 1TBZH 2HNTE 5EW1H 2XW9A 4LXBH 3TH3H 1TX6A 1XKAC 5IDKA 1UO6A 3GY4A 7KMEH 1O33A 3A8AA 3PM3A 1K1LA 3GY5A 3RXQA 1UTLM 2Z9IA 1TQ7B 1YCPM 1UVPA 2C8WB 1EZUC 3A8CA 3A81A 3TNTA 1QRWA 3RDZA 1W2KH 1BBRK 1KDQA 3EA8A 2BD4A 3NZIA 2BVSH 1EAIA 2HLCA 1GJ6A 1E36B 5TCAA 2JH5D 3BG8A 1H9LB 2BDAA 1LHGH 1NC6A 3RC6A 2FX4A 3TK6A 3KF2A 5JB9S 5FX5A 3MOCA 4FVDA 2V3HH 1UVUH 2BOKA 2QF0A 1AB9C 1AO5A 1Y3VA 2ZFPH 2NU4E 1CGHA 3BTME 1ZYOA 1E34B 1UTMA 2PUXB 4D8NA 1C1OA 3MH4A 1EOLA 1F0RA 3MMGA 1XUKA 1BJUA 1SLXB 4X2YA 3KL6A 4ZXYH 4NG9H 3BIVH 4ZKNU 4SGAE 3M5MA 1IQEA 1HAVA 3GYLB 4HTCH 3TH2H 1KXCA 2F9BH 2BDCA 1TMBH 3SI3H 1X7AC 2W3KA 1O2SA 3I29A 4FUBA 5F03A 1TALA 2BOHB 3STIA 4YM9A 1DSTA 1XUGA 3IWMA 3MU0A 2G4TA 3A7XA 1PQAA 3LONA 3SJKA 5AF9H 4JMYA 3S9AA 3LH1A 2V6NA 1Q3XA 1V2QT 1WYKA 1ELBA 4PROA 4UFDH 3FZDA 1D6WA 2JETB 1BDAA 5EGMA 3SNCA 1K1JA 2WV4A 1EUFA 2ZCLP 3A7YA 2AGGX 2BDGA 4IGDA 3ZV8A 3RU4E 2FO9A 3V3MA 2IOTA 2B8OH 2EA3A 4X8TH 1LHEH 1MQ6A 2A32A 2BHGA 1SMFE 1DY8A 2B7DH 1CBWB 1CHOG 1A7SA 4I8KA 1HAOH 3UOPA 1BITA 1C1SA 1S5SA 1V6DA 4X2WA 3UTUH 2PKAA 4AB9A 3B8JA 3A88A 2R3UA 1S85A 1BHXB 1T8MA 4BAOB 1QTFA 1AFEH 1GG6B 3PTNA 4IMZA 4BXSA 3BTHE 1Y5UT 4K8BA 1YC0A 5E0HA 1Z8GA 3PMBB 1ZTLA 1GGDB 1L0ZA 4GCHG 1GBKA 5ABWA 4BTIB 1EP5A 5HXFA 4CR9A 2G51A 5FBIA 4ABIA 1ZTKA 2BLWA 2VIDA 3ZZ7A 4H6SB 3E16B 2CV3A 3UNRA 4Q2KA 1G2MA 5GXPA 3H5CB 1GI3A 1VZQH 1XUIA 2BZAA 1SBWA 1O5CB 4X1SU 3ZVDA 1WBGB 1HJAB 1O3BA 3BG4C 2FOAA 1GBLA 4RKOB 1ZJDA 4ABJA 3P17H 3LGVA 3QZRA 2Y7XA 3NUMA 1O2TA 2ZP0H 1ELGA 2Z3CA 4WMFA 1MAYA 1HAXB 1V2VT 2NU3E 1IQGA 2BVXH 2FZZA 4JK6A 2VWMA 4MLFB 1EQ9A 1RIWB 1DM4B 4X6MA 3RXKA 3RXLA 2XBWA 4K1EA 1INCA 1NRNH 2XC4A 4OS5A 2BLVA 1TOMH 1O3LA 2BDIA 2AEIH 4ZMAH 3SNDA 1TNLA 5F8TA 1XKBC 2XC0A 5FBEA 2VH6A 1ETRH 1EOJA 3PTBA 4NIVA 5JBCS 4Y76A 2ZHQH 4Y8YA 1BTPA 5HM2A 3ATWA 1AUJA 4AZ2B 1Y8TA 1TRMA 2EC9H 4IC6A 1C5OH 3Q76A 3PROA 4YOJA 1GHWH 2GP9B 1HIAB 1BRAA 1KY9A 2BD2A 1HXEH 1VCWA 4ISIH 3E0NB 1ZRBA 4BNRA 3DD2H 3ZZ5A 3FP8E 1XMNB 3M37A 3BEFB 1K2I1 3GY7A 3OYPA 3RP2A 8GCHF 1F0TA 1C5YB 1O3GA 1THSH 3GY8A 3U98H 1EJMA 5DJ7A 1ZMJA 1SB1H 1CA8B 3F9EA 1HYLA 1IQKA 1C5ZB 4D7FA 5K7RA 3HK3B 1SVPA 1C2JA 4JZFH 1P2OA 4DY7B 5A8XA 2SNVA 5A8ZA 2GDDA 2H9TH 1SLWB 1N6XA 1L4DA 2H2ZA 1QRXA 1O39A 3PLKA 3GCTG 3MU5A 2QYIA 3LGWA 4WVPE 1O3EA 3ENSB 1H9HE 1Z8IB 2GDEH 3L33A 1O3IA 4IC5A 2XXLA 2BY5X 5SGAE 1DICA 3ODFA 3MU1A 1WV7H 1G36A 3VPKA 1EAXA 1AFQB 2JH0D 2FYQA 3GY6A 4Y79A 4H42U 1BIOA 3SUEA 5F8XA 5AVDA 5A0BA 4NIWA 1XXFA 3GYMA 1O3NA 1SQTA 4KTSA 2SGQE 1TGTA 2WYJA 2BQ6B 3DT0H 2Z7FE 1BTWA 4K1SA 4ABBA 3TJVA 2A4OA 3BF6H 7ESTE 1AZZA 2FOEA 1O5AB 1A4WH 1VGCB 3MNSA 1AVXA 5PTPA 3UNQA 1GVKB 3SZNA 1YPLH 3MWIU 5A09A 1C5XB 2QXHA 3GCOA 3V7TA 3TGKE 5L2ZH 4BAKB 1O2KA 2J92A 3GISB 1O2WA 3S0NA 2XWBI 1KXAA 1FY1A 1BBRE 2C8XB 3RU4T 2FOGA 2XC5A 2BYAX 2FOMB 9LPRA 1CA0B 2UUYA 3SN8A 3SJ8A 1GHAG 1RD3B 4DIHH 4HZHA 1SQOA 1GI0A 3PWCA 1TPPA 1ELVA 1K21H 3RXIA 1AHTH 1KXDA 1NZQH 1SHHB 3ATLA 3SU0A 3STJA 5HMAA 1HJ9A 1A5GH 1ZOMA 3M5NA 2C90B 1YKTA 2P8OC 3UOUA 1HAYB 2AMQA 4KELA 3U8RH 2PKSC 3MH6A 3PYHA 4SGBE 3ZZBA 4DOQA 1PPHE 2XNIA 4U2WA 2H6MA 3W94A 2PLXA 4E06H 3LJOA 1AD8H 1GDNA 1OX1A 2UUFB 8ESTE 1OPHB 1H8DH 1S84A 1SQAA 5EW2H 1HJAC 3VXEH 1ARBA 1OWDA 1O3CA 1TX7A 1AKSA 4I8HA 1NRPH 4CR5A 4ABFA 2ALPA 2HPPH 1G3BA 4GLYA 3IITA 1H9IE 1FN8A 3S7HB 1HGTH 2KAIB 5TJXA 1KXFA 4JCNA 1IQIA 2V35A 5FCKA 3FANA 1CVWH 1YPHC 3RXBA 1MKXK 1O5EH 4JZ1A 4TY6A 1EPTC 3C27B 3ATIA 2XWAA 4O97A 4ZROA 1EAWA 4LZ4B 3ATKA 3ATMA 4XE4A 1W7GH 2ANMH 3UREA 2BY9X 4JZDH 2P93A 4NSYA 1NFXA 2D26C 2BD8A 3LJJA 1BTUA 3M35A 2FOBA 4LZ1H 1C5LH 1C5UA 2F9OA 1YCPK 2G81E 3E90B 1ZHMA 4CRBA 2Y82A 4JYVH 4INLA 3FFGA 2OLGA 3UR6A 1TGCA 1J14A 1O3HA 3LOXA 4IN1A 3TK9A 1P9SA 4OS6A 1NU9A 1SL3A 5HYOA 1C1MA 4ZKOU 1GHBF 1FIZA 3BN9A 2SNWA 2ZC9H 2VU8E 4WXVA 4GHTA 3PMHB 4DGJA 1NY22 1ARCA 1C1VH 5BRRE 1HDTH 3EGKH 3M5OA 2SGEE 1L1JA 2PTNA 2Y7ZA 1O3PB 4D9QA 1O2UA 4WY3A 1XX9A 4E05H 4Q80A 5JDUB 4JZEH 1AIXH 3A82A 1TB6H 1KTSB 1F5LA 2TGTA 4X8VH 3GCNA 1GCTB 1AI8H 2ZHWH 4YZUA 3TITA 4UFFH 4OS4A 3MO9A 1BJVA 2AS9A 3NK8A 2I6QA 3E6PH 3BTTE 2C93B 3GCHB 5DGJA 2ZHDA 1ZR0A 2WUCA 1QBOA 1P2QA 3TJNA 1FAKH 1N6YA 1CE5A 2PTCE 2ZEBA 1SGFA 3U8TH 4MPXA 1UK3A 1C2GA 1C5WB 4YOIA 2VWLA 2R9PA 1N8OC 2HRVA 1YPJH 2FEQH 6LPRA 2Y5GA 5GCHF 2O8UA 5CMXH 1T31A 4GPGA 2GT7A 1O30A 1MTSA 1MTNC 1D6RA 1GI2A 2ZFSA 4AFZA 2SGDE 1DWEH 2UUKB 1GBMA 2HVXA 4NWLA 1V2NT 1FNIA 1K1OA 4BOHA 4AORA 3LGTA 3CS0A 1BMMH 1BQYA 2OCVB 3Q00A 5EU8A 2ZQ2A 1LHFH 4NCYA 1W10U 1V2ST 1PYTC 3VEQB 3GDUA 1Y3YA 2SGAA 1C5SA 5EPNA 1C1PA 2Q6FA 2ZGBH 4Q7XA 1O5FH 1RTFB 3SV6A 4JK5A 3U1IB 1NESE 2TBSA 5E8EH 3RXTA 3MI4A 1UCYH 2OQUA 2VGCC 5EQQA 1VJ9U 3E0PB 3SV2H 1SOTA 2RCEA 1VCPA 2AIPA 1C1QA 5C1YA 1BRBE 1ANEA 3MHWU 5LPEA 3ZVCA 1MKWK 3M3VA 1XUJA 1F0SA 3RLYH 3SJ9A 1T8LA 5JYIA 2ZCHP 4AGKA 1TPOA 5B6OA 1S0QA 4TWWA 1WOFA 4UDWH 3EDXB 1FUJA 3HK6B 1OP2A 1GJ9B 1GBJA 1C2EA 4DVAU 1WQVH 5J4QA 1JIMA 3ZZDA 4AFSA 1DANH 1THPB 2Y80A 3B23B 4O3UA 3BTDE 4AYVB 6CHAB 1FXYA 1YPKH 4LOYH 2ZU2A 1CSOE 5GJ4B 1QHRB 1P10A 1OWJA 2ESTE 3K6YA 2Q6GA 3A7WA 3SQHE 1UJ1A 4ZHMU 3I77A 3S7KB 3TH4H 1O2PA 1P0SH 4O9VA 2FLBH 2FMJA 1WQSA 4BXWA 1GJ5H 3NXPA 2FM2A 3M7UA 2BZ6H 5F8ZA 1UTNA 3D65E 3EQ0H 3M3SA 1O35A 4X6OA 4FUFA 1S81A 2Y5FA 1UCYK 4INHA 3SORA 3IG6B 1V2OT 4MNXA 1FY5A 2IPHA 2VVVA 1VITH 2ZDMA 1SI5H 2NU0E 1EJAA 2I6SA 1SGNE 4Q7ZA 6GCHF 4K8YA 4GCHF 2R0LA 2UWOA 4UD9H 5GPIB 1WTGH 4FUHA 3SV7A 1L4ZA 3U69H 1GMDF 1P2NA 2WYGA 3PMAB 4YESB 5GDSH 3ESTA 1GMCF 3T26A 3A87A 4OS2A 2W26A 1YM0A 3VGCB 3AASA 2QXJA 5AFYH 2K1QA 3RXHA 3TNSA 1YGCH 3EYDA 3L6PA 4CH8B 1QJ6B 1ZMLA 4AX9H 4ZXXH 1CGIE 4X0WU 2GCHG 1THRH 2PWXA 3MNXA 2C8YB 4NIXA 3RMNH 1QFKH 4MPVA 1C5MD 1ACBE 4YT7H 3RXGA 3RXAA 2HWLB 1PPZA 2ALVA 1ABIH 3O8CA 1XUFA 1OWHA 3AW1A 2AGEX 2ZFRH 4RSPA 4B2CA 3VB5A 1ZSLA 1TONA 4JYTA 1BCUH 1GBIA 1C9TA 1A3EH 3DFJA 1EX3A 2AMPA 4GUXA 1C5TA 1ZSJA 3SNEA 1TA2A 1UTOA 1SC8U 1EZSC 3C1KA 1E37B 1LHDH 1Q31A 2AIQA 2F83A 1HAVB 2Z9KA 3QGNB 3UIRA 4NFFA 1G3EA 1LKAA 1GL0E 3HKIB 3T25A 1YPEH 1ANDA 1LVMA 1A5HA 2P3UB 3FP7E 1KYNA 1QIXB 3OSYA 4X1NU 2XBXA 3RXVA 2FI3E 2GTBA 1A1RA 3KQCA 5EQRA 1LPZB 4VGCB 1G32B 3KQEA 2FX6A 1TOCB 1MH0A 2ZFFH 3SW2B 4CREA 2IN2A 1NM6A 2RA0A 2XBVA 2R2MB 1EB1H 4X1PU 1GI5A 4U32A 1O2VA 2O8MA 1EPTA 1HV7A 2VIPA 1O31A 1FZZA 3KIDU 1EB2A 1TMTH 5AFZH 3LGUA 5JBTA 3BEIB 1H8IH 1P09A 4B73A 3ZVEA 3MO3A 2WPKS 3RXOA 1O2HA 4NIYA 1ZPZA 4FUDA 2VIQA 2OP9A 3UY9A 4MTBA 1TGNA 4TPIZ 1FY8E 2PKAB 1J15A 2BDHA 4DW2U 2QV1A 4XOJA 3LGIA 3LGYA 7GCHF 1E0FD 3DUXH 5C5OA 5DP8A 3PO1B 1TMUH 1HIAA 2GZ7A 2OD3B 4FUJA 1K28D 5C20A 5C3NA 3A7VA 1TFXA 3QO6A 1XM1A 4NFEA 3EA7A 1Z1IA 2CN0H 1JBUH 1OWIA 1HNEE 1PJPA 1NFWA 4DJZB 3EE0B 1B5GH 4CHAB 3MTYA 3SU6A 3P8OA 1TNIA 5DP5A 2ZTYA 3SUDA 1MTWA 3LC3A 2CHAB 2PSXA 3M5LA 2P59A 2TPIZ 5DP6A 1IOEA 1GJ7B 1BTHH 1QQUA 1MUEB 4NWKA 2AGIX 5DP4A 2XRCA 3TK5A 5F6MA 5FPYA 2J4IA 3D62A 3SHAH 4Z0KA 3ZZCA 3VB3A 2Q1JA 4AGJA 1ESAA 2GCTC 1BTXA 2ZNKH 4AB8A 4XDEA 1S6FA 1K22H 1L2EA 2VWNA 3BTEE 1ID5H 3KNXA 3ELAH 4NA9H 1BHXF 1A3BH 1WUNH 5DP9A 4AYYB 1MTUA 4OS1A 2GV7A 1OP0A 1GHAF 1PPCE 4K60A 1G30B 3RXDA 2YNBA 2WV5A 3RM0H 2SGFE 3D23A 3SNBA 2QC2A 1LCYA 2QF3A 2VWOA 2RDLA 2Z9JA 1O2QA 1QNJA 1PQ8A 1K1NA 2GZ8A 1O0DH 1DXWA 2ZU3A 3BTWE 3UWJH 5HM9A 1G3CA 1QJ7B 5A2MH 1W13U 3T27A 5AHGH 2JH6D 3VXFH 1DLKB 2VIVA 2ZTZA 4ESTE 2VNTA 1KXEA 2GD4B 1FPHH 1NS3A 2GT8A 2UUJB 1P02A 4K69A 2OC8A 4Y10E 1HAIH 5JBAS 2WUBA 3T29A 3QTOH 1IQMA 3GY2A 3URCA 2PFEA 2B0FA 2D8WA 4WF8A 5L30H 2ZI2H 1AVGH 1BRCE 3ZYEA 1F0UA 1SPJA 2ZF0H 4I8GA 2A2QH 4RKJB 2ZPRA 4AFUA 4O03A 1O5BB 6ESTA 2XYAA 4J2YB 1GMHF 3SGBE 3ZZ3A 1CQQA 1OYTH 1GJ4H 3OX7U 1BUIA 2AERH 2F9PA 1VITG 2AH4X 5T6DA 1M9UA 5EXLA 3QUMP 2XBYA 3BTQE 1LMWB 2JETC 4I32A 1VCQA 4BAMB 1C5PA 2XCNA 4BAQB 4X2VA 3RXEA 1UCYE 4HGCA 3F1SB 2PHBA 1GPZA 1PPGE 2Y6TA 3PMJA 4NGAH 2FDAA 2GGVB 3P92A 4CBNA 5CE1A 5JB8S 1AUTC 3SUGA 1G2LA 1ZRKA 2ZKSA 1OKXA 1CBWC 2F9VA 3QX5H 3GOVB 3KQBA 1ESTA 3SBKA 1A46H 5HGGA 2ZWLH 1ELCA 1BT7A 2R3YA 4ABGA 4FUCA 1RTLA 1ABJH 1ZHPA 2H5CA 1A61H 1GG6C 3E1XB 3H7TA 2O8LA 2WPHS 1GGDC 1UK4A 1K9OE 2B5TB 1XVOA 4JYUH 3MU8A 4A1TA 1LVYA 4VGCC 1OS8A 1O2LA 2EI6A 1V2TT 1C9PA 5T6FA 3NKKA 1ORFA 1QBVH 2ZDAH 1P3EA 4X1RU 1S83A 3V13A 2F91A 2ZG0H 1Z8RA 1SHYA 2A7CA 4UE7H 4UONA 1HBTH 4MPUA 2EI7A 3SU3A 1QRZA 1S82A 4BAHB 5FPTA 1T4UH 2VIWA 4DURA 1GI9B 1QB1A 1P04A 2ANYA 2FS8A 1DWBH 1O2IA 4UEHH 1C4U2 1A0HB 1RIWC 1QA0A 4CH2B 1NFUA 1A5IA 2OTVA 1GDQA 4A92A 2FOFA 2F9UA 1C4V2 2FP7B 1YLDA 1QR3E 2HNTF 1GI6A 1W3CA 1TLDA 5DP7A 4DIIH 3TVJB 1P2MA 1SGRE 1BZXE 4DCDA 1UHBA 1Y5AT 2NU2E 4KTUA 1Q2WA 4ABEA 3BTKE 2G00A 3A85A 1AB9B 2W3IA 2FOCA 3WY8A 2QXGA 2WPJS 1UVSH 1TNGA 3UR9A 4KP0A 1MZAA 1GJAB 4MNYA 1AKSB 3BTFE 1IAUA 4CRAA 4KTCA 4I7YH 3E3TA 5DP3A 1ANBA 2R0KA 4R8TB 4WH6A 4GSOA 1OXGA 2ZDKA 3KN2A 4MNWA 1DS2E 1NPMA 3U8OH 5IYTA 3SGAE 2EEKA 1K1MA 1O3DA 3M7QA 1NT1A 1CHGA 1T8NA 2Z9GA 4HFPB 3BV9B 5C67A 1GI1A 1OSSA 3P6ZB 3SV9A 3G01A 4UFGH 1D3QB 4TPYA 2H1UA 3VB7A 2ZDVH 2VVUA 1P11E 2ZU1A 3JZ1B 4MNVA 3SNAA 4GAWA 1AMHA 4J1YA 1P2IA 2BQ7B 3LDXH 5C2ZA 4O3TA 1HXFH 1TBRH 2ZGHA 3LU9B 1JOUB 1KTTB 1IQHA 1GWAA 2Z3EA 3F9GA 1YPMH 4CRFA 1DFPA 1V2WT 2CF9H 2B9LA 1DDJA 3RXFA 1ZTJA 1B0FA 5A0AE 4XBCA 1AN1E 1TRNA 1NU7B 3T2NA 3UNSA 2GVFA 1YF4A 1DUAA 1SGTA 1GVZA 1RS0A 3F68H 4INKA 3A80A 5FAHA 3O8RA 1HJ8A 4FUIA 3V12A 1AFQC 1YPHE 1AWFH 3QN7A 2BD5A 5E2OA 3O8BA 1RGQA 1LTOA 2WPIS 3HKJB 1MQ5A 4DG4A 1LPKB 2A4RA 1ZLRA 1QBNA 2HPQH 3RLWH 2VH0A 1QJ1B 2A1DB 1KLTA 5J4SA 4AOQA 4ZKRU 2G52A 2BLOA 2HNTC 1UTPA 3TJUA 4X8SH 1N1LA 4U30A 1VGCC 4ZKSU 3BTGE 2R2WU 2ANWA 2BY8X 3HPTB 3FZZA 1HFDA 1RTKA 1MU8B 4Y0ZE 3UQVA 4AN7A 1ANCA 1O3AA 2ZGXH 3ZZ8A 3BG4B 1FLEE 2BXTH 2V0BA 1SOZA 3P8FA 4ABDA 2WINI 3ODDA 5EPYA 3SV8A 4CRDA 3LH3A 1CA0C 2YNAA 3U9AH 2THFB 1AWHB 3TLOA 3EA9A 2A0QB 1T7CA 4IMQA 1F5KU 4LK4A 4TYDA 1GHBG 3ZZAA 1VR1H 1C4Y2 1P8VC 4B74A 4B1TA 3HGNA 3OU0A 1HAHH 5GWZA 1PQ7A 2Z6BD 3KGPA 2TGAA 1F92A 1K1PA 3SGQE 1YBWA 1GCDA 1AU8A 1EZXC 1GBCA 1JXPA 1W0ZU 2TGPZ 1P12E 3RM2H 3RXJA 2ODQA 2OC0A 1NO9H 1H1BA 1UTJA 1Y59T 4Z6AH 2ODPA 1Y5BT 2GCHF 8KME2 1DWCH 3F6UH 2PUQH 2G55A 1T4VH 1GHVH 1BOQA 3MYWA 1GI7B 1LQEA 1O32A 4ISLA 1P57B 3AVZA 1ZGIA 2GMTB 2BD9A 3K9XB 1O34A 1QL7A 2BQWB 3A7TA 2PGQB 2BDBA 1SR5C 1QURH 4NSVA 3OY6U 1OOKB 4B76A 1MD8A 2CJIA 2A31A 1SFQB 2ZCKP 1V2MT 3PLPA 3M3TA 2P3TB 3KCGH 1NRRH 4X6NA 1L1NA 1CHOF 1TA6A 1YPGH 3RC5A 1CGJE 2OXSA 1O3JA 1WAYB 4K1TA 4K3JA 3SU4A 3GY3A 1QL9A 2QCYA 1TGSZ 1ELAA 4E7RG 4UFEH 1O2XA 1TQ0B 4B75A 2HALA 4NZQA 5T3HA 4WMDA 3ZVAA 3N7OA 2F9NA 1CT4E 1UVTH 1Z7KA 3AAUA 1U6QA 1VJAU 2G5VA 4XBBA 3AW0A 1YP9A 1L1GA 4IS5A 5JPMH 1GHZA 4Y0YE 5FX6A 1W0YH 3SU2A 1FPCH 4B71A 3T62A 2CGAA 1O3OA 3W95A 4DT7B 3QDZB 1EXFA 4X2XA 1AE5A 2P94A 1IQJA 1GBHA 1KDQB 1NROH 2OBOA 3DHKH 1GHXH 2CXVA 2DE9A 1EASA 2C8ZB 2DUCA 3GICB 2J95A 2ANKH 3P8GA 3ZZ4A 1NRSH 1NRQH 4CRGA 1XVMA 2FIRH 2Y5HA 4YO9A 2UWPA 1E35B 4A5TS 2PGBB 1TE0A 1D9IA 1MBQA 2WPMS 3SU5A 1UVOA 1FAXA 4CBOA 1D4PB 1UTKA 2LNCA 1JRTA 1B7XB 2RG3A 2BMGB 4X6PA 1MU6B 1GCTC 2WPLS 3QTVH 4FU9A 5K0HA 1TBQH 1ETTH 2ZO3H 2BXUH 4ABHA 1SSXA 3K2UA 1HUTH 4YT6H 2Y81A 3GCHC 4I8LA 4THNH 1DSUA 4R0IA 1HAZB 1J16A 1BTZA 2QN5T 4GVUA 1O2NA 5A8YA 3URDA 3S69A 1C1NA 3MH5A 2Q6DA 2PSYA 1LVOA 5CHAB 1RXPA 1HAPH 5LPRA 1EZQA 2ZDNA 3EAJA 1CU1A 2GKVE 4M7GA 1HCGA 2H9HA 1TAWA 2BY7X 2P8OB 3CP7A 3HATH 1Y3WA 1C2LA 1SGDE 2TIOA 2PKSB 3KHVA 5JBBS 1KIGH 2ZU5A 1MAXA 2FXRA 1PPBH 2J9NA 2ZPQA 3M36A 3Q3XA 1V2LT 1A0JA 1S6HA 6GCHG 2ZGJA 1FQ3A 1EKBB 1EP6A 1SGFG 1FONA 5C1UA 3OY5U 4XSKU 1MZDA 1P2JA 2ZFQH 1HRTH 5EOKA 2C4FH 1SLUB 1GMDG 1O2RA 1WSSH 4WH8A 4RN6A 1GMCG 1XXDA 3GCTF 2FTMA 1Z8JB 1ZGVA 1BTYA 1FV9A 1DUEA 1Z1JA 2FS9A 2G5NA 1YLCA 4H6TA 3PB1E 5C5NA 1JRSA 4FU7A 2OINA 3TGJE 1DPOA 4WJG2 1GBAA 1SG8B 1J9CH 5LGOA 1BRUP 1SGQE 4TY7A 1DITH 4Y11E 5H4IB 4ISOA 2Z94A 1AQ7A 1GBEA 1DX5M 2TGDA 1O36A 1O2GH 2PV9B 5ESBA 2BD3A 1ESBA 3TPIZ 2CF8H 4Y7AA 3JZ2B 4WWYA 1BMAA 1EPTB 5ETXA 3Q3KA 1G9IE 1B0EA 1C5VA 1QB9A 2OBQA 2BTCE 2OC1A 4ZUHA 1K1IA 3VFEA 4TWYA 2AYWA 1PPFE 1KLIH 5FHTA 3L3TA 2A7JA 1C1WH 1YYY1 6CHAC 1KXBA 1TYNA 1TGBA 3LC5A 1D3DB 2SFAA 2P16A 1VITF 1W14U 3LKWA 1C2HA 1LPGB 1O2JA 2GMTC 1C5RA 2JKHA 1GJDB 1JIRA 1C1RA 1O3MA 1W8BH 1P2KA 3QLPH 2FI4E 2ZZUH 1HPGA 3P95A 3A8BA 3RXMA 3DA9B 4A1XA 1V3XA 2VB0A 2VJ1A 4Y8XA 1C2DA 2ZA5A 1GDUA 3SHCH 1OP8A 1GL1A 2DE8A 1SGEE 4ZHAA 2VINA 1FDPA 4FXGH 3T5FH 5C1XA 1O5GH 3DFLA 1JWTA 2Z9LA 4FVBA 3RC4A 4A6LA 1RFNA 4NA8A 5A0CA 3SI4H 1V2UT 2QIQA 1D3PB 4JZIA 2FOHA 2QXIA 1SLVB 2A7HA 1TNKA 3D49H 3O8DA 3MNCA 3HGPA 4YOGA 1ZMNA 2NU1E 1FJSA 4I31A 7LPRA 1P03A 3UPEA 1MCTA 1G37A 3SOSA 2VIOA 4IBLH 2FLRH 2FI5E 4WXIA 4GHQA 1UTQA 1ELDE 1QGFA 4ISHH 4Y6DA 1SFIA 2ILNA 7GCHG 1O3KA 5DK1A 4A1VA 1KLJH 2GZ9A 2LPRA 4D76A 1CO7E 4AFQA 1A2CH 5ESTE 1IHTH 4FUEA 3VGCC 1N8OB 1QA7A 4MDSA 3H7OA 4MVNA 3LPRA 5EG4A 3K65B 2AFQB 3S9CA 1MTNB 1GJ8B 3FVFB 1V2KT 2V3OH 2HGTH 2UWLA 3KQDA 1J17T 1PYTD 1BMLA 1C1TA 2XTTB 3P8NA 1PPEE 2D1JA 2RA3A 5TCCA 3UWIA 4AG2A 2FWWA 1TPSA 2D2DA 2OC7A 4NA7A 4X1QU 1OWEA 1O3FA 4Y7BA 4X8UH 1TPAE 1O2YA 5FPSA 3R3GB 8GCHG 4ZAEA 1QQ4A 1FI8A 1WCZA 1WTHD 3TU7H 2FYRA 2QY0B 2P95A 1EAUA 1GBTA 4AG1A 2VGCB 3ITIA 3K6ZA 1E38B 1W7XH 2STAE 4Y8ZA 5FXLA 4F4OC 1NFYA 2G4UA 3QZQA 2FTLE 4FU8A 3SU1A 1MKXH 1OYQA 2ASUB 1ZZZA 5CHAC 2GX4A 1XUHA 3ZVFA 2XCFA 1C2MA 2ZIQH 1OWKA 1MD7A 1TIOA 1T32A 3CS7A 2KAIA 3A8DA 1TX8A 1WU1A 2BX4A 2HOBA 4YTAA 4F49A 1LVBA 1F7ZA 5EODA 5I25A 2VVCA 2A5AA 2J34A 2G8TA 3M61U 1H4WA 1YCPH 3ZZ6A 2ZU4A 1HAGE 5I46H 3RXRA 2OQ5A 2ZTXA 3FP6E 2H9EH 1DE7H 1KSNA 1W11U 2W5EA 4FUGA 2QAAA 5GIBA 3E8LA 3P70B 1BMNH 5DPAA 2BB4A 3SUFA 4BANB 4OS7A 2O8WA 1D3TB 2BY6X 1LO6A 3QK1A 3RXUA 2A4QA 1AE8H 3A86A 3TGIE 3ZZ9A 3RU4D 2FPZA 2ZDLA
chains in the Genus database with same CATH superfamily
5DG6A 3ZYDA 3PO1C 1PFXC 3BIUH 2A45B 1GHYH 1GMHG 1SGYE 5E0GA 3CNRA 4OGYA 1C2FA 2CMYA 1IQLA 4XFQA 2O8TA 4YLUA 1ELTA 3OTJE 2PR3A 4D9RA 4RT0A 3UAIC 4CHAC 5BPEA 4NZLA 4XBDA 1F2SE 2A2XH 3ZVGA 4KGAA 2GV6A 2ZFTA 1LDTT 1RJXB 2CHAC 4BTTB 1GBFA 8LPRA 2F4LA 2ZHFH 5FCRA 3GDSA 4H4FA 2J94A 1GJCB 1UK2A 1ELEE 1FIWA 5T6GA 4DT4A 4CRCA 1C5NH 2EI8A 3U1JB 2ULLA 1ELFA 1IQFA 5EQSA 3GDVA 3LT3A 1F5RA 1V2PT 3S9BA 1FY4A 1V2JT 3A84A 4Y71A 2J2UA 3A89A 1QL8A 1MCVA 5DO4H 4OGXA 1P06A 1Y3UA 1SGPE 3B9FH 2ZPSA 1FMGA 2SGPE 3RMLH 3QGJA 1Z6EA 1TABE 2ZGCA 1AZ8A 2ZHEH 1NN6A 1EJNA 1C2KA 1QY6A 2A5KA 3NPSA 3PWBA 3R0FA 4MG3A 3RMMH 3RXCA 4YLQH 3RXSA 3MU4A 1P3CA 3CENA 2M5TA 2C3SA 5EXNA 2Z3DA 3Q77A 1UHBB 1QCPA 1BA8B 1FN6A 1DY9A 5E2PA 1TRYA 1O2OA 1T8OA 9ESTA 1GI4A 4MPWA 2BVRH 1O2MA 2IJOB 2TRMA 4B2BA 1OHHD 1Y3XA 1S0RA 4ISNA 3F0OA 5KEDA 1E1QD 1HLTH 3NWUA 3PV4A 3E91A 1NTPA 2A5IA 4HI3A 2ODYB 2QGRA 1H8HD 1ZPCA 1ZJKA 1C1UH 1MKWH 4U01A 1DLEA 3A7ZA 5LPFA 1A0LA 3UQOA 2BD7A 1GBDA 1UMAH 4ASHA 1IQNA 1IHSH 2W7SA 1HB0B 4K2YA 2FODA 1PQ5A 4ZH8A 3RMOH 5LH8A 2OUAA 1C2IA 1J8AA 1G3DA 1JMOH 1FY3A 3ZVBA 1CT0E 1LKBA 1SGCA 3RUOA 4ZCNA 3SJIA 3WWFA 1RRKA 3T28A 1ZPBA 3SQEE 4ZHLU 4KKDA 1Z71A 3VB4A 2FESH 3AK5A 1DT2A 3TJOA 1P05A 1GBBA 4A7IB 4ABAA 1MMJN 1DVAH 3A83A 3Q3YA 1ZSKA 4BTUB 1Z6JH 1MTVA 1O5DH 5EXMA 4Q7YA 2O9QA 2QA9E 2BX3A 3M7TA 1O38A 2J38A 4WMEA 1EATA 1SGIB 1TNJA 2W7UA 3MNBA 1GVLA 2A4GA 5G4BA 4MQAA 1TWXB 3AAVA 2PW8H 2BDYA 1BB0B 3F9FA 3VB6A 3NCLA 1W12U 3PLBA 3MFJA 1BBRH 3BEUA 2YOLA 4IN2A 1QZ8A 3UUZA 3QWCH 3MH7A 3ZV9A 1GJBB 4I8JA 1TNHA 1ZHRA 1LQDB 3RXPA 3F9HA 3MO6A 1DXPA 1ETSH 3BSQA 3TIUA 1P9UA 3FAOA 5L6NH 2F3CE 2P3FH 2STBE 4I33A 3UFAA 2NWNA 2ZECA 4IW4E 2H5DA 4K5ZA 4Z1MD 2BM2A 3KEEA 1DOJA 4E7NA 1MBMA 2BLQA 3V0XA 3SO3A 3LIWA 5E0JA 1QB6A 1O2ZA 1CT2E 5L2YH 1GI8B 3OEED 2ZQ1A 4XRNA 2AMDA 1AVWA 1P01A 1AY6H 3I78A 4TT3D 3SJOA 4B2AA 1AGJA 1DWDH 1LHCH 1C5QA 4QT8C 4D7GA 3OEHD 2GCTB 1V2RT 5GCHG 2CK3D 1O37A 5DKMA 1TBZH 2HNTE 5EW1H 2XW9A 4LXBH 3TH3H 1TX6A 1XKAC 5IDKA 1UO6A 1COWD 3GY4A 7KMEH 1O33A 3A8AA 3PM3A 1K1LA 3GY5A 3RXQA 1UTLM 2Z9IA 1TQ7B 1YCPM 1UVPA 2C8WB 1EZUC 2WHXA 3A8CA 3A81A 3TNTA 1QRWA 3RDZA 1W2KH 1BBRK 1KDQA 3EA8A 2BD4A 3FN8A 2BVSH 3NZIA 1EAIA 2HLCA 1GJ6A 1E36B 5TCAA 2JH5D 3BG8A 1H9LB 2BDAA 1LHGH 1NC6A 3RC6A 2FX4A 3TK6A 3KF2A 5JB9S 5FX5A 3MOCA 4FVDA 2V3HH 1VKYA 1UVUH 2BOKA 2QF0A 1AB9C 1AO5A 1Y3VA 2ZFPH 2NU4E 1CGHA 3BTME 1ZYOA 1E34B 1UTMA 2PUXB 4D8NA 1C1OA 3MH4A 1EOLA 1F0RA 3MMGA 1XUKA 1BJUA 1SLXB 4X2YA 3KL6A 4ZXYH 4NG9H 3BIVH 4ZKNU 4SGAE 3M5MA 1IQEA 1HAVA 3GYLB 4HTCH 3TH2H 1KXCA 2F9BH 2BDCA 1TMBH 3SI3H 1X7AC 2W3KA 1O2SA 3I29A 4FUBA 3ZIAD 5F03A 1TALA 2BOHB 3STIA 4YM9A 1DSTA 1XUGA 3IWMA 3MU0A 2G4TA 3A7XA 1PQAA 3LONA 3SJKA 5AF9H 4JMYA 3S9AA 3LH1A 2V6NA 1Q3XA 1V2QT 1WYKA 1ELBA 5EIYA 4PROA 4UFDH 3FZDA 1D6WA 2JETB 1BDAA 5EGMA 3SNCA 1K1JA 2WV4A 1EUFA 2ZCLP 3A7YA 2AGGX 5HIYA 2BDGA 2V3MA 4IGDA 3ZV8A 3RU4E 2FO9A 3V3MA 2IOTA 2B8OH 2EA3A 4X8TH 1YWUA 1LHEH 1MQ6A 2A32A 2BHGA 1SMFE 1DY8A 2B7DH 1CBWB 1CHOG 1A7SA 4I8KA 1HAOH 3UOPA 1BITA 1C1SA 1S5SA 1V6DA 4X2WA 3UTUH 2PKAA 4AB9A 3B8JA 3A88A 2R3UA 1S85A 1BHXB 1T8MA 4BAOB 1QTFA 1AFEH 4I86A 1GG6B 3PTNA 4IMZA 4BXSA 3BTHE 1Y5UT 4K8BA 1YC0A 5E0HA 1Z8GA 3PMBB 1ZTLA 1GGDB 1L0ZA 4GCHG 1GBKA 5ABWA 4BTIB 1EP5A 5HXFA 4CR9A 2G51A 5FBIA 4ABIA 1ZTKA 2BLWA 2VIDA 3ZZ7A 4H6SB 3E16B 2CV3A 3UNRA 4Q2KA 1G2MA 5GXPA 3H5CB 1GI3A 1VZQH 1XUIA 2BZAA 1SBWA 1O5CB 4X1SU 3ZVDA 1WBGB 1HJAB 1O3BA 3BG4C 2FOAA 1GBLA 4RKOB 1ZJDA 4ABJA 3P17H 3LGVA 3DSOA 3QZRA 2Y7XA 3NUMA 1O2TA 2ZP0H 1ELGA 2RFKC 2Z3CA 4WMFA 1MAYA 1HAXB 1V2VT 2BVXH 1IQGA 2FZZA 2NU3E 4JK6A 2VWMA 4MLFB 1EQ9A 1RIWB 1DM4B 1W0KD 2KCOA 4X6MA 3RXKA 3RXLA 2XBWA 4K1EA 1INCA 1NRNH 2XC4A 4OS5A 2BLVA 5T1VA 1TOMH 1O3LA 2BDIA 2AEIH 4ZMAH 3SNDA 1TNLA 5F8TA 1XKBC 2XC0A 5FBEA 2VH6A 1ETRH 1EOJA 3PTBA 4NIVA 5JBCS 4Y76A 2ZHQH 4Y8YA 1BTPA 5HM2A 3ATWA 1AUJA 4AZ2B 1Y8TA 1TRMA 2EC9H 4IC6A 1C5OH 3Q76A 3PROA 4YOJA 1GHWH 2GP9B 2M2AA 1HIAB 1BRAA 1KY9A 2BD2A 1HXEH 1VCWA 4ISIH 3E0NB 1ZRBA 4BNRA 3DD2H 1UW7A 3ZZ5A 3FP8E 1XMNB 3M37A 3BEFB 1K2I1 3GY7A 3OYPA 3RP2A 8GCHF 1F0TA 1C5YB 1O3GA 1THSH 3GY8A 3U98H 1EJMA 5DJ7A 1ZMJA 1SB1H 1CA8B 3F9EA 1HYLA 1IQKA 1C5ZB 4D7FA 5K7RA 3HK3B 1SVPA 1C2JA 4JZFH 1P2OA 4DY7B 5A8XA 2SNVA 5A8ZA 2GDDA 2H9TH 1SLWB 1N6XA 1L4DA 2H2ZA 1QRXA 1O39A 3PLKA 3GCTG 3MU5A 2QYIA 3LGWA 4WVPE 1O3EA 3ENSB 1H9HE 1Z8IB 2GDEH 3L33A 1O3IA 4IC5A 2XXLA 2BY5X 5SGAE 1DICA 3ODFA 3W1EA 3MU1A 1WV7H 1G36A 5C94A 3VPKA 1EAXA 1AFQB 2JH0D 1E79D 2FYQA 3GY6A 4Y79A 4H42U 1BIOA 3SUEA 5F8XA 5AVDA 5A0BA 4NIWA 1XXFA 3GYMA 4FETA 1O3NA 1SQTA 4KTSA 2SGQE 1TGTA 2WYJA 2BQ6B 3FOAA 3DT0H 2Z7FE 1BTWA 4K1SA 4ABBA 3TJVA 2A4OA 3BF6H 7ESTE 1AZZA 2FOEA 1O5AB 1A4WH 1VGCB 3MNSA 1AVXA 5PTPA 3UNQA 1GVKB 3SZNA 1YPLH 3MWIU 2J5UA 5A09A 1C5XB 2QXHA 3GCOA 3WW7A 3V7TA 3TGKE 5L2ZH 1KMHB 4BAKB 1O2KA 2J92A 3GISB 1O2WA 3S0NA 2XWBI 1KXAA 1SKYE 1FY1A 1BBRE 2C8XB 3RU4T 2IJD1 2FOGA 2XC5A 2BYAX 2FOMB 9LPRA 1CA0B 2UUYA 3SN8A 3SJ8A 1GHAG 1RD3B 4DIHH 4HZHA 1SQOA 1GI0A 3PWCA 1TPPA 1ELVA 1K21H 3RXIA 1AHTH 1KXDA 1NZQH 1SHHB 3ATLA 3SU0A 3STJA 5HMAA 1HJ9A 1A5GH 2W6JD 1ZOMA 3M5NA 2C90B 1YKTA 2P8OC 3UOUA 1HAYB 2AMQA 4KELA 3N7DA 3U8RH 1YY3A 2PKSC 3MH6A 3PYHA 4SGBE 3ZZBA 4DOQA 1PPHE 2XNIA 4U2WA 2H6MA 2WPDD 3W94A 2PLXA 4E06H 3LJOA 1AD8H 1GDNA 1OX1A 2UUFB 8ESTE 1OPHB 1H8DH 1S84A 1SQAA 5EW2H 1HJAC 3VXEH 1ARBA 1OWDA 1O3CA 1TX7A 1AKSA 4I8HA 2J98B 1NRPH 4CR5A 2KX4A 4ABFA 2ALPA 2HPPH 1G3BA 2IPQX 4GLYA 3IITA 1H9IE 1H8ED 1FN8A 3S7HB 5B6LA 1HGTH 2KAIB 5TJXA 1KXFA 4JCNA 1IQIA 2V35A 5FCKA 3FANA 1CVWH 3KYFA 1YPHC 3RXBA 1MKXK 1O5EH 4JZ1A 4TY6A 1EPTC 3C27B 3ATIA 2XWAA 4O97A 4ZROA 1EAWA 4LZ4B 3ATKA 3ATMA 4XE4A 1W7GH 2ANMH 3UREA 2BY9X 4JZDH 2P93A 4NSYA 1NFXA 3VG8A 2D26C 2BD8A 3LJJA 4P02A 1BTUA 3M35A 3N7EA 2FOBA 4LZ1H 1C5LH 5F53A 1C5UA 2F9OA 1YCPK 1SQRA 2G81E 3E90B 1ZHMA 4CRBA 3PRBA 2Y82A 4JYVH 5EJZA 4INLA 5CDFE 3FFGA 2OLGA 3UR6A 1TGCA 1J14A 1O3HA 3LOXA 4IN1A 3TK9A 1P9SA 4OS6A 1NU9A 1SL3A 5HYOA 1C1MA 4RI0A 4ZKOU 1GHBF 1FIZA 3BN9A 2SNWA 2ZC9H 2VU8E 4WXVA 4GHTA 3PMHB 4DGJA 2J97A 1NY22 1ARCA 1C1VH 5BRRE 1HDTH 3F3BA 3EGKH 3M5OA 2SGEE 1L1JA 2PTNA 2Y7ZA 1O3PB 3OTPA 4D9QA 1O2UA 4WY3A 1XX9A 4E05H 4Q80A 5JDUB 4JZEH 1AIXH 3A82A 1TB6H 1KTSB 1F5LA 2TGTA 4X8VH 3GCNA 1GCTB 1AI8H 2ZHWH 3F2HA 4YZUA 4UFFH 3TITA 3OFND 4OS4A 3MO9A 1BJVA 2AS9A 3NK8A 2I6QA 3E6PH 3BTTE 2C93B 3GCHB 5DGJA 2ZHDA 1ZR0A 2WUCA 1QBOA 1P2QA 3TJNA 1FAKH 1N6YA 1CE5A 2PTCE 2ZEBA 1SGFA 3U8TH 4MPXA 1UK3A 1C2GA 1C5WB 4YOIA 2VWLA 2R9PA 1N8OC 2HRVA 1YPJH 2FEQH 1NBME 6LPRA 2Y5GA 2YMSC 5GCHF 3U28C 2O8UA 5CMXH 1T31A 4GPGA 2GT7A 1O30A 1MTSA 1MTNC 1D6RA 1GI2A 2ZFSA 4AFZA 2SGDE 1DWEH 2UUKB 1GBMA 2HVXA 4NWLA 1V2NT 1FNIA 1K1OA 2EY4C 4BOHA 3MQKC 4AORA 3LGTA 3CS0A 1BMMH 1BQYA 2OCVB 3Q00A 5EU8A 2ZQ2A 1LHFH 4NCYA 1W10U 1V2ST 1PYTC 3VEQB 3SYJA 3GDUA 1Y3YA 2SGAA 1C5SA 5EPNA 1E1RD 2F43B 1C1PA 2Q6FA 2ZGBH 4Q7XA 1O5FH 1RTFB 3SV6A 4JK5A 3U1IB 1NESE 2TBSA 5E8EH 3RXTA 5C17A 3MI4A 1UCYH 2OQUA 2VGCC 5EQQA 1VJ9U 3E0PB 3SV2H 1SOTA 2RCEA 1VCPA 2AIPA 1C1QA 5C1YA 1BRBE 1ANEA 3MHWU 5LPEA 3ZVCA 1MKWK 3M3VA 1XUJA 1F0SA 3RLYH 3SJ9A 1T8LA 5JYIA 2ZCHP 4AGKA 1TPOA 5B6OA 1S0QA 4TWWA 1WOFA 4UDWH 3EDXB 1FUJA 3HK6B 1OP2A 1GJ9B 1GBJA 1C2EA 4DVAU 1WQVH 5J4QA 1JIMA 3ZZDA 4AFSA 1DANH 1THPB 2Y80A 5FL7D 3B23B 4O3UA 3BTDE 4AYVB 6CHAB 1FXYA 1YPKH 4LOYH 2ZU2A 1CSOE 5GJ4B 4Q63A 1QHRB 1P10A 1OWJA 2QE7D 2ESTE 3K6YA 2Q6GA 3A7WA 4ASUD 3SQHE 1UJ1A 4ZHMU 3I77A 3S7KB 3TH4H 1O2PA 1P0SH 4O9VA 2FLBH 2FMJA 1WQSA 4BXWA 1GJ5H 3NXPA 4F48B 2FM2A 3M7UA 2BZ6H 4XD7D 3PRDA 5F8ZA 1UTNA 3D65E 2KR7A 3EQ0H 1O35A 3M3SA 4X6OA 4FUFA 1S81A 2Y5FA 1UCYK 4INHA 3SORA 3IG6B 1V2OT 2JJ2D 4MNXA 1FY5A 5KGOA 2IPHA 2VVVA 1VITH 2ZDMA 1SI5H 2NU0E 1EJAA 2I6SA 1SGNE 4Q7ZA 6GCHF 4K8YA 4GCHF 2R0LA 2UWOA 4UD9H 5GPIB 1WTGH 4FUHA 3SV7A 1L4ZA 3U69H 1GMDF 1P2NA 2WYGA 3PMAB 4YESB 3UB0A 5GDSH 3ESTA 1GMCF 3T26A 3A87A 4OS2A 2W26A 1YM0A 3VGCB 3AASA 2QXJA 5AFYH 2K1QA 3RXHA 3TNSA 1YGCH 3EYDA 3L6PA 4CH8B 1QJ6B 1ZMLA 4AX9H 4ZXXH 1CGIE 4X0WU 2GCHG 1THRH 2PWXA 3MNXA 2C8YB 4NIXA 3RMNH 1QFKH 4MPVA 1C5MD 1ACBE 4YT7H 3RXGA 3RXAA 2HWLB 1PPZA 2ALVA 1ABIH 3O8CA 1XUFA 1OWHA 3AW1A 2AGEX 2ZFRH 4RSPA 4B2CA 3VB5A 1ZSLA 1TONA 4JYTA 1BCUH 1GBIA 1C9TA 1A3EH 3DFJA 1EX3A 2AMPA 4GUXA 1C5TA 1ZSJA 3SNEA 1TA2A 1UTOA 2V7QD 1SC8U 1EZSC 3C1KA 1E37B 1LHDH 1Q31A 2AIQA 2F83A 1HAVB 2JIZD 2Z9KA 3QGNB 4NFFA 3UIRA 1G3EA 1LKAA 3DCLA 1GL0E 3HKIB 3T25A 1YPEH 1ANDA 1LVMA 1A5HA 2P3UB 3FP7E 1KYNA 1QIXB 3FKSD 3OSYA 2XBXA 4X1NU 3RXVA 2FI3E 1WDIA 2GTBA 1A1RA 3KQCA 5EQRA 1LPZB 4VGCB 1G32B 3KQEA 2FX6A 1TOCB 1MH0A 3OAAD 2ZFFH 3SW2B 4CREA 2IN2A 1NM6A 2RA0A 2XBVA 2HLDD 2R2MB 1EB1H 4X1PU 3KYGA 1GI5A 4U32A 1O2VA 2O8MA 1EPTA 1HV7A 2VIPA 1O31A 1FZZA 3KIDU 1EB2A 1TMTH 5AFZH 3LGUA 5JBTA 3BEIB 1H8IH 1P09A 2KM0A 4B73A 3F0PA 3ZVEA 3MO3A 2WPKS 3RXOA 3H09A 1O2HA 4NIYA 1ZPZA 4FUDA 2VIQA 2OP9A 3UY9A 4MTBA 1TGNA 4TPIZ 1FY8E 2PKAB 1J15A 2BDHA 4DW2U 2QV1A 4XOJA 3LGIA 3LGYA 7GCHF 1E0FD 3DUXH 1K0HA 5C5OA 5KECA 5DP8A 3PO1B 3PV5A 1TMUH 1HIAA 2GZ7A 4OM9A 2OD3B 3FO8D 4FUJA 1K28D 5C20A 5C3NA 3A7VA 1TFXA 3QO6A 1XM1A 4NFEA 3EA7A 1Z1IA 2CN0H 1JBUH 1OWIA 1HNEE 1NBMD 1PJPA 1NFWA 4DJZB 3EE0B 1B5GH 4CHAB 3MTYA 3SU6A 3P8OA 1TNIA 5DP5A 2ZTYA 2K8IA 3SUDA 1MTWA 3LC3A 2CHAB 2PSXA 3M5LA 2P59A 2TPIZ 5DP6A 1IOEA 1GJ7B 2HVYB 1BTHH 1QQUA 1MUEB 4NWKA 2AGIX 5DP4A 2XRCA 3TK5A 5F6MA 5FPYA 2J4IA 3D62A 3SHAH 4Z0KA 3ZZCA 3VB3A 2Q1JA 4AGJA 1ESAA 2GCTC 1BTXA 2ZNKH 4AB8A 4XDEA 1S6FA 1K22H 1L2EA 2VWNA 3BTEE 1ID5H 2GJGA 3KNXA 3ELAH 2W6ID 4NA9H 1BHXF 1A3BH 1WUNH 5DP9A 4AYYB 1MTUA 4OS1A 2GV7A 1OP0A 3DSGA 1GHAF 1PPCE 4K60A 4P00A 1G30B 3RXDA 2YNBA 2WV5A 3RM0H 2KZ4A 2SGFE 3D23A 3SNBA 2QC2A 1LCYA 2QF3A 2VWOA 2RDLA 2Z9JA 1O2QA 5EJ1A 1QNJA 1PQ8A 1K1NA 2GZ8A 1O0DH 1DXWA 2ZU3A 3BTWE 3UWJH 5HM9A 1G3CA 1QJ7B 5A2MH 1W13U 3T27A 5AHGH 2JH6D 3VXFH 1DLKB 2VIVA 2ZTZA 4ESTE 2VNTA 1KXEA 5EJLA 2GD4B 1FPHH 1NS3A 2GT8A 2JDID 2UUJB 1P02A 4K69A 2OC8A 4Y10E 1HAIH 5JBAS 2WUBA 3T29A 3QTOH 1IQMA 3GY2A 3URCA 2PFEA 2RDEA 2B0FA 2D8WA 4WF8A 5L30H 2YMSD 2ZI2H 1AVGH 1BRCE 3ZYEA 1F0UA 1SPJA 2ZF0H 4I8GA 2A2QH 3KQ5A 4RKJB 2ZPRA 4AFUA 4O03A 1O5BB 6ESTA 2XYAA 4J2YB 1GMHF 3SGBE 3ZZ3A 1CQQA 1OYTH 1GJ4H 3OX7U 1BUIA 2AERH 2F9PA 1VITG 2AH4X 5T6DA 1M9UA 5EXLA 3QUMP 2XBYA 3BTQE 1LMWB 2JETC 4I32A 1VCQA 4BAMB 1C5PA 2XCNA 4BAQB 4F55A 4X2VA 3RXEA 2JJ1D 1UCYE 4HGCA 3F1SB 2PHBA 1GPZA 1PPGE 2Y6TA 3PMJA 4NGAH 2FDAA 2GGVB 3P92A 4CBNA 5CE1A 5JB8S 1AUTC 3SUGA 1G2LA 1ZRKA 2ZKSA 1OKXA 1CBWC 2F9VA 3QX5H 3GOVB 3KQBA 1ESTA 3SBKA 1A46H 5HGGA 2ZWLH 1ELCA 1BT7A 2R3YA 4ABGA 4FUCA 1RTLA 1ABJH 1ZHPA 2H5CA 1A61H 1GG6C 3E1XB 3H7TA 2O8LA 2WPHS 1GGDC 1UK4A 1K9OE 2B5TB 1XVOA 4JYUH 3MU8A 4A1TA 1LVYA 4VGCC 5IK2D 1OS8A 1O2LA 2EI6A 1V2TT 1C9PA 5T6FA 3NKKA 1ORFA 1QBVH 2ZDAH 1P3EA 4X1RU 1S83A 3V13A 1W0JD 2F91A 2ZG0H 1Z8RA 1SHYA 2A7CA 4UE7H 4UONA 1HBTH 4MPUA 2EI7A 3SU3A 1QRZA 1S82A 4BAHB 5FPTA 1T4UH 4FOUC 2VIWA 4DURA 1GI9B 1QB1A 1P04A 2ANYA 2FS8A 1DWBH 1O2IA 4UEHH 1C4U2 1A0HB 1RIWC 1QA0A 4RT1A 4CH2B 1NFUA 1A5IA 2OTVA 1GDQA 4A92A 2FOFA 2F9UA 1C4V2 2FP7B 1YLDA 4AC9A 1QR3E 2HNTF 1GI6A 1W3CA 1TLDA 5DP7A 4DIIH 3TVJB 1P2MA 1SGRE 1BZXE 4DCDA 1UHBA 3F2GA 1Y5AT 2NU2E 4KTUA 1Q2WA 4ABEA 3BTKE 2G00A 3A85A 1AB9B 2W3IA 3DSPA 2FOCA 3WY8A 2QXGA 3NRLA 2WPJS 3GS9A 1UVSH 1TNGA 3UR9A 4KP0A 1MZAA 1GJAB 4MNYA 1AKSB 3BTFE 1IAUA 4CRAA 4KTCA 4I7YH 3E3TA 5DP3A 1ANBA 2R0KA 4R8TB 4WH6A 4ACBA 4GSOA 1OXGA 2ZDKA 3KN2A 4MNWA 1DS2E 1NPMA 3U8OH 5IYTA 3SGAE 2EEKA 1K1MA 1O3DA 3M7QA 1NT1A 1CHGA 1T8NA 2Z9GA 4HFPB 3BV9B 5C67A 1GI1A 1OSSA 3P6ZB 3SV9A 3G01A 4UFGH 1D3QB 4TPYA 2H1UA 3VB7A 2ZDVH 2VVUA 1P11E 2ZU1A 3JZ1B 4MNVA 3SNAA 4GAWA 1AMHA 4J1YA 1P2IA 2BQ7B 3LDXH 5C2ZA 4O3TA 1HXFH 1TBRH 2ZGHA 3LU9B 1JOUB 1KTTB 1IQHA 1GWAA 2Z3EA 3F9GA 1YPMH 4CRFA 1DFPA 1V2WT 2CF9H 2B9LA 4Q4LA 1DDJA 3RXFA 1ZTJA 1B0FA 5A0AE 4XBCA 1AN1E 1TRNA 1NU7B 4HG6A 3T2NA 3UNSA 2GVFA 1YF4A 1DUAA 1SGTA 1GVZA 1RS0A 3F68H 4INKA 3A80A 5FAHA 3O8RA 1HJ8A 4FUIA 3V12A 1AFQC 1YPHE 1AWFH 3QN7A 2BD5A 5E2OA 3O8BA 1RGQA 1LTOA 2WPIS 3HKJB 1MQ5A 4DG4A 1LPKB 2A4RA 1ZLRA 1QBNA 2HPQH 3RLWH 2VH0A 1QJ1B 2A1DB 4ACAA 1KLTA 5C0UA 2WZQA 5J4SA 3N99A 4AOQA 4ZKRU 2G52A 2BLOA 2HNTC 1UTPA 3TJUA 4X8SH 1N1LA 4U30A 1VGCC 4ZKSU 3BTGE 2R2WU 2ANWA 2BY8X 3HPTB 5C0TA 3FZZA 1HFDA 1RTKA 1MU8B 4Y0ZE 3UQVA 4AN7A 1ANCA 1O3AA 2ZGXH 3ZZ8A 3BG4B 2L74A 1FLEE 2BXTH 2V0BA 1SOZA 3P8FA 4ABDA 2WINI 3ODDA 5EPYA 3SV8A 4CRDA 2OK5A 3LH3A 1CA0C 2LP6A 2YNAA 3U9AH 2THFB 1AWHB 3TLOA 3EA9A 2A0QB 1T7CA 4IMQA 1F5KU 4LK4A 4TYDA 1GHBG 3ZZAA 1VR1H 1C4Y2 1P8VC 4B74A 4B1TA 3HGNA 3OU0A 1HAHH 5GWZA 1PQ7A 2Z6BD 3KGPA 2TGAA 1F92A 1K1PA 3SGQE 1YBWA 1GCDA 1AU8A 1EZXC 1GBCA 1JXPA 1W0ZU 2TGPZ 1P12E 3RM2H 3RXJA 2ODQA 2OC0A 1NO9H 1H1BA 1UTJA 1Y59T 4Z6AH 2ODPA 1Y5BT 2GCHF 8KME2 1DWCH 3F6UH 2PUQH 2G55A 1T4VH 1GHVH 1BOQA 3MYWA 1GI7B 1LQEA 1O32A 4ISLA 1P57B 3AVZA 1ZGIA 2GMTB 2XOKD 2BD9A 3F2FA 3K9XB 1O34A 1QL7A 2BQWB 3A7TA 2PGQB 2BDBA 1BMFD 1SR5C 1QURH 4NSVA 3OY6U 1OOKB 4B76A 1MD8A 2CJIA 2A31A 1SFQB 2ZCKP 1V2MT 3PLPA 3EE7A 3M3TA 2P3TB 3KCGH 1NRRH 4X6NA 2AHME 1L1NA 1CHOF 1TA6A 1YPGH 3RC5A 2PP6A 2KCAA 1CGJE 2OXSA 1O3JA 1WAYB 4K1TA 4K3JA 3SU4A 3GY3A 1QL9A 2QCYA 1TGSZ 1ELAA 4E7RG 4UFEH 1O2XA 1TQ0B 1FX0B 4B75A 2HALA 4NZQA 5T3HA 4WMDA 3ZVAA 3N7OA 2F9NA 1CT4E 1UVTH 1Z7KA 3AAUA 1S6LA 1U6QA 1VJAU 5HIZA 2G5VA 4XBBA 3AW0A 1YP9A 1L1GA 4IS5A 5JPMH 1GHZA 4Y0YE 5FX6A 1W0YH 3SU2A 1FPCH 4B71A 2WV9A 3T62A 2CGAA 1MABB 1O3OA 3W95A 4DT7B 3QDZB 1EXFA 4X2XA 1AE5A 2P94A 1IQJA 1GBHA 1KDQB 1NROH 2OBOA 3DHKH 1GHXH 2CXVA 2DE9A 1EASA 2C8ZB 2DUCA 3GICB 2J95A 2ANKH 3P8GA 3ZZ4A 1NRSH 1NRQH 4CRGA 1XVMA 2FIRH 2Y5HA 4YO9A 2UWPA 1E35B 4A5TS 2PGBB 1TE0A 1D9IA 1MBQA 2WPMS 3SU5A 1UVOA 1FAXA 4CBOA 1D4PB 1UTKA 2LNCA 1JRTA 1B7XB 2RG3A 2BMGB 4X6PA 1MU6B 1GCTC 2WPLS 3QTVH 4FU9A 5K0HA 1TBQH 1ETTH 2ZO3H 2BXUH 1EFRD 4ABHA 1SSXA 3K2UA 1HUTH 4YT6H 2Y81A 3GCHC 4I8LA 4THNH 1DSUA 4R0IA 1HAZB 1J16A 1BTZA 2QN5T 4GVUA 1O2NA 5A8YA 3URDA 3S69A 1C1NA 3MH5A 2Q6DA 2PSYA 1LVOA 5CHAB 1RXPA 1HAPH 5LPRA 1EZQA 2ZDNA 3EAJA 1CU1A 2GKVE 2KCPA 4M7GA 1HCGA 2H9HA 1TAWA 2BY7X 2P8OB 3CP7A 3HATH 1Y3WA 1C2LA 1SGDE 2TIOA 2PKSB 3KHVA 2QF5A 5JBBS 5DN6D 1KIGH 2ZU5A 1MAXA 2FXRA 1PPBH 2J9NA 2ZPQA 3M36A 3Q3XA 1V2LT 1A0JA 1S6HA 6GCHG 2ZGJA 1FQ3A 1EKBB 1EP6A 1SGFG 1FONA 5C1UA 3OY5U 4XSKU 1MZDA 1P2JA 2ZFQH 1HRTH 5EOKA 2C4FH 1SLUB 1GMDG 1O2RA 1WSSH 4WH8A 4RN6A 2KCYA 1GMCG 1XXDA 3GCTF 2FTMA 1Z8JB 1ZGVA 1BTYA 1FV9A 1DUEA 1Z1JA 2FS9A 2G5NA 1YLCA 4H6TA 3PB1E 5C5NA 1JRSA 4FU7A 2OINA 3TGJE 1DPOA 4WJG2 1GBAA 1SG8B 1J9CH 5LGOA 1BRUP 1SGQE 4TY7A 1DITH 4Y11E 5H4IB 4ISOA 2Z94A 1AQ7A 1GBEA 1DX5M 2TGDA 1O36A 1O2GH 4B6FA 2PV9B 5ESBA 2BD3A 1ESBA 3TPIZ 2CF8H 3PV2A 4Y7AA 3JZ2B 4WWYA 1BMAA 1EPTB 5ETXA 3Q3KA 1G9IE 1B0EA 1C5VA 1QB9A 2OBQA 2BTCE 2OC1A 4ZUHA 1K1IA 2QF4A 4TWYA 3VFEA 2AYWA 2EQNA 1PPFE 1KLIH 5FHTA 3L3TA 2A7JA 1C1WH 1YYY1 6CHAC 1KXBA 1TYNA 1TGBA 3LC5A 1D3DB 2SFAA 2P16A 1VITF 2L6OA 1W14U 3LKWA 1C2HA 1LPGB 1O2JA 2GMTC 1C5RA 2JKHA 1GJDB 1JIRA 1C1RA 1O3MA 1W8BH 1P2KA 3QLPH 2FI4E 2ZZUH 1HPGA 3P95A 3A8BA 3RXMA 3DA9B 4A1XA 1V3XA 2VB0A 2VJ1A 4Y8XA 1C2DA 2ZA5A 1GDUA 3SHCH 1OP8A 1GL1A 2DE8A 1SGEE 4B6EA 4ZHAA 2VINA 1FDPA 4FXGH 3T5FH 5C1XA 1O5GH 3DFLA 1JWTA 2Z9LA 4FVBA 3RC4A 4A6LA 1RFNA 4NA8A 5A0CA 3SI4H 1V2UT 2VBCA 2QIQA 1D3PB 4JZIA 2FOHA 2QXIA 1SLVB 2A7HA 1TNKA 3D49H 3O8DA 3MNCA 3WWBA 3HGPA 4YOGA 1ZMNA 4TSFD 2NU1E 1FJSA 4I31A 7LPRA 1P03A 3UPEA 1MCTA 1G37A 5CHBA 2K0QA 3SOSA 2VIOA 4IBLH 2FLRH 2FI5E 4WXIA 4GHQA 1UTQA 1ELDE 1QGFA 4ISHH 4Y6DA 1SFIA 5DSFA 2ILNA 7GCHG 1O3KA 5DK1A 4A1VA 1KLJH 2GZ9A 2LPRA 4D76A 1CO7E 4AFQA 1A2CH 5GNDA 5ESTE 1IHTH 4FUEA 3VGCC 1N8OB 1QA7A 4MDSA 3H7OA 4MVNA 3LPRA 2YMSB 2WSSD 5EG4A 3K65B 2AFQB 3S9CA 1MTNB 1GJ8B 3FVFB 1V2KT 3OE7D 2V3OH 2HGTH 2UWLA 3KQDA 1J17T 1PYTD 1BMLA 1C1TA 2XTTB 5HKKD 3P8NA 1PPEE 2D1JA 2RA3A 5TCCA 3UWIA 4AG2A 2FWWA 1TPSA 2D2DA 2OC7A 4NA7A 1WXRA 4X1QU 1OWEA 1O3FA 4Y7BA 4X8UH 1TPAE 1O2YA 5FPSA 3R3GB 8GCHG 4ZAEA 1YLNA 1QQ4A 1FI8A 1WCZA 1WTHD 3TU7H 2FYRA 2QY0B 2P95A 1EAUA 1GBTA 4AG1A 2VGCB 3ITIA 3K6ZA 1E38B 1W7XH 2STAE 4Y8ZA 5FXLA 4F4OC 1NFYA 2G4UA 3QZQA 2FTLE 4FU8A 3SU1A 1MKXH 1OYQA 2ASUB 1ZZZA 2J98A 5CHAC 2GX4A 1XUHA 3ZVFA 2XCFA 1C2MA 2ZIQH 2KFWA 1OWKA 1MD7A 1TIOA 3SZEA 1T32A 4M9FA 3CS7A 2KAIA 3A8DA 1TX8A 1WU1A 2BX4A 2HOBA 4YTAA 4F49A 1LVBA 1F7ZA 5EODA 5I25A 2VVCA 2A5AA 2J34A 2G8TA 3M61U 1H4WA 4YXWD 1YCPH 3ZZ6A 2ZU4A 1HAGE 5I46H 3RXRA 2OQ5A 2ZTXA 3FP6E 2H9EH 1DE7H 1KSNA 1W11U 2W5EA 4FUGA 2QAAA 5GIBA 3E8LA 3P70B 1BMNH 5DPAA 2BB4A 3SUFA 4BANB 4OS7A 2O8WA 1D3TB 2BY6X 1LO6A 3QK1A 3RXUA 2A4QA 1AE8H 3A86A 3TGIE 3ZZ9A 2XNDD 2LELA 3RU4D 2FPZA 2ZDLA
chains in the Genus database with same CATH topology
5DG6A 3ZYDA 3PO1C 1PFXC 3BIUH 2A45B 1GHYH 1GMHG 1SGYE 5E0GA 4OGYA 1C2FA 2CMYA 1IQLA 4XFQA 2O8TA 4YLUA 1ELTA 3OTJE 2PR3A 4D9RA 4CHAC 5BPEA 4NZLA 4XBDA 1F2SE 2A2XH 3ZVGA 4KGAA 2GV6A 2ZFTA 1LDTT 1RJXB 2CHAC 4BTTB 1GBFA 8LPRA 5FCRA 2ZHFH 3GDSA 4H4FA 2J94A 1GJCB 1UK2A 1ELEE 1FIWA 5T6GA 4CRCA 1C5NH 2EI8A 3U1JB 2ULLA 1ELFA 1IQFA 5EQSA 3GDVA 3LT3A 1F5RA 1V2PT 3S9BA 1FY4A 1V2JT 3A84A 4Y71A 2J2UA 3A89A 1QL8A 1MCVA 5DO4H 4OGXA 1P06A 1Y3UA 1SGPE 3B9FH 2ZPSA 1FMGA 2SGPE 3RMLH 3QGJA 1Z6EA 1TABE 2ZGCA 1AZ8A 2ZHEH 1NN6A 1EJNA 1C2KA 1QY6A 2A5KA 3NPSA 3PWBA 3R0FA 4MG3A 3RMMH 3RXCA 4YLQH 3RXSA 3MU4A 1P3CA 3CENA 2M5TA 2C3SA 5EXNA 2Z3DA 3Q77A 1UHBB 1QCPA 1BA8B 1FN6A 1DY9A 5E2PA 1TRYA 1O2OA 1T8OA 9ESTA 1GI4A 4MPWA 2BVRH 1O2MA 2IJOB 2TRMA 4B2BA 1Y3XA 1S0RA 4ISNA 1HLTH 3NWUA 3PV4A 3E91A 1NTPA 2A5IA 4HI3A 2ODYB 2QGRA 1ZPCA 1ZJKA 1C1UH 1MKWH 4U01A 1DLEA 3A7ZA 5LPFA 1A0LA 3UQOA 2BD7A 1GBDA 1UMAH 4ASHA 1IQNA 1IHSH 2W7SA 1HB0B 4K2YA 2FODA 1PQ5A 4ZH8A 3RMOH 5LH8A 2OUAA 1C2IA 1J8AA 1G3DA 1JMOH 1FY3A 3ZVBA 1CT0E 1LKBA 1SGCA 3RUOA 3SJIA 1RRKA 3T28A 1ZPBA 3SQEE 4ZHLU 4KKDA 1Z71A 3VB4A 2FESH 1DT2A 3TJOA 1P05A 1GBBA 4A7IB 4ABAA 1MMJN 1DVAH 3A83A 3Q3YA 1ZSKA 4BTUB 1Z6JH 1MTVA 1O5DH 5EXMA 4Q7YA 2O9QA 2QA9E 2BX3A 3M7TA 1O38A 2J38A 4WMEA 1EATA 1SGIB 1TNJA 2W7UA 3MNBA 1GVLA 2A4GA 5G4BA 4MQAA 1TWXB 3AAVA 2PW8H 2BDYA 1BB0B 3F9FA 3VB6A 3NCLA 1W12U 3PLBA 3MFJA 1BBRH 3BEUA 2YOLA 4IN2A 3UUZA 3QWCH 3MH7A 3ZV9A 1GJBB 4I8JA 1TNHA 1ZHRA 1LQDB 3RXPA 3F9HA 3MO6A 1DXPA 1ETSH 3BSQA 3TIUA 1P9UA 3FAOA 5L6NH 2F3CE 2P3FH 2STBE 4I33A 3UFAA 2NWNA 2ZECA 4IW4E 2H5DA 4K5ZA 2BM2A 3KEEA 1DOJA 4E7NA 1MBMA 2BLQA 3V0XA 3SO3A 3LIWA 5E0JA 1QB6A 1O2ZA 1CT2E 5L2YH 1GI8B 2ZQ1A 2AMDA 1AVWA 1P01A 1AY6H 3I78A 3SJOA 4B2AA 1AGJA 1DWDH 1LHCH 1C5QA 4QT8C 4D7GA 2GCTB 1V2RT 5GCHG 1O37A 5DKMA 1TBZH 2HNTE 5EW1H 2XW9A 4LXBH 3TH3H 1TX6A 1XKAC 5IDKA 1UO6A 3GY4A 7KMEH 1O33A 3A8AA 3PM3A 1K1LA 3GY5A 3RXQA 1UTLM 2Z9IA 1TQ7B 1YCPM 1UVPA 2C8WB 1EZUC 3A8CA 3A81A 3TNTA 1QRWA 3RDZA 1W2KH 1BBRK 1KDQA 3EA8A 2BD4A 3NZIA 2BVSH 1EAIA 2HLCA 1GJ6A 1E36B 5TCAA 2JH5D 3BG8A 1H9LB 2BDAA 1LHGH 1NC6A 3RC6A 2FX4A 3TK6A 3KF2A 5JB9S 5FX5A 3MOCA 4FVDA 2V3HH 1UVUH 2BOKA 2QF0A 1AB9C 1AO5A 1Y3VA 2ZFPH 2NU4E 1CGHA 3BTME 1ZYOA 1E34B 1UTMA 2PUXB 4D8NA 1C1OA 3MH4A 1EOLA 1F0RA 3MMGA 1XUKA 1BJUA 1SLXB 4X2YA 3KL6A 4ZXYH 4NG9H 3BIVH 4ZKNU 4SGAE 3M5MA 1IQEA 1HAVA 3GYLB 4HTCH 3TH2H 1KXCA 2F9BH 2BDCA 1TMBH 3SI3H 1X7AC 2W3KA 1O2SA 3I29A 4FUBA 5F03A 1TALA 2BOHB 3STIA 4YM9A 1DSTA 1XUGA 3IWMA 3MU0A 2G4TA 3A7XA 1PQAA 3LONA 3SJKA 5AF9H 4JMYA 3S9AA 3LH1A 2V6NA 1Q3XA 1V2QT 1WYKA 1ELBA 4PROA 4UFDH 3FZDA 1D6WA 2JETB 1BDAA 5EGMA 3SNCA 1K1JA 2WV4A 1EUFA 2ZCLP 3A7YA 2AGGX 2BDGA 4IGDA 3ZV8A 3RU4E 2FO9A 3V3MA 2IOTA 2B8OH 2EA3A 4X8TH 1LHEH 1MQ6A 2A32A 2BHGA 1SMFE 1DY8A 2B7DH 1CBWB 1CHOG 1A7SA 4I8KA 1HAOH 3UOPA 1BITA 1C1SA 1S5SA 1V6DA 4X2WA 3UTUH 2PKAA 4AB9A 3B8JA 3A88A 2R3UA 1S85A 1BHXB 1T8MA 4BAOB 1QTFA 1AFEH 1GG6B 3PTNA 4IMZA 4BXSA 3BTHE 1Y5UT 4K8BA 1YC0A 5E0HA 1Z8GA 3PMBB 1ZTLA 1GGDB 1L0ZA 4GCHG 1GBKA 5ABWA 4BTIB 1EP5A 5HXFA 4CR9A 2G51A 5FBIA 4ABIA 1ZTKA 2BLWA 2VIDA 3ZZ7A 4H6SB 3E16B 2CV3A 3UNRA 4Q2KA 1G2MA 5GXPA 3H5CB 1GI3A 1VZQH 1XUIA 2BZAA 1SBWA 1O5CB 4X1SU 3ZVDA 1WBGB 1HJAB 1O3BA 3BG4C 2FOAA 1GBLA 4RKOB 1ZJDA 4ABJA 3P17H 3LGVA 3QZRA 2Y7XA 3NUMA 1O2TA 2ZP0H 1ELGA 2Z3CA 4WMFA 1MAYA 1HAXB 1V2VT 2NU3E 1IQGA 2BVXH 2FZZA 4JK6A 2VWMA 4MLFB 1EQ9A 1RIWB 1DM4B 4X6MA 3RXKA 3RXLA 2XBWA 4K1EA 1INCA 1NRNH 2XC4A 4OS5A 2BLVA 1TOMH 1O3LA 2BDIA 2AEIH 4ZMAH 3SNDA 1TNLA 5F8TA 1XKBC 2XC0A 5FBEA 2VH6A 1ETRH 1EOJA 3PTBA 4NIVA 5JBCS 4Y76A 2ZHQH 4Y8YA 1BTPA 5HM2A 3ATWA 1AUJA 4AZ2B 1Y8TA 1TRMA 2EC9H 4IC6A 1C5OH 3Q76A 3PROA 4YOJA 1GHWH 2GP9B 1HIAB 1BRAA 1KY9A 2BD2A 1HXEH 1VCWA 4ISIH 3E0NB 1ZRBA 4BNRA 3DD2H 3ZZ5A 3FP8E 1XMNB 3M37A 3BEFB 1K2I1 3GY7A 3OYPA 3RP2A 8GCHF 1F0TA 1C5YB 1O3GA 1THSH 3GY8A 3U98H 1EJMA 5DJ7A 1ZMJA 1SB1H 1CA8B 3F9EA 1HYLA 1IQKA 1C5ZB 4D7FA 5K7RA 3HK3B 1SVPA 1C2JA 4JZFH 1P2OA 4DY7B 5A8XA 2SNVA 5A8ZA 2GDDA 2H9TH 1SLWB 1N6XA 1L4DA 2H2ZA 1QRXA 1O39A 3PLKA 3GCTG 3MU5A 2QYIA 3LGWA 4WVPE 1O3EA 3ENSB 1H9HE 1Z8IB 2GDEH 3L33A 1O3IA 4IC5A 2XXLA 2BY5X 5SGAE 1DICA 3ODFA 3MU1A 1WV7H 1G36A 3VPKA 1EAXA 1AFQB 2JH0D 2FYQA 3GY6A 4Y79A 4H42U 1BIOA 3SUEA 5F8XA 5AVDA 5A0BA 4NIWA 1XXFA 3GYMA 1O3NA 1SQTA 4KTSA 2SGQE 1TGTA 2WYJA 2BQ6B 3DT0H 2Z7FE 1BTWA 4K1SA 4ABBA 3TJVA 2A4OA 3BF6H 7ESTE 1AZZA 2FOEA 1O5AB 1A4WH 1VGCB 3MNSA 1AVXA 5PTPA 3UNQA 1GVKB 3SZNA 1YPLH 3MWIU 5A09A 1C5XB 2QXHA 3GCOA 3V7TA 3TGKE 5L2ZH 4BAKB 1O2KA 2J92A 3GISB 1O2WA 3S0NA 2XWBI 1KXAA 1FY1A 1BBRE 2C8XB 3RU4T 2FOGA 2XC5A 2BYAX 2FOMB 9LPRA 1CA0B 2UUYA 3SN8A 3SJ8A 1GHAG 1RD3B 4DIHH 4HZHA 1SQOA 1GI0A 3PWCA 1TPPA 1ELVA 1K21H 3RXIA 1AHTH 1KXDA 1NZQH 1SHHB 3ATLA 3SU0A 3STJA 5HMAA 1HJ9A 1A5GH 1ZOMA 3M5NA 2C90B 1YKTA 2P8OC 3UOUA 1HAYB 2AMQA 4KELA 3U8RH 2PKSC 3MH6A 3PYHA 4SGBE 3ZZBA 4DOQA 1PPHE 2XNIA 4U2WA 2H6MA 3W94A 2PLXA 4E06H 3LJOA 1AD8H 1GDNA 1OX1A 2UUFB 8ESTE 1OPHB 1H8DH 1S84A 1SQAA 5EW2H 1HJAC 3VXEH 1ARBA 1OWDA 1O3CA 1TX7A 1AKSA 4I8HA 1NRPH 4CR5A 4ABFA 2ALPA 2HPPH 1G3BA 4GLYA 3IITA 1H9IE 1FN8A 3S7HB 1HGTH 2KAIB 5TJXA 1KXFA 4JCNA 1IQIA 2V35A 5FCKA 3FANA 1CVWH 1YPHC 3RXBA 1MKXK 1O5EH 4JZ1A 4TY6A 1EPTC 3C27B 3ATIA 2XWAA 4O97A 4ZROA 1EAWA 4LZ4B 3ATKA 3ATMA 4XE4A 1W7GH 2ANMH 3UREA 2BY9X 4JZDH 2P93A 4NSYA 1NFXA 2D26C 2BD8A 3LJJA 1BTUA 3M35A 2FOBA 4LZ1H 1C5LH 1C5UA 2F9OA 1YCPK 2G81E 3E90B 1ZHMA 4CRBA 2Y82A 4JYVH 4INLA 3FFGA 2OLGA 3UR6A 1TGCA 1J14A 1O3HA 3LOXA 4IN1A 3TK9A 1P9SA 4OS6A 1NU9A 1SL3A 5HYOA 1C1MA 4ZKOU 1GHBF 1FIZA 3BN9A 2SNWA 2ZC9H 2VU8E 4WXVA 4GHTA 3PMHB 4DGJA 1NY22 1ARCA 1C1VH 5BRRE 1HDTH 3EGKH 3M5OA 2SGEE 1L1JA 2PTNA 2Y7ZA 1O3PB 4D9QA 1O2UA 4WY3A 1XX9A 4E05H 4Q80A 5JDUB 4JZEH 1AIXH 3A82A 1TB6H 1KTSB 1F5LA 2TGTA 4X8VH 3GCNA 1GCTB 1AI8H 2ZHWH 4YZUA 3TITA 4UFFH 4OS4A 3MO9A 1BJVA 2AS9A 3NK8A 2I6QA 3E6PH 3BTTE 2C93B 3GCHB 5DGJA 2ZHDA 1ZR0A 2WUCA 1QBOA 1P2QA 3TJNA 1FAKH 1N6YA 1CE5A 2PTCE 2ZEBA 1SGFA 3U8TH 4MPXA 1UK3A 1C2GA 1C5WB 4YOIA 2VWLA 2R9PA 1N8OC 2HRVA 1YPJH 2FEQH 6LPRA 2Y5GA 5GCHF 2O8UA 5CMXH 1T31A 4GPGA 2GT7A 1O30A 1MTSA 1MTNC 1D6RA 1GI2A 2ZFSA 4AFZA 2SGDE 1DWEH 2UUKB 1GBMA 2HVXA 4NWLA 1V2NT 1FNIA 1K1OA 4BOHA 4AORA 3LGTA 3CS0A 1BMMH 1BQYA 2OCVB 3Q00A 5EU8A 2ZQ2A 1LHFH 4NCYA 1W10U 1V2ST 1PYTC 3VEQB 3GDUA 1Y3YA 2SGAA 1C5SA 5EPNA 1C1PA 2Q6FA 2ZGBH 4Q7XA 1O5FH 1RTFB 3SV6A 4JK5A 3U1IB 1NESE 2TBSA 5E8EH 3RXTA 3MI4A 1UCYH 2OQUA 2VGCC 5EQQA 1VJ9U 3E0PB 3SV2H 1SOTA 2RCEA 1VCPA 2AIPA 1C1QA 5C1YA 1BRBE 1ANEA 3MHWU 5LPEA 3ZVCA 1MKWK 3M3VA 1XUJA 1F0SA 3RLYH 3SJ9A 1T8LA 5JYIA 2ZCHP 4AGKA 1TPOA 5B6OA 1S0QA 4TWWA 1WOFA 4UDWH 3EDXB 1FUJA 3HK6B 1OP2A 1GJ9B 1GBJA 1C2EA 4DVAU 1WQVH 5J4QA 1JIMA 3ZZDA 4AFSA 1DANH 1THPB 2Y80A 3B23B 4O3UA 3BTDE 4AYVB 6CHAB 1FXYA 1YPKH 4LOYH 2ZU2A 1CSOE 5GJ4B 1QHRB 1P10A 1OWJA 2ESTE 3K6YA 2Q6GA 3A7WA 3SQHE 1UJ1A 4ZHMU 3I77A 3S7KB 3TH4H 1O2PA 1P0SH 4O9VA 2FLBH 2FMJA 1WQSA 4BXWA 1GJ5H 3NXPA 2FM2A 3M7UA 2BZ6H 5F8ZA 1UTNA 3D65E 3EQ0H 3M3SA 1O35A 4X6OA 4FUFA 1S81A 2Y5FA 1UCYK 4INHA 3SORA 3IG6B 1V2OT 4MNXA 1FY5A 2IPHA 2VVVA 1VITH 2ZDMA 1SI5H 2NU0E 1EJAA 2I6SA 1SGNE 4Q7ZA 6GCHF 4K8YA 4GCHF 2R0LA 2UWOA 4UD9H 5GPIB 1WTGH 4FUHA 3SV7A 1L4ZA 3U69H 1GMDF 1P2NA 2WYGA 3PMAB 4YESB 5GDSH 3ESTA 1GMCF 3T26A 3A87A 4OS2A 2W26A 1YM0A 3VGCB 3AASA 2QXJA 5AFYH 2K1QA 3RXHA 3TNSA 1YGCH 3EYDA 3L6PA 4CH8B 1QJ6B 1ZMLA 4AX9H 4ZXXH 1CGIE 4X0WU 2GCHG 1THRH 2PWXA 3MNXA 2C8YB 4NIXA 3RMNH 1QFKH 4MPVA 1C5MD 1ACBE 4YT7H 3RXGA 3RXAA 2HWLB 1PPZA 2ALVA 1ABIH 3O8CA 1XUFA 1OWHA 3AW1A 2AGEX 2ZFRH 4RSPA 4B2CA 3VB5A 1ZSLA 1TONA 4JYTA 1BCUH 1GBIA 1C9TA 1A3EH 3DFJA 1EX3A 2AMPA 4GUXA 1C5TA 1ZSJA 3SNEA 1TA2A 1UTOA 1SC8U 1EZSC 3C1KA 1E37B 1LHDH 1Q31A 2AIQA 2F83A 1HAVB 2Z9KA 3QGNB 3UIRA 4NFFA 1G3EA 1LKAA 1GL0E 3HKIB 3T25A 1YPEH 1ANDA 1LVMA 1A5HA 2P3UB 3FP7E 1KYNA 1QIXB 3OSYA 4X1NU</