2VINA

Fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR CHAIN B
publication title Fragment-Based Discovery of Mexiletine Derivatives as Orally Bioavailable Inhibitors of Urokinase-Type Plasminogen Activator
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 61
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vinA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vinA01
3EAJA 2A4RA 3LONA 3STIA 1B0FA 1ZPCA 1AI8H 4K3JA 1TNHA 3U8RH 1DSUA 1EJMA 4DIHH 1GI9B 2LPRA 1EP6A 4NCYA 2G52A 3SU6A 3ZVEA 1FIWA 2ZO3H 1QCPA 1BTPA 3A7VA 2FTLE 1YCPH 3SJ9A 3PMBB 3PV4A 1UTPA 4Y79A 1BTUA 2XTTB 1T4UH 2PKSC 4Q7XA 1MZDA 1BT7A 1QJ7B 1UCYH 2AIPA 1XUFA 5DP4A 1P2QA 4X6OA 1ZLRA 1ZSLA 4KGAA 5BPEA 1ZJDA 3M3VA 4JZEH 1GBAA 3ZZ6A 1AMHA 1TPPA 1KLJH 3SQHE 3T2NA 1C5NH 1DWCH 3M7QA 1D3QB 3L6PA 2V3OH 1YPEH 4XSKU 3ZVFA 3UR9A 3D49H 2Z9IA 2LNCA 2P95A 3VEQB 4JYVH 1P3EA 2Z7FE 2WYJA 2ZFRH 4Y0ZE 4JCNA 4WH8A 1GHWH 2Y5GA 4YT7H 4INLA 3NZIA 1THPB 3FP7E 1BMNH 1GBBA 1XM1A 2F9VA 1DFPA 3VXEH 3GY4A 1MBMA 5JBAS 1S82A 3U69H 1OYQA 5C20A 3D23A 1LPKB 1BMMH 2FI5E 2Z3CA 1C4U2 3MI4A 1UK2A 5J4SA 3SU2A 1P06A 1P11E 3OTJE 3U8TH 1CA0B 1LHFH 1G37A 1FAXA 1YCPK 3RXCA 1A0JA 4AG1A 5HXFA 1TGCA 2FX4A 5ABWA 3UQOA 2VU8E 2NU4E 4FUJA 1UCYK 1OWIA 1GWAA 2XBXA 2ZHEH 1YLCA 5FPYA 1ABIH 4H42U 1EPTA 3IG6B 4D76A 1EPTC 2PUQH 4B76A 1KTSB 1CVWH 2ZGHA 1XUJA 2QV1A 1RTFB 3A8CA 4OS2A 6GCHF 1EAWA 1O2MA 3B8JA 3O8BA 1INCA 5CHAC 4LOYH 4WMFA 1GJ9B 1SGIB 1S5SA 3RLWH 2Y5HA 3MNCA 4YESB 3BF6H 2GZ8A 1F0RA 1YLDA 1GBMA 3GY6A 2ZIQH 3MFJA 4WMDA 3A85A 3NCLA 1GBFA 1RJXB 4MDSA 2QF3A 5T3HA 3RXPA 4DOQA 1WTHD 5EOKA 1C1MA 3FZZA 1AZZA 1KDQB 3AW0A 3M5LA 4CR5A 3VXFH 2Q6DA 4NA8A 1N6XA 1DUEA 1V2RT 3LJOA 1SLWB 1O37A 2DUCA 3TIUA 2H2ZA 1TA2A 2CJIA 3PMAB 1JWTA 1V2ST 3HKJB 2OQ5A 3LC5A 4KELA 4UD9H 1DE7H 4Q7YA 4H4FA 4K1TA 1DY9A 4X2XA 3STJA 4ABEA 4E7RG 1YM0A 4YT6H 1C2GA 1ANBA 1P02A 1YF4A 2ZKSA 1FY3A 4JZ1A 1EQ9A 1FMGA 3B23B 2XW9A 3ELAH 2FEQH 2SGFE 1Z6JH 2A5AA 4BXSA 3SUDA 2ZC9H 4VGCB 2WPIS 3TH4H 1GJCB 4Y76A 2VIWA 5JBCS 1NY22 3EA7A 3KQBA 1MTSA 2Y81A 4WY3A 2F9NA 1W7GH 1P2KA 3ZVCA 1C2JA 2XCFA 4U32A 3VPKA 2H9EH 1YPGH 1G9IE 3LOXA 1KIGH 3SUEA 1MBQA 1MTWA 3GCNA 2VWOA 5FXLA 5A8YA 1SLVB 3RXHA 1ARBA 1SLXB 1HBTH 5EPYA 1V2VT 1YYY1 4DG4A 2VWLA 2BLOA 1EP5A 3M7TA 1FN6A 1C1WH 4K69A 4UFFH 1GDUA 1LDTT 1D6RA 1AFQB 2OBQA 3A84A 3U9AH 1YPHE 3A89A 3E8LA 4FU7A 1V2MT 1V2WT 4BAMB 4CRCA 1O3BA 3TGIE 1BRUP 1QTFA 2G81E 4ZKOU 2UWPA 2VB0A 1AIXH 3LGUA 3QLPH 1KTTB 1HJ9A 3UUZA 4BAQB 1GL0E 4H6SB 1O38A 2FO9A 4UFDH 4WMEA 1NROH 1QA7A 3ATWA 1SHYA 4GUXA 2OBOA 3VGCC 3QX5H 4ZH8A 3P8OA 3T26A 4AB9A 1O5BB 3NWUA 5FCRA 1G3CA 1GCDA 3SV7A 1LKBA 4LK4A 1OS8A 3GY3A 3T29A 5LGOA 4NZLA 3QZQA 1O0DH 1V2TT 1CQQA 1PYTC 2G4UA 2BDIA 3EE0B 2ESTE 1Y59T 2UUKB 3RC4A 3GCTF 1Y3YA 4RKOB 1AWHB 2DE9A 2Y7XA 1WUNH 1PQ5A 3F9EA 2AGGX 1QL7A 1TPAE 2ZU1A 2ZP0H 1ELBA 2BD7A 3MO9A 3PTNA 1UVSH 5E2OA 1HYLA 2IPHA 4YM9A 1TX7A 3SI3H 3PLBA 4ZKNU 1PYTD 1XUKA 3VB5A 3SV8A 1SI5H 1ZHPA 4FVBA 5LPFA 1O30A 4ABDA 1AUTC 4TWWA 3KQCA 1IQNA 3E1XB 5TCCA 3HKIB 5GDSH 4XBBA 1LVMA 3ATMA 3K9XB 1O2PA 3ZVDA 1O3FA 1MZAA 4IS5A 1THRH 1O5AB 1VJ9U 2CXVA 4TY6A 4DY7B 1P0SH 2ZTYA 1O3JA 1G3BA 3ZZ9A 4CH8B 1SHHB 1UTMA 4I8GA 4NG9H 3RUOA 1VGCB 5AFZH 3BTFE 3I77A 3ZVBA 1XUHA 2GV7A 2PWXA 3M36A 1WU1A 3M5OA 1PPCE 2OC0A 3ODFA 7GCHG 3K2UA 1O39A 2BY6X 2QF0A 1NZQH 1NFYA 3MTYA 1BTXA 1P3CA 1W3CA 3LGVA 1TA6A 1GBCA 3A8AA 1IQHA 4AG2A 1BBRH 2FDAA 1HIAA 1XXFA 1T32A 2ZU5A 8GCHG 4MPUA 4ZXXH 4WXIA 2ZFFH 3P8FA 5C1YA 1HAZB 3SI4H 4X8TH 2W7SA 5H4IB 1BIOA 1MUEB 4A7IB 1SGNE 2BZ6H 1DDJA 1O2WA 3GY7A 3MO3A 3QK1A 3A7TA 3A87A 2JH6D 3S69A 4MTBA 2BDGA 2G8TA 4RN6A 1GHAG 4CH2B 3SGQE 4XFQA 1G2MA 3RC5A 4DURA 1S6FA 2BQ7B 3FVFB 2TBSA 3DFJA 1WV7H 1NRRH 1ABJH 1F0UA 5E0HA 4RKJB 1NPMA 1SOTA 1J9CH 4E7NA 1A1RA 3M3TA 1TYNA 2FOHA 5JYIA 2ALPA 1S0RA 1AHTH 1C1NA 5TCAA 2SGEE 5FCKA 1DVAH 1OX1A 5GIBA 2F9BH 5EG4A 4KTCA 2V0BA 4INKA 2C4FH 1K1MA 3LIWA 4A92A 4ABIA 3UNSA 1GBTA 1C5OH 3AW1A 1QGFA 3GCHB 2BY7X 5E2PA 1F5KU 3LPRA 2J38A 4BAOB 2F91A 3RXQA 2PV9B 1CA8B 1BBRK 5FPTA 1P2JA 1QA0A 2WYGA 4X1RU 1IQFA 4OS4A 3M37A 2CF9H 4K1SA 1BRBE 1FQ3A 1NT1A 1S84A 5EXLA 1W0ZU 2SGDE 2QXIA 2HOBA 1ZMNA 4FUCA 2WUBA 3QGJA 3DFLA 2FODA 1UJ1A 4J1YA 1BZXE 5A8XA 4CHAC 1ANDA 2F83A 1C1OA 5EQQA 5SGAE 1TX8A 1T8OA 5I46H 1SMFE 4BXWA 2G4TA 1RRKA 4I8JA 1SVPA 1Y5BT 2J34A 1DXWA 3HGPA 2PSXA 1W11U 3UOUA 5C5NA 2OC1A 5C1XA 1QJ6B 1HJAB 2QYIA 2F9PA 1ID5H 2WPKS 1HXEH 1UHBA 3RXMA 1AFEH 1AN1E 4UE7H 2GCHG 7KMEH 2NU0E 1VR1H 2ANWA 1V2QT 1GHBG 3UY9A 1S85A 2VVCA 1QBOA 1A5GH 4JK5A 4MPXA 1ANEA 1QQUA 1ELEE 2ZDVH 3ITIA 1GVZA 1XKBC 1RD3B 3Q3KA 1TRNA 3RU4T 2XBYA 1FZZA 1TB6H 2P3TB 2ODPA 5DGJA 4AX9H 2FTMA 2GT8A 5A0BA 1LQEA 3A88A 1SQAA 4CREA 2V3HH 1V2KT 1A5IA 5CMXH 1SQTA 3DHKH 3TU7H 4NIYA 1J17T 4X2YA 4X1QU 4FU9A 4AGJA 4ABAA 2JKHA 1T7CA 1SGEE 1A7SA 2P93A 2ZGXH 1OWJA 3TPIZ 1Y3XA 4A6LA 3OU0A 1SGRE 4AOQA 2P94A 1GMCG 1P2MA 3ZZDA 1NO9H 3TH2H 1TE0A 5GXPA 1ZYOA 2RG3A 1AGJA 1EAIA 3F1SB 1D3DB 1HDTH 1JBUH 1CO7E 3GYLB 1HUTH 2PKSB 5AFYH 1O3GA 4O3TA 3S7HB 3G01A 1YPJH 2AGEX 2QC2A 4ISLA 5IYTA 3E3TA 3RMLH 1PQAA 3ATKA 1VJAU 4DGJA 1AVGH 1BTYA 1YCPM 1ELFA 2VGCC 4K8YA 5HM2A 1V2JT 3SGAE 1FNIA 3TJUA 2PHBA 1RXPA 1UTLM 1UVTH 1YPLH 1AE5A 3NPSA 1QB9A 3S7KB 1C5XB 1AKSA 2ZPQA 3TGJE 4AORA 4MQAA 1A61H 1HAVB 2ZDMA 2W7UA 4KTSA 2GD4B 4FVDA 3HK6B 4TPIZ 5G4BA 1CT0E 2HALA 1HAIH 4Y7BA 3TITA 2GX4A 3GDUA 3GOVB 1HAGE 2BMGB 3A82A 4ZHAA 1P2NA 1TIOA 1DOJA 4YOJA 1H4WA 4INHA 1UO6A 1PPFE 2BOKA 2GDEH 2V35A 1QBNA 3PLKA 4IGDA 4MPWA 4CRGA 1AB9C 1F92A 1E37B 3BTME 4OS7A 1LQDB 2HNTE 2QXJA 1OPHB 2ZFSA 1C9TA 1SSXA 3V12A 2EI7A 2VIQA 3PO1C 2BD2A 8KME2 4J2YB 5F6MA 5CHAB 3JZ1B 1QIXB 3BIUH 4FUDA 1O32A 3BEUA 3BTQE 1RTLA 2FXRA 1QL8A 3CS7A 5GWZA 3GDSA 4Y0YE 3WY8A 4BTUB 8GCHF 1HLTH 2EA3A 2Z6BD 2WINI 3D65E 3BTDE 4AGKA 1UVOA 4UONA 2H6MA 1P05A 1PPZA 3PROA 1O5CB 1YKTA 4DIIH 1OWKA 2BDBA 1O3DA 3RC6A 1ELCA 1ZR0A 4D8NA 5DG6A 2ZDNA 3A8BA 4XBCA 4ABHA 4F49A 5AF9H 1EKBB 1GI8B 1GMHG 1IHSH 4B2CA 4AN7A 2FZZA 2ZWLH 2Z3DA 2GP9B 2QA9E 4NFFA 3SNEA 3FP6E 1C5MD 4Y10E 2AERH 1IHTH 3GDVA 3SJ8A 5E8EH 1GBIA 2A4QA 3M5MA 2G5VA 5EQSA 1P10A 3P17H 5L30H 1FPHH 2BD9A 3T5FH 4WH6A 1CBWC 1GJDB 4JYUH 4GVUA 2HNTC 2BHGA 3A81A 2C8XB 6CHAC 2H9HA 1TBQH 1EUFA 5DP5A 2C93B 3QTVH 1L4DA 1H9LB 2UUJB 5JB9S 1EB2A 1PQ7A 1QRWA 5EU8A 1O3NA 3RXTA 2PKAB 4BANB 3V7TA 3V3MA 1D4PB 2JETC 2XC5A 1GJ4H 1KLIH 1MTNC 1VITG 4X0WU 1PPBH 1BJUA 1QY6A 1P09A 1O2HA 1DY8A 1H1BA 2AGIX 1CSOE 1EAXA 1CT2E 3KN2A 5DP8A 5LPEA 2FLRH 1GJ7B 1TWXB 1UTJA 1CHOG 4MVNA 2BDAA 1LKAA 1TALA 1YP9A 1F0SA 1TNKA 2WPMS 1L4ZA 3UNRA 5L2YH 2JH0D 2O8WA 2VVVA 1G30B 4OS5A 4IW4E 2GKVE 2GCHF 3ATLA 2BD8A 4K8BA 1K2I1 1Q3XA 2BLWA 1XMNB 1GMDG 2FI4E 1IOEA 2RCEA 1C5UA 3BEIB 3F9FA 3OX7U 1MH0A 1T31A 1GJ5H 1MAXA 2AMQA 1RFNA 2WV4A 1O35A 3VGCB 4MNVA 1TBRH 2UUYA 4M7GA 2BLVA 1DWBH 1EATA 3LU9B 3RU4E 1TNLA 2VIDA 4ZMAH 3ZV9A 2Z9KA 3RXFA 3U98H 1SQOA 2NU1E 2BXTH 2AH4X 3GISB 2FM2A 1VCQA 4AYVB 1HCGA 4K5ZA 4LZ1H 2XC0A 2ZFTA 3BTTE 1IQJA 4FUHA 1D3TB 2CN0H 1TBZH 1WTGH 1VZQH 2FX6A 1DS2E 2SGAA 1MQ5A 4DCDA 3TVJB 1Y5AT 4TWYA 1ZJKA 4U2WA 2ZGCA 1OWEA 2ANMH 1O2VA 1Y3VA 1O36A 1SL3A 2ZFQH 3ZZ7A 4ZKSU 4NA7A 3UFAA 3NUMA 4BAKB 1SG8B 1FJSA 3SHCH 3E16B 4YOGA 1Y5UT 1QL9A 1OSSA 1NRQH 3GCOA 4ABBA 1QB1A 1TOCB 1LMWB 8LPRA 3LGTA 1P57B 1YGCH 3QUMP 1TONA 1DITH 1C2FA 4WXVA 1GI4A 3T25A 1GDQA 1GI5A 4O3UA 1O3PB 2XRCA 2PW8H 2B7DH 1TX6A 5F8ZA 2BD3A 4ESTE 1P2OA 2GCTB 3BTKE 1OP0A 1BJVA 3KQEA 4H6TA 1P9UA 2FOFA 1GG6B 1ZTKA 4JK6A 1TNJA 1HAPH 4X8VH 4FUBA 1O3MA 2FYQA 2C90B 5FX6A 1AVWA 2Y5FA 4NGAH 4X2VA 2A45B 3KL6A 1O34A 2BZAA 4GCHG 1UTQA 3RMOH 1C2IA 1Z8JB 2SNWA 1K21H 5A2MH 4DJZB 5DKMA 2C8ZB 3RXAA 5JDUB 3RU4D 2YNAA 1GI3A 2F3CE 3FZDA 1KDQA 2HPQH 4JZIA 4NIXA 1G2LA 3MOCA 1AWFH 4D9RA 1MQ6A 1E38B 3SQEE 1FY5A 1DPOA 1V3XA 3TK5A 3BEFB 3PM3A 4CR9A 3FANA 3MNXA 2BTCE 1K1OA 1QQ4A 1GJAB 4X6NA 2FS8A 3LGIA 2G5NA 5DP7A 4GLYA 3QO6A 3MMGA 3SJKA 1O2QA 1HB0B 3QN7A 4MNXA 3IWMA 2QCYA 4ZAEA 3RXSA 2HWLB 3ZZ4A 4E05H 5CE1A 1GGDB 2OCVB 1C1VH 4XBDA 1BITA 1ZZZA 1G36A 3Q3YA 1GCTC 5FBIA 2IN2A 1HNEE 3KIDU 1E35B 1H9IE 1KYNA 1WOFA 4K1EA 1SLUB 1SPJA 1PPEE 5PTPA 3R0FA 3AAVA 3QWCH 2EI8A 4IC6A 3M5NA 4I7YH 2A4OA 3VB3A 1ZGIA 2O8MA 1V2PT 1KY9A 4CHAB 1QURH 2ZHWH 5I25A 1DXPA 1P9SA 4LXBH 1HAHH 1E36B 3MH7A 5HGGA 1C2KA 1UVUH 1Z6EA 1W7XH 4X8SH 2QAAA 3DA9B 3KHVA 3BG4C 1OXGA 1NN6A 3PMHB 2OUAA 1Z1IA 2P16A 2GMTC 4I31A 2VNTA 2EEKA 1FY4A 1NRSH 1O2UA 2R2MB 3OY6U 1ZPZA 5K7RA 1O3LA 3E0PB 2H1UA 2XBWA 1C2DA 2J2UA 3SOSA 5JPMH 3SU4A 1HJ8A 4NWKA 1LVYA 1ESTA 1TGTA 3PLPA 2HPPH 3TNSA 2F9UA 3RXOA 2W5EA 2ASUB 1Z8GA 5T6FA 1Z8IB 3SJIA 1ZTJA 4ZHLU 2BOHB 3UWIA 6LPRA 3SORA 4Y8XA 2ZGJA 1WQVH 3RXEA 3LGWA 3HK3B 4GSOA 1XVMA 1ZHRA 2TGDA 1AQ7A 1AZ8A 1RIWB 2GVFA 1ORFA 3Q00A 2SFAA 1D9IA 1KXBA 2Y7ZA 1RTKA 4B2AA 2AMDA 1BTWA 1O3KA 1GMDF 3P8NA 3RMMH 3CS0A 1FDPA 2KAIB 3DT0H 3IITA 1UTOA 1Q31A 4OS1A 1IQGA 1BCUH 2IJOB 1ZSKA 1BRAA 2EI6A 1TGNA 1N8OC 1ELVA 1LVOA 4Z6AH 3ODDA 2OTVA 2VGCB 1FAKH 1MU8B 1LHCH 1HV7A 1NFUA 4FUGA 4Y8YA 1B7XB 3OSYA 2BVRH 3KQDA 1J16A 4I8KA 4AFQA 1TNGA 2WV5A 1YPKH 3U1IB 5ESTE 1BRCE 4AFUA 1C5YB 1A3EH 1DANH 1KLTA 2A32A 4ZUHA 2OINA 1IQKA 1P01A 1SGYE 2ZQ2A 2ILNA 1IQMA 1GDNA 2PTNA 1FV9A 4WWYA 1AE8H 1T8MA 1VITH 5C3NA 4CRFA 1SGQE 2V6NA 6GCHG 3QTOH 2BXUH 1SGTA 1QRZA 2ZCLP 4CBNA 3RXJA 1ZMJA 1NU7B 2AFQB 2BLQA 4DT7B 1DWDH 4ISIH 1O3EA 1YBWA 1SGCA 1K9OE 2VVUA 2CGAA 3A80A 1P8VC 3RXBA 3UREA 3TK6A 1W8BH 4I8LA 1O31A 5EW2H 3S9AA 3EDXB 4B74A 4BTIB 3UR6A 1O2SA 3RXUA 1C5ZB 3H7TA 2GTBA 1WQSA 2UUFB 2AMPA 2PGQB 1GL1A 3PO1B 1TPSA 1SGPE 4PROA 3KEEA 3M7UA 1V2LT 1F0TA 5HYOA 1SGFG 1HXFH 2ZEBA 4B71A 1O2YA 1XUIA 1PPHE 2FMJA 5E0GA 4X6PA 1A4WH 1QJ1B 2R3UA 2VH6A 2ZTZA 3SU1A 2FIRH 1L1GA 4MPVA 4CRDA 3GY2A 1NTPA 1C4V2 1Y3WA 4UFGH 3S9CA 1G3EA 3H7OA 1IQIA 1LHGH 4THNH 1C1UH 3Q76A 2FOMB 3RXGA 2R9PA 3GICB 4UEHH 3KNXA 3K65B 2NU2E 1L1NA 2BQ6B 3RXIA 1WSSH 2BQWB 2FWWA 1X7AC 1DX5M 4AYYB 5HM9A 3ATIA 3SUFA 1F2SE 3I29A 2IOTA 2ZQ1A 5JBTA 2J95A 3NXPA 2Z9LA 4OGYA 1C1SA 3MH6A 2FOCA 1EZQA 3T28A 1QFKH 1KXDA 1C5TA 5B6OA 4AFZA 5DP6A 2TIOA 3H5CB 4X1NU 3QZRA 4QT8C 1CGIE 1EZUC 4D7GA 5C1UA 3A7YA 5DO4H 3RM0H 1FLEE 3ZZ3A 1GI2A 1CBWB 3PYHA 1GJ6A 3P8GA 1B5GH 2FLBH 2ZPRA 1PQ8A 3EA9A 1GJBB 4NFEA 1ESBA 1CU1A 2GGVB 2ANYA 8ESTE 1C4Y2 1FY8E 1TMBH 2EC9H 1UVPA 3BV9B 2A4GA 3MNSA 5GCHG 4MNYA 3LKWA 3TNTA 1JXPA 3TH3H 4AFSA 2QIQA 2SGQE 1UK3A 5T6DA 3UNQA 1P12E 1ZRKA 5T6GA 1MKWH 2JETB 3O8RA 2ZU3A 1MTNB 1O2XA 1EPTB 1ANCA 3KCGH 2WPJS 3PB1E 3S0NA 3L3TA 3QGNB 2H5DA 4AB8A 4ABJA 1G3DA 7GCHF 3DUXH 5J4QA 2FESH 1C1QA 4OGXA 1LCYA 1GHZA 1CHGA 3ZVAA 4B2BA 2HGTH 1L2EA 1TMTH 2HVXA 2JH5D 3NKKA 3EQ0H 1K1NA 2Z94A 3MU1A 1C1PA 3EYDA 1EASA 3HPTB 1F7ZA 1LO6A 1ZOMA 2B0FA 3GCTG 4X6MA 5F8TA 3U8OH 3A86A 1W13U 5FBEA 1UMAH 1EX3A 3ZYEA 1TABE 1XKAC 1T8LA 2W3IA 1O2LA 2H9TH 4E06H 5JBBS 1GVKB 1F5LA 2P3UB 2XWBI 1GHAF 1C5WB 1KSNA 3UOPA 3CP7A 2FOGA 1UCYE 2TRMA 4LZ4B 2QY0B 3ZYDA 3SV6A 2A7HA 2CHAC 4A1TA 2A2XH 1XVOA 2OQUA 2M5TA 3BG8A 2SNVA 5DK1A 1V2NT 3SBKA 1DT2A 2WPLS 2ZZUH 4B75A 1BB0B 2P8OC 4MLFB 1MKWK 2Z9JA 1UK4A 5C67A 3BN9A 1C5LH 2ZG0H 2ODQA 1BHXB 1AD8H 2TGAA 5DJ7A 4ABFA 1AU8A 1A3BH 1JRSA 1FY1A 5LH8A 2TPIZ 2ZDLA 1EZXC 1F5RA 2QGRA 4U01A 1MKXH 5EQRA 4IBLH 4U30A 9ESTA 2J4IA 1YC0A 2XNIA 1MMJN 2QXGA 4NIVA 3MU8A 1GI6A 1HAVA 2BD4A 2AS9A 1O3IA 1BTHH 3ESTA 3SV2H 2XYAA 3TJVA 1C5QA 1ELDE 1YPMH 2FOBA 3ZZ8A 1QBVH 5FX5A 3A7ZA 3RXKA 1KXEA 1MD7A 4SGAE 1TOMH 4YLUA 3HGNA 2A7CA 3OY5U 1AY6H 3AAUA 2FS9A 2VWNA 3SHAH 3TK9A 3UQVA 2ZDKA 3SNCA 5C5OA 5E0JA 9LPRA 4I33A 2PR3A 3SO3A 4NSYA 2BDYA 2OC7A 1C2EA 3VB7A 3SN8A 2VINA 3MU5A 1C5SA 3K6ZA 2SGPE 3BSQA 1LTOA 2W26A 3T27A 1MCVA 4NIWA 1C2HA 2Z3EA 4IMZA 1GHBF 2Q1JA 2Y6TA 1OYTH 1MKXK 3UIRA 2WPHS 1SOZA 1TRYA 1GHYH 4A5TS 7LPRA 1BMLA 3BTWE 1XUGA 1U6QA 1MTUA 1OP2A 1C9PA 3P95A 2ZCHP 1SGDE 1C5RA 1NS3A 1C2MA 1HFDA 4FU8A 3Q77A 4JZDH 1ZSJA 4HI3A 1TQ0B 2DE8A 4ISOA 1W0YH 1JOUB 2Q6GA 1EXFA 3F9HA 4HFPB 1A5HA 2ZDAH 2R0KA 2STAE 1ELGA 1AUJA 1GI7B 1NC6A 3K6YA 2ULLA 3M3SA 1QRXA 1GHXH 1O3OA 3O8DA 3BIVH 5ETXA 5IDKA 1Z8RA 4NZQA 2ZTXA 1N1LA 1PJPA 3E91A 2XCNA 1ZMLA 3MO6A 1TQ7B 2D8WA 1GMCF 1BMAA 3UTUH 1GHVH 1OWDA 2VJ1A 2XC4A 3EGKH 1K1JA 4YOIA 2R3YA 2VIVA 2ZHFH 1HAXB 2J94A 2A2QH 1O5GH 2G00A 1ZTLA 1MCTA 2A5IA 4YZUA 3U1JB 1ETTH 1GCTB 4KTUA 1MAYA 2TGTA 2UWOA 2Y80A 3ZZAA 2XBVA 1W14U 1CA0C 4IN1A 1BA8B 1FUJA 4HTCH 4O97A 1JIRA 1FN8A 1NFWA 4Q80A 1TLDA 5GJ4B 4TY7A 3LH3A 3LDXH 3A83A 4X1PU 2WUCA 2RA0A 2CV3A 2BY5X 2PKAA 4CBOA 4R0IA 1SFQB 3LGYA 4FUEA 4BOHA 1VCPA 1GBEA 3SV9A 1O3AA 5EXMA 2PLXA 3GYMA 4YLQH 1Z71A 1FPCH 1Z1JA 2A0QB 1TPOA 3BG4B 1GBHA 1HIAB 3ZZBA 1CGJE 2RA3A 3MWIU 3C1KA 2B9LA 3TJNA 1D6WA 4DW2U 3UWJH 4SGBE 2GMTB 4ZKRU 4JZFH 5FPSA 1UTKA 3ZZCA 3ZV8A 4X2WA 4Y8ZA 1O3HA 5GCHF 5F8XA 5HMAA 3SNDA 1FI8A 1NRPH 1O2JA 4YO9A 3F6UH 3RDZA 3PTBA 1AO5A 1N6YA 1GBLA 3TJOA 2O8UA 3A7XA 5A09A 1D3PB 4XE4A 1T8NA 5TJXA 4A1XA 3MYWA 1K1IA 4IC5A 4X1SU 4HGCA 1C1RA 2Y82A 1LVBA 1UTNA 4Y6DA 2PFEA 2BDCA 2BVSH 2YNBA 2AYWA 3NK8A 1O5DH 2PUXB 3SNAA 2Z9GA 1NESE 4R8TB 2PTCE 1S6HA 1P2IA 3Q3XA 4ZXYH 5DP9A 2P3FH 1DLEA 1GPZA 1MU6B 1S83A 1QR3E 3SU0A 3SGBE 1OWHA 4KKDA 1O3CA 1K22H 1W10U 2GZ7A 1EOLA 2ZFPH 1W12U 1WCZA 4BTTB 4VGCC 1LPGB 2PSYA 2QN5T 2D2DA 1ZPBA 1TGSZ 1L0ZA 4B73A 2J92A 1GMHF 3QDZB 7ESTE 1N8OB 2ZECA 3LH1A 3SU3A 1HPGA 3VFEA 1EJAA 2O9QA 1IAUA 2BVXH 2G51A 1H8DH 1PFXC 1J14A 2BD5A 4K2YA 4NA9H 3E0NB 3SUGA 1TNIA 2A31A 1YPHC 5EW1H 3EA8A 1O2KA 1CGHA 1EOJA 1EZSC 1OP8A 2BX3A 4F4OC 3TGKE 2D26C 4GHQA 1J15A 2J9NA 1KXCA 3PWCA 4UFEH 1ELAA 1NRNH 2GCTC 3BTGE 1MD8A 2GV6A 4O03A 1L1JA 1AFQC 1O5EH 4X8UH 1NM6A 5DPAA 1SB1H 4ISHH 1UHBB 3VB4A 1GG6C 1BDAA 4KP0A 2VIOA 1SGFA 1BBRE 3W94A 4GPGA 4A1VA 1KXFA 1TRMA 1QNJA 4NSVA 3VB6A 1HRTH 1VITF 5EXNA 4K60A 2STBE 3V0XA 3MH4A 2H5CA 3SZNA 1GBJA 1EJNA 3CENA 1O2RA 1VCWA 2TGPZ 5A0AE 3E6PH 1SC8U 5FAHA 1BUIA 1CHOF 1ACBE 5F03A 5GPIB 1IQLA 2F9OA 1G32B 1NFXA 1O2TA 4MNWA 2OXSA 2ODYB 4GAWA 1DICA 2Q6FA 2ZGBH 2OD3B 4B1TA 4IMQA 1GBDA 2THFB 4FUIA 1P03A 1K28D 1A0LA 3OYPA 2BM2A 5AHGH 4JYTA 2G55A 2BDHA 2C8WB 3F9GA 1O33A 2ZI2H 4YTAA 1DLKB 1Y8TA 1TMUH 2W3KA 1GGDC 3ENSB 2HRVA 2NU3E 2XXLA 5A8ZA 3SNBA 3UPEA 4AZ2B 3LC3A 4Y71A 3O8CA 1WYKA 2OP9A 2GT7A 1DSTA 2GZ9A 3HATH 1WAYB 3PMJA 1HGTH 3RXLA 3R3GB 2NWNA 1EB1H 6ESTA 1O2ZA 2P59A 3MU0A 2ANKH 3RXRA 2O8LA 1AKSB 1KXAA 1C1TA 1VGCC 1A46H 1FXYA 4ASHA 4CRAA 1SBWA 2A1DB 4D9QA 3AVZA 3RP2A 2FOEA 1DWEH 3RXDA 2AEIH 2VH0A 2ZHDA 1AVXA 4NWLA 4HZHA 3SJOA 4IN2A 5FHTA 1SFIA 1C2LA 1HAOH 5L2ZH 2ZF0H 1ZGVA 5C2ZA 4Z0KA 2R0LA 1CE5A 4GHTA 1CT4E 1W2KH 4MG3A 1JRTA 1B0EA 2BX4A 3KGPA 1GI1A 2GDDA 4BNRA 1Z7KA 3MH5A 1C5VA 3SU5A 1JMOH 3P70B 1E34B 1V2OT 1RS0A 1XX9A 4XDEA 2FI3E 2D1JA 1AB9B 2ZCKP 4ABGA 2ZU2A 3P92A 3T62A 2XWAA 4TPYA 5DP3A 3M35A 1A0HB 3TLOA 1GJ8B 1H9HE 2QXHA 1O2GH 2ZA5A 1BTZA 5AVDA 4DVAU 2VWMA 2B5TB 2UWLA 3MHWU 3LJJA 1ZHMA 1M9UA 1NU9A 5K0HA 3A7WA 1LHEH 1OKXA 2VIPA 1QB6A 4GCHF 1PPGE 5ESBA 1EAUA 1ETSH 3W95A 2C8YB 2HNTF 1BOQA 3F68H 1SR5C 3URDA 2A7JA 1JIMA 3GY5A 2R2WU 1T4VH 2I6SA 1O2IA 3C27B 3M61U 3PWBA 2OLGA 1RIWC 3MNBA 3GCHC 1K1PA 2C3SA 4I32A 1OOKB 1Y3UA 2O8TA 1TFXA 3KF2A 3RMNH 1V2UT 1TAWA 4XOJA 3L33A 4ZHMU 2B8OH 2CHAB 2KAIA 3AASA 4WJG2 1K1LA 4UDWH 5LPRA 4Q2KA 3S9BA 2OC8A 1FONA 1A2CH 5EPNA 1V6DA 4Y7AA 1O2OA 1O2NA 3LT3A 4FXGH 2ZNKH 2P8OB 1XXDA 2FPZA 2ZHQH 3ZVGA 4TYDA 2I6QA 3BTHE 5JB8S 2HLCA 1ELTA 1BQYA 1J8AA 3V13A 1HAYB 5EODA 3SW2B 1S0QA 2PGBB 4RSPA 4I8HA 4Y11E 2CF8H 2YOLA 1C5PA 1MTVA 1GVLA 4Q7ZA 3P6ZB 3MU4A 1WBGB 3D62A 4O9VA 1H8IH 3GY8A 6CHAB 3A8DA 4ISNA 1ESAA 3N7OA 3DD2H 1S81A 2AIQA 1HJAC 4CRBA 3E90B 4FUFA 4D7FA 3B9FH 3FAOA 2RDLA 1LHDH 4JMYA 4ZROA 2ZPSA 3RM2H 1DM4B 2ZU4A 1LPZB 1DUAA 1GI0A 2K1QA 1Q2WA 3BTEE 2ALVA 2BB4A 3URCA 1E0FD 3RXVA 2FP7B 1QHRB 5L6NH 2A5KA 3FP8E 5BRRE 3JZ2B 3FFGA 3RLYH 2FYRA 1BHXF 1P04A 1FIZA 1THSH 3I78A 4OS6A 1ARCA 2BY9X 4BAHB 4WF8A 1RGQA 1IQEA 2BYAX 5EGMA 1TGBA 3ZZ5A 1ETRH 4WVPE 2BY8X 1ZRBA 2CMYA 1O5FH 5A0CA 2FOAA 1GBKA
chains in the Genus database with same CATH superfamily
3EAJA 2A4RA 3LONA 3STIA 1B0FA 1ZPCA 1AI8H 4K3JA 1TNHA 3U8RH 1DSUA 1EJMA 3N7EA 4DIHH 1GI9B 2LPRA 1EP6A 4NCYA 2G52A 3SU6A 3ZVEA 1FIWA 2ZO3H 1QCPA 1BTPA 3A7VA 1MABB 2FTLE 1YCPH 3SJ9A 3PMBB 3PV4A 1UTPA 4Y79A 1BTUA 2XTTB 1T4UH 2PKSC 4Q7XA 1MZDA 1BT7A 1QJ7B 1UCYH 2AIPA 1XUFA 5DP4A 1P2QA 4X6OA 1ZLRA 1ZSLA 4KGAA 5BPEA 4FOUC 1ZJDA 3M3VA 4JZEH 1GBAA 3ZZ6A 2W6JD 1AMHA 1TPPA 1KLJH 3SQHE 3T2NA 1C5NH 1DWCH 3M7QA 1D3QB 3L6PA 2V3OH 1YPEH 4XSKU 3ZVFA 3UR9A 3D49H 2Z9IA 2LNCA 2P95A 3VEQB 4JYVH 1P3EA 2Z7FE 2WYJA 2ZFRH 4Y0ZE 4JCNA 4WH8A 1GHWH 2Y5GA 4YT7H 4INLA 2WSSD 3NZIA 1THPB 3FP7E 1BMNH 1VKYA 1GBBA 1XM1A 2F9VA 1DFPA 3VXEH 3GY4A 1COWD 1MBMA 5JBAS 1S82A 3U69H 1NBME 1OYQA 5C20A 3D23A 1LPKB 1BMMH 2FI5E 2Z3CA 1C4U2 3MI4A 1UK2A 5J4SA 3SU2A 1P06A 1P11E 3OTJE 3U8TH 1CA0B 2CK3D 1LHFH 1G37A 1FAXA 1YCPK 3RXCA 1A0JA 4AG1A 5HXFA 1TGCA 2FX4A 5ABWA 3UQOA 2VU8E 2NU4E 4FUJA 1UCYK 1OWIA 1GWAA 2XBXA 2ZHEH 1YLCA 5FPYA 1ABIH 4H42U 1EPTA 3IG6B 4RI0A 4D76A 1EPTC 2PUQH 4OM9A 4B76A 1KTSB 1CVWH 2ZGHA 1XUJA 2QV1A 1RTFB 3A8CA 4OS2A 6GCHF 1EAWA 1O2MA 3B8JA 3O8BA 1INCA 5CHAC 4LOYH 4WMFA 1GJ9B 1SGIB 1S5SA 3RLWH 2Y5HA 3MNCA 4YESB 3BF6H 4XRNA 2GZ8A 1F0RA 1YLDA 1GBMA 4B6FA 3GY6A 2ZIQH 3MFJA 4WMDA 3A85A 3NCLA 1GBFA 1RJXB 4MDSA 2QF3A 5T3HA 3RXPA 4DOQA 1WTHD 2IPQX 5EOKA 1C1MA 3FZZA 1AZZA 1KDQB 3AW0A 3M5LA 4CR5A 3VXFH 3PV5A 2F4LA 2Q6DA 4NA8A 1N6XA 1DUEA 2KCYA 1V2RT 3LJOA 1SLWB 1O37A 2DUCA 3TIUA 2H2ZA 1TA2A 2CJIA 3PMAB 1JWTA 1V2ST 3HKJB 2OQ5A 3LC5A 4KELA 4UD9H 1DE7H 4Q7YA 4H4FA 4K1TA 1DY9A 4X2XA 3STJA 4ABEA 4E7RG 1YM0A 4YT6H 1C2GA 1ANBA 1P02A 1NBMD 1YF4A 2ZKSA 1FY3A 4JZ1A 1EQ9A 1FMGA 3B23B 2XW9A 3ELAH 2FEQH 2SGFE 1Z6JH 2A5AA 4BXSA 3SUDA 2ZC9H 4VGCB 2WPIS 3TH4H 1GJCB 4Y76A 2VIWA 5JBCS 1NY22 3EA7A 3KQBA 1MTSA 2Y81A 4WY3A 2F9NA 1W7GH 1P2KA 3ZVCA 1C2JA 2XCFA 4U32A 3VPKA 2H9EH 1YPGH 1G9IE 3LOXA 1KIGH 3SUEA 1MBQA 1MTWA 3GCNA 2VWOA 5FXLA 5A8YA 1SLVB 3RXHA 1ARBA 1OHHD 1SLXB 1HBTH 5EPYA 1V2VT 1YYY1 4DG4A 3PRBA 2VWLA 2BLOA 1EP5A 3M7TA 1FN6A 1C1WH 4K69A 4UFFH 1GDUA 1LDTT 1D6RA 1AFQB 2OBQA 3A84A 3U9AH 1YPHE 5EIYA 3A89A 3E8LA 4FU7A 1V2MT 1V2WT 4BAMB 4CRCA 1O3BA 3TGIE 1BRUP 1QTFA 2G81E 4ZKOU 2UWPA 2VB0A 1AIXH 3LGUA 3QLPH 1KTTB 1HJ9A 3UUZA 4BAQB 1GL0E 4H6SB 1O38A 2FO9A 4UFDH 4WMEA 1NROH 1QA7A 3ATWA 1SHYA 4GUXA 2OBOA 3VGCC 3QX5H 4ZH8A 3P8OA 3T26A 4AB9A 1O5BB 3NWUA 5FCRA 1G3CA 1GCDA 3SV7A 1LKBA 4LK4A 1OS8A 3GY3A 3T29A 5LGOA 4NZLA 1W0KD 3QZQA 1O0DH 1V2TT 1CQQA 1PYTC 2G4UA 2BDIA 3EE0B 2ESTE 1Y59T 2UUKB 3RC4A 3GCTF 1Y3YA 4RKOB 1AWHB 2DE9A 2Y7XA 1WUNH 1PQ5A 3F9EA 2AGGX 1QL7A 1TPAE 2ZU1A 2ZP0H 1ELBA 2BD7A 3MO9A 3PTNA 1UVSH 5E2OA 1HYLA 2IPHA 4YM9A 2KCPA 2KX4A 1TX7A 3SI3H 3PLBA 4ZKNU 1PYTD 1XUKA 3VB5A 3SV8A 1SI5H 1ZHPA 4FVBA 5LPFA 1O30A 4ABDA 1AUTC 1KMHB 4TWWA 3KQCA 1IQNA 3E1XB 5TCCA 3HKIB 1SQRA 5GDSH 4XBBA 1LVMA 3ATMA 3K9XB 2L6OA 1O2PA 3ZVDA 1O3FA 3KYFA 1MZAA 4IS5A 1THRH 3OTPA 1O5AB 1VJ9U 2CXVA 4TY6A 2VBCA 4DY7B 1P0SH 2ZTYA 1O3JA 1G3BA 3ZZ9A 4CH8B 2K0QA 1SHHB 2J5UA 1UTMA 4I8GA 4NG9H 3RUOA 2XOKD 1VGCB 5AFZH 3BTFE 3I77A 3NRLA 3ZVBA 1XUHA 2GV7A 2PWXA 3OEHD 3M36A 1WU1A 3M5OA 1PPCE 2OC0A 3ODFA 7GCHG 3K2UA 1O39A 2BY6X 2QF0A 1NZQH 1NFYA 3MTYA 1BTXA 1P3CA 1W3CA 3LGVA 1TA6A 1GBCA 3A8AA 1IQHA 4AG2A 1BBRH 2FDAA 1HIAA 1XXFA 1T32A 2ZU5A 8GCHG 4MPUA 4ZXXH 4WXIA 2ZFFH 3P8FA 5C1YA 1HAZB 3SI4H 4X8TH 2W7SA 5H4IB 1BIOA 1YWUA 1MUEB 4A7IB 1SGNE 2BZ6H 1DDJA 1O2WA 3GY7A 3MO3A 3QK1A 3A7TA 3A87A 2JH6D 3S69A 4MTBA 2BDGA 2G8TA 4RN6A 1GHAG 4CH2B 3SGQE 4XFQA 1G2MA 3RC5A 4DURA 1S6FA 2BQ7B 3FVFB 2TBSA 3DFJA 1WV7H 1NRRH 1ABJH 1F0UA 5E0HA 4RKJB 1NPMA 1SOTA 1J9CH 4E7NA 1A1RA 3M3TA 1TYNA 2FOHA 5JYIA 2ALPA 1S0RA 1AHTH 1C1NA 5TCAA 2SGEE 5FCKA 2GJGA 1DVAH 1OX1A 5GIBA 2F9BH 5EG4A 4KTCA 2V0BA 4INKA 2C4FH 1K1MA 3LIWA 4A92A 4ABIA 3UNSA 1GBTA 1C5OH 3SZEA 3AW1A 1QGFA 3GCHB 2BY7X 5E2PA 1F5KU 3LPRA 2J38A 4BAOB 2F91A 3RXQA 2PV9B 1CA8B 1BBRK 2F43B 1P2JA 5FPTA 1QA0A 2WYGA 4X1RU 1IQFA 4OS4A 3M37A 2CF9H 4K1SA 1BRBE 1FQ3A 1NT1A 1S84A 5EXLA 1W0ZU 2SGDE 2QXIA 2HOBA 1ZMNA 4FUCA 2WUBA 3QGJA 3DFLA 2FODA 1K0HA 1UJ1A 4J1YA 1BZXE 5A8XA 4CHAC 1ANDA 2F83A 1C1OA 5EQQA 5SGAE 1TX8A 1T8OA 5I46H 1SMFE 4BXWA 2G4TA 1RRKA 4I8JA 1SVPA 1Y5BT 2J34A 1DXWA 3HGPA 2PSXA 1W11U 3UOUA 5C5NA 2OC1A 5C1XA 2J97A 5HIYA 2QE7D 1QJ6B 1HJAB 2QYIA 2F9PA 1ID5H 1E79D 2WPKS 1HXEH 1UHBA 3RXMA 1AFEH 1AN1E 4UE7H 2GCHG 2KFWA 2NU0E 7KMEH 1VR1H 2ANWA 1V2QT 1GHBG 3UY9A 1S85A 2VVCA 1QBOA 3F2FA 1A5GH 4JK5A 4MPXA 1ANEA 1QQUA 1ELEE 2ZDVH 3ITIA 1GVZA 1XKBC 1RD3B 3Q3KA 1TRNA 3RU4T 2XBYA 1FZZA 1TB6H 2P3TB 2ODPA 5DGJA 4AX9H 2FTMA 2GT8A 5A0BA 1LQEA 3A88A 1SQAA 4CREA 2V3HH 1V2KT 1A5IA 5CMXH 1SQTA 3DHKH 3TU7H 4NIYA 1J17T 4X2YA 4X1QU 4FU9A 4AGJA 4ABAA 2JKHA 1T7CA 1SGEE 1A7SA 3KYGA 2P93A 2ZGXH 1OWJA 3TPIZ 1Y3XA 4A6LA 3OU0A 1SGRE 4AOQA 2P94A 1GMCG 1P2MA 3ZZDA 4RT0A 1NO9H 1EFRD 3TH2H 1TE0A 5GXPA 1ZYOA 2RG3A 1AGJA 1EAIA 3F1SB 1D3DB 1HDTH 1JBUH 1CO7E 3GYLB 1HUTH 2PKSB 5AFYH 1O3GA 4O3TA 3S7HB 3G01A 1YPJH 2AGEX 2QC2A 4ISLA 5IYTA 3E3TA 3RMLH 1PQAA 3ATKA 1VJAU 4DGJA 1AVGH 1BTYA 1YCPM 1ELFA 2VGCC 4K8YA 5HM2A 1V2JT 3SGAE 1FNIA 3TJUA 2PHBA 1RXPA 1UTLM 1UVTH 1YPLH 1AE5A 3NPSA 5CHBA 1QB9A 3S7KB 1C5XB 1AKSA 3OEED 2ZPQA 3TGJE 4AORA 4MQAA 1A61H 1HAVB 2ZDMA 2W7UA 4KTSA 2GD4B 4FVDA 3HK6B 4TPIZ 5G4BA 1CT0E 2HALA 1HAIH 4Y7BA 3TITA 2GX4A 3GDUA 3GOVB 1HAGE 2BMGB 3F0PA 3A82A 4ZHAA 1P2NA 1TIOA 1DOJA 4YOJA 1H4WA 2PP6A 4INHA 1UO6A 1PPFE 2BOKA 2GDEH 2V35A 1QBNA 3PLKA 4IGDA 4MPWA 4CRGA 1AB9C 1F92A 1E37B 3BTME 4OS7A 1LQDB 2HNTE 2QXJA 1OPHB 2ZFSA 1C9TA 4Z1MD 1SSXA 3V12A 2EI7A 2VIQA 3PO1C 2BD2A 8KME2 4J2YB 5F6MA 5CHAB 3JZ1B 1QIXB 3BIUH 4FUDA 1O32A 3BEUA 3BTQE 1RTLA 2RFKC 2FXRA 1QL8A 3CS7A 4YXWD 3GDSA 5GWZA 4Y0YE 3WY8A 4BTUB 8GCHF 3GS9A 1HLTH 2EA3A 2Z6BD 4B6EA 2WINI 3D65E 3BTDE 4AGKA 1UVOA 4DT4A 4UONA 2H6MA 1P05A 1PPZA 3PROA 1O5CB 1YKTA 4DIIH 1OWKA 2BDBA 1O3DA 3RC6A 1ELCA 1ZR0A 4D8NA 5DG6A 2ZDNA 3A8BA 4XBCA 4ABHA 4F49A 5AF9H 1EKBB 1GI8B 1GMHG 1IHSH 4B2CA 4AN7A 2FZZA 2ZWLH 2Z3DA 2GP9B 2QA9E 4NFFA 3SNEA 3FP6E 1BMFD 1C5MD 4Y10E 2AERH 1IHTH 3GDVA 3SJ8A 5E8EH 1GBIA 2A4QA 3M5MA 3H09A 2G5VA 5EQSA 1P10A 3P17H 5B6LA 5L30H 1FPHH 2BD9A 3T5FH 1YY3A 4WH6A 1CBWC 1GJDB 4JYUH 4GVUA 2HNTC 2BHGA 3A81A 2C8XB 6CHAC 3AK5A 2H9HA 1TBQH 1EUFA 5DP5A 3SYJA 2C93B 3QTVH 1L4DA 1H9LB 2UUJB 5JB9S 1EB2A 1PQ7A 1QRWA 5EU8A 1O3NA 3RXTA 2PKAB 4BANB 3V7TA 3V3MA 1D4PB 2JETC 2XC5A 1GJ4H 1KLIH 1MTNC 1VITG 4X0WU 1PPBH 1BJUA 1QY6A 1P09A 1O2HA 1DY8A 1H1BA 2AGIX 2J98B 1CSOE 1EAXA 1CT2E 3KN2A 5DP8A 5LPEA 2FLRH 1GJ7B 1TWXB 1UTJA 1CHOG 4MVNA 2BDAA 1LKAA 4I86A 1TALA 1YP9A 1F0SA 1TNKA 2WPMS 4P02A 1L4ZA 3UNRA 5L2YH 4TT3D 5EJLA 2JH0D 2O8WA 2VVVA 1G30B 4OS5A 4IW4E 2GKVE 2GCHF 3ATLA 2BD8A 4K8BA 1K2I1 1Q3XA 2BLWA 1XMNB 1GMDG 2FI4E 1IOEA 2RCEA 1C5UA 3BEIB 3F9FA 3OX7U 1MH0A 1T31A 1GJ5H 1MAXA 2AMQA 2WV9A 1RFNA 2WV4A 1O35A 3VGCB 4MNVA 1TBRH 2UUYA 4M7GA 2BLVA 1DWBH 1EATA 2K8IA 3F3BA 3LU9B 3RU4E 1TNLA 2VIDA 4ZMAH 3ZV9A 2Z9KA 3RXFA 3U98H 1SQOA 2NU1E 2BXTH 2AH4X 3GISB 2FM2A 1VCQA 4AYVB 1HCGA 4K5ZA 4LZ1H 3OFND 5KECA 2XC0A 2ZFTA 3BTTE 1IQJA 4M9FA 4FUHA 1D3TB 2CN0H 1TBZH 1WTGH 3DSOA 1VZQH 2FX6A 1DS2E 2SGAA 1MQ5A 4DCDA 3TVJB 1Y5AT 4TWYA 1ZJKA 4U2WA 2ZGCA 1OWEA 2ANMH 1O2VA 1Y3VA 1O36A 1SL3A 2ZFQH 3ZZ7A 4ZKSU 4NA7A 3UFAA 3NUMA 4BAKB 1SG8B 1FJSA 3SHCH 3E16B 4YOGA 5C94A 1Y5UT 1QL9A 1OSSA 3WWFA 5DN6D 1NRQH 3GCOA 4ABBA 1QB1A 1TOCB 1LMWB 8LPRA 3LGTA 1P57B 1YGCH 3QUMP 1TONA 1DITH 1C2FA 4WXVA 1GI4A 3T25A 1GDQA 1GI5A 4O3UA 1O3PB 2XRCA 2PW8H 2B7DH 1TX6A 5F8ZA 2BD3A 4ESTE 1P2OA 2GCTB 3BTKE 1OP0A 2V7QD 1BJVA 3KQEA 5EJZA 4H6TA 1P9UA 2FOFA 1GG6B 1ZTKA 4JK6A 1TNJA 1HAPH 4X8VH 4FUBA 1O3MA 2FYQA 2C90B 5FX6A 1AVWA 2Y5FA 4NGAH 4X2VA 2A45B 3KL6A 1O34A 2BZAA 3F2GA 4GCHG 1UTQA 3RMOH 1C2IA 1Z8JB 2SNWA 1K21H 5A2MH 4DJZB 5DKMA 2C8ZB 3RXAA 5JDUB 2WZQA 3RU4D 2YNAA 2V3MA 1GI3A 2F3CE 3FZDA 1KDQA 2HPQH 4JZIA 4NIXA 1G2LA 3MOCA 1AWFH 4D9RA 1MQ6A 1E38B 3SQEE 1FY5A 1DPOA 1V3XA 3TK5A 3BEFB 3PM3A 4CR9A 3FANA 3MNXA 2BTCE 1K1OA 1QQ4A 1GJAB 4X6NA 2FS8A 3LGIA 2G5NA 5DP7A 4GLYA 3QO6A 2RDEA 3MMGA 3SJKA 1O2QA 1HB0B 3QN7A 4MNXA 3IWMA 2QCYA 4ZAEA 3RXSA 2HWLB 2JJ2D 3ZZ4A 4E05H 5CE1A 1GGDB 2OCVB 3VG8A 1C1VH 4XBDA 1BITA 1ZZZA 1G36A 3Q3YA 1GCTC 5FBIA 2IN2A 1HNEE 3KIDU 1E35B 1H9IE 1KYNA 1WOFA 4K1EA 1SLUB 1SPJA 1PPEE 4F48B 2KR7A 5PTPA 3R0FA 3AAVA 3QWCH 2EI8A 4IC6A 3M5NA 4I7YH 2A4OA 3VB3A 1ZGIA 2O8MA 1V2PT 1KY9A 4CHAB 1QURH 2ZHWH 5I25A 1DXPA 1P9SA 4LXBH 1HAHH 3FKSD 5HKKD 1E36B 3MH7A 5HGGA 1C2KA 1UVUH 1Z6EA 2KZ4A 1W7XH 4X8SH 2QAAA 3DA9B 3KHVA 3KQ5A 3BG4C 3WWBA 4Q4LA 1OXGA 1NN6A 3PMHB 2OUAA 1Z1IA 3FN8A 2P16A 2GMTC 4I31A 2VNTA 2EEKA 1FY4A 1NRSH 1O2UA 2R2MB 3OY6U 1ZPZA 5K7RA 1O3LA 3E0PB 2H1UA 2XBWA 1C2DA 2J2UA 3SOSA 5JPMH 3SU4A 1HJ8A 4NWKA 1LVYA 1ESTA 1TGTA 3PLPA 2HPPH 3TNSA 2F9UA 3RXOA 2W5EA 2ASUB 1Z8GA 5T6FA 2EQNA 1Z8IB 3SJIA 1ZTJA 4ZHLU 2BOHB 3UWIA 6LPRA 3SORA 4Y8XA 2ZGJA 1WQVH 2HLDD 3RXEA 3LGWA 3HK3B 4GSOA 1XVMA 1ZHRA 2TGDA 1AQ7A 1AZ8A 1RIWB 2GVFA 1ORFA 3Q00A 2SFAA 1D9IA 1KXBA 2QF5A 1RTKA 2Y7ZA 4B2AA 2AMDA 5DSFA 1BTWA 2OK5A 1O3KA 1GMDF 3P8NA 3RMMH 3CS0A 1FDPA 2KAIB 3DT0H 3IITA 1UTOA 1Q31A 4OS1A 1IQGA 1BCUH 2IJOB 1ZSKA 1BRAA 2EI6A 1TGNA 1N8OC 1ELVA 1LVOA 4Z6AH 3ODDA 2OTVA 2VGCB 1FAKH 1MU8B 1LHCH 1HV7A 1NFUA 3UAIC 4FUGA 4Y8YA 1B7XB 3OSYA 2BVRH 3KQDA 1J16A 4I8KA 4AFQA 1TNGA 4RT1A 2WV5A 1YPKH 3U1IB 5ESTE 1BRCE 4AFUA 1C5YB 1A3EH 1DANH 1KLTA 2A32A 4ZUHA 2OINA 1IQKA 1P01A 1SGYE 2ZQ2A 2ILNA 1E1QD 3DCLA 3FO8D 1IQMA 1GDNA 3N7DA 2PTNA 1FV9A 4WWYA 1AE8H 1T8MA 1VITH 5C3NA 4CRFA 1SGQE 2V6NA 6GCHG 3QTOH 2BXUH 1SGTA 1QRZA 2ZCLP 2YMSC 4CBNA 3RXJA 1ZMJA 1NU7B 2AFQB 2BLQA 4DT7B 1DWDH 4ISIH 1O3EA 1YBWA 1SGCA 1K9OE 2VVUA 2CGAA 3A80A 1P8VC 3RXBA 3UREA 3TK6A 1W8BH 4I8LA 1O31A 5EW2H 3S9AA 3EDXB 4B74A 4BTIB 2YMSD 3UR6A 1O2SA 3RXUA 1C5ZB 3H7TA 2GTBA 1WQSA 2UUFB 2AMPA 2PGQB 1GL1A 3PO1B 1TPSA 1SGPE 4PROA 3KEEA 3M7UA 1V2LT 1F0TA 2M2AA 5HYOA 1SGFG 1HXFH 2ZEBA 4B71A 1O2YA 1XUIA 1PPHE 2FMJA 5E0GA 4X6PA 1A4WH 1QJ1B 2R3UA 2VH6A 2ZTZA 3SU1A 2FIRH 1L1GA 4MPVA 4CRDA 3GY2A 1NTPA 1C4V2 1Y3WA 4UFGH 3S9CA 1G3EA 3H7OA 1IQIA 1LHGH 4THNH 5EJ1A 1C1UH 3Q76A 2FOMB 3RXGA 2R9PA 3GICB 4UEHH 3KNXA 3K65B 2NU2E 1L1NA 2BQ6B 3RXIA 1WSSH 2BQWB 2FWWA 1X7AC 1DX5M 4AYYB 5HM9A 3ATIA 3SUFA 1F2SE 3I29A 2IOTA 2ZQ1A 5JBTA 2J95A 3NXPA 2Z9LA 4OGYA 1C1SA 3MH6A 2FOCA 1EZQA 3T28A 1QFKH 1KXDA 1C5TA 5B6OA 4AFZA 5DP6A 2TIOA 3H5CB 4X1NU 3QZRA 4QT8C 1CGIE 1EZUC 4D7GA 5C1UA 3A7YA 5DO4H 3RM0H 1FLEE 3ZZ3A 1GI2A 1CBWB 3PYHA 1GJ6A 3P8GA 1B5GH 2FLBH 2L74A 2ZPRA 1PQ8A 3EA9A 1GJBB 4NFEA 1ESBA 1CU1A 2GGVB 2ANYA 8ESTE 1C4Y2 1FY8E 1TMBH 2EC9H 1UVPA 1E1RD 2A4GA 3BV9B 3MNSA 5GCHG 4MNYA 3LKWA 3TNTA 1JXPA 3TH3H 4AFSA 2QIQA 2SGQE 1UK3A 5T6DA 3UNQA 1P12E 1ZRKA 5T6GA 1MKWH 2JETB 3O8RA 2ZU3A 1MTNB 1O2XA 1EPTB 1ANCA 3KCGH 2WPJS 3PB1E 3S0NA 3L3TA 3QGNB 2H5DA 4AB8A 4ABJA 1G3DA 7GCHF 3DUXH 5J4QA 5KEDA 2FESH 1C1QA 4OGXA 1LCYA 1GHZA 1CHGA 3ZVAA 4B2BA 2HGTH 1L2EA 1TMTH 2HVXA 2JH5D 5C0TA 3NKKA 3EQ0H 1K1NA 2Z94A 3MU1A 1C1PA 3EYDA 1EASA 3HPTB 1F7ZA 1LO6A 1ZOMA 2B0FA 3GCTG 4X6MA 5F8TA 3U8OH 3A86A 1W13U 5FBEA 1UMAH 1EX3A 3ZYEA 1TABE 1XKAC 1T8LA 2AHME 2W3IA 1O2LA 2H9TH 4E06H 5JBBS 1GVKB 1F5LA 2P3UB 2XWBI 1GHAF 5CDFE 1C5WB 1KSNA 3UOPA 3CP7A 2FOGA 1UCYE 2TRMA 4LZ4B 2QY0B 3ZYDA 3SV6A 2A7HA 2CHAC 4A1TA 2A2XH 1XVOA 2OQUA 3OE7D 2M5TA 3BG8A 2EY4C 2SNVA 1W0JD 5DK1A 1V2NT 3SBKA 3U28C 1DT2A 2WPLS 1YLNA 2ZZUH 4B75A 1BB0B 2P8OC 4MLFB 1MKWK 4P00A 2Z9JA 1UK4A 5C67A 3BN9A 1C5LH 4ACAA 2ZG0H 2ODQA 1BHXB 1AD8H 2TGAA 5DJ7A 4ABFA 1AU8A 1A3BH 1JRSA 1FY1A 5LH8A 2TPIZ 2ZDLA 1EZXC 1F5RA 2QGRA 4U01A 1MKXH 5EQRA 1S6LA 4IBLH 4U30A 9ESTA 2J4IA 1YC0A 2LELA 2XNIA 5FL7D 1MMJN 2QXGA 4NIVA 1QZ8A 3MU8A 1GI6A 1HAVA 2BD4A 2AS9A 1O3IA 1BTHH 3ESTA 3SV2H 2XYAA 3TJVA 1C5QA 1ELDE 1YPMH 2FOBA 3ZZ8A 1QBVH 5FX5A 3A7ZA 3RXKA 1KXEA 1MD7A 4SGAE 1TOMH 4YLUA 3HGNA 2A7CA 3OY5U 1AY6H 3AAUA 5KGOA 2FS9A 2VWNA 2JIZD 3SHAH 5T1VA 3TK9A 3UQVA 2ZDKA 3SNCA 5C5OA 5E0JA 9LPRA 4I33A 2LP6A 2PR3A 3SO3A 4NSYA 2BDYA 2OC7A 1C2EA 3VB7A 3SN8A 2VINA 3MU5A 1C5SA 3K6ZA 2SGPE 3BSQA 1LTOA 2W26A 3T27A 1MCVA 4NIWA 1C2HA 3DSGA 2Z3EA 4IMZA 1GHBF 4ZCNA 2Q1JA 2Y6TA 1OYTH 1MKXK 3UIRA 2WPHS 1SOZA 1TRYA 1GHYH 4A5TS 7LPRA 1BMLA 3BTWE 1XUGA 1U6QA 1MTUA 1OP2A 1C9PA 3P95A 2ZCHP 2KM0A 3W1EA 1SGDE 1C5RA 1NS3A 1C2MA 1HFDA 4FU8A 3Q77A 4JZDH 1ZSJA 4HI3A 1TQ0B 2DE8A 4ISOA 1W0YH 1JOUB 2Q6GA 1EXFA 3F9HA 4HFPB 1A5HA 2ZDAH 2R0KA 2STAE 2WPDD 1ELGA 1AUJA 1GI7B 1NC6A 3K6YA 2ULLA 3M3SA 1QRXA 1GHXH 4ACBA 1O3OA 3O8DA 3BIVH 5ETXA 5IDKA 1Z8RA 4NZQA 2ZTXA 1N1LA 1PJPA 3E91A 3FOAA 2XCNA 1ZMLA 3MO6A 1TQ7B 2D8WA 1GMCF 1BMAA 3UTUH 1GHVH 1OWDA 2VJ1A 2XC4A 3EGKH 1K1JA 4YOIA 2R3YA 2VIVA 2ZHFH 1HAXB 2J94A 2A2QH 1O5GH 2G00A 1ZTLA 1MCTA 2A5IA 4YZUA 3U1JB 1ETTH 1GCTB 4KTUA 1MAYA 2TGTA 2UWOA 2Y80A 3ZZAA 2XBVA 1W14U 5IK2D 3PV2A 1SKYE 1CA0C 4IN1A 1BA8B 1FUJA 4HTCH 4O97A 1JIRA 1FN8A 1NFWA 4Q80A 1TLDA 5GJ4B 4TY7A 3LH3A 3LDXH 3A83A 4X1PU 2WUCA 2RA0A 2CV3A 2BY5X 2PKAA 4CBOA 4R0IA 1SFQB 3LGYA 4FUEA 4BOHA 5HIZA 1VCPA 1GBEA 3SV9A 2J98A 1O3AA 5EXMA 2PLXA 3GYMA 4YLQH 1Z71A 1FPCH 1Z1JA 2A0QB 1TPOA 3BG4B 1GBHA 1HIAB 3ZZBA 1CGJE 2RA3A 3MWIU 3DSPA 3C1KA 2B9LA 3TJNA 1D6WA 4DW2U 3UWJH 4SGBE 2GMTB 4ZKRU 4JZFH 5FPSA 2XNDD 1UTKA 3ZZCA 3ZV8A 5C0UA 4X2WA 4Y8ZA 1O3HA 5GCHF 5F8XA 5HMAA 3SNDA 1FI8A 1NRPH 1O2JA 4YO9A 3F6UH 3RDZA 3PTBA 1AO5A 1N6YA 1GBLA 3TJOA 2O8UA 3A7XA 5A09A 1D3PB 4XE4A 1T8NA 5TJXA 4A1XA 1WDIA 3MYWA 1K1IA 4IC5A 4X1SU 4HGCA 1C1RA 2Y82A 1LVBA 1UTNA 4Y6DA 2KCOA 2PFEA 2BDCA 2BVSH 2YNBA 2AYWA 3NK8A 1O5DH 2PUXB 3SNAA 4FETA 2Z9GA 1NESE 4R8TB 1H8ED 2PTCE 1S6HA 1P2IA 3Q3XA 4ZXYH 3WW7A 5DP9A 2P3FH 1DLEA 1GPZA 1MU6B 1S83A 1QR3E 3SU0A 3SGBE 1OWHA 4KKDA 1O3CA 1K22H 1W10U 2GZ7A 1EOLA 2ZFPH 1W12U 1WCZA 4BTTB 4VGCC 5F53A 1LPGB 2PSYA 2QN5T 2D2DA 1ZPBA 1TGSZ 1L0ZA 4B73A 2J92A 3MQKC 1GMHF 3QDZB 4Q63A 7ESTE 1N8OB 2ZECA 3LH1A 3SU3A 1HPGA 3VFEA 1EJAA 4AC9A 2O9QA 1IAUA 2BVXH 2G51A 1H8DH 1PFXC 1J14A 2BD5A 4K2YA 4NA9H 3E0NB 3SUGA 1TNIA 2A31A 1YPHC 5EW1H 2JJ1D 3EA8A 1O2KA 1CGHA 1EOJA 1EZSC 1OP8A 2BX3A 4F4OC 3TGKE 2D26C 4GHQA 1J15A 2J9NA 4TSFD 1KXCA 3PWCA 4UFEH 1ELAA 1NRNH 2GCTC 3BTGE 1MD8A 2GV6A 4O03A 1L1JA 1AFQC 1O5EH 4X8UH 1NM6A 5DPAA 1SB1H 4ISHH 1UHBB 3VB4A 1GG6C 1BDAA 4KP0A 2VIOA 1SGFA 1BBRE 2YMSB 3W94A 4GPGA 4A1VA 2IJD1 1KXFA 1TRMA 1QNJA 2QF4A 4NSVA 3VB6A 2WHXA 1HRTH 1VITF 5EXNA 4K60A 2STBE 3V0XA 3MH4A 2H5CA 3SZNA 1GBJA 1EJNA 3CENA 1O2RA 1VCWA 2TGPZ 5A0AE 3E6PH 1SC8U 5FAHA 1BUIA 3PRDA 1CHOF 1ACBE 5F03A 5GPIB 1IQLA 2F9OA 1G32B 1NFXA 1O2TA 4MNWA 2OXSA 2ODYB 4GAWA 1DICA 2Q6FA 2ZGBH 2OD3B 4XD7D 4B1TA 4IMQA 1H8HD 1GBDA 2THFB 5C17A 4FUIA 1P03A 1K28D 1A0LA 3OYPA 2BM2A 5AHGH 4JYTA 2G55A 2BDHA 2C8WB 4F55A 3F9GA 1O33A 2ZI2H 4YTAA 1DLKB 1Y8TA 1TMUH 2W3KA 1GGDC 3ENSB 2HRVA 2NU3E 2XXLA 5A8ZA 3SNBA 3UPEA 4AZ2B 3LC3A 4Y71A 3O8CA 1WYKA 2OP9A 2GT7A 1DSTA 2GZ9A 3HATH 1WAYB 3PMJA 1HGTH 3RXLA 3R3GB 2NWNA 1EB1H 6ESTA 1O2ZA 2P59A 4ASUD 3MU0A 2ANKH 3ZIAD 3RXRA 2O8LA 1AKSB 1WXRA 1KXAA 1C1TA 1VGCC 1A46H 1FXYA 4ASHA 4CRAA 1SBWA 2A1DB 4D9QA 3AVZA 3RP2A 2FOEA 1DWEH 3RXDA 2AEIH 2VH0A 2ZHDA 1AVXA 4NWLA 4HZHA 3SJOA 4IN2A 5FHTA 1SFIA 1C2LA 1HAOH 5L2ZH 2ZF0H 1ZGVA 5C2ZA 3F2HA 4Z0KA 2R0LA 1CE5A 4GHTA 1CT4E 1W2KH 4MG3A 1JRTA 1B0EA 2BX4A 3KGPA 1GI1A 2GDDA 4BNRA 1Z7KA 3MH5A 1C5VA 3SU5A 1JMOH 3P70B 1E34B 1V2OT 1RS0A 1XX9A 4XDEA 2FI3E 2D1JA 1AB9B 2ZCKP 4ABGA 2ZU2A 3P92A 3T62A 2XWAA 4TPYA 5DP3A 3M35A 1A0HB 3TLOA 1GJ8B 1H9HE 2QXHA 1O2GH 2ZA5A 1BTZA 5AVDA 2KCAA 4DVAU 2VWMA 2B5TB 2UWLA 3MHWU 3LJJA 1ZHMA 1M9UA 1NU9A 3EE7A 5K0HA 3A7WA 1LHEH 1OKXA 2VIPA 1QB6A 4GCHF 1PPGE 5ESBA 1EAUA 1ETSH 3W95A 2C8YB 2HNTF 1BOQA 3F68H 1SR5C 3URDA 2A7JA 1JIMA 3GY5A 2R2WU 1T4VH 4HG6A 2I6SA 1O2IA 3C27B 3M61U 3PWBA 2OLGA 1RIWC 3MNBA 1FX0B 3GCHC 1K1PA 2C3SA 4I32A 1OOKB 1Y3UA 2O8TA 1TFXA 3KF2A 3RMNH 1V2UT 1TAWA 4XOJA 3L33A 4ZHMU 2B8OH 2CHAB 2KAIA 3AASA 4WJG2 1K1LA 4UDWH 5LPRA 4Q2KA 3S9BA 2OC8A 2HVYB 1FONA 1A2CH 5EPNA 1V6DA 4Y7AA 1O2OA 1O2NA 3LT3A 4FXGH 2ZNKH 2P8OB 1XXDA 1UW7A 2FPZA 2ZHQH 4TYDA 3ZVGA 2I6QA 3BTHE 5JB8S 2HLCA 1ELTA 2W6ID 1BQYA 1J8AA 3F0OA 3V13A 1HAYB 5EODA 3SW2B 1S0QA 2PGBB 4RSPA 4I8HA 4Y11E 2CF8H 2YOLA 3CNRA 1C5PA 1MTVA 1GVLA 4Q7ZA 3P6ZB 3MU4A 1WBGB 3D62A 4O9VA 1H8IH 3GY8A 6CHAB 3A8DA 4ISNA 1ESAA 3N7OA 3DD2H 1S81A 2AIQA 1HJAC 4CRBA 3E90B 4FUFA 4D7FA 3B9FH 3FAOA 2JDID 2RDLA 1LHDH 4JMYA 4ZROA 2ZPSA 3RM2H 1DM4B 3OAAD 2ZU4A 1LPZB 1DUAA 1GI0A 2K1QA 1Q2WA 3N99A 3BTEE 2ALVA 2BB4A 3URCA 1E0FD 3RXVA 2FP7B 1QHRB 5L6NH 2A5KA 3FP8E 5BRRE 5GNDA 3JZ2B 3FFGA 3UB0A 3RLYH 2FYRA 1BHXF 1P04A 1FIZA 1THSH 3I78A 4OS6A 1ARCA 2BY9X 4BAHB 4WF8A 1RGQA 1IQEA 2BYAX 5EGMA 1TGBA 3ZZ5A 1ETRH 4WVPE 2BY8X 1ZRBA 2CMYA 1O5FH 5A0CA 2FOAA 1GBKA
chains in the Genus database with same CATH topology
3EAJA 2A4RA 3LONA 3STIA 1B0FA 1ZPCA 1AI8H 4K3JA 1TNHA 3U8RH 1DSUA 1EJMA 4DIHH 1GI9B 2LPRA 1EP6A 4NCYA 2G52A 3SU6A 3ZVEA 1FIWA 2ZO3H 1QCPA 1BTPA 3A7VA 2FTLE 1YCPH 3SJ9A 3PMBB 3PV4A 1UTPA 4Y79A 1BTUA 2XTTB 1T4UH 2PKSC 4Q7XA 1MZDA 1BT7A 1QJ7B 1UCYH 2AIPA 1XUFA 5DP4A 1P2QA 4X6OA 1ZLRA 1ZSLA 4KGAA 5BPEA 1ZJDA 3M3VA 4JZEH 1GBAA 3ZZ6A 1AMHA 1TPPA 1KLJH 3SQHE 3T2NA 1C5NH 1DWCH 3M7QA 1D3QB 3L6PA 2V3OH 1YPEH 4XSKU 3ZVFA 3UR9A 3D49H 2Z9IA 2LNCA 2P95A 3VEQB 4JYVH 1P3EA 2Z7FE 2WYJA 2ZFRH 4Y0ZE 4JCNA 4WH8A 1GHWH 2Y5GA 4YT7H 4INLA 3NZIA 1THPB 3FP7E 1BMNH 1GBBA 1XM1A 2F9VA 1DFPA 3VXEH 3GY4A 1MBMA 5JBAS 1S82A 3U69H 1OYQA 5C20A 3D23A 1LPKB 1BMMH 2FI5E 2Z3CA 1C4U2 3MI4A 1UK2A 5J4SA 3SU2A 1P06A 1P11E 3OTJE 3U8TH 1CA0B 1LHFH 1G37A 1FAXA 1YCPK 3RXCA 1A0JA 4AG1A 5HXFA 1TGCA 2FX4A 5ABWA 3UQOA 2VU8E 2NU4E 4FUJA 1UCYK 1OWIA 1GWAA 2XBXA 2ZHEH 1YLCA 5FPYA 1ABIH 4H42U 1EPTA 3IG6B 4D76A 1EPTC 2PUQH 4B76A 1KTSB 1CVWH 2ZGHA 1XUJA 2QV1A 1RTFB 3A8CA 4OS2A 6GCHF 1EAWA 1O2MA 3B8JA 3O8BA 1INCA 5CHAC 4LOYH 4WMFA 1GJ9B 1SGIB 1S5SA 3RLWH 2Y5HA 3MNCA 4YESB 3BF6H 2GZ8A 1F0RA 1YLDA 1GBMA 3GY6A 2ZIQH 3MFJA 4WMDA 3A85A 3NCLA 1GBFA 1RJXB 4MDSA 2QF3A 5T3HA 3RXPA 4DOQA 1WTHD 5EOKA 1C1MA 3FZZA 1AZZA 1KDQB 3AW0A 3M5LA 4CR5A 3VXFH 2Q6DA 4NA8A 1N6XA 1DUEA 1V2RT 3LJOA 1SLWB 1O37A 2DUCA 3TIUA 2H2ZA 1TA2A 2CJIA 3PMAB 1JWTA 1V2ST 3HKJB 2OQ5A 3LC5A 4KELA 4UD9H 1DE7H 4Q7YA 4H4FA 4K1TA 1DY9A 4X2XA 3STJA 4ABEA 4E7RG 1YM0A 4YT6H 1C2GA 1ANBA 1P02A 1YF4A 2ZKSA 1FY3A 4JZ1A 1EQ9A 1FMGA 3B23B 2XW9A 3ELAH 2FEQH 2SGFE 1Z6JH 2A5AA 4BXSA 3SUDA 2ZC9H 4VGCB 2WPIS 3TH4H 1GJCB 4Y76A 2VIWA 5JBCS 1NY22 3EA7A 3KQBA 1MTSA 2Y81A 4WY3A 2F9NA 1W7GH 1P2KA 3ZVCA 1C2JA 2XCFA 4U32A 3VPKA 2H9EH 1YPGH 1G9IE 3LOXA 1KIGH 3SUEA 1MBQA 1MTWA 3GCNA 2VWOA 5FXLA 5A8YA 1SLVB 3RXHA 1ARBA 1SLXB 1HBTH 5EPYA 1V2VT 1YYY1 4DG4A 2VWLA 2BLOA 1EP5A 3M7TA 1FN6A 1C1WH 4K69A 4UFFH 1GDUA 1LDTT 1D6RA 1AFQB 2OBQA 3A84A 3U9AH 1YPHE 3A89A 3E8LA 4FU7A 1V2MT 1V2WT 4BAMB 4CRCA 1O3BA 3TGIE 1BRUP 1QTFA 2G81E 4ZKOU 2UWPA 2VB0A 1AIXH 3LGUA 3QLPH 1KTTB 1HJ9A 3UUZA 4BAQB 1GL0E 4H6SB 1O38A 2FO9A 4UFDH 4WMEA 1NROH 1QA7A 3ATWA 1SHYA 4GUXA 2OBOA 3VGCC 3QX5H 4ZH8A 3P8OA 3T26A 4AB9A 1O5BB 3NWUA 5FCRA 1G3CA 1GCDA 3SV7A 1LKBA 4LK4A 1OS8A 3GY3A 3T29A 5LGOA 4NZLA 3QZQA 1O0DH 1V2TT 1CQQA 1PYTC 2G4UA 2BDIA 3EE0B 2ESTE 1Y59T 2UUKB 3RC4A 3GCTF 1Y3YA 4RKOB 1AWHB 2DE9A 2Y7XA 1WUNH 1PQ5A 3F9EA 2AGGX 1QL7A 1TPAE 2ZU1A 2ZP0H 1ELBA 2BD7A 3MO9A 3PTNA 1UVSH 5E2OA 1HYLA 2IPHA 4YM9A 1TX7A 3SI3H 3PLBA 4ZKNU 1PYTD 1XUKA 3VB5A 3SV8A 1SI5H 1ZHPA 4FVBA 5LPFA 1O30A 4ABDA 1AUTC 4TWWA 3KQCA 1IQNA 3E1XB 5TCCA 3HKIB 5GDSH 4XBBA 1LVMA 3ATMA 3K9XB 1O2PA 3ZVDA 1O3FA 1MZAA 4IS5A 1THRH 1O5AB 1VJ9U 2CXVA 4TY6A 4DY7B 1P0SH 2ZTYA 1O3JA 1G3BA 3ZZ9A 4CH8B 1SHHB 1UTMA 4I8GA 4NG9H 3RUOA 1VGCB 5AFZH 3BTFE 3I77A 3ZVBA 1XUHA 2GV7A 2PWXA 3M36A 1WU1A 3M5OA 1PPCE 2OC0A 3ODFA 7GCHG 3K2UA 1O39A 2BY6X 2QF0A 1NZQH 1NFYA 3MTYA 1BTXA 1P3CA 1W3CA 3LGVA 1TA6A 1GBCA 3A8AA 1IQHA 4AG2A 1BBRH 2FDAA 1HIAA 1XXFA 1T32A 2ZU5A 8GCHG 4MPUA 4ZXXH 4WXIA 2ZFFH 3P8FA 5C1YA 1HAZB 3SI4H 4X8TH 2W7SA 5H4IB 1BIOA 1MUEB 4A7IB 1SGNE 2BZ6H 1DDJA 1O2WA 3GY7A 3MO3A 3QK1A 3A7TA 3A87A 2JH6D 3S69A 4MTBA 2BDGA 2G8TA 4RN6A 1GHAG 4CH2B 3SGQE 4XFQA 1G2MA 3RC5A 4DURA 1S6FA 2BQ7B 3FVFB 2TBSA 3DFJA 1WV7H 1NRRH 1ABJH 1F0UA 5E0HA 4RKJB 1NPMA 1SOTA 1J9CH 4E7NA 1A1RA 3M3TA 1TYNA 2FOHA 5JYIA 2ALPA 1S0RA 1AHTH 1C1NA 5TCAA 2SGEE 5FCKA 1DVAH 1OX1A 5GIBA 2F9BH 5EG4A 4KTCA 2V0BA 4INKA 2C4FH 1K1MA 3LIWA 4A92A 4ABIA 3UNSA 1GBTA 1C5OH 3AW1A 1QGFA 3GCHB 2BY7X 5E2PA 1F5KU 3LPRA 2J38A 4BAOB 2F91A 3RXQA 2PV9B 1CA8B 1BBRK 5FPTA 1P2JA 1QA0A 2WYGA 4X1RU 1IQFA 4OS4A 3M37A 2CF9H 4K1SA 1BRBE 1FQ3A 1NT1A 1S84A 5EXLA 1W0ZU 2SGDE 2QXIA 2HOBA 1ZMNA 4FUCA 2WUBA 3QGJA 3DFLA 2FODA 1UJ1A 4J1YA 1BZXE 5A8XA 4CHAC 1ANDA 2F83A 1C1OA 5EQQA 5SGAE 1TX8A 1T8OA 5I46H 1SMFE 4BXWA 2G4TA 1RRKA 4I8JA 1SVPA 1Y5BT 2J34A 1DXWA 3HGPA 2PSXA 1W11U 3UOUA 5C5NA 2OC1A 5C1XA 1QJ6B 1HJAB 2QYIA 2F9PA 1ID5H 2WPKS 1HXEH 1UHBA 3RXMA 1AFEH 1AN1E 4UE7H 2GCHG 7KMEH 2NU0E 1VR1H 2ANWA 1V2QT 1GHBG 3UY9A 1S85A 2VVCA 1QBOA 1A5GH 4JK5A 4MPXA 1ANEA 1QQUA 1ELEE 2ZDVH 3ITIA 1GVZA 1XKBC 1RD3B 3Q3KA 1TRNA 3RU4T 2XBYA 1FZZA 1TB6H 2P3TB 2ODPA 5DGJA 4AX9H 2FTMA 2GT8A 5A0BA 1LQEA 3A88A 1SQAA 4CREA 2V3HH 1V2KT 1A5IA 5CMXH 1SQTA 3DHKH 3TU7H 4NIYA 1J17T 4X2YA 4X1QU 4FU9A 4AGJA 4ABAA 2JKHA 1T7CA 1SGEE 1A7SA 2P93A 2ZGXH 1OWJA 3TPIZ 1Y3XA 4A6LA 3OU0A 1SGRE 4AOQA 2P94A 1GMCG 1P2MA 3ZZDA 1NO9H 3TH2H 1TE0A 5GXPA 1ZYOA 2RG3A 1AGJA 1EAIA 3F1SB 1D3DB 1HDTH 1JBUH 1CO7E 3GYLB 1HUTH 2PKSB 5AFYH 1O3GA 4O3TA 3S7HB 3G01A 1YPJH 2AGEX 2QC2A 4ISLA 5IYTA 3E3TA 3RMLH 1PQAA 3ATKA 1VJAU 4DGJA 1AVGH 1BTYA 1YCPM 1ELFA 2VGCC 4K8YA 5HM2A 1V2JT 3SGAE 1FNIA 3TJUA 2PHBA 1RXPA 1UTLM 1UVTH 1YPLH 1AE5A 3NPSA 1QB9A 3S7KB 1C5XB 1AKSA 2ZPQA 3TGJE 4AORA 4MQAA 1A61H 1HAVB 2ZDMA 2W7UA 4KTSA 2GD4B 4FVDA 3HK6B 4TPIZ 5G4BA 1CT0E 2HALA 1HAIH 4Y7BA 3TITA 2GX4A 3GDUA 3GOVB 1HAGE 2BMGB 3A82A 4ZHAA 1P2NA 1TIOA 1DOJA 4YOJA 1H4WA 4INHA 1UO6A 1PPFE 2BOKA 2GDEH 2V35A 1QBNA 3PLKA 4IGDA 4MPWA 4CRGA 1AB9C 1F92A 1E37B 3BTME 4OS7A 1LQDB 2HNTE 2QXJA 1OPHB 2ZFSA 1C9TA 1SSXA 3V12A 2EI7A 2VIQA 3PO1C 2BD2A 8KME2 4J2YB 5F6MA 5CHAB 3JZ1B 1QIXB 3BIUH 4FUDA 1O32A 3BEUA 3BTQE 1RTLA 2FXRA 1QL8A 3CS7A 5GWZA 3GDSA 4Y0YE 3WY8A 4BTUB 8GCHF 1HLTH 2EA3A 2Z6BD 2WINI 3D65E 3BTDE 4AGKA 1UVOA 4UONA 2H6MA 1P05A 1PPZA 3PROA 1O5CB 1YKTA 4DIIH 1OWKA 2BDBA 1O3DA 3RC6A 1ELCA 1ZR0A 4D8NA 5DG6A 2ZDNA 3A8BA 4XBCA 4ABHA 4F49A 5AF9H 1EKBB 1GI8B 1GMHG 1IHSH 4B2CA 4AN7A 2FZZA 2ZWLH 2Z3DA 2GP9B 2QA9E 4NFFA 3SNEA 3FP6E 1C5MD 4Y10E 2AERH 1IHTH 3GDVA 3SJ8A 5E8EH 1GBIA 2A4QA 3M5MA 2G5VA 5EQSA 1P10A 3P17H 5L30H 1FPHH 2BD9A 3T5FH 4WH6A 1CBWC 1GJDB 4JYUH 4GVUA 2HNTC 2BHGA 3A81A 2C8XB 6CHAC 2H9HA 1TBQH 1EUFA 5DP5A 2C93B 3QTVH 1L4DA 1H9LB 2UUJB 5JB9S 1EB2A 1PQ7A 1QRWA 5EU8A 1O3NA 3RXTA 2PKAB 4BANB 3V7TA 3V3MA 1D4PB 2JETC 2XC5A 1GJ4H 1KLIH 1MTNC 1VITG 4X0WU 1PPBH 1BJUA 1QY6A 1P09A 1O2HA 1DY8A 1H1BA 2AGIX 1CSOE 1EAXA 1CT2E 3KN2A 5DP8A 5LPEA 2FLRH 1GJ7B 1TWXB 1UTJA 1CHOG 4MVNA 2BDAA 1LKAA 1TALA 1YP9A 1F0SA 1TNKA 2WPMS 1L4ZA 3UNRA 5L2YH 2JH0D 2O8WA 2VVVA 1G30B 4OS5A 4IW4E 2GKVE 2GCHF 3ATLA 2BD8A 4K8BA 1K2I1 1Q3XA 2BLWA 1XMNB 1GMDG 2FI4E 1IOEA 2RCEA 1C5UA 3BEIB 3F9FA 3OX7U 1MH0A 1T31A 1GJ5H 1MAXA 2AMQA 1RFNA 2WV4A 1O35A 3VGCB 4MNVA 1TBRH 2UUYA 4M7GA 2BLVA 1DWBH 1EATA 3LU9B 3RU4E 1TNLA 2VIDA 4ZMAH 3ZV9A 2Z9KA 3RXFA 3U98H 1SQOA 2NU1E 2BXTH 2AH4X 3GISB 2FM2A 1VCQA 4AYVB 1HCGA 4K5ZA 4LZ1H 2XC0A 2ZFTA 3BTTE 1IQJA 4FUHA 1D3TB 2CN0H 1TBZH 1WTGH 1VZQH 2FX6A 1DS2E 2SGAA 1MQ5A 4DCDA 3TVJB 1Y5AT 4TWYA 1ZJKA 4U2WA 2ZGCA 1OWEA 2ANMH 1O2VA 1Y3VA 1O36A 1SL3A 2ZFQH 3ZZ7A 4ZKSU 4NA7A 3UFAA 3NUMA 4BAKB 1SG8B 1FJSA 3SHCH 3E16B 4YOGA 1Y5UT 1QL9A 1OSSA 1NRQH 3GCOA 4ABBA 1QB1A 1TOCB 1LMWB 8LPRA 3LGTA 1P57B 1YGCH 3QUMP 1TONA 1DITH 1C2FA 4WXVA 1GI4A 3T25A 1GDQA 1GI5A 4O3UA 1O3PB 2XRCA 2PW8H 2B7DH 1TX6A 5F8ZA 2BD3A 4ESTE 1P2OA 2GCTB 3BTKE 1OP0A 1BJVA 3KQEA 4H6TA 1P9UA 2FOFA 1GG6B 1ZTKA 4JK6A 1TNJA 1HAPH 4X8VH 4FUBA 1O3MA 2FYQA 2C90B 5FX6A 1AVWA 2Y5FA 4NGAH 4X2VA 2A45B 3KL6A 1O34A 2BZAA 4GCHG 1UTQA 3RMOH 1C2IA 1Z8JB 2SNWA 1K21H 5A2MH 4DJZB 5DKMA 2C8ZB 3RXAA 5JDUB 3RU4D 2YNAA 1GI3A 2F3CE 3FZDA 1KDQA 2HPQH 4JZIA 4NIXA 1G2LA 3MOCA 1AWFH 4D9RA 1MQ6A 1E38B 3SQEE 1FY5A 1DPOA 1V3XA 3TK5A 3BEFB 3PM3A 4CR9A 3FANA 3MNXA 2BTCE 1K1OA 1QQ4A 1GJAB 4X6NA 2FS8A 3LGIA 2G5NA 5DP7A 4GLYA 3QO6A 3MMGA 3SJKA 1O2QA 1HB0B 3QN7A 4MNXA 3IWMA 2QCYA 4ZAEA 3RXSA 2HWLB 3ZZ4A 4E05H 5CE1A 1GGDB 2OCVB 1C1VH 4XBDA 1BITA 1ZZZA 1G36A 3Q3YA 1GCTC 5FBIA 2IN2A 1HNEE 3KIDU 1E35B 1H9IE 1KYNA 1WOFA 4K1EA 1SLUB 1SPJA 1PPEE 5PTPA 3R0FA 3AAVA 3QWCH 2EI8A 4IC6A 3M5NA 4I7YH 2A4OA 3VB3A 1ZGIA 2O8MA 1V2PT 1KY9A 4CHAB 1QURH 2ZHWH 5I25A 1DXPA 1P9SA 4LXBH 1HAHH 1E36B 3MH7A 5HGGA 1C2KA 1UVUH 1Z6EA 1W7XH 4X8SH 2QAAA