3DCLA

Crystal structure of tm1086
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
283
structure length
283
Chain Sequence
GHMRTNKDRLVRISVVGEIAPAKMRSPYSVTTEGTVRVIPVLGGITYNVKVGDSAYGWAGDHVEPGVSVMARRKEEEIPLMTLSCIGNEVIVMSGDAKGSRGFVTGKHGGVNHVLVHFEEEVLGKLMVGDKILIKAWGQGLKLLDHPDVKVMNIDPDLFEKLGIQEKNGKIHVPVVAKIPAHMMGSGIGASSSASTDYDIMASNPEDLGVADLKLGDIVAIQDHDNSYGVGKYRKGAVSIGVVVHSACVSAGHGPGVVVIMTGDESKILPEEVERANISDYLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TM1086
rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
molecule keywords TM1086
total genus 77
structure length 283
sequence length 283
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14505 DUF4438 Domain of unknown function (DUF4438)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.170 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3dclA02
2.102.30.10 Mainly Beta 3-layer Sandwich tm1086 (SG structure) fold tm1086 (SG structure) domain 3dclA01
4.10.1180.10 Few Secondary Structures Irregular tm1086 fold tm1086 domain 3dclA03
1NBMD 1BMFD 1W0KD 2CK3D 4YXWD 3OEED 1OHHD 3OEHD 4XD7D 4ASUD 5CDFE 3OAAD 2QE7D 3DCLA 1E79D 1COWD 1E1QD 5IK2D 5DN6D 2XNDD 3OFND 2W6JD 2XOKD 1EFRD 3N99A 3FKSD 2HLDD 4Z1MD 4TSFD 4TT3D 2JDID 2F43B 2JIZD 2JJ1D 2W6ID 2V7QD 1MABB 5HKKD 1E1RD 1NBME 2JJ2D 1W0JD 2WSSD 4Q4LA 1H8ED 3ZIAD 3OE7D 2WPDD 1H8HD 5FL7D 1KMHB 1SKYE 1FX0B
chains in the Genus database with same CATH superfamily
3URCA 3BTTE 3OEED 3D62A 3VB5A 2ZDVH 2J34A 4F55A 1JMOH 1FIWA 2SGFE 1P2QA 3KL6A 1UTKA 5DPAA 7LPRA 3M61U 2ZWLH 1GJDB 4K60A 5T1VA 1A5IA 1ARCA 3FP7E 4IW4E 3BTQE 4CRAA 2PV9B 3GS9A 3T2NA 1MCTA 4Y7AA 4B74A 1O3LA 4Y76A 1TGBA 5FAHA 3N7OA 5EW2H 1O2TA 5AVDA 3UQVA 1E34B 1EJNA 3TGJE 3K65B 1EOLA 3A8AA 1T4UH 3QN7A 2KCYA 1IAUA 1WQSA 2C90B 1BJUA 3S9BA 4INLA 1EXFA 3M7TA 1IQJA 3TH3H 2CHAB 1L0ZA 4X8UH 2FIRH 2TGDA 1MTWA 1FDPA 2Z9IA 1UCYH 3LJOA 1JBUH 1LVOA 3ZVGA 3I29A 3LGVA 3M36A 4AB8A 1C1MA 4GAWA 2VIOA 2R0LA 2ZDLA 4FVBA 3ZVCA 1YPGH 4FUCA 1XXDA 2Z9KA 2FI4E 1FZZA 1JIRA 2M5TA 4Y0ZE 1TNJA 3EA7A 1WUNH 4KTUA 1OP8A 5HXFA 1WTGH 1C1RA 2FTMA 1GMDG 4K5ZA 1CA0B 5E8EH 5FCKA 1ESTA 3SU3A 2ESTE 3KF2A 3KQDA 1TQ0B 2Z7FE 1D9IA 5ABWA 4B71A 3TGKE 3BEIB 2BY8X 2R9PA 3AW1A 2J98B 2JETC 3F2HA 1E38B 3TH4H 1MKWK 5CE1A 2BX4A 1MU6B 4AFQA 1J15A 1VKYA 1T32A 3UQOA 1NRNH 1HAPH 2BVSH 4OS6A 5EXMA 1GMCG 1Z7KA 5JB8S 5C1UA 3KEEA 3M7QA 2R2MB 4AG1A 3BG8A 3FZDA 1P09A 3F9EA 5A0AE 1FV9A 2VH0A 1QZ8A 1Z6JH 2FS9A 3SJIA 3UNRA 5GIBA 5F8ZA 2G8TA 4AGKA 4MTBA 1O2ZA 5GWZA 1OYQA 1DY9A 1RGQA 3SGQE 2QYIA 2H9HA 1YM0A 1C2FA 2ZC9H 3O8DA 1ELAA 2FYRA 1EATA 2GGVB 3RM2H 3BTFE 1G37A 1NBME 1CU1A 3HK3B 1GHZA 2ZU3A 1GDNA 2A7CA 1U6QA 4O03A 4TPIZ 1CE5A 1C1UH 1IQNA 3SQEE 1SLUB 4H4FA 2XBWA 4Y8XA 2WPMS 3PYHA 3FVFB 3FP6E 2BM2A 1EAUA 3SNDA 1V2KT 1A4WH 1Y59T 2B9LA 2P8OB 1EFRD 5C2ZA 3GY5A 1EP5A 1MAYA 3TU7H 1F0SA 2ZI2H 1DLKB 1O2PA 4TY6A 2SNWA 1K0HA 1O3EA 1UTLM 2RDEA 3RC5A 4B6FA 1TMUH 1Y3XA 5AHGH 2BY9X 1HAIH 1MH0A 3DFJA 4X2WA 4UEHH 1D3PB 2PP6A 4BXSA 4Z0KA 1WYKA 2V35A 5C20A 2ANKH 4IMQA 4UE7H 1SR5C 2K0QA 3K2UA 1MZDA 1ZJKA 3TJUA 2L74A 2WINI 1NFXA 2G55A 4WMFA 2BDGA 2ALPA 4ZXYH 4DIHH 1UHBA 1MABB 1OYTH 3TH2H 3P8GA 3EAJA 3PRBA 5A8ZA 1Y3YA 1O5BB 1AB9C 3EE0B 2WPDD 4FUGA 1WTHD 2ZGBH 3BV9B 1IQMA 3UPEA 2RA0A 1AU8A 1P01A 2OINA 2CK3D 5EODA 1K1MA 2A1DB 1BTYA 1A7SA 1C2LA 1JOUB 4R8TB 3VEQB 2FOCA 4DJZB 2IJOB 4NA8A 4ZKOU 3SV9A 3P17H 1S6LA 1SLXB 1ETRH 3ZZ6A 1C5VA 3LGTA 1P03A 4VGCB 5EJ1A 1UTQA 1RTLA 2JH5D 2GMTB 2VIPA 3AVZA 4MG3A 2ZF0H 3BTGE 4BANB 2J4IA 2XNIA 4RI0A 1C5PA 3AW0A 2YMSB 1VGCB 2GCTB 3AAUA 1WBGB 1L1NA 2VB0A 2YOLA 3MTYA 4ZKSU 3ZZ5A 4Y6DA 1TNLA 1GJBB 1ELVA 3CENA 5FBEA 5ETXA 1F5LA 3SU4A 3RXHA 1HAGE 1O3HA 4OS4A 1QHRB 2KAIA 5HM9A 1BJVA 1C4Y2 1V2OT 5HGGA 1HIAB 1ELCA 3QO6A 2B5TB 1GHBF 1DOJA 1LPGB 1SQAA 1AVGH 1DXPA 5FX5A 3RXRA 3VXEH 1ZTKA 5IYTA 2F9PA 3PMAB 3MU8A 1O2LA 1HDTH 3V0XA 5F6MA 1IQHA 4B2CA 4Z6AH 2BB4A 2BYAX 2JH0D 1SL3A 3SU1A 1RIWB 1K22H 1UVTH 1SVPA 1BTHH 1QURH 4ZHMU 3IWMA 3OY5U 3E91A 2J98A 3MHWU 2FTLE 1J16A 4UDWH 1AY6H 3BTEE 4CRGA 4A1XA 1RS0A 1DXWA 2J9NA 5A0BA 3UOPA 3HK6B 1BTUA 2Y81A 3UNQA 3BSQA 2A5IA 7ESTE 3A81A 1FN8A 1EB2A 1QQ4A 3ZZBA 3ATWA 2ZFPH 2ZFTA 2PW8H 1RRKA 1BBRE 1C4U2 1YF4A 1NS3A 3SJKA 1H9IE 1VITF 3C1KA 3LC3A 1IQIA 1K9OE 1PQ5A 1V3XA 2HWLB 1MTNB 1QL7A 1ZR0A 1C9PA 1V2JT 1P2MA 1GJAB 1W7GH 5H4IB 2Z9GA 1ETSH 3ODDA 5EIYA 2FYQA 1QL8A 2DUCA 2FOBA 1KYNA 2BDYA 3MH6A 3LJJA 5GCHF 4UFEH 1YCPH 2Z94A 3T5FH 1ELGA 4TSFD 4WH6A 3SJOA 3MU4A 4U01A 2IPHA 2BD8A 2TRMA 3RXTA 4DY7B 5A09A 1Y8TA 3S0NA 3KNXA 3F1SB 1BRBE 1C1SA 2LELA 3SU0A 2H1UA 3T29A 2KR7A 2CF8H 1TGCA 2XBVA 3RXVA 1V2WT 4X2VA 1EASA 5E0HA 4I8HA 3MNCA 3SW2B 2CGAA 2Y5FA 1GI8B 1O2VA 7KMEH 2ZHQH 1L2EA 1QJ7B 2W6JD 1FONA 1C5OH 3LU9B 3GCHC 1ANEA 3LH3A 1GCTC 1QA7A 3F0PA 5T6DA 4NA7A 4MNVA 1ANCA 3RXSA 1PPBH 1W0ZU 2VWOA 2ZPQA 4BAOB 5JBAS 3CP7A 3NWUA 1O39A 5TCCA 3PTBA 1GI4A 1HAVA 1N1LA 2UUFB 2CN0H 3ZV8A 4B1TA 4O3UA 3UREA 4E06H 1IHSH 1SGEE 3R0FA 1N8OC 1ID5H 4AOQA 1HAVB 2BLVA 1VZQH 2ILNA 4Y8YA 1NM6A 2ZFQH 1EJAA 1C1WH 4NCYA 2F83A 1O2WA 1ZPZA 4K1TA 4XE4A 1HAXB 1UVSH 3GY8A 3VGCB 2WUCA 2RFKC 4BXWA 4ZCNA 3EDXB 1SG8B 3E8LA 5FPYA 4A1TA 1KLJH 1X7AC 3BIUH 3L6PA 5CDFE 2OC8A 3ZZ4A 1E0FD 2BY6X 1W11U 3P70B 5BRRE 1O30A 1PQAA 2A5KA 2ZDMA 3PROA 4FOUC 5GDSH 2P59A 1LPZB 3SV8A 3A88A 3RLYH 1Z8IB 1O2XA 3GYMA 4WJG2 2G81E 1OS8A 4K1SA 3TJVA 3E0NB 3P92A 3BG4C 1GL1A 4GHTA 2A4QA 3ATIA 3M3VA 3SUFA 3I77A 1TX8A 1O3MA 1Y3VA 2H5DA 1IQEA 3ATLA 1C2GA 2C8WB 3W1EA 1TB6H 4K69A 4CRFA 5I46H 2FP7B 2XC0A 3U8RH 2WYJA 2ZGJA 5IK2D 1UK3A 4NSYA 1T8MA 3QDZB 2CHAC 1GL0E 2HRVA 1K2I1 2HPPH 2V3HH 1FY1A 1XUFA 1HFDA 2PSXA 4D8NA 1C5QA 1LPKB 6GCHG 2XCFA 1SQTA 5HIZA 3NK8A 1Q2WA 1TBZH 3SV2H 5TJXA 1F92A 1ZMNA 3MFJA 3T25A 1FXYA 2ZFFH 2Y7ZA 4RN6A 3A7YA 1FQ3A 5HYOA 2PFEA 1YPEH 3M5NA 3LT3A 4I8KA 1QR3E 2ZCLP 3MYWA 4U32A 4NFFA 4CHAC 1XUJA 3TNSA 2WUBA 3UUZA 2OD3B 4U30A 3HGNA 3U1JB 2QV1A 3MU1A 4CBOA 3F2FA 3A7VA 2GP9B 1MKWH 4ZMAH 3LDXH 5TCAA 5FPSA 3SOSA 2GT8A 1P2OA 1TFXA 2B0FA 2C93B 4P02A 3SHCH 2GX4A 2ODPA 2BDIA 1O2SA 1TA2A 2Y82A 2Q6GA 2WYGA 2PTCE 1ZSLA 4OGYA 1O34A 3WWFA 1S84A 4B73A 2FZZA 1GHVH 2VH6A 2TIOA 1EZSC 1C4V2 1DITH 3OYPA 5GNDA 1O3NA 3WWBA 3STIA 3UR9A 1AFEH 2ZEBA 4B76A 1Y5AT 2VVUA 1LVMA 4Y79A 2ZCKP 5ESTE 1OWEA 2XXLA 1SGRE 2A2QH 2XBYA 5K0HA 1F0TA 1TRNA 2QXIA 1LVBA 1QB1A 1SGQE 3VB6A 5EU8A 3FN8A 1TRMA 1TNGA 3ESTA 2H6MA 3MO6A 1B0FA 1NPMA 5T3HA 1ZGIA 4OS5A 1A5HA 3A7WA 4KKDA 3SV7A 2Z9JA 5T6FA 2AIPA 4XBCA 4X2YA 4Y7BA 1AI8H 2OLGA 1TNKA 3RXFA 4LZ1H 1G36A 3LGWA 1QJ6B 2ZGHA 2H9EH 1MD7A 1GMHG 2P8OC 4RKJB 4OS1A 3BEFB 3V7TA 5LH8A 1GI9B 3NCLA 3SI3H 1F5RA 3SBKA 2C8ZB 3OEHD 4HFPB 1S85A 1UO6A 1SQRA 1P2IA 1C2JA 1GPZA 2STBE 3EA9A 4I8JA 5CHAC 2V3MA 1QY6A 2VU8E 3UTUH 3B8JA 4IS5A 3RXMA 1GBDA 3RP2A 3T62A 2FMJA 5HKKD 3RXIA 2KX4A 4LK4A 2SGEE 3KYFA 2FWWA 1FPHH 3ATKA 4K8BA 1NU9A 1P9SA 2XW9A 1L4ZA 1LQDB 2RG3A 2P3TB 1D3QB 4XD7D 1QTFA 1W7XH 1BBRK 1CQQA 3TGIE 1SFQB 1SGNE 1EKBB 3RXQA 2ZHWH 2HLDD 4XRNA 2F3CE 1AB9B 2Y6TA 1GI1A 1O3PB 1PPHE 1L1JA 3U28C 1HAYB 1LHFH 2H5CA 1E1RD 2M2AA 2ZTYA 5HM2A 3ZZ8A 1C2KA 5K7RA 4MPUA 4WWYA 4I7YH 1GG6B 1HV7A 3ZVBA 3BF6H 1XMNB 2LP6A 3OSYA 1SGTA 2BLQA 1N6XA 4ACBA 5A2MH 2A4RA 3DFLA 5CHBA 1UTJA 2AMPA 3RMOH 1WAYB 1TPPA 1EZUC 2ALVA 1A61H 2P3FH 4I86A 1C5NH 3FO8D 3SUEA 2AYWA 2PGQB 1ZTLA 1A5GH 1VGCC 1V2UT 2UUKB 1T8NA 3GY6A 4SGAE 5FBIA 1EOJA 2YNBA 5JPMH 1XX9A 1O2UA 3E6PH 5DSFA 3RXLA 3A7XA 4ZXXH 3FFGA 2O8TA 3RXAA 1GJ9B 1YBWA 3RXDA 1J17T 1DS2E 2ZTXA 3RC6A 3Q76A 3P8NA 4DIIH 4UFFH 3I78A 1Q31A 2QY0B 2YMSD 2BTCE 4WF8A 1DSUA 3QTVH 1TX7A 4MLFB 1LKBA 1B7XB 1GJ8B 1SGFG 6CHAB 5F8XA 1OPHB 4GUXA 1YY3A 4YOIA 3UIRA 5B6LA 2W7SA 1FX0B 3SNCA 1AGJA 2VGCB 3SNEA 1ELFA 5DGJA 5DP6A 1CT4E 1ZHPA 1Z8JB 2HALA 3U8OH 1EPTC 2ZQ2A 2BDAA 1O3GA 1GI3A 3C27B 4FUEA 2ZHEH 4BAKB 3Q3YA 4BTTB 5EGMA 3DT0H 5DP7A 4XBDA 3SZEA 2F91A 4R0IA 4GLYA 1QCPA 3TLOA 1J9CH 1HCGA 3HATH 4HGCA 1BTZA 1SB1H 1BB0B 3W95A 2FODA 5FPTA 3UAIC 3QGJA 3TIUA 3VG8A 3ELAH 1MBMA 1KTSB 4ISNA 1KXEA 4MVNA 2AFQB 1JRSA 3SV6A 2W6ID 2JJ1D 1ABIH 4U2WA 2P95A 2VWNA 4A5TS 2XCNA 1O2NA 5F03A 1E36B 3RLWH 9LPRA 3P8FA 2O8WA 1F7ZA 2D2DA 2IJD1 1HJ8A 4GCHG 1BHXF 3TNTA 1ZGVA 3ZYEA 3KQBA 3F9FA 2AMQA 2UUYA 1NY22 3PMHB 1MKXH 1DWDH 1KXBA 3PMBB 3K6YA 4I32A 2R2WU 1ELDE 1UTOA 4JZDH 1NT1A 2KM0A 3MU0A 1ZSKA 4WH8A 5E2OA 1G3DA 5A8YA 2FOGA 4NGAH 8ESTE 1UTPA 3ZZCA 2KCPA 1NBMD 5DKMA 1DICA 1CVWH 1GCTB 2IPQX 2CXVA 2FM2A 1E1QD 1FLEE 2A7HA 1LHDH 3E90B 3PB1E 5L30H 4CRCA 1TX6A 2VVVA 4NSVA 1ZYOA 1C2HA 4D9RA 3RXPA 2J97A 1AIXH 1HBTH 3ZV9A 1HIAA 4K2YA 4AX9H 3M3TA 3D65E 1QJ1B 4RT1A 3GDSA 1VJAU 3SO3A 1P2KA 1S6FA 1SKYE 1GBTA 1O3AA 1T7CA 1Y5UT 1PYTD 3VGCC 2STAE 3SUGA 2CJIA 1DX5M 1NFUA 1A2CH 3TVJB 1P11E 1SGFA 3RXJA 1C5WB 3M3SA 1FIZA 2HVYB 4HTCH 1YPHE 1L1GA 1Z8GA 4CH8B 1P2NA 3UOUA 1UTMA 2AH4X 4DW2U 1YLDA 2BY5X 1DE7H 2AHME 4FUFA 4FUDA 1GMDF 1P2JA 1O5GH 1MQ5A 1CA0C 1GI5A 2G4UA 1DWEH 1INCA 2Q1JA 4YZUA 3BG4B 1V2LT 1UK2A 2GDEH 2K1QA 1Q3XA 1AE5A 1P9UA 1EZQA 1N6YA 3HKIB 2J92A 1EJMA 1YYY1 5EG4A 4GCHF 1HAOH 1NESE 2YNAA 1AZZA 3PO1B 4OS2A 1FNIA 1BCUH 1O2IA 2BD4A 1C2EA 3FAOA 1K1NA 1HGTH 4X8TH 1WCZA 1E79D 1L4DA 2FLRH 1GHYH 3LGUA 2AERH 3SORA 4AFSA 1RJXB 2TGTA 1CHOF 2V0BA 4GSOA 3DSGA 3MWIU 4BAMB 4YLUA 3EE7A 4MNWA 1THPB 4YESB 3MMGA 4TY7A 1AHTH 3EA8A 1SFIA 1SGPE 2BOKA 3GCOA 1LVYA 2QA9E 3RXCA 2QAAA 2ZO3H 1Z1IA 4ABEA 1J8AA 1EZXC 4Y8ZA 4CHAB 3KHVA 3MI4A 3EGKH 4ZUHA 4YLQH 1WV7H 2OQUA 2VNTA 2ZTZA 2C8YB 3VB7A 4KTCA 2Y80A 3BTKE 2Z9LA 1LO6A 2VIWA 5LPRA 2FOAA 1QNJA 3K9XB 2H9TH 1BHXB 2OBOA 3ZYDA 3SUDA 8LPRA 2AGIX 4SGBE 4IN2A 1TLDA 1MTSA 1GBKA 1ZOMA 3ZIAD 5C5NA 4AN7A 1T8OA 4X1RU 2SNVA 4CRDA 1GBHA 2ZP0H 2F9NA 1PJPA 2NU3E 1XXFA 1O5DH 3V3MA 6GCHF 3JZ2B 3UR6A 1WOFA 4K3JA 1EB1H 4BTIB 1TGTA 2BX3A 1NFWA 3PV2A 4PROA 3BTHE 1GBCA 1DWBH 3UNSA 2BXUH 1P8VC 1ZLRA 2EQNA 3FANA 2JDID 3KIDU 1B5GH 1AVWA 3A80A 2VWMA 4NZLA 1HPGA 3H7TA 1UHBB 3PTNA 5C0TA 4XSKU 1T8LA 3QWCH 1TA6A 5E2PA 3RUOA 2ZHDA 4OS7A 1FY4A 4AB9A 1O3JA 3SU5A 2NU4E 5JDUB 1MUEB 1W8BH 1HRTH 3S9CA 3NPSA 5SGAE 2SGAA 1GBFA 2XYAA 2OXSA 2KCAA 4JZIA 1GI6A 3F9HA 3RC4A 3ZVEA 4Z1MD 1ANBA 1UVPA 2V7QD 3MNXA 4JYTA 3A7ZA 3RXBA 1FPCH 2BDHA 4XFQA 1CGHA 1AKSA 2F9VA 2FX6A 1SOTA 3S7HB 1BZXE 3GY2A 1P3CA 2WPLS 5CHAB 2Z3EA 4F48B 5JYIA 3A8BA 1GHAG 3GDVA 1DWCH 4FETA 4ZHAA 2FXRA 4FUJA 3DA9B 3N99A 3SYJA 2Q6FA 9ESTA 5JBTA 4ZAEA 2BDCA 2JH6D 2QF5A 1YCPK 1UVUH 2GMTC 3PV5A 1SLWB 5DP5A 1YPHC 4YO9A 4B2AA 1MTUA 3AAVA 3MO3A 4KTSA 3GOVB 4TYDA 3ZZ9A 5BPEA 3O8RA 1W0JD 2W7UA 1O2JA 2AIQA 1ZJDA 1CGJE 3SGBE 2GCHF 3F0OA 3A8CA 4CH2B 1THRH 3BIVH 1BITA 3U69H 3P8OA 5HIYA 3K6ZA 1C1VH 3PLKA 1F0RA 1PFXC 3A86A 3M5LA 5JBBS 1TBRH 1ESBA 1RTKA 1A46H 1K21H 3GY7A 1Z1JA 1OWHA 2JIZD 1YPLH 1IQGA 4MNXA 1C5UA 1KY9A 1GG6C 3STJA 1S82A 4NZQA 1QA0A 1PQ7A 4IMZA 1GBLA 1RIWC 4ESTE 1OHHD 2WZQA 3H09A 1TBQH 4AG2A 1BMMH 2FOMB 3RU4T 4BOHA 4RKOB 1GBMA 2PR3A 1DSTA 1C5YB 3GCTG 1LQEA 2FPZA 1K1PA 4X6OA 5DP3A 1S81A 4NFEA 2NWNA 3SU6A 2TBSA 3S9AA 1TMTH 1KTTB 1LCYA 2AEIH 1Y3WA 4Q4LA 1O38A 1OKXA 2ZDNA 1BUIA 1MAXA 5J4QA 3QUMP 3RMNH 1VITG 2HLCA 4YOGA 1DM4B 3A82A 1OP2A 1SMFE 1KDQB 1GWAA 1VCQA 1RFNA 2ASUB 3UFAA 1CBWC 2ZA5A 2ZKSA 3GCTF 3TK6A 1MTNC 4OM9A 1WDIA 2EI7A 3VFEA 1H9LB 1O3BA 4FUHA 1GJ6A 3R3GB 5DJ7A 2PUXB 3E3TA 1SC8U 3RU4D 1GI7B 3GICB 3SN8A 4ISLA 1GGDB 2Y5GA 3BTWE 1GJ5H 1UVOA 3QZRA 4QT8C 5FX6A 4TT3D 1O2YA 1OX1A 2A2XH 1C2DA 1E35B 1EX3A 1VR1H 2OCVB 3V12A 1P04A 2VJ1A 5C3NA 2HNTE 2G5NA 1TGSZ 1F2SE 3BTDE 4YXWD 1XUHA 4ASUD 2PWXA 5ESBA 8KME2 3KGPA 5CMXH 1IQLA 1NFYA 3EQ0H 1GCDA 5KGOA 1C2MA 4H6TA 2Y5HA 1FMGA 4ABIA 4WXIA 4ABAA 4YM9A 2A4GA 4YTAA 5DG6A 5IDKA 1O31A 1ZZZA 2ULLA 2ANWA 2O8MA 1WU1A 1P3EA 3ODFA 7GCHF 4JCNA 4KELA 5EJZA 1BT7A 5DP4A 3O8CA 1O5EH 4FUBA 4TPYA 1KXCA 3LKWA 1BRUP 4CRBA 3UY9A 1AVXA 3OFND 4YT7H 1IQKA 1DY8A 4DT4A 3Q00A 3VPKA 1LHEH 1O36A 3A89A 1BBRH 3S69A 2DE8A 4JZFH 1NN6A 1O33A 3IG6B 4IN1A 1TMBH 7GCHG 1XKAC 1C1NA 1FY3A 1V6DA 2AS9A 2ODQA 4ABBA 4NWLA 4X1NU 2OK5A 1GJ4H 1G2MA 4ASHA 1ZTJA 2HNTF 1SBWA 1O2RA 4IC6A 5EW1H 3QX5H 2XNDD 1FAKH 2BVRH 2Z6BD 2CF9H 1HAHH 2BHGA 1O3DA 1CA8B 1OOKB 2EC9H 2UUJB 1ARBA 2ANMH 2P16A 1O3FA 1MTVA 3PV4A 4X6PA 3JZ1B 3Q77A 1HJAB 4MPXA 1FI8A 1Z71A 5JB9S 2WSSD 2BQ6B 1AUTC 4Q7ZA 4HG6A 3BTME 1FJSA 2QXJA 4X2XA 2ZDKA 2BMGB 1XKBC 1YGCH 1V2QT 5EQRA 2H2ZA 4D7GA 1O5FH 1EP6A 5AFZH 4AYYB 1UCYK 4JYUH 4J1YA 4CBNA 1SPJA 1BQYA 2ZNKH 3DSOA 2LNCA 1PPZA 2JETB 4DURA 1EAWA 3A85A 2PKAB 4ABGA 4E05H 1IQFA 1TRYA 1GBEA 2GDDA 3KYGA 1G30B 2F9UA 4DVAU 1AWHB 2G51A 2NU0E 4IGDA 1CT0E 2P94A 3U1IB 1W12U 4GVUA 2FOFA 5KECA 1TNHA 1HXFH 5EQQA 2XWAA 1PPGE 2A31A 2FI3E 3MQKC 4INKA 2TGAA 2GD4B 1ETTH 4F49A 3DSPA 3RXGA 1F5KU 1GHAF 1MCVA 3TJOA 4Q80A 2K8IA 2G52A 1AQ7A 1O0DH 1WSSH 1UCYE 4XBBA 3P95A 3FOAA 3OE7D 5DP9A 1A1RA 1H4WA 1KLTA 3RMMH 2OTVA 2PSYA 3MO9A 3DCLA 4B75A 1NU7B 2BZAA 4ZHLU 4WY3A 2W26A 5I25A 5PTPA 1DDJA 1TPAE 5GJ4B 1C9TA 2VIDA 1O3CA 5EXNA 4K8YA 2ZHFH 2QF4A 4M7GA 1BMLA 1G3BA 1C5MD 1MU8B 4WXVA 3ZZAA 2UWOA 2BLOA 3GY4A 4Q7YA 3TK9A 1H8HD 2KFWA 4D76A 2BD7A 3ZVDA 1Y3UA 2BD9A 3T28A 3M35A 2F9BH 2ZU4A 4MQAA 1K1IA 2GZ7A 2OUAA 2ZZUH 4NIWA 1TPOA 1ZMJA 1UTNA 1ELEE 2ZCHP 4YOJA 2XBXA 1B0EA 2EI8A 2PKSC 3MH5A 1BIOA 1M9UA 1W13U 1G32B 1S0QA 1S5SA 4X1QU 4Y71A 3LH1A 1TOCB 1C1PA 5FL7D 3V13A 3L33A 2I6QA 3T26A 1GVKB 1O3IA 1YP9A 2ZFRH 5LPEA 3OY6U 4X0WU 1NRQH 1IOEA 2WPIS 3SHAH 3SNAA 3LPRA 4NIVA 5GCHG 2XOKD 3SNBA 2RCEA 4INHA 2BZ6H 4J2YB 4ABJA 1SHHB 2HGTH 2Z3DA 3ATMA 4A1VA 1THSH 4NWKA 5FHTA 2ZIQH 3LIWA 4CR5A 1O2OA 2ZPRA 2XTTB 3RDZA 3RM0H 3IITA 2J5UA 5C1YA 1DUAA 4THNH 2JKHA 3OAAD 1BOQA 1KXDA 4HZHA 5DN6D 1JXPA 4MPWA 2J2UA 2A0QB 1YCPM 2GCTC 1FAXA 1XVOA 2OC7A 5C67A 4JMYA 3PMJA 3TPIZ 2KCOA 1O35A 1V2VT 3SI4H 2FI5E 1GMHF 2HVXA 1KIGH 2BLWA 1QQUA 2WHXA 2TPIZ 4AZ2B 4B2BA 5A8XA 1QBNA 3D49H 3L3TA 3M37A 4FU9A 1TWXB 1YPMH 2QE7D 1JRTA 4I33A 5J4SA 3TK5A 1O3KA 1PPCE 4DOQA 2KAIB 2O9QA 5HMAA 1T31A 1QFKH 2SGPE 4I31A 4AORA 5C1XA 3WY8A 1O2GH 3KQEA 3MOCA 1TALA 1W10U 1O37A 3H7OA 1PPEE 4F4OC 1VJ9U 8GCHF 3HPTB 4FU8A 3N7DA 1H8DH 2FLBH 4H6SB 4JZEH 5L2ZH 1UK4A 3CNRA 1ZMLA 3NZIA 4P00A 2OBQA 1SGYE 1GBAA 2C3SA 2WV4A 1WXRA 1H1BA 4A7IB 2PGBB 3OX7U 1OWDA 1TNIA 1YC0A 4O97A 1CSOE 3DD2H 1AD8H 4AFZA 1YKTA 1A0HB 1FY5A 2CV3A 1PYTC 4XDEA 1OWKA 1OWIA 2ZFSA 3A7TA 2AGGX 1A0LA 1UW7A 2L6OA 1AFQC 4DG4A 5C17A 3DHKH 1CHGA 1EPTB 1O2KA 6LPRA 2FOEA 1HYLA 3MNSA 1BRCE 4ZKNU 1BMFD 2BQ7B 3ZZDA 3U9AH 5C0UA 2EI6A 1D6RA 4ISHH 1GI0A 1O5CB 2A7JA 3ZVFA 3CS0A 5JBCS 2W3IA 2QN5T 1QBOA 2NU2E 1C5LH 2ZPSA 3AASA 1SSXA 1P10A 3OTJE 1G2LA 1MBQA 2O8UA 2GCHG 1S0RA 1NTPA 3EYDA 1FUJA 2Z3CA 4Q7XA 2BDBA 1K1OA 3GYLB 1TPSA 1EQ9A 3LGYA 3S7KB 5AF9H 4NIXA 3RXOA 2WV9A 2XC5A 4Q63A 4JZ1A 2PTNA 2FS8A 3LOXA 3F6UH 1ZHRA 1QGFA 1LHGH 3SGAE 2ANYA 2WV5A 1DVAH 2I6SA 4Y0YE 5EQSA 3VXFH 4RSPA 1AE8H 1ZPCA 4DGJA 1AUJA 1C5TA 3U8TH 2QXHA 2UWLA 2Y7XA 3QZQA 2JJ2D 1GGDC 2OC1A 2J95A 4KGAA 1A3EH 2QXGA 1MQ6A 2THFB 1LHCH 1EAXA 1RTFB 3ENSB 1TE0A 2XWBI 3A87A 1QB6A 1HLTH 2BXTH 1F0UA 1GBIA 1G3CA 3FKSD 3HKJB 2FEQH 4UD9H 3URDA 4HI3A 3QLPH 2F43B 3UB0A 1C5ZB 1O2MA 1TAWA 2QIQA 1WQVH 1H9HE 2F4LA 2G00A 4I8LA 4O9VA 2OP9A 2XRCA 2QF3A 1P05A 1V2NT 1TOMH 2BVXH 4E7NA 1BMAA 1TIOA 2V6NA 4LZ4B 1YPKH 1KXFA 1NRPH 1SGCA 3B23B 3NXPA 4ZKRU 1DUEA 1VCPA 4KP0A 1C1QA 3SU2A 2XC4A 4NG9H 1ELTA 2SFAA 2PKAA 1Z6EA 1OWJA 3SZNA 4K1EA 1GDUA 3BEUA 1CT2E 1GJCB 2GJGA 3HGPA 1V2TT 1NC6A 3RMLH 5GPIB 1ZSJA 2ZGXH 2BD2A 1QB9A 1HNEE 1K28D 3KCGH 3A8DA 1OP0A 4FUIA 5E0GA 1GBJA 1C5XB 2CMYA 2GZ8A 5B6OA 1PPFE 1NZQH 4AFUA 1NROH 2GT7A 2PLXA 2VINA 4ABDA 4JYVH 2OC0A 2ZQ1A 1ELBA 3Q3XA 1MZAA 1P12E 4X1PU 5C5OA 2QC2A 1BTXA 1D3TB 4WVPE 1HJ9A 1LDTT 1H8IH 2FOHA 4BTUB 1C5SA 1G9IE 4MNYA 2J38A 1BMNH 1NO9H 3MU5A 1YPJH 1HJAC 4WMEA 2ODYB 2G4TA 4X1SU 3SJ8A 2R3YA 2AGEX 3PO1C 5F8TA 4GPGA 3F2GA 5L6NH 3G01A 8GCHG 5E0JA 2WPJS 1ACBE 3E1XB 3KQ5A 3VB3A 1C1OA 1UMAH 3A83A 2VIVA 4LXBH 4X6NA 3W94A 4UONA 2F9OA 2D26C 2VWLA 1AWFH 2A5AA 1BRAA 2BD5A 1AKSB 2GKVE 2DE9A 1XUGA 1AN1E 4YT6H 3TITA 1EPTA 1NRSH 2KZ4A 3GDUA 2BY7X 4FXGH 2GVFA 3PRDA 2VBCA 4CR9A 1SGDE 1ANDA 3KN2A 1QIXB 1TYNA 1DFPA 4AGJA 5EJLA 1G3EA 5LGOA 1ESAA 1O2HA 4UFDH 3B9FH 1ZPBA 1GI2A 1V2RT 1AO5A 1D3DB 3KQCA 2PHBA 2P93A 4ABHA 4IBLH 1QBVH 3M5MA 2PUQH 5EXLA 1GDQA 4OGXA 4Y10E 2C8XB 2G5VA 1EAIA 1V2PT 1P57B 1XM1A 3VB4A 2D8WA 2B7DH 1YLNA 1KMHB 1W0KD 2HPQH 2FDAA 3LC5A 1TABE 1GJ7B 1COWD 2QF0A 1SLVB 1NRRH 5DP8A 1GBBA 1OXGA 1BTWA 3SQHE 4NA9H 1W0YH 1QRWA 3U98H 1PQ8A 2A4OA 3M5OA 1CHOG 4BAHB 5A0CA 1DLEA 5GXPA 4MPVA 2Q6DA 2GV7A 4TWYA 1HXEH 5G4BA 2GTBA 3QK1A 3NKKA 1H8ED 1O2QA 1SHYA 3GY3A 2EY4C 1QRZA 1FY8E 1K1JA 2PKSB 4DT7B 4VGCC 5F53A 1AZ8A 2A45B 1O32A 1GVLA 4ZH8A 4Y11E 3WW7A 4FU7A 2RDLA 1O3OA 3D23A 4ZROA 1XVMA 2YMSC 1KSNA 5EPNA 3FP8E 1SQOA 1AMHA 5C94A 4LOYH 1C2IA 3PLBA 4D7FA 2B8OH 1OSSA 1ORFA 3AK5A 1D6WA 3BN9A 1W3CA 1VCWA 2HNTC 4I8GA 1Y5BT 1ZRBA 1DANH 3PWCA 1HB0B 5FCRA 4ABFA 1KLIH 3E16B 5T6GA 1A0JA 1S83A 3ZVAA 1HAZB 2ZGCA 2IOTA 1SGIB 1P02A 2ZU5A 5KEDA 3ZZ3A 3MH7A 4UFGH 5DO4H 4BAQB 3UWJH 2IN2A 1E37B 4D9QA 2ZDAH 4ACAA 3TJNA 2VIQA 3QGNB 1K1LA 1TQ7B 2FO9A 3N7EA 3ZZ7A 1P0SH 3RU4E 2HOBA 3LONA 4X8SH 2EEKA 2BD3A 3PWBA 4FVDA 2LPRA 4Q2KA 2ZU1A 2WPKS 2R3UA 4XOJA 2BQWB 3FZZA 5EOKA 3Q3KA 1LMWB 1W14U 4O3TA 2R0KA 2VVCA 2D1JA 1GHWH 1V2MT 4ISOA 1UJ1A 3RXUA 4AYVB 2J94A 2A32A 1ZHMA 2SGQE 3DUXH 2UWPA 1GHXH 1ZRKA 3GCNA 4TWWA 1D4PB 1EUFA 1TONA 1JIMA 1BDAA 1QRXA 1JWTA 1S6HA 3P6ZB 2TGPZ 4M9FA 3E0PB 6CHAC 1BTPA 1C5RA 2C4FH 3LGIA 3ITIA 6ESTA 1IHTH 3RXEA 1BA8B 2FESH 2RA3A 2VGCC 1VITH 2W5EA 4JK5A 3A84A 2WPHS 1YLCA 1MKXK 2OQ5A 3UWIA 3T27A 5DK1A 1Z8RA 1HUTH 1YWUA 3MH4A 5L2YH 1O5AB 1CGIE 2ZECA 1KXAA 4E7RG 3H5CB 1RXPA 2SGDE 1CBWB 2EA3A 5LPFA 4JK6A 3F68H 4IC5A 2ZU2A 1QL9A 2P3UB 3OTPA 3QTOH 4CREA 2BOHB 4NIYA 1AFQB 1DPOA 1T4VH 4MDSA 2V3OH 3SJ9A 1XUIA 1J14A 3OU0A 4DCDA 4ISIH 4WMDA 1W2KH 3GCHB 4AC9A 1GMCF 2GV6A 2NU1E 1FN6A 4H42U 1MD8A 1ABJH 2FX4A 1SOZA 3PM3A 1LKAA 4A6LA 1RD3B 2QGRA 3CS7A 1XUKA 4X8VH 1GHBG 1DT2A 1A3BH 3RXKA 3MNBA 1KDQA 5EPYA 3NRLA 4RT0A 2AMDA 3NUMA 1P06A 1TGNA 3F9GA 3GISB 1SI5H 1N8OB 3M7UA 2ZG0H 1GVZA 5FXLA 3PLPA 4A92A 1MMJN 2GZ9A 3O8BA 2O8LA 2W3KA 1CO7E 5AFYH 1C1TA 1V2ST 4B6EA 4X6MA 4BNRA 4GHQA 3F3BA 1LTOA 2QCYA
chains in the Genus database with same CATH topology
2OK5A 5FPTA 3SU5A 2YMSB 3OEED 2AHME 4XD7D 3VG8A 3N7EA 3M5NA 2OBQA 2YOLA 1WXRA 2XNDD 3LONA 2KCAA 4F55A 2W6JD 5ETXA 3SU4A 3M5MA 2HLDD 1DY9A 3RC4A 1RGQA 4Z1MD 3SV6A 2W6ID 2JJ1D 2V7QD 4OM9A 3F0PA 2K1QA 5T1VA 3O8DA 3SU2A 1E1RD 2GGVB 2QV1A 2M2AA 3U1JB 1NBME 2F9VA 1CU1A 3GS9A 2L6OA 3F2FA 5C17A 4B74A 2XCNA 1DXPA 2WSSD 5FPSA 4NWLA 5FL7D 1N1LA 5GPIB 1KMHB 5CDFE 1BMFD 1W0KD 5C0UA 5EQRA 4M9FA 2IJD1 1E79D 1COWD 4FETA 3WWFA 4B73A 2XOKD 2KCYA 1EFRD 3N99A 3SYJA 3M5OA 2A4RA 5CHBA 3SU1A 2QF5A 4TT3D 3OYPA 5GNDA 3PV5A 3DSOA 3WWBA 4A1VA 3FO8D 4NWKA 3SUEA 3EYDA 4I32A 4B76A 4B6FA 4TYDA 2OC0A 3RC5A 4ZCNA 2KM0A 4WH8A 3O8RA 5FPYA 1W0JD 4A1TA 1H8ED 2F9UA 2KCPA 3FN8A 1NBMD 2J5UA 2WV9A 3F0OA 4Q63A 4A1XA 4YXWD 1DXWA 3L6PA 4RI0A 2OC8A 4ASUD 3LOXA 5DSFA 3OAAD 2K0QA 5ESBA 5F53A 3OTPA 3P8OA 2FM2A 1E1QD 3SV7A 3U1IB 5DN6D 3E90B 3WW7A 1JXPA 3M5LA 4KTCA 3RC6A 5EQSA 5EQQA 3P8NA 2YMSC 2JIZD 2P59A 2OC7A 5EPNA 3SV8A 1MABB 2YMSD 1NS3A 3DSPA 4JMYA 2A4GA 5IDKA 3PRBA 2OBOA 4WF8A 2K8IA 3F2GA 2KCOA 2O8MA 3SUDA 3SU3A 2JJ2D 1BT7A 3KF2A 2OC1A 3FOAA 3ZIAD 3OE7D 2WPDD 3O8CA 2A4QA 3SUFA 1A1RA 5B6LA 2WHXA 3AK5A 1SKYE 1FX0B 4B71A 1W3CA 3LKWA 2OINA 2CK3D 5H4IB 1OHHD 2WZQA 3OEHD 3H09A 3W1EA 2FP7B 2QE7D 3DCLA 4R8TB 4B75A 4I33A 2IJOB 5IK2D 5EPYA 3F2HA 2FOMB 3NRLA 3OFND 1DY8A 3PV2A 3SUGA 3FKSD 5GJ4B 4DT4A 4TSFD 2F43B 2JDID 4WH6A 3UB0A 3SV9A 4U01A 2KZ4A 4I31A 3SZEA 1S6LA 2GVFA 2VBCA 3PRDA 3SU6A 4A92A 5HKKD 3KNXA 5C0TA 2QF4A 2XCFA 3O8BA 3KN2A 2LELA 3SU0A 4Q4LA 4B6EA 2F4LA 3N7DA 1RTLA 1H8HD 2KR7A 3KEEA 2KFWA 4K8BA 3F3BA 2XNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NBM D;  1BMF D;  1W0K D;  2CK3 D;  4YXW D;  3OEE D;  1OHH D;  3OEH D;  4XD7 D;  4ASU D;  5CDF E;  3OAA D;  2QE7 D;  3DCL A;  1E79 D;  1COW D;  1E1Q D;  5IK2 D;  5DN6 D;  2XND D;  3OFN D;  2W6J D;  2XOK D;  1EFR D;  3N99 A;  3FKS D;  2HLD D;  4Z1M D;  4TSF D;  4TT3 D;  2JDI D;  2F43 B;  2JIZ D;  2JJ1 D;  2W6I D;  2V7Q D;  1MAB B;  5HKK D;  1E1R D;  1NBM E;  2JJ2 D;  1W0J D;  2WSS D;  4Q4L A;  1H8E D;  3ZIA D;  3OE7 D;  2WPD D;  1H8H D;  5FL7 D;  1KMH B;  1SKY E;  1FX0 B; 
#chains in the Genus database with same CATH topology
 3URC A;  3BTT E;  3OEE D;  3D62 A;  3VB5 A;  2ZDV H;  2J34 A;  4F55 A;  1JMO H;  1FIW A;  2SGF E;  1P2Q A;  3KL6 A;  1UTK A;  5DPA A;  7LPR A;  3M61 U;  2ZWL H;  1GJD B;  4K60 A;  5T1V A;  1A5I A;  1ARC A;  3FP7 E;  4IW4 E;  3BTQ E;  4CRA A;  2PV9 B;  3GS9 A;  3T2N A;  1MCT A;  4Y7A A;  4B74 A;  1O3L A;  4Y76 A;  1TGB A;  5FAH A;  3N7O A;  5EW2 H;  1O2T A;  5AVD A;  3UQV A;  1E34 B;  1EJN A;  3TGJ E;  3K65 B;  1EOL A;  3A8A A;  1T4U H;  3QN7 A;  2KCY A;  1IAU A;  1WQS A;  2C90 B;  1BJU A;  3S9B A;  4INL A;  1EXF A;  3M7T A;  1IQJ A;  3TH3 H;  2CHA B;  1L0Z A;  4X8U H;  2FIR H;  2TGD A;  1MTW A;  1FDP A;  2Z9I A;  1UCY H;  3LJO A;  1JBU H;  1LVO A;  3ZVG A;  3I29 A;  3LGV A;  3M36 A;  4AB8 A;  1C1M A;  4GAW A;  2VIO A;  2R0L A;  2ZDL A;  4FVB A;  3ZVC A;  1YPG H;  4FUC A;  1XXD A;  2Z9K A;  2FI4 E;  1FZZ A;  1JIR A;  2M5T A;  4Y0Z E;  1TNJ A;  3EA7 A;  1WUN H;  4KTU A;  1OP8 A;  5HXF A;  1WTG H;  1C1R A;  2FTM A;  1GMD G;  4K5Z A;  1CA0 B;  5E8E H;  5FCK A;  1EST A;  3SU3 A;  2EST E;  3KF2 A;  3KQD A;  1TQ0 B;  2Z7F E;  1D9I A;  5ABW A;  4B71 A;  3TGK E;  3BEI B;  2BY8 X;  2R9P A;  3AW1 A;  2J98 B;  2JET C;  3F2H A;  1E38 B;  3TH4 H;  1MKW K;  5CE1 A;  2BX4 A;  1MU6 B;  4AFQ A;  1J15 A;  1VKY A;  1T32 A;  3UQO A;  1NRN H;  1HAP H;  2BVS H;  4OS6 A;  5EXM A;  1GMC G;  1Z7K A;  5JB8 S;  5C1U A;  3KEE A;  3M7Q A;  2R2M B;  4AG1 A;  3BG8 A;  3FZD A;  1P09 A;  3F9E A;  5A0A E;  1FV9 A;  2VH0 A;  1QZ8 A;  1Z6J H;  2FS9 A;  3SJI A;  3UNR A;  5GIB A;  5F8Z A;  2G8T A;  4AGK A;  4MTB A;  1O2Z A;  5GWZ A;  1OYQ A;  1DY9 A;  1RGQ A;  3SGQ E;  2QYI A;  2H9H A;  1YM0 A;  1C2F A;  2ZC9 H;  3O8D A;  1ELA A;  2FYR A;  1EAT A;  2GGV B;  3RM2 H;  3BTF E;  1G37 A;  1NBM E;  1CU1 A;  3HK3 B;  1GHZ A;  2ZU3 A;  1GDN A;  2A7C A;  1U6Q A;  4O03 A;  4TPI Z;  1CE5 A;  1C1U H;  1IQN A;  3SQE E;  1SLU B;  4H4F A;  2XBW A;  4Y8X A;  2WPM S;  3PYH A;  3FVF B;  3FP6 E;  2BM2 A;  1EAU A;  3SND A;  1V2K T;  1A4W H;  1Y59 T;  2B9L A;  2P8O B;  1EFR D;  5C2Z A;  3GY5 A;  1EP5 A;  1MAY A;  3TU7 H;  1F0S A;  2ZI2 H;  1DLK B;  1O2P A;  4TY6 A;  2SNW A;  1K0H A;  1O3E A;  1UTL M;  2RDE A;  3RC5 A;  4B6F A;  1TMU H;  1Y3X A;  5AHG H;  2BY9 X;  1HAI H;  1MH0 A;  3DFJ A;  4X2W A;  4UEH H;  1D3P B;  2PP6 A;  4BXS A;  4Z0K A;  1WYK A;  2V35 A;  5C20 A;  2ANK H;  4IMQ A;  4UE7 H;  1SR5 C;  2K0Q A;  3K2U A;  1MZD A;  1ZJK A;  3TJU A;  2L74 A;  2WIN I;  1NFX A;  2G55 A;  4WMF A;  2BDG A;  2ALP A;  4ZXY H;  4DIH H;  1UHB A;  1MAB B;  1OYT H;  3TH2 H;  3P8G A;  3EAJ A;  3PRB A;  5A8Z A;  1Y3Y A;  1O5B B;  1AB9 C;  3EE0 B;  2WPD D;  4FUG A;  1WTH D;  2ZGB H;  3BV9 B;  1IQM A;  3UPE A;  2RA0 A;  1AU8 A;  1P01 A;  2OIN A;  2CK3 D;  5EOD A;  1K1M A;  2A1D B;  1BTY A;  1A7S A;  1C2L A;  1JOU B;  4R8T B;  3VEQ B;  2FOC A;  4DJZ B;  2IJO B;  4NA8 A;  4ZKO U;  3SV9 A;  3P17 H;  1S6L A;  1SLX B;  1ETR H;  3ZZ6 A;  1C5V A;  3LGT A;  1P03 A;  4VGC B;  5EJ1 A;  1UTQ A;  1RTL A;  2JH5 D;  2GMT B;  2VIP A;  3AVZ A;  4MG3 A;  2ZF0 H;  3BTG E;  4BAN B;  2J4I A;  2XNI A;  4RI0 A;  1C5P A;  3AW0 A;  2YMS B;  1VGC B;  2GCT B;  3AAU A;  1WBG B;  1L1N A;  2VB0 A;  2YOL A;  3MTY A;  4ZKS U;  3ZZ5 A;  4Y6D A;  1TNL A;  1GJB B;  1ELV A;  3CEN A;  5FBE A;  5ETX A;  1F5L A;  3SU4 A;  3RXH A;  1HAG E;  1O3H A;  4OS4 A;  1QHR B;  2KAI A;  5HM9 A;  1BJV A;  1C4Y 2;  1V2O T;  5HGG A;  1HIA B;  1ELC A;  3QO6 A;  2B5T B;  1GHB F;  1DOJ A;  1LPG B;  1SQA A;  1AVG H;  1DXP A;  5FX5 A;  3RXR A;  3VXE H;  1ZTK A;  5IYT A;  2F9P A;  3PMA B;  3MU8 A;  1O2L A;  1HDT H;  3V0X A;  5F6M A;  1IQH A;  4B2C A;  4Z6A H;  2BB4 A;  2BYA X;  2JH0 D;  1SL3 A;  3SU1 A;  1RIW B;  1K22 H;  1UVT H;  1SVP A;  1BTH H;  1QUR H;  4ZHM U;  3IWM A;  3OY5 U;  3E91 A;  2J98 A;  3MHW U;  2FTL E;  1J16 A;  4UDW H;  1AY6 H;  3BTE E;  4CRG A;  4A1X A;  1RS0 A;  1DXW A;  2J9N A;  5A0B A;  3UOP A;  3HK6 B;  1BTU A;  2Y81 A;  3UNQ A;  3BSQ A;  2A5I A;  7EST E;  3A81 A;  1FN8 A;  1EB2 A;  1QQ4 A;  3ZZB A;  3ATW A;  2ZFP H;  2ZFT A;  2PW8 H;  1RRK A;  1BBR E;  1C4U 2;  1YF4 A;  1NS3 A;  3SJK A;  1H9I E;  1VIT F;  3C1K A;  3LC3 A;  1IQI A;  1K9O E;  1PQ5 A;  1V3X A;  2HWL B;  1MTN B;  1QL7 A;  1ZR0 A;  1C9P A;  1V2J T;  1P2M A;  1GJA B;  1W7G H;  5H4I B;  2Z9G A;  1ETS H;  3ODD A;  5EIY A;  2FYQ A;  1QL8 A;  2DUC A;  2FOB A;  1KYN A;  2BDY A;  3MH6 A;  3LJJ A;  5GCH F;  4UFE H;  1YCP H;  2Z94 A;  3T5F H;  1ELG A;  4TSF D;  4WH6 A;  3SJO A;  3MU4 A;  4U01 A;  2IPH A;  2BD8 A;  2TRM A;  3RXT A;  4DY7 B;  5A09 A;  1Y8T A;  3S0N A;  3KNX A;  3F1S B;  1BRB E;  1C1S A;  2LEL A;  3SU0 A;  2H1U A;  3T29 A;  2KR7 A;  2CF8 H;  1TGC A;  2XBV A;  3RXV A;  1V2W T;  4X2V A;  1EAS A;  5E0H A;  4I8H A;  3MNC A;  3SW2 B;  2CGA A;  2Y5F A;  1GI8 B;  1O2V A;  7KME H;  2ZHQ H;  1L2E A;  1QJ7 B;  2W6J D;  1FON A;  1C5O H;  3LU9 B;  3GCH C;  1ANE A;  3LH3 A;  1GCT C;  1QA7 A;  3F0P A;  5T6D A;  4NA7 A;  4MNV A;  1ANC A;  3RXS A;  1PPB H;  1W0Z U;  2VWO A;  2ZPQ A;  4BAO B;  5JBA S;  3CP7 A;  3NWU A;  1O39 A;  5TCC A;  3PTB A;  1GI4 A;  1HAV A;  1N1L A;  2UUF B;  2CN0 H;  3ZV8 A;  4B1T A;  4O3U A;  3URE A;  4E06 H;  1IHS H;  1SGE E;  3R0F A;  1N8O C;  1ID5 H;  4AOQ A;  1HAV B;  2BLV A;  1VZQ H;  2ILN A;  4Y8Y A;  1NM6 A;  2ZFQ H;  1EJA A;  1C1W H;  4NCY A;  2F83 A;  1O2W A;  1ZPZ A;  4K1T A;  4XE4 A;  1HAX B;  1UVS H;  3GY8 A;  3VGC B;  2WUC A;  2RFK C;  4BXW A;  4ZCN A;  3EDX B;  1SG8 B;  3E8L A;  5FPY A;  4A1T A;  1KLJ H;  1X7A C;  3BIU H;  3L6P A;  5CDF E;  2OC8 A;  3ZZ4 A;  1E0F D;  2BY6 X;  1W11 U;  3P70 B;  5BRR E;  1O30 A;  1PQA A;  2A5K A;  2ZDM A;  3PRO A;  4FOU C;  5GDS H;  2P59 A;  1LPZ B;  3SV8 A;  3A88 A;  3RLY H;  1Z8I B;  1O2X A;  3GYM A;  4WJG 2;  2G81 E;  1OS8 A;  4K1S A;  3TJV A;  3E0N B;  3P92 A;  3BG4 C;  1GL1 A;  4GHT A;  2A4Q A;  3ATI A;  3M3V A;  3SUF A;  3I77 A;  1TX8 A;  1O3M A;  1Y3V A;  2H5D A;  1IQE A;  3ATL A;  1C2G A;  2C8W B;  3W1E A;  1TB6 H;  4K69 A;  4CRF A;  5I46 H;  2FP7 B;  2XC0 A;  3U8R H;  2WYJ A;  2ZGJ A;  5IK2 D;  1UK3 A;  4NSY A;  1T8M A;  3QDZ B;  2CHA C;  1GL0 E;  2HRV A;  1K2I 1;  2HPP H;  2V3H H;  1FY1 A;  1XUF A;  1HFD A;  2PSX A;  4D8N A;  1C5Q A;  1LPK B;  6GCH G;  2XCF A;  1SQT A;  5HIZ A;  3NK8 A;  1Q2W A;  1TBZ H;  3SV2 H;  5TJX A;  1F92 A;  1ZMN A;  3MFJ A;  3T25 A;  1FXY A;  2ZFF H;  2Y7Z A;  4RN6 A;  3A7Y A;  1FQ3 A;  5HYO A;  2PFE A;  1YPE H;  3M5N A;  3LT3 A;  4I8K A;  1QR3 E;  2ZCL P;  3MYW A;  4U32 A;  4NFF A;  4CHA C;  1XUJ A;  3TNS A;  2WUB A;  3UUZ A;  2OD3 B;  4U30 A;  3HGN A;  3U1J B;  2QV1 A;  3MU1 A;  4CBO A;  3F2F A;  3A7V A;  2GP9 B;  1MKW H;  4ZMA H;  3LDX H;  5TCA A;  5FPS A;  3SOS A;  2GT8 A;  1P2O A;  1TFX A;  2B0F A;  2C93 B;  4P02 A;  3SHC H;  2GX4 A;  2ODP A;  2BDI A;  1O2S A;  1TA2 A;  2Y82 A;  2Q6G A;  2WYG A;  2PTC E;  1ZSL A;  4OGY A;  1O34 A;  3WWF A;  1S84 A;  4B73 A;  2FZZ A;  1GHV H;  2VH6 A;  2TIO A;  1EZS C;  1C4V 2;  1DIT H;  3OYP A;  5GND A;  1O3N A;  3WWB A;  3STI A;  3UR9 A;  1AFE H;  2ZEB A;  4B76 A;  1Y5A T;  2VVU A;  1LVM A;  4Y79 A;  2ZCK P;  5EST E;  1OWE A;  2XXL A;  1SGR E;  2A2Q H;  2XBY A;  5K0H A;  1F0T A;  1TRN A;  2QXI A;  1LVB A;  1QB1 A;  1SGQ E;  3VB6 A;  5EU8 A;  3FN8 A;  1TRM A;  1TNG A;  3EST A;  2H6M A;  3MO6 A;  1B0F A;  1NPM A;  5T3H A;  1ZGI A;  4OS5 A;  1A5H A;  3A7W A;  4KKD A;  3SV7 A;  2Z9J A;  5T6F A;  2AIP A;  4XBC A;  4X2Y A;  4Y7B A;  1AI8 H;  2OLG A;  1TNK A;  3RXF A;  4LZ1 H;  1G36 A;  3LGW A;  1QJ6 B;  2ZGH A;  2H9E H;  1MD7 A;  1GMH G;  2P8O C;  4RKJ B;  4OS1 A;  3BEF B;  3V7T A;  5LH8 A;  1GI9 B;  3NCL A;  3SI3 H;  1F5R A;  3SBK A;  2C8Z B;  3OEH D;  4HFP B;  1S85 A;  1UO6 A;  1SQR A;  1P2I A;  1C2J A;  1GPZ A;  2STB E;  3EA9 A;  4I8J A;  5CHA C;  2V3M A;  1QY6 A;  2VU8 E;  3UTU H;  3B8J A;  4IS5 A;  3RXM A;  1GBD A;  3RP2 A;  3T62 A;  2FMJ A;  5HKK D;  3RXI A;  2KX4 A;  4LK4 A;  2SGE E;  3KYF A;  2FWW A;  1FPH H;  3ATK A;  4K8B A;  1NU9 A;  1P9S A;  2XW9 A;  1L4Z A;  1LQD B;  2RG3 A;  2P3T B;  1D3Q B;  4XD7 D;  1QTF A;  1W7X H;  1BBR K;  1CQQ A;  3TGI E;  1SFQ B;  1SGN E;  1EKB B;  3RXQ A;  2ZHW H;  2HLD D;  4XRN A;  2F3C E;  1AB9 B;  2Y6T A;  1GI1 A;  1O3P B;  1PPH E;  1L1J A;  3U28 C;  1HAY B;  1LHF H;  2H5C A;  1E1R D;  2M2A A;  2ZTY A;  5HM2 A;  3ZZ8 A;  1C2K A;  5K7R A;  4MPU A;  4WWY A;  4I7Y H;  1GG6 B;  1HV7 A;  3ZVB A;  3BF6 H;  1XMN B;  2LP6 A;  3OSY A;  1SGT A;  2BLQ A;  1N6X A;  4ACB A;  5A2M H;  2A4R A;  3DFL A;  5CHB A;  1UTJ A;  2AMP A;  3RMO H;  1WAY B;  1TPP A;  1EZU C;  2ALV A;  1A61 H;  2P3F H;  4I86 A;  1C5N H;  3FO8 D;  3SUE A;  2AYW A;  2PGQ B;  1ZTL A;  1A5G H;  1VGC C;  1V2U T;  2UUK B;  1T8N A;  3GY6 A;  4SGA E;  5FBI A;  1EOJ A;  2YNB A;  5JPM H;  1XX9 A;  1O2U A;  3E6P H;  5DSF A;  3RXL A;  3A7X A;  4ZXX H;  3FFG A;  2O8T A;  3RXA A;  1GJ9 B;  1YBW A;  3RXD A;  1J17 T;  1DS2 E;  2ZTX A;  3RC6 A;  3Q76 A;  3P8N A;  4DII H;  4UFF H;  3I78 A;  1Q31 A;  2QY0 B;  2YMS D;  2BTC E;  4WF8 A;  1DSU A;  3QTV H;  1TX7 A;  4MLF B;  1LKB A;  1B7X B;  1GJ8 B;  1SGF G;  6CHA B;  5F8X A;  1OPH B;  4GUX A;  1YY3 A;  4YOI A;  3UIR A;  5B6L A;  2W7S A;  1FX0 B;  3SNC A;  1AGJ A;  2VGC B;  3SNE A;  1ELF A;  5DGJ A;  5DP6 A;  1CT4 E;  1ZHP A;  1Z8J B;  2HAL A;  3U8O H;  1EPT C;  2ZQ2 A;  2BDA A;  1O3G A;  1GI3 A;  3C27 B;  4FUE A;  2ZHE H;  4BAK B;  3Q3Y A;  4BTT B;  5EGM A;  3DT0 H;  5DP7 A;  4XBD A;  3SZE A;  2F91 A;  4R0I A;  4GLY A;  1QCP A;  3TLO A;  1J9C H;  1HCG A;  3HAT H;  4HGC A;  1BTZ A;  1SB1 H;  1BB0 B;  3W95 A;  2FOD A;  5FPT A;  3UAI C;  3QGJ A;  3TIU A;  3VG8 A;  3ELA H;  1MBM A;  1KTS B;  4ISN A;  1KXE A;  4MVN A;  2AFQ B;  1JRS A;  3SV6 A;  2W6I D;  2JJ1 D;  1ABI H;  4U2W A;  2P95 A;  2VWN A;  4A5T S;  2XCN A;  1O2N A;  5F03 A;  1E36 B;  3RLW H;  9LPR A;  3P8F A;  2O8W A;  1F7Z A;  2D2D A;  2IJD 1;  1HJ8 A;  4GCH G;  1BHX F;  3TNT A;  1ZGV A;  3ZYE A;  3KQB A;  3F9F A;  2AMQ A;  2UUY A;  1NY2 2;  3PMH B;  1MKX H;  1DWD H;  1KXB A;  3PMB B;  3K6Y A;  4I32 A;  2R2W U;  1ELD E;  1UTO A;  4JZD H;  1NT1 A;  2KM0 A;  3MU0 A;  1ZSK A;  4WH8 A;  5E2O A;  1G3D A;  5A8Y A;  2FOG A;  4NGA H;  8EST E;  1UTP A;  3ZZC A;  2KCP A;  1NBM D;  5DKM A;  1DIC A;  1CVW H;  1GCT B;  2IPQ X;  2CXV A;  2FM2 A;  1E1Q D;  1FLE E;  2A7H A;  1LHD H;  3E90 B;  3PB1 E;  5L30 H;  4CRC A;  1TX6 A;  2VVV A;  4NSV A;  1ZYO A;  1C2H A;  4D9R A;  3RXP A;  2J97 A;  1AIX H;  1HBT H;  3ZV9 A;  1HIA A;  4K2Y A;  4AX9 H;  3M3T A;  3D65 E;  1QJ1 B;  4RT1 A;  3GDS A;  1VJA U;  3SO3 A;  1P2K A;  1S6F A;  1SKY E;  1GBT A;  1O3A A;  1T7C A;  1Y5U T;  1PYT D;  3VGC C;  2STA E;  3SUG A;  2CJI A;  1DX5 M;  1NFU A;  1A2C H;  3TVJ B;  1P11 E;  1SGF A;  3RXJ A;  1C5W B;  3M3S A;  1FIZ A;  2HVY B;  4HTC H;  1YPH E;  1L1G A;  1Z8G A;  4CH8 B;  1P2N A;  3UOU A;  1UTM A;  2AH4 X;  4DW2 U;  1YLD A;  2BY5 X;  1DE7 H;  2AHM E;  4FUF A;  4FUD A;  1GMD F;  1P2J A;  1O5G H;  1MQ5 A;  1CA0 C;  1GI5 A;  2G4U A;  1DWE H;  1INC A;  2Q1J A;  4YZU A;  3BG4 B;  1V2L T;  1UK2 A;  2GDE H;  2K1Q A;  1Q3X A;  1AE5 A;  1P9U A;  1EZQ A;  1N6Y A;  3HKI B;  2J92 A;  1EJM A;  1YYY 1;  5EG4 A;  4GCH F;  1HAO H;  1NES E;  2YNA A;  1AZZ A;  3PO1 B;  4OS2 A;  1FNI A;  1BCU H;  1O2I A;  2BD4 A;  1C2E A;  3FAO A;  1K1N A;  1HGT H;  4X8T H;  1WCZ A;  1E79 D;  1L4D A;  2FLR H;  1GHY H;  3LGU A;  2AER H;  3SOR A;  4AFS A;  1RJX B;  2TGT A;  1CHO F;  2V0B A;  4GSO A;  3DSG A;  3MWI U;  4BAM B;  4YLU A;  3EE7 A;  4MNW A;  1THP B;  4YES B;  3MMG A;  4TY7 A;  1AHT H;  3EA8 A;  1SFI A;  1SGP E;  2BOK A;  3GCO A;  1LVY A;  2QA9 E;  3RXC A;  2QAA A;  2ZO3 H;  1Z1I A;  4ABE A;  1J8A A;  1EZX C;  4Y8Z A;  4CHA B;  3KHV A;  3MI4 A;  3EGK H;  4ZUH A;  4YLQ H;  1WV7 H;  2OQU A;  2VNT A;  2ZTZ A;  2C8Y B;  3VB7 A;  4KTC A;  2Y80 A;  3BTK E;  2Z9L A;  1LO6 A;  2VIW A;  5LPR A;  2FOA A;  1QNJ A;  3K9X B;  2H9T H;  1BHX B;  2OBO A;  3ZYD A;  3SUD A;  8LPR A;  2AGI X;  4SGB E;  4IN2 A;  1TLD A;  1MTS A;  1GBK A;  1ZOM A;  3ZIA D;  5C5N A;  4AN7 A;  1T8O A;  4X1R U;  2SNV A;  4CRD A;  1GBH A;  2ZP0 H;  2F9N A;  1PJP A;  2NU3 E;  1XXF A;  1O5D H;  3V3M A;  6GCH F;  3JZ2 B;  3UR6 A;  1WOF A;  4K3J A;  1EB1 H;  4BTI B;  1TGT A;  2BX3 A;  1NFW A;  3PV2 A;  4PRO A;  3BTH E;  1GBC A;  1DWB H;  3UNS A;  2BXU H;  1P8V C;  1ZLR A;  2EQN A;  3FAN A;  2JDI D;  3KID U;  1B5G H;  1AVW A;  3A80 A;  2VWM A;  4NZL A;  1HPG A;  3H7T A;  1UHB B;  3PTN A;  5C0T A;  4XSK U;  1T8L A;  3QWC H;  1TA6 A;  5E2P A;  3RUO A;  2ZHD A;  4OS7 A;  1FY4 A;  4AB9 A;  1O3J A;  3SU5 A;  2NU4 E;  5JDU B;  1MUE B;  1W8B H;  1HRT H;  3S9C A;  3NPS A;  5SGA E;  2SGA A;  1GBF A;  2XYA A;  2OXS A;  2KCA A;  4JZI A;  1GI6 A;  3F9H A;  3RC4 A;  3ZVE A;  4Z1M D;  1ANB A;  1UVP A;  2V7Q D;  3MNX A;  4JYT A;  3A7Z A;  3RXB A;  1FPC H;  2BDH A;  4XFQ A;  1CGH A;  1AKS A;  2F9V A;  2FX6 A;  1SOT A;  3S7H B;  1BZX E;  3GY2 A;  1P3C A;  2WPL S;  5CHA B;  2Z3E A;  4F48 B;  5JYI A;  3A8B A;  1GHA G;  3GDV A;  1DWC H;  4FET A;  4ZHA A;  2FXR A;  4FUJ A;  3DA9 B;  3N99 A;  3SYJ A;  2Q6F A;  9EST A;  5JBT A;  4ZAE A;  2BDC A;  2JH6 D;  2QF5 A;  1YCP K;  1UVU H;  2GMT C;  3PV5 A;  1SLW B;  5DP5 A;  1YPH C;  4YO9 A;  4B2A A;  1MTU A;  3AAV A;  3MO3 A;  4KTS A;  3GOV B;  4TYD A;  3ZZ9 A;  5BPE A;  3O8R A;  1W0J D;  2W7U A;  1O2J A;  2AIQ A;  1ZJD A;  1CGJ E;  3SGB E;  2GCH F;  3F0O A;  3A8C A;  4CH2 B;  1THR H;  3BIV H;  1BIT A;  3U69 H;  3P8O A;  5HIY A;  3K6Z A;  1C1V H;  3PLK A;  1F0R A;  1PFX C;  3A86 A;  3M5L A;  5JBB S;  1TBR H;  1ESB A;  1RTK A;  1A46 H;  1K21 H;  3GY7 A;  1Z1J A;  1OWH A;  2JIZ D;  1YPL H;  1IQG A;  4MNX A;  1C5U A;  1KY9 A;  1GG6 C;  3STJ A;  1S82 A;  4NZQ A;  1QA0 A;  1PQ7 A;  4IMZ A;  1GBL A;  1RIW C;  4EST E;  1OHH D;  2WZQ A;  3H09 A;  1TBQ H;  4AG2 A;  1BMM H;  2FOM B;  3RU4 T;  4BOH A;  4RKO B;  1GBM A;  2PR3 A;  1DST A;  1C5Y B;  3GCT G;  1LQE A;  2FPZ A;  1K1P A;  4X6O A;  5DP3 A;  1S81 A;  4NFE A;  2NWN A;  3SU6 A;  2TBS A;  3S9A A;  1TMT H;  1KTT B;  1LCY A;  2AEI H;  1Y3W A;  4Q4L A;  1O38 A;  1OKX A;  2ZDN A;  1BUI A;  1MAX A;  5J4Q A;  3QUM P;  3RMN H;  1VIT G;  2HLC A;  4YOG A;  1DM4 B;  3A82 A;  1OP2 A;  1SMF E;  1KDQ B;  1GWA A;  1VCQ A;  1RFN A;  2ASU B;  3UFA A;  1CBW C;  2ZA5 A;  2ZKS A;  3GCT F;  3TK6 A;  1MTN C;  4OM9 A;  1WDI A;  2EI7 A;  3VFE A;  1H9L B;  1O3B A;  4FUH A;  1GJ6 A;  3R3G B;  5DJ7 A;  2PUX B;  3E3T A;  1SC8 U;  3RU4 D;  1GI7 B;  3GIC B;  3SN8 A;  4ISL A;  1GGD B;  2Y5G A;  3BTW E;  1GJ5 H;  1UVO A;  3QZR A;  4QT8 C;  5FX6 A;  4TT3 D;  1O2Y A;  1OX1 A;  2A2X H;  1C2D A;  1E35 B;  1EX3 A;  1VR1 H;  2OCV B;  3V12 A;  1P04 A;  2VJ1 A;  5C3N A;  2HNT E;  2G5N A;  1TGS Z;  1F2S E;  3BTD E;  4YXW D;  1XUH A;  4ASU D;  2PWX A;  5ESB A;  8KME 2;  3KGP A;  5CMX H;  1IQL A;  1NFY A;  3EQ0 H;  1GCD A;  5KGO A;  1C2M A;  4H6T A;  2Y5H A;  1FMG A;  4ABI A;  4WXI A;  4ABA A;  4YM9 A;  2A4G A;  4YTA A;  5DG6 A;  5IDK A;  1O31 A;  1ZZZ A;  2ULL A;  2ANW A;  2O8M A;  1WU1 A;  1P3E A;  3ODF A;  7GCH F;  4JCN A;  4KEL A;  5EJZ A;  1BT7 A;  5DP4 A;  3O8C A;  1O5E H;  4FUB A;  4TPY A;  1KXC A;  3LKW A;  1BRU P;  4CRB A;  3UY9 A;  1AVX A;  3OFN D;  4YT7 H;  1IQK A;  1DY8 A;  4DT4 A;  3Q00 A;  3VPK A;  1LHE H;  1O36 A;  3A89 A;  1BBR H;  3S69 A;  2DE8 A;  4JZF H;  1NN6 A;  1O33 A;  3IG6 B;  4IN1 A;  1TMB H;  7GCH G;  1XKA C;  1C1N A;  1FY3 A;  1V6D A;  2AS9 A;  2ODQ A;  4ABB A;  4NWL A;  4X1N U;  2OK5 A;  1GJ4 H;  1G2M A;  4ASH A;  1ZTJ A;  2HNT F;  1SBW A;  1O2R A;  4IC6 A;  5EW1 H;  3QX5 H;  2XND D;  1FAK H;  2BVR H;  2Z6B D;  2CF9 H;  1HAH H;  2BHG A;  1O3D A;  1CA8 B;  1OOK B;  2EC9 H;  2UUJ B;  1ARB A;  2ANM H;  2P16 A;  1O3F A;  1MTV A;  3PV4 A;  4X6P A;  3JZ1 B;  3Q77 A;  1HJA B;  4MPX A;  1FI8 A;  1Z71 A;  5JB9 S;  2WSS D;  2BQ6 B;  1AUT C;  4Q7Z A;  4HG6 A;  3BTM E;  1FJS A;  2QXJ A;  4X2X A;  2ZDK A;  2BMG B;  1XKB C;  1YGC H;  1V2Q T;  5EQR A;  2H2Z A;  4D7G A;  1O5F H;  1EP6 A;  5AFZ H;  4AYY B;  1UCY K;  4JYU H;  4J1Y A;  4CBN A;  1SPJ A;  1BQY A;  2ZNK H;  3DSO A;  2LNC A;  1PPZ A;  2JET B;  4DUR A;  1EAW A;  3A85 A;  2PKA B;  4ABG A;  4E05 H;  1IQF A;  1TRY A;  1GBE A;  2GDD A;  3KYG A;  1G30 B;  2F9U A;  4DVA U;  1AWH B;  2G51 A;  2NU0 E;  4IGD A;  1CT0 E;  2P94 A;  3U1I B;  1W12 U;  4GVU A;  2FOF A;  5KEC A;  1TNH A;  1HXF H;  5EQQ A;  2XWA A;  1PPG E;  2A31 A;  2FI3 E;  3MQK C;  4INK A;  2TGA A;  2GD4 B;  1ETT H;  4F49 A;  3DSP A;  3RXG A;  1F5K U;  1GHA F;  1MCV A;  3TJO A;  4Q80 A;  2K8I A;  2G52 A;  1AQ7 A;  1O0D H;  1WSS H;  1UCY E;  4XBB A;  3P95 A;  3FOA A;  3OE7 D;  5DP9 A;  1A1R A;  1H4W A;  1KLT A;  3RMM H;  2OTV A;  2PSY A;  3MO9 A;  3DCL A;  4B75 A;  1NU7 B;  2BZA A;  4ZHL U;  4WY3 A;  2W26 A;  5I25 A;  5PTP A;  1DDJ A;  1TPA E;  5GJ4 B;  1C9T A;  2VID A;  1O3C A;  5EXN A;  4K8Y A;  2ZHF H;  2QF4 A;  4M7G A;  1BML A;  1G3B A;  1C5M D;  1MU8 B;  4WXV A;  3ZZA A;  2UWO A;  2BLO A;  3GY4 A;  4Q7Y A;  3TK9 A;  1H8H D;  2KFW A;  4D76 A;  2BD7 A;  3ZVD A;  1Y3U A;  2BD9 A;  3T28 A;  3M35 A;  2F9B H;  2ZU4 A;  4MQA A;  1K1I A;  2GZ7 A;  2OUA A;  2ZZU H;  4NIW A;  1TPO A;  1ZMJ A;  1UTN A;  1ELE E;  2ZCH P;  4YOJ A;  2XBX A;  1B0E A;  2EI8 A;  2PKS C;  3MH5 A;  1BIO A;  1M9U A;  1W13 U;  1G32 B;  1S0Q A;  1S5S A;  4X1Q U;  4Y71 A;  3LH1 A;  1TOC B;  1C1P A;  5FL7 D;  3V13 A;  3L33 A;  2I6Q A;  3T26 A;  1GVK B;  1O3I A;  1YP9 A;  2ZFR H;  5LPE A;  3OY6 U;  4X0W U;  1NRQ H;  1IOE A;  2WPI S;  3SHA H;  3SNA A;  3LPR A;  4NIV A;  5GCH G;  2XOK D;  3SNB A;  2RCE A;  4INH A;  2BZ6 H;  4J2Y B;  4ABJ A;  1SHH B;  2HGT H;  2Z3D A;  3ATM A;  4A1V A;  1THS H;  4NWK A;  5FHT A;  2ZIQ H;  3LIW A;  4CR5 A;  1O2O A;  2ZPR A;  2XTT B;  3RDZ A;  3RM0 H;  3IIT A;  2J5U A;  5C1Y A;  1DUA A;  4THN H;  2JKH A;  3OAA D;  1BOQ A;  1KXD A;  4HZH A;  5DN6 D;  1JXP A;  4MPW A;  2J2U A;  2A0Q B;  1YCP M;  2GCT C;  1FAX A;  1XVO A;  2OC7 A;  5C67 A;  4JMY A;  3PMJ A;  3TPI Z;  2KCO A;  1O35 A;  1V2V T;  3SI4 H;  2FI5 E;  1GMH F;  2HVX A;  1KIG H;  2BLW A;  1QQU A;  2WHX A;  2TPI Z;  4AZ2 B;  4B2B A;  5A8X A;  1QBN A;  3D49 H;  3L3T A;  3M37 A;  4FU9 A;  1TWX B;  1YPM H;  2QE7 D;  1JRT A;  4I33 A;  5J4S A;  3TK5 A;  1O3K A;  1PPC E;  4DOQ A;  2KAI B;  2O9Q A;  5HMA A;  1T31 A;  1QFK H;  2SGP E;  4I31 A;  4AOR A;  5C1X A;  3WY8 A;  1O2G H;  3KQE A;  3MOC A;  1TAL A;  1W10 U;  1O37 A;  3H7O A;  1PPE E;  4F4O C;  1VJ9 U;  8GCH F;  3HPT B;  4FU8 A;  3N7D A;  1H8D H;  2FLB H;  4H6S B;  4JZE H;  5L2Z H;  1UK4 A;  3CNR A;  1ZML A;  3NZI A;  4P00 A;  2OBQ A;  1SGY E;  1GBA A;  2C3S A;  2WV4 A;  1WXR A;  1H1B A;  4A7I B;  2PGB B;  3OX7 U;  1OWD A;  1TNI A;  1YC0 A;  4O97 A;  1CSO E;  3DD2 H;  1AD8 H;  4AFZ A;  1YKT A;  1A0H B;  1FY5 A;  2CV3 A;  1PYT C;  4XDE A;  1OWK A;  1OWI A;  2ZFS A;  3A7T A;  2AGG X;  1A0L A;  1UW7 A;  2L6O A;  1AFQ C;  4DG4 A;  5C17 A;  3DHK H;  1CHG A;  1EPT B;  1O2K A;  6LPR A;  2FOE A;  1HYL A;  3MNS A;  1BRC E;  4ZKN U;  1BMF D;  2BQ7 B;  3ZZD A;  3U9A H;  5C0U A;  2EI6 A;  1D6R A;  4ISH H;  1GI0 A;  1O5C B;  2A7J A;  3ZVF A;  3CS0 A;  5JBC S;  2W3I A;  2QN5 T;  1QBO A;  2NU2 E;  1C5L H;  2ZPS A;  3AAS A;  1SSX A;  1P10 A;  3OTJ E;  1G2L A;  1MBQ A;  2O8U A;  2GCH G;  1S0R A;  1NTP A;  3EYD A;  1FUJ A;  2Z3C A;  4Q7X A;  2BDB A;  1K1O A;  3GYL B;  1TPS A;  1EQ9 A;  3LGY A;  3S7K B;  5AF9 H;  4NIX A;  3RXO A;  2WV9 A;  2XC5 A;  4Q63 A;  4JZ1 A;  2PTN A;  2FS8 A;  3LOX A;  3F6U H;  1ZHR A;  1QGF A;  1LHG H;  3SGA E;  2ANY A;  2WV5 A;  1DVA H;  2I6S A;  4Y0Y E;  5EQS A;  3VXF H;  4RSP A;  1AE8 H;  1ZPC A;  4DGJ A;  1AUJ A;  1C5T A;  3U8T H;  2QXH A;  2UWL A;  2Y7X A;  3QZQ A;  2JJ2 D;  1GGD C;  2OC1 A;  2J95 A;  4KGA A;  1A3E H;  2QXG A;  1MQ6 A;  2THF B;  1LHC H;  1EAX A;  1RTF B;  3ENS B;  1TE0 A;  2XWB I;  3A87 A;  1QB6 A;  1HLT H;  2BXT H;  1F0U A;  1GBI A;  1G3C A;  3FKS D;  3HKJ B;  2FEQ H;  4UD9 H;  3URD A;  4HI3 A;  3QLP H;  2F43 B;  3UB0 A;  1C5Z B;  1O2M A;  1TAW A;  2QIQ A;  1WQV H;  1H9H E;  2F4L A;  2G00 A;  4I8L A;  4O9V A;  2OP9 A;  2XRC A;  2QF3 A;  1P05 A;  1V2N T;  1TOM H;  2BVX H;  4E7N A;  1BMA A;  1TIO A;  2V6N A;  4LZ4 B;  1YPK H;  1KXF A;  1NRP H;  1SGC A;  3B23 B;  3NXP A;  4ZKR U;  1DUE A;  1VCP A;  4KP0 A;  1C1Q A;  3SU2 A;  2XC4 A;  4NG9 H;  1ELT A;  2SFA A;  2PKA A;  1Z6E A;  1OWJ A;  3SZN A;  4K1E A;  1GDU A;  3BEU A;  1CT2 E;  1GJC B;  2GJG A;  3HGP A;  1V2T T;  1NC6 A;  3RML H;  5GPI B;  1ZSJ A;  2ZGX H;  2BD2 A;  1QB9 A;  1HNE E;  1K28 D;  3KCG H;  3A8D A;  1OP0 A;  4FUI A;  5E0G A;  1GBJ A;  1C5X B;  2CMY A;  2GZ8 A;  5B6O A;  1PPF E;  1NZQ H;  4AFU A;  1NRO H;  2GT7 A;  2PLX A;  2VIN A;  4ABD A;  4JYV H;  2OC0 A;  2ZQ1 A;  1ELB A;  3Q3X A;  1MZA A;  1P12 E;  4X1P U;  5C5O A;  2QC2 A;  1BTX A;  1D3T B;  4WVP E;  1HJ9 A;  1LDT T;  1H8I H;  2FOH A;  4BTU B;  1C5S A;  1G9I E;  4MNY A;  2J38 A;  1BMN H;  1NO9 H;  3MU5 A;  1YPJ H;  1HJA C;  4WME A;  2ODY B;  2G4T A;  4X1S U;  3SJ8 A;  2R3Y A;  2AGE X;  3PO1 C;  5F8T A;  4GPG A;  3F2G A;  5L6N H;  3G01 A;  8GCH G;  5E0J A;  2WPJ S;  1ACB E;  3E1X B;  3KQ5 A;  3VB3 A;  1C1O A;  1UMA H;  3A83 A;  2VIV A;  4LXB H;  4X6N A;  3W94 A;  4UON A;  2F9O A;  2D26 C;  2VWL A;  1AWF H;  2A5A A;  1BRA A;  2BD5 A;  1AKS B;  2GKV E;  2DE9 A;  1XUG A;  1AN1 E;  4YT6 H;  3TIT A;  1EPT A;  1NRS H;  2KZ4 A;  3GDU A;  2BY7 X;  4FXG H;  2GVF A;  3PRD A;  2VBC A;  4CR9 A;  1SGD E;  1AND A;  3KN2 A;  1QIX B;  1TYN A;  1DFP A;  4AGJ A;  5EJL A;  1G3E A;  5LGO A;  1ESA A;  1O2H A;  4UFD H;  3B9F H;  1ZPB A;  1GI2 A;  1V2R T;  1AO5 A;  1D3D B;  3KQC A;  2PHB A;  2P93 A;  4ABH A;  4IBL H;  1QBV H;  3M5M A;  2PUQ H;  5EXL A;  1GDQ A;  4OGX A;  4Y10 E;  2C8X B;  2G5V A;  1EAI A;  1V2P T;  1P57 B;  1XM1 A;  3VB4 A;  2D8W A;  2B7D H;  1YLN A;  1KMH B;  1W0K D;  2HPQ H;  2FDA A;  3LC5 A;  1TAB E;  1GJ7 B;  1COW D;  2QF0 A;  1SLV B;  1NRR H;  5DP8 A;  1GBB A;  1OXG A;  1BTW A;  3SQH E;  4NA9 H;  1W0Y H;  1QRW A;  3U98 H;  1PQ8 A;  2A4O A;  3M5O A;  1CHO G;  4BAH B;  5A0C A;  1DLE A;  5GXP A;  4MPV A;  2Q6D A;  2GV7 A;  4TWY A;  1HXE H;  5G4B A;  2GTB A;  3QK1 A;  3NKK A;  1H8E D;  1O2Q A;  1SHY A;  3GY3 A;  2EY4 C;  1QRZ A;  1FY8 E;  1K1J A;  2PKS B;  4DT7 B;  4VGC C;  5F53 A;  1AZ8 A;  2A45 B;  1O32 A;  1GVL A;  4ZH8 A;  4Y11 E;  3WW7 A;  4FU7 A;  2RDL A;  1O3O A;  3D23 A;  4ZRO A;  1XVM A;  2YMS C;  1KSN A;  5EPN A;  3FP8 E;  1SQO A;  1AMH A;  5C94 A;  4LOY H;  1C2I A;  3PLB A;  4D7F A;  2B8O H;  1OSS A;  1ORF A;  3AK5 A;  1D6W A;  3BN9 A;  1W3C A;  1VCW A;  2HNT C;  4I8G A;  1Y5B T;  1ZRB A;  1DAN H;  3PWC A;  1HB0 B;  5FCR A;  4ABF A;  1KLI H;  3E16 B;  5T6G A;  1A0J A;  1S83 A;  3ZVA A;  1HAZ B;  2ZGC A;  2IOT A;  1SGI B;  1P02 A;  2ZU5 A;  5KED A;  3ZZ3 A;  3MH7 A;  4UFG H;  5DO4 H;  4BAQ B;  3UWJ H;  2IN2 A;  1E37 B;  4D9Q A;  2ZDA H;  4ACA A;  3TJN A;  2VIQ A;  3QGN B;  1K1L A;  1TQ7 B;  2FO9 A;  3N7E A;  3ZZ7 A;  1P0S H;  3RU4 E;  2HOB A;  3LON A;  4X8S H;  2EEK A;  2BD3 A;  3PWB A;  4FVD A;  2LPR A;  4Q2K A;  2ZU1 A;  2WPK S;  2R3U A;  4XOJ A;  2BQW B;  3FZZ A;  5EOK A;  3Q3K A;  1LMW B;  1W14 U;  4O3T A;  2R0K A;  2VVC A;  2D1J A;  1GHW H;  1V2M T;  4ISO A;  1UJ1 A;  3RXU A;  4AYV B;  2J94 A;  2A32 A;  1ZHM A;  2SGQ E;  3DUX H;  2UWP A;  1GHX H;  1ZRK A;  3GCN A;  4TWW A;  1D4P B;  1EUF A;  1TON A;  1JIM A;  1BDA A;  1QRX A;  1JWT A;  1S6H A;  3P6Z B;  2TGP Z;  4M9F A;  3E0P B;  6CHA C;  1BTP A;  1C5R A;  2C4F H;  3LGI A;  3ITI A;  6EST A;  1IHT H;  3RXE A;  1BA8 B;  2FES H;  2RA3 A;  2VGC C;  1VIT H;  2W5E A;  4JK5 A;  3A84 A;  2WPH S;  1YLC A;  1MKX K;  2OQ5 A;  3UWI A;  3T27 A;  5DK1 A;  1Z8R A;  1HUT H;  1YWU A;  3MH4 A;  5L2Y H;  1O5A B;  1CGI E;  2ZEC A;  1KXA A;  4E7R G;  3H5C B;  1RXP A;  2SGD E;  1CBW B;  2EA3 A;  5LPF A;  4JK6 A;  3F68 H;  4IC5 A;  2ZU2 A;  1QL9 A;  2P3U B;  3OTP A;  3QTO H;  4CRE A;  2BOH B;  4NIY A;  1AFQ B;  1DPO A;  1T4V H;  4MDS A;  2V3O H;  3SJ9 A;  1XUI A;  1J14 A;  3OU0 A;  4DCD A;  4ISI H;  4WMD A;  1W2K H;  3GCH B;  4AC9 A;  1GMC F;  2GV6 A;  2NU1 E;  1FN6 A;  4H42 U;  1MD8 A;  1ABJ H;  2FX4 A;  1SOZ A;  3PM3 A;  1LKA A;  4A6L A;  1RD3 B;  2QGR A;  3CS7 A;  1XUK A;  4X8V H;  1GHB G;  1DT2 A;  1A3B H;  3RXK A;  3MNB A;  1KDQ A;  5EPY A;  3NRL A;  4RT0 A;  2AMD A;  3NUM A;  1P06 A;  1TGN A;  3F9G A;  3GIS B;  1SI5 H;  1N8O B;  3M7U A;  2ZG0 H;  1GVZ A;  5FXL A;  3PLP A;  4A92 A;  1MMJ N;  2GZ9 A;  3O8B A;  2O8L A;  2W3K A;  1CO7 E;  5AFY H;  1C1T A;  1V2S T;  4B6E A;  4X6M A;  4BNR A;  4GHQ A;  3F3B A;  1LTO A;  2QCY A; 
#chains in the Genus database with same CATH homology
 2OK5 A;  5FPT A;  3SU5 A;  2YMS B;  3OEE D;  2AHM E;  4XD7 D;  3VG8 A;  3N7E A;  3M5N A;  2OBQ A;  2YOL A;  1WXR A;  2XND D;  3LON A;  2KCA A;  4F55 A;  2W6J D;  5ETX A;  3SU4 A;  3M5M A;  2HLD D;  1DY9 A;  3RC4 A;  1RGQ A;  4Z1M D;  3SV6 A;  2W6I D;  2JJ1 D;  2V7Q D;  4OM9 A;  3F0P A;  2K1Q A;  5T1V A;  3O8D A;  3SU2 A;  1E1R D;  2GGV B;  2QV1 A;  2M2A A;  3U1J B;  1NBM E;  2F9V A;  1CU1 A;  3GS9 A;  2L6O A;  3F2F A;  5C17 A;  4B74 A;  2XCN A;  1DXP A;  2WSS D;  5FPS A;  4NWL A;  5FL7 D;  1N1L A;  5GPI B;  1KMH B;  5CDF E;  1BMF D;  1W0K D;  5C0U A;  5EQR A;  4M9F A;  2IJD 1;  1E79 D;  1COW D;  4FET A;  3WWF A;  4B73 A;  2XOK D;  2KCY A;  1EFR D;  3N99 A;  3SYJ A;  3M5O A;  2A4R A;  5CHB A;  3SU1 A;  2QF5 A;  4TT3 D;  3OYP A;  5GND A;  3PV5 A;  3DSO A;  3WWB A;  4A1V A;  3FO8 D;  4NWK A;  3SUE A;  3EYD A;  4I32 A;  4B76 A;  4B6F A;  4TYD A;  2OC0 A;  3RC5 A;  4ZCN A;  2KM0 A;  4WH8 A;  3O8R A;  5FPY A;  1W0J D;  4A1T A;  1H8E D;  2F9U A;  2KCP A;  3FN8 A;  1NBM D;  2J5U A;  2WV9 A;  3F0O A;  4Q63 A;  4A1X A;  4YXW D;  1DXW A;  3L6P A;  4RI0 A;  2OC8 A;  4ASU D;  3LOX A;  5DSF A;  3OAA D;  2K0Q A;  5ESB A;  5F53 A;  3OTP A;  3P8O A;  2FM2 A;  1E1Q D;  3SV7 A;  3U1I B;  5DN6 D;  3E90 B;  3WW7 A;  1JXP A;  3M5L A;  4KTC A;  3RC6 A;  5EQS A;  5EQQ A;  3P8N A;  2YMS C;  2JIZ D;  2P59 A;  2OC7 A;  5EPN A;  3SV8 A;  1MAB B;  2YMS D;  1NS3 A;  3DSP A;  4JMY A;  2A4G A;  5IDK A;  3PRB A;  2OBO A;  4WF8 A;  2K8I A;  3F2G A;  2KCO A;  2O8M A;  3SUD A;  3SU3 A;  2JJ2 D;  1BT7 A;  3KF2 A;  2OC1 A;  3FOA A;  3ZIA D;  3OE7 D;  2WPD D;  3O8C A;  2A4Q A;  3SUF A;  1A1R A;  5B6L A;  2WHX A;  3AK5 A;  1SKY E;  1FX0 B;  4B71 A;  1W3C A;  3LKW A;  2OIN A;  2CK3 D;  5H4I B;  1OHH D;  2WZQ A;  3OEH D;  3H09 A;  3W1E A;  2FP7 B;  2QE7 D;  3DCL A;  4R8T B;  4B75 A;  4I33 A;  2IJO B;  5IK2 D;  5EPY A;  3F2H A;  2FOM B;  3NRL A;  3OFN D;  1DY8 A;  3PV2 A;  3SUG A;  3FKS D;  5GJ4 B;  4DT4 A;  4TSF D;  2F43 B;  2JDI D;  4WH6 A;  3UB0 A;  3SV9 A;  4U01 A;  2KZ4 A;  4I31 A;  3SZE A;  1S6L A;  2GVF A;  2VBC A;  3PRD A;  3SU6 A;  4A92 A;  5HKK D;  3KNX A;  5C0T A;  2QF4 A;  2XCF A;  3O8B A;  3KN2 A;  2LEL A;  3SU0 A;  4Q4L A;  4B6E A;  2F4L A;  3N7D A;  1RTL A;  1H8H D;  2KR7 A;  3KEE A;  2KFW A;  4K8B A;  3F3B A;  2XNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...