2PSYA

Crystal structure of human kallikrein 5 in complex with leupeptin and zinc
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
227
structure length
227
Chain Sequence
IINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the zinc inhibition of human tissue kallikrein 5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Kallikrein-5
total genus 52
structure length 227
sequence length 227
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2psyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2psyA02
1G3DA 1FNIA 1K2I1 2TPIZ 3BSQA 3LH1A 4Q2KA 1Z6EA 2WYGA 5JBBS 2AEIH 1V2OT 1DFPA 1FIZA 1AB9B 3VGCC 2GCTC 3QN7A 1C1TA 5E0JA 1L4ZA 1PQ7A 1CBWC 4K2YA 1BITA 1O3OA 4IMZA 1OP0A 3UWIA 4F4OC 1W7XH 5G4BA 3BEUA 2ZP0H 3A8CA 5ESTE 1NFUA 1MQ6A 4A1TA 3TVJB 3M3VA 3MNXA 1D6RA 3P95A 4INKA 2GKVE 2OC0A 1EB1H 2EI8A 3GDUA 1GGDC 1HRTH 5TCCA 3RMMH 3A87A 4DOQA 3SJ9A 1VJAU 3E8LA 1NPMA 2UUFB 1TNGA 2ZGHA 3ZZ6A 1YC0A 1TRNA 2ZU4A 1UK2A 5LPFA 1KTSB 4SGBE 2QV1A 4JZIA 2NU0E 4BAOB 2B0FA 3OX7U 2HWLB 1RFNA 2BD9A 3DHKH 4E7RG 1C5PA 1G3BA 1J8AA 2A45B 6GCHG 2NU1E 2OLGA 3AW1A 2VVCA 2FOGA 3TK5A 3KF2A 1DM4B 1TRYA 5GDSH 1IHTH 1MTNC 1DVAH 1YPEH 4J1YA 1MTNB 5DP6A 3BTDE 2BLVA 3ZZ8A 1ZMLA 1DWBH 4X8UH 1DY9A 1HPGA 1ESAA 1EATA 1O2RA 4ZMAH 1Q2WA 2OBOA 2Z9LA 1EJNA 4OS4A 1LPZB 1O3IA 1L1JA 4NFFA 1M9UA 1F5RA 4MPUA 2V0BA 3GCTG 1K9OE 1TLDA 1F0RA 4YOIA 2KAIA 4WMEA 5DP8A 1THSH 5I46H 3LC3A 1GJCB 1G30B 2D26C 2ZECA 4I8LA 1BUIA 3GCHC 4UFFH 1F0UA 3AASA 5FCRA 3RC5A 2Z3CA 2B7DH 3B9FH 4YT7H 3PROA 4WMDA 2XWAA 4TYDA 1RTFB 1PYTC 1MD8A 2C8ZB 1P57B 5GCHF 4ZKSU 1CBWB 3SV8A 2BDGA 1P9UA 3DD2H 2UWLA 2PHBA 2FOFA 3SJ8A 5A2MH 1KSNA 2XXLA 4WVPE 1QJ7B 1NM6A 3SJOA 3LOXA 1O2YA 1TQ0B 1SR5C 2R0LA 1P3CA 1VCPA 2PGQB 2ESTE 3ZZBA 3RXIA 1XUJA 4YO9A 1C1NA 1EQ9A 5T3HA 2B5TB 3A81A 4AN7A 3I77A 1DWEH 2H1UA 2J95A 2OTVA 2TGPZ 1S0RA 2A4OA 4FUDA 4NA8A 5HGGA 3GDSA 2AGEX 5K7RA 5AHGH 2ZPQA 1B5GH 2ZFSA 1QGFA 4SGAE 5GCHG 3MOCA 3EDXB 5AF9H 1SSXA 1GI4A 2BZ6H 1QFKH 1TMUH 3MMGA 1KXDA 2D2DA 2FMJA 1BRBE 3ELAH 3I29A 2JETC 1HAHH 1NFXA 2BOKA 3SU1A 1FUJA 2PTCE 4OGYA 1HNEE 5EPNA 1SGIB 3TH2H 3M5LA 2R0KA 3GY6A 1ZTKA 5JB8S 1C5MD 1C1QA 1SLXB 2M5TA 1MKXK 1C5SA 4IGDA 5GIBA 3SO3A 5EQSA 1OWJA 1UVUH 1ACBE 4NA9H 1CO7E 4ABJA 3ZV8A 3PO1B 1HB0B 4HI3A 2Z9IA 1ZPZA 2Q6FA 1SC8U 2G4TA 2ZHWH 3SGBE 1T8MA 4A7IB 6CHAC 1T31A 3P70B 3GY2A 2QXJA 3SV7A 1UTPA 4I33A 3SNAA 3DFLA 3H7OA 4H4FA 3W95A 4NG9H 4YLQH 3RXGA 4CRCA 3NWUA 1OXGA 1AU8A 3UNRA 1TMBH 2B9LA 1F5LA 4TPYA 5JDUB 4JZFH 1TONA 3PLPA 3TK6A 5F8XA 2FYRA 5ESBA 1SLVB 1E37B 2OINA 1QTFA 3MH6A 5C1XA 3TJNA 1O5DH 1OP8A 3PO1C 3UNSA 1GJ7B 5C67A 1QR3E 1VZQH 1AZZA 1VJ9U 1JOUB 5DKMA 4MG3A 1JRTA 2G8TA 3GCOA 1MH0A 1NFWA 5A0CA 1O2JA 3A86A 3M5OA 1Y8TA 3PB1E 1ARCA 3U9AH 3Q3XA 1C4U2 2FS9A 1E38B 2BDCA 2QAAA 5FCKA 6ESTA 1FDPA 1J9CH 3K6ZA 1Y5AT 2ODQA 1QRZA 1UVSH 2R9PA 3KCGH 2FPZA 3RXQA 4KTUA 3AVZA 1MBQA 2BD5A 1MUEB 1UTKA 2RA0A 4BXWA 3L6PA 4B74A 2ZI2H 4FXGH 3IITA 1GBLA 4FVDA 5L6NH 4JCNA 2BDAA 2ZG0H 1TA2A 2CF9H 2F9BH 1GL0E 1QQUA 1TWXB 1TQ7B 1PPCE 3ZZ7A 2VIQA 2XNIA 4H6SB 1FONA 2TIOA 2SFAA 4MQAA 6GCHF 3O8DA 3HGNA 1C4V2 2P95A 3MNCA 1T7CA 1AKSB 3KIDU 4ABHA 4B71A 1FN6A 1HFDA 1XVMA 4CHAB 3GCHB 4LZ1H 1DS2E 2Z9GA 1KY9A 1DSTA 4DIIH 5EOKA 1VCWA 3SU5A 4I8GA 4X8SH 3TJUA 1OWKA 2EI7A 5LGOA 5JBTA 1RS0A 1BQYA 4FUEA 3E3TA 3GY8A 3SU2A 1JIMA 1YPKH 1TB6H 5HXFA 2FWWA 5E0GA 1WV7H 2KAIB 1IQNA 3R3GB 4AOQA 2Y6TA 4ZKNU 3ZZ5A 4BTUB 1UCYE 2PUQH 2ODPA 3GCNA 4X6MA 1SGRE 1N6YA 4M7GA 5FAHA 9ESTA 4MVNA 3PLKA 1BRUP 3KNXA 2O8UA 1MKXH 1V6DA 5EW2H 1Q3XA 1TAWA 1ELVA 2QF3A 1O3NA 1ELEE 2ANKH 4Y7AA 4NA7A 3NPSA 2BB4A 1AMHA 2IOTA 3M3SA 4VGCB 5C20A 1AHTH 5DPAA 1NRSH 4B73A 1P3EA 1KTTB 1EZXC 3RLYH 5ETXA 1D3QB 4U01A 4ABFA 1GGDB 3U1JB 1O32A 1GCDA 2O9QA 2H9EH 5K0HA 1P9SA 3U69H 2F9PA 1TGCA 2P94A 3ATWA 3MYWA 4AFUA 4WMFA 3S9AA 3U1IB 1VITH 1T32A 2EEKA 2IJOB 3RMOH 2ANMH 2G81E 3P8FA 1O2OA 2PLXA 2G52A 2SGFE 2FODA 1S81A 1C5YB 4FUGA 3RXRA 1F5KU 1WYKA 4DY7B 2SGAA 4IC5A 3SN8A 8KME2 2XBYA 1Z8IB 1TOMH 1GG6B 3RXJA 4ZHAA 2G55A 1TNIA 3A8DA 5GWZA 1TX8A 4Y0ZE 4AYVB 2V3OH 3KQEA 5DK1A 1MCVA 4CREA 1H8DH 3BTWE 5IYTA 4YTAA 2A1DB 3BIUH 1V2PT 3T62A 4WH6A 3KN2A 1TIOA 4X1NU 3SQEE 2EI6A 3LGUA 2VWNA 4MDSA 4UDWH 3ZV9A 3ODDA 2ZF0H 4LK4A 4AZ2B 4WJG2 1HAGE 2ZC9H 2BTCE 1FY1A 1QJ6B 2VH6A 5EQRA 3ZYEA 4Y7BA 2UUJB 1AE5A 1KXAA 1SFQB 2AH4X 1BHXB 4Y10E 5C1UA 1SOZA 4NCYA 1LHGH 1ZJKA 4XE4A 4U32A 3SNBA 2FX6A 1IQHA 1O39A 1GDNA 1YPHE 3UOUA 4CRDA 1J15A 1KYNA 4BXSA 1B7XB 1VITF 5I25A 1SGYE 1K1OA 2GCTB 4IBLH 4JK6A 1AB9C 1T8OA 1SHHB 3DT0H 1AIXH 1VCQA 1YPMH 3F9FA 1EZUC 3SJIA 1YLDA 3MU5A 1RTKA 1Y3VA 1C5QA 4OS7A 3MO6A 2GD4B 1BTHH 1DXWA 4X1SU 2A7CA 4WF8A 4R0IA 3VXFH 2FOBA 3BTGE 1BTUA 2BDBA 3VXEH 2V3HH 4THNH 3D65E 4Q7ZA 1EKBB 3STIA 4JMYA 1Q31A 5EQQA 2F83A 3UWJH 1F0SA 3MU4A 1D3PB 3BG4C 2PWXA 1GVKB 2CN0H 5E8EH 2VINA 3A85A 1LVMA 1P0SH 2W5EA 2SNWA 3LIWA 5DO4H 5LPEA 2UWOA 1GMDF 1BTZA 1DY8A 1WAYB 3RXDA 2ZFRH 1S6FA 1O5EH 1WCZA 1ZGIA 1KLJH 2CHAC 1K21H 2ZU1A 3K9XB 1ZHPA 3LGWA 1G9IE 3U8OH 1O2ZA 1TX7A 4IW4E 4UD9H 3FVFB 3OSYA 2ZGJA 3E0NB 4QT8C 4DG4A 3UTUH 2A2QH 1GBTA 3K6YA 1QQ4A 4ZXXH 4I7YH 1O2GH 2BMGB 2H5DA 5DGJA 2OD3B 1PQ5A 4JZ1A 3GISB 4LXBH 4Y11E 5C5OA 3SU4A 3SHAH 2Z6BD 1NS3A 1AVWA 4XDEA 1GDUA 1AKSA 3SUGA 3UPEA 2ASUB 1NU9A 2ANYA 2HVXA 1KDQA 3E1XB 1LMWB 5GPIB 3RXTA 3HK3B 3WY8A 2V6NA 1DWCH 1QCPA 1OWHA 2C3SA 2VIWA 3RP2A 1FMGA 1AFQC 2C90B 3A7YA 2PSXA 3ZVFA 2VNTA 2VWMA 3K65B 1E34B 3MU0A 1NFYA 2AGGX 4MTBA 3KL6A 1LO6A 2FTMA 2GT8A 3AAVA 3T5FH 1C5ZB 4IC6A 5FXLA 4UONA 3ZVAA 2BX4A 3A8AA 3M37A 1Y3YA 3ZZCA 1O33A 1O5FH 3MH4A 4TWYA 1B0EA 1LKBA 2P59A 1YM0A 2PTNA 2GDEH 1HJ9A 4D9QA 3F9GA 3SNDA 1SVPA 1P04A 1S82A 2P3UB 1MKWH 1O2UA 2GP9B 2O8LA 1UTQA 1DE7H 1ETSH 2Y7ZA 5EPYA 1MBMA 2AGIX 3BEFB 2GV6A 3PWCA 4FU7A 1HIAA 1FY3A 1HAXB 1A3EH 3EA9A 2GCHF 3A7XA 3S7KB 2YNAA 3A89A 1PJPA 2FOCA 1CQQA 1JXPA 1SHYA 2NU2E 1DXPA 4I8JA 1CHGA 1GMCF 2J2UA 1IOEA 5HM2A 1UK4A 1J17T 1YGCH 1ARBA 1C5LH 1GJ4H 4NIVA 1XM1A 4MNVA 5E2PA 4Y76A 1LHDH 3ATLA 2ALPA 1S5SA 3M5MA 4X2VA 1Z8GA 1H9LB 2AMQA 1SQOA 3LGVA 2ZHQH 4KGAA 4MPWA 1PFXC 4CH8B 5FPTA 4OS1A 3KQDA 1TYNA 2QXGA 3S9BA 1GBBA 1O2SA 1YF4A 4PROA 1O38A 3TNSA 3STJA 3MWIU 2Z3DA 1DT2A 1HLTH 4KTCA 4UEHH 2BY6X 4K60A 4E7NA 3H7TA 4U2WA 5AFYH 3F9EA 1BRCE 3TGJE 4CBOA 1DUEA 1WSSH 1NY22 1O5BB 2HRVA 1YCPK 3MO3A 3TH3H 5A09A 1O2LA 4MNYA 3UQOA 2CXVA 1FAXA 4BAKB 1TBRH 2ZGCA 3RXPA 2XCFA 3SOSA 1HAVA 1FPCH 2AMPA 1GJ8B 1ZHRA 1O3PB 4NFEA 3P92A 4NWKA 1XXFA 1Y5UT 2OBQA 4MNWA 1KXFA 4UFGH 3B23B 3HK6B 1DPOA 1C1WH 1GBDA 1SB1H 2XC5A 1GI7B 5J4QA 1EAXA 1V2RT 2SGDE 3GY4A 1C1OA 1TE0A 3P8GA 1QHRB 3NZIA 3BTME 7GCHF 2CGAA 4O03A 5C1YA 1F7ZA 3EA8A 1RRKA 5HYOA 1LKAA 3D49H 2FI4E 4NIWA 3ZZ4A 1RD3B 2AYWA 1W3CA 1UJ1A 4XBDA 1ZSLA 1XUIA 4FVBA 4A1XA 1UTJA 1GHBG 1FIWA 1RTLA 2OXSA 3QZRA 5T6FA 1GBHA 2A5KA 1O3GA 4RKOB 4D9RA 1KXBA 1XUFA 4B2AA 2F9VA 2Z9KA 1MQ5A 1BTXA 3N7OA 1HGTH 3PM3A 3RLWH 1TFXA 3TU7H 1ANDA 1C1VH 2JETB 3Q77A 1AN1E 5JYIA 1O3AA 2C4FH 1NRRH 3RXFA 1UMAH 1YPLH 2Y82A 1L1NA 2BD3A 3TITA 1KXEA 2B8OH 3BG4B 3SZNA 1V2LT 1FXYA 3SGAE 4WH8A 4KELA 5IDKA 1HJAC 5CMXH 5A0AE 1OYQA 1P09A 3CP7A 1C5UA 3P17H 3DUXH 1D3TB 2ZTYA 1NC6A 4ZUHA 1P03A 2PKAA 1TGNA 1EX3A 1RIWB 1EJAA 1H4WA 1BRAA 1XXDA 2ALVA 1OSSA 2GT7A 2I6QA 1OKXA 2ZTXA 1G2LA 1TGBA 3SI3H 3M7TA 2JKHA 3CS7A 4K3JA 1H8IH 3DA9B 4K1TA 2HLCA 5J4SA 3D62A 2ANWA 1A3BH 4YOGA 1O2TA 2PW8H 2PGBB 2A2XH 5T6GA 1AY6H 4E06H 1XKAC 1MAYA 1BMLA 1N6XA 3LJJA 2FEQH 2J4IA 1DITH 2FIRH 3BTTE 1S6HA 1SGEE 2BYAX 1F92A 1Z8RA 1KDQB 3VB4A 1CU1A 1ZZZA 3RM2H 1P2JA 4DJZB 1PQAA 2OQUA 4NZLA 2QC2A 1N8OC 1QA7A 2R2MB 4Y6DA 1V2TT 1UVOA 1TOCB 4WXVA 3UREA 2ZCKP 3SV9A 1T8NA 1GVLA 3V13A 2VGCB 1BCUH 3RXSA 1XKBC 1Z7KA 2BZAA 3ZVDA 1YPHC 1LHFH 5HM9A 4ZHMU 1AUJA 1XVOA 3C27B 1GG6C 1V2JT 1OWDA 3TGKE 1GJAB 1HAZB 4ASHA 3RXUA 2BD4A 2H6MA 1TBZH 4O97A 1E36B 1RJXB 1H9IE 1MD7A 4WY3A 2A5AA 4Y8XA 3SW2B 4ISHH 1CVWH 1HIAB 3MH7A 3ZZ9A 4IN1A 1QB6A 3T2NA 1C4Y2 2O8MA 3BF6H 4RN6A 3R0FA 1EP6A 3TJVA 1GMCG 4JYVH 1GJ6A 1HAYB 2BDYA 2W7SA 4CRBA 5JBAS 4LZ4B 4BTTB 1O2WA 1SG8B 4X1PU 1C9PA 1Z1IA 1XMNB 4AFSA 4CHAC 1GBMA 2ZEBA 2BXTH 5CE1A 2DE9A 4ZH8A 2BD2A 2XBVA 3M7UA 4HZHA 1P05A 5FPSA 3OY6U 3RXVA 1GJ5H 1CT0E 1T4VH 1P2IA 1NRQH 3RUOA 1F2SE 2OQ5A 2BY5X 3EA7A 5E2OA 1HAOH 5FBEA 1ANBA 1O36A 2YNBA 1O2IA 2ZO3H 3LONA 1K1JA 2BY9X 1GHXH 1W11U 1TA6A 1PPEE 1SGPE 1QL7A 1S83A 1FJSA 3IG6B 3ZVGA 2O8TA 4UFDH 4HFPB 2BX3A 2BLQA 2F91A 3SNCA 2QGRA 4BOHA 1EZQA 2ZDVH 2J94A 3RDZA 1EJMA 1GBAA 3BG8A 1NZQH 1O3EA 1HUTH 3JZ2B 4O9VA 3U98H 1AO5A 2Q6GA 2ZFQH 2AFQB 1SMFE 3PMBB 2GVFA 1QIXB 4CRFA 2TGAA 2LPRA 1G3EA 2ZDAH 4NWLA 2CJIA 1ZRBA 1IQGA 1DX5M 1G37A 1LPGB 1ZTLA 2BLWA 5DP5A 5C5NA 1SOTA 1BIOA 2AERH 1B0FA 2UUKB 3GYLB 2STAE 8GCHF 2ZIQH 4B76A 3NK8A 3S69A 3D23A 1ABJH 1X7AC 2H2ZA 3EE0B 1UTMA 2C8YB 1IQKA 2PKSB 1GBJA 1P01A 2ZHEH 4NSYA 3TGIE 5EXMA 3BV9B 7ESTE 1GI5A 2ZPRA 2JH5D 1FZZA 1NTPA 3GCTF 3MU8A 3RXHA 4GVUA 1N1LA 1O5AB 5EGMA 4AB9A 2R2WU 3TIUA 1AFQB 4D76A 1O30A 3LJOA 3FZDA 1UO6A 1RGQA 1GMHG 4KTSA 3A88A 4A6LA 3LT3A 2FP7B 3ESTA 2G4UA 2VWOA 1UHBA 3VB6A 2OCVB 2Z94A 1A5IA 3S9CA 1W13U 1ELDE 1GPZA 4DW2U 1GCTC 4OGXA 1UCYK 1ANCA 1C2HA 4BTIB 5FBIA 2FO9A 1LVBA 1J14A 2WPMS 5L2ZH 1P12E 3P8NA 3MH5A 1K22H 2ZZUH 3QGJA 1C1SA 1K1NA 1ZR0A 4E05H 1BMAA 1KXCA 1NO9H 1W0YH 2BDIA 2A4QA 2NU3E 4CRAA 1O3LA 1SGCA 2FYQA 4AG1A 4BANB 1LQDB 3O8CA 3OTJE 2PKAB 1LVOA 4ISOA 4B1TA 2CHAB 1G36A 4RSPA 1AWHB 1C5TA 2BOHB 1GL1A 2THFB 1HXEH 1QJ1B 4AORA 4JK5A 1IQIA 5ABWA 3KEEA 2FOHA 1GCTB 3V0XA 1CA0B 3SQHE 2ZHFH 1ESTA 2GDDA 5PTPA 5H4IB 4ZXYH 4DIHH 1L0ZA 2W3IA 2FOEA 4DCDA 4X6PA 2XBXA 1LCYA 4GCHG 3ZZ3A 3QTOH 3MNSA 3T28A 1AE8H 4CR5A 1NRPH 4CH2B 1GBEA 2HNTC 3I78A 4YOJA 1G32B 4X2WA 4IMQA 1P02A 3TNTA 6CHAB 1O2QA 3KQBA 4ESTE 2VU8E 2BHGA 1O2HA 3FP6E 3F68H 3QTVH 2ZTZA 2A7HA 1SGQE 1FN8A 3AAUA 4ISIH 4ZKRU 1YPGH 2PKSC 2QY0B 2AMDA 3P6ZB 4AB8A 2ZGXH 2XTTB 3A84A 3GYMA 5JPMH 4GCHF 1XUKA 3A7WA 5A8YA 1O35A 2ZCLP 4MPXA 1MCTA 1WQSA 3PTBA 1ID5H 1C2FA 1YP9A 2EA3A 1V3XA 4JYTA 1W14U 1WOFA 2A0QB 2TRMA 1C2GA 1OWIA 1L1GA 2F3CE 3SBKA 1TNHA 4X8TH 4ZROA 4K1SA 1G3CA 1TGTA 2GZ7A 2ZU2A 3SV2H 3LH3A 4AFQA 1A61H 1GI0A 3LGYA 1TPOA 4DGJA 2FX4A 1UK3A 2OC1A 1AGJA 1K1PA 4XSKU 3QZQA 4TY6A 1SGFG 3BTHE 4I8KA 1UTLM 1GBCA 5F8TA 1LQEA 1QL9A 5LPRA 4ABGA 1V2KT 1NRNH 1YCPM 3EQ0H 1SI5H 1GBKA 2FTLE 5F8ZA 1TPSA 1T4UH 1O2KA 5EW1H 1GHZA 1UTOA 5A8XA 1O3BA 1EPTB 2QA9E 2XYAA 1OOKB 3URDA 4MPVA 4BNRA 3Q00A 4YT6H 3FAOA 3SUFA 4D7FA 4INLA 4HGCA 3ZVBA 3VB7A 2SGPE 1MTUA 1DANH 1EPTC 4VGCC 1CT4E 1SGDE 1FPHH 1O3KA 1A4WH 1V2ST 2XBWA 1C5OH 1C5WB 1NT1A 1EAWA 1P8VC 1SLWB 2AIPA 2QYIA 1LHCH 3E91A 3PWBA 1QNJA 1S85A 3NCLA 1CE5A 2HPPH 3W94A 4AYYB 2WV4A 3LU9B 3URCA 2C8WB 3HKIB 3QO6A 3ZZAA 4OS6A 3HPTB 2IPHA 3E90B 2TGDA 3MFJA 1C2MA 3PMJA 3QLPH 8GCHG 4X1QU 2P16A 4K5ZA 1L2EA 2XW9A 4K8BA 3PV4A 2A4RA 3HGPA 3TH4H 2WUCA 4FUBA 2K1QA 2QCYA 3A82A 1P06A 4Y71A 1UVTH 1A5GH 2OC8A 3EYDA 2ZQ2A 1A0JA 2ZKSA 2Q1JA 4BAQB 1O0DH 2ZQ1A 1MU6B 1Z8JB 8LPRA 2I6SA 3CS0A 1CGJE 2FM2A 3K2UA 2BXUH 3A7VA 1BTYA 4UE7H 1SLUB 1KLTA 1O2PA 2JH6D 3FZZA 3RXAA 4FUIA 1ZMNA 1BTWA 1C2EA 1O34A 2CMYA 2OP9A 5LH8A 4FUHA 1O2VA 1V2WT 2BQWB 1D3DB 2FOAA 1BJUA 2ZA5A 1O3DA 1QBOA 3SV6A 2EC9H 2YOLA 3ENSB 1UHBB 1C2KA 1HJ8A 2AIQA 2ZFFH 1A2CH 2C8XB 1JIRA 4ZKOU 3VGCB 1YCPH 3T27A 1ABIH 3MTYA 3QUMP 1P11E 1P2OA 2PUXB 4ZHLU 1WBGB 2ZCHP 3LKWA 1EAIA 1C5NH 2WINI 4DVAU 3BTFE 1YYY1 1EZSC 1Y5BT 2GGVB 1ETRH 5AVDA 1LTOA 2C93B 2XC4A 3ZVEA 1THRH 1BZXE 1BHXF 1FLEE 1SFIA 2GZ8A 1LHEH 2PSYA 1HV7A 1GJ9B 3FP7E 4MLFB 2GTBA 2FLBH 4D8NA 4LOYH 1LVYA 2BM2A 3PLBA 1E0FD 3ZVCA 5T6DA 2RDLA 1DOJA 1TALA 4IS5A 2VVVA 1IQLA 1PYTD 1IQEA 3BIVH 1O5CB 5EXNA 4ABAA 1A46H 1J16A 1S0QA 1PPFE 3M7QA 5CHAB 1AUTC 4Y8YA 3MHWU 1GHVH 3LPRA 3UQVA 1Z1JA 4Y8ZA 2G5VA 3HKJB 4TPIZ 2ZFPH 3A83A 4AGKA 1UVPA 1OPHB 2BD7A 1O2NA 4GPGA 3LC5A 3HATH 2F9NA 3F9HA 1ZLRA 3U8TH 1ZHMA 1O3CA 1C2JA 2W7UA 3V12A 1MTWA 4XOJA 1KLIH 1XUGA 1MTSA 5DP9A 3UR9A 1W2KH 1P10A 3RXMA 2J92A 2VJ1A 3OU0A 3RC6A 3CENA 5E0HA 1BTPA 3KHVA 4K69A 2J38A 3SU6A 1SBWA 2GZ9A 1VITG 1GI8B 2JH0D 1C5XB 1BMNH 4INHA 2ZDKA 2A31A 4YM9A 1C1RA 3SNEA 3SU3A 4ABEA 3LGIA 4I8HA 1ELCA 3M5NA 4GHQA 2LNCA 4CR9A 2NU4E 3ZYDA 5BPEA 1GWAA 3M61U 4X2XA 4JYUH 5A8ZA 3V7TA 1K28D 2VIDA 1OX1A 1NROH 5AFZH 2GMTB 3L33A 3KQCA 4UFEH 2GMTC 2ILNA 4I32A 3NXPA 2TBSA 5L30H 2WV5A 3PTNA 2P8OC 1A1RA 1OYTH 1PPBH 2WPKS 5DP4A 3P8OA 1O3MA 4ABDA 2QIQA 1DLKB 4OS5A 1AZ8A 2NWNA 1JBUH 4K8YA 1YLCA 2H9HA 1DDJA 1V2QT 3RM0H 4A1VA 1GMDG 1EPTA 3RXOA 1Y3XA 3UUZA 1VR1H 3A7ZA 1QA0A 3MNBA 3PYHA 3RC4A 3ATKA 4KKDA 1JRSA 1GI1A 1LDTT 1PQ8A 7KMEH 1FV9A 3L3TA 4NIXA 3A8BA 3SUEA 5C2ZA 4A92A 1IHSH 4XBCA 1NESE 3ATMA 2IN2A 1HCGA 1THPB 4DURA 1AI8H 3SI4H 2FXRA 1EAUA 2VGCC 1SGTA 2WYJA 1MAXA 1Z6JH 3UNQA 3O8RA 3H5CB 1QY6A 3BTEE 4BAHB 1UTNA 4F49A 2P3TB 1EASA 4J2YB 1TNKA 2BQ6B 9LPRA 4B75A 2VH0A 3BTKE 7LPRA 1GHAG 3SGQE 1PPZA 4GUXA 2WPJS 1BBRH 2QXHA 3GY7A 2FESH 5DG6A 1BB0B 1DICA 1O2MA 2GV7A 1BA8B 1DWDH 5SGAE 2SGQE 4FUCA 2QF0A 3NKKA 2WPLS 8ESTE 2W3KA 2PFEA 1ELGA 2G5NA 1ZMJA 3TK9A 4FU8A 1FY5A 1T8LA 1BBRE 1TPAE 4A5TS 1QURH 1QBVH 1C9TA 1HDTH 2FZZA 2G00A 1RIWC 2F9OA 4O3TA 2PV9B 1GHAF 1GI6A 1ZGVA 1MKWK 3ODFA 4X8VH 3QWCH 4AGJA 2SGEE 4Z0KA 4GHTA 4Q7XA 1VGCB 2FI5E 2Z3EA 3JZ1B 1HAVB 1O3JA 3A7TA 1BMMH 2GCHG 1GHWH 4XFQA 2HNTF 1GHYH 3PMHB 4R8TB 1EOJA 3FFGA 2VWLA 4AG2A 1HBTH 2BLOA 3M35A 1N8OB 4WWYA 1D4PB 4X6NA 3RU4D 3V3MA 3VB5A 3IWMA 2BVXH 3OY5U 3F1SB 4GLYA 1OP2A 3S7HB 1D9IA 1EUFA 1Y59T 5TJXA 4ZAEA 1P2MA 3BTQE 1ZYOA 3UFAA 3UIRA 5EXLA 1A0LA 1Z71A 4Y0YE 4YLUA 1MTVA 1GBIA 2GX4A 2ZDLA 3UY9A 1V2VT 4ABBA 3SHCH 1VGCC 1F0TA 1SGNE 1CHOF 1GVZA 3M3TA 1A5HA 3LGTA 1TPPA 5EU8A 1V2MT 4WXIA 1E35B 1GDQA 2RG3A 2A5IA 1HAIH 3RXKA 3SORA 2FI3E 2PR3A 1HJAB 4Y79A 1BT7A 1YPJH 5L2YH 1H9HE 1YBWA 2WUBA 4OS2A 2ZWLH 1TMTH 1GBFA 4H6TA 1SL3A 1KIGH 2DUCA 1K1MA 1V2NT 1ESBA 4NSVA 1C1MA 1CHOG 5GXPA 3VFEA 3M36A 3F6UH 1MZDA 2AS9A 3SU0A 2VIPA 4B2BA 1O31A 3MI4A 3VB3A 2UUYA 3OYPA 2H9TH 1PPHE 3AW0A 1FY4A 2RA3A 3PMAB 3QDZB 3Q76A 4AFZA 2H5CA 2SNVA 1AVGH 1K1LA 1FAKH 2HOBA 5JBCS 1OWEA 1Y3UA 1JMOH 5EG4A 2Y5GA 4FUFA 3MU1A 1TRMA 2ZPSA 1XUHA 3B8JA 1BJVA 3G01A 4CBNA 3FANA 1MU8B 4Q7YA 5JB9S 3RXLA 3QGNB 5FHTA 2Y80A 1WQVH 1ZJDA 2ZNKH 2CV3A 2R3YA 2TGTA 3GOVB 1G2MA 3GY3A 1GJBB 1CGIE 2ULLA 1DLEA 2ZU3A 3BEIB 2D1JA 1O37A 1SQAA 1FY8E 4Q80A 1AFEH 1ELAA 3TPIZ 1DSUA 1W10U 3EAJA 2VIOA 1IQFA 2BD8A 4X6OA 3QX5H 4I31A 3T29A 2HALA 1LPKB 1AQ7A 1ELFA 1C2LA 1BBRK 1EOLA 1JWTA 4YZUA 1BOQA 2Y5HA 1GI9B 1A0HB 2G51A 2VB0A 3Q3YA 4MNXA 4YESB 1U6QA 1RXPA 2VVUA 4FUJA 2Z7FE 1IQJA 1OS8A 5GJ4B 3ITIA 3KGPA 2V35A 1PPGE 1MMJN 3GDVA 1CA8B 1L4DA 4AX9H 1GMHF 1WUNH 1TGSZ 1EP5A 5FX5A 5C3NA 1P2QA 5FPYA 1ELBA 1INCA 7GCHG 2VIVA 1ELTA 4U30A 1ORFA 3Q3KA 1AD8H 4ABIA 1C1UH 1TNJA 1Y3WA 1ZOMA 2O8WA 3UOPA 2A7JA 2ODYB 4TWWA 5TCAA 3UR6A 3MO9A 2P93A 2J34A 5DP7A 2FLRH 1GHBF 4Z6AH 4B2CA 4BAMB 1O3FA 4JZEH 1K1IA 1C5VA 3E16B 4GSOA 1AWFH 3E6PH 3QK1A 2BQ7B 2A32A 2J9NA 1H1BA 1FQ3A 1P2KA 2DE8A 2STBE 1C2DA 2CF8H 1EXFA 2BDHA 2P3FH 2OUAA 2ZDMA 1D6WA 1TBQH 2XRCA 1GI3A 3GY5A 1CA0C 1MZAA 3EGKH 3VEQB 3DFJA 5F6MA 2ZU5A 3RXBA 1QL8A 2BVSH 1AVXA 4H42U 3T26A 2P8OB 2Y81A 1C5RA 3ZZDA 2ZFTA 2HNTE 4ISNA 4K1EA 4XBBA 3TLOA 3E0PB 2XCNA 1XX9A 1W0ZU 2HPQH 1GI2A 3BN9A 3LDXH 5HMAA 1ZPCA 1SQTA 1BDAA 2HGTH 1TNLA 1W12U 3A80A 1QRWA 1YKTA 1C1PA 1ZRKA 4ISLA 1CGHA 1ZSKA 2WPHS 1W7GH 5B6OA 2ZDNA 3FP8E 4DT7B 1ETTH 2Q6DA 3ATIA 4NZQA 1TABE 1ANEA 2XWBI 5A0BA 2QXIA 4CRGA 4IN2A 1WTHD 3T25A 1QRXA 6LPRA 4FU9A 4O3UA 1UCYH 2BY8X 1S84A 1WU1A 2Z9JA 5BRRE 1QB1A 1O5GH 1HXFH 4RKJB 2FDAA 3RXCA 4X1RU 2FOMB 3SJKA 1O2XA 1SPJA 1GJDB 1ZPBA 1IAUA 2RCEA 2D8WA 2QN5T 1O3HA 4KP0A 3SUDA 5F03A 2FS8A 1SGFA 2UWPA 1EB2A 4GAWA 5FX6A 3RU4E 3RXEA 1V2UT 4X2YA 3TJOA 1HAPH 1CT2E 2F9UA 1NU7B 4HTCH 3VPKA 4NGAH 1NN6A 5CHAC 2A4GA 1ZSJA 1IQMA 2ZHDA 1C2IA 2ZGBH 5EODA 3U8RH 3GICB 2XC0A 1QB9A 2BY7X 2OC7A 1DUAA 3S0NA 1HYLA 3C1KA 2BVRH 1WTGH 4JZDH 5DP3A 4TY7A 1W8BH 2Y7XA 2W26A 4D7GA 1FI8A 3RU4T 1TX6A 2Y5FA 3RMLH 2WPIS 3O8BA 2R3UA 1ZTJA 1QBNA 3NUMA 1CSOE 4NIYA 4X0WU 1P2NA 3RMNH 1A7SA 5DJ7A
chains in the Genus database with same CATH superfamily
1G3DA 1FNIA 1K2I1 2TPIZ 3BSQA 3LH1A 4Q2KA 1Z6EA 2WYGA 5JBBS 2AEIH 1V2OT 1DFPA 1FIZA 1AB9B 3VGCC 2GCTC 3QN7A 1C1TA 5E0JA 1L4ZA 1PQ7A 1CBWC 4K2YA 1BITA 1O3OA 4IMZA 3WW7A 1OP0A 3UWIA 4F4OC 1W7XH 5G4BA 3BEUA 2ZP0H 3A8CA 3FN8A 5ESTE 2F4LA 1NFUA 1MQ6A 4A1TA 3TVJB 3M3VA 3MNXA 1D6RA 3P95A 4INKA 2GKVE 2OC0A 3OEED 1EB1H 2EI8A 2M2AA 3GDUA 1GGDC 3SYJA 1HRTH 5TCCA 3RMMH 3A87A 4DOQA 3SJ9A 1VJAU 3E8LA 1NPMA 2UUFB 1TNGA 2ZGHA 3ZZ6A 1YC0A 1TRNA 2ZU4A 1UK2A 5LPFA 1KTSB 4SGBE 2QV1A 4JZIA 2NU0E 4BAOB 2B0FA 3OX7U 2HWLB 1RFNA 2BD9A 3DHKH 4E7RG 1C5PA 1G3BA 1J8AA 2A45B 6GCHG 2NU1E 2OLGA 3AW1A 2VVCA 2FOGA 3TK5A 3KF2A 1DM4B 1TRYA 5GDSH 1IHTH 1MTNC 1DVAH 2YMSB 1YPEH 5KECA 2EY4C 4J1YA 1MTNB 5DP6A 3BTDE 2BLVA 3ZZ8A 1ZMLA 1DWBH 4X8UH 1DY9A 1HPGA 1ESAA 1EATA 3F0OA 1O2RA 4ZMAH 1Q2WA 2OBOA 2Z9LA 1EJNA 2WPDD 4OS4A 1LPZB 1O3IA 1L1JA 4NFFA 1M9UA 1F5RA 4MPUA 2V0BA 3GCTG 1K9OE 1TLDA 1W0JD 1F0RA 4YOIA 2KAIA 4WMEA 5DP8A 1THSH 5I46H 3LC3A 1GJCB 5HIYA 1G30B 2D26C 2ZECA 4I8LA 1BUIA 3GCHC 4UFFH 1F0UA 3AASA 5FCRA 3RC5A 2Z3CA 2B7DH 3B9FH 4YT7H 3PROA 4WMDA 3N7EA 2XWAA 4TYDA 1RTFB 1PYTC 1MD8A 2C8ZB 1P57B 5GCHF 4ZKSU 1CBWB 3SV8A 2BDGA 1P9UA 3DD2H 2UWLA 2WHXA 2PHBA 2FOFA 3SJ8A 5A2MH 2J98B 1KSNA 2XXLA 4WVPE 1QJ7B 1NM6A 3SJOA 3LOXA 1O2YA 1TQ0B 1SR5C 2R0LA 1P3CA 1VCPA 2PGQB 2ESTE 3ZZBA 3RXIA 1XUJA 4YO9A 1C1NA 1EQ9A 5T3HA 2B5TB 3A81A 4AN7A 3I77A 1DWEH 2H1UA 2J95A 2OTVA 2TGPZ 1S0RA 2A4OA 4FUDA 4NA8A 5HGGA 3GDSA 2AGEX 5K7RA 5AHGH 2ZPQA 1B5GH 2ZFSA 3DCLA 1QGFA 4SGAE 5GCHG 5KEDA 3MOCA 3EDXB 5AF9H 1SSXA 1GI4A 2BZ6H 1QFKH 1TMUH 3MMGA 1KXDA 2D2DA 2FMJA 1BRBE 3ELAH 3I29A 2JETC 1HAHH 1NFXA 2BOKA 3SU1A 1FUJA 2PTCE 4OGYA 4RI0A 1HNEE 5EPNA 1SGIB 3TH2H 3M5LA 2R0KA 3GY6A 1ZTKA 5JB8S 1C5MD 1C1QA 1SLXB 2M5TA 1MKXK 1C5SA 4IGDA 5GIBA 3SO3A 5EQSA 1OWJA 1UVUH 1ACBE 4NA9H 1CO7E 4ABJA 3ZV8A 3PO1B 1HB0B 4HI3A 4FOUC 2Z9IA 1ZPZA 2Q6FA 1SC8U 2G4TA 2ZHWH 3SGBE 1T8MA 4A7IB 6CHAC 1T31A 3P70B 3GY2A 2QXJA 3SV7A 1UTPA 4I33A 3SNAA 1E79D 3DFLA 3H7OA 4H4FA 3W95A 4NG9H 4YLQH 3RXGA 4CRCA 3NWUA 1OXGA 1AU8A 3UNRA 1TMBH 2B9LA 1F5LA 4TPYA 5JDUB 4JZFH 1TONA 3PLPA 3TK6A 5F8XA 2FYRA 5ESBA 1SLVB 3NRLA 1E37B 2OINA 1QTFA 3MH6A 5C1XA 3TJNA 1O5DH 1OP8A 3PO1C 3UNSA 1GJ7B 5C67A 1QR3E 1VZQH 1AZZA 1VJ9U 1JOUB 5DKMA 4MG3A 1JRTA 2G8TA 3GCOA 1MH0A 1NFWA 5A0CA 1O2JA 3A86A 3M5OA 1Y8TA 3PB1E 1ARCA 3U9AH 3Q3XA 5GNDA 1C4U2 2FS9A 1E38B 2BDCA 2XNDD 2QAAA 5FCKA 3OAAD 6ESTA 1FDPA 3UB0A 1J9CH 3K6ZA 1Y5AT 2ODQA 1QRZA 1UVSH 2R9PA 3KCGH 2FPZA 3RXQA 4KTUA 3AVZA 1MBQA 2BD5A 1MUEB 1UTKA 2RA0A 4BXWA 3L6PA 4B74A 2ZI2H 4FXGH 2J97A 3IITA 1GBLA 4FVDA 5L6NH 4JCNA 2BDAA 2ZG0H 1TA2A 2CF9H 2F9BH 4ACAA 1GL0E 1QQUA 1TWXB 1TQ7B 1PPCE 3ZZ7A 2VIQA 2XNIA 4H6SB 1FONA 2TIOA 2SFAA 4MQAA 6GCHF 3O8DA 3HGNA 2W6ID 1C4V2 2P95A 3MNCA 1WDIA 1T7CA 1AKSB 3KIDU 4ABHA 4B71A 1FN6A 1HFDA 1XVMA 4CHAB 3GCHB 4LZ1H 1DS2E 2Z9GA 1KY9A 1DSTA 4DIIH 5EOKA 1VCWA 2L6OA 3SU5A 4I8GA 4X8SH 3TJUA 1OWKA 2EI7A 5LGOA 5JBTA 1RS0A 1BQYA 4FUEA 3E3TA 3GY8A 3SU2A 1JIMA 1YPKH 1TB6H 5HXFA 5EJZA 2FWWA 5E0GA 1WV7H 2KAIB 1IQNA 3R3GB 3SZEA 4AOQA 2Y6TA 4ZKNU 4F48B 4M9FA 3ZZ5A 4BTUB 1UCYE 2PUQH 2ODPA 2KM0A 3GCNA 4X6MA 1SGRE 1N6YA 4M7GA 1SQRA 5FAHA 9ESTA 5EJ1A 4MVNA 3PLKA 1BRUP 3KNXA 2O8UA 1MKXH 1V6DA 2K8IA 2YMSD 5EW2H 3FO8D 5HKKD 1Q3XA 1TAWA 1ELVA 2QF3A 1O3NA 1ELEE 4DT4A 2ANKH 4Y7AA 4NA7A 3NPSA 2BB4A 1AMHA 2IOTA 3M3SA 4VGCB 5C20A 1AHTH 5DPAA 1NRSH 4B73A 1P3EA 1KTTB 1EZXC 3RLYH 3W1EA 5ETXA 2WZQA 1D3QB 4U01A 4ABFA 1GGDB 3U1JB 1O32A 1GCDA 2O9QA 2H9EH 5K0HA 1P9SA 3U69H 2F9PA 2HLDD 1TGCA 2P94A 3ATWA 3MYWA 4AFUA 4WMFA 3S9AA 3U1IB 1VITH 1T32A 2EEKA 2IJOB 1H8HD 3RMOH 5C94A 2ANMH 2G81E 3P8FA 1O2OA 2PLXA 2G52A 2SGFE 2FODA 1S81A 1C5YB 1E1QD 4FUGA 3RXRA 1F5KU 1WYKA 4DY7B 2SGAA 4IC5A 3SN8A 8KME2 2XBYA 1Z8IB 4P02A 2YMSC 1TOMH 1GG6B 3RXJA 5EJLA 2G55A 4ZHAA 1TNIA 3A8DA 5GWZA 1TX8A 4Y0ZE 4AYVB 2V3OH 3KQEA 5DK1A 1MCVA 4CREA 1H8DH 3BTWE 5IYTA 4YTAA 2A1DB 3BIUH 1V2PT 3T62A 4WH6A 3KN2A 1TIOA 4X1NU 3SQEE 2EI6A 3LGUA 2VWNA 4MDSA 4UDWH 3ZV9A 3ODDA 2ZF0H 4LK4A 4AZ2B 4WJG2 1HAGE 2ZC9H 2BTCE 1FY1A 1QJ6B 2VH6A 5EQRA 3ZYEA 4Y7BA 2UUJB 1AE5A 1KXAA 1SFQB 2AH4X 1BHXB 4Y10E 5C1UA 1SOZA 2RFKC 4NCYA 1LHGH 1ZJKA 4XE4A 2QF5A 4U32A 3SNBA 2FX6A 1IQHA 1O39A 1GDNA 1YPHE 3UOUA 4CRDA 1J15A 1KYNA 4BXSA 1B7XB 1VITF 5I25A 1SGYE 1K1OA 2GCTB 4IBLH 4JK6A 1AB9C 1T8OA 1SHHB 3DT0H 1AIXH 1VCQA 1YPMH 3F9FA 1EZUC 3SJIA 1YLDA 3MU5A 4I86A 1RTKA 1Y3VA 1C5QA 4OS7A 3MO6A 2GD4B 1BTHH 1DXWA 4X1SU 2A7CA 4WF8A 4R0IA 3VXFH 2FOBA 3BTGE 1BTUA 2BDBA 2V7QD 3VXEH 2V3HH 4THNH 3D65E 4Q7ZA 1EKBB 3STIA 4JMYA 1Q31A 5EQQA 1NBMD 2F83A 3UWJH 1F0SA 3MU4A 1D3PB 3BG4C 2PWXA 1GVKB 2CN0H 5E8EH 2VINA 3A85A 1LVMA 1P0SH 2W5EA 2SNWA 3LIWA 5DO4H 5LPEA 2UWOA 1GMDF 1BTZA 1DY8A 1WAYB 3RXDA 2ZFRH 5CDFE 1S6FA 1O5EH 1WCZA 1ZGIA 1KLJH 2CHAC 1K21H 2ZU1A 3K9XB 1ZHPA 1KMHB 3LGWA 1G9IE 3U8OH 1O2ZA 1TX7A 4IW4E 4UD9H 3FVFB 3OSYA 2ZGJA 3E0NB 4QT8C 4DG4A 3UTUH 2A2QH 5C17A 1GBTA 3K6YA 1QQ4A 4ZXXH 4I7YH 1O2GH 2BMGB 2H5DA 5DGJA 2OD3B 2W6JD 1PQ5A 4JZ1A 2JIZD 3GISB 4LXBH 4Y11E 5C5OA 3SU4A 3SHAH 1NBME 2Z6BD 1NS3A 1AVWA 3FOAA 4XDEA 1GDUA 1AKSA 3SUGA 3UPEA 3F2HA 2ASUB 1NU9A 2ANYA 2HVXA 1KDQA 3E1XB 1LMWB 5GPIB 3RXTA 3HK3B 1S6LA 3WY8A 4OM9A 3F0PA 2V6NA 1DWCH 1QCPA 1OWHA 2C3SA 2VIWA 3RP2A 1FMGA 1AFQC 2C90B 3A7YA 2PSXA 3ZVFA 2VNTA 2VWMA 3K65B 1E34B 3MU0A 1NFYA 2AGGX 4MTBA 3KL6A 3U28C 1LO6A 2FTMA 2GT8A 3AAVA 3T5FH 1C5ZB 4IC6A 5FXLA 4UONA 3ZVAA 2BX4A 5F53A 3A8AA 3M37A 1Y3YA 3ZZCA 2IPQX 1O33A 1O5FH 3MH4A 4TWYA 1B0EA 1VKYA 1LKBA 2P59A 1YM0A 2PTNA 2GDEH 1HJ9A 4D9QA 3F9GA 3SNDA 3MQKC 1SVPA 2V3MA 1P04A 1S82A 2P3UB 2K0QA 1MKWH 1O2UA 2GP9B 2O8LA 1UTQA 1DE7H 1ETSH 2Y7ZA 5EPYA 1MBMA 2AGIX 3BEFB 2GV6A 3PWCA 4FU7A 1HIAA 1FY3A 1HAXB 1A3EH 3EA9A 2GCHF 3A7XA 3S7KB 2YNAA 3A89A 1PJPA 2FOCA 1CQQA 3KQ5A 1JXPA 1SHYA 2NU2E 1DXPA 4I8JA 1CHGA 1GMCF 2J2UA 1IOEA 5HM2A 1UK4A 1J17T 1YGCH 1ARBA 1C5LH 1GJ4H 4NIVA 1XM1A 4MNVA 5E2PA 4Y76A 1LHDH 3ATLA 2ALPA 1S5SA 3M5MA 4X2VA 1Z8GA 1H9LB 2AMQA 1SQOA 3LGVA 2ZHQH 4KGAA 4MPWA 1PFXC 4CH8B 5FPTA 4OS1A 3KQDA 1TYNA 2QXGA 3S9BA 1GBBA 1O2SA 1YF4A 4PROA 1O38A 3TNSA 3STJA 3MWIU 2Z3DA 1DT2A 1HLTH 4KTCA 4B6FA 4UEHH 2BY6X 4K60A 4E7NA 4YXWD 3H7TA 4U2WA 5AFYH 3F9EA 1BRCE 3TGJE 4CBOA 1DUEA 1YLNA 1WSSH 1NY22 1O5BB 2HRVA 1YCPK 3MO3A 3TH3H 5A09A 1O2LA 4MNYA 3UQOA 2CXVA 1FAXA 4BAKB 1TBRH 2ZGCA 3RXPA 2XCFA 3SOSA 1HAVA 1FPCH 2AMPA 1GJ8B 1ZHRA 1O3PB 4NFEA 3P92A 4NWKA 1XXFA 1Y5UT 2OBQA 4MNWA 1KXFA 4UFGH 3EE7A 3B23B 3HK6B 2OK5A 3N99A 1DPOA 1C1WH 1GBDA 1SB1H 2KR7A 2XC5A 1GI7B 5J4QA 1EAXA 1V2RT 2SGDE 3GY4A 1C1OA 1TE0A 2JJ1D 3P8GA 1QHRB 3NZIA 3BTME 7GCHF 2CGAA 4O03A 5C1YA 1F7ZA 3EA8A 1RRKA 2KCOA 5HYOA 1LKAA 3D49H 2FI4E 4NIWA 3ZZ4A 1RD3B 2AYWA 1W3CA 1UJ1A 4XBDA 1ZSLA 1XUIA 4FVBA 4A1XA 1UTJA 1GHBG 1FIWA 1RTLA 2OXSA 3QZRA 5T6FA 1GBHA 2A5KA 1O3GA 4RKOB 4D9RA 1KXBA 1XUFA 4B2AA 2F9VA 2Z9KA 1MQ5A 1BTXA 3N7OA 1HGTH 3PM3A 3RLWH 1TFXA 3TU7H 1ANDA 1C1VH 2JETB 3Q77A 1AN1E 5JYIA 1O3AA 2C4FH 1NRRH 3RXFA 1UMAH 1YPLH 2Y82A 1L1NA 2BD3A 3TITA 1KXEA 2B8OH 3BG4B 3SZNA 1V2LT 1FXYA 3SGAE 4WH8A 4KELA 5IDKA 1HJAC 5CMXH 5A0AE 1OYQA 1P09A 3CP7A 1C5UA 3P17H 3DUXH 1D3TB 2ZTYA 1NC6A 4ZUHA 1P03A 2PKAA 1TGNA 1EX3A 1RIWB 1EJAA 1H4WA 1BRAA 1XXDA 2ALVA 1OSSA 2GT7A 2I6QA 1OKXA 2ZTXA 1G2LA 1TGBA 3SI3H 3M7TA 2JKHA 3CS7A 4K3JA 1H8IH 3DA9B 4K1TA 2HLCA 5J4SA 3D62A 2ANWA 1A3BH 4YOGA 1O2TA 2PW8H 2PGBB 2A2XH 5T6GA 1AY6H 4E06H 1XKAC 1MAYA 1BMLA 1N6XA 3LJJA 2FEQH 2J4IA 1DITH 4RT1A 2FIRH 1UW7A 1WXRA 3BTTE 1S6HA 1SGEE 2BYAX 1F92A 1Z8RA 1KDQB 3VB4A 1CU1A 1ZZZA 3RM2H 1P2JA 4DJZB 1PQAA 2OQUA 4NZLA 2QC2A 1N8OC 1QA7A 2R2MB 4Y6DA 1V2TT 1UVOA 1TOCB 4WXVA 3UREA 2ZCKP 3SV9A 1T8NA 1GVLA 3V13A 2VGCB 1BCUH 3RXSA 1XKBC 1Z7KA 2BZAA 3ZVDA 1YPHC 1LHFH 5HM9A 4ZHMU 1AUJA 3VG8A 1XVOA 3C27B 1GG6C 1V2JT 1OWDA 3TGKE 1GJAB 1HAZB 4ASHA 3RXUA 2BD4A 2H6MA 1TBZH 4O97A 1E36B 1RJXB 1H9IE 1MD7A 4WY3A 2A5AA 4Y8XA 3SW2B 4ISHH 1CVWH 1HIAB 3MH7A 3ZZ9A 4IN1A 1QB6A 3T2NA 1C4Y2 2O8MA 3BF6H 4RN6A 3R0FA 1EP6A 2VBCA 3TJVA 1GMCG 4JYVH 1GJ6A 1HAYB 2BDYA 2W7SA 4CRBA 3KYGA 5JBAS 4LZ4B 4BTTB 5KGOA 1O2WA 1SG8B 4X1PU 1C9PA 1Z1IA 1XMNB 4AFSA 4CHAC 1GBMA 2ZEBA 2BXTH 5CE1A 2DE9A 4ZH8A 2BD2A 2XBVA 3M7UA 4HZHA 1P05A 5FPSA 3OY6U 3RXVA 2KCYA 1GJ5H 1CT0E 1T4VH 1P2IA 1NRQH 3RUOA 1F2SE 2OQ5A 2BY5X 3EA7A 5E2OA 1HAOH 5FBEA 1ANBA 1O36A 2YNBA 1O2IA 2ZO3H 3LONA 1K1JA 2BY9X 1GHXH 1W11U 1TA6A 1PPEE 1SGPE 1QL7A 1S83A 5B6LA 1FJSA 3IG6B 3ZVGA 2O8TA 4UFDH 4HFPB 2BX3A 2BLQA 2F91A 3SNCA 2QGRA 4BOHA 1EZQA 2ZDVH 2J94A 3RDZA 1EJMA 1GBAA 3BG8A 1NZQH 1O3EA 1HUTH 3JZ2B 4O9VA 3U98H 1AO5A 2Q6GA 2ZFQH 2AFQB 1SMFE 3PMBB 2GVFA 1QIXB 4CRFA 2TGAA 2LPRA 1G3EA 2ZDAH 4NWLA 2CJIA 1ZRBA 1IQGA 1DX5M 1G37A 1LPGB 1ZTLA 2BLWA 5DP5A 5C5NA 1SOTA 1BIOA 2AERH 2J98A 1B0FA 2UUKB 3GYLB 1E1RD 2STAE 8GCHF 2ZIQH 4B76A 3NK8A 3S69A 3D23A 1ABJH 1X7AC 2H2ZA 3EE0B 1UTMA 2C8YB 1IQKA 2PKSB 1GBJA 1P01A 1BMFD 2ZHEH 4NSYA 3TGIE 5EXMA 3BV9B 7ESTE 1GI5A 2RDEA 2JH5D 2ZPRA 1FZZA 1NTPA 3GCTF 3MU8A 3RXHA 4GVUA 1N1LA 1O5AB 5EGMA 4AB9A 2R2WU 3TIUA 1AFQB 4D76A 1O30A 3LJOA 3FZDA 1UO6A 1RGQA 1GMHG 4KTSA 3A88A 4A6LA 3LT3A 2FP7B 3ESTA 2G4UA 2VWOA 1UHBA 3VB6A 2OCVB 2Z94A 1A5IA 1QZ8A 1W13U 1ELDE 1GPZA 4DW2U 3S9CA 1GCTC 4OGXA 1UCYK 1ANCA 1C2HA 4BTIB 5FBIA 2FO9A 1LVBA 1J14A 2WPMS 5L2ZH 5C0TA 1P12E 3P8NA 3MH5A 1K22H 2ZZUH 3QGJA 1C1SA 1K1NA 1ZR0A 4E05H 1BMAA 1KXCA 1NO9H 1W0YH 2BDIA 2A4QA 2NU3E 4CRAA 1O3LA 1SGCA 2FYQA 4AG1A 4BANB 1LQDB 3O8CA 3OTJE 2PKAB 1LVOA 4ISOA 4B1TA 2CHAB 4HG6A 1G36A 4RSPA 1AWHB 1C5TA 2BOHB 1GL1A 2THFB 1HXEH 1QJ1B 4AORA 4JK5A 3AK5A 1IQIA 5ABWA 3KEEA 2FOHA 1GCTB 3V0XA 1CA0B 3SQHE 2ZHFH 1ESTA 2GDDA 5PTPA 5H4IB 4ZXYH 4DIHH 1L0ZA 2W3IA 2FOEA 4DCDA 4X6PA 2XBXA 1LCYA 4GCHG 3ZZ3A 3QTOH 2KX4A 3MNSA 3T28A 1AE8H 4CR5A 1NRPH 4CH2B 1GBEA 2HNTC 3I78A 4YOJA 1G32B 4X2WA 4IMQA 1P02A 3TNTA 6CHAB 1O2QA 3KQBA 4ESTE 2VU8E 2BHGA 1O2HA 3FP6E 3F68H 3QTVH 2ZTZA 2A7HA 1SGQE 2JJ2D 1FN8A 3AAUA 4ISIH 4ZKRU 1YPGH 2PKSC 2QY0B 2AMDA 3P6ZB 4AB8A 3OFND 2ZGXH 2XTTB 3A84A 3GYMA 5JPMH 4GCHF 1XUKA 3A7WA 5A8YA 1O35A 2ZCLP 4MPXA 1MCTA 1WQSA 3PTBA 1ID5H 4F55A 1C2FA 1YP9A 2EA3A 1V3XA 4JYTA 1W14U 1WOFA 2A0QB 2TRMA 3PRBA 1C2GA 1OWIA 1L1GA 2F3CE 3SBKA 1TNHA 4X8TH 4ZROA 4K1SA 4Q63A 1G3CA 1TGTA 2GZ7A 2ZU2A 3SV2H 3LH3A 4AFQA 1A61H 1GI0A 3LGYA 2WV9A 1TPOA 4DGJA 2FX4A 1UK3A 2OC1A 1AGJA 1K1PA 4XSKU 3QZQA 4TY6A 2WSSD 1SGFG 3BTHE 4I8KA 1UTLM 4B6EA 2F43B 1GBCA 5F8TA 1LQEA 1QL9A 5LPRA 3F2GA 4ABGA 1V2KT 1NRNH 1YCPM 3EQ0H 1SI5H 1GBKA 2FTLE 4ACBA 2KFWA 5F8ZA 1TPSA 1T4UH 1O2KA 5EW1H 1GHZA 1UTOA 5A8XA 1O3BA 1EPTB 2QA9E 2XYAA 1OHHD 1OOKB 3URDA 4MPVA 4BNRA 3Q00A 4YT6H 5CHBA 3FAOA 3SUFA 4D7FA 4INLA 4HGCA 3ZVBA 3VB7A 2SGPE 1MTUA 1DANH 1EPTC 4VGCC 1CT4E 1SGDE 1FPHH 1O3KA 1A4WH 1V2ST 1C5OH 1C5WB 1NT1A 1EAWA 1P8VC 1SLWB 2QYIA 2AIPA 2XBWA 3UAIC 1LHCH 3E91A 3PWBA 1QNJA 1S85A 3F2FA 1CE5A 2HPPH 3NCLA 3W94A 4AYYB 2WV4A 3LU9B 3URCA 2C8WB 3HKIB 3QO6A 3ZZAA 4OS6A 3HPTB 2IPHA 3E90B 2TGDA 3MFJA 1C2MA 3PMJA 3QLPH 8GCHG 4X1QU 2P16A 4K5ZA 1L2EA 2XW9A 4K8BA 3PV4A 2A4RA 3HGPA 3TH4H 2WUCA 4FUBA 2K1QA 2QCYA 3A82A 1P06A 4Y71A 1UVTH 1A5GH 2OC8A 3EYDA 2L74A 2ZQ2A 1A0JA 2ZKSA 2Q1JA 4BAQB 1O0DH 2ZQ1A 1MU6B 1Z8JB 8LPRA 2I6SA 3CS0A 1CGJE 3DSPA 2FM2A 3K2UA 2BXUH 3A7VA 1BTYA 4UE7H 1SLUB 3GS9A 1KLTA 1O2PA 2JH6D 3FZZA 3RXAA 4FUIA 1ZMNA 1BTWA 1C2EA 1O34A 2CMYA 2OP9A 5LH8A 4FUHA 1O2VA 1V2WT 2BQWB 1D3DB 3KYFA 2FOAA 1BJUA 2ZA5A 1O3DA 1QBOA 3SV6A 2EC9H 2YOLA 3ENSB 1UHBB 1C2KA 1HJ8A 2AIQA 2ZFFH 1A2CH 2C8XB 1JIRA 4ZKOU 3VGCB 1YCPH 3T27A 1ABIH 3MTYA 3QUMP 1P11E 1P2OA 2PUXB 4ZHLU 1WBGB 2ZCHP 3LKWA 1EAIA 1C5NH 2WINI 3CNRA 4DVAU 3BTFE 1YYY1 1EZSC 1Y5BT 2GGVB 1ETRH 5AVDA 1LTOA 2C93B 2XC4A 3ZVEA 1THRH 1BZXE 1BHXF 1FLEE 1SFIA 2GZ8A 1LHEH 2PSYA 1HV7A 1GJ9B 3FP7E 4MLFB 2GTBA 2FLBH 4D8NA 4LOYH 1LVYA 2BM2A 2CK3D 3PLBA 1E0FD 3ZVCA 5T6DA 2RDLA 1DOJA 1TALA 4IS5A 2VVVA 1IQLA 1PYTD 1IQEA 3BIVH 1O5CB 5EXNA 4ABAA 1A46H 1J16A 1S0QA 1PPFE 3M7QA 2QE7D 5CHAB 1AUTC 4Y8YA 2AHME 3MHWU 1GHVH 3LPRA 3UQVA 1Z1JA 4Y8ZA 1FX0B 2G5VA 3HKJB 4TPIZ 2ZFPH 3A83A 4TSFD 4P00A 4AGKA 1UVPA 2EQNA 1OPHB 2BD7A 1O2NA 4GPGA 3LC5A 3HATH 2F9NA 3F9HA 1ZLRA 3U8TH 1ZHMA 1O3CA 1C2JA 2W7UA 3V12A 1MTWA 4XOJA 1KLIH 2QF4A 1XUGA 1MTSA 5DP9A 3DSOA 3OE7D 3OTPA 3UR9A 1W2KH 1P10A 3RXMA 2J92A 2VJ1A 3OU0A 3DSGA 3RC6A 3CENA 5E0HA 1BTPA 3KHVA 4K69A 2J38A 5EIYA 3SU6A 1SBWA 2GZ9A 1VITG 1GI8B 2JH0D 1C5XB 1BMNH 4INHA 2ZDKA 2A31A 4YM9A 1C1RA 3SNEA 3OEHD 3SU3A 4ABEA 3LGIA 4I8HA 1ELCA 3M5NA 4GHQA 2LNCA 4CR9A 2NU4E 3ZYDA 5BPEA 1GWAA 3M61U 4X2XA 5HIZA 1MABB 4JYUH 5A8ZA 3V7TA 1K28D 2VIDA 1OX1A 1NROH 5AFZH 2GMTB 3L33A 3KQCA 4UFEH 2GMTC 2ILNA 4I32A 3NXPA 2TBSA 5L30H 2WV5A 3PTNA 2P8OC 1A1RA 1OYTH 1PPBH 2WPKS 5DP4A 3P8OA 1O3MA 4ABDA 2QIQA 1DLKB 4OS5A 1AZ8A 2NWNA 1JBUH 4K8YA 1YLCA 2H9HA 1DDJA 1V2QT 3RM0H 4A1VA 1GMDG 1EPTA 3RXOA 3PV5A 1Y3XA 3UUZA 1VR1H 3A7ZA 1QA0A 3MNBA 3PYHA 3RC4A 3ATKA 4KKDA 1JRSA 1GI1A 1LDTT 1PQ8A 3WWBA 7KMEH 5T1VA 1FV9A 3L3TA 4NIXA 3A8BA 3SUEA 5C2ZA 4A92A 1IHSH 4XBCA 1NESE 3ATMA 2IN2A 1HCGA 1THPB 4DURA 1AI8H 5DSFA 3SI4H 2FXRA 1EAUA 2VGCC 1SGTA 2WYJA 1MAXA 1Z6JH 3UNQA 3O8RA 2KZ4A 3H5CB 1QY6A 3PRDA 3BTEE 4BAHB 1UTNA 4F49A 2P3TB 1EASA 4J2YB 1TNKA 2BQ6B 9LPRA 4B75A 2VH0A 3BTKE 7LPRA 1GHAG 3SGQE 1PPZA 4GUXA 2WPJS 1BBRH 2QXHA 3GY7A 2FESH 5DG6A 1BB0B 1DICA 1O2MA 2GV7A 1BA8B 1DWDH 5SGAE 2SGQE 4FUCA 2QF0A 3NKKA 2WPLS 8ESTE 2W3KA 3WWFA 2PFEA 1ELGA 2G5NA 1ZMJA 3TK9A 4FU8A 1FY5A 1T8LA 1BBRE 1TPAE 4A5TS 1QURH 1QBVH 1C9TA 1HDTH 2FZZA 2G00A 1RIWC 2F9OA 4O3TA 2PV9B 4ZCNA 1GHAF 1GI6A 1ZGVA 1MKWK 3ODFA 4X8VH 3QWCH 3FKSD 4AGJA 2SGEE 4Z0KA 4GHTA 4Q7XA 1VGCB 2FI5E 2Z3EA 3JZ1B 1HAVB 1O3JA 3A7TA 5FL7D 1BMMH 2GCHG 1GHWH 4XFQA 2HNTF 1GHYH 3PMHB 4R8TB 1EOJA 5IK2D 3FFGA 2VWLA 4AG2A 1HBTH 2BLOA 3M35A 1N8OB 4WWYA 1D4PB 4X6NA 3RU4D 3V3MA 3VB5A 3IWMA 2BVXH 3OY5U 3F1SB 4GLYA 1OP2A 3S7HB 1D9IA 1EUFA 1Y59T 5TJXA 4ZAEA 4AC9A 1P2MA 3BTQE 1ZYOA 3UFAA 3UIRA 5EXLA 1A0LA 1Z71A 4Y0YE 4YLUA 1MTVA 1GBIA 2GX4A 2ZDLA 5C0UA 3ZIAD 3UY9A 2HVYB 1V2VT 4ABBA 1K0HA 3SHCH 1VGCC 1F0TA 1SGNE 1CHOF 1GVZA 4TT3D 3M3TA 1A5HA 2LELA 3LGTA 1TPPA 5EU8A 1V2MT 4WXIA 1E35B 2IJD1 1GDQA 2RG3A 2A5IA 1HAIH 3RXKA 3SORA 2FI3E 2PR3A 2J5UA 1HJAB 2XOKD 4Y79A 1BT7A 1YPJH 5L2YH 2KCPA 3N7DA 1H9HE 1YBWA 2WUBA 4OS2A 2ZWLH 1TMTH 1GBFA 4H6TA 1SL3A 1KIGH 1W0KD 2DUCA 1K1MA 1V2NT 1ESBA 4NSVA 1C1MA 1CHOG 4XRNA 5GXPA 3VFEA 3M36A 3F6UH 1MZDA 2AS9A 3SU0A 2VIPA 4B2BA 1O31A 3MI4A 3VB3A 2UUYA 3OYPA 2H9TH 1PPHE 3AW0A 1FY4A 2RA3A 3PMAB 3QDZB 3Q76A 4AFZA 2H5CA 2SNVA 1AVGH 1K1LA 1FAKH 2HOBA 5JBCS 1OWEA 1Y3UA 1JMOH 5EG4A 2Y5GA 4FUFA 3MU1A 1TRMA 2ZPSA 1XUHA 3B8JA 1BJVA 3G01A 4CBNA 3FANA 1MU8B 4Q7YA 5JB9S 3RXLA 3QGNB 5FHTA 2Y80A 1WQVH 1ZJDA 2ZNKH 2CV3A 2R3YA 2TGTA 4FETA 3GOVB 1G2MA 3GY3A 3F3BA 1GJBB 1CGIE 2ULLA 2JDID 1DLEA 2ZU3A 1H8ED 3BEIB 2D1JA 1O37A 1SQAA 1FY8E 4Q80A 1AFEH 1YWUA 1ELAA 3TPIZ 1DSUA 1W10U 3EAJA 2VIOA 1IQFA 2BD8A 4X6OA 3QX5H 4I31A 3T29A 2HALA 1LPKB 1AQ7A 1ELFA 1C2LA 1BBRK 1EOLA 1JWTA 4YZUA 1BOQA 1GI9B 1A0HB 2G51A 2VB0A 2Y5HA 3Q3YA 4MNXA 4YESB 1U6QA 1RXPA 2VVUA 2PP6A 2Z7FE 1IQJA 4FUJA 1OS8A 1YY3A 5GJ4B 3ITIA 3KGPA 2V35A 1PPGE 1MMJN 3GDVA 1CA8B 1L4DA 4AX9H 1GMHF 1WUNH 1TGSZ 1EP5A 5FX5A 5C3NA 1P2QA 5FPYA 1ELBA 1INCA 7GCHG 2VIVA 1ELTA 4U30A 1ORFA 3Q3KA 1AD8H 4ABIA 1C1UH 1TNJA 1Y3WA 1ZOMA 2O8WA 3UOPA 2A7JA 2ODYB 4TWWA 5TCAA 3UR6A 2LP6A 3MO9A 2P93A 2J34A 5DP7A 2FLRH 1GHBF 4Q4LA 4Z6AH 4B2CA 4BAMB 1O3FA 4JZEH 1K1IA 1C5VA 3E16B 4GSOA 1AWFH 3E6PH 3QK1A 2BQ7B 2A32A 2J9NA 1H1BA 1FQ3A 4Z1MD 1P2KA 2DE8A 2STBE 1C2DA 2CF8H 1EXFA 2BDHA 2P3FH 2OUAA 2ZDMA 1D6WA 1TBQH 2XRCA 3H09A 1GI3A 3GY5A 1CA0C 1MZAA 3EGKH 3VEQB 3DFJA 5F6MA 2ZU5A 3RXBA 1QL8A 2BVSH 1AVXA 4H42U 3T26A 5DN6D 2P8OB 2Y81A 1C5RA 3ZZDA 2ZFTA 2HNTE 4ISNA 4K1EA 4XBBA 3TLOA 3E0PB 2XCNA 1XX9A 1W0ZU 2HPQH 1GI2A 3BN9A 3LDXH 5HMAA 1ZPCA 1SQTA 1BDAA 2HGTH 1TNLA 1W12U 3A80A 1QRWA 1YKTA 1C1PA 1ZRKA 4XD7D 4ISLA 1CGHA 1ZSKA 2WPHS 1W7GH 2GJGA 5B6OA 2ZDNA 3FP8E 4DT7B 1ETTH 2Q6DA 3ATIA 4NZQA 1TABE 1ANEA 2XWBI 5A0BA 2QXIA 4CRGA 4IN2A 1WTHD 3T25A 1QRXA 6LPRA 4FU9A 4O3UA 1UCYH 2BY8X 1S84A 1WU1A 2Z9JA 5BRRE 4ASUD 1QB1A 1O5GH 1HXFH 4RKJB 2FDAA 3RXCA 4X1RU 2FOMB 3SJKA 1O2XA 1SPJA 1GJDB 2QN5T 1ZPBA 2RCEA 1IAUA 2D8WA 4RT0A 1O3HA 1EFRD 4KP0A 3SUDA 5F03A 2FS8A 1SGFA 2UWPA 1EB2A 4GAWA 5FX6A 3RU4E 3RXEA 1V2UT 4X2YA 3PV2A 3TJOA 1HAPH 1CT2E 2F9UA 1NU7B 4HTCH 3VPKA 4NGAH 1NN6A 2KCAA 5CHAC 2A4GA 1ZSJA 1IQMA 2ZHDA 1C2IA 2ZGBH 5EODA 3U8RH 3GICB 2XC0A 1QB9A 2BY7X 2OC7A 1DUAA 3S0NA 1HYLA 3C1KA 2BVRH 1WTGH 4JZDH 5DP3A 4TY7A 1W8BH 2Y7XA 2W26A 4D7GA 1COWD 1FI8A 3RU4T 1SKYE 1TX6A 2Y5FA 3RMLH 2WPIS 3O8BA 2R3UA 1ZTJA 1QBNA 3NUMA 1CSOE 4NIYA 4X0WU 1P2NA 3RMNH 1A7SA 5DJ7A
chains in the Genus database with same CATH topology
1G3DA 1FNIA 1K2I1 2TPIZ 3BSQA 3LH1A 4Q2KA 1Z6EA 2WYGA 5JBBS 2AEIH 1V2OT 1DFPA 1FIZA 1AB9B 3VGCC 2GCTC 3QN7A 1C1TA 5E0JA 1L4ZA 1PQ7A 1CBWC 4K2YA 1BITA 1O3OA 4IMZA 1OP0A 3UWIA 4F4OC 1W7XH 5G4BA 3BEUA 2ZP0H 3A8CA 5ESTE 1NFUA 1MQ6A 4A1TA 3TVJB 3M3VA 3MNXA 1D6RA 3P95A 4INKA 2GKVE 2OC0A 1EB1H 2EI8A 3GDUA 1GGDC 1HRTH 5TCCA 3RMMH 3A87A 4DOQA 3SJ9A 1VJAU 3E8LA 1NPMA 2UUFB 1TNGA 2ZGHA 3ZZ6A 1YC0A 1TRNA 2ZU4A 1UK2A 5LPFA 1KTSB 4SGBE 2QV1A 4JZIA 2NU0E 4BAOB 2B0FA 3OX7U 2HWLB 1RFNA 2BD9A 3DHKH 4E7RG 1C5PA 1G3BA 1J8AA 2A45B 6GCHG 2NU1E 2OLGA 3AW1A 2VVCA 2FOGA 3TK5A 3KF2A 1DM4B 1TRYA 5GDSH 1IHTH 1MTNC 1DVAH 1YPEH 4J1YA 1MTNB 5DP6A 3BTDE 2BLVA 3ZZ8A 1ZMLA 1DWBH 4X8UH 1DY9A 1HPGA 1ESAA 1EATA 1O2RA 4ZMAH 1Q2WA 2OBOA 2Z9LA 1EJNA 4OS4A 1LPZB 1O3IA 1L1JA 4NFFA 1M9UA 1F5RA 4MPUA 2V0BA 3GCTG 1K9OE 1TLDA 1F0RA 4YOIA 2KAIA 4WMEA 5DP8A 1THSH 5I46H 3LC3A 1GJCB 1G30B 2D26C 2ZECA 4I8LA 1BUIA 3GCHC 4UFFH 1F0UA 3AASA 5FCRA 3RC5A 2Z3CA 2B7DH 3B9FH 4YT7H 3PROA 4WMDA 2XWAA 4TYDA 1RTFB 1PYTC 1MD8A 2C8ZB 1P57B 5GCHF 4ZKSU 1CBWB 3SV8A 2BDGA 1P9UA 3DD2H 2UWLA 2PHBA 2FOFA 3SJ8A 5A2MH 1KSNA 2XXLA 4WVPE 1QJ7B 1NM6A 3SJOA 3LOXA 1O2YA 1TQ0B 1SR5C 2R0LA 1P3CA 1VCPA 2PGQB 2ESTE 3ZZBA 3RXIA 1XUJA 4YO9A 1C1NA 1EQ9A 5T3HA 2B5TB 3A81A 4AN7A 3I77A 1DWEH 2H1UA 2J95A 2OTVA 2TGPZ 1S0RA 2A4OA 4FUDA 4NA8A 5HGGA 3GDSA 2AGEX 5K7RA 5AHGH 2ZPQA 1B5GH 2ZFSA 1QGFA 4SGAE 5GCHG 3MOCA 3EDXB 5AF9H 1SSXA 1GI4A 2BZ6H 1QFKH 1TMUH 3MMGA 1KXDA 2D2DA 2FMJA 1BRBE 3ELAH 3I29A 2JETC 1HAHH 1NFXA 2BOKA 3SU1A 1FUJA 2PTCE 4OGYA 1HNEE 5EPNA 1SGIB 3TH2H 3M5LA 2R0KA 3GY6A 1ZTKA 5JB8S 1C5MD 1C1QA 1SLXB 2M5TA 1MKXK 1C5SA 4IGDA 5GIBA 3SO3A 5EQSA 1OWJA 1UVUH 1ACBE 4NA9H 1CO7E 4ABJA 3ZV8A 3PO1B 1HB0B 4HI3A 2Z9IA 1ZPZA 2Q6FA 1SC8U 2G4TA 2ZHWH 3SGBE 1T8MA 4A7IB 6CHAC 1T31A 3P70B 3GY2A 2QXJA 3SV7A 1UTPA 4I33A 3SNAA 3DFLA 3H7OA 4H4FA 3W95A 4NG9H 4YLQH 3RXGA 4CRCA 3NWUA 1OXGA 1AU8A 3UNRA 1TMBH 2B9LA 1F5LA 4TPYA 5JDUB 4JZFH 1TONA 3PLPA 3TK6A 5F8XA 2FYRA 5ESBA 1SLVB 1E37B 2OINA 1QTFA 3MH6A 5C1XA 3TJNA 1O5DH 1OP8A 3PO1C 3UNSA 1GJ7B 5C67A 1QR3E 1VZQH 1AZZA 1VJ9U 1JOUB 5DKMA 4MG3A 1JRTA 2G8TA 3GCOA 1MH0A 1NFWA 5A0CA 1O2JA 3A86A 3M5OA 1Y8TA 3PB1E 1ARCA 3U9AH 3Q3XA 1C4U2 2FS9A 1E38B 2BDCA 2QAAA 5FCKA 6ESTA 1FDPA 1J9CH 3K6ZA 1Y5AT 2ODQA 1QRZA 1UVSH 2R9PA 3KCGH 2FPZA 3RXQA 4KTUA 3AVZA 1MBQA 2BD5A 1MUEB 1UTKA 2RA0A 4BXWA 3L6PA 4B74A 2ZI2H 4FXGH 3IITA 1GBLA 4FVDA 5L6NH 4JCNA 2BDAA 2ZG0H 1TA2A 2CF9H 2F9BH 1GL0E 1QQUA 1TWXB 1TQ7B 1PPCE 3ZZ7A 2VIQA 2XNIA 4H6SB 1FONA 2TIOA 2SFAA 4MQAA 6GCHF 3O8DA 3HGNA 1C4V2 2P95A 3MNCA 1T7CA 1AKSB 3KIDU 4ABHA 4B71A 1FN6A 1HFDA 1XVMA 4CHAB 3GCHB 4LZ1H 1DS2E 2Z9GA 1KY9A 1DSTA 4DIIH 5EOKA 1VCWA 3SU5A 4I8GA 4X8SH 3TJUA 1OWKA 2EI7A 5LGOA 5JBTA 1RS0A 1BQYA 4FUEA 3E3TA 3GY8A 3SU2A 1JIMA 1YPKH 1TB6H 5HXFA 2FWWA 5E0GA 1WV7H 2KAIB 1IQNA 3R3GB 4AOQA 2Y6TA 4ZKNU 3ZZ5A 4BTUB 1UCYE 2PUQH 2ODPA 3GCNA 4X6MA 1SGRE 1N6YA 4M7GA 5FAHA 9ESTA 4MVNA 3PLKA 1BRUP 3KNXA 2O8UA 1MKXH 1V6DA 5EW2H 1Q3XA 1TAWA 1ELVA 2QF3A 1O3NA 1ELEE 2ANKH 4Y7AA 4NA7A 3NPSA 2BB4A 1AMHA 2IOTA 3M3SA 4VGCB 5C20A 1AHTH 5DPAA 1NRSH 4B73A 1P3EA 1KTTB 1EZXC 3RLYH 5ETXA 1D3QB 4U01A 4ABFA 1GGDB 3U1JB 1O32A 1GCDA 2O9QA 2H9EH 5K0HA 1P9SA 3U69H 2F9PA 1TGCA 2P94A 3ATWA 3MYWA 4AFUA 4WMFA 3S9AA 3U1IB 1VITH 1T32A 2EEKA 2IJOB 3RMOH 2ANMH 2G81E 3P8FA 1O2OA 2PLXA 2G52A 2SGFE 2FODA 1S81A 1C5YB 4FUGA 3RXRA 1F5KU 1WYKA 4DY7B 2SGAA 4IC5A 3SN8A 8KME2 2XBYA 1Z8IB 1TOMH 1GG6B 3RXJA 4ZHAA 2G55A 1TNIA 3A8DA 5GWZA 1TX8A 4Y0ZE 4AYVB 2V3OH 3KQEA 5DK1A 1MCVA 4CREA 1H8DH 3BTWE 5IYTA 4YTAA 2A1DB 3BIUH 1V2PT 3T62A 4WH6A 3KN2A 1TIOA 4X1NU 3SQEE 2EI6A 3LGUA 2VWNA 4MDSA 4UDWH 3ZV9A 3ODDA 2ZF0H 4LK4A 4AZ2B 4WJG2 1HAGE 2ZC9H 2BTCE 1FY1A 1QJ6B 2VH6A 5EQRA 3ZYEA 4Y7BA 2UUJB 1AE5A 1KXAA 1SFQB 2AH4X 1BHXB 4Y10E 5C1UA 1SOZA 4NCYA 1LHGH 1ZJKA 4XE4A 4U32A 3SNBA 2FX6A 1IQHA 1O39A 1GDNA 1YPHE 3UOUA 4CRDA 1J15A 1KYNA 4BXSA 1B7XB 1VITF 5I25A 1SGYE 1K1OA 2GCTB 4IBLH 4JK6A 1AB9C 1T8OA 1SHHB 3DT0H 1AIXH 1VCQA 1YPMH 3F9FA 1EZUC 3SJIA 1YLDA 3MU5A 1RTKA 1Y3VA 1C5QA 4OS7A 3MO6A 2GD4B 1BTHH 1DXWA 4X1SU 2A7CA 4WF8A 4R0IA 3VXFH 2FOBA 3BTGE 1BTUA 2BDBA 3VXEH 2V3HH 4THNH 3D65E 4Q7ZA 1EKBB 3STIA 4JMYA 1Q31A 5EQQA 2F83A 3UWJH 1F0SA 3MU4A 1D3PB 3BG4C 2PWXA 1GVKB 2CN0H 5E8EH 2VINA 3A85A 1LVMA 1P0SH 2W5EA 2SNWA 3LIWA 5DO4H 5LPEA 2UWOA 1GMDF 1BTZA 1DY8A 1WAYB 3RXDA 2ZFRH 1S6FA 1O5EH 1WCZA 1ZGIA 1KLJH 2CHAC 1K21H 2ZU1A 3K9XB 1ZHPA 3LGWA 1G9IE 3U8OH 1O2ZA 1TX7A 4IW4E 4UD9H 3FVFB 3OSYA 2ZGJA 3E0NB 4QT8C 4DG4A 3UTUH 2A2QH 1GBTA 3K6YA 1QQ4A 4ZXXH 4I7YH 1O2GH 2BMGB 2H5DA 5DGJA 2OD3B 1PQ5A 4JZ1A 3GISB 4LXBH 4Y11E 5C5OA 3SU4A 3SHAH 2Z6BD 1NS3A 1AVWA 4XDEA 1GDUA 1AKSA 3SUGA 3UPEA 2ASUB 1NU9A 2ANYA 2HVXA 1KDQA 3E1XB 1LMWB 5GPIB 3RXTA 3HK3B 3WY8A 2V6NA 1DWCH 1QCPA 1OWHA 2C3SA 2VIWA 3RP2A 1FMGA 1AFQC 2C90B 3A7YA 2PSXA 3ZVFA 2VNTA 2VWMA 3K65B 1E34B 3MU0A 1NFYA 2AGGX 4MTBA 3KL6A 1LO6A 2FTMA 2GT8A 3AAVA 3T5FH 1C5ZB 4IC6A 5FXLA 4UONA 3ZVAA 2BX4A 3A8AA 3M37A 1Y3YA 3ZZCA 1O33A 1O5FH 3MH4A 4TWYA 1B0EA 1LKBA 2P59A 1YM0A 2PTNA 2GDEH 1HJ9A 4D9QA 3F9GA 3SNDA 1SVPA 1P04A 1S82A 2P3UB 1MKWH 1O2UA 2GP9B 2O8LA 1UTQA 1DE7H 1ETSH 2Y7ZA 5EPYA 1MBMA 2AGIX 3BEFB 2GV6A 3PWCA 4FU7A 1HIAA 1FY3A 1HAXB 1A3EH 3EA9A 2GCHF 3A7XA 3S7KB 2YNAA 3A89A 1PJPA 2FOCA 1CQQA 1JXPA 1SHYA 2NU2E 1DXPA 4I8JA 1CHGA 1GMCF 2J2UA 1IOEA 5HM2A 1UK4A 1J17T 1YGCH 1ARBA 1C5LH 1GJ4H 4NIVA 1XM1A 4MNVA 5E2PA 4Y76A 1LHDH 3ATLA 2ALPA 1S5SA 3M5MA 4X2VA 1Z8GA 1H9LB 2AMQA 1SQOA 3LGVA 2ZHQH 4KGAA 4MPWA 1PFXC 4CH8B 5FPTA 4OS1A 3KQDA 1TYNA 2QXGA 3S9BA 1GBBA 1O2SA 1YF4A 4PROA 1O38A 3TNSA 3STJA 3MWIU 2Z3DA 1DT2A 1HLTH 4KTCA 4UEHH 2BY6X 4K60A 4E7NA 3H7TA 4U2WA 5AFYH 3F9EA 1BRCE 3TGJE 4CBOA 1DUEA 1WSSH 1NY22 1O5BB 2HRVA 1YCPK 3MO3A 3TH3H 5A09A 1O2LA 4MNYA 3UQOA 2CXVA 1FAXA 4BAKB 1TBRH 2ZGCA 3RXPA 2XCFA 3SOSA 1HAVA 1FPCH 2AMPA 1GJ8B 1ZHRA 1O3PB 4NFEA 3P92A 4NWKA 1XXFA 1Y5UT 2OBQA 4MNWA 1KXFA 4UFGH 3B23B 3HK6B 1DPOA 1C1WH 1GBDA 1SB1H 2XC5A 1GI7B 5J4QA 1EAXA 1V2RT 2SGDE 3GY4A 1C1OA 1TE0A 3P8GA 1QHRB 3NZIA 3BTME 7GCHF 2CGAA 4O03A 5C1YA 1F7ZA 3EA8A 1RRKA 5HYOA 1LKAA 3D49H 2FI4E 4NIWA 3ZZ4A 1RD3B 2AYWA 1W3CA 1UJ1A 4XBDA 1ZSLA 1XUIA 4FVBA 4A1XA 1UTJA 1GHBG 1FIWA 1RTLA 2OXSA 3QZRA 5T6FA 1GBHA 2A5KA 1O3GA 4RKOB 4D9RA 1KXBA 1XUFA 4B2AA 2F9VA 2Z9KA 1MQ5A 1BTXA 3N7OA 1HGTH 3PM3A 3RLWH 1TFXA 3TU7H 1ANDA 1C1VH 2JETB 3Q77A 1AN1E 5JYIA 1O3AA 2C4FH 1NRRH 3RXFA 1UMAH 1YPLH 2Y82A 1L1NA 2BD3A 3TITA 1KXEA 2B8OH 3BG4B 3SZNA 1V2LT 1FXYA 3SGAE 4WH8A 4KELA 5IDKA 1HJAC 5CMXH 5A0AE 1OYQA 1P09A 3CP7A 1C5UA 3P17H 3DUXH 1D3TB 2ZTYA 1NC6A 4ZUHA 1P03A 2PKAA 1TGNA 1EX3A 1RIWB 1EJAA 1H4WA 1BRAA 1XXDA 2ALVA 1OSSA 2GT7A 2I6QA 1OKXA 2ZTXA 1G2LA 1TGBA 3SI3H 3M7TA 2JKHA 3CS7A 4K3JA 1H8IH 3DA9B 4K1TA 2HLCA 5J4SA 3D62A 2ANWA 1A3BH 4YOGA 1O2TA 2PW8H 2PGBB 2A2XH 5T6GA 1AY6H 4E06H 1XKAC 1MAYA 1BMLA 1N6XA 3LJJA 2FEQH 2J4IA 1DITH 2FIRH 3BTTE 1S6HA 1SGEE 2BYAX 1F92A 1Z8RA 1KDQB 3VB4A 1CU1A 1ZZZA 3RM2H 1P2JA 4DJZB 1PQAA 2OQUA 4NZLA 2QC2A 1N8OC 1QA7A 2R2MB 4Y6DA 1V2TT 1UVOA 1TOCB 4WXVA 3UREA 2ZCKP 3SV9A 1T8NA 1GVLA 3V13A 2VGCB 1BCUH 3RXSA 1XKBC 1Z7KA 2BZAA 3ZVDA 1YPHC 1LHFH 5HM9A 4ZHMU 1AUJA 1XVOA 3C27B 1GG6C 1V2JT 1OWDA 3TGKE 1GJAB 1HAZB 4ASHA 3RXUA 2BD4A 2H6MA 1TBZH 4O97A 1E36B 1RJXB 1H9IE 1MD7A 4WY3A 2A5AA 4Y8XA 3SW2B 4ISHH 1CVWH 1HIAB 3MH7A 3ZZ9A 4IN1A 1QB6A 3T2NA 1C4Y2 2O8MA 3BF6H 4RN6A 3R0FA 1EP6A 3TJVA 1GMCG 4JYVH 1GJ6A 1HAYB 2BDYA 2W7SA 4CRBA 5JBAS 4LZ4B 4BTTB 1O2WA 1SG8B 4X1PU 1C9PA 1Z1IA 1XMNB 4AFSA 4CHAC 1GBMA 2ZEBA 2BXTH 5CE1A 2DE9A 4ZH8A 2BD2A 2XBVA 3M7UA 4HZHA 1P05A 5FPSA 3OY6U 3RXVA 1GJ5H 1CT0E 1T4VH 1P2IA 1NRQH 3RUOA 1F2SE 2OQ5A 2BY5X 3EA7A 5E2OA 1HAOH 5FBEA 1ANBA 1O36A 2YNBA 1O2IA 2ZO3H 3LONA 1K1JA 2BY9X 1GHXH 1W11U 1TA6A 1PPEE 1SGPE 1QL7A 1S83A 1FJSA 3IG6B 3ZVGA 2O8TA 4UFDH 4HFPB 2BX3A 2BLQA 2F91A 3SNCA 2QGRA 4BOHA 1EZQA 2ZDVH 2J94A 3RDZA 1EJMA