2PSYA

Crystal structure of human kallikrein 5 in complex with leupeptin and zinc
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
227
structure length
227
Chain Sequence
IINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Kallikrein-5
publication title Structural basis of the zinc inhibition of human tissue kallikrein 5.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 227
sequence length 227
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2psyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2psyA02
5FX6A 2XBXA 1FPHH 3VB3A 1CVWH 1QB6A 1GHYH 1W14U 1IQKA 2FXRA 4B2CA 2NU4E 1FONA 2GP9B 4D7GA 1IHSH 3SHAH 2DUCA 1HNEE 4KP0A 2IN2A 2VWNA 1LTOA 2YNAA 1EPTB 2FLBH 4FUJA 2QXJA 1GBFA 5F8XA 2W7UA 1EP6A 1O39A 4FU8A 1GJ5H 3ODDA 5E0JA 3F6UH 1VZQH 4NIWA 3PLBA 3MYWA 5C1UA 2B9LA 1FN6A 2OINA 1UMAH 4CRAA 3QLPH 4X8TH 1HIAA 3VB7A 1YPLH 3U9AH 3A8BA 3RM0H 1C1QA 2BD7A 1LPKB 1OX1A 2A1DB 2XC4A 1O2QA 2Z9JA 2JH0D 4FUCA 4ZH8A 2SGFE 2OC0A 5DG6A 4WXVA 1AUJA 3ZZDA 1SFQB 3RXTA 3L6PA 4ZHLU 2ANYA 1O33A 3ZZCA 1XXDA 2GCHF 5SGAE 5J4QA 4WVPE 1A0LA 1MTUA 1C1WH 2SGDE 4GPGA 2ZKSA 1QL9A 1VJAU 2O8UA 1G2MA 1HLTH 2VNTA 1P09A 3RXLA 1T8MA 3UREA 3FFGA 1EAIA 4X8VH 1CT2E 4Q7YA 5BRRE 4GUXA 1AVXA 1TPSA 3P8OA 3SUDA 1GG6C 2V6NA 1DM4B 3GCHB 4HGCA 2PSYA 3FAOA 4B73A 1FY1A 1TFXA 2VU8E 5EPYA 1G3BA 1GJCB 2R0KA 3SI3H 1HAOH 1C1NA 1SGPE 2FOGA 2CF9H 1K1NA 3P17H 2P95A 3MU8A 1ELCA 1F0TA 1HDTH 1V2JT 2ZPSA 3M3VA 1PPHE 3ZZ6A 2UWPA 4Y10E 1XM1A 2Q1JA 4K3JA 3BTGE 1M9UA 1AUTC 1C1RA 5T3HA 2VH0A 3ITIA 4KELA 3SGAE 4YO9A 4ABJA 1HGTH 1JXPA 1ZYOA 1K21H 3SOSA 1GL1A 5JPMH 4TWWA 3L33A 2R3YA 4CRDA 4CRFA 1V2PT 3QO6A 2PKAA 5EU8A 3LGTA 1UTNA 3RXOA 3UOUA 2OC7A 3QDZB 1QRWA 1G3CA 3HATH 3BN9A 2FODA 1UTOA 2OCVB 5HMAA 1KLJH 4E05H 3SU3A 3D62A 4X1RU 4TYDA 1V2ST 2A4GA 2GCHG 4FUHA 1NZQH 3WY8A 1Y3UA 2ZG0H 2DE9A 3T62A 5HYOA 5EOKA 1GJBB 3HGPA 3ZZ7A 1BIOA 3V3MA 1GHXH 5DP8A 4FVDA 3PTNA 2ZDLA 2R3UA 1JIRA 3UR6A 3GOVB 2FESH 4XOJA 4AGJA 2ZDVH 2W7SA 1BTXA 1B0EA 3SV9A 3CS0A 1FUJA 3SQEE 3F1SB 1C5LH 1QNJA 3Q3YA 3FZDA 3RP2A 2ULLA 1BMNH 3UUZA 1A5HA 4CRGA 2BZ6H 4IW4E 4H6SB 1L4ZA 2V3OH 5LPFA 2XRCA 2BDAA 2QXGA 4LK4A 6LPRA 1BA8B 3ELAH 3A88A 2F91A 1Q3XA 1QBOA 4MPUA 1F0UA 3BEFB 1FJSA 3FP8E 1ZGIA 1WTHD 5C1XA 1EASA 1IQGA 4OS6A 5L2YH 4NCYA 4ABHA 4ISIH 1LCYA 4JZFH 3RXJA 1OWHA 3E8LA 7ESTE 3BIUH 1GI7B 1ELTA 2D1JA 2AGGX 2ZFTA 1ELGA 4YESB 2J4IA 3LGVA 2STBE 3OY6U 1IQNA 2ZDKA 3RXUA 1P2QA 3URCA 3NWUA 3PYHA 2EC9H 1OWIA 1LPZB 4Q7ZA 1W0ZU 3G01A 2ILNA 1O31A 4H4FA 1O2JA 4ZKRU 1Y8TA 4WXIA 4AN7A 1C4U2 1ZRBA 2STAE 1AU8A 3PB1E 1ABIH 4ZKSU 1ARBA 2I6SA 1ELVA 3JZ1B 3LC5A 4J2YB 4XFQA 3N7OA 4IBLH 2GV6A 1DANH 2UUYA 2ODPA 1EJMA 2FTLE 4AGKA 3E1XB 1TX6A 1P9UA 4Y7BA 3UNRA 1MAYA 2ZDMA 1ZTJA 2ZFQH 1LDTT 4B1TA 1KDQB 1OXGA 2WPHS 2WUBA 3F9FA 1MZAA 1VCWA 1TGCA 5J4SA 3NZIA 3TK5A 2VWMA 1QQUA 3RMOH 1MTVA 3SJ8A 4ABIA 3TPIZ 3QK1A 1H9HE 1DPOA 2CF8H 3P70B 1BMLA 1GI9B 1TNIA 2OBOA 3SJKA 4CBNA 1FIZA 3RXVA 1EJAA 1C1TA 3UY9A 4MNWA 2GT7A 2AFQB 2GTBA 1BBRH 1UCYH 1C2LA 2VH6A 3O8RA 4AYYB 1TYNA 7KMEH 2O8TA 1RTLA 1AGJA 4YOJA 1Y3YA 1GBHA 1GJ4H 1NO9H 2HNTC 2WPIS 2Z9LA 1ZTLA 1EPTA 3ZZBA 1SGCA 3EDXB 1UVPA 4FVBA 3KIDU 4NSYA 1FN8A 3A82A 1AY6H 1P2OA 1BZXE 1PYTD 3LIWA 4OS1A 1IQLA 3RMLH 4GHTA 3K6YA 2FP7B 2WV5A 1SMFE 3Q76A 1MCVA 1VJ9U 2AIQA 1NTPA 3GCOA 4KTCA 1P03A 2Z9GA 4BTUB 3GYMA 1O3AA 3DT0H 1G36A 1P8VC 2SGAA 1HAZB 2AMQA 2B7DH 2QA9E 1YPHE 3V13A 4JYUH 1O3GA 3C27B 2ZA5A 1Y5BT 1EZUC 4LXBH 3S7HB 5T6FA 5C1YA 4AB8A 1MD8A 2VIDA 2ZHEH 3PWBA 1QL7A 3A7XA 5EODA 1UCYK 1L4DA 2GDDA 2SFAA 4A1TA 3OTJE 2FPZA 1SLXB 1XMNB 1A61H 4TY7A 1BB0B 2UUKB 2GCTB 3SQHE 1QCPA 1W3CA 4ABBA 3RXBA 1O3PB 1BBRE 1Y59T 3ZVFA 1HRTH 4BXSA 3MU1A 4JZEH 1K1JA 2TRMA 4A1VA 2RA3A 1DWEH 1GDQA 1QB9A 1UVUH 3GY2A 1DFPA 2A2XH 3VGCB 2ZU5A 1HJ8A 1O0DH 3VB6A 1P05A 3M36A 1YPKH 1E0FD 1TLDA 4DIIH 3A84A 4CH8B 1QJ1B 2BQWB 2WPMS 4UD9H 3HGNA 1O3HA 4AZ2B 2CN0H 2HOBA 1TNKA 1BTUA 1DUEA 3QX5H 1GJDB 1MU8B 4X1PU 1EB1H 4IMZA 2F9VA 3LH1A 2P8OB 1D3TB 4R0IA 2ZGHA 1ZR0A 7GCHF 3BTQE 5H4IB 2VIVA 5F8ZA 3ZVBA 1TA6A 1U6QA 3S69A 1O2TA 2P3UB 4M7GA 2J2UA 3KQBA 5GDSH 2F3CE 1SQAA 2VIPA 1NS3A 5FXLA 2XWAA 1GJ6A 1C1UH 3SNEA 1QBNA 2BTCE 2FS8A 2Y81A 3RU4E 1PQ8A 4MNYA 1TOMH 4JZ1A 1GBMA 1TBZH 4UFFH 4DURA 2BX3A 1TNLA 1GBTA 1ESTA 5K7RA 1JBUH 1O3OA 1YGCH 3UR9A 1A3BH 3ZZ9A 1TX7A 1LVYA 2B8OH 3JZ2B 3IG6B 4NIXA 4AX9H 2ZGXH 2BD8A 2AERH 1ZOMA 4WMDA 4Q2KA 1FI8A 1T7CA 2FOBA 3A8DA 3SUGA 1JMOH 4INHA 1IQIA 2P3FH 3SNCA 3ZVGA 1OSSA 4ZKOU 2W3IA 4XE4A 3MU5A 1W10U 1IHTH 4Y7AA 5FPSA 1ZPZA 1ABJH 4Y79A 2ASUB 3AASA 4Y0ZE 1ANCA 3SGBE 1EAUA 3MNXA 2EI7A 1XUFA 2VINA 4DGJA 2ZF0H 3SGQE 1C5SA 2BLOA 1O34A 1O36A 2XBWA 5A0AE 1ANBA 1TMBH 1RRKA 3SHCH 3R0FA 4VGCB 7GCHG 1AD8H 5A8YA 1AB9B 1YKTA 3S9CA 2GCTC 1SG8B 3Q00A 1QURH 2BMGB 2OC1A 1NFXA 3OSYA 4BAMB 2IOTA 3U69H 1HPGA 1F7ZA 4B2AA 5EQRA 2FZZA 2ZTXA 1GI8B 5HXFA 3B9FH 3RXRA 2H2ZA 2PUXB 1BHXF 4GVUA 5A09A 1HAVB 3TIUA 1YCPH 3SV7A 1QHRB 3UIRA 1OP8A 1SGFA 5C3NA 2VWOA 4X8UH 4D8NA 3B8JA 1OKXA 4MPVA 1OYQA 3GISB 4U32A 1MBMA 3P95A 2WINI 3ZZ3A 1NFUA 2IPHA 1SGTA 1K22H 2C90B 2P8OC 1O2NA 3H5CB 1QQ4A 1LVBA 5AFYH 1C5MD 1FY4A 9LPRA 2UWOA 1O2PA 1KDQA 1PPEE 2QIQA 1C9TA 4Z0KA 4J1YA 2BY6X 5GIBA 3LU9B 1HXEH 1G3EA 1TE0A 3AW1A 4UFDH 3BEIB 1UTLM 1PJPA 1P2NA 2HRVA 1ZTKA 1O2XA 4U30A 4BTTB 3VXEH 1LHGH 1MKXK 2PGBB 3I77A 5E2OA 2NU1E 1TGNA 1GG6B 3UQOA 2WPJS 1ETSH 1DWCH 1F5KU 3A7VA 1C1VH 2ZPRA 1P3CA 1YCPK 4D9QA 1CA0B 3F9EA 4NZLA 1GGDB 3PV4A 1SGFG 1AVWA 1D3DB 2J92A 2WYJA 1SGDE 1C5YB 4GSOA 1A0JA 2FOAA 2FO9A 3SU2A 3BTWE 1Z8RA 3ZVDA 1F0RA 2ZCLP 1G37A 4KTSA 1C5NH 3H7OA 1BTHH 1C2HA 2LNCA 3A81A 3A7ZA 1GHAF 4ZHMU 3TJUA 3TNSA 1AMHA 1S0RA 1RS0A 1VCQA 1C4Y2 2B5TB 2FI3E 2AEIH 4XDEA 2BVSH 1CT4E 3SN8A 1UTPA 2J9NA 4X2XA 1V2RT 4NZQA 1D3QB 1THPB 4VGCC 3VXFH 1ETTH 3PTBA 1O38A 1AB9C 3SV2H 2H9TH 2QCYA 2Q6FA 4ZHAA 3UOPA 1C1MA 1MUEB 4B74A 1DDJA 1MQ6A 3MWIU 1O5FH 1VITF 3RDZA 3DD2H 1L0ZA 2QV1A 3T5FH 3F9HA 3GY6A 4YOIA 2FDAA 2ZFRH 1QA0A 2O8LA 2ZFSA 3UWJH 1F92A 2ZU3A 3DA9B 2EI8A 1EZQA 3M3TA 1O5BB 2J95A 4NIVA 3RXHA 3EA8A 1DVAH 1JOUB 3UNSA 1SI5H 2F9PA 1JWTA 2VIWA 4I8HA 5A0CA 2OD3B 3PMHB 4CBOA 1F5LA 2YOLA 1AKSA 1HAHH 3BTEE 5I46H 1X7AC 3BEUA 1LQEA 1WU1A 1GJ8B 2XCFA 4OGYA 2UUFB 3ZZ4A 3ZYDA 3RXFA 1A0HB 1VITH 1AQ7A 1OOKB 3OU0A 1C5ZB 2HPPH 1WTGH 3GY3A 4X6OA 4DOQA 1H8DH 1KLTA 2NU3E 1GHAG 3F68H 1C5VA 1PQAA 3E6PH 1T4UH 3KF2A 2GD4B 1MMJN 2W5EA 1CO7E 1QGFA 1OWEA 4Y6DA 4LZ4B 5A8ZA 1K1IA 1W8BH 1GPZA 2H1UA 3UTUH 1XXFA 1MH0A 1V2QT 2BD3A 3DUXH 2A45B 1CA0C 4X1NU 3M35A 3T28A 3EA9A 1GGDC 4UONA 1NU9A 1GBJA 1SGQE 2Z3EA 2VIQA 3BTKE 1P01A 2BB4A 3EQ0H 3ZZ8A 1TPAE 5EW2H 1O37A 3M7TA 3NPSA 2AYWA 4CR5A 1ZZZA 2F9UA 4YT6H 1VITG 1SQTA 1GVLA 3D23A 1NROH 2GGVB 1YPHC 3BIVH 5T6GA 1V2VT 1LPGB 2ZHWH 6CHAB 3Q3KA 2ODQA 1C2MA 1UK4A 9ESTA 5HM9A 1P2JA 2OC8A 5FPYA 3RUOA 1D4PB 1YPJH 1O30A 1GI6A 1P3EA 1FAXA 3MU0A 1O2GH 1DE7H 1GMHF 1F2SE 3LC3A 1LHEH 1DS2E 4FUBA 4Q7XA 1RGQA 1CT0E 1SLWB 3AW0A 3SNDA 3V12A 1FDPA 4Q80A 1SGNE 2FOHA 1A3EH 1O5DH 1RTFB 1HV7A 5JB8S 2ODYB 5GWZA 5JBCS 3BTHE 2XW9A 3MO9A 2Y5FA 3S9AA 1XUGA 3STJA 1O3DA 4I8KA 2XBYA 5DKMA 4MQAA 1V6DA 2CXVA 3MTYA 4INKA 3W95A 1TX8A 1ZHPA 2TGPZ 1UVTH 1SGEE 1ANDA 1S82A 4UFGH 5TCAA 2BD4A 3TJVA 5DGJA 2XNIA 3SI4H 1KXBA 1OWJA 3BTFE 2EI6A 3E3TA 5FBIA 3RMMH 2ZDAH 2QF0A 1BRUP 2G00A 1P9SA 1TQ7B 3MMGA 2J38A 1K9OE 1YBWA 2ANKH 1DX5M 1GCTC 3FVFB 3D49H 2C8WB 4FUFA 1PQ7A 5TCCA 1Z6JH 2QY0B 1O3EA 4K1TA 3SU4A 3E91A 4FUEA 1B7XB 1GI3A 1OWDA 2AIPA 1E36B 2SGPE 3RC5A 3T25A 1HBTH 3ATIA 2KAIB 3T2NA 4NA9H 3RMNH 3SZNA 3U8TH 2A4QA 3PWCA 3RXDA 3A8AA 1QRZA 1GMHG 2BDBA 3Q77A 4AFZA 2C93B 4BAOB 4XSKU 2BYAX 4X2YA 1P04A 5F03A 2BY9X 3SBKA 1BRBE 2RA0A 4CREA 1NU7B 1WYKA 3NCLA 1IQFA 2BDYA 1L1JA 2FS9A 3LKWA 3RXMA 3SU0A 3I29A 1O3FA 3KHVA 3UQVA 2PTNA 1TPOA 3O8DA 3U8RH 1NY22 2VVCA 3VB4A 1O2IA 2ZPQA 2XWBI 3LONA 3ZYEA 4I33A 4NWLA 6CHAC 1W7GH 4JZIA 1XKAC 1NRSH 2FYQA 5C67A 1EXFA 3LJOA 4KKDA 3VPKA 1GHZA 1AE5A 1DLEA 1SOTA 3T26A 4ISOA 3A86A 3U1JB 1SVPA 1YLCA 4D76A 1C1SA 2BZAA 2C4FH 2Y7ZA 1NPMA 1PPFE 3HKIB 1TONA 2Z9KA 4KTUA 3ESTA 3RC4A 2G81E 1QY6A 1NRPH 4CH2B 1EP5A 1K1OA 1UTJA 1D3PB 1AO5A 5LGOA 2A5IA 2CMYA 3IWMA 3TJNA 4NA7A 1EUFA 3MNSA 1PPZA 2QYIA 2BXTH 1ELAA 3KNXA 1O2HA 2WPLS 4NFEA 2A0QB 3FANA 3M61U 2DE8A 1TNGA 1W0YH 4IC6A 4IN2A 3A85A 4TWYA 3ZVAA 1L2EA 2ZC9H 4YT7H 4OGXA 4X8SH 4NGAH 1Q31A 1DT2A 5GJ4B 2A4RA 1SC8U 1T8NA 5JBBS 2FOFA 1V2WT 1F5RA 1BTWA 2OTVA 1YC0A 1BTYA 1AWHB 1D6WA 3LGIA 3ATMA 3HPTB 5I25A 1NFWA 2WPKS 4ZROA 4NA8A 4JK5A 4B75A 3KQEA 4UDWH 1GHVH 1CGJE 3LDXH 2GMTB 5E0HA 3M3SA 1GBBA 1GHBG 4TPYA 4THNH 1BRCE 1ZPCA 1ELBA 5FBEA 1C5UA 1SHHB 2PLXA 1KXFA 2BD5A 2Q6DA 1CE5A 2W3KA 1G3DA 4UEHH 3GCTG 1HCGA 2PTCE 2A7JA 3OX7U 1ZLRA 3UPEA 1UCYE 1H9LB 1C2GA 1DWDH 2ZFPH 2VVUA 1TGBA 1XVOA 4HI3A 1YF4A 2J34A 4WF8A 2PV9B 2AGEX 2C3SA 3RC6A 1DSUA 4FU9A 3QN7A 4WMFA 1CHGA 1O2UA 1MU6B 3VFEA 4BNRA 1TB6H 1HFDA 3BV9B 1KSNA 3M5LA 3S7KB 3EGKH 1O32A 1GI2A 3S9BA 2ZQ1A 2HWLB 1AZZA 2OBQA 2ZCHP 3OYPA 2ZHFH 3SNAA 1HIAB 1TGTA 4A5TS 4Z6AH 1K2I1 4BAHB 1Y3VA 2HNTF 3M7QA 4FU7A 2XC0A 1GBAA 1W7XH 1A5GH 2GZ7A 1RFNA 1UVSH 1KXDA 1CQQA 4AB9A 1N8OC 1SFIA 2XCNA 3TGJE 4A7IB 1J16A 4A92A 2A7CA 1TNJA 2R2MB 1WOFA 1LKAA 4D9RA 2ALPA 3C1KA 2BDIA 4K1EA 1O3LA 1Z7KA 3ENSB 1OPHB 3O8CA 1LVMA 4IGDA 2R2WU 5IDKA 2VIOA 5CMXH 2GX4A 1KXEA 1WSSH 2PHBA 3SV6A 2ZGCA 2P94A 1IQJA 2AGIX 1QIXB 1DUAA 1N6XA 1BRAA 4GHQA 1A4WH 3BG4B 2G5VA 4A1XA 2GMTC 2ZWLH 3PMAB 1K1MA 2F9BH 1CBWB 1NESE 4BAQB 4ISNA 1BUIA 4KGAA 3ODFA 1SHYA 3BG8A 6GCHG 1UHBB 3RXAA 1NN6A 1AVGH 1O3CA 1Y3WA 1AN1E 4JMYA 6ESTA 1B5GH 5LH8A 1ANEA 3NK8A 1UTMA 2GVFA 2ZTYA 2JH5D 4FUIA 2M5TA 2EEKA 1KXCA 1S5SA 3TJOA 1P06A 1P02A 2ESTE 5CHAB 1GI5A 4IN1A 4ZUHA 3GYLB 3KN2A 1SPJA 2W26A 1O2KA 2P59A 5JBAS 3PROA 1T4VH 4AYVB 4ABAA 1MKXH 3A80A 1SOZA 4RKOB 1HUTH 3SU5A 2EA3A 1G30B 3MH6A 2OUAA 4AFQA 1FPCH 3SJ9A 1SR5C 3SUFA 1TRMA 3SO3A 1XX9A 3LPRA 1RXPA 1EAXA 4Y0YE 3RXKA 1YYY1 3GDUA 1INCA 1AE8H 1SQOA 2R9PA 2GT8A 3SNBA 2BOKA 4Y8YA 2H6MA 2YNBA 1Z8IB 1V2TT 1ZSLA 1V2NT 1MTWA 1O5EH 4I8GA 1O3MA 2ZHQH 1S83A 2K1QA 3EYDA 2RCEA 5BPEA 4E7RG 4MG3A 4UFEH 3RXGA 4YTAA 1XKBC 1HB0B 2FOEA 2HLCA 2ZGBH 2ZQ2A 2FOMB 2TGTA 1Y5UT 5EGMA 4QT8C 1Q2WA 3A7YA 2G4TA 1ELDE 1TWXB 1IQMA 3DFLA 2UWLA 2BD9A 4WJG2 1HXFH 1IAUA 2ANMH 2G52A 4K2YA 1G2LA 2C8ZB 1C5XB 1GBEA 1SB1H 3NKKA 3T29A 4B76A 1W13U 3TNTA 3M37A 1HJ9A 1GI0A 1S84A 2H5CA 2PFEA 1GJAB 1NRNH 1QB1A 4OS5A 5GCHF 2G55A 1TRNA 1HAGE 3MU4A 1UTQA 2A7HA 4Y11E 5EG4A 2VWLA 3S0NA 1C4V2 1S6HA 3SJIA 2AS9A 1UTKA 1CA8B 1RJXB 2JKHA 3ATKA 2TIOA 5L2ZH 1ID5H 1C5OH 1V3XA 3E0NB 2SGEE 8ESTE 1BTZA 3BG4C 4K8YA 1O2LA 3TVJB 3TU7H 3A8CA 1CBWC 2ZHDA 2Y7XA 1V2OT 1TGSZ 2H5DA 2ZGJA 3TGKE 3RXQA 1A46H 1VCPA 2BX4A 1SGYE 1WAYB 2QXHA 3GY5A 1TAWA 1HAPH 4I31A 1TOCB 3URDA 1UK2A 2NWNA 1SBWA 2FM2A 3V0XA 3K9XB 1J8AA 4MPWA 1EJNA 4INLA 1FY3A 1EX3A 1O3BA 1O2SA 5CHAC 5EPNA 2BLWA 2QXIA 1LHDH 2PSXA 1V2LT 3K65B 1EZSC 1C2DA 1P2KA 1O2OA 3M5NA 2SGQE 1DICA 4O3TA 4RSPA 2Q6GA 5T6DA 3TK6A 1MZDA 5DP6A 2ZI2H 3A7TA 3QGNB 3RXIA 1Z6EA 3P8GA 2V3HH 4MNVA 1QR3E 2QF3A 1IOEA 1DXPA 3TH2H 1GDNA 1RTKA 2FI4E 4X6MA 2ZECA 1DXWA 1SSXA 5TJXA 2BDGA 1ZMJA 2BLVA 4FXGH 1GBIA 2HVXA 3MOCA 2XXLA 5GCHG 4FUGA 2HGTH 1FZZA 5DK1A 1GBLA 4X2VA 1FQ3A 4YOGA 1CGIE 1GCTB 4ISHH 3BSQA 5GXPA 1YM0A 2VVVA 3GY4A 1GI4A 1H4WA 1TBQH 1SGRE 4UE7H 5E2PA 3MHWU 1O35A 4OS2A 1PPGE 1Y5AT 4K60A 2XBVA 3U8OH 4X6NA 2O9QA 3TLOA 4JZDH 4CHAB 5ABWA 4E7NA 5EXLA 5K0HA 1P0SH 1GMCF 3GCNA 1NM6A 5FCKA 4MVNA 1C2FA 2FWWA 1PPCE 5DJ7A 1GVZA 4HZHA 1AWFH 1LQDB 2FYRA 2UUJB 2ZO3H 5G4BA 5AF9H 1YCPM 4O03A 1AHTH 1RIWB 1FMGA 2Y82A 3ZZ5A 3E0PB 1TPPA 2BLQA 1AFQB 1KXAA 1BITA 3U98H 2BVRH 1PYTC 4DY7B 1HAXB 4AOQA 2QC2A 2A5AA 3ZVEA 1C1PA 1C5WB 2AMPA 4Y8XA 2O8WA 1O2ZA 1J15A 3PM3A 3SU1A 1KTTB 5EQSA 1UJ1A 3QUMP 3A87A 3GY8A 4WWYA 1EATA 1ZJKA 1ACBE 4I32A 5E0GA 1UVOA 4H6TA 1HJAC 4O3UA 3SV8A 3PLPA 2PW8H 1BOQA 4JYTA 5DP4A 1UHBA 4I8LA 4JYVH 3DHKH 4IMQA 2A4OA 2ZEBA 4ZMAH 3I78A 1TBRH 1ZGVA 2SNVA 3ATLA 2ZNKH 2G8TA 4D7FA 2RDLA 1QJ7B 1LHCH 3ATWA 1F0SA 1QA7A 4I8JA 1GDUA 1ZHMA 3H7TA 2IJOB 5HGGA 1N1LA 4U2WA 2GV7A 1T8LA 4DW2U 4F49A 2F83A 1TALA 2JETB 1DY9A 1LO6A 3M5OA 3LJJA 1EAWA 4CRCA 1C2JA 3B23B 1ZMLA 1GMCG 1HAVA 2FEQH 3IITA 1ZJDA 1EPTC 2FIRH 2GZ9A 2A2QH 4HFPB 2RG3A 1XUKA 2WYGA 1B0FA 1BJUA 2BOHB 4TPIZ 1W12U 2G4UA 1FAKH 3TK9A 1EOJA 3PLKA 3SORA 1CGHA 2VJ1A 4E06H 1E37B 3RLWH 1JRTA 4BOHA 1ARCA 2A31A 3BF6H 2ZZUH 1L1NA 1YP9A 3QZRA 1UK3A 3AAUA 3MH7A 1C5QA 2ALVA 5AFZH 1PPBH 3E90B 1E34B 3T27A 2A32A 5C20A 1Z71A 5PTPA 4CHAC 4Y76A 1KY9A 4ESTE 3K2UA 5A0BA 4GCHF 2CGAA 2OQ5A 2THFB 7LPRA 3CP7A 3PMBB 1FIWA 4FUDA 1QL8A 3MNCA 2XYAA 3U1IB 1GBCA 2ZDNA 3VEQB 3EA7A 1KLIH 1W11U 5JDUB 4AFUA 3RXPA 2Z3CA 1YPEH 1RIWC 4R8TB 1WQSA 1SLUB 1AFQC 1XUHA 2D8WA 3SU6A 2R0LA 1SLVB 1T31A 2NU0E 2Y5GA 3LGWA 1OP2A 3Q3XA 3TH3H 3LH3A 2BY8X 4H42U 1ZSJA 3KQCA 5FHTA 1GHWH 4YLUA 1BTPA 3GCHC 1ELEE 4HTCH 1Y3XA 1DY8A 2BHGA 2V35A 1GHBF 2FMJA 3VB5A 1P2IA 5LPEA 3RXCA 4AG1A 1LMWB 1BDAA 5JB9S 2V0BA 1O5AB 3TITA 1QRXA 4CRBA 2XTTB 1A5IA 5DPAA 1FV9A 2FX6A 1VGCB 2BQ6B 3GCTF 1EZXC 4DJZB 2PWXA 1EKBB 3ZV8A 2GDEH 3P8FA 3QGJA 1G9IE 1BHXB 2GZ8A 2ZCKP 1P57B 2C8YB 1LVOA 1TQ0B 1BJVA 1GJ7B 4DG4A 1MAXA 1TIOA 2Y80A 2J94A 1EOLA 1N8OB 5B6OA 1O3JA 2ZU1A 1E38B 1O3KA 1ELFA 2JETC 2FX4A 3GDVA 4GCHG 3SUEA 1GBDA 2BQ7B 3M7UA 1T8OA 3P6ZB 4BANB 5CE1A 3HKJB 5C2ZA 3UFAA 1Z8JB 4JCNA 1A2CH 3MNBA 1Z1JA 1KTSB 4K1SA 3RU4T 2B0FA 4NG9H 1DWBH 3K6ZA 1HAIH 1XUIA 1VR1H 1C5TA 3W94A 2TGDA 2QN5T 1O2RA 5ESTE 1OS8A 1AFEH 1GMDF 3KGPA 4AG2A 4ZXYH 1V2MT 2AH4X 2Y6TA 2OXSA 2BDCA 5JYIA 1MTNB 1BT7A 2G51A 4O9VA 3A89A 1FNIA 2VB0A 1XUJA 4K5ZA 3RXEA 1RD3B 1C5RA 3SW2B 3RM2H 4ZXXH 1DLKB 5L30H 5DO4H 3GY7A 3QTVH 3NXPA 1ESAA 4SGAE 5EQQA 2CHAB 4K8BA 3MFJA 1MTSA 1TMTH 3QWCH 1BBRK 2BVXH 4OS4A 1Z1IA 3LGUA 3TH4H 3BTTE 4IC5A 1H9IE 3MH4A 1ESBA 3EAJA 2F9NA 4ABDA 4YM9A 1J9CH 3OY5U 1QFKH 2O8MA 3E16B 4Y8ZA 6GCHF 2VGCB 2ZP0H 1IQHA 1D9IA 1ETRH 2FLRH 1ZSKA 1DITH 2SNWA 1DSTA 1GI1A 1PFXC 1E35B 1K28D 1VGCC 8LPRA 1WCZA 1CU1A 5FX5A 1T32A 4WH6A 5A8XA 2H9HA 1A1RA 1HAYB 5C5NA 3ZZAA 1FXYA 4ZAEA 4AFSA 3RXSA 1AKSB 4B2BA 4OS7A 3KL6A 1CHOF 2P93A 1WV7H 4ASHA 4ABEA 2H9EH 2Z3DA 4Y71A 1GMDG 2HALA 2BY5X 3PO1B 5F6MA 1TMUH 3STIA 2JH6D 3RU4D 1OP0A 4XBBA 3MO6A 4WH8A 1GCDA 3AVZA 1GVKB 1HYLA 3KEEA 5IYTA 1S0QA 4ZKNU 3A83A 1IQEA 1H1BA 1O3IA 8GCHF 1TABE 2D26C 1P10A 1BMMH 2Z9IA 4PROA 1ZPBA 4SGBE 2Y5HA 1DOJA 1NC6A 1ZHRA 2P3TB 1D6RA 1MKWH 3UNQA 1O3NA 2Z94A 3FZZA 4NIYA 2FOCA 4NSVA 3UWIA 4DVAU 1OWKA 1BCUH 2D2DA 4NWKA 2PKSB 4X1QU 3GICB 3TGIE 4XBDA 5A2MH 2TGAA 1NT1A 1JIMA 3NUMA 5ETXA 1K1LA 3PMJA 5F8TA 1UO6A 1QBVH 1FY5A 4U01A 1O2MA 3M5MA 4YLQH 4DIHH 1ORFA 1BMAA 4ABGA 1C2IA 3LT3A 4CR9A 1MTNC 2PUQH 1C2KA 1O2VA 4YZUA 3QTOH 1BQYA 4X6PA 3HK6B 1WBGB 2PKAB 2QGRA 3KCGH 2KAIA 5EXMA 1AI8H 1P2MA 1MBQA 3MO3A 4TY6A 5DP7A 4BTIB 3BTDE 5HM2A 5FCRA 2CHAC 4WY3A 3EE0B 1QTFA 3BTME 1TRYA 1TA2A 2HPQH 2LPRA 1K1PA 1CHOG 1N6YA 1NFYA 3R3GB 3RLYH 4X1SU 3V7TA 4NFFA 1O2YA 2P16A 2BY7X 2PR3A 4X2WA 1MKWK 1GJ9B 1V2KT 2VGCC 3CS7A 2BD2A 3P8NA 4O97A 5EW1H 4RN6A 3FP7E 4MTBA 5FAHA 3F9GA 1ZRKA 2ZU4A 1Z8GA 1C5PA 3SJOA 1P12E 2NU2E 4LZ1H 1FLEE 2QAAA 2CJIA 3O8BA 8GCHG 1AIXH 2HNTE 3VGCC 1WUNH 2ZU2A 2ZTZA 4X0WU 1PQ5A 5DP9A 1C9PA 4A6LA 1YPMH 4B71A 1V2UT 1NRRH 2Z6BD 1MCTA 2C8XB 2BDHA 5DP3A 5EXNA 3P92A 1YPGH 4GLYA 1ZMNA 4DT7B 2CV3A 1KYNA 1SL3A 2PGQB 3AAVA 4ABFA 5ESBA 2F9OA 1O2WA 1S85A 4LOYH 2TPIZ 2OP9A 1GL0E 5AVDA 3D65E 3PO1C 2OQUA 4WMEA 4MPXA 5C5OA 3ZVCA 1KIGH 2Z7FE 5GPIB 2ZFFH 1S6FA 4DCDA 1CSOE 3MI4A 1MD7A 1O5GH 3LGYA 1GBKA 1OYTH 1YLDA 2WUCA 2G5NA 3GDSA 5AHGH 2OLGA 1SGIB 4MDSA 2BXUH 5JBTA 1NRQH 1C2EA 2FTMA 1A7SA 3DFJA 4MNXA 3ZV9A 1FY8E 2ANWA 4JK6A 2A5KA 1THSH 3KQDA 1H8IH 4I7YH 4BXWA 1G32B 8KME2 1GWAA 3FP6E 3MH5A 1THRH 4RKJB 2XC5A 1QJ6B 4GAWA 2PKSC 1MQ5A 3HK3B 1J17T 3A7WA 4BAKB 1LKBA 4F4OC 1J14A 1O5CB 4XBCA 1HJAB 1JRSA 5FPTA 1TNHA 1L1GA 2GKVE 1EB2A 2AMDA 4AORA 2BM2A 3QZQA 5DP5A 1C1OA 2TBSA 2WV4A 1XVMA 1EQ9A 5LPRA 4IS5A 5L6NH 4K69A 1LHFH 4MLFB 1S81A 3L3TA 1AZ8A 2I6QA 1WQVH 1P11E 2FI5E 5E8EH 2ZIQH 3LOXA 4ISLA 1W2KH 3CENA
chains in the Genus database with same CATH superfamily
5FX6A 2XBXA 1FPHH 3VB3A 1CVWH 1QB6A 1GHYH 1W14U 1IQKA 2FXRA 4B2CA 2NU4E 1FONA 2GP9B 4D7GA 1IHSH 3SHAH 2DUCA 1HNEE 4KP0A 2IN2A 2VWNA 1LTOA 2YNAA 2J5UA 1EPTB 2FLBH 4FUJA 2QXJA 1GBFA 5F8XA 2W7UA 1EP6A 1O39A 4FU8A 1GJ5H 3ODDA 4DT4A 5E0JA 3F6UH 1VZQH 3F3BA 4NIWA 3PLBA 3MYWA 5EJ1A 1NBME 5C1UA 2B9LA 1FN6A 2OINA 1UMAH 3FOAA 4CRAA 3QLPH 4X8TH 1HIAA 3VB7A 1YPLH 2GJGA 3U9AH 3A8BA 3RM0H 1C1QA 2BD7A 1LPKB 1OX1A 2A1DB 2XC4A 1O2QA 2Z9JA 2JH0D 4FUCA 4ZH8A 2SGFE 2OC0A 5DG6A 4WXVA 1AUJA 2WPDD 3ZZDA 1SFQB 3RXTA 3L6PA 4ZHLU 2ANYA 1O33A 3ZZCA 1XXDA 2GCHF 5SGAE 5J4QA 4WVPE 1A0LA 1MTUA 1C1WH 2J98A 2SGDE 4GPGA 2ZKSA 1QL9A 1VJAU 2O8UA 1G2MA 1HLTH 2VNTA 1P09A 3RXLA 1T8MA 3UREA 3FFGA 1EAIA 4X8VH 1CT2E 4Q7YA 5BRRE 4GUXA 1AVXA 1TPSA 2HLDD 3P8OA 3SUDA 1GG6C 2V6NA 1DM4B 3GCHB 4HGCA 2PSYA 3FAOA 4B73A 1FY1A 1TFXA 2VU8E 5EPYA 5FL7D 1G3BA 1GJCB 2R0KA 3SI3H 1HAOH 1C1NA 1SGPE 1VKYA 2FOGA 2CF9H 1K1NA 3P17H 4Q63A 2P95A 3MU8A 1ELCA 1F0TA 1HDTH 1V2JT 2ZPSA 3M3VA 1PPHE 3ZZ6A 2UWPA 4Y10E 1XM1A 2Q1JA 4Z1MD 4K3JA 3BTGE 1E1RD 1M9UA 1AUTC 1C1RA 5T3HA 3KQ5A 2VH0A 3ITIA 4KELA 3SGAE 4YO9A 4ABJA 1HGTH 1JXPA 1ZYOA 1K21H 3SOSA 1GL1A 5JPMH 4TWWA 3L33A 2R3YA 4CRDA 4CRFA 1V2PT 2F43B 3QO6A 2PKAA 5EU8A 3LGTA 1UTNA 3RXOA 3UOUA 2OC7A 3QDZB 1QRWA 1G3CA 3HATH 3BN9A 2FODA 1UTOA 2OCVB 5HMAA 1KLJH 4E05H 3SU3A 3D62A 4X1RU 4TYDA 1V2ST 2A4GA 2GCHG 4FUHA 1NZQH 3WY8A 1Y3UA 2ZG0H 2DE9A 3T62A 5HYOA 5EOKA 1GJBB 3HGPA 3ZZ7A 1BIOA 3V3MA 4FOUC 1GHXH 5DP8A 4FVDA 3PTNA 2ZDLA 2R3UA 1JIRA 3UR6A 3GOVB 2FESH 4XOJA 4AGJA 2ZDVH 2W7SA 1BTXA 1B0EA 3SV9A 5DSFA 2KX4A 3CS0A 4F55A 1FUJA 3SQEE 3F1SB 1C5LH 1QNJA 3Q3YA 3FZDA 3RP2A 2ULLA 1BMNH 3UUZA 1A5HA 4CRGA 2BZ6H 4IW4E 2EQNA 1L4ZA 4H6SB 2V3OH 5LPFA 2XRCA 2BDAA 2QXGA 4LK4A 6LPRA 1BA8B 3ELAH 3A88A 2F91A 1Q3XA 1QBOA 4MPUA 1F0UA 3BEFB 1FJSA 3FP8E 1ZGIA 1WTHD 5C1XA 1EASA 1IQGA 2KFWA 4OS6A 1YY3A 5L2YH 4NCYA 4ABHA 4ISIH 1LCYA 4JZFH 3RXJA 1OWHA 3E8LA 7ESTE 3BIUH 1GI7B 2L74A 1ELTA 2D1JA 2AGGX 2ZFTA 1ELGA 4YESB 2J4IA 3F0OA 3LGVA 2STBE 3OY6U 1IQNA 2ZDKA 3RXUA 1P2QA 3URCA 5EJZA 3NWUA 3PYHA 2EC9H 1OWIA 1LPZB 4Q7ZA 1W0ZU 3G01A 2ILNA 4ACBA 1O31A 4H4FA 1O2JA 4ZKRU 1Y8TA 4WXIA 5F53A 4AN7A 1C4U2 1ZRBA 2STAE 1AU8A 3PB1E 1ABIH 4ZKSU 1ARBA 2I6SA 1ELVA 3JZ1B 3WWFA 2LELA 3LC5A 4J2YB 4XFQA 3N7OA 4IBLH 2GV6A 1DANH 2UUYA 2ODPA 1EJMA 2FTLE 4AGKA 3DCLA 3SYJA 3E1XB 1TX6A 1P9UA 4Y7BA 3UNRA 1MAYA 2ZDMA 1ZTJA 2ZFQH 1LDTT 4B1TA 1KDQB 1OXGA 2WPHS 2WUBA 2YMSB 1MZAA 1VCWA 3F9FA 3N7DA 2K8IA 1TGCA 4ASUD 3NZIA 5J4SA 3TK5A 2VWMA 1QQUA 3RMOH 1MTVA 3SJ8A 4ABIA 3TPIZ 3QK1A 1H9HE 1DPOA 2CF8H 3P70B 1BMLA 1GI9B 1TNIA 2OBOA 3SJKA 4CBNA 1FIZA 3RXVA 1EJAA 1C1TA 1YLNA 4MNWA 3UY9A 1KMHB 2GT7A 2AFQB 2GTBA 1BBRH 1UCYH 1C2LA 2VH6A 3FN8A 4AYYB 5C0UA 3O8RA 1TYNA 2WV9A 7KMEH 2O8TA 1RTLA 1AGJA 4YOJA 1Y3YA 1GBHA 1GJ4H 1NO9H 2HNTC 2WPIS 2Z9LA 1ZTLA 1EPTA 3ZZBA 1SGCA 3EDXB 1UVPA 4FVBA 3KIDU 4NSYA 1FN8A 3A82A 1AY6H 1P2OA 1BZXE 1PYTD 3LIWA 4OS1A 1IQLA 3RMLH 4GHTA 3K6YA 2FP7B 2WV5A 1SMFE 3Q76A 1MCVA 1VJ9U 2AIQA 1NTPA 3GCOA 4KTCA 1P03A 2Z9GA 4BTUB 3GYMA 1O3AA 3DT0H 1G36A 1P8VC 2SGAA 1HAZB 2AMQA 2B7DH 2QA9E 1YPHE 3V13A 4JYUH 1O3GA 3C27B 2ZA5A 1Y5BT 1EZUC 4LXBH 3S7HB 5T6FA 5C1YA 4AB8A 1MD8A 2VIDA 2ZHEH 3PWBA 1QL7A 3A7XA 5EODA 1UCYK 4ACAA 1L4DA 2GDDA 2SFAA 3VG8A 4A1TA 3OTJE 2FPZA 5EIYA 1SLXB 1XMNB 1A61H 4TY7A 1BB0B 2UUKB 2GCTB 3SQHE 1QCPA 1W3CA 4ABBA 3RXBA 1O3PB 1BBRE 1Y59T 3ZVFA 1HRTH 4BXSA 3MU1A 4JZEH 1K1JA 2TRMA 4A1VA 2RA3A 1DWEH 1GDQA 1QB9A 1UVUH 1COWD 3GY2A 1DFPA 2A2XH 3VGCB 2ZU5A 3MQKC 1HJ8A 1O0DH 3VB6A 2OK5A 1P05A 3M36A 1YPKH 1E0FD 1TLDA 4DIIH 3A84A 4CH8B 1QJ1B 2BQWB 4Q4LA 2WPMS 4UD9H 3HGNA 1O3HA 4AZ2B 2CN0H 2HOBA 1TNKA 1BTUA 1DUEA 3QX5H 1GJDB 1MU8B 2KCOA 4X1PU 1EB1H 4IMZA 2F9VA 2F4LA 3LH1A 2P8OB 2YMSC 1D3TB 4R0IA 2ZGHA 1ZR0A 7GCHF 3BTQE 5H4IB 2VIVA 5F8ZA 3ZVBA 1TA6A 1U6QA 3S69A 1O2TA 2P3UB 4M7GA 2J2UA 3KQBA 5GDSH 2F3CE 1SQAA 4XD7D 2VIPA 1NS3A 5FXLA 2XWAA 1GJ6A 1C1UH 4XRNA 3SNEA 1QBNA 2BTCE 2FS8A 2Y81A 3RU4E 1PQ8A 4MNYA 3UAIC 1TOMH 4JZ1A 1GBMA 1TBZH 4UFFH 4DURA 2BX3A 1TNLA 1GBTA 1ESTA 5K7RA 1JBUH 1O3OA 3AK5A 1YGCH 3UR9A 1A3BH 3ZZ9A 2W6ID 1TX7A 1LVYA 2B8OH 2KCYA 3IG6B 3JZ2B 4NIXA 4AX9H 2ZGXH 2BD8A 2AERH 1ZOMA 4WMDA 4Q2KA 1FI8A 5CDFE 1T7CA 2FOBA 3A8DA 3OAAD 3SUGA 1JMOH 4INHA 1IQIA 2P3FH 3SNCA 3ZVGA 3ZIAD 1OSSA 4ZKOU 2W3IA 4XE4A 3MU5A 1W10U 1IHTH 4Y7AA 5FPSA 2CK3D 1ZPZA 1ABJH 4Y79A 2ASUB 3AASA 4Y0ZE 1ANCA 3SGBE 1EAUA 3MNXA 2EI7A 1XUFA 2VINA 4DGJA 2ZF0H 3SGQE 1C5SA 2BLOA 1O34A 1O36A 2XBWA 5A0AE 1ANBA 1TMBH 1RRKA 4RI0A 3SHCH 3R0FA 4VGCB 7GCHG 1AD8H 5A8YA 1AB9B 1YKTA 3S9CA 2GCTC 1SG8B 3Q00A 1QURH 2BMGB 2OC1A 1NFXA 3OSYA 4BAMB 2IOTA 3U69H 1HPGA 1F7ZA 4B2AA 5EQRA 2FZZA 2ZTXA 1GI8B 5HXFA 3B9FH 3RXRA 2H2ZA 2PUXB 1BHXF 4GVUA 5A09A 1HAVB 3TIUA 1YCPH 3SV7A 1QHRB 3UIRA 1OP8A 1SGFA 5C3NA 2VWOA 4X8UH 4D8NA 3B8JA 1OKXA 4MPVA 1OYQA 3GISB 4U32A 1MBMA 3P95A 2WINI 3ZZ3A 1NFUA 2IPHA 1SGTA 1K22H 2C90B 2P8OC 1O2NA 3H5CB 1QQ4A 1LVBA 5AFYH 1C5MD 1FY4A 9LPRA 2UWOA 1O2PA 1KDQA 1PPEE 2QIQA 1C9TA 4Z0KA 4J1YA 2BY6X 5GIBA 3LU9B 1HXEH 1G3EA 1TE0A 3AW1A 2QE7D 4UFDH 3BEIB 1UTLM 1PJPA 1P2NA 2HRVA 2V7QD 1ZTKA 1O2XA 4U30A 4BTTB 3VXEH 1LHGH 1MKXK 2PGBB 3I77A 5E2OA 2NU1E 1TGNA 1GG6B 3UQOA 2WPJS 1ETSH 1DWCH 1F5KU 3A7VA 1C1VH 2ZPRA 1P3CA 1YCPK 4D9QA 1CA0B 3F9EA 4NZLA 1GGDB 3PV4A 1SGFG 1AVWA 1D3DB 2J92A 2WYJA 1SGDE 1C5YB 4GSOA 1A0JA 2FOAA 2FO9A 3SU2A 3BTWE 1Z8RA 3ZVDA 1F0RA 2ZCLP 1G37A 4KTSA 1K0HA 1C5NH 3H7OA 1BTHH 1C2HA 2LNCA 3A81A 3A7ZA 1GHAF 4ZHMU 3TJUA 3TNSA 1AMHA 1S0RA 1RS0A 1VCQA 2KR7A 1C4Y2 2B5TB 2FI3E 2AEIH 4XDEA 1SQRA 2BVSH 1CT4E 3SN8A 1UTPA 2J9NA 4X2XA 1V2RT 4NZQA 1D3QB 1THPB 4VGCC 3VXFH 1ETTH 3PTBA 1O38A 1AB9C 3SV2H 2H9TH 2QCYA 2Q6FA 4ZHAA 5CHBA 3UOPA 1C1MA 1MUEB 2L6OA 4B74A 1DDJA 1MQ6A 3GS9A 3MWIU 1O5FH 1VITF 3RDZA 3DD2H 1L0ZA 2QV1A 4P02A 3T5FH 3F9HA 3GY6A 4YOIA 2FDAA 2ZFRH 1QA0A 2O8LA 2ZFSA 3UWJH 1F92A 2ZU3A 3DA9B 2EI8A 1EZQA 3M3TA 1O5BB 2J95A 4NIVA 3RXHA 3EA8A 1DVAH 1JOUB 3UNSA 1SI5H 2F9PA 1JWTA 3NRLA 2VIWA 4I8HA 5A0CA 2OD3B 3PMHB 4CBOA 1F5LA 2YOLA 1QZ8A 1AKSA 1HAHH 3BTEE 5I46H 1X7AC 3BEUA 1LQEA 1WU1A 1GJ8B 2XCFA 4OGYA 2UUFB 3ZZ4A 2KZ4A 3ZYDA 3RXFA 1A0HB 1VITH 1AQ7A 1OOKB 3OU0A 1C5ZB 2HPPH 1WTGH 3GY3A 4X6OA 4DOQA 1H8DH 1KLTA 2NU3E 1GHAG 3F68H 1C5VA 1PQAA 3E6PH 1T4UH 3KF2A 5KEDA 2GD4B 1MMJN 2W5EA 1CO7E 1QGFA 1OWEA 4Y6DA 4LZ4B 5A8ZA 1K1IA 1W8BH 1GPZA 2H1UA 3UTUH 1XXFA 2AHME 1MH0A 1V2QT 2BD3A 3DUXH 2A45B 1CA0C 4X1NU 3M35A 3T28A 3EA9A 1GGDC 4UONA 1NU9A 1GBJA 1SGQE 2Z3EA 2VIQA 3BTKE 1P01A 2BB4A 3EQ0H 3ZZ8A 1TPAE 5EW2H 1O37A 3M7TA 3NPSA 2AYWA 4CR5A 1ZZZA 2F9UA 4YT6H 1VITG 1SQTA 1GVLA 3D23A 1NROH 2GGVB 1YPHC 3BIVH 5T6GA 1V2VT 1LPGB 2ZHWH 6CHAB 3Q3KA 2ODQA 4RT0A 1C2MA 1UK4A 9ESTA 5HM9A 1P2JA 2OC8A 5FPYA 3RUOA 1D4PB 1E1QD 1YPJH 1S6LA 1O30A 1GI6A 1P3EA 1FAXA 3MU0A 1O2GH 1DE7H 1GMHF 1F2SE 3LC3A 1LHEH 1DS2E 4FUBA 4Q7XA 1RGQA 1CT0E 1SLWB 3AW0A 3SNDA 3V12A 1FDPA 4Q80A 1SGNE 2FOHA 1A3EH 1O5DH 1RTFB 1HV7A 5JB8S 2ODYB 5GWZA 5JBCS 3BTHE 2XW9A 3MO9A 2Y5FA 3S9AA 1XUGA 3STJA 1O3DA 4I8KA 2QF5A 2XBYA 5DKMA 4MQAA 1V6DA 2CXVA 3MTYA 4INKA 3W95A 1TX8A 1ZHPA 2TGPZ 1UVTH 1SGEE 1ANDA 1S82A 4UFGH 5TCAA 2BD4A 3TJVA 5DGJA 2XNIA 3SI4H 1KXBA 1OWJA 3BTFE 2EY4C 2EI6A 3E3TA 5FBIA 3RMMH 2WZQA 2ZDAH 2XNDD 2QF0A 1BRUP 2G00A 1P9SA 1TQ7B 3MMGA 2J38A 1K9OE 1YBWA 2ANKH 1DX5M 1GCTC 3FVFB 3D49H 2C8WB 4FUFA 1PQ7A 3WW7A 5TCCA 2IPQX 3H09A 1Z6JH 2QY0B 1O3EA 4K1TA 3SU4A 3E91A 4FUEA 1B7XB 1GI3A 1OWDA 2AIPA 1E36B 2SGPE 3RC5A 3T25A 3N7EA 1HBTH 3ATIA 2KAIB 3T2NA 4NA9H 3RMNH 3SZNA 3U8TH 2A4QA 3PWCA 3RXDA 3A8AA 1QRZA 1GMHG 2BDBA 3Q77A 4AFZA 2C93B 4BAOB 4XSKU 2BYAX 4X2YA 3WWBA 1P04A 5F03A 2BY9X 3SBKA 1BRBE 2RA0A 4CREA 1NU7B 1WYKA 3NCLA 1IQFA 2BDYA 1L1JA 2FS9A 3LKWA 3RXMA 3SU0A 3I29A 1O3FA 2XOKD 3KHVA 3UQVA 2PTNA 1TPOA 3O8DA 2IJD1 1WXRA 3U8RH 1NY22 2VVCA 3VB4A 1O2IA 2ZPQA 2XWBI 3LONA 3ZYEA 4I33A 4NWLA 6CHAC 1W7GH 3PV2A 4JZIA 1XKAC 1NRSH 2FYQA 5C67A 1EXFA 3LJOA 4KKDA 3VPKA 1GHZA 1AE5A 1DLEA 1SOTA 3T26A 4ISOA 3A86A 3U1JB 1SVPA 1YLCA 4D76A 1C1SA 2BZAA 2C4FH 2Y7ZA 1NPMA 1PPFE 3HKIB 1TONA 2Z9KA 4KTUA 3ESTA 3RC4A 2G81E 1QY6A 1NRPH 2LP6A 4CH2B 1EP5A 1K1OA 1UTJA 5GNDA 1D3PB 1AO5A 5LGOA 2A5IA 3KYFA 2CMYA 3IWMA 3TJNA 4NA7A 1EUFA 3MNSA 1PPZA 2QYIA 2BXTH 1ELAA 3KNXA 1O2HA 2WPLS 4NFEA 2A0QB 3FANA 3M61U 2DE8A 4FETA 1TNGA 1W0YH 4IC6A 4IN2A 3A85A 4TWYA 3ZVAA 1L2EA 2ZC9H 4YT7H 3PRBA 4OGXA 4X8SH 4NGAH 1Q31A 1DT2A 5GJ4B 2A4RA 1SC8U 1T8NA 5JBBS 2FOFA 1V2WT 1F5RA 1BTWA 2OTVA 1YC0A 1BTYA 1AWHB 1D6WA 3LGIA 3ATMA 3HPTB 5I25A 1NFWA 2WPKS 4ZROA 4OM9A 4NA8A 4JK5A 4B75A 3KQEA 4UDWH 1GHVH 3SZEA 1CGJE 3LDXH 2GMTB 5E0HA 3M3SA 1GBBA 1GHBG 4TPYA 4THNH 1WDIA 1BRCE 1ZPCA 1ELBA 5FBEA 1C5UA 1SHHB 2PLXA 1KXFA 2BD5A 2Q6DA 1CE5A 2W3KA 1G3DA 4UEHH 3GCTG 3OEED 3U28C 1HCGA 2PTCE 2A7JA 3OX7U 1ZLRA 3UPEA 1UCYE 3UB0A 1H9LB 1C2GA 5C17A 1DWDH 2ZFPH 2VVUA 1TGBA 1XVOA 4HI3A 1YF4A 2J34A 4WF8A 2PV9B 2AGEX 2C3SA 3RC6A 1DSUA 4FU9A 3QN7A 4WMFA 2RDEA 1CHGA 1O2UA 1MU6B 3VFEA 4BNRA 1TB6H 1HFDA 3BV9B 1KSNA 3M5LA 3S7KB 3EGKH 1O32A 1GI2A 3S9BA 2ZQ1A 4RT1A 4I86A 5HKKD 2HWLB 1AZZA 2OBQA 2ZCHP 3OYPA 2ZHFH 3SNAA 1HIAB 1TGTA 2K0QA 4A5TS 4Z6AH 1K2I1 4BAHB 1Y3VA 2HNTF 3M7QA 4FU7A 2XC0A 1GBAA 2W6JD 1W7XH 1A5GH 2GZ7A 1RFNA 1UVSH 1KXDA 2J98B 1CQQA 4AB9A 1N8OC 1SFIA 2HVYB 2XCNA 3TGJE 4A7IB 3PRDA 1J16A 4A92A 2A7CA 1TNJA 2R2MB 1WOFA 1LKAA 4D9RA 2ALPA 3C1KA 2BDIA 4K1EA 1O3LA 1Z7KA 3ENSB 1OPHB 3O8CA 1LVMA 4IGDA 2RFKC 2R2WU 5IDKA 2VIOA 5CMXH 2GX4A 1KXEA 1WSSH 2PHBA 3SV6A 2ZGCA 2P94A 1IQJA 2AGIX 1QIXB 1DUAA 1N6XA 1BRAA 1H8ED 4GHQA 1A4WH 3BG4B 2G5VA 4A1XA 2GMTC 2ZWLH 3PMAB 1K1MA 2F9BH 1CBWB 1NESE 4BAQB 4ISNA 1BUIA 4KGAA 3ODFA 1SHYA 3BG8A 6GCHG 1UHBB 5T1VA 2M2AA 1NN6A 1AVGH 1O3CA 3RXAA 1Y3WA 1AN1E 4JMYA 6ESTA 1B5GH 5LH8A 1ANEA 3NK8A 1UTMA 2GVFA 2ZTYA 2JH5D 4FUIA 2M5TA 2EEKA 1KXCA 1S5SA 3TJOA 1P06A 1P02A 2ESTE 5CHAB 1GI5A 4IN1A 4ZUHA 3GYLB 3KN2A 1SPJA 2JDID 2W26A 1O2KA 2P59A 5JBAS 3PROA 1T4VH 4AYVB 4ABAA 1MKXH 2PP6A 3A80A 1SOZA 4RKOB 1HUTH 3SU5A 2EA3A 4B6FA 1G30B 3MH6A 2OUAA 4AFQA 1FPCH 3SJ9A 1SR5C 3SUFA 1TRMA 3SO3A 1XX9A 3LPRA 1RXPA 1EAXA 4Y0YE 3RXKA 1YYY1 3GDUA 1INCA 1AE8H 1SQOA 2R9PA 2GT8A 3SNBA 2BOKA 4Y8YA 2H6MA 2YNBA 1Z8IB 1V2TT 1ZSLA 1V2NT 1MTWA 1O5EH 4I8GA 4F48B 1O3MA 2ZHQH 1S83A 2K1QA 3EYDA 2RCEA 5BPEA 4E7RG 4MG3A 4UFEH 3RXGA 4YTAA 1XKBC 1HB0B 2FOEA 2HLCA 2ZGBH 2ZQ2A 2FOMB 2TGTA 1Y5UT 5EGMA 4QT8C 1Q2WA 3A7YA 2G4TA 1ELDE 1TWXB 1IQMA 3DFLA 2UWLA 2BD9A 4WJG2 1HXFH 1IAUA 2ANMH 2G52A 4K2YA 1G2LA 2C8ZB 1C5XB 1GBEA 1SB1H 3NKKA 3T29A 4B76A 1W13U 3TNTA 3M37A 1HJ9A 1GI0A 1S84A 2H5CA 2KCPA 1GJAB 1NRNH 1QB1A 2PFEA 4OS5A 5GCHF 2G55A 1TRNA 1HAGE 3MU4A 1UTQA 1FX0B 2A7HA 4Y11E 5EG4A 2VWLA 3S0NA 1C4V2 1S6HA 3SJIA 2AS9A 1UTKA 1CA8B 1RJXB 2JKHA 3ATKA 2TIOA 5L2ZH 1ID5H 1C5OH 1V3XA 3E0NB 2SGEE 8ESTE 1BTZA 3BG4C 4K8YA 1O2LA 3TVJB 3TU7H 3A8CA 1CBWC 2ZHDA 2Y7XA 1V2OT 1TGSZ 2H5DA 2ZGJA 3TGKE 3RXQA 1A46H 1VCPA 2BX4A 1SGYE 1WAYB 2KCAA 2QXHA 3F2FA 3GY5A 1TAWA 1HAPH 4I31A 1TOCB 3URDA 1UK2A 2NWNA 1SBWA 2FM2A 3V0XA 3K9XB 2YMSD 1J8AA 4MPWA 1EJNA 4INLA 1FY3A 1EX3A 1O3BA 1O2SA 5CHAC 5EPNA 2BLWA 2QXIA 1LHDH 2PSXA 1V2LT 3K65B 1EZSC 1C2DA 1P2KA 1O2OA 3M5NA 2SGQE 1DICA 4O3TA 4RSPA 2Q6GA 5T6DA 3TK6A 1MZDA 5DP6A 2WHXA 2ZI2H 3A7TA 3QGNB 3RXIA 1Z6EA 3P8GA 2V3HH 4MNVA 1QR3E 2QF3A 1IOEA 1DXPA 3TH2H 1GDNA 1RTKA 1OHHD 2FI4E 4X6MA 2ZECA 1DXWA 1NBMD 1SSXA 3EE7A 5TJXA 2BDGA 1ZMJA 2BLVA 4FXGH 1GBIA 2HVXA 3OFND 3MOCA 2XXLA 5GCHG 4FUGA 2HGTH 1BMFD 1FZZA 2JIZD 1GBLA 5DK1A 4X2VA 1FQ3A 4YOGA 1CGIE 1GCTB 4ISHH 3BSQA 5GXPA 1YM0A 2VVVA 3GY4A 1GI4A 1H4WA 1TBQH 1SGRE 4UE7H 5E2PA 3MHWU 1O35A 4OS2A 1PPGE 1Y5AT 4K60A 2XBVA 3U8OH 4X6NA 2O9QA 3TLOA 4JZDH 4CHAB 5ABWA 4E7NA 5EXLA 5K0HA 1P0SH 1GMCF 3GCNA 1NM6A 5FCKA 4MVNA 1C2FA 2FWWA 1PPCE 5DJ7A 1GVZA 4HZHA 1AWFH 1LQDB 2FYRA 2UUJB 2ZO3H 5G4BA 5AF9H 1YCPM 4O03A 1AHTH 1RIWB 1FMGA 2Y82A 3ZZ5A 3OTPA 3E0PB 1TPPA 2BLQA 1AFQB 1KXAA 1BITA 3U98H 2BVRH 1PYTC 4DY7B 1HAXB 4AOQA 2QC2A 2A5AA 3ZVEA 1C1PA 1C5WB 2AMPA 4Y8XA 2O8WA 1EFRD 1O2ZA 4P00A 1J15A 3PM3A 3SU1A 1KTTB 5EQSA 1UJ1A 3QUMP 3A87A 3GY8A 4WWYA 1EATA 1ZJKA 1W0JD 2WSSD 1ACBE 4I32A 5E0GA 1UVOA 3F2GA 4H6TA 1HJAC 4O3UA 3SV8A 3PLPA 2PW8H 1BOQA 4JYTA 5DP4A 1UHBA 4I8LA 4JYVH 3DHKH 4IMQA 2A4OA 2ZEBA 4ZMAH 3I78A 1TBRH 1ZGVA 2SNVA 3ATLA 2ZNKH 2G8TA 4D7FA 2RDLA 1QJ7B 1LHCH 3ATWA 1F0SA 1QA7A 4I8JA 1GDUA 1ZHMA 3H7TA 2IJOB 5HGGA 1N1LA 4U2WA 2GV7A 3F2HA 1T8LA 4DW2U 4F49A 2F83A 1TALA 2JETB 1DY9A 1LO6A 3M5OA 3LJJA 1EAWA 4CRCA 1C2JA 3B23B 1ZMLA 1GMCG 1HAVA 2FEQH 3IITA 1ZJDA 1EPTC 2FIRH 2GZ9A 3DSGA 2A2QH 4HFPB 2RG3A 1XUKA 2WYGA 1B0FA 1BJUA 2BOHB 4TPIZ 4TSFD 1W12U 2G4UA 1FAKH 3TK9A 1EOJA 3PLKA 3SORA 1CGHA 2VJ1A 3W1EA 4E06H 1E37B 3RLWH 1JRTA 4BOHA 1ARCA 2A31A 3BF6H 2ZZUH 1L1NA 1YP9A 3QZRA 1UK3A 3AAUA 3MH7A 1C5QA 2ALVA 2V3MA 5AFZH 1PPBH 5DN6D 3E90B 1E34B 3T27A 2A32A 5C20A 1Z71A 5PTPA 4CHAC 4Y76A 1KY9A 4ESTE 3K2UA 5A0BA 1MABB 4GCHF 2CGAA 2OQ5A 2THFB 7LPRA 4ZCNA 3CP7A 3PMBB 1FIWA 1UW7A 4FUDA 1QL8A 3MNCA 4HG6A 2XYAA 3U1IB 1GBCA 2ZDNA 3VEQB 3EA7A 1KLIH 1W11U 4M9FA 5JDUB 4AFUA 3RXPA 1YWUA 2Z3CA 1YPEH 1RIWC 4R8TB 1WQSA 1SLUB 1AFQC 1XUHA 2D8WA 3SU6A 2R0LA 1SLVB 1T31A 2NU0E 2Y5GA 3LGWA 1OP2A 3Q3XA 5KGOA 3TH3H 3LH3A 2BY8X 4H42U 1ZSJA 3KQCA 5FHTA 1GHWH 4YLUA 1BTPA 3GCHC 1ELEE 4HTCH 3DSPA 1Y3XA 1DY8A 2BHGA 2JJ1D 2V35A 1GHBF 2FMJA 3VB5A 1P2IA 5LPEA 3RXCA 4AG1A 1LMWB 1BDAA 5JB9S 2V0BA 1O5AB 3TITA 1QRXA 4CRBA 2XTTB 2JJ2D 1A5IA 5DPAA 1FV9A 2FX6A 1VGCB 2BQ6B 3GCTF 1EZXC 4DJZB 2PWXA 1EKBB 3ZV8A 1W0KD 2GDEH 3P8FA 3QGJA 1G9IE 1BHXB 2GZ8A 2ZCKP 4YXWD 1P57B 2C8YB 1LVOA 1TQ0B 2VBCA 1BJVA 1GJ7B 4DG4A 1MAXA 5IK2D 1TIOA 2Y80A 2J94A 1EOLA 1N8OB 5B6OA 1O3JA 2ZU1A 1E38B 1O3KA 1ELFA 2JETC 3KYGA 2FX4A 3GDVA 4GCHG 3SUEA 1GBDA 2BQ7B 3M7UA 1T8OA 3P6ZB 4BANB 5CE1A 3HKJB 5C2ZA 3UFAA 1Z8JB 4JCNA 3OE7D 1A2CH 3MNBA 2KM0A 1Z1JA 1KTSB 4K1SA 3RU4T 4B6EA 2B0FA 4NG9H 1DWBH 3K6ZA 1HAIH 1XUIA 1VR1H 1C5TA 3W94A 2TGDA 2QN5T 1O2RA 5ESTE 1OS8A 1AFEH 1GMDF 3KGPA 4AG2A 4ZXYH 1V2MT 2AH4X 2Y6TA 2OXSA 2BDCA 5JYIA 1MTNB 1BT7A 2G51A 4O9VA 4TT3D 3A89A 1FNIA 2VB0A 1XUJA 5HIZA 4K5ZA 3RXEA 1RD3B 1C5RA 3SW2B 3RM2H 4ZXXH 1DLKB 5L30H 5DO4H 3GY7A 3QTVH 3NXPA 1ESAA 4SGAE 5EQQA 4AC9A 2CHAB 4K8BA 3MFJA 1MTSA 1TMTH 3QWCH 1BBRK 2BVXH 4OS4A 1Z1IA 3LGUA 3TH4H 3BTTE 4IC5A 1H9IE 3MH4A 1ESBA 3EAJA 2F9NA 4ABDA 4YM9A 1J9CH 3OY5U 1QFKH 2O8MA 3E16B 4Y8ZA 6GCHF 2VGCB 2ZP0H 1IQHA 1D9IA 1ETRH 2QF4A 2FLRH 3FO8D 1ZSKA 1DITH 2SNWA 1DSTA 1GI1A 1PFXC 1E35B 1K28D 3F0PA 1VGCC 8LPRA 1WCZA 1CU1A 5FX5A 1T32A 4WH6A 1H8HD 5A8XA 2H9HA 1A1RA 1HAYB 5C5NA 3ZZAA 1FXYA 4ZAEA 4AFSA 3RXSA 1AKSB 4B2BA 4OS7A 3KL6A 1CHOF 2P93A 1WV7H 4ASHA 4ABEA 3FKSD 2H9EH 2Z3DA 4Y71A 1GMDG 2HALA 2BY5X 3PO1B 5F6MA 3CNRA 1TMUH 3STIA 2JH6D 3RU4D 1OP0A 4XBBA 3MO6A 4WH8A 1GCDA 3AVZA 1GVKB 1HYLA 3KEEA 5IYTA 1S0QA 4ZKNU 3A83A 1IQEA 1H1BA 1O3IA 8GCHF 1TABE 2D26C 1P10A 1BMMH 2Z9IA 4PROA 1ZPBA 4SGBE 2Y5HA 3DSOA 5HIYA 1DOJA 1NC6A 1ZHRA 2P3TB 1D6RA 1MKWH 3UNQA 1O3NA 2Z94A 3FZZA 4NIYA 2FOCA 4NSVA 3UWIA 4DVAU 1OWKA 1BCUH 2D2DA 4NWKA 2PKSB 4X1QU 3GICB 3TGIE 4XBDA 5A2MH 2TGAA 1NT1A 1JIMA 3NUMA 5ETXA 1K1LA 3PMJA 5F8TA 1UO6A 1QBVH 2J97A 1FY5A 4U01A 1O2MA 3M5MA 4YLQH 4DIHH 1ORFA 1BMAA 4ABGA 1C2IA 3LT3A 4CR9A 1MTNC 2PUQH 1C2KA 1O2VA 4YZUA 3QTOH 1BQYA 4X6PA 3HK6B 1WBGB 2PKAB 2QGRA 3KCGH 2KAIA 5EXMA 1AI8H 1P2MA 1MBQA 3MO3A 4TY6A 5DP7A 4BTIB 3BTDE 5HM2A 5FCRA 2CHAC 4WY3A 3EE0B 1QTFA 3BTME 3OEHD 1TRYA 1TA2A 2HPQH 2LPRA 1K1PA 1CHOG 1N6YA 1NFYA 3R3GB 3RLYH 4X1SU 3V7TA 4NFFA 1E79D 1O2YA 2P16A 2BY7X 2PR3A 4X2WA 1MKWK 5C94A 1GJ9B 1V2KT 2VGCC 3CS7A 2BD2A 3P8NA 4O97A 5EW1H 4RN6A 3FP7E 4MTBA 5FAHA 3F9GA 1ZRKA 2ZU4A 1Z8GA 1C5PA 3SJOA 1P12E 2NU2E 4LZ1H 1FLEE 2QAAA 2CJIA 3O8BA 8GCHG 1AIXH 2HNTE 3VGCC 1WUNH 2ZU2A 2ZTZA 4X0WU 3PV5A 1PQ5A 5DP9A 1C9PA 4A6LA 1YPMH 4B71A 1V2UT 1NRRH 2Z6BD 1MCTA 2C8XB 2BDHA 5DP3A 5EXNA 3P92A 1YPGH 4GLYA 1ZMNA 4DT7B 2CV3A 1KYNA 1SL3A 2PGQB 3AAVA 4ABFA 5ESBA 2F9OA 1O2WA 1S85A 4LOYH 2TPIZ 2OP9A 1GL0E 5AVDA 3D65E 3PO1C 2OQUA 4WMEA 4MPXA 5C5OA 3ZVCA 1KIGH 2Z7FE 5GPIB 2ZFFH 1S6FA 4DCDA 1CSOE 3MI4A 1MD7A 1O5GH 3LGYA 1GBKA 1OYTH 1YLDA 2WUCA 2G5NA 3GDSA 5AHGH 2OLGA 1SGIB 4MDSA 2BXUH 5JBTA 1NRQH 5C0TA 1C2EA 2FTMA 1A7SA 3DFJA 4MNXA 3ZV9A 1FY8E 2ANWA 4JK6A 5B6LA 2A5KA 1THSH 3KQDA 1H8IH 4I7YH 4BXWA 1G32B 8KME2 1GWAA 3FP6E 3MH5A 1THRH 4RKJB 2XC5A 1QJ6B 4GAWA 2PKSC 1MQ5A 3HK3B 1J17T 3A7WA 4BAKB 1LKBA 4F4OC 1J14A 1O5CB 4XBCA 1HJAB 1JRSA 5FPTA 1TNHA 1L1GA 2GKVE 1EB2A 2AMDA 3N99A 4AORA 2BM2A 3QZQA 5DP5A 1C1OA 2TBSA 2WV4A 1XVMA 1EQ9A 5LPRA 4IS5A 5L6NH 4K69A 1LHFH 5EJLA 4MLFB 1S81A 5KECA 3L3TA 1AZ8A 2I6QA 1WQVH 1P11E 2FI5E 5E8EH 2ZIQH 3LOXA 1SKYE 1W2KH 4ISLA 3CENA
chains in the Genus database with same CATH topology
5FX6A 2XBXA 1FPHH 3VB3A 1CVWH 1QB6A 1GHYH 1W14U 1IQKA 2FXRA 4B2CA 2NU4E 1FONA 2GP9B 4D7GA 1IHSH 3SHAH 2DUCA 1HNEE 4KP0A 2IN2A 2VWNA 1LTOA 2YNAA 1EPTB 2FLBH 4FUJA 2QXJA 1GBFA 5F8XA 2W7UA 1EP6A 1O39A 4FU8A 1GJ5H 3ODDA 5E0JA 3F6UH 1VZQH 4NIWA 3PLBA 3MYWA 5C1UA 2B9LA 1FN6A 2OINA 1UMAH 4CRAA 3QLPH 4X8TH 1HIAA 3VB7A 1YPLH 3U9AH 3A8BA 3RM0H 1C1QA 2BD7A 1LPKB 1OX1A 2A1DB 2XC4A 1O2QA 2Z9JA 2JH0D 4FUCA 4ZH8A 2SGFE 2OC0A 5DG6A 4WXVA 1AUJA 3ZZDA 1SFQB 3RXTA 3L6PA 4ZHLU 2ANYA 1O33A 3ZZCA 1XXDA 2GCHF 5SGAE 5J4QA 4WVPE 1A0LA 1MTUA 1C1WH 2SGDE 4GPGA 2ZKSA 1QL9A 1VJAU 2O8UA 1G2MA 1HLTH 2VNTA 1P09A 3RXLA 1T8MA 3UREA 3FFGA 1EAIA 4X8VH 1CT2E 4Q7YA 5BRRE 4GUXA 1AVXA 1TPSA 3P8OA 3SUDA 1GG6C 2V6NA 1DM4B 3GCHB 4HGCA 2PSYA 3FAOA 4B73A 1FY1A 1TFXA 2VU8E 5EPYA 1G3BA 1GJCB 2R0KA 3SI3H 1HAOH 1C1NA 1SGPE 2FOGA 2CF9H 1K1NA 3P17H 2P95A 3MU8A 1ELCA 1F0TA 1HDTH 1V2JT 2ZPSA 3M3VA 1PPHE 3ZZ6A 2UWPA 4Y10E 1XM1A 2Q1JA 4K3JA 3BTGE 1M9UA 1AUTC 1C1RA 5T3HA 2VH0A 3ITIA 4KELA 3SGAE 4YO9A 4ABJA 1HGTH 1JXPA 1ZYOA 1K21H 3SOSA 1GL1A 5JPMH 4TWWA 3L33A 2R3YA 4CRDA 4CRFA 1V2PT 3QO6A 2PKAA 5EU8A 3LGTA 1UTNA 3RXOA 3UOUA 2OC7A 3QDZB 1QRWA 1G3CA 3HATH 3BN9A 2FODA 1UTOA 2OCVB 5HMAA 1KLJH 4E05H 3SU3A 3D62A 4X1RU 4TYDA 1V2ST 2A4GA 2GCHG 4FUHA 1NZQH 3WY8A 1Y3UA 2ZG0H 2DE9A 3T62A 5HYOA 5EOKA 1GJBB 3HGPA 3ZZ7A 1BIOA 3V3MA 1GHXH 5DP8A 4FVDA 3PTNA 2ZDLA 2R3UA 1JIRA 3UR6A 3GOVB 2FESH 4XOJA 4AGJA 2ZDVH 2W7SA 1BTXA 1B0EA 3SV9A 3CS0A 1FUJA 3SQEE 3F1SB 1C5LH 1QNJA 3Q3YA 3FZDA 3RP2A 2ULLA 1BMNH 3UUZA 1A5HA 4CRGA 2BZ6H 4IW4E 4H6SB 1L4ZA 2V3OH 5LPFA 2XRCA 2BDAA 2QXGA 4LK4A 6LPRA 1BA8B 3ELAH 3A88A 2F91A 1Q3XA 1QBOA 4MPUA 1F0UA 3BEFB 1FJSA 3FP8E 1ZGIA 1WTHD 5C1XA 1EASA 1IQGA 4OS6A 5L2YH 4NCYA 4ABHA 4ISIH 1LCYA 4JZFH 3RXJA 1OWHA 3E8LA 7ESTE 3BIUH 1GI7B 1ELTA 2D1JA 2AGGX 2ZFTA 1ELGA 4YESB 2J4IA 3LGVA 2STBE 3OY6U 1IQNA 2ZDKA 3RXUA 1P2QA 3URCA 3NWUA 3PYHA 2EC9H 1OWIA 1LPZB 4Q7ZA 1W0ZU 3G01A 2ILNA 1O31A 4H4FA 1O2JA 4ZKRU 1Y8TA 4WXIA 4AN7A 1C4U2 1ZRBA 2STAE 1AU8A 3PB1E 1ABIH 4ZKSU 1ARBA 2I6SA 1ELVA 3JZ1B 3LC5A 4J2YB 4XFQA 3N7OA 4IBLH 2GV6A 1DANH 2UUYA 2ODPA 1EJMA 2FTLE 4AGKA 3E1XB 1TX6A 1P9UA 4Y7BA 3UNRA 1MAYA 2ZDMA 1ZTJA 2ZFQH 1LDTT 4B1TA 1KDQB 1OXGA 2WPHS 2WUBA 3F9FA 1MZAA 1VCWA 1TGCA 5J4SA 3NZIA 3TK5A 2VWMA 1QQUA 3RMOH 1MTVA 3SJ8A 4ABIA 3TPIZ 3QK1A 1H9HE 1DPOA 2CF8H 3P70B 1BMLA 1GI9B 1TNIA 2OBOA 3SJKA 4CBNA 1FIZA 3RXVA 1EJAA 1C1TA 3UY9A 4MNWA 2GT7A 2AFQB 2GTBA 1BBRH 1UCYH 1C2LA 2VH6A 3O8RA 4AYYB 1TYNA 7KMEH 2O8TA 1RTLA 1AGJA 4YOJA 1Y3YA 1GBHA 1GJ4H 1NO9H 2HNTC 2WPIS 2Z9LA 1ZTLA 1EPTA 3ZZBA 1SGCA 3EDXB 1UVPA 4FVBA 3KIDU 4NSYA 1FN8A 3A82A 1AY6H 1P2OA 1BZXE 1PYTD 3LIWA 4OS1A 1IQLA 3RMLH 4GHTA 3K6YA 2FP7B 2WV5A 1SMFE 3Q76A 1MCVA 1VJ9U 2AIQA 1NTPA 3GCOA 4KTCA 1P03A 2Z9GA 4BTUB 3GYMA 1O3AA 3DT0H 1G36A 1P8VC 2SGAA 1HAZB 2AMQA 2B7DH 2QA9E 1YPHE 3V13A 4JYUH 1O3GA 3C27B 2ZA5A 1Y5BT 1EZUC 4LXBH 3S7HB 5T6FA 5C1YA 4AB8A 1MD8A 2VIDA 2ZHEH 3PWBA 1QL7A 3A7XA 5EODA 1UCYK 1L4DA 2GDDA 2SFAA 4A1TA 3OTJE 2FPZA 1SLXB 1XMNB 1A61H 4TY7A 1BB0B 2UUKB 2GCTB 3SQHE 1QCPA 1W3CA 4ABBA 3RXBA 1O3PB 1BBRE 1Y59T 3ZVFA 1HRTH 4BXSA 3MU1A 4JZEH 1K1JA 2TRMA 4A1VA 2RA3A 1DWEH 1GDQA 1QB9A 1UVUH 3GY2A 1DFPA 2A2XH 3VGCB 2ZU5A 1HJ8A 1O0DH 3VB6A 1P05A 3M36A 1YPKH 1E0FD 1TLDA 4DIIH 3A84A 4CH8B 1QJ1B 2BQWB 2WPMS 4UD9H 3HGNA 1O3HA 4AZ2B 2CN0H 2HOBA 1TNKA 1BTUA 1DUEA 3QX5H 1GJDB 1MU8B 4X1PU 1EB1H 4IMZA 2F9VA 3LH1A 2P8OB 1D3TB 4R0IA 2ZGHA 1ZR0A 7GCHF 3BTQE 5H4IB 2VIVA 5F8ZA 3ZVBA 1TA6A 1U6QA 3S69A 1O2TA 2P3UB 4M7GA 2J2UA 3KQBA 5GDSH 2F3CE 1SQAA 2VIPA 1NS3A 5FXLA 2XWAA 1GJ6A 1C1UH 3SNEA 1QBNA 2BTCE 2FS8A 2Y81A 3RU4E 1PQ8A 4MNYA 1TOMH 4JZ1A 1GBMA 1TBZH 4UFFH 4DURA 2BX3A 1TNLA 1GBTA 1ESTA 5K7RA 1JBUH 1O3OA 1YGCH 3UR9A 1A3BH 3ZZ9A 1TX7A 1LVYA 2B8OH 3JZ2B 3IG6B 4NIXA 4AX9H 2ZGXH 2BD8A 2AERH 1ZOMA 4WMDA 4Q2KA 1FI8A 1T7CA 2FOBA 3A8DA 3SUGA 1JMOH 4INHA 1IQIA 2P3FH 3SNCA 3ZVGA 1OSSA 4ZKOU 2W3IA 4XE4A 3MU5A 1W10U 1IHTH 4Y7AA 5FPSA 1ZPZA 1ABJH 4Y79A 2ASUB 3AASA 4Y0ZE 1ANCA 3SGBE 1EAUA 3MNXA 2EI7A 1XUFA 2VINA 4DGJA 2ZF0H 3SGQE 1C5SA 2BLOA 1O34A 1O36A 2XBWA 5A0AE 1ANBA 1TMBH 1RRKA 3SHCH 3R0FA 4VGCB 7GCHG 1AD8H 5A8YA 1AB9B 1YKTA 3S9CA 2GCTC 1SG8B 3Q00A 1QURH 2BMGB 2OC1A 1NFXA 3OSYA 4BAMB 2IOTA 3U69H 1HPGA 1F7ZA 4B2AA 5EQRA 2FZZA 2ZTXA 1GI8B 5HXFA 3B9FH 3RXRA 2H2ZA 2PUXB 1BHXF 4GVUA 5A09A 1HAVB 3TIUA 1YCPH 3SV7A 1QHRB 3UIRA 1OP8A 1SGFA 5C3NA 2VWOA 4X8UH 4D8NA 3B8JA 1OKXA 4MPVA 1OYQA 3GISB 4U32A 1MBMA 3P95A 2WINI 3ZZ3A 1NFUA 2IPHA 1SGTA 1K22H 2C90B 2P8OC 1O2NA 3H5CB 1QQ4A 1LVBA 5AFYH 1C5MD 1FY4A 9LPRA 2UWOA 1O2PA 1KDQA 1PPEE 2QIQA 1C9TA 4Z0KA 4J1YA 2BY6X 5GIBA 3LU9B 1HXEH 1G3EA 1TE0A 3AW1A 4UFDH 3BEIB 1UTLM 1PJPA 1P2NA 2HRVA 1ZTKA 1O2XA 4U30A 4BTTB 3VXEH 1LHGH 1MKXK 2PGBB 3I77A 5E2OA 2NU1E 1TGNA 1GG6B 3UQOA 2WPJS 1ETSH 1DWCH 1F5KU 3A7VA 1C1VH 2ZPRA 1P3CA 1YCPK 4D9QA 1CA0B 3F9EA 4NZLA 1GGDB 3PV4A 1SGFG 1AVWA 1D3DB 2J92A 2WYJA 1SGDE 1C5YB 4GSOA 1A0JA 2FOAA 2FO9A 3SU2A 3BTWE 1Z8RA 3ZVDA 1F0RA 2ZCLP 1G37A 4KTSA 1C5NH 3H7OA 1BTHH 1C2HA 2LNCA 3A81A 3A7ZA 1GHAF 4ZHMU 3TJUA 3TNSA 1AMHA 1S0RA 1RS0A 1VCQA 1C4Y2 2B5TB 2FI3E 2AEIH 4XDEA 2BVSH 1CT4E 3SN8A 1UTPA 2J9NA 4X2XA 1V2RT 4NZQA 1D3QB 1THPB 4VGCC 3VXFH 1ETTH 3PTBA 1O38A 1AB9C 3SV2H 2H9TH 2QCYA 2Q6FA 4ZHAA 3UOPA 1C1MA 1MUEB 4B74A 1DDJA 1MQ6A 3MWIU 1O5FH 1VITF 3RDZA 3DD2H 1L0ZA 2QV1A 3T5FH 3F9HA 3GY6A 4YOIA 2FDAA 2ZFRH 1QA0A 2O8LA 2ZFSA 3UWJH 1F92A 2ZU3A 3DA9B 2EI8A 1EZQA 3M3TA 1O5BB 2J95A 4NIVA 3RXHA 3EA8A 1DVAH 1JOUB 3UNSA 1SI5H 2F9PA 1JWTA 2VIWA 4I8HA 5A0CA 2OD3B 3PMHB 4CBOA 1F5LA 2YOLA 1AKSA 1HAHH 3BTEE 5I46H 1X7AC 3BEUA 1LQEA 1WU1A 1GJ8B 2XCFA 4OGYA 2UUFB 3ZZ4A 3ZYDA 3RXFA 1A0HB 1VITH 1AQ7A 1OOKB 3OU0A 1C5ZB 2HPPH 1WTGH 3GY3A 4X6OA 4DOQA 1H8DH 1KLTA 2NU3E 1GHAG 3F68H 1C5VA 1PQAA 3E6PH 1T4UH 3KF2A 2GD4B 1MMJN 2W5EA 1CO7E 1QGFA 1OWEA 4Y6DA 4LZ4B 5A8ZA 1K1IA 1W8BH 1GPZA 2H1UA 3UTUH 1XXFA 1MH0A 1V2QT 2BD3A 3DUXH 2A45B 1CA0C 4X1NU 3M35A 3T28A 3EA9A 1GGDC 4UONA 1NU9A 1GBJA 1SGQE 2Z3EA 2VIQA 3BTKE 1P01A 2BB4A 3EQ0H 3ZZ8A 1TPAE 5EW2H 1O37A 3M7TA 3NPSA 2AYWA 4CR5A 1ZZZA 2F9UA 4YT6H 1VITG 1SQTA 1GVLA 3D23A 1NROH 2GGVB 1YPHC 3BIVH 5T6GA 1V2VT 1LPGB 2ZHWH 6CHAB 3Q3KA 2ODQA 1C2MA 1UK4A 9ESTA 5HM9A 1P2JA 2OC8A 5FPYA 3RUOA 1D4PB 1YPJH 1O30A 1GI6A 1P3EA 1FAXA 3MU0A 1O2GH 1DE7H 1GMHF 1F2SE 3LC3A 1LHEH 1DS2E 4FUBA 4Q7XA 1RGQA 1CT0E 1SLWB 3AW0A 3SNDA 3V12A 1FDPA 4Q80A 1SGNE 2FOHA 1A3EH 1O5DH 1RTFB 1HV7A 5JB8S 2ODYB 5GWZA 5JBCS 3BTHE 2XW9A 3MO9A 2Y5FA 3S9AA 1XUGA 3STJA 1O3DA 4I8KA 2XBYA 5DKMA 4MQAA 1V6DA 2CXVA 3MTYA 4INKA 3W95A 1TX8A 1ZHPA 2TGPZ 1UVTH 1SGEE 1ANDA 1S82A 4UFGH 5TCAA 2BD4A 3TJVA 5DGJA 2XNIA 3SI4H 1KXBA 1OWJA 3BTFE 2EI6A 3E3TA 5FBIA 3RMMH 2ZDAH 2QF0A 1BRUP 2G00A 1P9SA 1TQ7B 3MMGA 2J38A 1K9OE 1YBWA 2ANKH 1DX5M 1GCTC 3FVFB 3D49H 2C8WB 4FUFA 1PQ7A 5TCCA 1Z6JH 2QY0B 1O3EA 4K1TA 3SU4A 3E91A 4FUEA 1B7XB 1GI3A 1OWDA 2AIPA 1E36B 2SGPE 3RC5A 3T25A 1HBTH 3ATIA 2KAIB 3T2NA 4NA9H 3RMNH 3SZNA 3U8TH 2A4QA 3PWCA 3RXDA 3A8AA 1QRZA 1GMHG 2BDBA 3Q77A 4AFZA 2C93B 4BAOB 4XSKU 2BYAX 4X2YA 1P04A 5F03A 2BY9X 3SBKA 1BRBE 2RA0A 4CREA 1NU7B 1WYKA 3NCLA 1IQFA 2BDYA 1L1JA 2FS9A 3LKWA 3RXMA 3SU0A 3I29A 1O3FA 3KHVA 3UQVA 2PTNA 1TPOA 3O8DA 3U8RH 1NY22 2VVCA 3VB4A 1O2IA 2ZPQA 2XWBI 3LONA 3ZYEA 4I33A 4NWLA 6CHAC 1W7GH 4JZIA 1XKAC 1NRSH 2FYQA 5C67A 1EXFA 3LJOA 4KKDA 3VPKA 1GHZA 1AE5A 1DLEA 1SOTA 3T26A 4ISOA 3A86A 3U1JB 1SVPA 1YLCA 4D76A 1C1SA 2BZAA 2C4FH 2Y7ZA 1NPMA 1PPFE 3HKIB 1TONA 2Z9KA 4KTUA 3ESTA 3RC4A 2G81E 1QY6A 1NRPH 4CH2B 1EP5A 1K1OA 1UTJA 1D3PB 1AO5A 5LGOA 2A5IA 2CMYA 3IWMA 3TJNA 4NA7A 1EUFA 3MNSA 1PPZA 2QYIA 2BXTH 1ELAA 3KNXA 1O2HA 2WPLS 4NFEA 2A0QB 3FANA 3M61U 2DE8A 1TNGA 1W0YH 4IC6A 4IN2A 3A85A 4TWYA 3ZVAA 1L2EA 2ZC9H 4YT7H 4OGXA 4X8SH 4NGAH 1Q31A 1DT2A 5GJ4B 2A4RA 1SC8U 1T8NA 5JBBS 2FOFA 1V2WT 1F5RA 1BTWA 2OTVA 1YC0A 1BTYA 1AWHB 1D6WA 3LGIA 3ATMA 3HPTB 5I25A 1NFWA 2WPK