2PSYA

Crystal structure of human kallikrein 5 in complex with leupeptin and zinc
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
227
structure length
227
Chain Sequence
IINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kallikrein-5
publication title Structural basis of the zinc inhibition of human tissue kallikrein 5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 227
sequence length 227
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2psyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2psyA02
2BY8X 2BY6X 1AFQC 1C1PA 3BEUA 5TCCA 1NFWA 2FYQA 3SJ9A 1CA0B 2WV4A 3T29A 3BEIB 3A83A 3TJUA 2STAE 1F0SA 1YBWA 1ABIH 4UFGH 4WVPE 1HBTH 1OOKB 1P3EA 2OBOA 1GMDG 1P2OA 2WPKS 1WSSH 3VB5A 2BOKA 3SI4H 2OCVB 3BN9A 3W94A 2BD9A 5LPRA 4ABDA 1S6FA 1QQ4A 3GCHB 1DWCH 1MBMA 3W95A 2BY7X 3GY6A 4YOIA 1MKXK 2QGRA 2H1UA 3RXPA 3GY3A 2PKSB 3U8TH 1DM4B 4XFQA 1MH0A 1THRH 1GCTB 3VFEA 4K1EA 3AASA 4X1SU 1D3QB 1HAYB 4IN2A 1VITF 2ANMH 2QN5T 1OWKA 1C5VA 1GGDC 3GYLB 2GCTB 1KLIH 3GCTG 3SU3A 3UFAA 1T4UH 4MVNA 1FY8E 2QF0A 1BB0B 2A7JA 4F49A 1GBDA 3PMAB 2J38A 1GMCG 1ZRKA 5GCHF 1SC8U 3OTJE 1O2GH 3ZV8A 3VB3A 5K0HA 1H9IE 2PWXA 3LC3A 3PWBA 1UJ1A 1BBRE 1HDTH 1Y5UT 4IW4E 2HLCA 1JIMA 2PUQH 1KY9A 1Z8IB 2Z9LA 5T3HA 1OPHB 1Y3UA 2Q6GA 5I25A 1ZPBA 1WAYB 3E16B 1J15A 1DXPA 3D62A 5DKMA 1SOTA 1SQOA 4AGJA 1Y8TA 2BMGB 5ABWA 3SV6A 3H5CB 1NRSH 1O2TA 2FOBA 4Q2KA 2RG3A 4A1VA 1P3CA 2Y5HA 2Z3EA 1RGQA 1PPEE 1O2OA 1OWIA 2QYIA 1LCYA 1B5GH 1L4ZA 1HRTH 1T8NA 2H9TH 2JH5D 2QXIA 3KL6A 3VB6A 2FYRA 3EAJA 2FPZA 2VJ1A 5C1XA 2XC5A 5AVDA 4KP0A 1T4VH 2A32A 4FUIA 1EAWA 4NIYA 3SZNA 1ARCA 4B2CA 2VIVA 4AB8A 3ZZCA 3BTDE 2A5AA 3GCNA 3ODDA 1GI6A 1A5IA 1AO5A 4BXSA 1THSH 3LDXH 4OS5A 1O35A 3L33A 4NCYA 3KN2A 4ZXYH 2SGFE 1HCGA 1SVPA 4LK4A 4CBNA 3P6ZB 4YLUA 2OQ5A 3MU1A 2ZGJA 1EB1H 5C2ZA 3EQ0H 1C5QA 5E8EH 1A7SA 1MCVA 1V2LT 1SPJA 1K9OE 1IQLA 2CGAA 3QGNB 2VIQA 1CU1A 4YOJA 3A8AA 1O3MA 3ZV9A 1CA8B 1GBHA 1H9HE 2TGDA 1O33A 1SGCA 1BMNH 1W13U 1ELVA 2P3UB 3SV7A 2G81E 4X2WA 4AGKA 1TMTH 2ALVA 1OWEA 1U6QA 1O2YA 1FAXA 1Z8GA 4ZHMU 4B2AA 1VITH 1J17T 4YTAA 1GDUA 1JBUH 1TBRH 1MUEB 1S0QA 1EZSC 2PV9B 1KTSB 2EI7A 2WV5A 2YNAA 5AF9H 2VWOA 1CHOG 4X0WU 1KXEA 3GYMA 4THNH 1CQQA 4CRFA 5HYOA 1ZGIA 3SNBA 3KNXA 3SNAA 3A8DA 4DT7B 6ESTA 2FOAA 4FUHA 2NU2E 5CE1A 1O2QA 1QA7A 1VZQH 4KTCA 2J92A 1XUKA 5EQRA 1FPCH 3P17H 1FDPA 1SGFG 1V2KT 1V2ST 3RP2A 3U69H 4NFEA 2AMQA 2BD7A 3ZZ6A 4RSPA 1BTHH 1CT2E 1ELFA 1HXFH 5FBIA 4NA8A 3MO3A 2BLQA 3P8GA 3BEFB 1KXBA 1G3CA 3PLBA 2SNVA 1F7ZA 1QBVH 1VJ9U 1DPOA 3A7TA 1SMFE 2F9BH 2GD4B 5DK1A 1IHTH 4U01A 2F9NA 4CR9A 3P8NA 4D7FA 3FP6E 4NZLA 1W14U 4UFDH 1YM0A 2BVSH 2Y5GA 1TRMA 3TH2H 5B6OA 1FY4A 1SHYA 3M7QA 3RXOA 4FUJA 1Z6JH 4UE7H 1QTFA 1K1IA 1MD8A 2PKAA 1O3NA 2G4TA 3ZZ9A 3RLYH 1RTKA 1CE5A 3U8RH 1C1UH 3LONA 1YCPK 1A5GH 1GI7B 1AI8H 1EOJA 1D3TB 2R3YA 3A7WA 4AN7A 3MH6A 1C5WB 2YNBA 4WWYA 4A1XA 2OQUA 8KME2 4Q80A 1BT7A 2Z3DA 1AKSB 3RU4T 1HGTH 1GI5A 2ZDKA 4I8GA 1F0TA 4HTCH 5DJ7A 4BTUB 2AGIX 1QIXB 2JETB 1DANH 4IMQA 3BTGE 3UQVA 4JZFH 1ARBA 1IOEA 3K2UA 1Z7KA 4U32A 4R8TB 3Q77A 1NT1A 3QDZB 2VINA 3H7OA 1NFUA 3S9BA 2BD4A 3VXFH 1DUEA 2BQWB 1G37A 3TJVA 1FPHH 1QCPA 2UUYA 1ZPZA 2OP9A 1KYNA 5C20A 5LPEA 1TGNA 4INLA 5AHGH 4E7NA 1GHYH 1C2EA 1Q31A 3BTFE 4I7YH 2B7DH 4H4FA 1MZDA 1IQKA 2ODPA 1JXPA 1WTHD 1SGNE 5L30H 5TCAA 1FN8A 1HJ9A 4GUXA 3SU6A 4DOQA 4FU9A 4JCNA 5EXLA 1VR1H 1FQ3A 1DSTA 2Y5FA 1KXFA 1A3EH 1P57B 2R2WU 1C2DA 1UVPA 3R0FA 4Y0YE 1ZJDA 1ZHPA 1SQTA 3IG6B 4LOYH 3PV4A 2FOFA 1EX3A 4DY7B 1SFIA 1FAKH 1O2HA 8LPRA 3RXKA 1JMOH 3A84A 2AH4X 2C3SA 4Y7AA 3VXEH 1ZHRA 1GJ8B 2J34A 3IWMA 3SI3H 1PQ5A 3F9EA 2O8MA 1YP9A 4AFSA 1AHTH 2FS9A 4K8YA 2TPIZ 3TNTA 2D8WA 1TQ0B 1OP8A 4DIHH 1TX7A 4H6SB 1IQIA 1EJAA 1QQUA 4ZKSU 1UVOA 2A2QH 4GCHF 4ISHH 2P8OC 1RTFB 3I78A 3TIUA 2OBQA 1QURH 1EPTB 3F9FA 2BXTH 3LGYA 1RIWB 1A5HA 1ESTA 1LDTT 3STJA 2XXLA 4A92A 5E2PA 1BOQA 3R3GB 3UQOA 2ZECA 2BYAX 1YCPH 1C5OH 2ZO3H 1UMAH 1EAIA 3SU5A 4AYVB 2J95A 3VPKA 2ZIQH 2THFB 3MYWA 2WPIS 3BSQA 4YLQH 1WCZA 4NIVA 1F0RA 2IOTA 1K22H 2AIPA 2ODYB 3EYDA 4ZKNU 4X2YA 3ZYDA 3NCLA 2Z9JA 1LKBA 1BMMH 1VCWA 8GCHF 5JBAS 1C1NA 5AFYH 1QY6A 3ZVBA 4Y8ZA 3O8RA 1FONA 2LNCA 1QB6A 2JKHA 3FFGA 5DP9A 3AW1A 1GDQA 3RXQA 1ZTLA 1K1PA 1E38B 1PPZA 1JRSA 1C2KA 1GI8B 5GWZA 1DICA 5TJXA 1ELAA 1LPGB 1C1QA 2HPPH 4DW2U 2VIDA 1FN6A 1QGFA 1S81A 1OYTH 3KF2A 1YYY1 2SGAA 1P10A 2QA9E 3SGBE 4ABFA 2B5TB 1NU7B 4MPUA 4AFUA 4ZKRU 3ZZBA 3MH7A 2RA0A 4TWYA 2CXVA 4ABBA 1V2QT 3SNDA 2F9VA 3C27B 1GBEA 4XDEA 2ZA5A 2DE8A 4X8VH 4IMZA 2W3IA 3B9FH 2HNTF 3FZDA 2ZFQH 2AGGX 2M5TA 1YPLH 2BQ7B 5H4IB 2C8XB 3TU7H 3V12A 1KDQA 4X1PU 3A8BA 2BDBA 1EUFA 1UK4A 1YKTA 1F0UA 2ZTZA 2ZCHP 3QGJA 3M35A 1Z8RA 3U98H 2W7SA 4ZH8A 3NKKA 1ZMNA 3NZIA 2GGVB 3TLOA 1BITA 4AB9A 1TRYA 2ESTE 3MNSA 3A82A 4RKOB 4Y71A 3UR6A 1O3EA 1TOCB 3LH3A 2VWNA 2BLVA 1HAZB 2XC4A 3I29A 1HJAB 2FOHA 3VEQB 2VWMA 2KAIA 4GLYA 2KAIB 3B23B 4DURA 1UVSH 1V2WT 2G52A 1F92A 1ESBA 2ZDNA 3JZ2B 1LMWB 7GCHG 3DD2H 1EJNA 4UFFH 3S69A 1HAVB 3EA7A 4K8BA 4NWLA 1O2NA 3AAVA 5A8XA 2VU8E 3PTBA 4RN6A 1LQDB 1SLVB 1LHCH 3UOPA 4BNRA 3NPSA 2F83A 3E1XB 2ANKH 5EODA 1M9UA 4ZXXH 1JOUB 5FBEA 3GDVA 1S84A 3RC6A 4JZEH 4YT6H 3QTVH 3PMBB 1OSSA 4A6LA 1P2IA 1UTOA 2VH6A 2XTTB 1DX5M 2F9OA 1ELDE 4TY6A 3QTOH 1DXWA 1TX8A 3BTME 1P2KA 1W12U 2F3CE 5A2MH 3LJOA 3LJJA 2ZPSA 3FAOA 5JYIA 3PM3A 2CV3A 3RXGA 1NTPA 2RA3A 1P2NA 2G51A 1GWAA 3SW2B 3TH3H 4UD9H 2IN2A 1GI2A 3HKJB 1SBWA 4OS7A 3LPRA 2UWOA 2C90B 1XVMA 5F8XA 3M7TA 4Y6DA 2G8TA 2SFAA 3LGTA 1O2XA 1TABE 1ZSKA 2GMTC 1GMHG 1DDJA 4X1RU 4BAKB 4LZ4B 3UUZA 1N8OB 1E34B 1TAWA 2XW9A 3QLPH 1HAOH 4X6MA 1RJXB 2AGEX 2P95A 1ESAA 1Z71A 2ZU5A 4DCDA 5F8ZA 1O2RA 3ZVAA 3K6ZA 2ZFSA 2HOBA 3LGIA 5CMXH 2ZGHA 2VIPA 1SGRE 3PTNA 1NRPH 1UK2A 2R3UA 1O31A 1L4DA 1XX9A 4I8JA 1TGBA 2FIRH 1QR3E 4TWWA 3K6YA 2STBE 1ZTJA 4KELA 5T6FA 3KIDU 4I8LA 1A1RA 5ESTE 3PYHA 4E7RG 5BRRE 1QNJA 1GJ9B 2BQ6B 1BIOA 2V3HH 3JZ1B 4AX9H 4BTTB 4B76A 4QT8C 5GCHG 3DFJA 1TGTA 1MCTA 1SGFA 2WYGA 1UCYK 3BV9B 4AFQA 4E05H 1F5LA 1NM6A 1GBCA 1EQ9A 5JPMH 3A81A 1IAUA 3E0PB 1THPB 3TJNA 2QAAA 1HLTH 3GY4A 1O5GH 1CGHA 1W2KH 3NK8A 3BG8A 1LVOA 4MTBA 5L2ZH 1KXAA 1C4V2 4MQAA 1W11U 4B2BA 3V0XA 1O2ZA 1NRQH 2FI3E 1O2IA 3TGJE 1K2I1 2W7UA 3SV8A 1JRTA 2BDAA 2UUFB 3A7VA 4NWKA 1T32A 1FLEE 4D9RA 3GICB 5BPEA 4KTSA 3UNSA 3ZZ7A 3ESTA 2ZFFH 1GI0A 3M5MA 2W5EA 2FZZA 4H42U 2PHBA 5FCKA 2BVXH 1ZR0A 4VGCB 2O8LA 3D65E 5T6GA 2GX4A 1UTMA 3TGKE 2AMDA 4FUFA 2UWPA 1AVXA 1O0DH 4BANB 1GBLA 5PTPA 2J2UA 3QO6A 1CGJE 2BXUH 3E8LA 2Y7XA 1BTUA 5FX5A 3ZVDA 1SI5H 3MU4A 1P06A 3ZZ5A 5C1UA 1C5XB 2G5NA 2CHAC 4NFFA 1N6XA 1GJ5H 4IS5A 3E91A 3ZVCA 1HXEH 2F91A 2QY0B 1O3LA 2AIQA 3MNCA 1WOFA 3HPTB 5SGAE 1MTNB 1G3BA 3SV2H 1SL3A 2CF9H 3UNQA 3P70B 3F68H 1H8IH 5GXPA 1PPBH 3EA9A 5C1YA 2ZWLH 2PTNA 4NIWA 1AZ8A 2FESH 3STIA 3P8FA 1C1VH 1IQHA 3BG4B 1OWDA 3FP8E 2WPHS 1GBAA 4OS4A 2ZFPH 3LT3A 2QV1A 4AOQA 1AFQB 1EAXA 1FY3A 1ABJH 2ZCKP 1TWXB 2NU0E 1J14A 4WMDA 3RXTA 3S0NA 2ZQ1A 1VCQA 1WTGH 1FJSA 2GZ7A 8ESTE 2R0KA 1TBZH 3DHKH 3SUDA 1DS2E 1RTLA 4TPYA 1GBIA 2BB4A 4OGXA 1AWHB 1UO6A 1C2LA 1TPOA 3SHAH 2P93A 2VVVA 4Q7YA 3A7ZA 1C2MA 3BTTE 2J9NA 2B9LA 3D49H 3UWIA 1OS8A 1HPGA 3HK6B 3RXFA 1UCYH 1NPMA 1O3CA 1GHXH 4XOJA 1GBBA 1QBOA 1O5FH 2ZDMA 5FX6A 1TYNA 1S0RA 3TK5A 1P05A 1WU1A 2ULLA 4K5ZA 2QXHA 1L1JA 1PYTC 2H9EH 1GHZA 1UVUH 3NXPA 3SJOA 2H2ZA 4GHTA 1P0SH 5A0CA 2ZI2H 4XBBA 1DITH 2EA3A 3UPEA 5DO4H 2QIQA 1INCA 1KXCA 1TGSZ 3QX5H 3BTKE 3TNSA 4D9QA 1XUFA 2A31A 1NFYA 6GCHF 3S7KB 1P01A 4JK5A 1GGDB 1P11E 4JK6A 1ZSLA 1A0JA 1AY6H 5L6NH 2ZHDA 3BTEE 3RM0H 4Y0ZE 1MD7A 3FANA 1V6DA 1ZOMA 1HAHH 3PLKA 2FLRH 4FU7A 4HZHA 3RLWH 4CRCA 1GI9B 1S82A 2WPJS 3T2NA 2GKVE 3RXDA 4OS2A 1MQ6A 1ANDA 2DUCA 4IGDA 3V3MA 1V2PT 2FOEA 3UOUA 3PMJA 3UNRA 1SLUB 5HM9A 3EDXB 2OUAA 1TBQH 1TGCA 2RDLA 3VGCC 1TB6H 3T25A 4WXIA 3RMNH 4H6TA 3RXCA 1AB9C 1C2IA 2OC1A 1FNIA 1F5RA 1VGCC 1ZHMA 1GBJA 3M37A 2FWWA 1EAUA 1GVKB 1MTSA 2ZCLP 2ZP0H 1BQYA 2ZPRA 3ATIA 2ASUB 1J8AA 2HWLB 1PQAA 3EA8A 2G55A 5JBCS 2QCYA 4FVBA 1T8LA 3ZZDA 3LGVA 4O03A 4FUGA 2CJIA 1QBNA 3QUMP 4MNWA 1MTVA 1AE5A 1T7CA 1O2WA 3EE0B 1Y3YA 5EPYA 2FXRA 3LKWA 4SGBE 4R0IA 2TGPZ 1GDNA 1P04A 2PKAB 3SN8A 3ATMA 4INKA 4WMEA 4GSOA 4Y76A 2XCNA 5FXLA 1QL9A 1B0FA 5K7RA 2Q6DA 1LO6A 1MU8B 3I77A 1F2SE 3CENA 5DG6A 1YGCH 3T5FH 1V2OT 1YLDA 2OC7A 5T6DA 1FMGA 3SUFA 1AVGH 3M36A 3URDA 1CHOF 2GCHF 1ZTKA 2XWBI 1O3AA 4MLFB 1NRNH 3SUGA 5JB8S 4K3JA 1FXYA 1NZQH 4X8SH 4ASHA 1QHRB 4Y11E 4ZUHA 1GI3A 4X8TH 2C93B 2ZHEH 4FUDA 4HI3A 1EZXC 2VVUA 1GG6C 1A0HB 2Z7FE 1ELGA 3MOCA 1YPMH 1O30A 1C9TA 3N7OA 4K69A 2FI4E 1UTKA 1LHGH 2H6MA 3LOXA 4Q7ZA 3LGWA 1C2JA 1QFKH 1Q2WA 1G9IE 1HIAA 1SR5C 3TH4H 1NU9A 4NSVA 1PPCE 1GL0E 1UTJA 1ELBA 1OX1A 4X8UH 4ABIA 1C1OA 5J4QA 1OP2A 3RXAA 3IITA 5GPIB 2C8WB 2ZFRH 1AIXH 1MKWK 2Y6TA 2PSXA 4GCHG 1G2LA 3MFJA 2BOHB 3MI4A 4MPWA 4ABEA 2TRMA 3P8OA 5JBTA 1KXDA 1YPKH 3UIRA 2P59A 2TGAA 4X2XA 2ZGXH 5EU8A 1QL7A 1IQEA 2HVXA 4CH8B 1DUAA 1TNJA 1GL1A 3TJOA 5C3NA 1AB9B 3EGKH 1LHEH 7LPRA 3M3VA 1VGCB 1W0ZU 3GY5A 4JYTA 4ZHAA 1IQGA 1O2LA 2PLXA 4FUBA 5F8TA 4X6PA 2K1QA 1DFPA 3AW0A 3E0NB 1EASA 4X6NA 1G32B 1W10U 2NU3E 4X1NU 1GCDA 2P3FH 1GHAF 1RFNA 2A0QB 1SGTA 2OLGA 2XNIA 2C8ZB 1TX6A 3O8CA 2FLBH 2A45B 3RXRA 1C2HA 1MTWA 3KCGH 1WBGB 2FOCA 1L1GA 3PWCA 5DPAA 1D6RA 1AWFH 2Z9IA 1O2PA 2XRCA 1LVMA 1SQAA 2Z6BD 1HAXB 1K21H 4F4OC 1CGIE 5A0AE 1ZYOA 2BD5A 3F1SB 4I32A 4CHAC 1D4PB 3SHCH 4MG3A 4O3TA 1BBRH 1O2JA 1O3IA 1CBWC 2PSYA 1E0FD 2GDEH 4IC6A 2ZDAH 1SGIB 1AU8A 1TOMH 2ZHQH 3QZRA 5EXNA 1G30B 1GG6B 1C5TA 5DP3A 3A8CA 3E3TA 2QF3A 4JZ1A 1EZUC 4I8HA 2A5IA 4J2YB 3T62A 1BTYA 1O2MA 2ZU3A 7KMEH 4AYYB 1BHXB 1YC0A 3RDZA 1O3HA 1TMUH 1XM1A 3TK6A 1GJ7B 1YPJH 1LPZB 1V2RT 2BY5X 3RMMH 1MTUA 3VB4A 2P94A 1GPZA 3L6PA 2PGBB 3S9CA 4NG9H 1F5KU 4U30A 1C2FA 2BVRH 5A8ZA 5E0GA 4IN1A 4TPIZ 1TALA 4YOGA 1SG8B 2ZU1A 2UUJB 3V13A 1UCYE 4Y10E 1H1BA 1PFXC 1D6WA 1MKWH 1W0YH 5ESBA 1XKBC 4PROA 1EP5A 1T31A 2FOMB 1ETRH 4DIIH 5GDSH 4UEHH 5JBBS 4CREA 2IJOB 2WINI 3A7XA 2PFEA 5F03A 1RRKA 1QL8A 4D8NA 2C8YB 1TFXA 4FU8A 4A1TA 3RUOA 2BDIA 2BDYA 3E90B 1KDQB 5ETXA 5A09A 1AMHA 4I33A 5EXMA 1ZRBA 1CHGA 4BOHA 1EOLA 2ZU4A 2XWAA 1AE8H 1SGDE 9LPRA 1AUTC 1XUHA 1SOZA 1W8BH 3H7TA 1PPHE 2EEKA 2FM2A 3ZZ8A 4WJG2 1O5DH 2P8OB 3LIWA 4A7IB 1JWTA 2F9PA 1WQVH 1DE7H 1CA0C 2UWLA 4I8KA 5EOKA 1TNIA 3PMHB 1H4WA 2SGEE 1V2MT 2Y81A 5EW1H 2CMYA 1GJ6A 1GJBB 3ENSB 2Q1JA 3HATH 2GTBA 3M61U 3RXBA 2A7HA 1C5NH 1ZGVA 1SGEE 1CO7E 2SGDE 4MNYA 1O5EH 3SGAE 1WYKA 1V2UT 2BD2A 1QRZA 3GCHC 3RU4E 1P8VC 2HRVA 3GOVB 3UWJH 1G3DA 4LXBH 1Y5AT 2G00A 1KIGH 1BJUA 3U1JB 2PKSC 4XBCA 3ODFA 1TMBH 1D3DB 5JB9S 2CF8H 2VIOA 1P09A 2GV7A 1Y3VA 1GCTC 4YESB 2BDHA 2XBYA 1BRUP 5FPSA 2FTMA 2FMJA 1FZZA 2ZDLA 2ALPA 4ZROA 4KTUA 4CRAA 3M5LA 2HGTH 2P3TB 2PGQB 3MO9A 2GCTC 4AG1A 2J4IA 4WMFA 3CS0A 1PJPA 5FAHA 1MAXA 1OP0A 1SGQE 1O3GA 3DA9B 3KQEA 4UDWH 1O32A 1C5PA 2ANYA 1EKBB 1O5BB 2ANWA 1O3FA 2GVFA 1ZMJA 1LHFH 3RC4A 1UHBA 1BZXE 4BXWA 1UHBB 2R9PA 7GCHF 2XBVA 1P02A 2O8UA 3NWUA 2G4UA 3M5NA 3S9AA 1Z8JB 1SB1H 3ELAH 4LZ1H 2H9HA 1VJAU 2I6QA 1QRXA 1VITG 5LGOA 4TY7A 4CBOA 4D7GA 1A61H 2ZHFH 5EGMA 4CRDA 1CT4E 3RC5A 1A2CH 2EI6A 3RXIA 2PR3A 1GHBF 1QJ7B 2V35A 2VWLA 1XMNB 2WPLS 3GY7A 1LPKB 1EB2A 3BIVH 4ISOA 3ZZ3A 1QB9A 1V2TT 3ATKA 1D3PB 4NGAH 1OWHA 4FUEA 4JYVH 4B74A 1FY1A 1C1RA 4ISIH 5J4SA 1MU6B 2OXSA 5E0JA 1LQEA 3GDUA 1MAYA 2CN0H 1C5RA 3LH1A 2XC0A 3LC5A 3HGPA 1W7XH 1BJVA 4KGAA 2V3OH 3DUXH 1C1MA 2V6NA 1GJCB 1K1JA 1GMHF 3RXSA 4D76A 2UUKB 1ETSH 3DT0H 5A8YA 5I46H 1G36A 1TA6A 2GV6A 4K2YA 1BTPA 4ABAA 1O36A 2LPRA 3OYPA 2ZEBA 1BRBE 4DGJA 1O34A 3KHVA 1TNLA 1PPGE 3KQDA 1AFEH 3MU8A 3TK9A 1DY9A 1WV7H 4DVAU 2FOGA 1MMJN 1YPHE 1T8MA 6CHAC 2FI5E 3V7TA 1UTPA 2AS9A 1HB0B 3LGUA 1DWBH 2Y7ZA 2ZU2A 1ZSJA 1QJ6B 3A7YA 5EQSA 3F9HA 3K65B 1BHXF 1L2EA 4YT7H 1Z6EA 1BUIA 4AZ2B 3PO1C 1ELEE 1FY5A 4AG2A 2PW8H 1SFQB 3MU5A 2GMTB 1GMDF 1O38A 2QXJA 2XCFA 2AEIH 4BTIB 1C1SA 5FCRA 2A5KA 2DE9A 3MU0A 4CRGA 1O3DA 1TPAE 1XVOA 2GZ8A 1DWDH 2HNTC 4MDSA 1O3KA 1UTNA 1B0EA 4MNXA 4Z0KA 5C5OA 1ANCA 1C5UA 1EZQA 1VCPA 5LPFA 5L2YH 4ABJA 5EQQA 3UR9A 1XUJA 3BTWE 1E35B 2OTVA 1TPPA 2ZNKH 1LTOA 2AMPA 1DLEA 1OKXA 2BDGA 6GCHG 4Y7BA 4Y8XA 3BF6H 2Z9GA 1ZMLA 1O3JA 1PYTD 2VH0A 1C5MD 3P92A 1ANEA 3E6PH 2PTCE 1BA8B 1Q3XA 4K60A 1TRNA 3GCTF 3U9AH 2Z94A 1IQFA 4UFEH 1GMCF 4BAOB 1H9LB 1RXPA 3GY8A 1AQ7A 2P16A 1MZAA 1GBTA 4Y79A 3FP7E 4Y8YA 3GDSA 2VIWA 1HJ8A 2XBXA 1C5YB 4IC5A 1P9SA 2GZ9A 4XE4A 2H5CA 3SOSA 1BMLA 1C5SA 2ODQA 1L1NA 3UREA 1GJAB 4NIXA 2ILNA 2HPQH 2ZTXA 4J1YA 3MNBA 1K1OA 3SU4A 3A88A 1UK3A 2Z9KA 4ZAEA 2JETC 1V2VT 1ZLRA 3RXUA 2TIOA 2ZG0H 1XXFA 1YF4A 3O8BA 4TYDA 2GP9B 3LU9B 3SUEA 4BAQB 3Q00A 4B71A 4ZKOU 3ZVFA 1DWEH 1MKXH 1TE0A 1PQ7A 2Q6FA 1UVTH 5A0BA 3QZQA 6CHAB 5HXFA 5C67A 2Y80A 1O3OA 3DFLA 1PPFE 1EP6A 1K1MA 1W3CA 2OD3B 1NY22 3QWCH 2ZGCA 2CHAB 2OINA 1CT0E 3PROA 4ISLA 4WY3A 3BTQE 2GCHG 1EXFA 1IQJA 3PO1B 4FVDA 1SGPE 3MWIU 2VVCA 3FVFB 1SGYE 3ZZ4A 1Y59T 5DGJA 3PLPA 1C5ZB 2PUXB 4MNVA 2WUCA 2FEQH 2BM2A 3KEEA 1P12E 4UONA 1BRAA 1TQ7B 1WQSA 1KLTA 3GISB 1OXGA 1WUNH 1IQMA 1BTXA 2AYWA 4OS6A 4Z6AH 3MTYA 4E06H 1S85A 1NO9H 3MH4A 4WH6A 3CP7A 4FXGH 1HAGE 2I6SA 2OC0A 3T26A 1MQ5A 2TBSA 1GI1A 3ZYEA 1BBRK 2Y82A 1ACBE 1BTZA 1BRCE 2VNTA 3SNEA 4GVUA 3SJIA 1DVAH 4JYUH 2R2MB 1SSXA 2A4GA 2ZF0H 1V2NT 1Z1JA 1AGJA 1A4WH 3SU1A 4I31A 3O8DA 1LHDH 1FIWA 4WF8A 1EPTC 4XBDA 1RIWC 3CS7A 3URCA 1DOJA 5IDKA 3FZZA 3M3TA 1ETTH 1HUTH 4NSYA 2HNTE 3C1KA 1AKSA 4OGYA 1TNGA 1KTTB 2W3KA 4X6OA 1LKAA 1P03A 1GHVH 3M7UA 5EG4A 1HIAB 3OY6U 1HNEE 3SV9A 3SGQE 1GHAG 3QN7A 3G01A 5DP4A 1A3BH 2ZZUH 3Q3YA 1EJMA 2BZ6H 4WH8A 3RU4D 1IHSH 1K1LA 2R0LA 2FS8A 1Y5BT 1G2MA 3OY5U 4ZMAH 3UTUH 5HGGA 3M3SA 1S5SA 4YM9A 1DLKB 3SNCA 2G5VA 5E2OA 3VGCB 1PQ8A 1ZJKA 3A85A 2ZGBH 3GY2A 2ZFTA 1AZZA 5AFZH 2JH0D 3T28A 1JIRA 3K9XB 3ZZAA 1SLXB 2SGPE 2D2DA 3ATLA 1FV9A 6LPRA 3A89A 2V0BA 1DSUA 3RXHA 3D23A 1SHHB 1XUIA 1T8OA 3A86A 1ID5H 4NA9H 4B1TA 4X2VA 2FX6A 4KKDA 8GCHG 5IYTA 3OX7U 2BD8A 3MNXA 3ZVGA 4ESTE 1ORFA 3NUMA 1J16A 4Q7XA 3SQEE 5DP7A 3SJ8A 4SGAE 3PB1E 1NRRH 3SO3A 2B8OH 5DP8A 1GJ4H 1NC6A 1TONA 5FHTA 2AFQB 1ELCA 1GJDB 4JZDH 3HGNA 1C2GA 1X7AC 2TGTA 1GBKA 2ZC9H 3BIUH 3B8JA 3F6UH 1O3BA 3TVJB 1RD3B 1C4U2 3RMLH 2BD3A 1EATA 2HALA 2XBWA 4JZIA 1W7GH 3SU2A 1N1LA 3MHWU 3TGIE 4XSKU 2FTLE 1FI8A 3U8OH 1S83A 2A2XH 1HJAC 2BX3A 2BDCA 2GT7A 1BDAA 1EPTA 1HFDA 1O2KA 2BX4A 4WXVA 2WYJA 1Y3XA 5E0HA 1E37B 1MBQA 1S6HA 1O39A 1BTWA 3A87A 3F9GA 3QK1A 1J9CH 3GCOA 2W26A 2SNWA 1HV7A 1V2JT 1HAPH 1TIOA 5JDUB 2FODA 4JMYA 5DP6A 1DT2A 2Z3CA 3S7HB 3RXJA 2GDDA 1TA2A 3OU0A 1O3PB 1TNKA 1NROH 3HKIB 4AORA 1GBMA 2QXGA 1H8DH 1O5AB 3TPIZ 4BAHB 1QB1A 4ISNA 2VGCC 1NFXA 2A1DB 1NN6A 2A4QA 2A4OA 5CHAC 3VB7A 4FUCA 2FO9A 4BAMB 5C5NA 5DP5A 2NWNA 2NU4E 1YPGH 4ABGA 1D9IA 1HYLA 1P2JA 4MPXA 4GAWA 2BY9X 1NESE 1P9UA 2ZHWH 2BLWA 3BTHE 1FUJA 1ZZZA 1RS0A 2BHGA 1O2SA 2GT8A 1QJ1B 1A0LA 2ZTYA 3KQBA 3WY8A 3RXVA 1O2VA 3KGPA 1N8OC 1SLWB 1ELTA 1N6YA 1GHWH 2O9QA 2VB0A 5FPYA 1QA0A 1YPHC 1C4Y2 2D1JA 1HAIH 4RKJB 5G4BA 1KLJH 1AVWA 2J94A 3M5OA 3MO6A 5GIBA 1O2UA 2YOLA 1C5LH 2O8WA 3OSYA 1LVBA 4CR5A 2IPHA 2ZPQA 5F6MA 1ZPCA 1KSNA 4NA7A 1XKAC 4B75A 4O3UA 3P95A 4YO9A 2D26C 4CHAB 9ESTA 1P2MA 1GBFA 4GPGA 1GVZA 1NS3A 3L3TA 3SJKA 1C1WH 1E36B 1CVWH 2ZQ2A 4OS1A 1GVLA 1O5CB 1CBWB 2WPMS 4GHQA 5EW2H 3AAUA 4MPVA 1FIZA 1BCUH 7ESTE 1YLCA 3RXLA 2A4RA 2RCEA 3Q76A 1Y3WA 1OYQA 4AFZA 2C4FH 1HAVA 3Q3KA 4K1TA 3T27A 1LVYA 4CRBA 4ZHLU 2JH6D 1TLDA 4HFPB 4IBLH 3SQHE 4INHA 3U1IB 1V3XA 4NZQA 1K1NA 2B0FA 4B73A 1AN1E 1OWJA 3ZVEA 1UTLM 1IQNA 2FX4A 3RM2H 4YZUA 2FP7B 1UTQA 4K1SA 1AUJA 1TNHA 1TPSA 1C9PA 2VGCB 4CH2B 1GHBG 2A7CA 3KQCA 3Q3XA 5CHAB 4A5TS 5GJ4B 1C1TA 4VGCC 1L0ZA 2EC9H 2BLOA 3MMGA 2QC2A 4O97A 5LH8A 3AVZA 3RXEA 1K28D 4ABHA 4DJZB 2ZKSA 1QRWA 2XYAA 3RXMA 2H5DA 2ZDVH 1G3EA 2FDAA 3RMOH 4X1QU 3TITA 3MH5A 1BMAA 1YCPM 5HM2A 4U2WA 3UY9A 2NU1E 3SBKA 2OC8A 1DY8A 1XUGA 1A46H 4DG4A 2EI8A 3SORA 1AD8H 5FPTA 1CSOE 4O9VA 1MTNC 3HK3B 2F9UA 3ATWA 3SU0A 1YPEH 2O8TA 3A80A 5EPNA 1B7XB 2AERH 1GI4A 2WUBA 2BTCE 4HGCA 3ITIA 2SGQE 1XXDA 1P2QA 1O37A 4M7GA 1ANBA 1Z1IA 5HMAA 3BG4C 2BZAA
chains in the Genus database with same CATH superfamily
2BY8X 2BY6X 1AFQC 1C1PA 1SKYE 3BEUA 3FN8A 5TCCA 1NFWA 2FYQA 3SJ9A 1CA0B 2WV4A 3T29A 3BEIB 3A83A 3TJUA 2STAE 1F0SA 1YBWA 1ABIH 4UFGH 4WVPE 3OAAD 1HBTH 1OOKB 1P3EA 2OBOA 1GMDG 1P2OA 2WPKS 1WSSH 3VB5A 2BOKA 3SI4H 2OCVB 2JDID 2J98B 3BN9A 3W94A 2BD9A 5LPRA 4ABDA 1S6FA 1QQ4A 3GCHB 1DWCH 1MBMA 3W95A 2BY7X 3GY6A 4YOIA 1MKXK 2QGRA 2H1UA 3RXPA 3GY3A 2PKSB 3U8TH 1DM4B 4XFQA 1MH0A 1THRH 1GCTB 3VFEA 4K1EA 3AASA 4X1SU 1D3QB 1HAYB 4IN2A 1VITF 2ANMH 2QN5T 1OWKA 1C5VA 1GGDC 3GYLB 2GCTB 1KLIH 3GCTG 3SU3A 3UFAA 1T4UH 4MVNA 1FY8E 2QF0A 1BB0B 2A7JA 4F49A 1GBDA 3PMAB 3N7DA 2J38A 1GMCG 1ZRKA 2GJGA 5GCHF 1SC8U 3OTJE 1O2GH 3ZV8A 3VB3A 5K0HA 1H9IE 2PWXA 3LC3A 3PWBA 1UJ1A 1BBRE 1HDTH 1Y5UT 4IW4E 2HLCA 1JIMA 2PUQH 1KY9A 1Z8IB 2Z9LA 5T3HA 1OPHB 1Y3UA 2Q6GA 5I25A 1ZPBA 1WAYB 3E16B 1J15A 1DXPA 3D62A 5DKMA 1SOTA 1SQOA 4AGJA 1Y8TA 2BMGB 5ABWA 3SV6A 3H5CB 1NRSH 1W0JD 1O2TA 2FOBA 4Q2KA 2RG3A 4A1VA 1P3CA 2Y5HA 2Z3EA 1RGQA 1PPEE 1O2OA 1OWIA 2QYIA 1LCYA 1B5GH 1L4ZA 1HRTH 1T8NA 2H9TH 2JH5D 2QXIA 3KL6A 3VB6A 2FYRA 3EAJA 2FPZA 2VJ1A 5C1XA 2XC5A 5AVDA 4KP0A 1T4VH 2A32A 4FUIA 1EAWA 3DSPA 4NIYA 3SZNA 1ARCA 4B2CA 2VIVA 4AB8A 3ZZCA 3BTDE 2A5AA 3GCNA 3ODDA 3F2HA 1GI6A 1A5IA 1AO5A 4BXSA 1THSH 3LDXH 4OS5A 1O35A 3L33A 4NCYA 3KN2A 4ZXYH 2SGFE 1HCGA 1SVPA 4LK4A 4CBNA 1COWD 3P6ZB 4YLUA 2OQ5A 3MU1A 2ZGJA 1EB1H 5C2ZA 3EQ0H 1C5QA 4F48B 4B6FA 5E8EH 1A7SA 1VKYA 1MCVA 1V2LT 1K0HA 1SPJA 1K9OE 1IQLA 2CGAA 3QGNB 2VIQA 1CU1A 4YOJA 3A8AA 1O3MA 3ZV9A 1CA8B 1GBHA 1H9HE 2TGDA 1O33A 1SGCA 1BMNH 1W13U 1ELVA 2P3UB 3SV7A 2G81E 4X2WA 4AGKA 1TMTH 2ALVA 1OWEA 1U6QA 1O2YA 2L6OA 1FAXA 1Z8GA 4ZHMU 4B2AA 1VITH 1J17T 4YTAA 1GDUA 1JBUH 1TBRH 3KYFA 1MUEB 1S0QA 1EZSC 2PV9B 1KTSB 2EI7A 2WV5A 2YNAA 5AF9H 2VWOA 1CHOG 4X0WU 1KXEA 3GYMA 4THNH 1CQQA 4CRFA 5HYOA 1ZGIA 3SNBA 3KNXA 2K0QA 3SNAA 3A8DA 4DT7B 6ESTA 2FOAA 3MQKC 4FUHA 2NU2E 2W6JD 5CE1A 1O2QA 1QA7A 1VZQH 4KTCA 2J92A 1XUKA 5EQRA 1FPCH 3P17H 1FDPA 1SGFG 1V2KT 1V2ST 3RP2A 3U69H 4NFEA 2AMQA 4ACBA 5C0UA 2BD7A 3ZZ6A 4RSPA 1BTHH 1CT2E 1ELFA 1HXFH 5FBIA 4NA8A 3MO3A 2BLQA 3N7EA 3P8GA 3BEFB 1KXBA 1G3CA 3PLBA 2SNVA 3N99A 1F7ZA 1QBVH 1VJ9U 1DPOA 3A7TA 1SMFE 2F9BH 2GD4B 5DK1A 1IHTH 4U01A 2F9NA 4CR9A 3P8NA 4D7FA 3FP6E 4NZLA 1W14U 2HLDD 1YM0A 4UFDH 2BVSH 2Y5GA 1TRMA 3TH2H 5B6OA 1YY3A 1FY4A 1SHYA 3M7QA 3RXOA 4FUJA 5KECA 1Z6JH 4UE7H 3PRDA 1QTFA 1K1IA 2V7QD 1MD8A 2PKAA 1O3NA 2G4TA 3ZZ9A 3RLYH 1RTKA 1CE5A 3U8RH 1C1UH 3LONA 1YCPK 1A5GH 1GI7B 1AI8H 1EOJA 1D3TB 2R3YA 3A7WA 4AN7A 2CK3D 3MH6A 1C5WB 2YNBA 4WWYA 4A1XA 2OQUA 8KME2 4Q80A 1BT7A 2Z3DA 1AKSB 3RU4T 1HGTH 1GI5A 2ZDKA 5DN6D 4I8GA 1F0TA 4HTCH 5DJ7A 4BTUB 2AGIX 1QIXB 2JETB 1DANH 4IMQA 3BTGE 3UQVA 2IJD1 4JZFH 1ARBA 1IOEA 3K2UA 1Z7KA 4U32A 4R8TB 3Q77A 1NT1A 3QDZB 2VINA 3H7OA 1NFUA 3S9BA 5EJ1A 2BD4A 3VXFH 1DUEA 2BQWB 1G37A 3TJVA 1FPHH 1QCPA 2UUYA 1ZPZA 2OP9A 1KYNA 5C20A 5LPEA 1TGNA 4INLA 5AHGH 4E7NA 1GHYH 1C2EA 1Q31A 3BTFE 4I7YH 2B7DH 4H4FA 1MZDA 1IQKA 2ODPA 1JXPA 1WTHD 1SGNE 5L30H 5TCAA 1FN8A 1HJ9A 4GUXA 3SU6A 4DOQA 2F43B 4Q63A 4FU9A 4JCNA 5EXLA 1VR1H 1FQ3A 1DSTA 2Y5FA 1KXFA 1A3EH 1P57B 2R2WU 1C2DA 1UVPA 3R0FA 4Y0YE 1ZJDA 1ZHPA 1SQTA 3IG6B 4LOYH 3PV4A 2FOFA 1EX3A 4DY7B 1SFIA 1FAKH 1O2HA 8LPRA 3RXKA 1JMOH 3A84A 3VG8A 2AH4X 2C3SA 4Y7AA 3VXEH 1ZHRA 4HG6A 1GJ8B 2J34A 3IWMA 3SI3H 1PQ5A 3F9EA 3F2GA 2O8MA 1YP9A 4AFSA 1AHTH 2FS9A 4K8YA 2TPIZ 3TNTA 2D8WA 1TQ0B 1OP8A 4DIHH 1TX7A 4H6SB 2KCOA 1IQIA 1EJAA 1QQUA 4ZKSU 1UVOA 2A2QH 4GCHF 4ISHH 2P8OC 1RTFB 3I78A 3TIUA 2OBQA 1QURH 1EPTB 3F9FA 2BXTH 3LGYA 1RIWB 1A5HA 1ESTA 1LDTT 3STJA 2XXLA 4A92A 5E2PA 3H09A 1BOQA 3R3GB 3UQOA 2ZECA 2BYAX 1YCPH 1C5OH 2ZO3H 1UMAH 1EAIA 2F4LA 3SU5A 4AYVB 2J95A 3VPKA 2ZIQH 2THFB 3MYWA 2WPIS 3BSQA 4YLQH 1WCZA 4NIVA 1F0RA 2IOTA 1K22H 2AIPA 2ODYB 5HIYA 3EYDA 4ZKNU 4X2YA 3ZYDA 3NCLA 2Z9JA 1LKBA 1BMMH 1VCWA 4XD7D 8GCHF 5JBAS 1C1NA 5AFYH 1QY6A 3ZVBA 4Y8ZA 3O8RA 1FONA 2LNCA 1QB6A 2JKHA 3FFGA 4ASUD 5DP9A 3AW1A 1GDQA 3RXQA 1ZTLA 1K1PA 1E38B 1PPZA 1JRSA 1C2KA 1GI8B 5GWZA 1DICA 5TJXA 1ELAA 1LPGB 1C1QA 2HPPH 4DW2U 2VIDA 5EJZA 3WW7A 1FN6A 1QGFA 1S81A 1OYTH 3KF2A 1YYY1 2SGAA 1P10A 2QA9E 3SGBE 4ABFA 2B5TB 1NU7B 4MPUA 4AFUA 4ZKRU 3ZZBA 3MH7A 2RA0A 4TWYA 2CXVA 4ABBA 1V2QT 3SNDA 2F9VA 3C27B 1GBEA 4XDEA 2ZA5A 2DE8A 4X8VH 4IMZA 2W3IA 3B9FH 2HNTF 2JJ2D 3FZDA 2ZFQH 2AGGX 2M5TA 1YPLH 2BQ7B 5H4IB 2C8XB 3TU7H 3V12A 1KDQA 4X1PU 3A8BA 2BDBA 1EUFA 1UK4A 2KZ4A 1YKTA 1F0UA 2ZTZA 2ZCHP 3QGJA 3M35A 1Z8RA 3U98H 2W7SA 4ZH8A 3NKKA 1ZMNA 3NZIA 2GGVB 3TLOA 1BITA 4AB9A 1TRYA 2KCAA 2ESTE 3MNSA 3A82A 4RKOB 4Y71A 3UR6A 1O3EA 1TOCB 3LH3A 2VWNA 2BLVA 1HAZB 2XC4A 3I29A 1HJAB 2FOHA 3VEQB 2VWMA 2KAIA 4GLYA 2KAIB 3B23B 4DURA 1UVSH 1V2WT 2G52A 1F92A 1ESBA 2ZDNA 3JZ2B 1LMWB 7GCHG 3DD2H 1EJNA 4UFFH 3S69A 1HAVB 1QZ8A 3EA7A 2OK5A 4K8BA 4NWLA 1O2NA 3AAVA 5A8XA 2VU8E 3PTBA 4RN6A 1LQDB 1SLVB 1LHCH 3UOPA 4BNRA 3NPSA 2F83A 3E1XB 2ANKH 5EODA 1M9UA 4ZXXH 1JOUB 5FBEA 2KCYA 3GDVA 1S84A 3RC6A 4JZEH 4YT6H 3QTVH 3PMBB 1OSSA 4I86A 4A6LA 1P2IA 1UTOA 2VH6A 2XTTB 1DX5M 2F9OA 1ELDE 4TY6A 3QTOH 1DXWA 1TX8A 3BTME 1P2KA 1W12U 2F3CE 5A2MH 3LJOA 3LJJA 2ZPSA 3FAOA 5JYIA 3PM3A 2CV3A 3RXGA 1NTPA 2RA3A 1P2NA 2G51A 1GWAA 3SW2B 3TH3H 4UD9H 2IN2A 1GI2A 3HKJB 1SBWA 4OS7A 3LPRA 2V3MA 2UWOA 2C90B 1XVMA 5F8XA 3M7TA 4Y6DA 2G8TA 2SFAA 3LGTA 1O2XA 1TABE 1ZSKA 2GMTC 1GMHG 3F0PA 1DDJA 4X1RU 4BAKB 4LZ4B 3UUZA 1N8OB 1E34B 1TAWA 2XW9A 3QLPH 3SYJA 1HAOH 4X6MA 4RI0A 1RJXB 2AGEX 4F55A 2P95A 1ESAA 1Z71A 2ZU5A 4DCDA 5F8ZA 1O2RA 3ZVAA 3K6ZA 2ZFSA 2HOBA 2WZQA 3LGIA 5CMXH 2ZGHA 2VIPA 1SGRE 3PTNA 1NRPH 1UK2A 2R3UA 1O31A 1L4DA 1XX9A 4I8JA 1TGBA 2FIRH 1QR3E 4TWWA 2K8IA 3K6YA 2STBE 1ZTJA 4KELA 5T6FA 3KIDU 4I8LA 1A1RA 5ESTE 3PYHA 4E7RG 1W0KD 5BRRE 1QNJA 1GJ9B 2BQ6B 1BIOA 2V3HH 3JZ1B 4AX9H 4BTTB 4B76A 4QT8C 5GCHG 3DFJA 1TGTA 1MCTA 1SGFA 2WYGA 1UCYK 2KFWA 3BV9B 4AFQA 4E05H 1F5LA 1NM6A 1GBCA 1EQ9A 5JPMH 3A81A 1IAUA 3E0PB 1THPB 3TJNA 2QAAA 1HLTH 3GY4A 1O5GH 1CGHA 1W2KH 3NK8A 3BG8A 1LVOA 4MTBA 5L2ZH 1KXAA 1C4V2 4MQAA 1W11U 2KM0A 4B2BA 3V0XA 1O2ZA 1NRQH 2FI3E 1O2IA 3TGJE 1K2I1 2W7UA 3SV8A 2QF4A 3UB0A 1JRTA 2BDAA 2UUFB 3A7VA 4NWKA 1T32A 1FLEE 4D9RA 3GICB 5BPEA 4KTSA 3UNSA 3ZZ7A 3ESTA 2XNDD 2ZFFH 1GI0A 3M5MA 2W5EA 2FZZA 4H42U 2PHBA 5FCKA 2BVXH 1ZR0A 4VGCB 2O8LA 3D65E 5T6GA 2GX4A 1UTMA 3TGKE 2AMDA 4FUFA 5B6LA 2UWPA 1AVXA 1O0DH 4BANB 3PV5A 1GBLA 5PTPA 2J2UA 3QO6A 1CGJE 2BXUH 3E8LA 4Q4LA 2Y7XA 1BTUA 5FX5A 3ZVDA 1SI5H 3MU4A 1P06A 3ZZ5A 5C1UA 1C5XB 2G5NA 2CHAC 4NFFA 1N6XA 1GJ5H 1MABB 4IS5A 3E91A 3ZVCA 1HXEH 2F91A 2QY0B 1O3LA 2AIQA 3MNCA 1WOFA 3HPTB 5SGAE 1MTNB 1G3BA 3SV2H 1SL3A 2CF9H 3UNQA 3P70B 3F68H 1H8IH 5GXPA 1PPBH 3EA9A 3DSGA 5C1YA 2ZWLH 2PTNA 4NIWA 1AZ8A 2FESH 3STIA 3P8FA 1C1VH 1IQHA 3BG4B 1OWDA 3FP8E 5HIZA 2WPHS 1GBAA 4OS4A 2ZFPH 3LT3A 2QV1A 4AOQA 1AFQB 1EAXA 1FY3A 1ABJH 2ZCKP 1TWXB 5T1VA 2NU0E 1J14A 4WMDA 3RXTA 3S0NA 2ZQ1A 1VCQA 1WTGH 1FJSA 2GZ7A 5KGOA 8ESTE 2R0KA 1TBZH 3DHKH 3FOAA 3SUDA 1DS2E 1RTLA 4TPYA 1GBIA 2BB4A 4OGXA 1AWHB 1UO6A 5DSFA 1C2LA 1TPOA 3SHAH 2P93A 1E79D 2VVVA 4Q7YA 2QE7D 3A7ZA 1C2MA 3BTTE 2J9NA 2B9LA 3D49H 3UWIA 1OS8A 1HPGA 3HK6B 3RXFA 1UCYH 1NPMA 1O3CA 1GHXH 4XOJA 1GBBA 1QBOA 1O5FH 2ZDMA 5FX6A 1TYNA 1S0RA 3TK5A 1P05A 1WU1A 2ULLA 4K5ZA 2QXHA 1L1JA 1PYTC 2H9EH 1GHZA 1UVUH 3NXPA 3SJOA 2H2ZA 4GHTA 1P0SH 5A0CA 2ZI2H 4XBBA 1DITH 2EA3A 3UPEA 5DO4H 2QIQA 1INCA 1KXCA 1TGSZ 3QX5H 3BTKE 3TNSA 4D9QA 1XUFA 2A31A 1NFYA 6GCHF 3S7KB 1NBMD 1P01A 4JK5A 1GGDB 1P11E 4JK6A 1ZSLA 1A0JA 1AY6H 5L6NH 2ZHDA 3BTEE 3RM0H 4Y0ZE 1MD7A 3FANA 1V6DA 1ZOMA 1HAHH 3PLKA 2FLRH 4FU7A 4HZHA 3RLWH 3EE7A 4CRCA 1GI9B 1S82A 2WPJS 3T2NA 2GKVE 3RXDA 4OS2A 1MQ6A 3OTPA 1ANDA 2DUCA 4IGDA 3V3MA 1V2PT 2FOEA 3UOUA 3PMJA 3UNRA 1SLUB 5HM9A 3EDXB 2OUAA 1TBQH 1TGCA 2RDLA 3VGCC 1TB6H 3T25A 4WXIA 3RMNH 4H6TA 3RXCA 1AB9C 1C2IA 2OC1A 1FNIA 1F5RA 1VGCC 1ZHMA 1GBJA 3M37A 2FWWA 2LP6A 1EAUA 1GVKB 1MTSA 2ZCLP 2ZP0H 4ZCNA 1BQYA 2ZPRA 3ATIA 2ASUB 1J8AA 2HWLB 4YXWD 1PQAA 3EA8A 2G55A 5JBCS 2QCYA 4FVBA 1T8LA 3ZZDA 3LGVA 4O03A 4FUGA 2CJIA 1QBNA 3QUMP 4MNWA 1MTVA 1AE5A 1T7CA 1O2WA 1BMFD 3EE0B 1Y3YA 5EPYA 2KR7A 2FXRA 3LKWA 4SGBE 4R0IA 2TGPZ 1GDNA 1P04A 2PKAB 3SN8A 3ATMA 4INKA 4WMEA 4GSOA 4Y76A 2XCNA 5FXLA 1QL9A 1B0FA 5K7RA 2Q6DA 1LO6A 1MU8B 3I77A 1F2SE 3CENA 5DG6A 1YGCH 3T5FH 1V2OT 1YLDA 2OC7A 2YMSC 1FMGA 5T6DA 1AVGH 3M36A 3SUFA 3URDA 1CHOF 2GCHF 1ZTKA 2XWBI 1O3AA 4MLFB 1NRNH 3SUGA 5JB8S 4K3JA 1FXYA 1NZQH 4X8SH 4ASHA 1QHRB 4Y11E 4ZUHA 1GI3A 4X8TH 2C93B 2ZHEH 4FUDA 4HI3A 1EZXC 2VVUA 1GG6C 1A0HB 2Z7FE 1ELGA 3MOCA 1YPMH 1O30A 1C9TA 3N7OA 4K69A 2FI4E 1UTKA 1LHGH 2H6MA 3LOXA 4Q7ZA 3LGWA 1C2JA 1QFKH 1Q2WA 1G9IE 1HIAA 1SR5C 3TH4H 2XOKD 1NU9A 4NSVA 1PPCE 2M2AA 1GL0E 1UTJA 1ELBA 1OX1A 4X8UH 4ABIA 1C1OA 1H8ED 5J4QA 1OP2A 3RXAA 3IITA 5GPIB 2C8WB 2ZFRH 1AIXH 1MKWK 2Y6TA 2PSXA 4GCHG 1G2LA 3MFJA 2BOHB 3MI4A 4MPWA 4ABEA 2TRMA 3P8OA 5JBTA 1KXDA 1YPKH 5C0TA 3UIRA 2P59A 2TGAA 4X2XA 2ZGXH 5EU8A 1QL7A 1IQEA 2HVXA 4CH8B 1DUAA 1TNJA 1GL1A 3TJOA 5C3NA 1AB9B 3EGKH 4ACAA 1LHEH 7LPRA 3M3VA 1VGCB 1W0ZU 3GY5A 4JYTA 4ZHAA 1IQGA 1O2LA 1FX0B 2PLXA 4FUBA 5F8TA 4X6PA 2K1QA 1DFPA 3AW0A 3E0NB 1EASA 4X6NA 1G32B 1W10U 5GNDA 2NU3E 4X1NU 1GCDA 5CDFE 2P3FH 1GHAF 1RFNA 2A0QB 1SGTA 2OLGA 2XNIA 2C8ZB 3F2FA 1YWUA 1TX6A 3O8CA 2FLBH 2A45B 3RXRA 1C2HA 1MTWA 3KCGH 1WBGB 2FOCA 1L1GA 3PWCA 5DPAA 1D6RA 1AWFH 2Z9IA 1O2PA 2XRCA 1LVMA 1SQAA 2Z6BD 1HAXB 1K21H 4F4OC 2QF5A 1CGIE 5A0AE 1ZYOA 2BD5A 3F1SB 4I32A 4CHAC 1D4PB 3SHCH 2WSSD 1WXRA 4MG3A 4O3TA 1BBRH 1O2JA 1O3IA 1CBWC 2PSYA 1E0FD 2GDEH 4IC6A 2ZDAH 1SGIB 1AU8A 1TOMH 2ZHQH 3QZRA 5EXNA 1G30B 1GG6B 1C5TA 5DP3A 3A8CA 3E3TA 2QF3A 4JZ1A 1EZUC 4I8HA 1YLNA 2A5IA 4J2YB 3T62A 1BTYA 1O2MA 2ZU3A 7KMEH 4AYYB 1BHXB 1YC0A 3RDZA 1O3HA 1TMUH 1XM1A 3TK6A 3GS9A 1GJ7B 1YPJH 1LPZB 1V2RT 2BY5X 3RMMH 1MTUA 3VB4A 2P94A 1GPZA 3L6PA 2PGBB 3S9CA 4XRNA 4TT3D 4NG9H 1F5KU 4U30A 1C2FA 2BVRH 5FL7D 5E0GA 5A8ZA 4IN1A 4TPIZ 1TALA 4YOGA 1SG8B 2ZU1A 2UUJB 3V13A 1UCYE 4B6EA 4Y10E 1H1BA 1PFXC 1D6WA 1E1QD 1MKWH 1W0YH 5ESBA 1XKBC 4PROA 1EP5A 1T31A 2FOMB 1ETRH 4DIIH 5GDSH 4UEHH 5JBBS 4CREA 2IJOB 2WINI 3A7XA 2PFEA 5F03A 1RRKA 1QL8A 4D8NA 2C8YB 1TFXA 4FU8A 4A1TA 3RUOA 2BDIA 2BDYA 3E90B 1KDQB 5ETXA 5A09A 1AMHA 4I33A 5EXMA 1ZRBA 1CHGA 4BOHA 4OM9A 1EOLA 2ZU4A 2XWAA 1AE8H 1SGDE 2EQNA 9LPRA 3F0OA 1AUTC 1XUHA 1SOZA 1W8BH 3H7TA 1PPHE 2EEKA 2FM2A 3ZZ8A 4WJG2 1O5DH 2P8OB 3LIWA 4A7IB 1JWTA 2F9PA 1WQVH 1DE7H 2RDEA 1CA0C 2UWLA 4I8KA 5EOKA 1TNIA 3PMHB 1H4WA 2SGEE 1V2MT 2Y81A 5EW1H 2CMYA 1GJ6A 1GJBB 3ENSB 2Q1JA 3HATH 2GTBA 3M61U 3RXBA 2A7HA 1OHHD 1C5NH 1ZGVA 1SGEE 1CO7E 2SGDE 4MNYA 1O5EH 3PRBA 3SGAE 1WYKA 1V2UT 2BD2A 1QRZA 3GCHC 3RU4E 1P8VC 2HRVA 3GOVB 3UWJH 1G3DA 4LXBH 1Y5AT 2G00A 1KIGH 1BJUA 3U1JB 2PKSC 4XBCA 3ODFA 1TMBH 1D3DB 5JB9S 2CF8H 2VIOA 1P09A 4RT0A 2GV7A 1KMHB 1Y3VA 1GCTC 4YESB 2BDHA 2XBYA 1BRUP 5FPSA 2FTMA 2FMJA 1FZZA 2ZDLA 2ALPA 4ZROA 4KTUA 4CRAA 3M5LA 2HGTH 2P3TB 2PGQB 3MO9A 2GCTC 2IPQX 4AG1A 2J4IA 4WMFA 3CS0A 1PJPA 5FAHA 1MAXA 1OP0A 5HKKD 1SGQE 1O3GA 3DA9B 3KQEA 4UDWH 1O32A 1SQRA 1C5PA 2ANYA 1EKBB 1O5BB 2ANWA 1O3FA 5C94A 2GVFA 1ZMJA 1LHFH 3RC4A 4RT1A 1UHBA 1BZXE 4BXWA 1UHBB 2R9PA 7GCHF 2XBVA 1P02A 2O8UA 3NWUA 2G4UA 3M5NA 1WDIA 3S9AA 1E1RD 1SB1H 1Z8JB 3ELAH 4LZ1H 2H9HA 1VJAU 2I6QA 1QRXA 1VITG 5LGOA 4TY7A 4CBOA 4D7GA 1A61H 2ZHFH 5EGMA 4CRDA 1CT4E 3RC5A 1A2CH 2EI6A 3RXIA 2PR3A 1GHBF 1QJ7B 2V35A 2VWLA 1XMNB 2WPLS 3GY7A 1LPKB 1EB2A 3BIVH 4ISOA 3ZZ3A 4Z1MD 1QB9A 1V2TT 3ATKA 1D3PB 4NGAH 1OWHA 4FUEA 4JYVH 4B74A 1FY1A 1C1RA 2HVYB 4ISIH 5J4SA 1MU6B 2OXSA 5E0JA 1LQEA 3GDUA 1MAYA 2CN0H 1C5RA 3LH1A 2XC0A 3LC5A 3HGPA 1W7XH 2J98A 1BJVA 4KGAA 2V3OH 3DUXH 1C1MA 2V6NA 2PP6A 1GJCB 1K1JA 1GMHF 3RXSA 4D76A 2UUKB 1ETSH 3DT0H 5A8YA 5I46H 1G36A 1TA6A 2GV6A 4K2YA 1BTPA 4ABAA 1O36A 2LPRA 3OYPA 2ZEBA 1BRBE 4DGJA 1O34A 3KHVA 1TNLA 1PPGE 3KQDA 1AFEH 3MU8A 3F3BA 3TK9A 1DY9A 1WV7H 4DVAU 2FOGA 1MMJN 1YPHE 1T8MA 6CHAC 2FI5E 3V7TA 1UTPA 2AS9A 3KQ5A 1HB0B 3LGUA 1DWBH 2Y7ZA 2ZU2A 1ZSJA 1QJ6B 3A7YA 5EQSA 3F9HA 3K65B 1BHXF 1L2EA 4YT7H 1Z6EA 1BUIA 4AZ2B 3PO1C 1ELEE 1FY5A 4AG2A 2PW8H 1SFQB 3MU5A 2GMTB 1GMDF 1O38A 2QXJA 2XCFA 2AEIH 4BTIB 1C1SA 5FCRA 5CHBA 2A5KA 2DE9A 5KEDA 3MU0A 4CRGA 1O3DA 1TPAE 1XVOA 2GZ8A 1DWDH 2HNTC 4MDSA 1O3KA 1UTNA 1B0EA 4MNXA 4Z0KA 5C5OA 1ANCA 1C5UA 1EZQA 1VCPA 5LPFA 5L2YH 4ABJA 5EQQA 3UR9A 1XUJA 3BTWE 1E35B 4P00A 2OTVA 1TPPA 2ZNKH 1LTOA 3WWBA 2AMPA 1DLEA 1OKXA 2BDGA 6GCHG 4Y7BA 4Y8XA 3BF6H 2Z9GA 1ZMLA 1O3JA 3DSOA 1PYTD 2VH0A 1C5MD 3P92A 1ANEA 3E6PH 2PTCE 1BA8B 1Q3XA 4K60A 1TRNA 3GCTF 3U9AH 2Z94A 1IQFA 4UFEH 1GMCF 4BAOB 1H9LB 1RXPA 3GY8A 1AQ7A 2P16A 1MZAA 1GBTA 4Y79A 3FP7E 4Y8YA 4DT4A 3GDSA 2VIWA 1HJ8A 2XBXA 1C5YB 4IC5A 1P9SA 2GZ9A 4XE4A 2H5CA 3SOSA 1BMLA 1C5SA 2ODQA 1L1NA 3NRLA 3UREA 1GJAB 2JJ1D 4NIXA 2ILNA 2HPQH 2ZTXA 4J1YA 3MNBA 3FKSD 1K1OA 3SU4A 5EIYA 3A88A 1UK3A 2Z9KA 4ZAEA 2JETC 1V2VT 1ZLRA 3RXUA 2TIOA 2ZG0H 1XXFA 1YF4A 3O8BA 4TYDA 2GP9B 3LU9B 3SUEA 1EFRD 4BAQB 3Q00A 4B71A 4ZKOU 3ZVFA 1DWEH 1MKXH 1TE0A 2KX4A 1PQ7A 2Q6FA 1UVTH 5A0BA 3QZQA 6CHAB 5HXFA 5C67A 2Y80A 1O3OA 3DFLA 1PPFE 1EP6A 1K1MA 1W3CA 2OD3B 1NY22 3QWCH 2ZGCA 2CHAB 2OINA 1CT0E 3PROA 4ISLA 4WY3A 3BTQE 2GCHG 1EXFA 1IQJA 3PO1B 4FVDA 1SGPE 3MWIU 2VVCA 3FVFB 2VBCA 1SGYE 3ZZ4A 1Y59T 5DGJA 3PLPA 1C5ZB 2PUXB 3PV2A 4MNVA 2YMSD 2WUCA 2FEQH 2BM2A 3KEEA 1P12E 4UONA 1BRAA 1TQ7B 1WQSA 1KLTA 3GISB 1OXGA 1WUNH 1IQMA 1BTXA 2AYWA 4OS6A 4Z6AH 2KCPA 3MTYA 4E06H 1S85A 1NO9H 3MH4A 4WH6A 3CP7A 4FXGH 1HAGE 2I6SA 2OC0A 3T26A 1MQ5A 2TBSA 1GI1A 3ZYEA 1BBRK 2Y82A 1ACBE 1BTZA 1BRCE 2VNTA 3SNEA 4GVUA 3SJIA 1DVAH 3OEED 4JYUH 2R2MB 3OE7D 1SSXA 2A4GA 2ZF0H 1V2NT 1Z1JA 1AGJA 1A4WH 2LELA 4AC9A 3SU1A 4I31A 3O8DA 1LHDH 1FIWA 4WF8A 1EPTC 4XBDA 1RIWC 3CS7A 3URCA 1DOJA 5IDKA 3FZZA 3M3TA 1ETTH 1HUTH 4NSYA 2HNTE 2L74A 3C1KA 1AKSA 4OGYA 1TNGA 1KTTB 2W3KA 5F53A 3CNRA 1LKAA 4X6OA 1P03A 1GHVH 3M7UA 5EG4A 1HIAB 3OY6U 1HNEE 2AHME 3SV9A 3SGQE 1GHAG 3QN7A 3G01A 5DP4A 1A3BH 2ZZUH 3Q3YA 1EJMA 3W1EA 2BZ6H 4WH8A 3RU4D 1IHSH 1K1LA 2R0LA 2FS8A 1Y5BT 1G2MA 3OY5U 4FETA 4ZMAH 3UTUH 5HGGA 3M3SA 1S5SA 4YM9A 1DLKB 3SNCA 2WPDD 2G5VA 5E2OA 3UAIC 3VGCB 1PQ8A 1ZJKA 3A85A 2ZGBH 3GY2A 2ZFTA 5IK2D 1AZZA 5AFZH 2JH0D 3T28A 1JIRA 3K9XB 3ZZAA 1SLXB 2SGPE 2D2DA 3ATLA 1FV9A 6LPRA 3A89A 2V0BA 1DSUA 3RXHA 3D23A 1SHHB 1XUIA 1T8OA 3A86A 1ID5H 4NA9H 4B1TA 4X2VA 4FOUC 2FX6A 4KKDA 8GCHG 5IYTA 3OX7U 2BD8A 3MNXA 3ZVGA 4ESTE 1ORFA 3NUMA 1J16A 4Q7XA 3SQEE 5DP7A 3SJ8A 3ZIAD 4SGAE 3PB1E 1NRRH 3SO3A 2B8OH 5DP8A 1GJ4H 1NC6A 1TONA 5FHTA 2AFQB 1ELCA 1GJDB 4JZDH 3HGNA 1C2GA 1S6LA 1X7AC 2TGTA 1GBKA 3U28C 2ZC9H 3BIUH 3B8JA 3F6UH 1O3BA 3TVJB 1RD3B 1C4U2 3RMLH 2BD3A 1EATA 2YMSB 2HALA 2XBWA 4JZIA 1W7GH 3SU2A 1N1LA 3MHWU 3TGIE 4XSKU 2FTLE 1FI8A 3U8OH 1S83A 2A2XH 1HJAC 2BX3A 2BDCA 2GT7A 1BDAA 1EPTA 1HFDA 1O2KA 2BX4A 4WXVA 2WYJA 1Y3XA 5E0HA 1E37B 1MBQA 1S6HA 1O39A 1BTWA 3A87A 3DCLA 3F9GA 3QK1A 1J9CH 3GCOA 2W26A 2SNWA 1HV7A 1V2JT 1HAPH 1TIOA 5JDUB 2FODA 4JMYA 4P02A 5DP6A 1DT2A 1NBME 2Z3CA 3S7HB 3RXJA 2GDDA 1TA2A 3OU0A 2RFKC 1H8HD 3FO8D 1O3PB 1TNKA 1NROH 3HKIB 4AORA 1GBMA 2QXGA 1H8DH 1O5AB 3TPIZ 4BAHB 1QB1A 4ISNA 2VGCC 1NFXA 2A1DB 1NN6A 2A4QA 2A4OA 5CHAC 3VB7A 4FUCA 2FO9A 4BAMB 4TSFD 5C5NA 5DP5A 2NWNA 2NU4E 1YPGH 4ABGA 1D9IA 1HYLA 1P2JA 4MPXA 4GAWA 2BY9X 1NESE 1P9UA 2ZHWH 2BLWA 3BTHE 1FUJA 1ZZZA 1RS0A 2BHGA 2EY4C 1O2SA 2GT8A 1QJ1B 1A0LA 2ZTYA 3KQBA 3WY8A 3RXVA 2W6ID 1O2VA 3KGPA 1N8OC 1SLWB 1ELTA 1N6YA 1GHWH 2O9QA 2VB0A 5FPYA 1QA0A 1YPHC 1C4Y2 2D1JA 1HAIH 4RKJB 5G4BA 1KLJH 1AVWA 2J94A 3M5OA 1UW7A 3MO6A 5GIBA 1O2UA 2YOLA 1C5LH 2O8WA 3OSYA 1LVBA 4CR5A 2IPHA 2ZPQA 5F6MA 1ZPCA 1KSNA 4NA7A 1XKAC 4B75A 4O3UA 3P95A 4YO9A 2D26C 4CHAB 9ESTA 1P2MA 1GBFA 5C17A 4GPGA 1GVZA 1NS3A 3L3TA 3SJKA 3AK5A 1C1WH 1E36B 3WWFA 1CVWH 2ZQ2A 4OS1A 1GVLA 1O5CB 1CBWB 2WPMS 4GHQA 5EW2H 3AAUA 2WHXA 4MPVA 1FIZA 1BCUH 7ESTE 1YLCA 3RXLA 2A4RA 2RCEA 3Q76A 1Y3WA 1OYQA 4AFZA 2C4FH 1HAVA 3Q3KA 4K1TA 5EJLA 1LVYA 3OEHD 3T27A 4CRBA 2JH6D 4ZHLU 1TLDA 4HFPB 4IBLH 3SQHE 4INHA 3U1IB 1V3XA 4NZQA 1K1NA 2B0FA 4B73A 1AN1E 1OWJA 3ZVEA 1UTLM 1IQNA 2FX4A 3RM2H 4YZUA 2FP7B 1UTQA 2JIZD 4K1SA 1AUJA 1TNHA 1TPSA 1C9PA 2VGCB 4CH2B 1GHBG 2A7CA 3KQCA 3Q3XA 5CHAB 4A5TS 5GJ4B 1C1TA 4VGCC 1L0ZA 2EC9H 2WV9A 2BLOA 3MMGA 2QC2A 4O97A 5LH8A 3OFND 3AVZA 3RXEA 3KYGA 1K28D 4ABHA 4DJZB 2ZKSA 1QRWA 2XYAA 3RXMA 2H5DA 2ZDVH 1G3EA 2FDAA 3RMOH 4X1QU 3TITA 3MH5A 1BMAA 1YCPM 5HM2A 4U2WA 3UY9A 2J5UA 2NU1E 3SBKA 2OC8A 1DY8A 4M9FA 1XUGA 1A46H 4DG4A 2EI8A 3SORA 1AD8H 5FPTA 1CSOE 4O9VA 2J97A 1MTNC 3SZEA 3HK3B 2F9UA 3ATWA 3SU0A 1YPEH 2O8TA 3A80A 5EPNA 1B7XB 2AERH 1GI4A 2WUBA 2BTCE 4HGCA 3ITIA 2SGQE 1XXDA 1P2QA 1O37A 4M7GA 1ANBA 1Z1IA 5HMAA 3BG4C 2BZAA
chains in the Genus database with same CATH topology
2BY8X 2BY6X 1AFQC 1C1PA 3BEUA 5TCCA 1NFWA 2FYQA 3SJ9A 1CA0B 2WV4A 3T29A 3BEIB 3A83A 3TJUA 2STAE 1F0SA 1YBWA 1ABIH 4UFGH 4WVPE 1HBTH 1OOKB 1P3EA 2OBOA 1GMDG 1P2OA 2WPKS 1WSSH 3VB5A 2BOKA 3SI4H 2OCVB 3BN9A 3W94A 2BD9A 5LPRA 4ABDA 1S6FA 1QQ4A 3GCHB 1DWCH 1MBMA 3W95A 2BY7X 3GY6A 4YOIA 1MKXK 2QGRA 2H1UA 3RXPA 3GY3A 2PKSB 3U8TH 1DM4B 4XFQA 1MH0A 1THRH 1GCTB 3VFEA 4K1EA 3AASA 4X1SU 1D3QB 1HAYB 4IN2A 1VITF 2ANMH 2QN5T 1OWKA 1C5VA 1GGDC 3GYLB 2GCTB 1KLIH 3GCTG 3SU3A 3UFAA 1T4UH 4MVNA 1FY8E 2QF0A 1BB0B 2A7JA 4F49A 1GBDA 3PMAB 2J38A 1GMCG 1ZRKA 5GCHF 1SC8U 3OTJE 1O2GH 3ZV8A 3VB3A 5K0HA 1H9IE 2PWXA 3LC3A 3PWBA 1UJ1A 1BBRE 1HDTH 1Y5UT 4IW4E 2HLCA 1JIMA 2PUQH 1KY9A 1Z8IB 2Z9LA 5T3HA 1OPHB 1Y3UA 2Q6GA 5I25A 1ZPBA 1WAYB 3E16B 1J15A 1DXPA 3D62A 5DKMA 1SOTA 1SQOA 4AGJA 1Y8TA 2BMGB 5ABWA 3SV6A 3H5CB 1NRSH 1O2TA 2FOBA 4Q2KA 2RG3A 4A1VA 1P3CA 2Y5HA 2Z3EA 1RGQA 1PPEE 1O2OA 1OWIA 2QYIA 1LCYA 1B5GH 1L4ZA 1HRTH 1T8NA 2H9TH 2JH5D 2QXIA 3KL6A 3VB6A 2FYRA 3EAJA 2FPZA 2VJ1A 5C1XA 2XC5A 5AVDA 4KP0A 1T4VH 2A32A 4FUIA 1EAWA 4NIYA 3SZNA 1ARCA 4B2CA 2VIVA 4AB8A 3ZZCA 3BTDE 2A5AA 3GCNA 3ODDA 1GI6A 1A5IA 1AO5A 4BXSA 1THSH 3LDXH 4OS5A 1O35A 3L33A 4NCYA 3KN2A 4ZXYH 2SGFE 1HCGA 1SVPA 4LK4A 4CBNA 3P6ZB 4YLUA 2OQ5A 3MU1A 2ZGJA 1EB1H 5C2ZA 3EQ0H 1C5QA 5E8EH 1A7SA 1MCVA 1V2LT 1SPJA 1K9OE 1IQLA 2CGAA 3QGNB 2VIQA 1CU1A 4YOJA 3A8AA 1O3MA 3ZV9A 1CA8B 1GBHA 1H9HE 2TGDA 1O33A 1SGCA 1BMNH 1W13U 1ELVA 2P3UB 3SV7A 2G81E 4X2WA 4AGKA 1TMTH 2ALVA 1OWEA 1U6QA 1O2YA 1FAXA 1Z8GA 4ZHMU 4B2AA 1VITH 1J17T 4YTAA 1GDUA 1JBUH 1TBRH 1MUEB 1S0QA 1EZSC 2PV9B 1KTSB 2EI7A 2WV5A 2YNAA 5AF9H 2VWOA 1CHOG 4X0WU 1KXEA 3GYMA 4THNH 1CQQA 4CRFA 5HYOA 1ZGIA 3SNBA 3KNXA 3SNAA 3A8DA 4DT7B 6ESTA 2FOAA 4FUHA 2NU2E 5CE1A 1O2QA 1QA7A 1VZQH 4KTCA 2J92A 1XUKA 5EQRA 1FPCH 3P17H 1FDPA 1SGFG 1V2KT 1V2ST 3RP2A 3U69H 4NFEA 2AMQA 2BD7A 3ZZ6A 4RSPA 1BTHH 1CT2E 1ELFA 1HXFH 5FBIA 4NA8A 3MO3A 2BLQA 3P8GA 3BEFB 1KXBA 1G3CA 3PLBA 2SNVA 1F7ZA 1QBVH 1VJ9U 1DPOA 3A7TA 1SMFE 2F9BH 2GD4B 5DK1A 1IHTH 4U01A 2F9NA 4CR9A 3P8NA 4D7FA 3FP6E 4NZLA 1W14U 4UFDH 1YM0A 2BVSH 2Y5GA 1TRMA 3TH2H 5B6OA 1FY4A 1SHYA 3M7QA 3RXOA 4FUJA 1Z6JH 4UE7H 1QTFA 1K1IA 1MD8A 2PKAA 1O3NA 2G4TA 3ZZ9A 3RLYH 1RTKA 1CE5A 3U8RH 1C1UH 3LONA 1YCPK 1A5GH 1GI7B 1AI8H 1EOJA 1D3TB 2R3YA 3A7WA 4AN7A 3MH6A 1C5WB 2YNBA 4WWYA 4A1XA 2OQUA 8KME2 4Q80A 1BT7A 2Z3DA 1AKSB 3RU4T 1HGTH 1GI5A 2ZDKA 4I8GA 1F0TA 4HTCH 5DJ7A 4BTUB 2AGIX 1QIXB 2JETB 1DANH 4IMQA 3BTGE 3UQVA 4JZFH 1ARBA 1IOEA 3K2UA 1Z7KA 4U32A 4R8TB 3Q77A 1NT1A 3QDZB 2VINA 3H7OA 1NFUA 3S9BA 2BD4A 3VXFH 1DUEA 2BQWB 1G37A 3TJVA 1FPHH 1QCPA 2UUYA 1ZPZA 2OP9A 1KYNA 5C20A 5LPEA 1TGNA 4INLA 5AHGH 4E7NA 1GHYH 1C2EA 1Q31A 3BTFE 4I7YH 2B7DH 4H4FA 1MZDA 1IQKA 2ODPA 1JXPA 1WTHD 1SGNE 5L30H 5TCAA 1FN8A 1HJ9A 4GUXA 3SU6A 4DOQA 4FU9A 4JCNA 5EXLA 1VR1H 1FQ3A 1DSTA 2Y5FA 1KXFA 1A3EH 1P57B 2R2WU 1C2DA 1UVPA 3R0FA 4Y0YE 1ZJDA 1ZHPA 1SQTA 3IG6B 4LOYH 3PV4A 2FOFA 1EX3A 4DY7B 1SFIA 1FAKH 1O2HA 8LPRA 3RXKA 1JMOH 3A84A 2AH4X 2C3SA 4Y7AA 3VXEH 1ZHRA 1GJ8B 2J34A 3IWMA 3SI3H 1PQ5A 3F9EA 2O8MA 1YP9A 4AFSA 1AHTH 2FS9A 4K8YA 2TPIZ 3TNTA 2D8WA 1TQ0B 1OP8A 4DIHH 1TX7A 4H6SB 1IQIA 1EJAA 1QQUA 4ZKSU 1UVOA 2A2QH 4GCHF 4ISHH 2P8OC 1RTFB 3I78A 3TIUA 2OBQA 1QURH 1EPTB 3F9FA 2BXTH 3LGYA 1RIWB 1A5HA 1ESTA 1LDTT 3STJA 2XXLA 4A92A 5E2PA 1BOQA 3R3GB 3UQOA 2ZECA 2BYAX 1YCPH 1C5OH 2ZO3H 1UMAH 1EAIA 3SU5A 4AYVB 2J95A 3VPKA 2ZIQH 2THFB 3MYWA 2WPIS 3BSQA 4YLQH 1WCZA 4NIVA 1F0RA 2IOTA 1K22H 2AIPA 2ODYB 3EYDA 4ZKNU 4X2YA 3ZYDA 3NCLA 2Z9JA 1LKBA 1BMMH 1VCWA 8GCHF 5JBAS 1C1NA 5AFYH 1QY6A 3ZVBA 4Y8ZA 3O8RA 1FONA 2LNCA 1QB6A 2JKHA 3FFGA 5DP9A 3AW1A 1GDQA 3RXQA 1ZTLA 1K1PA 1E38B 1PPZA 1JRSA 1C2KA 1GI8B 5GWZA 1DICA 5TJXA 1ELAA 1LPGB 1C1QA 2HPPH 4DW2U 2VIDA 1FN6A 1QGFA 1S81A 1OYTH 3KF2A 1YYY1 2SGAA 1P10A 2QA9E 3SGBE 4ABFA 2B5TB 1NU7B 4MPUA 4AFUA 4ZKRU 3ZZBA 3MH7A 2RA0A 4TWYA 2CXVA 4ABBA 1V2QT 3SNDA 2F9VA 3C27B 1GBEA 4XDEA 2ZA5A 2DE8A 4X8VH 4IMZA 2W3IA 3B9FH 2HNTF 3FZDA 2ZFQH 2AGGX 2M5TA 1YPLH 2BQ7B 5H4IB 2C8XB 3TU7H 3V12A 1KDQA 4X1PU 3A8BA 2BDBA 1EUFA 1UK4A 1YKTA 1F0UA 2ZTZA 2ZCHP 3QGJA 3M35A 1Z8RA 3U98H 2W7SA 4ZH8A 3NKKA 1ZMNA 3NZIA 2GGVB 3TLOA 1BITA 4AB9A 1TRYA 2ESTE 3MNSA 3A82A 4RKOB 4Y71A 3UR6A 1O3EA 1TOCB 3LH3A 2VWNA 2BLVA 1HAZB 2XC4A 3I29A 1HJAB 2FOHA 3VEQB 2VWMA 2KAIA 4GLYA 2KAIB 3B23B 4DURA 1UVSH 1V2WT 2G52A 1F92A 1ESBA 2ZDNA 3JZ2B 1LMWB 7GCHG 3DD2H 1EJNA 4UFFH 3S69A 1HAVB 3EA7A 4K8BA 4NWLA 1O2NA 3AAVA 5A8XA 2VU8E 3PTBA 4RN6A 1LQDB 1SLVB 1LHCH 3UOPA 4BNRA 3NPSA 2F83A 3E1XB 2ANKH 5EODA 1M9UA 4ZXXH 1JOUB 5FBEA 3GDVA 1S84A 3RC6A 4JZEH 4YT6H 3QTVH 3PMBB 1OSSA 4A6LA 1P2IA 1UTOA 2VH6A 2XTTB 1DX5M 2F9OA 1ELDE 4TY6A 3QTOH 1DXWA 1TX8A 3BTME 1P2KA 1W12U 2F3CE 5A2MH 3LJOA 3LJJA 2ZPSA 3FAOA 5JYIA 3PM3A 2CV3A 3RXGA 1NTPA 2RA3A 1P2NA 2G51A 1GWAA 3SW2B 3TH3H 4UD9H 2IN2A 1GI2A 3HKJB 1SBWA 4OS7A 3LPRA 2UWOA 2C90B 1XVMA 5F8XA 3M7TA 4Y6DA 2G8TA 2SFAA 3LGTA 1O2XA 1TABE 1ZSKA 2GMTC 1GMHG 1DDJA 4X1RU 4BAKB 4LZ4B 3UUZA 1N8OB 1E34B 1TAWA 2XW9A 3QLPH 1HAOH 4X6MA 1RJXB 2AGEX 2P95A 1ESAA 1Z71A 2ZU5A 4DCDA 5F8ZA 1O2RA 3ZVAA 3K6ZA 2ZFSA 2HOBA 3LGIA 5CMXH 2ZGHA 2VIPA 1SGRE 3PTNA 1NRPH 1UK2A 2R3UA 1O31A 1L4DA 1XX9A 4I8JA 1TGBA 2FIRH 1QR3E 4TWWA 3K6YA 2STBE 1ZTJA 4KELA 5T6FA 3KIDU 4I8LA 1A1RA 5ESTE 3PYHA 4E7RG 5BRRE 1QNJA 1GJ9B 2BQ6B 1BIOA 2V3HH 3JZ1B 4AX9H 4BTTB 4B76A 4QT8C 5GCHG 3DFJA 1TGTA 1MCTA 1SGFA 2WYGA 1UCYK 3BV9B 4AFQA 4E05H 1F5LA 1NM6A 1GBCA 1EQ9A 5JPMH 3A81A 1IAUA 3E0PB 1THPB 3TJNA 2QAAA 1HLTH 3GY4A 1O5GH 1CGHA 1W2KH 3NK8A 3BG8A 1LVOA 4MTBA 5L2ZH 1KXAA 1C4V2 4MQAA 1W11U 4B2BA 3V0XA 1O2ZA 1NRQH 2FI3E 1O2IA 3TGJE 1K2I1 2W7UA 3SV8A 1JRTA 2BDAA 2UUFB 3A7VA 4NWKA 1T32A 1FLEE 4D9RA 3GICB 5BPEA 4KTSA 3UNSA 3ZZ7A 3ESTA 2ZFFH 1GI0A 3M5MA 2W5EA 2FZZA 4H42U 2PHBA 5FCKA 2BVXH 1ZR0A 4VGCB 2O8LA 3D65E 5T6GA 2GX4A 1UTMA 3TGKE 2AMDA 4FUFA 2UWPA 1AVXA 1O0DH 4BANB 1GBLA 5PTPA 2J2UA 3QO6A 1CGJE 2BXUH 3E8LA 2Y7XA 1BTUA 5FX5A 3ZVDA 1SI5H 3MU4A 1P06A 3ZZ5A 5C1UA 1C5XB 2G5NA 2CHAC 4NFFA 1N6XA 1GJ5H 4IS5A 3E91A 3ZVCA 1HXEH 2F91A 2QY0B 1O3LA 2AIQA 3MNCA 1WOFA 3HPTB 5SGAE 1MTNB 1G3BA 3SV2H 1SL3A 2CF9H 3UNQA 3P70B 3F68H 1H8IH 5GXPA 1PPBH 3EA9A 5C1YA 2ZWLH 2PTNA 4NIWA 1AZ8A 2FESH 3STIA 3P8FA 1C1VH 1IQHA 3BG4B 1OWDA 3FP8E 2WPHS 1GBAA 4OS4A 2ZFPH 3LT3A 2QV1A 4AOQA 1AFQB 1EAXA 1FY3A 1ABJH 2ZCKP 1TWXB 2NU0E 1J14A 4WMDA 3RXTA 3S0NA 2ZQ1A 1VCQA 1WTGH 1FJSA 2GZ7A 8ESTE 2R0KA 1TBZH 3DHKH 3SUDA 1DS2E 1RTLA 4TPYA 1GBIA 2BB4A 4OGXA 1AWHB 1UO6A 1C2LA 1TPOA 3SHAH 2P93A 2VVVA 4Q7YA 3A7ZA 1C2MA 3BTTE 2J9NA 2B9LA 3D49H 3UWIA 1OS8A 1HPGA 3HK6B 3RXFA 1UCYH 1NPMA 1O3CA 1GHXH 4XOJA 1GBBA 1QBOA 1O5FH 2ZDMA 5FX6A 1TYNA 1S0RA 3TK5A 1P05A 1WU1A 2ULLA 4K5ZA 2QXHA 1L1JA 1PYTC 2H9EH 1GHZA 1UVUH 3NXPA 3SJOA 2H2ZA 4GHTA 1P0SH 5A0CA 2ZI2H 4XBBA 1DITH 2EA3A 3UPEA 5DO4H 2QIQA 1INCA 1KXCA 1TGSZ 3QX5H 3BTKE 3TNSA 4D9QA 1XUFA 2A31A 1NFYA 6GCHF 3S7KB 1P01A 4JK5A 1GGDB 1P11E 4JK6A 1ZSLA 1A0JA 1AY6H 5L6NH 2ZHDA 3BTEE 3RM0H 4Y0ZE 1MD7A 3FANA 1V6DA 1ZOMA 1HAHH 3PLKA 2FLRH 4FU7A 4HZHA 3RLWH 4CRCA 1GI9B 1S82A 2WPJS 3T2NA 2GKVE 3RXDA 4OS2A 1MQ6A 1ANDA 2DUCA 4IGDA 3V3MA 1V2PT 2FOEA 3UOUA 3PMJA 3UNRA 1SLUB 5HM9A 3EDXB 2OUAA 1TBQH 1TGCA 2RDLA 3VGCC 1TB6H 3T25A 4WXIA 3RMNH 4H6TA 3RXCA 1AB9C 1C2IA 2OC1A 1FNIA 1F5RA 1VGCC 1ZHMA 1GBJA 3M37A 2FWWA 1EAUA 1GVKB 1MTSA 2ZCLP 2ZP0H 1BQYA 2ZPRA 3ATIA 2ASUB 1J8AA 2HWLB 1PQAA 3EA8A 2G55A 5JBCS 2QCYA 4FVBA 1T8LA 3ZZDA 3LGVA 4O03A 4FUGA 2CJIA 1QBNA 3QUMP 4MNWA 1MTVA 1AE5A 1T7CA 1O2WA 3EE0B 1Y3YA 5EPYA 2FXRA 3LKWA 4SGBE 4R0IA 2TGPZ 1GDNA 1P04A 2PKAB 3SN8A 3ATMA 4INKA 4WMEA 4GSOA 4Y76A 2XCNA 5FXLA 1QL9A 1B0FA 5K7RA 2Q6DA 1LO6A 1MU8B 3I77A 1F2SE 3CENA 5DG6A 1YGCH 3T5FH 1V2OT 1YLDA 2OC7A 5T6DA 1FMGA 3SUFA 1AVGH 3M36A 3URDA 1CHOF 2GCHF 1ZTKA 2XWBI 1O3AA 4MLFB 1NRNH 3SUGA 5JB8S 4K3JA 1FXYA 1NZQH 4X8SH 4ASHA 1QHRB 4Y11E 4ZUHA 1GI3A 4X8TH 2C93B 2ZHEH 4FUDA