2PSYA

Crystal structure of human kallikrein 5 in complex with leupeptin and zinc
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
227
structure length
227
Chain Sequence
IINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the zinc inhibition of human tissue kallikrein 5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Kallikrein-5
total genus 52
structure length 227
sequence length 227
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2psyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2psyA02
3SV2H 1ORFA 4Y11E 1LHDH 3LH1A 3A8DA 2ZHQH 2ZP0H 2GP9B 1TGSZ 3M5OA 1ELTA 1GHYH 2QGRA 4NFEA 1CHOF 4JZFH 4K1SA 1KXEA 3SNBA 2BY7X 1O2LA 1AVWA 1BTPA 1FI8A 2BY9X 2ZGHA 1O2SA 4CRCA 2AERH 2F9UA 4GUXA 1TNGA 5E2PA 1WQVH 1GI6A 2WINI 3MU5A 2WPJS 2QC2A 2J4IA 1DLKB 1DX5M 1QB6A 3A86A 1BJVA 4Q2KA 1YGCH 2A2XH 2ZEBA 1GMCF 4WY3A 3PMAB 1C1OA 3MMGA 1NROH 4LK4A 3A83A 3LGVA 1CA0C 3EA8A 1ZTKA 1AWFH 1RIWC 2O9QA 1C1MA 2H9TH 4BTUB 2GCTC 3UY9A 3MNXA 4FUBA 2ZDMA 1GMDG 1O2PA 1OS8A 2AGGX 1B0EA 3HK3B 2BXTH 4HFPB 3SV7A 1DM4B 2BLQA 4GHQA 1UK4A 1DVAH 1NM6A 1THPB 2BVRH 5LPFA 2GVFA 2G00A 3EA7A 3Q00A 1EOJA 3P8OA 3SQHE 1UHBB 1VITH 1GJBB 4AN7A 3QUMP 1D6RA 1TOMH 3A7YA 1OKXA 2FOBA 2XTTB 2ZIQH 3E3TA 4H6TA 4CBNA 4BXSA 2VIDA 1EASA 4BTIB 4WH6A 1P57B 5GJ4B 5LGOA 1LVYA 3RXBA 3K65B 1G9IE 3RU4D 1EAWA 4B2AA 1Y5UT 2H2ZA 3SORA 1OPHB 5GWZA 1Q3XA 5HM9A 1C2DA 4FU9A 4FUCA 1O3JA 1TGNA 4Y6DA 4AFQA 2O8TA 3L33A 5FAHA 2P3UB 1YBWA 2CXVA 2BB4A 2FS8A 3GCNA 4NA7A 2Z9GA 3ZYDA 3PTBA 1QA0A 4F4OC 4D9QA 1A0JA 3T27A 3M3TA 3ENSB 4BOHA 3T26A 1CT2E 1DY9A 2P59A 5TCAA 2OP9A 3EQ0H 4JCNA 1AQ7A 4WMEA 1HIAB 1V2ST 1O2YA 5J4SA 1AUJA 1ZMLA 3SW2B 1TONA 5TCCA 1BMNH 4ZKSU 2FOCA 2ZDVH 2QIQA 1CT0E 3BG4C 1S81A 5FBIA 4B76A 1W7GH 4ESTE 2HRVA 1VGCC 1NN6A 1SPJA 1P2JA 1BMAA 1JIRA 1LO6A 1O5CB 1SB1H 2ZTXA 1A0HB 1XM1A 4INKA 1XUKA 3P8FA 1FZZA 3RXGA 1HV7A 5DP4A 2FOAA 2XXLA 1O3PB 1QRXA 4CREA 4IN2A 4Y10E 4ZXYH 4YOIA 3DFLA 5JBCS 3MO3A 1AE5A 2G5NA 1A2CH 1SOZA 1P3EA 3L3TA 3ZZ8A 1VCWA 1CU1A 2C8XB 4IGDA 3SNAA 2FPZA 1H4WA 2QN5T 1DSTA 1Z7KA 2GV6A 1V2JT 3S9BA 1CVWH 1TPPA 1O33A 1SBWA 5C3NA 1C5WB 1FDPA 2OQ5A 1P02A 3M3VA 2VVUA 3B23B 3VPKA 3MNBA 3BTKE 1O3DA 1AO5A 1FUJA 3L6PA 3QN7A 1AKSA 4X1SU 1CHOG 3F9EA 4NG9H 5I25A 1BHXB 3MU1A 3U69H 1YF4A 1LVMA 1UVOA 2BDYA 2FTMA 2OXSA 3ZYEA 3UNQA 1EUFA 1WU1A 1O3BA 4I33A 1CGHA 2ZU4A 4QT8C 1NTPA 1MQ6A 5LH8A 3U8OH 1OWDA 4HZHA 1ABJH 1ELAA 3EGKH 2BD3A 1ZYOA 1UHBA 2ZFQH 3RDZA 2PSXA 4BAMB 2PUQH 1O31A 1O3LA 1UTKA 2HPPH 4Y8XA 1EP6A 4ASHA 1SLVB 1IQGA 2GTBA 1QURH 2BTCE 1BOQA 3DT0H 1NFUA 1EJAA 1GBMA 5JB8S 2HLCA 1OYQA 1UVSH 2NU4E 3KHVA 1WV7H 1PJPA 2ODPA 3A8BA 1G3CA 2BQ7B 4B74A 2JETB 2VWMA 1GI9B 2AMQA 2ZHEH 1GI0A 1L1JA 2AFQB 2PW8H 4AFZA 1NRSH 3RM0H 4DJZB 1GHWH 4I31A 1M9UA 1DFPA 4ABEA 4BAQB 2Q6FA 3GY4A 2P3FH 3K6YA 4O3UA 1AI8H 1UTJA 3UR9A 4CRDA 4FU7A 1A5IA 5DP6A 3SGAE 5DP8A 3RXSA 5EPYA 1CGJE 3GY7A 1T31A 3KF2A 5T6GA 8GCHG 1LHGH 1S0QA 1TPAE 1ETTH 2ZNKH 1P2IA 1YM0A 1O37A 4YT6H 4OS6A 2XBYA 1K22H 2VWNA 1HAGE 2O8UA 2W26A 1GHAF 3BTFE 4PROA 1EJNA 3PTNA 3UNRA 1TLDA 3V7TA 4UE7H 1W7XH 2FOFA 2W7SA 3TGJE 1UCYK 2BD9A 4ABJA 1F5KU 4UFDH 2BVSH 3PMJA 1J17T 2CN0H 3SQEE 1YPJH 1GL0E 3FP8E 1FQ3A 2GMTC 2SNWA 1EOLA 1NRRH 2DE8A 2A4RA 2XC5A 1TQ0B 4O3TA 4BAHB 2YNAA 6CHAB 1RD3B 3UTUH 3FP7E 3MOCA 1BCUH 2J94A 2NU1E 4XE4A 4WXVA 3T28A 1VGCB 1GBBA 4NA9H 3VB5A 4K5ZA 9LPRA 3UFAA 1T7CA 5JYIA 1O3HA 3PO1C 3SUDA 3ZV9A 1C1SA 3MTYA 2Z6BD 5F8XA 1L4ZA 5AFZH 3PM3A 3JZ2B 2HPQH 1UCYE 3BEUA 3I29A 1C9TA 4H4FA 4MG3A 1TBZH 2PKSB 3Q3KA 1FONA 1TRYA 2C8WB 3E8LA 3URDA 3MHWU 1SMFE 3MNCA 3STIA 1GBIA 1IHSH 4X2WA 2OTVA 4JYUH 3S0NA 4KTUA 4ABHA 1GJ8B 2SGEE 2VU8E 1D3PB 4K1TA 1HIAA 1E36B 4WVPE 3P8GA 1YPMH 1PQ7A 1CSOE 2ZFPH 1UMAH 2CV3A 3ELAH 1JIMA 2PV9B 2G81E 1SL3A 1QL7A 2QA9E 2PHBA 3KQEA 1O2XA 4K1EA 1LPKB 2IOTA 3SJIA 1XVMA 2NU3E 2SFAA 9ESTA 4AGJA 2BX4A 3NZIA 4CH8B 4RSPA 1SGYE 2H6MA 1ZRKA 2J2UA 3FVFB 4J1YA 1C4U2 1RGQA 3D49H 4CRGA 1LPZB 1GVZA 1X7AC 4D9RA 2G51A 3KGPA 4OS7A 1A7SA 4ZHLU 2TIOA 1PQAA 2SGQE 4VGCC 5B6OA 3LGYA 1GJ9B 1UTQA 3KQDA 1C9PA 1P2KA 4IN1A 1ZMNA 3A84A 4ISIH 1QBNA 1DOJA 1TBRH 5DO4H 1LHEH 1ZPZA 4UONA 1GHVH 2XWBI 5GCHG 3GY2A 2STBE 5SGAE 4FUDA 1NRQH 1INCA 3MU8A 3NPSA 3RUOA 1RFNA 2A32A 1OP0A 1AZ8A 1K1OA 1GHBF 2OUAA 1HJAB 2CF9H 1GJ5H 1CGIE 3LDXH 1F5LA 1OXGA 5G4BA 2H1UA 4KELA 5IDKA 2J38A 2AMPA 3BG4B 4WH8A 2Z3CA 1BTWA 1ZPBA 2ZCLP 1A0LA 4Y71A 5F6MA 4NIXA 1TALA 1IHTH 1C5XB 1QBVH 1GI2A 1UVUH 5K7RA 1W11U 2P93A 1TNHA 3RC4A 2WUCA 5LPRA 1YLCA 3RMLH 3UPEA 3QDZB 3BV9B 1O30A 1GJDB 1TE0A 3TNSA 1MAXA 4CH2B 2B9LA 4Y0ZE 4NWKA 1KXAA 1V3XA 3ITIA 3U98H 5EXNA 5JBAS 3PYHA 1BB0B 1PPGE 1EPTB 3Q76A 1P2NA 5FX6A 1PPHE 4HGCA 2R3YA 3SJKA 4KTCA 4KTSA 4ABAA 1ESAA 3BTGE 4YOGA 4FUGA 1OSSA 3ATKA 7ESTE 4TWYA 2AGIX 3QGNB 3AAUA 3MO9A 2OD3B 3E91A 2DUCA 4UEHH 2Q1JA 3SU3A 1C4V2 1ZJDA 4X6OA 3RC6A 4HI3A 3PB1E 1DICA 1ZMJA 1GBHA 1O32A 2I6QA 3RXRA 1QL8A 4I7YH 2IPHA 2ZECA 1W3CA 1T8LA 3TJUA 1YYY1 1KLTA 2WPIS 1HCGA 2BLVA 1GDNA 2ZG0H 1BRCE 4B2BA 5JB9S 1G36A 1FLEE 1TMUH 1TBQH 2QYIA 3LC3A 3SJOA 2FX4A 1MZAA 2QV1A 1TNJA 1WYKA 2ZI2H 3SN8A 4H42U 2OC8A 1CT4E 4J2YB 3R0FA 1SLWB 2OC7A 3C27B 1Y59T 3ZV8A 1L1GA 2OLGA 2VIPA 2G4TA 1EJMA 4INLA 2THFB 4WMDA 3SZNA 1Q2WA 2QXHA 1UJ1A 1S0RA 5HGGA 1GI3A 3UIRA 4TPYA 1MTSA 1V2RT 1D3DB 2CHAC 2JH5D 1OOKB 2AIQA 1MTWA 1MTUA 3OSYA 1WOFA 2A7JA 4B75A 5BPEA 5A0AE 1F7ZA 1S6FA 2XBVA 4XBDA 2GGVB 1SLUB 4YZUA 2C90B 1ZRBA 1K1NA 1DS2E 1PQ5A 6ESTA 1ACBE 5C1YA 1YKTA 2TBSA 1IQEA 1DLEA 2ZHWH 1O3FA 3ODDA 2ZDKA 1GPZA 3QTOH 4K8YA 3U1IB 3SHCH 4AB8A 4UDWH 3SGQE 3DD2H 2BDHA 4YTAA 3RXEA 5GXPA 1NY22 1KSNA 3M61U 4IS5A 3LIWA 4BAKB 2ZPSA 1OX1A 4B2CA 3B8JA 1YPEH 2PKAA 1N1LA 4MNWA 1QJ6B 1HAVA 1AHTH 3EAJA 2ZGJA 2ZGXH 4UFGH 3Q3YA 1VITF 2Q6GA 3CP7A 3OX7U 1LHFH 4K3JA 4KKDA 1ZSLA 2WYGA 1HAYB 3MH4A 1SGQE 1Z71A 3GY6A 4XDEA 1V6DA 1MKXH 2RCEA 4FUEA 4U32A 4Y7BA 1D3QB 1KYNA 1MMJN 1MCVA 2VH0A 4TYDA 2G52A 2Z94A 1GBEA 1O3NA 2Y5FA 2Y82A 1H8IH 5EXLA 1E35B 1O2WA 1NO9H 3QZQA 2F9PA 3GDUA 2JETC 2F9NA 1QJ1B 1KTTB 1PPBH 3SNEA 1P9UA 1EATA 3A82A 3RMOH 1D6WA 1P2QA 1C2GA 1J8AA 3DA9B 5FX5A 3P92A 1V2TT 2HVXA 3SUFA 1QNJA 2HNTE 2B5TB 1H9IE 4MNXA 1AIXH 1TABE 3TIUA 3BTME 1O3IA 3E0PB 2FP7B 1Z8GA 1O3AA 2A7CA 6GCHG 1AFQC 4X1PU 2Z3DA 4ZAEA 3EYDA 1TX7A 1GI5A 2UUYA 3E1XB 3ZZCA 4ZKOU 3V0XA 2ZWLH 3FFGA 2Z9JA 3P8NA 5C5NA 3EA9A 2D8WA 4UFEH 4NIWA 1SFQB 2ASUB 1Y3YA 1P01A 1TWXB 4MNYA 2AMDA 2P94A 3QX5H 3RXJA 3GYLB 3LOXA 1O2UA 1GCDA 2FYRA 1QIXB 3IITA 3CS0A 3E16B 2FLBH 2V3HH 1A3EH 1P2MA 1TYNA 4WF8A 1SGNE 4KP0A 1GGDC 4X1QU 8LPRA 1FAKH 4RKOB 1SOTA 1AWHB 1FIZA 1DANH 1ZHMA 1BTZA 4GSOA 4WJG2 2HNTC 1KDQB 2AS9A 2VGCB 1NRNH 3DHKH 4DY7B 1P09A 2BDIA 1G30B 1HUTH 1SC8U 4Y7AA 1O2QA 3HK6B 3PROA 3SUEA 1AUTC 1Z6JH 1G2MA 3F68H 1GI8B 2GCTB 1EQ9A 4E06H 1ID5H 1W10U 1KXBA 2IN2A 2WV4A 3O8RA 1FNIA 1B0FA 1IOEA 1SGDE 3GCTG 4AYVB 3QWCH 4YM9A 1UVPA 3BTEE 2SGFE 1O2OA 3BTQE 3BN9A 3D62A 4NA8A 1J9CH 2A5KA 1QGFA 3RU4T 1RJXB 2FX6A 2ZHFH 1C5OH 4YOJA 1Y5BT 4IW4E 1ABIH 1HJ9A 3S9CA 2ANMH 3CS7A 1O5BB 4K8BA 1O0DH 5F8TA 2XRCA 2OC1A 4ZKNU 1ANCA 4MLFB 3OY6U 3ZZ6A 1DXPA 4OGYA 3VEQB 2FOMB 1BBRE 5GCHF 2ZTYA 1Y5AT 1ZSKA 3RXUA 1JRSA 1P11E 5L2ZH 1EAIA 3ESTA 5A8XA 2GT8A 2TRMA 2GD4B 3HKJB 1RS0A 2J95A 1MUEB 1XUFA 1WUNH 3PO1B 5DGJA 1O5EH 1O2TA 5PTPA 4FUFA 2Z9KA 2EC9H 1TX6A 1ESTA 3V13A 3VB3A 2DE9A 3A7WA 1Y3VA 1JXPA 5C20A 2ZCHP 2CF8H 1MH0A 1GBAA 5A8ZA 2TGDA 2KAIA 4IMQA 5FHTA 1QQUA 1O2VA 1PYTD 1C5UA 2AH4X 1K2I1 2ZU5A 1Y3UA 2UWOA 4INHA 4MVNA 2VVVA 4NFFA 1CBWB 2ZQ2A 1AMHA 2AEIH 2R0KA 4XOJA 1TGCA 1C1RA 1J16A 1PYTC 3BSQA 1H1BA 2TPIZ 1AE8H 1P03A 1B5GH 2A5IA 3ZZAA 3SOSA 3ZZDA 4RKJB 1F0UA 4R0IA 3ZVAA 1KXDA 1A4WH 1QCPA 1KTSB 5CE1A 3EE0B 1EXFA 3S7KB 1TNKA 3BTWE 3RXTA 2ZDLA 2F91A 3UREA 8GCHF 5FBEA 3OY5U 4E7RG 3RLYH 3RXOA 1JWTA 1N8OB 1THSH 1TNIA 3Q77A 3RXDA 1TFXA 1TNLA 4AG2A 1H9LB 2PUXB 5C67A 1SSXA 1FY5A 4BTTB 2V0BA 4JYVH 1Z1JA 1FN6A 2QXGA 1BITA 5C1UA 2BD5A 1C5TA 1BRAA 1FY1A 5HMAA 1Z8IB 1GGDB 5I46H 1C1TA 2WPMS 1LTOA 1ANEA 3LH3A 1ZLRA 4FUJA 1H9HE 1Y3XA 2VNTA 4E05H 1YPHC 4ISNA 5C1XA 1LHCH 1HAHH 5DP5A 3R3GB 3H7OA 3IG6B 1CQQA 1ZHRA 5T3HA 3AW0A 3ZVEA 1A1RA 1MTNB 1BMMH 3O8BA 5DP9A 1MKWH 2GDEH 1DT2A 3ZZ4A 5EXMA 2WV5A 4ZMAH 2V35A 4AYYB 2BD7A 2XYAA 1K1PA 1HJAC 4NGAH 5DP3A 3LT3A 3V12A 2FDAA 1O3MA 2FODA 5EOKA 3Q3XA 3GCTF 3UQOA 1NRPH 1FJSA 1SGTA 3RXVA 4CHAC 2BXUH 4CR5A 3GY8A 2BDGA 4ISHH 1ELGA 1C5YB 3KQBA 3A87A 1UK3A 2A2QH 1WQSA 1C5PA 1Z6EA 2WYJA 3TLOA 3FP6E 1HFDA 1UK2A 5GDSH 2BZAA 3TK5A 5DG6A 1BA8B 1G3DA 2VGCC 1GWAA 4Y8YA 1FN8A 1VCPA 1E37B 1EB1H 1C1WH 4SGBE 1VJ9U 1LQDB 2PKSC 1ANBA 2ZDAH 4HTCH 4DOQA 1MKXK 4ABGA 2A31A 4DVAU 1O2IA 1GI1A 3F6UH 1V2QT 1MBMA 1ARBA 2Z7FE 3SU5A 1TB6H 3RXIA 2Y5GA 1ZOMA 4IMZA 5EPNA 1SHHB 1O2KA 3SHAH 1QL9A 2C4FH 1C5QA 3TGKE 1FY3A 1CE5A 3M5MA 1IQNA 6CHAC 5EODA 1TQ7B 2BY5X 5EQRA 4A6LA 3EDXB 1K1LA 1G2LA 2W7UA 3UOUA 2VINA 2VIOA 3RU4E 1SLXB 3TH4H 3M7QA 1OWEA 2R2MB 2C3SA 2R9PA 1HGTH 1UTPA 1DWDH 1GHBG 1C1UH 2ODQA 1GHXH 2ZPRA 5JBBS 3QZRA 4ABDA 2A1DB 4YLQH 4XSKU 5CHAC 2ZFFH 2BLOA 3DUXH 4OS2A 4ZUHA 1BHXF 4DG4A 5A0BA 2PTNA 2STAE 3C1KA 3UWIA 2BM2A 3LGWA 4O97A 4FUHA 2WPKS 3ZZBA 3MFJA 1O2GH 1Z1IA 1TPSA 4TY7A 2ESTE 3RXHA 1BQYA 1ELCA 2SGPE 1YP9A 2ANWA 2GZ7A 5ESTE 3M7TA 3OTJE 2ZTZA 1V2UT 4AB9A 1DWEH 4X1NU 2GZ8A 2ZGCA 6LPRA 1T8NA 3PWBA 4OGXA 4U01A 1SQAA 1GHAG 2F3CE 1KXFA 1PPEE 1NU7B 1SGIB 2BQWB 3E90B 5A8YA 1GBCA 1LVBA 3ATLA 1K28D 2Y80A 4Q7ZA 2ZPQA 2O8WA 3ZVBA 5BRRE 2YOLA 3MI4A 1V2VT 2UWPA 4I8GA 3A88A 1LMWB 2XWAA 4X1RU 1GBFA 5CMXH 1TIOA 4B73A 1AZZA 2VH6A 4JMYA 2V3OH 1ETSH 4XBBA 1BBRH 1FPHH 1GL1A 1KDQA 1YPHE 1GVLA 1S6HA 2VVCA 4BNRA 4NIVA 2C8YB 2VWLA 4GVUA 3VGCC 1KLJH 1SI5H 2FO9A 5AHGH 3VFEA 1SGPE 4FXGH 1MU6B 4X6NA 3QLPH 1VR1H 3HKIB 5T6FA 3MO6A 3NWUA 3KQCA 4CHAB 2EI6A 1MKWK 2GCHG 3LONA 1U6QA 2CJIA 1O5AB 4NCYA 3ZZ3A 2I6SA 1SR5C 4BXWA 1HB0B 2O8LA 5E2OA 3E6PH 4YLUA 4AFSA 1XXDA 2FXRA 1NFYA 1C2JA 3RMMH 4CR9A 1P2OA 8KME2 2FTLE 1SGFA 3GISB 1GCTC 2VJ1A 1C5VA 1OWIA 3V3MA 1Q31A 4D76A 2UUFB 4H6SB 3FZDA 2UUKB 1GJ4H 2A0QB 1GG6B 4X2YA 4Q80A 2FMJA 8ESTE 2FLRH 1TGBA 3M36A 1QB9A 5TJXA 2FOEA 5L2YH 2Y5HA 3SV6A 3RXMA 1RXPA 2XBXA 2XBWA 4AORA 2H9EH 3KN2A 1PPFE 5JPMH 4JZDH 2A4OA 4MPVA 5EW2H 2IJOB 1SGEE 2A7HA 2G5VA 3AVZA 1BMLA 2A4QA 1HAOH 1D3TB 3SBKA 1GJ7B 1C2KA 1O2ZA 1WBGB 1AU8A 2ANYA 2CMYA 2OBOA 1MD7A 4I8LA 3KIDU 4GAWA 3GY5A 2LPRA 1GMDF 5EU8A 1JBUH 1T32A 1BTHH 4VGCB 1C2MA 1DDJA 2BLWA 1O3KA 3RXCA 3ATWA 3O8DA 2QXJA 3ZZ7A 2FOHA 1E38B 2B7DH 2OC0A 1O34A 3BIVH 2F9BH 1IQKA 1DXWA 4ZH8A 2BQ6B 2BD8A 2BYAX 4AG1A 3SGBE 5JBTA 2R0LA 3SV8A 1XXFA 4WMFA 3SJ8A 2FWWA 4LXBH 1G3EA 4TWWA 3RXAA 2LNCA 1C5ZB 3TVJB 1BTXA 1GI4A 1CA0B 3F1SB 4NSYA 4UD9H 4DIHH 1ZJKA 1A5GH 3SNDA 1ZZZA 2ALVA 1GBJA 2PGBB 1G37A 5HYOA 3LJOA 3M7UA 4CRAA 3A7ZA 1Z8RA 1V2PT 2F9VA 1ZGIA 4OS1A 1AD8H 4M7GA 1L2EA 1FY4A 3RXLA 1WTGH 3TK6A 4ABBA 2EI8A 1ZSJA 3MNSA 3U8TH 1QFKH 1F2SE 1A5HA 2ALPA 2Z9LA 4NSVA 1MTVA 1V2WT 1C2IA 2H5CA 1KY9A 2VIQA 1HAIH 3BEFB 2Y6TA 2J34A 1ZGVA 2XC0A 1O2JA 1W14U 3BTDE 2H5DA 4D7FA 2BDBA 2HOBA 2FOGA 3KNXA 2OINA 1SVPA 1SGFG 1GMHF 2ZQ1A 3F9FA 1FIWA 4MQAA 4Z6AH 3LJJA 2AGEX 3I77A 4I8KA 2JH6D 2Y81A 2P8OB 4BAOB 1EZUC 4FVBA 1O3GA 1V2KT 3GDSA 1SFIA 1K1JA 1YLDA 1C2HA 1P3CA 5GIBA 1HXFH 3S69A 1DITH 1P12E 2BD2A 5AF9H 4LZ1H 1RRKA 2FIRH 2ZFRH 1ELDE 3G01A 1LCYA 1MAYA 2F9OA 2GCHF 4IBLH 2PGQB 1ZHPA 3PMHB 1C2EA 3GCHB 4OS5A 3STJA 2ZU2A 4ABIA 3SU1A 3NCLA 2ZU1A 1JOUB 1T8OA 1XKAC 4K69A 4U2WA 2GX4A 5ABWA 4Y8ZA 1K1IA 2QF0A 1J15A 3RXKA 2BOKA 3QK1A 2C93B 1ELBA 1DUEA 1S5SA 5E0JA 2FZZA 3F9GA 4A92A 4K2YA 2TGTA 2QAAA 1AVXA 1RTFB 3UQVA 1C5SA 1IQFA 1O2NA 3MU0A 3N7OA 4JZEH 5FXLA 2Z9IA 2RG3A 3RMNH 2EI7A 1YCPH 4B71A 1L0ZA 1GJCB 3BEIB 3PWCA 5E0GA 1AFQB 2Y7ZA 3QGJA 1P9SA 3U8RH 1XUIA 2OBQA 2JH0D 3M5NA 3ATIA 1K21H 3T25A 2JKHA 1DSUA 1RTKA 2V6NA 1O3OA 4GLYA 3UOPA 1XVOA 2ULLA 3MYWA 1FAXA 3HGNA 1GJAB 3DFJA 4XBCA 5F03A 3BF6H 1C1VH 1S83A 2ZA5A 1DWBH 1EAUA 3VXFH 3AAVA 4DIIH 1DUAA 1K9OE 1N8OC 4ZHMU 1ELVA 1P10A 3K2UA 3P17H 4Y0YE 2AIPA 2FI4E 3GCHC 4ZHAA 2B0FA 1YC0A 1KXCA 1VCQA 1G32B 1XMNB 1OWHA 1HAVB 3M35A 1CO7E 1MZDA 4F49A 4WWYA 2ZU3A 4AOQA 1EKBB 4A7IB 1WTHD 1QRWA 1LKBA 2PWXA 1MCTA 1AN1E 5ESBA 1BDAA 1VJAU 2GDDA 3RC5A 3W95A 1CHGA 2PR3A 1ZR0A 3SI3H 5F8ZA 7GCHF 1GHZA 4Z0KA 2D2DA 5A09A 3GDVA 5AVDA 3AASA 3H7TA 3E0NB 2EEKA 2J9NA 2OQUA 1BRBE 1D9IA 2ZGBH 3RLWH 4GCHG 1A46H 1MQ5A 3KL6A 5FPSA 4TY6A 1LKAA 1P04A 4JZ1A 1NPMA 4UFFH 1YPKH 2ANKH 3NKKA 2ZC9H 3SU2A 1DPOA 6GCHF 1G3BA 1LQEA 4X8UH 3T5FH 3ZVGA 4GHTA 3OU0A 1CA8B 4AX9H 2BY6X 1O3CA 1BTYA 2SGAA 3MH5A 3FANA 1GI7B 1YCPK 4MTBA 1O2RA 3P6ZB 2QY0B 1GJ6A 2G4UA 3LU9B 5E0HA 2TGAA 1UVTH 1Y8TA 2ZZUH 1SGCA 3TU7H 2FS9A 1O3EA 1A3BH 2QCYA 4ABFA 1O5DH 1AKSB 3OYPA 3LGUA 5FPTA 4X8SH 1NESE 1V2OT 2SNVA 3M5LA 2P8OC 3QO6A 2VB0A 2GV7A 2GKVE 2FESH 1AB9C 3I78A 1JMOH 1TMTH 2W3IA 7KMEH 1W0YH 1OWJA 1QRZA 2ZFTA 1C4Y2 1F0SA 1J14A 5IYTA 4GPGA 1A61H 1OYTH 4MNVA 4A1VA 7LPRA 1ESBA 4ZKRU 1LPGB 3RM2H 3T62A 1QA7A 1IQJA 2R2WU 4RN6A 1GMHG 1QQ4A 1DE7H 3TJNA 3MH7A 1BUIA 5FPYA 3ZZ9A 1XUJA 1NU9A 3RXFA 4X0WU 1HAZB 1ARCA 3A89A 2GZ9A 2Q6DA 1PPZA 3T29A 3ZVCA 3NXPA 2PFEA 4DT7B 3FAOA 1ZTJA 2ILNA 1C1PA 1EZQA 1QY6A 4NZQA 3VXEH 2G55A 4AGKA 4THNH 3SI4H 1HBTH 3SJ9A 1EZXC 3VB6A 3H5CB 3PV4A 3P70B 1IQMA 1V2LT 3TPIZ 3D23A 1N6XA 3M3SA 3SU4A 5DKMA 2BDCA 2XCNA 1OWKA 4X2VA 5DK1A 3MH6A 3S7HB 2ZKSA 1AFEH 2FM2A 4FUIA 3ATMA 3URCA 5EQSA 2BMGB 3SU6A 3BTTE 1GDUA 1FXYA 3ZZ5A 3A7TA 3CENA 4Q7XA 4X8VH 1ZTLA 1GBKA 2AYWA 1O39A 3A81A 2P16A 2D1JA 1SG8B 4D8NA 4MPUA 5L30H 1NS3A 3SUGA 1GMCG 5H4IB 2HWLB 3ODFA 4XFQA 1B7XB 1TPOA 1D4PB 4SGAE 4GCHF 4MPWA 1C5LH 2BVXH 4JK6A 2KAIB 1S82A 2EA3A 1O5GH 2GMTB 1C1QA 7GCHG 5FCKA 1GDQA 3ZVFA 2H9HA 2NU0E 3U1JB 1TA2A 1W13U 1QB1A 3SU0A 1BJUA 2VIVA 1P0SH 1DY8A 4ZXXH 2BY8X 1SGRE 2VIWA 3A8CA 1NC6A 4KGAA 3ZVDA 4X8TH 1F0RA 1L1NA 4NIYA 3RXQA 1NZQH 3SO3A 2BX3A 3BTHE 4O9VA 4WXIA 1BRUP 3A7XA 1HRTH 2HNTF 1XX9A 5HM2A 1AB9B 2RDLA 1O38A 2GT7A 3K9XB 4IC6A 1QHRB 2F83A 4CRBA 1HDTH 2ZFSA 3W94A 4Q7YA 4DW2U 1C1NA 1HPGA 2BZ6H 2ZO3H 3PMBB 3TJOA 1V2NT 1O5FH 2PTCE 1THRH 1W0ZU 2G8TA 2WPLS 1BT7A 2A5AA 5HXFA 1AY6H 1WSSH 1GG6C 1W12U 4Y76A 1ANDA 3FZZA 1QTFA 3MWIU 3LC5A 1BTUA 3HPTB 4R8TB 2YNBA 3A85A 2ZDNA 4I8JA 1O2HA 2K1QA 2ZF0H 5L6NH 3WY8A 3SNCA 3UR6A 3P95A 1IQLA 3TJVA 1C5MD 4ZROA 1FY8E 2XCFA 4IC5A 3TH2H 1ELFA 1H8DH 1GVKB 2Z3EA 3BG8A 1SQTA 3NUMA 2A45B 4X6PA 2CGAA 2O8MA 2UUJB 2OCVB 1HAXB 1XUHA 1BBRK 2B8OH 3SV9A 5DPAA 1O35A 1UTNA 3TK9A 4ISLA 1FPCH 1ETRH 3A7VA 2RA0A 2P95A 1F92A 1HXEH 3LGIA 2XC4A 1UTOA 1F5RA 3VB4A 1IQIA 5T6DA 1HNEE 3U9AH 3TGIE 4A5TS 5FCRA 3QTVH 1TGTA 1MD8A 1GCTB 1FMGA 1QR3E 4FVDA 2D26C 3UWJH 1LDTT 4E7NA 1W2KH 1L4DA 1HYLA 3PLKA 1P8VC 1EP5A 3NK8A 1CBWC 3LPRA 1PFXC 4I8HA 1PQ8A 1ZPCA 5EGMA 1O36A 2HALA 3TH3H 1GBTA 4JK5A 2BDAA 2ZCKP 3MU4A 3B9FH 4YT7H 2NWNA 5DP7A 1NFXA 1YPGH 2HGTH 3K6ZA 5GPIB 5AFYH 2FYQA 3TNTA 1QBOA 1HJ8A 4A1TA 2P3TB 1E0FD 1BZXE 4YESB 2CHAB 2TGPZ 1UCYH 5C2ZA 1UTMA 1W8BH 2BHGA 1UO6A 1N6YA 2UWLA 2R3UA 2M5TA 2SGDE 4B1TA 2PLXA 1P06A 3GCOA 5EQQA 4AFUA 4CRFA 3LGTA 1WAYB 1ELEE 1WCZA 1TAWA 2PKAB 3LKWA 2XW9A 2C8ZB 2FI5E 2FI3E 4NZLA 4BANB 2WPHS 1EX3A 1NFWA 4X6MA 1IQHA 5CHAB 1MBQA 1AGJA 5DJ7A 1TOCB 1SQOA 3HGPA 3A8AA 4Y79A 2Y7XA 2ODYB 3UUZA 1C5RA 1TRNA 4O03A 1O2MA 1OP8A 1QJ7B 4JZIA 1KIGH 4JYTA 4A1XA 1PPCE 1E34B 1C5NH 1NT1A 3D65E 1TRMA 3GOVB 2W3KA 4DURA 3TITA 1VZQH 1FV9A 1DWCH 1C2LA 1YCPM 4I32A 4TPIZ 4AZ2B 4U30A 1KLIH 4X2XA 1VITG 3A80A 2QF3A 1Y3WA 1HAPH 3KEEA 2W5EA 1TMBH 3GYMA 2PSYA 2WUBA 2J92A 1S85A 3BIUH 1RIWB 4YO9A 1TX8A 1EPTC 1MU8B 3S9AA 1GBDA 4ISOA 4OS4A 1T4UH 1F0TA 4DGJA 1T8MA 3F9HA 2VWOA 1LVOA 1MTNC 3T2NA 1SHYA 1S84A 4D7GA 1XKBC 3KCGH 1XUGA 3GY3A 1OP2A 1GBLA 1IAUA 1HLTH 3HATH 2FEQH 2BD4A 5J4QA 3UNSA 2QXIA 5EG4A 5E8EH 3RP2A 5K0HA 1YPLH 1UTLM 1T4VH 3PLBA 2A4GA 3VGCB 1BIOA 1TA6A 2RA3A 1C2FA 3RXPA 5ETXA 1EZSC 3PLPA 1V2MT 4MPXA 4CBOA 1EB2A 4MDSA 3AW1A 4LZ4B 3GICB 4FU8A 3JZ1B 1EAXA 2BOHB 5A2MH 3VB7A 3O8CA 1JRTA 1RTLA 4LOYH 3IWMA 5C5OA 5LPEA 1Z8JB 4DCDA 1P05A 5EW1H 2NU2E 5A0CA 5JDUB 1AVGH 2XNIA 4NWLA 1EPTA 1K1MA 2ZHDA 3M37A 4K60A
chains in the Genus database with same CATH superfamily
3SV2H 1ORFA 4Y11E 1LHDH 3LH1A 3A8DA 2ZHQH 2ZP0H 2GP9B 1TGSZ 3M5OA 1ELTA 1GHYH 2QGRA 4NFEA 1CHOF 4JZFH 2YMSD 4K1SA 1KXEA 3SNBA 2BY7X 1O2LA 1AVWA 1BTPA 1FI8A 2BY9X 2ZGHA 1O2SA 4CRCA 2AERH 2F9UA 4GUXA 1TNGA 2F4LA 5E2PA 1WQVH 1GI6A 2WINI 3MU5A 2WPJS 2QC2A 2J4IA 1DLKB 1DX5M 1QB6A 3A86A 1BJVA 4Q2KA 1YGCH 1YWUA 2A2XH 2ZEBA 1GMCF 4WY3A 3PMAB 5B6LA 1C1OA 3MMGA 1NROH 4LK4A 3A83A 3LGVA 1CA0C 3EA8A 1ZTKA 1AWFH 1RIWC 2O9QA 1C1MA 2H9TH 4BTUB 2GCTC 3UY9A 3MNXA 4FUBA 2ZDMA 1GMDG 1O2PA 1OS8A 2AGGX 1B0EA 3HK3B 2BXTH 4HFPB 3SV7A 1DM4B 2BLQA 4GHQA 1UK4A 1DVAH 1NM6A 1THPB 2BVRH 5LPFA 2GVFA 2G00A 3EA7A 3Q00A 1EOJA 3P8OA 3SQHE 1UHBB 1VITH 1GJBB 4AN7A 3QUMP 1D6RA 1TOMH 3A7YA 1OKXA 2FOBA 2XTTB 2ZIQH 3E3TA 4H6TA 4CBNA 4BXSA 2VIDA 1EASA 4BTIB 4WH6A 4RI0A 1P57B 5GJ4B 5LGOA 1LVYA 3RXBA 3K65B 1G9IE 3RU4D 1EAWA 4B2AA 1Y5UT 2H2ZA 3SORA 1OPHB 5GWZA 1Q3XA 5HM9A 1C2DA 4FU9A 4FUCA 1WXRA 1O3JA 1TGNA 4Y6DA 4AFQA 1QZ8A 2O8TA 3L33A 5FAHA 2P3UB 1YBWA 2CXVA 2BB4A 2FS8A 3GCNA 4NA7A 2Z9GA 3ZYDA 3PTBA 1QA0A 4F4OC 4D9QA 1A0JA 3T27A 3N99A 3M3TA 2JIZD 3ENSB 4BOHA 5HKKD 3T26A 1CT2E 1DY9A 5C0UA 2P59A 5TCAA 2OP9A 3EQ0H 4JCNA 1AQ7A 4WMEA 1HIAB 1V2ST 1O2YA 5J4SA 1NBME 1AUJA 1ZMLA 3SW2B 1TONA 5TCCA 1BMNH 4ZKSU 2FOCA 2ZDVH 2QIQA 1CT0E 3BG4C 1S81A 3FO8D 5FBIA 4B76A 3MQKC 1W7GH 4ESTE 2HRVA 1VGCC 1NN6A 1SPJA 5CDFE 1P2JA 1BMAA 2KM0A 1JIRA 1LO6A 1O5CB 1SB1H 3F0OA 2ZTXA 1A0HB 1XM1A 4INKA 1XUKA 3P8FA 1FZZA 3RXGA 1HV7A 5DP4A 2FOAA 2XXLA 1O3PB 1QRXA 3FKSD 4CREA 4IN2A 4Y10E 4ZXYH 1W0JD 4YOIA 3DFLA 5JBCS 3MO3A 1AE5A 2G5NA 1A2CH 1SOZA 1P3EA 3L3TA 3ZZ8A 1VCWA 1CU1A 2C8XB 4IGDA 3SNAA 2FPZA 1H4WA 2QN5T 1DSTA 1Z7KA 2GV6A 1V2JT 3S9BA 2IJD1 1CVWH 1TPPA 1O33A 1SBWA 5C3NA 1C5WB 1FDPA 2OQ5A 1P02A 3M3VA 2VVUA 3B23B 3VPKA 3MNBA 3BTKE 1O3DA 1AO5A 1FUJA 3L6PA 3QN7A 1AKSA 4X1SU 1CHOG 3F9EA 4NG9H 5I25A 1BHXB 3MU1A 3U69H 1YF4A 1LVMA 1UVOA 2BDYA 2FTMA 2OXSA 3ZYEA 3UNQA 1EUFA 1WU1A 1O3BA 4I33A 1CGHA 2ZU4A 4QT8C 1NTPA 1MQ6A 5HIZA 5LH8A 3U8OH 2KZ4A 1OWDA 4HZHA 1ABJH 1ELAA 3EGKH 2BD3A 1ZYOA 1UHBA 2ZFQH 3RDZA 2PSXA 4BAMB 2PUQH 1O31A 1O3LA 1UTKA 2HPPH 4Y8XA 1EP6A 4ASHA 4I86A 1SLVB 1IQGA 2GTBA 1QURH 2BTCE 1BOQA 3DT0H 1NFUA 1EJAA 1GBMA 5JB8S 2HLCA 1OYQA 1UVSH 2NU4E 3KHVA 1KMHB 1WV7H 1PJPA 2ODPA 3A8BA 1G3CA 4ASUD 2BQ7B 4B74A 2JETB 2IPQX 2VWMA 1GI9B 2AMQA 2KCOA 2HVYB 2ZHEH 3OEED 1GI0A 1L1JA 2AFQB 2PW8H 4AFZA 1NRSH 3RM0H 4DJZB 1GHWH 4I31A 1M9UA 1DFPA 4ABEA 4P00A 4BAQB 2Q6FA 3GY4A 2P3FH 3K6YA 4O3UA 1AI8H 1UTJA 3F2GA 3UR9A 4FU7A 4CRDA 1A5IA 5DP6A 3SGAE 5DP8A 3RXSA 5EPYA 1CGJE 3GY7A 1T31A 3KF2A 5T6GA 8GCHG 1LHGH 1S0QA 1TPAE 1ETTH 2KFWA 2ZNKH 1P2IA 1YM0A 1O37A 4YT6H 2L6OA 4OS6A 2XBYA 1K22H 2VWNA 2PP6A 1HAGE 2O8UA 2W26A 1GHAF 3BTFE 4PROA 1EJNA 3PTNA 3UNRA 1TLDA 3V7TA 4UE7H 1W7XH 2FOFA 2W7SA 3TGJE 5DN6D 1UCYK 2BD9A 4ABJA 1F5KU 4UFDH 2BVSH 3PMJA 1J17T 2CN0H 3SQEE 1YPJH 1GL0E 3FP8E 1FQ3A 2GMTC 3WWFA 2SNWA 1EOLA 1NRRH 5KECA 2DE8A 2A4RA 2XC5A 1TQ0B 4O3TA 4BAHB 2YNAA 6CHAB 1RD3B 3UTUH 3FP7E 2VBCA 3MOCA 1BCUH 2J94A 4TT3D 2NU1E 4XE4A 4WXVA 3T28A 1VGCB 1GBBA 4NA9H 3VB5A 4K5ZA 9LPRA 3UFAA 1T7CA 5JYIA 1O3HA 3PO1C 3SUDA 3ZV9A 1C1SA 3MTYA 2Z6BD 5F8XA 1L4ZA 5AFZH 3PM3A 3JZ2B 3SYJA 2HPQH 1UCYE 3BEUA 3I29A 1C9TA 4H4FA 4MG3A 1TBZH 2PKSB 3Q3KA 1FONA 1TRYA 2C8WB 3E8LA 3URDA 3MHWU 1SMFE 3MNCA 3STIA 1GBIA 1IHSH 4X2WA 2OTVA 4JYUH 3S0NA 4KTUA 4ABHA 1GJ8B 2SGEE 2VU8E 1D3PB 4K1TA 1HIAA 1E36B 4WVPE 3P8GA 1YPMH 1PQ7A 1CSOE 2ZFPH 4TSFD 1UMAH 2CV3A 3ELAH 1JIMA 2PV9B 2G81E 1SL3A 1QL7A 2QA9E 2PHBA 3KQEA 1O2XA 4K1EA 1LPKB 2IOTA 3SJIA 1XVMA 2NU3E 2SFAA 9ESTA 4AGJA 2BX4A 3NZIA 4CH8B 4RSPA 4DT4A 1SGYE 2H6MA 1ZRKA 2J2UA 3FVFB 4J1YA 1C4U2 1RGQA 3D49H 4CRGA 1LPZB 1GVZA 1X7AC 4D9RA 2G51A 3KGPA 4OS7A 1A7SA 4ZHLU 2TIOA 1PQAA 2SGQE 4VGCC 5B6OA 3LGYA 1GJ9B 1UTQA 3KQDA 1C9PA 1P2KA 4IN1A 1ZMNA 3A84A 4ISIH 1QBNA 1DOJA 1TBRH 5DO4H 1LHEH 1ZPZA 4UONA 1GHVH 2XWBI 5GCHG 3GY2A 2STBE 1H8ED 5SGAE 4FUDA 1NRQH 1INCA 3MU8A 2K0QA 3NPSA 3RUOA 1RFNA 2A32A 1OP0A 1AZ8A 1K1OA 1GHBF 2OUAA 1HJAB 2CF9H 1GJ5H 1CGIE 3LDXH 1F5LA 1OXGA 5G4BA 2H1UA 5KGOA 4KELA 5IDKA 5C17A 2J38A 2AMPA 3BG4B 4WH8A 2Z3CA 1BTWA 1ZPBA 2ZCLP 1A0LA 5IK2D 4Y71A 5F6MA 4NIXA 1TALA 1IHTH 1C5XB 1QBVH 1GI2A 1UVUH 5K7RA 1W11U 2P93A 1TNHA 3RC4A 2WUCA 5LPRA 1YLCA 3RMLH 3UPEA 2XNDD 3QDZB 3BV9B 1O30A 1GJDB 1TE0A 3TNSA 1MAXA 4CH2B 2B9LA 4Y0ZE 4NWKA 1KXAA 1V3XA 3ITIA 3U98H 5EXNA 5JBAS 3PYHA 1BB0B 1PPGE 1EPTB 3Q76A 1P2NA 5FX6A 3DCLA 1PPHE 4HGCA 2R3YA 3SJKA 4KTCA 4KTSA 4ABAA 1ESAA 5EJ1A 3BTGE 4YOGA 4FUGA 1OSSA 3ATKA 7ESTE 4TWYA 2AGIX 3QGNB 3AAUA 3MO9A 2OD3B 3E91A 2DUCA 4UEHH 2Q1JA 3SU3A 1C4V2 1ZJDA 2QE7D 4X6OA 3RC6A 4HI3A 3PB1E 1DICA 1ZMJA 1GBHA 1O32A 2I6QA 3RXRA 1QL8A 4I7YH 3UB0A 2IPHA 2ZECA 1W3CA 1T8LA 3TJUA 1YYY1 1KLTA 2WPIS 1HCGA 2BLVA 1GDNA 2ZG0H 1BRCE 4B2BA 1YY3A 1G36A 5JB9S 1FLEE 1TMUH 1TBQH 2QYIA 3LC3A 3SJOA 2FX4A 1MZAA 2QV1A 1TNJA 1WYKA 2ZI2H 3SN8A 4H42U 2OC8A 1CT4E 4J2YB 3R0FA 1SLWB 2OC7A 3C27B 1Y59T 3ZV8A 1L1GA 2OLGA 2VIPA 2G4TA 1EJMA 4INLA 2THFB 4WMDA 3SZNA 1Q2WA 2QXHA 1UJ1A 1S0RA 5HGGA 1GI3A 3UIRA 4TPYA 1MTSA 1V2RT 1D3DB 2CHAC 2JH5D 1OOKB 2AIQA 1MTWA 1MTUA 3OSYA 1WOFA 2A7JA 4B75A 5BPEA 5A0AE 1F7ZA 1S6FA 2XBVA 4XBDA 2GGVB 1SLUB 4YZUA 2C90B 1ZRBA 1K1NA 1DS2E 1PQ5A 6ESTA 1ACBE 5C1YA 1YKTA 2TBSA 1IQEA 1DLEA 2ZHWH 1O3FA 3ODDA 2ZDKA 1GPZA 3QTOH 4K8YA 5EJLA 3SHCH 3U1IB 4AB8A 4UDWH 3SGQE 3DD2H 2BDHA 4YTAA 3RXEA 5GXPA 1NY22 1KSNA 3M61U 4IS5A 3LIWA 4BAKB 3H09A 2ZPSA 1OX1A 3W1EA 3B8JA 1YPEH 4B2CA 2PKAA 2JJ2D 1N1LA 4MNWA 1QJ6B 1HAVA 1AHTH 3EAJA 2ZGJA 2ZGXH 4UFGH 3Q3YA 1VITF 2Q6GA 3CP7A 3OX7U 3PRDA 1LHFH 4K3JA 4KKDA 1ZSLA 2WYGA 1HAYB 3MH4A 1SGQE 4Z1MD 1Z71A 3GY6A 4XDEA 1V6DA 1MKXH 2RCEA 4FUEA 4U32A 4Y7BA 1D3QB 1KYNA 1MMJN 1MCVA 2VH0A 4TYDA 2G52A 2Z94A 1GBEA 1O3NA 5DSFA 5T1VA 2Y5FA 2Y82A 2JJ1D 1H8IH 5EXLA 1E35B 1O2WA 1NO9H 3QZQA 2F9PA 3GDUA 2JETC 2F9NA 1QJ1B 1KTTB 1PPBH 3SNEA 1P9UA 1EATA 3A82A 3RMOH 1D6WA 1P2QA 1C2GA 1J8AA 3DA9B 5FX5A 3P92A 1V2TT 2HVXA 3SUFA 1QNJA 2HNTE 2B5TB 1H9IE 4MNXA 1AIXH 1TABE 3TIUA 3BTME 1O3IA 3E0PB 2FP7B 1Z8GA 1O3AA 2A7CA 6GCHG 1AFQC 4X1PU 2Z3DA 4ZAEA 3EYDA 1TX7A 1GI5A 2UUYA 2JDID 2W6JD 3E1XB 2KX4A 3ZZCA 4ZKOU 3V0XA 2ZWLH 3FFGA 2Z9JA 3P8NA 5C5NA 3EA9A 2D8WA 4UFEH 4NIWA 1SFQB 2ASUB 1Y3YA 1P01A 1TWXB 4MNYA 2AMDA 2P94A 3QX5H 3RXJA 3GYLB 3LOXA 1O2UA 1GCDA 2FYRA 1QIXB 3IITA 3CS0A 3E16B 2FLBH 2V3HH 1A3EH 1P2MA 1TYNA 4WF8A 1SGNE 4KP0A 1GGDC 4X1QU 4RT1A 8LPRA 1FAKH 4XD7D 1YLNA 4RKOB 1SOTA 1AWHB 2KCYA 1FIZA 1DANH 1ZHMA 1BTZA 4GSOA 4WJG2 2HNTC 1KDQB 2AS9A 2VGCB 1NRNH 3DHKH 4DY7B 1P09A 2BDIA 1G30B 1HUTH 1SC8U 4Y7AA 1O2QA 3HK6B 3PROA 3SUEA 1AUTC 1Z6JH 1G2MA 3F68H 1GI8B 2GCTB 1EQ9A 4E06H 1ID5H 1W10U 1KXBA 2IN2A 2WV4A 3O8RA 1FNIA 1B0FA 1IOEA 1SGDE 3GCTG 3WW7A 4AYVB 3QWCH 1E1RD 4YM9A 1UVPA 3BTEE 2SGFE 1O2OA 3BTQE 3BN9A 3D62A 4NA8A 1J9CH 2A5KA 1QGFA 3RU4T 1RJXB 2FX6A 2QF4A 2ZHFH 1C5OH 4YOJA 1Y5BT 4Q63A 4IW4E 1ABIH 1HJ9A 3S9CA 1UW7A 2ANMH 3CS7A 1O5BB 4K8BA 1O0DH 5F8TA 2XRCA 2OC1A 4ZKNU 1ANCA 2J97A 4MLFB 3OY6U 3ZZ6A 4AC9A 1DXPA 4OGYA 3VEQB 2FOMB 1BBRE 5GCHF 2ZTYA 1Y5AT 1ZSKA 3RXUA 1JRSA 1P11E 5L2ZH 1EAIA 3ESTA 5A8XA 2GT8A 2TRMA 2GD4B 3HKJB 1RS0A 2J95A 1MUEB 1XUFA 1WUNH 4ACAA 3PO1B 5DGJA 1O5EH 1O2TA 5PTPA 4FUFA 2Z9KA 2EC9H 1TX6A 1ESTA 3V13A 3VB3A 2DE9A 3A7WA 1Y3VA 1JXPA 5C20A 2ZCHP 2CF8H 1MH0A 1GBAA 5A8ZA 2TGDA 2KAIA 4IMQA 5FHTA 1QQUA 1O2VA 1PYTD 3KYGA 1C5UA 2AH4X 1K2I1 2ZU5A 1Y3UA 2UWOA 4INHA 1BMFD 4MVNA 2VVVA 4NFFA 4F48B 1CBWB 2ZQ2A 1AMHA 2AEIH 2R0KA 4XOJA 1TGCA 1C1RA 1J16A 1PYTC 3BSQA 5C94A 1H1BA 2TPIZ 1AE8H 1P03A 3N7EA 1B5GH 2A5IA 2EQNA 2V7QD 3ZZAA 3SOSA 3ZZDA 4RKJB 1F0UA 3PV2A 4R0IA 5C0TA 3ZVAA 1KXDA 1A4WH 1QCPA 1KTSB 5CE1A 3EE0B 1EXFA 3S7KB 1TNKA 3BTWE 3RXTA 2K8IA 2ZDLA 2F91A 3UREA 8GCHF 5FBEA 3OY5U 4F55A 4E7RG 3RLYH 3RXOA 1JWTA 1N8OB 1THSH 1TNIA 3Q77A 3RXDA 1TFXA 1TNLA 4AG2A 1H9LB 2PUXB 5C67A 1SSXA 2KR7A 1FY5A 4BTTB 2V0BA 2V3MA 4JYVH 1Z1JA 1FN6A 2QXGA 1BITA 5C1UA 2BD5A 1C5TA 1BRAA 1FY1A 5HMAA 1Z8IB 1W0KD 1GGDB 5I46H 1FX0B 1C1TA 2WPMS 1LTOA 1ANEA 3LH3A 2J5UA 1ZLRA 4FUJA 1H9HE 1Y3XA 2VNTA 4E05H 1YPHC 4ISNA 5C1XA 1LHCH 4XRNA 1HAHH 5DP5A 3R3GB 3H7OA 3IG6B 1CQQA 1ZHRA 5T3HA 3AW0A 3ZVEA 1A1RA 1MTNB 1BMMH 3O8BA 5DP9A 1MKWH 1SKYE 2GDEH 1DT2A 3ZZ4A 5EXMA 2WV5A 4ZMAH 2V35A 2W6ID 4AYYB 2BD7A 2XYAA 1K1PA 3N7DA 1HJAC 2M2AA 4NGAH 5DP3A 3LT3A 3V12A 2FDAA 1O3MA 2FODA 5EOKA 3Q3XA 3GCTF 3UQOA 1NRPH 1FJSA 1SGTA 3RXVA 4CHAC 2BXUH 4CR5A 3GY8A 2BDGA 4ISHH 1ELGA 1C5YB 3KQBA 3A87A 1UK3A 2A2QH 1WQSA 5HIYA 1C5PA 2KCAA 1Z6EA 2WYJA 3TLOA 3FP6E 1HFDA 1UK2A 5GDSH 2BZAA 3TK5A 5DG6A 3OFND 1BA8B 1G3DA 2VGCC 1GWAA 4Y8YA 1FN8A 1VCPA 1E37B 1EB1H 1C1WH 5EIYA 4SGBE 1VJ9U 1LQDB 2PKSC 1ANBA 2ZDAH 4HTCH 4DOQA 1MKXK 4ABGA 2A31A 4DVAU 1O2IA 1GI1A 3F6UH 1V2QT 1MBMA 1ARBA 2Z7FE 3SU5A 2HLDD 1TB6H 3RXIA 2Y5GA 1ZOMA 4IMZA 5EPNA 1SHHB 1O2KA 2LP6A 3SHAH 1QL9A 2C4FH 3DSPA 1C5QA 3TGKE 1FY3A 1CE5A 3M5MA 1IQNA 6CHAC 5EODA 4M9FA 1TQ7B 2BY5X 5EQRA 4A6LA 3EDXB 1K1LA 1G2LA 2W7UA 3UOUA 2VINA 2VIOA 3RU4E 1SLXB 3TH4H 3M7QA 1OWEA 2R2MB 2C3SA 2R9PA 1HGTH 1UTPA 1DWDH 1GHBG 1C1UH 2ODQA 1GHXH 2ZPRA 5JBBS 3QZRA 4ABDA 2A1DB 4YLQH 4XSKU 5CHAC 2ZFFH 2BLOA 3DUXH 4OS2A 4ZUHA 1BHXF 4DG4A 5A0BA 2PTNA 2STAE 3C1KA 3UWIA 2BM2A 3LGWA 4O97A 4FUHA 2WPKS 3FN8A 3ZZBA 3MFJA 1O2GH 1Z1IA 1TPSA 4TY7A 2ESTE 3RXHA 1BQYA 1ELCA 2SGPE 1YP9A 2ANWA 2GZ7A 5ESTE 3M7TA 3OTJE 2ZTZA 1V2UT 4AB9A 1DWEH 4X1NU 2GZ8A 2ZGCA 6LPRA 1T8NA 3PWBA 4OGXA 3OAAD 4U01A 1SQAA 1GHAG 2F3CE 1KXFA 1PPEE 1NU7B 1SGIB 2BQWB 3E90B 5A8YA 1GBCA 1LVBA 3ATLA 1K28D 3UAIC 2Y80A 4FOUC 4Q7ZA 2ZPQA 2O8WA 3ZVBA 5BRRE 2YOLA 3MI4A 1V2VT 2UWPA 4I8GA 3A88A 1LMWB 2XWAA 4X1RU 1GBFA 5CMXH 1TIOA 4B73A 1AZZA 2VH6A 4JMYA 2V3OH 1ETSH 4XBBA 1BBRH 1FPHH 1GL1A 1KDQA 1YPHE 1GVLA 1S6HA 2VVCA 4BNRA 4NIVA 2C8YB 2VWLA 4GVUA 3EE7A 3VGCC 2J98B 1KLJH 1SI5H 2FO9A 5AHGH 4ACBA 3VFEA 1SGPE 4FXGH 5GNDA 1MU6B 4X6NA 3QLPH 1VR1H 3HKIB 5T6FA 3MO6A 2RDEA 3NWUA 3KQCA 4CHAB 2EI6A 1MKWK 2GCHG 3LONA 5FL7D 1U6QA 2CJIA 1O5AB 4NCYA 3ZZ3A 2I6SA 1SR5C 4BXWA 1HB0B 2O8LA 5E2OA 3E6PH 4YLUA 4AFSA 1XXDA 2FXRA 1NFYA 1C2JA 3RMMH 4CR9A 1P2OA 8KME2 2FTLE 1SGFA 3GISB 1GCTC 2VJ1A 1C5VA 1OWIA 3V3MA 1Q31A 4D76A 2UUFB 4H6SB 3FZDA 2UUKB 1GJ4H 2A0QB 1GG6B 4X2YA 4Q80A 2FMJA 8ESTE 2FLRH 1TGBA 3M36A 1QB9A 5TJXA 2FOEA 5L2YH 2Y5HA 3F0PA 3SV6A 3RXMA 1RXPA 2XBXA 2XBWA 4B6EA 4AORA 2H9EH 3KN2A 1PPFE 1K0HA 5JPMH 4JZDH 2A4OA 4MPVA 5EW2H 2IJOB 1SGEE 2A7HA 2G5VA 3AVZA 1BMLA 2A4QA 3PRBA 1D3TB 3SBKA 1GJ7B 1HAOH 1C2KA 1O2ZA 1WBGB 1AU8A 2ANYA 2CMYA 2OBOA 1MD7A 2WPDD 4I8LA 3DSOA 3KIDU 4GAWA 3GY5A 2LPRA 2YMSB 1GMDF 5EU8A 1JBUH 1T32A 1BTHH 4VGCB 1C2MA 1DDJA 2BLWA 1O3KA 3RXCA 3ATWA 3O8DA 2QXJA 3ZZ7A 2FOHA 1E38B 2B7DH 2OC0A 1O34A 3BIVH 2F9BH 1IQKA 1DXWA 4ZH8A 2BQ6B 2BD8A 2BYAX 3ZIAD 4AG1A 3SGBE 5JBTA 2R0LA 3SV8A 1XXFA 4WMFA 3SJ8A 2EY4C 2FWWA 4LXBH 1G3EA 2LELA 4TWWA 3RXAA 2LNCA 1C5ZB 3TVJB 1BTXA 1GI4A 1WDIA 1CA0B 3F1SB 4NSYA 4UD9H 4DIHH 1ZJKA 1A5GH 3SNDA 1ZZZA 2ALVA 1GBJA 2PGBB 1G37A 5HYOA 3LJOA 3M7UA 4CRAA 3A7ZA 1EFRD 1Z8RA 1V2PT 2F9VA 1ZGIA 4OS1A 1AD8H 2QF5A 4M7GA 1L2EA 1FY4A 3RXLA 1WTGH 3TK6A 4ABBA 2EI8A 1ZSJA 3MNSA 3U8TH 1QFKH 1F2SE 1A5HA 2ALPA 2Z9LA 4NSVA 1MTVA 1V2WT 1C2IA 2H5CA 1KY9A 2VIQA 3U28C 1HAIH 3BEFB 2Y6TA 2J34A 1ZGVA 2XC0A 1O2JA 1W14U 3BTDE 3F2FA 2H5DA 4Q4LA 4D7FA 2BDBA 2HOBA 4YXWD 2FOGA 3KNXA 2OINA 1SVPA 1SGFG 1GMHF 2ZQ1A 3F9FA 1FIWA 4MQAA 4Z6AH 2KCPA 3LJJA 2AGEX 3I77A 4I8KA 2JH6D 2Y81A 1MABB 2P8OB 4BAOB 3AK5A 1EZUC 1E79D 4FVBA 1O3GA 1V2KT 3GDSA 1SFIA 1K1JA 1YLDA 1C2HA 1P3CA 5GIBA 1HXFH 3S69A 1DITH 1P12E 2BD2A 5AF9H 4LZ1H 1RRKA 2FIRH 2ZFRH 1ELDE 3G01A 1LCYA 1MAYA 2F9OA 2GCHF 4IBLH 2PGQB 1ZHPA 3DSGA 3PMHB 1C2EA 3GCHB 4OS5A 3STJA 2ZU2A 4ABIA 3SU1A 3NCLA 2ZU1A 1JOUB 1T8OA 1XKAC 4K69A 4U2WA 2GX4A 5ABWA 4Y8ZA 1K1IA 2QF0A 1J15A 3RXKA 2BOKA 3QK1A 2C93B 1ELBA 1DUEA 1S5SA 5E0JA 2FZZA 3F9GA 4A92A 2L74A 4K2YA 2TGTA 2QAAA 1AVXA 1RTFB 3UQVA 1C5SA 1IQFA 1O2NA 3MU0A 3N7OA 4JZEH 5FXLA 2Z9IA 2RG3A 3RMNH 2EI7A 1YCPH 4B71A 1L0ZA 1GJCB 3BEIB 3PWCA 5E0GA 1AFQB 2Y7ZA 3QGJA 1P9SA 3U8RH 1XUIA 2OBQA 2JH0D 3M5NA 3ATIA 1K21H 3T25A 2JKHA 3CNRA 1DSUA 1RTKA 2V6NA 1O3OA 4GLYA 3UOPA 1XVOA 2ULLA 3MYWA 1FAXA 3HGNA 1GJAB 3DFJA 4XBCA 5F03A 3BF6H 1C1VH 1S83A 2ZA5A 1DWBH 1EAUA 3VXFH 3AAVA 4DIIH 1DUAA 2CK3D 5F53A 1K9OE 1N8OC 4ZHMU 1ELVA 1P10A 3K2UA 3P17H 4Y0YE 2AIPA 2FI4E 3GCHC 4ZHAA 2B0FA 1YC0A 1KXCA 2OK5A 1VCQA 1G32B 1XMNB 1OWHA 1HAVB 3M35A 1CO7E 1MZDA 4F49A 4WWYA 2ZU3A 4AOQA 1EKBB 4A7IB 1WTHD 1QRWA 1LKBA 2PWXA 1MCTA 1AN1E 5ESBA 1BDAA 1VJAU 2GDDA 3RC5A 3W95A 1CHGA 2PR3A 1ZR0A 3NRLA 3SI3H 5F8ZA 7GCHF 1GHZA 4Z0KA 2D2DA 5A09A 4P02A 3GDVA 5AVDA 3AASA 3H7TA 3E0NB 2EEKA 3PV5A 2J9NA 2OQUA 1BRBE 1D9IA 2ZGBH 3RLWH 4GCHG 1A46H 1MQ5A 3KL6A 5FPSA 4TY6A 1LKAA 1P04A 3KYFA 4JZ1A 1NPMA 4UFFH 1YPKH 2ANKH 3NKKA 2ZC9H 3SU2A 1DPOA 6GCHF 1G3BA 1LQEA 4X8UH 3T5FH 3ZVGA 4GHTA 3OU0A 1COWD 1CA8B 4AX9H 2BY6X 1O3CA 1BTYA 2SGAA 3MH5A 3FANA 1GI7B 1YCPK 4MTBA 1O2RA 3P6ZB 2QY0B 1GJ6A 3SZEA 2J98A 2G4UA 3LU9B 5E0HA 2TGAA 1UVTH 3KQ5A 1Y8TA 2ZZUH 1SGCA 3TU7H 2FS9A 1O3EA 1A3BH 2QCYA 4ABFA 1O5DH 1AKSB 3OYPA 3LGUA 5FPTA 2F43B 4X8SH 1NESE 1V2OT 2SNVA 3M5LA 2P8OC 3QO6A 2VB0A 2GV7A 2GKVE 2FESH 1AB9C 3I78A 1JMOH 1TMTH 2W3IA 7KMEH 1W0YH 1OWJA 1QRZA 2ZFTA 1C4Y2 1F0SA 1J14A 5IYTA 4GPGA 1A61H 1OYTH 4MNVA 4A1VA 7LPRA 1ESBA 4ZKRU 1LPGB 3RM2H 3T62A 1QA7A 1IQJA 2R2WU 4RN6A 1GMHG 1QQ4A 1DE7H 3TJNA 3MH7A 1BUIA 5FPYA 3ZZ9A 1XUJA 1NU9A 3RXFA 4X0WU 1HAZB 1ARCA 3A89A 2GZ9A 2Q6DA 1PPZA 3T29A 3ZVCA 3NXPA 2PFEA 4DT7B 3FAOA 1ZTJA 2ILNA 1C1PA 1EZQA 1QY6A 4NZQA 3VXEH 2G55A 4AGKA 4THNH 3SI4H 1HBTH 3SJ9A 1EZXC 3VB6A 3H5CB 3PV4A 3P70B 1IQMA 1V2LT 3TPIZ 3D23A 1N6XA 3M3SA 3SU4A 5DKMA 2BDCA 2XCNA 1OWKA 4X2VA 5DK1A 4HG6A 3MH6A 3S7HB 2ZKSA 1AFEH 2FM2A 4FUIA 3ATMA 3URCA 5EQSA 2BMGB 3SU6A 3BTTE 1GDUA 1FXYA 3ZZ5A 3A7TA 3CENA 4Q7XA 4X8VH 1ZTLA 1GBKA 2AYWA 1O39A 3A81A 2P16A 2D1JA 1SG8B 4D8NA 4MPUA 5L30H 1NS3A 3SUGA 1GMCG 5H4IB 2HWLB 3ODFA 4XFQA 1B7XB 1TPOA 1D4PB 4SGAE 3OEHD 4GCHF 4MPWA 1C5LH 2BVXH 4JK6A 2KAIB 1S82A 2EA3A 1O5GH 2GMTB 1C1QA 7GCHG 5FCKA 5EJZA 1GDQA 3ZVFA 2H9HA 2NU0E 3U1JB 1TA2A 2WZQA 1W13U 1QB1A 2GJGA 3SU0A 1BJUA 2VIVA 1P0SH 1DY8A 4ZXXH 2BY8X 1SGRE 2VIWA 3A8CA 1NC6A 4KGAA 3ZVDA 4X8TH 1F0RA 1L1NA 4NIYA 3RXQA 1NZQH 3SO3A 2BX3A 3BTHE 4O9VA 1NBMD 4WXIA 1BRUP 1E1QD 3A7XA 1HRTH 2HNTF 1XX9A 5HM2A 1AB9B 2RDLA 1O38A 2GT7A 3K9XB 4IC6A 1QHRB 2F83A 4CRBA 1HDTH 2ZFSA 3W94A 4Q7YA 4DW2U 1C1NA 1HPGA 2BZ6H 2ZO3H 3PMBB 4OM9A 1V2NT 1O5FH 3TJOA 2PTCE 1THRH 1W0ZU 2G8TA 2WPLS 1BT7A 2A5AA 4RT0A 5HXFA 1AY6H 1WSSH 2XOKD 1GG6C 1W12U 4Y76A 1ANDA 3FZZA 2RFKC 1QTFA 3MWIU 3LC5A 1BTUA 2WV9A 3HPTB 4R8TB 2YNBA 3VG8A 3A85A 2ZDNA 4I8JA 1O2HA 2YMSC 3OE7D 2K1QA 2ZF0H 5L6NH 3WY8A 3SNCA 3UR6A 3P95A 1IQLA 3TJVA 1C5MD 4ZROA 1FY8E 2XCFA 4IC5A 4ZCNA 3TH2H 1ELFA 1H8DH 1GVKB 1S6LA 2Z3EA 3BG8A 1SQTA 3NUMA 2A45B 4X6PA 3GS9A 4B6FA 2CGAA 2O8MA 2UUJB 2OCVB 1HAXB 1XUHA 1BBRK 2B8OH 3SV9A 5DPAA 1O35A 1UTNA 3TK9A 4ISLA 1FPCH 1ETRH 3A7VA 2RA0A 2P95A 1F92A 1HXEH 3LGIA 2XC4A 1UTOA 1F5RA 3VB4A 1IQIA 5T6DA 1HNEE 3U9AH 3TGIE 4A5TS 5FCRA 3QTVH 1TGTA 1MD8A 1GCTB 1FMGA 1QR3E 4FVDA 2D26C 3UWJH 1LDTT 4E7NA 1W2KH 5KEDA 1L4DA 1HYLA 3PLKA 1P8VC 1EP5A 3NK8A 1CBWC 3LPRA 1PFXC 4I8HA 1PQ8A 1ZPCA 5EGMA 1O36A 2HALA 3TH3H 1GBTA 4JK5A 2BDAA 2ZCKP 2WSSD 3MU4A 1VKYA 3B9FH 2AHME 4YT7H 2NWNA 5DP7A 1NFXA 1YPGH 2HGTH 3K6ZA 5GPIB 5AFYH 1OHHD 2FYQA 3TNTA 1QBOA 1HJ8A 4A1TA 2P3TB 1E0FD 1BZXE 4YESB 2CHAB 2TGPZ 1UCYH 5C2ZA 1UTMA 1W8BH 2BHGA 1UO6A 1N6YA 2UWLA 2R3UA 2M5TA 2SGDE 4B1TA 2PLXA 1P06A 3GCOA 5EQQA 4AFUA 4CRFA 3LGTA 1WAYB 1ELEE 1WCZA 1TAWA 2PKAB 3LKWA 2XW9A 2C8ZB 2FI5E 2FI3E 4NZLA 4BANB 2WPHS 1EX3A 1NFWA 4X6MA 1IQHA 5CHAB 1MBQA 1AGJA 5DJ7A 1TOCB 1SQOA 3HGPA 3A8AA 4Y79A 2Y7XA 2ODYB 3UUZA 1H8HD 1C5RA 1TRNA 4O03A 1O2MA 1OP8A 3WWBA 1QJ7B 4JZIA 1KIGH 4JYTA 4A1XA 1PPCE 1E34B 1C5NH 1NT1A 3D65E 1TRMA 3GOVB 5CHBA 2W3KA 4DURA 3TITA 1VZQH 1FV9A 1DWCH 1C2LA 1YCPM 3FOAA 4I32A 4TPIZ 4AZ2B 4U30A 1KLIH 4X2XA 1VITG 3A80A 2QF3A 1Y3WA 1HAPH 3KEEA 2W5EA 1TMBH 3GYMA 2PSYA 2WUBA 2J92A 1S85A 3BIUH 1RIWB 4YO9A 1TX8A 1EPTC 1MU8B 3S9AA 1GBDA 4ISOA 4OS4A 1T4UH 1F0TA 4DGJA 1T8MA 3F9HA 2VWOA 3F2HA 1LVOA 1MTNC 3T2NA 1SHYA 1S84A 4FETA 4D7GA 1XKBC 3KCGH 1XUGA 3GY3A 1OP2A 1GBLA 1IAUA 2WHXA 1HLTH 3HATH 2FEQH 1SQRA 2BD4A 5J4QA 3UNSA 2QXIA 5EG4A 5E8EH 3RP2A 3F3BA 5K0HA 1YPLH 1UTLM 1T4VH 3PLBA 2A4GA 3VGCB 1BIOA 1TA6A 2RA3A 1C2FA 3OTPA 3RXPA 5ETXA 1EZSC 3PLPA 1V2MT 4MPXA 4CBOA 1EB2A 4MDSA 3AW1A 4LZ4B 3GICB 4FU8A 3JZ1B 1EAXA 2BOHB 5A2MH 3VB7A 3O8CA 1JRTA 1RTLA 4LOYH 3IWMA 5C5OA 5LPEA 1Z8JB 4DCDA 1P05A 5EW1H 2NU2E 5A0CA 5JDUB 1AVGH 2XNIA 4NWLA 1EPTA 1K1MA 2ZHDA 3M37A 4K60A
chains in the Genus database with same CATH topology
3SV2H 1ORFA 4Y11E 1LHDH 3LH1A 3A8DA 2ZHQH 2ZP0H 2GP9B 1TGSZ 3M5OA 1ELTA 1GHYH 2QGRA 4NFEA 1CHOF 4JZFH 4K1SA 1KXEA 3SNBA 2BY7X 1O2LA 1AVWA 1BTPA 1FI8A 2BY9X 2ZGHA 1O2SA 4CRCA 2AERH 2F9UA 4GUXA 1TNGA 5E2PA 1WQVH 1GI6A 2WINI 3MU5A 2WPJS 2QC2A 2J4IA 1DLKB 1DX5M 1QB6A 3A86A 1BJVA 4Q2KA 1YGCH 2A2XH 2ZEBA 1GMCF 4WY3A 3PMAB 1C1OA 3MMGA 1NROH 4LK4A 3A83A 3LGVA 1CA0C 3EA8A 1ZTKA 1AWFH 1RIWC 2O9QA 1C1MA 2H9TH 4BTUB 2GCTC 3UY9A 3MNXA 4FUBA 2ZDMA 1GMDG 1O2PA 1OS8A 2AGGX 1B0EA 3HK3B 2BXTH 4HFPB 3SV7A 1DM4B 2BLQA 4GHQA 1UK4A 1DVAH 1NM6A 1THPB 2BVRH 5LPFA 2GVFA 2G00A 3EA7A 3Q00A 1EOJA 3P8OA 3SQHE 1UHBB 1VITH 1GJBB 4AN7A 3QUMP 1D6RA 1TOMH 3A7YA 1OKXA 2FOBA 2XTTB 2ZIQH 3E3TA 4H6TA 4CBNA 4BXSA 2VIDA 1EASA 4BTIB 4WH6A 1P57B 5GJ4B 5LGOA 1LVYA 3RXBA 3K65B 1G9IE 3RU4D 1EAWA 4B2AA 1Y5UT 2H2ZA 3SORA 1OPHB 5GWZA 1Q3XA 5HM9A 1C2DA 4FU9A 4FUCA 1O3JA 1TGNA 4Y6DA 4AFQA 2O8TA 3L33A 5FAHA 2P3UB 1YBWA 2CXVA 2BB4A 2FS8A 3GCNA 4NA7A 2Z9GA 3ZYDA 3PTBA 1QA0A 4F4OC 4D9QA 1A0JA 3T27A 3M3TA 3ENSB 4BOHA 3T26A 1CT2E 1DY9A 2P59A 5TCAA 2OP9A 3EQ0H 4JCNA 1AQ7A 4WMEA 1HIAB 1V2ST 1O2YA 5J4SA 1AUJA 1ZMLA 3SW2B 1TONA 5TCCA 1BMNH 4ZKSU 2FOCA 2ZDVH 2QIQA 1CT0E 3BG4C 1S81A 5FBIA 4B76A 1W7GH 4ESTE 2HRVA 1VGCC 1NN6A 1SPJA 1P2JA 1BMAA 1JIRA 1LO6A 1O5CB 1SB1H 2ZTXA 1A0HB 1XM1A 4INKA 1XUKA 3P8FA 1FZZA 3RXGA 1HV7A 5DP4A 2FOAA 2XXLA 1O3PB 1QRXA 4CREA 4IN2A 4Y10E 4ZXYH 4YOIA 3DFLA 5JBCS 3MO3A 1AE5A 2G5NA 1A2CH 1SOZA 1P3EA 3L3TA 3ZZ8A 1VCWA 1CU1A 2C8XB 4IGDA 3SNAA 2FPZA 1H4WA 2QN5T 1DSTA 1Z7KA 2GV6A 1V2JT 3S9BA 1CVWH 1TPPA 1O33A 1SBWA 5C3NA 1C5WB 1FDPA 2OQ5A 1P02A 3M3VA 2VVUA 3B23B 3VPKA 3MNBA 3BTKE 1O3DA 1AO5A 1FUJA 3L6PA 3QN7A 1AKSA 4X1SU 1CHOG 3F9EA 4NG9H 5I25A 1BHXB 3MU1A 3U69H 1YF4A 1LVMA 1UVOA 2BDYA 2FTMA 2OXSA 3ZYEA 3UNQA 1EUFA 1WU1A 1O3BA 4I33A 1CGHA 2ZU4A 4QT8C 1NTPA 1MQ6A 5LH8A 3U8OH 1OWDA 4HZHA 1ABJH 1ELAA 3EGKH 2BD3A 1ZYOA 1UHBA 2ZFQH 3RDZA 2PSXA 4BAMB 2PUQH 1O31A 1O3LA 1UTKA 2HPPH 4Y8XA 1EP6A 4ASHA 1SLVB 1IQGA 2GTBA 1QURH 2BTCE 1BOQA 3DT0H 1NFUA 1EJAA 1GBMA 5JB8S 2HLCA 1OYQA 1UVSH 2NU4E 3KHVA 1WV7H 1PJPA 2ODPA 3A8BA 1G3CA 2BQ7B 4B74A 2JETB 2VWMA 1GI9B 2AMQA 2ZHEH 1GI0A 1L1JA 2AFQB 2PW8H 4AFZA 1NRSH 3RM0H 4DJZB 1GHWH 4I31A 1M9UA 1DFPA 4ABEA 4BAQB 2Q6FA 3GY4A 2P3FH 3K6YA 4O3UA 1AI8H 1UTJA 3UR9A 4CRDA 4FU7A 1A5IA 5DP6A 3SGAE 5DP8A 3RXSA 5EPYA 1CGJE 3GY7A 1T31A 3KF2A 5T6GA 8GCHG 1LHGH 1S0QA 1TPAE 1ETTH 2ZNKH 1P2IA 1YM0A 1O37A 4YT6H 4OS6A 2XBYA 1K22H 2VWNA 1HAGE 2O8UA 2W26A 1GHAF 3BTFE 4PROA 1EJNA 3PTNA 3UNRA 1TLDA 3V7TA 4UE7H 1W7XH 2FOFA 2W7SA 3TGJE 1UCYK 2BD9A 4ABJA 1F5KU 4UFDH 2BVSH 3PMJA 1J17T 2CN0H 3SQEE 1YPJH 1GL0E 3FP8E 1FQ3A 2GMTC 2SNWA 1EOLA 1NRRH 2DE8A 2A4RA 2XC5A 1TQ0B 4O3TA 4BAHB 2YNAA 6CHAB 1RD3B 3UTUH 3FP7E 3MOCA 1BCUH 2J94A 2NU1E 4XE4A 4WXVA 3T28A 1VGCB 1GBBA 4NA9H 3VB5A 4K5ZA 9LPRA 3UFAA 1T7CA 5JYIA 1O3HA 3PO1C 3SUDA 3ZV9A 1C1SA 3MTYA 2Z6BD 5F8XA 1L4ZA 5AFZH 3PM3A 3JZ2B 2HPQH 1UCYE 3BEUA 3I29A 1C9TA 4H4FA 4MG3A 1TBZH 2PKSB 3Q3KA 1FONA 1TRYA 2C8WB 3E8LA 3URDA 3MHWU 1SMFE 3MNCA 3STIA 1GBIA 1IHSH 4X2WA 2OTVA 4JYUH 3S0NA 4KTUA 4ABHA 1GJ8B 2SGEE 2VU8E 1D3PB 4K1TA 1HIAA 1E36B 4WVPE 3P8GA 1YPMH 1PQ7A 1CSOE 2ZFPH 1UMAH 2CV3A 3ELAH 1JIMA 2PV9B 2G81E 1SL3A 1QL7A 2QA9E 2PHBA 3KQEA 1O2XA 4K1EA 1LPKB 2IOTA 3SJIA 1XVMA 2NU3E 2SFAA 9ESTA 4AGJA 2BX4A 3NZIA 4CH8B 4RSPA 1SGYE 2H6MA 1ZRKA 2J2UA 3FVFB 4J1YA 1C4U2 1RGQA 3D49H 4CRGA 1LPZB 1GVZA 1X7AC 4D9RA 2G51A 3KGPA 4OS7A 1A7SA 4ZHLU 2TIOA 1PQAA 2SGQE 4VGCC 5B6OA 3LGYA 1GJ9B 1UTQA 3KQDA 1C9PA 1P2KA 4IN1A 1ZMNA 3A84A 4ISIH 1QBNA 1DOJA 1TBRH 5DO4H 1LHEH 1ZPZA 4UONA 1GHVH 2XWBI 5GCHG 3GY2A 2STBE 5SGAE 4FUDA 1NRQH 1INCA 3MU8A 3NPSA 3RUOA 1RFNA 2A32A 1OP0A 1AZ8A 1K1OA 1GHBF 2OUAA 1HJAB 2CF9H 1GJ5H 1CGIE 3LDXH 1F5LA 1OXGA 5G4BA 2H1UA 4KELA 5IDKA 2J38A 2AMPA 3BG4B 4WH8A 2Z3CA 1BTWA 1ZPBA 2ZCLP 1A0LA 4Y71A 5F6MA 4NIXA 1TALA 1IHTH 1C5XB 1QBVH 1GI2A 1UVUH 5K7RA 1W11U 2P93A 1TNHA 3RC4A 2WUCA 5LPRA 1YLCA 3RMLH 3UPEA 3QDZB 3BV9B 1O30A 1GJDB 1TE0A 3TNSA 1MAXA 4CH2B 2B9LA 4Y0ZE 4NWKA 1KXAA 1V3XA 3ITIA 3U98H 5EXNA 5JBAS 3PYHA 1BB0B 1PPGE 1EPTB 3Q76A 1P2NA 5FX6A 1PPHE 4HGCA 2R3YA 3SJKA 4KTCA 4KTSA 4ABAA 1ESAA 3BTGE 4YOGA 4FUGA 1OSSA 3ATKA 7ESTE 4TWYA 2AGIX 3QGNB 3AAUA 3MO9A 2OD3B 3E91A 2DUCA 4UEHH 2Q1JA 3SU3A 1C4V2 1ZJDA 4X6OA 3RC6A 4HI3A 3PB1E 1DICA 1ZMJA 1GBHA 1O32A 2I6QA 3RXRA 1QL8A 4I7YH 2IPHA 2ZECA 1W3CA 1T8LA 3TJUA 1YYY1 1KLTA 2WPIS 1HCGA 2BLVA 1GDNA 2ZG0H 1BRCE 4B2BA 5JB9S 1G36A 1FLEE 1TMUH 1TBQH 2QYIA 3LC3A 3SJOA 2FX4A 1MZAA 2QV1A 1TNJA 1WYKA 2ZI2H 3SN8A 4H42U 2OC8A 1CT4E 4J2YB 3R0FA 1SLWB 2OC7A 3C27B 1Y59T 3ZV8A 1L1GA 2OLGA 2VIPA 2G4TA 1EJMA 4INLA 2THFB 4WMDA 3SZNA 1Q2WA 2QXHA 1UJ1A 1S0RA 5HGGA 1GI3A 3UIRA 4TPYA 1MTSA 1V2RT 1D3DB 2CHAC 2JH5D 1OOKB 2AIQA 1MTWA 1MTUA 3OSYA 1WOFA 2A7JA 4B75A 5BPEA 5A0AE 1F7ZA 1S6FA 2XBVA 4XBDA 2GGVB 1SLUB 4YZUA 2C90B 1ZRBA 1K1NA 1DS2E 1PQ5A 6ESTA 1ACBE 5C1YA 1YKTA 2TBSA 1IQEA 1DLEA 2ZHWH 1O3FA 3ODDA 2ZDKA 1GPZA 3QTOH 4K8YA 3U1IB 3SHCH 4AB8A 4UDWH 3SGQE 3DD2H 2BDHA 4YTAA 3RXEA 5GXPA 1NY22 1KSNA 3M61U 4IS5A 3LIWA 4BAKB 2ZPSA 1OX1A 4B2CA 3B8JA 1YPEH 2PKAA 1N1LA 4MNWA 1QJ6B 1HAVA 1AHTH 3EAJA 2ZGJA 2ZGXH 4UFGH 3Q3YA 1VITF 2Q6GA 3CP7A 3OX7U 1LHFH 4K3JA 4KKDA 1ZSLA 2WYGA 1HAYB 3MH4A 1SGQE 1Z71A 3GY6A 4XDEA 1V6DA 1MKXH 2RCEA 4FUEA 4U32A 4Y7BA 1D3QB 1KYNA 1MMJN 1MCVA 2VH0A 4TYDA 2G52A 2Z94A 1GBEA 1O3NA 2Y5FA 2Y82A 1H8IH 5EXLA 1E35B 1O2WA 1NO9H 3QZQA 2F9PA 3GDUA 2JETC 2F9NA 1QJ1B 1KTTB 1PPBH 3SNEA 1P9UA 1EATA 3A82A 3RMOH 1D6WA 1P2QA 1C2GA 1J8AA 3DA9B 5FX5A 3P92A 1V2TT 2HVXA 3SUFA 1QNJA 2HNTE 2B5TB 1H9IE 4MNXA 1AIXH 1TABE 3TIUA 3BTME 1O3IA 3E0PB 2FP7B 1Z8GA 1O3AA 2A7CA 6GCHG 1AFQC 4X1PU 2Z3DA 4ZAEA 3EYDA 1TX7A 1GI5A 2UUYA 3E1XB 3ZZCA 4ZKOU 3V0XA 2ZWLH 3FFGA 2Z9JA 3P8NA 5C5NA 3EA9A 2D8WA 4UFEH 4NIWA 1SFQB 2ASUB 1Y3YA 1P01A 1TWXB 4MNYA 2AMDA 2P94A 3QX5H 3RXJA 3GYLB 3LOXA 1O2UA 1GCDA 2FYRA 1QIXB 3IITA 3CS0A 3E16B 2FLBH 2V3HH 1A3EH 1P2MA 1TYNA 4WF8A 1SGNE 4KP0A 1GGDC 4X1QU 8LPRA 1FAKH 4RKOB 1SOTA 1AWHB 1FIZA 1DANH 1ZHMA 1BTZA 4GSOA 4WJG2 2HNTC 1KDQB 2AS9A 2VGCB 1NRNH 3DHKH 4DY7B 1P09A 2BDIA 1G30B 1HUTH 1SC8U 4Y7AA 1O2QA 3HK6B 3PROA 3SUEA 1AUTC 1Z6JH 1G2MA 3F68H 1GI8B 2GCTB 1EQ9A 4E06H 1ID5H 1W10U 1KXBA 2IN2A 2WV4A 3O8RA 1FNIA 1B0FA 1IOEA 1SGDE 3GCTG 4AYVB 3QWCH 4YM9A 1UVPA 3BTEE 2SGFE 1O2OA 3BTQE 3BN9A 3D62A 4NA8A 1J9CH 2A5KA 1QGFA 3RU4T 1RJXB 2FX6A 2ZHFH 1C5OH 4YOJA 1Y5BT 4IW4E 1ABIH 1HJ9A 3S9CA 2ANMH 3CS7A 1O5BB 4K8BA 1O0DH 5F8TA 2XRCA 2OC1A 4ZKNU 1ANCA 4MLFB 3OY6U 3ZZ6A 1DXPA 4OGYA 3VEQB 2FOMB 1BBRE 5GCHF 2ZTYA 1Y5AT 1ZSKA 3RXUA 1JRSA 1P11E 5L2ZH 1EAIA 3ESTA 5A8XA 2GT8A 2TRMA 2GD4B 3HKJB 1RS0A 2J95A 1MUEB 1XUFA 1WUNH 3PO1B 5DGJA 1O5EH 1O2TA 5PTPA 4FUFA 2Z9KA 2EC9H 1TX6A 1ESTA 3V13A 3VB3A 2DE9A 3A7WA 1Y3VA 1JXPA 5C20A 2ZCHP 2CF8H 1MH0A 1GBAA 5A8ZA 2TGDA 2KAIA 4IMQA 5FHTA 1QQUA 1O2VA 1PYTD 1C5UA 2AH4X 1K2I1 2ZU5A 1Y3UA 2UWOA 4INHA 4MVNA 2VVVA 4NFFA 1CBWB 2ZQ2A 1AMHA 2AEIH 2R0KA 4XOJA 1TGCA 1C1RA 1J16A 1PYTC 3BSQA 1H1BA 2TPIZ 1AE8H 1P03A 1B5GH 2A5IA 3ZZAA 3SOSA 3ZZDA 4RKJB 1F0UA 4R0IA 3ZVAA 1KXDA 1A4WH 1QCPA 1KTSB 5CE1A 3EE0B 1EXFA 3S7KB 1TNKA 3BTWE 3RXTA 2ZDLA 2F91A 3UREA 8GCHF 5FBEA 3OY5U 4E7RG 3RLYH 3RXOA 1JWTA 1N8OB 1THSH 1TNIA 3Q77A 3RXDA 1TFXA 1TNLA 4AG2A 1H9LB 2PUXB 5C67A 1SSXA 1FY5A 4BTTB 2V0BA 4JYVH 1Z1JA 1FN6A 2QXGA 1BITA 5C1UA 2BD5A 1C5TA 1BRAA 1FY1A 5HMAA 1Z8IB 1GGDB 5I46H 1C1TA 2WPMS 1LTOA 1ANEA 3LH3A 1ZLRA 4FUJA 1H9HE 1Y3XA 2VNTA 4E05H 1YPHC 4ISNA 5C1XA 1LHCH 1HAHH 5DP5A 3R3GB 3H7OA 3IG6B 1CQQA 1ZHRA 5T3HA 3AW0A 3ZVEA 1A1RA 1MTNB 1BMMH 3O8BA 5DP9A 1MKWH 2GDEH 1DT2A 3ZZ4A 5EXMA 2WV5A 4ZMAH 2V35A 4AYYB 2BD7A 2XYAA 1K1PA 1HJAC 4NGAH 5DP3A 3LT3A 3V12A 2FDAA 1O3MA 2FODA 5EOKA 3Q3XA 3GCTF 3UQOA 1NRPH 1FJSA 1SGTA 3RXVA 4CHAC 2BXUH 4CR5A 3GY8A 2BDGA 4ISHH 1ELGA 1C5YB 3KQBA 3A87A 1UK3A 2A2QH 1WQSA 1C5PA 1Z6EA 2WYJA 3TLOA 3FP6E 1HFDA 1UK2A 5GDSH