4ZHLU

The crystal structure of mupain-1-ig in complex with murinised human upa at ph7.4
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Selection of High-Affinity Peptidic Serine Protease Inhibitors with Increased Binding Entropy from a Back-Flip Library of Peptide-Protease Fusions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2015-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zhlU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zhlU01
1YGCH 3SNDA 3LDXH 3QGNB 5FBIA 3EAJA 1GHBF 5IYTA 3TNSA 3M35A 2W7SA 1BMAA 3ESTA 2F3CE 1MAYA 1Z6EA 5TCCA 1NPMA 2F9OA 2VINA 3QZQA 1IQJA 2FO9A 3NXPA 6ESTA 1YLCA 2VWNA 5E0HA 1C5TA 5JDUB 1MTVA 1DSTA 1SQOA 4XBDA 1RGQA 2Y82A 4KELA 1VR1H 1Z1JA 1W13U 4K5ZA 1C4U2 1TNHA 5BRRE 3P8GA 3ZYEA 1O2OA 3EA9A 2VVVA 1FLEE 4Y0ZE 5E0GA 1NRRH 1P2NA 2GT8A 3A85A 4OS4A 1O3PB 4NIWA 1NS3A 2QGRA 4IS5A 1DXWA 3RXUA 4DW2U 4KTCA 4ISOA 4NGAH 3QGJA 1IQFA 4K2YA 4LK4A 1K1IA 2A1DB 2ZG0H 4FUDA 4MQAA 2R2WU 1LVMA 3VB7A 1N8OC 4IGDA 4Y71A 1ARCA 5JB8S 1ANEA 1BBRE 1HJ9A 1WQVH 2FXRA 2Y81A 3TJOA 1W3CA 2ZTZA 1HV7A 1KIGH 1BRAA 1DITH 3MU4A 4ZKNU 2R9PA 1GI1A 2Z6BD 2UWLA 1G2LA 1VJAU 1EAWA 2ALVA 2A0QB 3M7QA 2Z94A 5HMAA 4FUCA 5A8YA 5H4IB 3U9AH 1PQ7A 1ZSJA 3BTFE 2BTCE 3M3SA 2FESH 4GVUA 4IMQA 4CR5A 1PQAA 1DUEA 1V2KT 3RXHA 1QY6A 3SNEA 3VXEH 2D8WA 3C1KA 2XCNA 1VJ9U 1O3CA 3JZ1B 5HXFA 3O8CA 4X6NA 1GI7B 1ACBE 3SU3A 2OBQA 1QR3E 4Y8XA 3T2NA 1P2KA 1UTPA 3SGQE 4X2VA 5DO4H 1P0SH 4AOQA 2GD4B 1QBVH 2V0BA 1C9TA 1FPHH 1O3MA 1MTUA 3UIRA 5E2PA 5EODA 1Q3XA 2G52A 1ZOMA 2BY8X 1IQNA 2TGAA 1L4DA 4DGJA 3BN9A 1QJ6B 1ARBA 2CHAC 2G5NA 1AZ8A 2ESTE 1GJAB 1DT2A 2PSXA 3GCOA 4YOJA 1O37A 4X2XA 1FAXA 1C1WH 2SGDE 3SU4A 2P8OB 2OQUA 1UCYK 1YBWA 2H5DA 1O3BA 1GBEA 4HI3A 5SGAE 1MBMA 1GMHG 1DWDH 1UMAH 4AB8A 5E2OA 1AU8A 1FY8E 1TRNA 4BXWA 2VNTA 3S9AA 1LHFH 1MH0A 1BTUA 2FI4E 2W5EA 3ZZ7A 1ZGIA 2EI7A 3VGCC 1Y3XA 3C27B 3S7HB 1UVSH 3KQDA 2BXUH 4Y8YA 3ATWA 2PGQB 1GVZA 1HPGA 2H1UA 4YO9A 3A81A 1C2FA 2CGAA 1HAVA 2BB4A 4NA7A 4B76A 1NZQH 3TH4H 1AFQC 3PTBA 3F9FA 4INKA 3DD2H 3GY6A 2PWXA 3MO6A 1ZLRA 1KXFA 4Y11E 3STJA 5GWZA 1OX1A 1GGDC 1CQQA 2FOEA 2PUXB 2D2DA 3IG6B 4GPGA 1ELBA 1F0SA 1SB1H 2FWWA 1TMUH 1J9CH 1XUHA 1Y59T 1NT1A 2ZO3H 1OP0A 4U2WA 1H8DH 2JH6D 2ZA5A 1SGFA 2FOGA 1H4WA 3FZZA 3SV9A 1NO9H 1HAXB 2ZPQA 1QL7A 1WUNH 1A5GH 1HAIH 1EPTA 1GHXH 4ZROA 2ZFSA 1VITG 1LHGH 4TY6A 1K1PA 1XXFA 4I7YH 3LGWA 4U01A 1M9UA 2C90B 5DP8A 1G36A 1L0ZA 3SGAE 1V2QT 1C1SA 2STBE 1C1RA 2SNVA 1N1LA 1TOMH 2BXTH 1O3EA 3MO3A 2BD7A 2QXGA 4D76A 5L30H 3IITA 2PV9B 1OP2A 4MNVA 2VJ1A 2ZDLA 5L2YH 2F91A 4NA8A 4XDEA 1JOUB 2J94A 1TPAE 4KKDA 1O2LA 4RKOB 3F68H 1DS2E 1YPMH 2QYIA 2ZFRH 4LOYH 4Y79A 2HGTH 3QX5H 3SW2B 3RM2H 3RLYH 5F8ZA 2CN0H 1TGNA 3QUMP 1GHAG 3RMNH 3RXPA 1W0ZU 2THFB 2G51A 3T26A 2FI3E 4A1XA 2PTCE 3M5MA 3OY5U 4J1YA 1ESBA 3RM0H 1BJVA 1IHTH 2JETB 5AVDA 1A4WH 1B5GH 1J15A 1SGIB 4NZQA 2ZPRA 1ZPZA 1S84A 3BTGE 4HFPB 1W12U 5EQSA 4NWLA 5EOKA 4ABIA 3LGVA 4OS1A 5C67A 3T28A 1F5RA 1PFXC 1QIXB 1V2NT 2A32A 3OTJE 3SI4H 4B2AA 1O35A 1TIOA 1PQ5A 4K69A 4OGYA 1BTHH 1GBMA 4X8UH 3SQEE 1EXFA 4OS6A 1DY8A 1AVGH 3T25A 1T8NA 3S69A 3TH2H 3BG4C 4MPXA 5DP3A 3TJVA 2BLWA 1DOJA 3TJNA 1YPKH 1BB0B 2JH5D 4ZHLU 2BZ6H 1C1OA 1HAVB 1UJ1A 3GCHB 3M5NA 2JH0D 2BVXH 1AB9C 4A1TA 4GCHF 2ZFFH 2LNCA 1Q2WA 1A2CH 3SV7A 3ZZ6A 1D3QB 1YF4A 1Y3UA 3OX7U 1GMCF 1ORFA 2J4IA 2WPMS 3D62A 1SGCA 4ZUHA 1GJBB 4E7NA 2PSYA 1O38A 1G3BA 1SI5H 4NA9H 3ZZDA 4DJZB 1G37A 3RXMA 4B74A 2NU1E 1JXPA 5L2ZH 4BAMB 2BDAA 1TRYA 3ODFA 5B6OA 2QN5T 1V2VT 1OSSA 4HTCH 1K1MA 1BZXE 4X6OA 1HDTH 2P3TB 1C1VH 1EPTB 1NU7B 1TBRH 1HJ8A 1XKBC 2BYAX 2OLGA 2ZU4A 1EP5A 1W2KH 1XUKA 1G32B 3V12A 4X2WA 9ESTA 3AW0A 4ZXXH 2P16A 3RXTA 5HYOA 4GHTA 1AKSA 1T7CA 5ABWA 1O5GH 1FY3A 4MNYA 1G9IE 1Q31A 1TPSA 1D6RA 3SUEA 4BOHA 1O3JA 3SV2H 1SFQB 2VIOA 1IHSH 1O2MA 1YPGH 1GBTA 1C5NH 4WXVA 4K3JA 2QXHA 3ATLA 1C2JA 2B9LA 3NK8A 3PMAB 4MLFB 1O2YA 4E7RG 4TWYA 1UCYE 3E1XB 5L6NH 1SHHB 1C9PA 2VIDA 1A5IA 2FLRH 2PHBA 2HRVA 3KIDU 2ZU2A 5FAHA 4UFGH 1EAIA 4X6PA 1KXBA 4B1TA 1O34A 3BG8A 2WPIS 2C8WB 2ALPA 3KGPA 1K21H 1K1OA 2GX4A 1O2GH 3UR9A 3LT3A 4Y8ZA 3U8OH 2B0FA 3RXQA 3UFAA 1ZJDA 5T3HA 1OWJA 1O2TA 1DICA 1CVWH 3SU0A 2AFQB 2UUFB 1THRH 3A8AA 1F0TA 1SC8U 4CBOA 3RUOA 1TAWA 2GMTB 3BIUH 3E3TA 1QJ1B 5FX5A 3MTYA 1CGHA 1C1NA 1A0JA 2ZHEH 1EJNA 4JZIA 5JBBS 3OY6U 1H8IH 5DP6A 1GHVH 1ELVA 1SGPE 5IDKA 3MU1A 2FDAA 1FIWA 4MPVA 3T27A 1MTSA 2CXVA 4GAWA 2TBSA 2BD2A 2XBWA 1HJAB 2ZCKP 1EJAA 2RA3A 4K8BA 3H5CB 5AF9H 1AO5A 1O2KA 1C1TA 1E35B 2HVXA 1SOTA 1FN8A 3R0FA 1GJDB 3D23A 4YESB 1QGFA 3BV9B 4ISIH 1FPCH 1NTPA 5CE1A 5JBAS 1BJUA 2ZDVH 1GVLA 1N6XA 2PKSC 1GCTB 1SGNE 4AG1A 1EB2A 1L2EA 3SUDA 3U1JB 3L3TA 4BNRA 1SGEE 3IWMA 1MZDA 2YOLA 1O2ZA 1GI5A 4X1NU 2IPHA 1C1PA 4DT7B 2QCYA 1ID5H 3TK5A 2DUCA 2P8OC 2ZFQH 2AGGX 1S83A 8GCHF 2Z7FE 2A4RA 3TITA 3NUMA 5C3NA 1LCYA 1P06A 1WBGB 3HK6B 3HATH 3MFJA 4BAKB 1AKSB 3GY3A 2ANYA 2GKVE 2XRCA 3QTOH 3LC3A 1PPFE 1MTNB 3A86A 4X1QU 2GTBA 1NRPH 3GYMA 1JIMA 3EE0B 4YTAA 1BIOA 1GG6B 1ZMNA 1AE5A 2Y5FA 2H6MA 2F9UA 1C5MD 4NCYA 1T8LA 4FU7A 3DFLA 1EAUA 1SLUB 2RA0A 4X1RU 3URDA 1YPJH 5C1XA 3TLOA 2G8TA 1HAYB 3LPRA 1HAGE 2BLOA 3K6YA 2FTMA 1P2MA 1TNJA 2OXSA 1NFWA 1CHOF 2R2MB 2B7DH 5E0JA 2HOBA 1RRKA 1MU8B 4B73A 1W11U 1F0UA 5AHGH 1G30B 1AWFH 5HM2A 1DM4B 1CSOE 3LIWA 1KLTA 3W95A 1QRWA 3KCGH 5LPRA 8ESTE 3MNCA 1KXCA 4Z6AH 1DWBH 1O2WA 1GHWH 1GI9B 4AG2A 4FU9A 2DE9A 3UOUA 3F6UH 1HNEE 4IBLH 3Q77A 2FTLE 3QK1A 5DP5A 1Y3VA 1O3HA 1UTNA 1B0EA 2P59A 2P93A 1TNLA 3KL6A 5EGMA 2BM2A 4FUFA 4I8LA 1J17T 3A7YA 1EZUC 4OGXA 1RXPA 2HWLB 1GMDF 3P95A 1YPHC 1MAXA 1RTFB 3FVFB 5CMXH 1NRQH 1TMBH 4JK6A 1P05A 1CT4E 3GDVA 1F7ZA 2BMGB 4YLUA 4BANB 3UPEA 1SGQE 2TGTA 4DY7B 1TYNA 2ZCHP 1LHEH 3KNXA 4JYTA 1NFUA 4GLYA 3LGTA 1NN6A 1AY6H 1ELDE 1C4Y2 1BTXA 2RG3A 3GCTG 2XW9A 3SZNA 2TGPZ 3RP2A 4UFDH 1AIXH 3RLWH 1TGBA 1CA0B 1YYY1 1V6DA 3ZZ5A 3D65E 1KXDA 1TPOA 3SV8A 2PGBB 1G3CA 2JETC 5ETXA 1ZZZA 5C5NA 3EA7A 1MU6B 2PW8H 5FHTA 1PJPA 4WY3A 3ZZ3A 3K6ZA 3W94A 4DURA 2GZ8A 3SJ9A 1RD3B 4FXGH 2AS9A 2WUBA 3T5FH 3KQEA 7GCHG 4YM9A 1ANBA 3VFEA 1Y5BT 5C5OA 3L33A 4AB9A 2Y5GA 4FUIA 2A5IA 1QA0A 3SBKA 3SNAA 2J34A 1AGJA 1TX7A 1A5HA 1FUJA 2ZGJA 3K9XB 3A89A 3QWCH 3TH3H 2HLCA 1EP6A 3PLBA 1PPCE 4Q7XA 2ZNKH 3VB4A 2ZWLH 2BQ6B 5I25A 1VCQA 3SNBA 2I6QA 2GDEH 3ATMA 2G4UA 1A7SA 2V3HH 1L1GA 1Z7KA 3GCHC 3SOSA 1K1JA 2XBYA 1NRSH 2BVRH 4CBNA 1H9LB 3SV6A 4ZAEA 3UTUH 1JRSA 2A4GA 1NESE 2BDCA 2ODPA 1XUIA 3SHAH 4ABFA 1C5VA 1TBQH 1AD8H 3SNCA 1P2IA 1CBWB 2O8MA 1WYKA 3RC5A 3ZZ9A 2P3FH 3M5LA 4K1SA 1NM6A 1TQ0B 1F2SE 2ODQA 1O2SA 2VWMA 3LONA 1LTOA 2K1QA 1W8BH 5DK1A 3E6PH 4QT8C 3FP6E 3MYWA 1MD7A 3GCNA 1IQIA 2AIQA 2ZPSA 4INLA 3BIVH 1C2GA 1UVPA 2V6NA 1XX9A 1ESAA 1TX8A 1FZZA 2A5KA 4AZ2B 1HFDA 3EA8A 1WCZA 3GY7A 5HGGA 2HPPH 1S5SA 3RU4E 4D9QA 1D3DB 2Z9GA 3UREA 3U98H 2GCHG 1FI8A 2ULLA 1QBNA 2FODA 1LHCH 2GZ7A 3RXSA 5EQRA 3N7OA 3ODDA 3JZ2B 4UFEH 4A5TS 2J2UA 4FUJA 2XC4A 4B75A 1GI4A 2ZHWH 2AH4X 1A0LA 4RN6A 5J4SA 1YM0A 3UQOA 3TIUA 2ZGXH 2YNBA 6GCHG 1T8OA 1XUGA 1A46H 2OC1A 1ZJKA 5ESBA 5LH8A 3A7WA 2J92A 1O2PA 1Z6JH 1W7GH 2A4QA 3NCLA 1HLTH 1KXEA 1T31A 5EXMA 3PLPA 1KLIH 2G5VA 3SJOA 1ELGA 3SU2A 4O03A 2XBVA 5J4QA 1CT2E 4MDSA 4NFFA 3RXGA 3FAOA 1OWHA 3TPIZ 1V2ST 2AMDA 5A0CA 2C8ZB 1JRTA 3RXOA 1DANH 1L1NA 4MNXA 3PMHB 2SGAA 1V2PT 1P2QA 3PTNA 1QBOA 2ZGBH 2JKHA 3T29A 1GHZA 1GWAA 3MWIU 4IMZA 1CGJE 3DT0H 2Z3EA 2OC8A 1VCWA 2BY5X 3MNSA 2OP9A 4ABDA 2VB0A 1V2WT 3MH7A 2BDGA 4BXSA 1IQKA 1S0QA 1J16A 3H7OA 4UDWH 3NWUA 3ZVEA 1YPLH 1SGYE 1C5PA 3DUXH 1HJAC 2WYGA 1LPZB 2J9NA 1FAKH 4CRCA 1O3FA 2Z9LA 4CREA 4Y0YE 1WAYB 5CHAB 3RXAA 1ETTH 1PPEE 4Q2KA 1ZTKA 3MU5A 4CRFA 5EXLA 1BBRH 1AZZA 1TQ7B 2IN2A 5A0BA 2LPRA 3TGJE 2H5CA 3ATKA 3BTWE 4FUEA 3PM3A 2ZU3A 1THSH 4TWWA 2UUKB 1TNGA 3UWIA 1QQ4A 1GBAA 3UWJH 2VH0A 1V2JT 1GJ4H 5G4BA 4CHAB 4WF8A 4RKJB 5C2ZA 1W0YH 1KSNA 2HNTE 2C4FH 5AFYH 5DP7A 1G3EA 1PPBH 1AE8H 3A84A 1K1NA 1SPJA 3F9EA 3S9BA 3M36A 2BY9X 2Y7ZA 5T6FA 3TU7H 4WMDA 1CE5A 1QHRB 1VZQH 3BTTE 4XOJA 4NIYA 1QB6A 1H9HE 2GVFA 2BDBA 4AFZA 1HYLA 4Z0KA 1BTYA 1F0RA 5FBEA 4JYUH 2A5AA 3VEQB 2PLXA 1GG6C 4MVNA 1JBUH 4JYVH 3VB6A 3T62A 2BOHB 1QJ7B 1ESTA 1ZR0A 3EYDA 1C5OH 3Q00A 2WPLS 4AGJA 1QA7A 2G81E 4JZEH 3RXEA 3MNXA 4Q7YA 4JZ1A 1TNIA 2QXIA 7LPRA 1E34B 1TBZH 3Q76A 4VGCC 1O33A 1TE0A 2QF0A 2VVCA 1TLDA 2ZTXA 3I78A 2F9BH 1PPHE 4O97A 3GICB 2R3UA 1UK4A 1BHXB 1Y3YA 5GDSH 2KAIA 1CU1A 1ZMJA 3PWCA 3RXBA 2ASUB 3UUZA 2ZHQH 1JIRA 1GMHF 1SOZA 1QTFA 3MOCA 2QF3A 1ZPCA 1UTJA 4NIXA 1RJXB 1SVPA 1DDJA 1V2LT 2BD5A 2PR3A 4AX9H 3BTKE 1GJ5H 1TONA 5JBCS 3M3VA 5GCHG 4M7GA 3NKKA 3SI3H 3PLKA 5FPYA 1LVYA 3OYPA 3LJJA 1MD8A 2BQWB 1SGRE 1Z71A 1ZRBA 1ZYOA 3RMOH 3ENSB 2ANKH 2IJOB 3MHWU 4UE7H 3QTVH 1CA8B 4Q7ZA 4ESTE 1P9SA 1S82A 2ZFTA 3TGKE 1INCA 3SUFA 2UWPA 2FOHA 4Y10E 5DG6A 1SG8B 4XSKU 2SFAA 1D9IA 1D6WA 1LKBA 2CHAB 1DVAH 2J38A 1EZXC 2ZZUH 3PO1B 4OS2A 4YOGA 1WV7H 2GP9B 1LQEA 4CRGA 1FXYA 4ZHAA 4I32A 3LOXA 5JBTA 3MO9A 2GDDA 3PYHA 1IQLA 1BMMH 1C2KA 1CA0C 1UTMA 4ABEA 1OXGA 1ABIH 1VITH 1E37B 5EW1H 4GSOA 1SHYA 1VITF 3V3MA 3BTDE 3ZVDA 1ZHRA 3GY5A 1DWEH 8KME2 1XVOA 4PROA 3BTQE 1SR5C 4F4OC 5DKMA 3ZZBA 1YLDA 1C5YB 2Y7XA 1PPGE 3LJOA 1Z1IA 2FMJA 1LQDB 1ZRKA 1GHBG 2XWBI 1V2OT 1BT7A 1BCUH 1EB1H 5E8EH 1BBRK 3M3TA 1KYNA 1QNJA 1ANCA 1F5KU 3O8DA 3URCA 5C20A 2HALA 1TGSZ 3MNBA 1NC6A 3O8RA 1C5WB 2ZDAH 1O3AA 2Z9JA 4I8GA 2VU8E 4R0IA 1MCTA 2UUJB 1GHAF 2QA9E 5ESTE 3NZIA 5A0AE 2C8YB 4NWKA 1F92A 3RXCA 3QO6A 3AW1A 1FY1A 4H6SB 2XYAA 4K1EA 2EI8A 2QV1A 4AN7A 4WVPE 1TWXB 4X8SH 2BY6X 4BTTB 4KTUA 4A6LA 1KXAA 4X1PU 1V2RT 1NY22 1P57B 1DUAA 1MUEB 1VGCB 1LKAA 2O8LA 2KAIB 2FEQH 3GISB 4NSVA 1UVOA 4BAOB 2FOMB 1Y5UT 2OC7A 1GVKB 2B5TB 2BY7X 1O3GA 1DFPA 1C1MA 2WPHS 2TRMA 4K60A 1L4ZA 1Z8IB 4CH8B 2ZF0H 4E06H 3QLPH 3BEIB 3VB5A 3A7VA 1GI6A 5F8TA 2WPJS 1SMFE 2G00A 1U6QA 3D49H 2A7JA 4I31A 2M5TA 3M7TA 4ABJA 1ELFA 1O30A 4GUXA 3CP7A 2OD3B 5EPYA 1AI8H 1ANDA 1G2MA 1YP9A 4I33A 4YZUA 2Z9IA 3O8BA 5C1YA 1WU1A 1P02A 3ZVAA 4D7FA 2ZIQH 5PTPA 3HGNA 1QRXA 3L6PA 1ELEE 2XNIA 2PUQH 2F9VA 2I6SA 3PWBA 1QURH 1OWDA 2BD8A 3E0NB 3V0XA 3ZVBA 2ZDMA 4ISHH 1Y8TA 3BF6H 3PB1E 1D3PB 4ASHA 1A61H 1PPZA 3OU0A 4WMFA 5A8ZA 1MTWA 1FJSA 2BQ7B 3UNQA 4ZMAH 2ZHFH 1P2OA 1ABJH 1BMNH 5TCAA 3VPKA 1CO7E 1OYTH 1HIAA 1BTPA 1WOFA 1O5AB 4MTBA 1LPKB 2CJIA 1HAOH 4B71A 2QIQA 2GCTB 2C93B 1YCPH 4A1VA 1B7XB 4ABHA 3U69H 1S6HA 3VB3A 1THPB 1O0DH 4Q80A 5EG4A 1AWHB 3BTME 3KF2A 2ZECA 2ILNA 7KMEH 5JYIA 3PV4A 1GBKA 3AVZA 3I77A 1OS8A 3UNRA 2O8UA 2HPQH 3BTEE 3E0PB 1TA6A 2AMQA 1OPHB 4XBCA 1NFXA 4AORA 5FX6A 1OYQA 1O3LA 5CHAC 3HPTB 1O3OA 2WV4A 1GBDA 6CHAB 4OS5A 1TNKA 4O3TA 1C1UH 4D9RA 1RIWB 1WTHD 3P8FA 3KQBA 1LO6A 8LPRA 2XC5A 3RXIA 4ZKRU 1NFYA 4NZLA 2XBXA 1IQMA 4Y7BA 5GJ4B 1P3EA 5DJ7A 1IQEA 2NU0E 3RXVA 2CV3A 2Y5HA 2VIWA 3RXJA 4CHAC 2PKAA 2F83A 1BHXF 2ZQ1A 1GJ8B 1TGCA 3RMMH 5AFZH 1C2LA 3MH5A 2BX4A 3RXKA 3B23B 1KTTB 2WUCA 1OWKA 2UWOA 4FUGA 2A7CA 5C1UA 1DLEA 2UUYA 1FQ3A 3P8NA 3FP7E 1T8MA 2FX4A 2WV5A 3H7TA 4D8NA 2R3YA 1P03A 2ZGCA 5GIBA 1A3EH 4LZ4B 1XUJA 4ZKOU 2Y6TA 2A7HA 3A88A 1HCGA 1GL0E 4JMYA 2GV7A 1C2EA 1C2HA 3RXFA 5HM9A 1O31A 1AUTC 1BA8B 2W3KA 4DVAU 3EQ0H 1C4V2 1EKBB 2BDIA 1K28D 2SGPE 3SGBE 3S9CA 1S81A 3Q3KA 2ZFPH 4X0WU 1OKXA 2FOFA 2GV6A 4D7GA 2O8TA 3SQHE 3NPSA 5EQQA 2R0KA 5FPSA 1BRUP 1B0FA 1D3TB 2ODYB 1SGTA 4ZXYH 1E0FD 1WTGH 3FFGA 4NSYA 1V2MT 1GDQA 2BDHA 3KEEA 1P10A 3A7ZA 1EZQA 1GBLA 4I8HA 1D4PB 2FP7B 2QC2A 1W10U 1DX5M 3UQVA 1Y5AT 1C5SA 1W7XH 3G01A 2STAE 4A92A 1O2RA 1ELTA 1MMJN 1Z8GA 1AHTH 4JK5A 1HIAB 1GDNA 1DXPA 2VWLA 2SGFE 1QQUA 1ZHMA 2FYQA 1O2JA 2VGCB 4U30A 2ZEBA 4SGAE 4NIVA 1S6FA 1XUFA 2BD4A 2BDYA 2OC0A 1EPTC 3MU8A 3ELAH 6LPRA 1O5FH 5JPMH 3LC5A 2Q6DA 5FXLA 2TGDA 1C5ZB 3PROA 3DHKH 4I8JA 2V3OH 1HUTH 2PKSB 1LVOA 1UHBA 2BLVA 1H9IE 1EAXA 4X6MA 4GCHG 3RXRA 4AFQA 2J95A 1XMNB 3PO1C 3U1IB 3R3GB 1C5RA 1K2I1 1HAZB 1EOJA 5LGOA 1MKWH 1GMCG 3GDUA 1O32A 1P11E 3P92A 1O36A 1YCPK 3UNSA 2BD3A 1KY9A 3E91A 3AAVA 1O2NA 1BOQA 4GHQA 1SLVB 5JB9S 2PKAB 1EASA 1OWEA 3QZRA 4IC5A 4AGKA 1UK3A 3I29A 1BITA 4ISLA 2SGQE 1T4VH 1SSXA 3SJIA 3ZVCA 4IN2A 3ZVFA 1FY5A 2H9TH 3F9HA 3QN7A 4H42U 4XE4A 2CF9H 4YOIA 2FI5E 1SLXB 1KDQA 1QRZA 2H2ZA 1RFNA 4MG3A 4MPWA 2FLBH 3RC6A 4CH2B 1FN6A 1MQ6A 3V7TA 2CF8H 1FNIA 3A8CA 1LPGB 1TB6H 2D1JA 5GPIB 2ZKSA 2GT7A 1K1LA 2NU4E 4CR9A 2GMTC 3M7UA 4O9VA 2AGIX 1HBTH 1GJCB 2Q6GA 2A45B 5I46H 2ZDKA 1TA2A 1O3DA 1NU9A 1ETRH 2OTVA 4H4FA 3CS0A 2VIVA 4CRBA 1TOCB 4AYVB 1SBWA 4ZH8A 1P01A 4UEHH 2C3SA 5EXNA 1V2TT 3DFJA 3ZZ4A 2FS9A 1RS0A 1SL3A 1A0HB 3GCTF 2ZI2H 3ZZ8A 2GZ9A 1L1JA 5EU8A 2A2QH 5GXPA 5K7RA 2SGEE 1SQTA 2PFEA 2XTTB 1C5UA 2Z9KA 3B8JA 3SN8A 4IN1A 1ZTJA 4BTIB 3HKIB 3QDZB 3SORA 1P8VC 3A8BA 2VIPA 2FIRH 1VGCC 3KHVA 1GBCA 1AN1E 7GCHF 3UY9A 1GJ7B 1OP8A 2RCEA 1QCPA 5DGJA 1GCTC 1HXEH 3HK3B 2ZDNA 7ESTE 4DIHH 4WXIA 4E05H 2Z3DA 1O5EH 4OS7A 2EA3A 4FUHA 3ZV8A 1O2UA 1MBQA 2AERH 2O8WA 2P95A 1ZHPA 2D26C 2F9NA 3RXLA 4CRAA 5EPNA 1EOLA 2A4OA 4YT6H 1BTWA 1SGDE 5TJXA 3VXFH 4U32A 1O2IA 3A80A 4ISNA 2A2XH 2FPZA 3U8TH 1SQAA 3LU9B 2AMPA 4AYYB 4DOQA 3GOVB 2AIPA 2YNAA 3FP8E 4WWYA 4MNWA 3STIA 1MTNC 3GY2A 5F6MA 1IAUA 1GCDA 1UHBB 3BSQA 3B9FH 3M37A 4ABBA 1C2DA 5A09A 4TPIZ 4Y7AA 1SFIA 2W26A 1RTKA 3PMJA 3E8LA 1HAPH 1AVWA 3RU4T 1KLJH 1GBJA 1NROH 1FV9A 2NU3E 5FCRA 2O9QA 4MPUA 4Y76A 2OBOA 3RXDA 1N8OB 4AFSA 4JCNA 4UFFH 3RC4A 5A8XA 1O39A 1BDAA 1TMTH 2W3IA 1MQ5A 1XKAC 1UTLM 3BTHE 3GY4A 3KQCA 4AFUA 1GBIA 3A7TA 1KDQB 1PQ8A 3RDZA 2GCTC 2GCHF 8GCHG 3GY8A 2TIOA 4X2YA 4XFQA 2NU2E 2RDLA 3LH3A 5FPTA 5T6GA 3SHCH 1BRCE 1HB0B 1O3IA 1O5DH 1DPOA 4CRDA 1FONA 1QB1A 3SU5A 1YCPM 4WJG2 2FX6A 4K1TA 1MKWK 1QL9A 2EI6A 1TRMA 1F5LA 1ELCA 1DWCH 2OQ5A 3ITIA 4TYDA 1Y3WA 2H9HA 3ZV9A 1K9OE 1C5QA 1SLWB 4IW4E 6GCHF 3SU6A 2B8OH 1S85A 2CMYA 2WPKS 4LZ1H 1Z8JB 1P2JA 3Q3YA 2W7UA 4NG9H 2FS8A 1FIZA 1GI8B 1BQYA 2XWAA 3TNTA 2R0LA 3TGIE 1UTKA 1DE7H 1TABE 3TK6A 6CHAC 2Z3CA 3SU1A 1RIWC 1GBFA 4O3UA 3A7XA 3CENA 2OCVB 3KN2A 1LVBA 4KP0A 1UTQA 4X8TH 1AFEH 4FUBA 2FM2A 4FVBA 1OOKB 1YPHE 1RTLA 3MH4A 2ZHDA 1V3XA 1QFKH 1CHOG 1VCPA 2FOCA 4Y6DA 1ELAA 3ZYDA 1GJ6A 1GDUA 1AQ7A 2OINA 1HGTH 2XXLA 4INHA 1GL1A 1X7AC 1BRBE 5F8XA 3M61U 3UR6A 1FDPA 4BAHB 1FY4A 2VH6A 4BAQB 2BLQA 4KGAA 1KTSB 3K65B 1ZPBA 1Z8RA 1E36B 4H6TA 2BOKA 4WMEA 1CHGA 1WQSA 3TVJB 1NRNH 1TPPA 1FMGA 1MKXH 3VGCB 3BEFB 1A1RA 4TPYA 3U8RH 3ZZCA 3LGYA 1O2QA 3AAUA 1TALA 1YPEH 2BZAA 5T6DA 1XXDA 1T4UH 3K2UA 4X1SU 4R8TB 1DLKB 1GBBA 2ANMH 2BX3A 4NFEA 1AFQB 3PMBB 3ZZAA 1GMDG 4YLQH 1DY9A 1QL8A 4ABAA 1DSUA 2FOBA 1UK2A 5FCKA 1GGDB 1PYTC 1K22H 2G55A 2HNTF 3TK9A 1GHYH 2ZP0H 2FYRA 1ZGVA 2WYJA 4DCDA 1WSSH 4HZHA 1CGIE 1BMLA 1TFXA 1JMOH 3FANA 3P6ZB 2A31A 2ZTYA 2V35A 2ZU1A 1HXFH 1IOEA 2ANWA 1O2HA 2Q1JA 4I8KA 1GI3A 3MH6A 2DE8A 2QAAA 4WH8A 4FVDA 2G4TA 3F1SB 1G3DA 3A82A 2IOTA 3A87A 1SGFG 3SJ8A 1CBWC 2NWNA 4K8YA 1O5BB 2EEKA 3P70B 1V2UT 1HAHH 1EX3A 3HKJB 5F03A 1O2VA 2VGCC 1OWIA 3V13A 5DP4A 3A8DA 1BTZA 2H9EH 2ZQ2A 4FU8A 1E38B 2VIQA 4A7IB 1C2MA 2P94A 3SUGA 1IQHA 1AVXA 1GBHA 5A2MH 3LH1A 2EC9H 2FZZA 3A83A 1XM1A 4WH6A 3WY8A 3ATIA 4SGBE 1ZMLA 3ZVGA 4X8VH 9LPRA 3SO3A 2BHGA 5DPAA 3FZDA 3E90B 1O3NA 2XCFA 1LHDH 1EUFA 1A3BH 4J2YB 3SJKA 3EDXB 2HNTC 5BPEA 5K0HA 3EGKH 1EATA 1AMHA 1N6YA 4UD9H 3MI4A 1MZAA 1EZSC 3GDSA 1AUJA 1QB9A 1UO6A 3AASA 3CS7A 4DG4A 1XVMA 4F49A 2AEIH 1UVTH 3S7KB 4BTUB 1C2IA 2WINI 2ZGHA 1LDTT 1YC0A 4YT7H 1TGTA 4TY7A 3F9GA 5EW2H 1HRTH 1LMWB 1ETSH 2BD9A 4ZKSU 1GI0A 3RU4D 1GJ9B 2VWOA 5GCHF 1O2XA 4KTSA 1ZSLA 1P12E 2C8XB 3DA9B 1P09A 3GYLB 3M5OA 3UOPA 1EJMA 1IQGA 2Y80A 3S0NA 3BG4B 1MCVA 2FOAA 3MU0A 2TPIZ 4LXBH 2GGVB 1P3CA 2SNWA 4XBBA 1GI2A 1ZSKA 2QY0B 1H1BA 1T32A 1UCYH 1YKTA 1ZTLA 2ZC9H 3E16B 1BUIA 2OUAA 2Q6FA 1AB9B 1CT0E 3P17H 4VGCB 3MMGA 4ZHMU 4JZFH 4DIIH 3RMLH 2AYWA 1EQ9A 2ZU5A 3TJUA 1TX6A 2F9PA 1O5CB 1GPZA 3BEUA 2QXJA 4ABGA 4HGCA 4UONA 1UVUH 3OSYA 3HGPA 4THNH 1J8AA 2P3UB 1C5LH 1JWTA 1C5XB 4IC6A 4JZDH 1J14A 1UTOA 3P8OA 5LPEA 4B2CA 5LPFA 1C1QA 1O3KA 1PYTD 1W14U 2BVSH 4B2BA 5DP9A 2AGEX 3LGIA 3LGUA 2XC0A 3LKWA 1MKXK 1P04A 3Q3XA 2PTNA 1S0RA 2ZCLP 1P9UA 2VVUA 4RSPA
chains in the Genus database with same CATH superfamily
1YGCH 3SNDA 3LDXH 3QGNB 5FBIA 3EAJA 1GHBF 5IYTA 3TNSA 4F48B 3M35A 2W7SA 1BMAA 3ESTA 2F3CE 1MAYA 1Z6EA 5TCCA 1NPMA 2F9OA 2VINA 3QZQA 1IQJA 2FO9A 3NXPA 6ESTA 1YLCA 2VWNA 5E0HA 1C5TA 5JDUB 1MTVA 1DSTA 4HG6A 1SQOA 4XBDA 2RDEA 1RGQA 2Y82A 4KELA 1VR1H 1Z1JA 1W13U 4K5ZA 1C4U2 1TNHA 5BRRE 3P8GA 3ZYEA 1O2OA 3EA9A 2VVVA 1FLEE 4Y0ZE 5E0GA 1NRRH 1P2NA 2GT8A 3A85A 4OS4A 1O3PB 2J97A 4NIWA 1NS3A 2QGRA 4IS5A 1DXWA 3RXUA 4DW2U 4KTCA 4ISOA 4NGAH 3QGJA 1IQFA 4K2YA 4LK4A 1K1IA 2A1DB 2ZG0H 4FUDA 4MQAA 2R2WU 1LVMA 3VB7A 1N8OC 4IGDA 4Y71A 3MQKC 1ARCA 5JB8S 1ANEA 1BBRE 1HJ9A 1WQVH 2FXRA 2Y81A 3TJOA 1W3CA 2ZTZA 1HV7A 1KIGH 1BRAA 1DITH 3MU4A 4ZKNU 2R9PA 1GI1A 2Z6BD 2UWLA 1G2LA 1VJAU 1EAWA 2ALVA 2A0QB 3M7QA 2Z94A 5HMAA 4FUCA 5A8YA 5H4IB 3U9AH 1PQ7A 1ZSJA 3BTFE 2BTCE 3M3SA 2FESH 4GVUA 4IMQA 4CR5A 1PQAA 1DUEA 1V2KT 3RXHA 1QY6A 3SNEA 3VXEH 2D8WA 3C1KA 2XCNA 3SYJA 1VJ9U 1O3CA 3JZ1B 5HXFA 3O8CA 2J98B 4X6NA 1GI7B 3OE7D 1ACBE 3SU3A 2OBQA 1QR3E 4Y8XA 3T2NA 1WDIA 1P2KA 1UTPA 3SGQE 4X2VA 5DO4H 1P0SH 4AOQA 2GD4B 3OTPA 1QBVH 3ZIAD 2V0BA 1C9TA 1FPHH 1O3MA 1MTUA 3UIRA 5E2PA 5EODA 1Q3XA 2G52A 1ZOMA 2BY8X 1IQNA 2TGAA 1L4DA 4DGJA 2K8IA 3BN9A 1QJ6B 1ARBA 2CHAC 2G5NA 1AZ8A 2ESTE 1GJAB 1DT2A 2PSXA 3GCOA 4YOJA 1O37A 4X2XA 1FAXA 1C1WH 2SGDE 3SU4A 2P8OB 3H09A 2OQUA 1UCYK 1YBWA 2H5DA 1O3BA 1GBEA 4HI3A 5SGAE 1MBMA 1GMHG 1K0HA 1DWDH 1UMAH 1COWD 4AB8A 2WHXA 1H8ED 5E2OA 1AU8A 1FY8E 1TRNA 4BXWA 2VNTA 3S9AA 1LHFH 1MH0A 1BTUA 2FI4E 2W5EA 3ZZ7A 1ZGIA 2EI7A 3VGCC 1Y3XA 3C27B 3S7HB 1UVSH 3KQDA 2BXUH 4Y8YA 1E79D 3ATWA 2PGQB 1GVZA 1HPGA 2H1UA 4YO9A 3A81A 1C2FA 2CGAA 1HAVA 2BB4A 4NA7A 4B76A 1NZQH 3TH4H 1AFQC 3PTBA 3F9FA 4INKA 3DD2H 5IK2D 3GY6A 2PWXA 3WWFA 3MO6A 1ZLRA 1KXFA 4Y11E 3STJA 5GWZA 1OX1A 1GGDC 1CQQA 2FOEA 2PUXB 2D2DA 3IG6B 4GPGA 1ELBA 1F0SA 1SB1H 2FWWA 1TMUH 1J9CH 1XUHA 1Y59T 1NT1A 2ZO3H 1OP0A 4U2WA 1H8DH 2JH6D 2ZA5A 1SGFA 2FOGA 1H4WA 3FZZA 4RT0A 1NO9H 3SV9A 1HAXB 2ZPQA 1QL7A 1WUNH 1A5GH 1HAIH 1EPTA 1GHXH 4ZROA 2ZFSA 1VITG 1LHGH 4TY6A 1K1PA 1XXFA 4I7YH 1SKYE 3LGWA 4U01A 1M9UA 2C90B 5DP8A 1G36A 1L0ZA 3SGAE 1V2QT 1YY3A 1C1SA 2STBE 1C1RA 3F0OA 2SNVA 1N1LA 1TOMH 2BXTH 1O3EA 3MO3A 2BD7A 2QXGA 4D76A 5L30H 3IITA 2PV9B 1OP2A 4MNVA 2VJ1A 2ZDLA 5L2YH 2F91A 4NA8A 4XDEA 1JOUB 2J94A 1TPAE 4KKDA 1O2LA 4RKOB 3F68H 1DS2E 1YPMH 2QYIA 2ZFRH 4LOYH 4Y79A 2HGTH 3QX5H 3SW2B 3RM2H 3RLYH 5F8ZA 2CN0H 1TGNA 3QUMP 1GHAG 3RMNH 3RXPA 1W0ZU 2THFB 2G51A 3T26A 2FI3E 4A1XA 2PTCE 3M5MA 3OY5U 3F2GA 4J1YA 1ESBA 3RM0H 1BJVA 3SZEA 1IHTH 2JETB 3GS9A 5AVDA 1A4WH 1B5GH 5C0TA 1J15A 4XD7D 1SGIB 4NZQA 2ZPRA 1ZPZA 1S84A 3BTGE 4HFPB 1NBME 1W12U 5EQSA 2HLDD 4NWLA 5EOKA 4ABIA 3LGVA 4B6FA 4OS1A 5C67A 3T28A 1F5RA 1PFXC 1QIXB 1V2NT 2A32A 3OTJE 3SI4H 4B2AA 1O35A 2KFWA 1TIOA 1PQ5A 4K69A 4OGYA 1BTHH 1GBMA 4X8UH 3SQEE 1EXFA 4OS6A 1DY8A 1AVGH 3T25A 1T8NA 3S69A 2AHME 3TH2H 3BG4C 4MPXA 5DP3A 3TJVA 2BLWA 1DOJA 3TJNA 1YPKH 2F4LA 1BB0B 2JH5D 4ZHLU 2BZ6H 1C1OA 1HAVB 1UJ1A 3GCHB 2JJ1D 3M5NA 2JH0D 2BVXH 1AB9C 4A1TA 4GCHF 2ZFFH 2LNCA 1Q2WA 1A2CH 3SV7A 3ZZ6A 1D3QB 1YF4A 1Y3UA 3OX7U 1GMCF 1ORFA 2J4IA 2WPMS 3D62A 1SGCA 4ZUHA 1GJBB 4E7NA 2PSYA 1O38A 1G3BA 1SI5H 4NA9H 3ZZDA 2IPQX 4DJZB 1G37A 3RXMA 4B74A 2NU1E 1JXPA 5L2ZH 4BAMB 2BDAA 1TRYA 3ODFA 5B6OA 2QN5T 1V2VT 2J5UA 1OSSA 4HTCH 1K1MA 1BZXE 2YMSB 4X6OA 1HDTH 2P3TB 1C1VH 1EPTB 1NU7B 1TBRH 1HJ8A 1XKBC 2BYAX 2OLGA 2ZU4A 1EP5A 4OM9A 2VBCA 1W2KH 1XUKA 1G32B 1S6LA 4AC9A 3V12A 4X2WA 9ESTA 3AW0A 4ZXXH 2P16A 3RXTA 5HYOA 4GHTA 1AKSA 1T7CA 5ABWA 4Q63A 1O5GH 1FY3A 4MNYA 1G9IE 1Q31A 1TPSA 1D6RA 3SUEA 4BOHA 1O3JA 3SV2H 1SFQB 2VIOA 1IHSH 1O2MA 1YPGH 2XNDD 1GBTA 1C5NH 4P02A 4WXVA 4K3JA 2QXHA 3ATLA 1C2JA 2B9LA 3NK8A 3PMAB 4MLFB 1O2YA 4E7RG 4TWYA 1UCYE 3E1XB 5L6NH 1SHHB 1C9PA 2VIDA 1A5IA 2FLRH 2PHBA 2HRVA 3KIDU 4FOUC 2ZU2A 5FAHA 4UFGH 1EAIA 4X6PA 1KXBA 4B1TA 1O34A 3BG8A 3OEHD 2WPIS 2C8WB 2ALPA 3KGPA 1K21H 1K1OA 2GX4A 1O2GH 3UR9A 3LT3A 3KYGA 4Y8ZA 3U8OH 2B0FA 3RXQA 3UFAA 1ZJDA 5T3HA 1OWJA 1O2TA 5C94A 1DICA 1CVWH 3SU0A 2AFQB 2UUFB 1THRH 3A8AA 1F0TA 1SC8U 3F3BA 4CBOA 3RUOA 1TAWA 2GMTB 3BIUH 3E3TA 1QJ1B 5FX5A 3MTYA 1CGHA 1C1NA 1A0JA 2ZHEH 1EJNA 4JZIA 5JBBS 3OY6U 1H8IH 5DP6A 1GHVH 1ELVA 1SGPE 5IDKA 3MU1A 2FDAA 1FIWA 4MPVA 3T27A 1MTSA 2CXVA 4Z1MD 4GAWA 2TBSA 2BD2A 2XBWA 1HJAB 2ZCKP 1EJAA 2RA3A 4K8BA 3H5CB 5AF9H 1AO5A 1O2KA 1C1TA 1E35B 2HVXA 1SOTA 1FN8A 3R0FA 1GJDB 3D23A 4YESB 1QGFA 3BV9B 4ISIH 1FPCH 1NTPA 5CE1A 5JBAS 1BJUA 2ZDVH 1QZ8A 1GVLA 1N6XA 2PKSC 2JDID 1GCTB 3UB0A 1MABB 1SGNE 4AG1A 1EB2A 1L2EA 3SUDA 3U1JB 3L3TA 3U28C 4BNRA 1SGEE 3IWMA 1MZDA 2YOLA 1O2ZA 1GI5A 4X1NU 2IPHA 1C1PA 4DT7B 2QCYA 1ID5H 3TK5A 2DUCA 2P8OC 2ZFQH 2AGGX 1S83A 8GCHF 2Z7FE 4RT1A 2A4RA 3TITA 3NUMA 5C3NA 1LCYA 1P06A 1WBGB 3HK6B 2KR7A 3HATH 3MFJA 4BAKB 1AKSB 3GY3A 2ANYA 2GKVE 2XRCA 3QTOH 3LC3A 1PPFE 1MTNB 3A86A 4X1QU 2GTBA 1NRPH 3GYMA 1JIMA 3EE0B 4YTAA 1BIOA 1GG6B 1ZMNA 1AE5A 2Y5FA 2H6MA 2CK3D 2F9UA 1C5MD 4NCYA 1T8LA 4FU7A 3DFLA 5KECA 1EAUA 1SLUB 2RA0A 4X1RU 3URDA 1YPJH 5C1XA 3TLOA 2G8TA 1HAYB 3LPRA 1HAGE 2BLOA 3K6YA 4Q4LA 3KQ5A 2FTMA 1P2MA 1TNJA 2OXSA 4DT4A 1NFWA 1CHOF 2R2MB 2B7DH 5E0JA 2HOBA 5CDFE 1RRKA 1MU8B 4B73A 1W11U 1F0UA 5AHGH 1G30B 1H8HD 1AWFH 5HM2A 1DM4B 1CSOE 3LIWA 1KLTA 3W95A 1QRWA 3KCGH 5LPRA 8ESTE 3MNCA 1KXCA 4Z6AH 1DWBH 1O2WA 1GHWH 1GI9B 4AG2A 4FU9A 2DE9A 5CHBA 3UOUA 3F6UH 1HNEE 4IBLH 3Q77A 2FTLE 3QK1A 5DP5A 1Y3VA 1O3HA 1UTNA 1B0EA 2P59A 2P93A 1TNLA 3KL6A 5EGMA 2BM2A 4FUFA 4I8LA 1J17T 3A7YA 1EZUC 4OGXA 1RXPA 2HWLB 1GMDF 3P95A 1YPHC 1MAXA 1RTFB 3FVFB 5CMXH 1NRQH 1TMBH 4JK6A 1P05A 3FN8A 1CT4E 3GDVA 1F7ZA 2BMGB 4TSFD 4YLUA 4BANB 3UPEA 1SGQE 2TGTA 4DY7B 1TYNA 2ZCHP 1LHEH 3KNXA 4JYTA 1NFUA 4GLYA 3LGTA 1NN6A 1AY6H 1ELDE 1C4Y2 2KM0A 1BTXA 2RG3A 3GCTG 2XW9A 3SZNA 2TGPZ 3RP2A 4UFDH 1AIXH 3RLWH 1TGBA 1CA0B 1YYY1 1V6DA 3CNRA 3ZZ5A 3D65E 1KXDA 1TPOA 3DSOA 3SV8A 2PGBB 1G3CA 2JETC 5ETXA 1ZZZA 5C5NA 3EA7A 1MU6B 2PW8H 5FHTA 1PJPA 4WY3A 3ZZ3A 3K6ZA 3W94A 4DURA 2GZ8A 3SJ9A 1RD3B 4FXGH 2AS9A 2WUBA 3T5FH 3KQEA 7GCHG 4YM9A 1ANBA 3VFEA 1Y5BT 5C5OA 3L33A 4AB9A 2Y5GA 4FUIA 2A5IA 1QA0A 3SBKA 3SNAA 2J34A 1AGJA 1TX7A 1A5HA 1FUJA 2ZGJA 3K9XB 3A89A 3QWCH 3TH3H 2HLCA 1EP6A 3PLBA 1PPCE 5C17A 4Q7XA 2ZNKH 3VB4A 2ZWLH 2BQ6B 2IJD1 5I25A 1VCQA 2K0QA 3SNBA 2I6QA 2GDEH 3ATMA 2G4UA 1A7SA 2V3HH 1L1GA 1Z7KA 3GCHC 3SOSA 1K1JA 2XBYA 1NRSH 2BVRH 4CBNA 1H9LB 3SV6A 4ZAEA 3UTUH 1JRSA 2A4GA 1NESE 2BDCA 2ODPA 1XUIA 3SHAH 4ABFA 1C5VA 1TBQH 1AD8H 3SNCA 1P2IA 1CBWB 2O8MA 1WYKA 3RC5A 3ZZ9A 2P3FH 3M5LA 4K1SA 2KCAA 1NM6A 1TQ0B 1F2SE 2ODQA 1O2SA 2VWMA 3LONA 1LTOA 2K1QA 1W8BH 5DK1A 3E6PH 4QT8C 3FP6E 3MYWA 1MD7A 3GCNA 1IQIA 2AIQA 2YMSC 2ZPSA 4INLA 3BIVH 1C2GA 1UVPA 2V6NA 1XX9A 1ESAA 3EE7A 1TX8A 1FZZA 2A5KA 4AZ2B 1HFDA 3EA8A 1WCZA 3GY7A 5HGGA 2HPPH 1S5SA 3RU4E 4D9QA 1D3DB 2Z9GA 3UREA 3U98H 2GCHG 1FI8A 2ULLA 1QBNA 2FODA 1LHCH 2GZ7A 3RXSA 5EQRA 3N7OA 3ODDA 2M2AA 3JZ2B 4UFEH 4A5TS 2J2UA 4FUJA 2XC4A 4B75A 1GI4A 2ZHWH 2AH4X 1A0LA 4RN6A 5J4SA 1YM0A 3UQOA 3TIUA 2ZGXH 2YNBA 2JIZD 6GCHG 1T8OA 1XUGA 1A46H 2OC1A 1ZJKA 5ESBA 5LH8A 3A7WA 2J92A 1O2PA 1Z6JH 1W7GH 2A4QA 3NCLA 1HLTH 1KXEA 1T31A 5EXMA 3PLPA 1KLIH 2G5VA 3SJOA 1ELGA 3SU2A 4O03A 2XBVA 5J4QA 1CT2E 4MDSA 4NFFA 3RXGA 3FAOA 1OWHA 3TPIZ 1V2ST 2AMDA 5A0CA 2C8ZB 4M9FA 1JRTA 3RXOA 1DANH 1L1NA 2EY4C 4MNXA 3PMHB 2SGAA 1V2PT 5KGOA 1P2QA 3PTNA 1QBOA 2ZGBH 2JKHA 3T29A 1GHZA 1GWAA 3MWIU 4IMZA 1CGJE 3DT0H 2Z3EA 2OC8A 1VCWA 2BY5X 3MNSA 2OP9A 4ABDA 2VB0A 2EQNA 1V2WT 3MH7A 2BDGA 4BXSA 1IQKA 1S0QA 1J16A 3H7OA 4UDWH 3NWUA 3ZVEA 4P00A 1YPLH 1SGYE 1C5PA 3DUXH 1HJAC 2WYGA 1LPZB 2J9NA 1FAKH 5GNDA 4CRCA 1O3FA 2Z9LA 4CREA 4Y0YE 1WAYB 5CHAB 3RXAA 1ETTH 1PPEE 4Q2KA 1ZTKA 3MU5A 4CRFA 5EXLA 1BBRH 1AZZA 1TQ7B 2IN2A 5A0BA 2LPRA 3TGJE 2H5CA 3ATKA 3BTWE 4FUEA 3PM3A 2ZU3A 4TT3D 1THSH 3OEED 4TWWA 2UUKB 1EFRD 1TNGA 3UWIA 1QQ4A 1GBAA 3UWJH 2VH0A 1V2JT 1GJ4H 4YXWD 5G4BA 4CHAB 4WF8A 4RKJB 5C2ZA 1W0YH 1KSNA 4B6EA 2HNTE 2C4FH 5AFYH 5DP7A 1G3EA 1PPBH 1AE8H 3A84A 1K1NA 1SPJA 3F9EA 3S9BA 3M36A 2BY9X 2Y7ZA 5T6FA 3TU7H 4WMDA 1CE5A 1QHRB 1VZQH 3BTTE 4XOJA 2YMSD 4NIYA 1QB6A 1H9HE 2GVFA 2BDBA 4AFZA 1HYLA 4Z0KA 1BTYA 1F0RA 5FBEA 4JYUH 2A5AA 3VEQB 2PLXA 1GG6C 4MVNA 1JBUH 3AK5A 4JYVH 3VB6A 3T62A 2BOHB 3OAAD 2JJ2D 1QJ7B 1ESTA 1ZR0A 3EYDA 1C5OH 3Q00A 3N7EA 2WPLS 4AGJA 1QA7A 2G81E 4JZEH 5F53A 3RXEA 3MNXA 4Q7YA 4JZ1A 1TNIA 2QXIA 7LPRA 1E34B 1TBZH 3Q76A 3DCLA 1O33A 4VGCC 1TE0A 2QF0A 2VVCA 1TLDA 2ZTXA 3I78A 1WXRA 2F9BH 1PPHE 4O97A 3GICB 2R3UA 1UK4A 1BHXB 1Y3YA 5GDSH 2KAIA 1CU1A 1ZMJA 3PWCA 3RXBA 2ASUB 3UUZA 2ZHQH 1JIRA 1GMHF 1SOZA 1QTFA 3MOCA 2QF3A 1ZPCA 1UTJA 4NIXA 1RJXB 1SVPA 1DDJA 1V2LT 2BD5A 2PR3A 2QF5A 4AX9H 3BTKE 1GJ5H 1TONA 5JBCS 3M3VA 5GCHG 4M7GA 3NKKA 3SI3H 3PLKA 5FPYA 1LVYA 3OYPA 3LJJA 1MD8A 2BQWB 1SGRE 1Z71A 1ZRBA 1ZYOA 3RMOH 3ENSB 2KCYA 2ANKH 2IJOB 2PP6A 3MHWU 4UE7H 3QTVH 1CA8B 4Q7ZA 4ESTE 1P9SA 1S82A 2ZFTA 3TGKE 1INCA 3SUFA 2UWPA 2FOHA 4Y10E 5DG6A 1SG8B 4XSKU 2SFAA 1D9IA 1D6WA 1LKBA 2CHAB 1DVAH 2J38A 1EZXC 2ZZUH 3PO1B 4OS2A 4YOGA 1OHHD 1WV7H 2GP9B 1LQEA 4CRGA 1FXYA 4ZHAA 4I32A 3LOXA 5JBTA 3MO9A 2GDDA 3PYHA 1IQLA 1BMMH 3F2FA 1C2KA 1CA0C 1UTMA 2QE7D 4ABEA 1OXGA 1ABIH 2WZQA 1VITH 1E37B 5EW1H 4GSOA 1SHYA 1VITF 3V3MA 3BTDE 3ZVDA 1ZHRA 3GY5A 1DWEH 8KME2 1XVOA 4PROA 3BTQE 1SR5C 3W1EA 4F4OC 5DKMA 3ZZBA 1YLDA 1C5YB 1E1QD 2Y7XA 1PPGE 3LJOA 1Z1IA 2FMJA 1E1RD 1LQDB 1ZRKA 1GHBG 2XWBI 3NRLA 1V2OT 1BT7A 3FO8D 1BCUH 1EB1H 5E8EH 1BBRK 3M3TA 1KYNA 1QNJA 1ANCA 1F5KU 3O8DA 3URCA 5C20A 2HALA 1TGSZ 3MNBA 1NC6A 3O8RA 1C5WB 2ZDAH 1O3AA 3F2HA 2Z9JA 4I8GA 2VU8E 4R0IA 1MCTA 2UUJB 1GHAF 2QA9E 5ESTE 3NZIA 5A0AE 4ACBA 2C8YB 4NWKA 2QF4A 1F92A 3RXCA 3QO6A 3AW1A 1FY1A 4H6SB 2XYAA 4K1EA 2EI8A 2QV1A 4AN7A 4WVPE 1TWXB 4X8SH 2BY6X 4BTTB 4KTUA 4A6LA 1KXAA 4X1PU 1V2RT 1NY22 1P57B 3WWBA 1DUAA 1MUEB 1VGCB 1LKAA 2O8LA 2KAIB 2FEQH 3GISB 4NSVA 1UVOA 4BAOB 2FOMB 1Y5UT 2OC7A 1GVKB 2B5TB 2BY7X 1O3GA 1DFPA 1C1MA 2WPHS 3DSGA 2TRMA 2WSSD 4K60A 1L4ZA 1Z8IB 4CH8B 2ZF0H 4E06H 3QLPH 3UAIC 3BEIB 3VB5A 3A7VA 1GI6A 5F8TA 2WPJS 1SMFE 2G00A 1U6QA 3D49H 2A7JA 1W0KD 4I31A 2M5TA 5DSFA 3M7TA 1SQRA 4ABJA 1ELFA 1O30A 4GUXA 3CP7A 2OD3B 5EPYA 1AI8H 1ANDA 1G2MA 1YP9A 4I33A 4YZUA 2Z9IA 3O8BA 5C1YA 1WU1A 1P02A 3ZVAA 4D7FA 2ZIQH 5PTPA 3HGNA 1QRXA 3L6PA 1ELEE 2XNIA 2PUQH 2F9VA 2I6SA 3PWBA 1QURH 1OWDA 2BD8A 3E0NB 3V0XA 3ZVBA 2ZDMA 4ISHH 1Y8TA 3BF6H 3PB1E 1D3PB 4ASHA 1A61H 1PPZA 3OU0A 4WMFA 5A8ZA 1MTWA 1FJSA 2BQ7B 3UNQA 4ZMAH 2ZHFH 1P2OA 1ABJH 1BMNH 5TCAA 3VPKA 1CO7E 1OYTH 1HIAA 1BTPA 1WOFA 1O5AB 4MTBA 1LPKB 2CJIA 1HAOH 4B71A 2QIQA 2GCTB 2C93B 1YCPH 4A1VA 1B7XB 4ABHA 2F43B 3U69H 1S6HA 3VB3A 1THPB 1O0DH 4Q80A 5EG4A 1AWHB 3BTME 3KF2A 2ZECA 2ILNA 7KMEH 5JYIA 3PV4A 1GBKA 3AVZA 3I77A 1OS8A 3UNRA 2O8UA 2HPQH 3BTEE 4ACAA 3E0PB 1TA6A 2AMQA 1OPHB 4XBCA 1NFXA 4AORA 5FX6A 1OYQA 1O3LA 5CHAC 3HPTB 1O3OA 2WV4A 1GBDA 6CHAB 4OS5A 1TNKA 4O3TA 1C1UH 4D9RA 1RIWB 1WTHD 3P8FA 3KQBA 1LO6A 8LPRA 2XC5A 3RXIA 4ZKRU 1NFYA 4NZLA 2XBXA 1IQMA 4Y7BA 5GJ4B 1P3EA 1UW7A 2LP6A 5DJ7A 1IQEA 2NU0E 3RXVA 2CV3A 2Y5HA 2VIWA 3RXJA 4CHAC 2PKAA 2F83A 1BHXF 2ZQ1A 1GJ8B 1TGCA 2RFKC 3RMMH 5AFZH 1C2LA 3MH5A 2BX4A 3RXKA 3B23B 1KTTB 2WUCA 1OWKA 2UWOA 4FUGA 2A7CA 5C1UA 1DLEA 2UUYA 1FQ3A 3P8NA 3FP7E 1T8MA 2FX4A 2WV5A 3H7TA 4D8NA 2R3YA 1P03A 2ZGCA 5GIBA 1A3EH 4LZ4B 1XUJA 4ZKOU 2Y6TA 2A7HA 3A88A 1HCGA 3N99A 1GL0E 4JMYA 2GV7A 1C2EA 5EIYA 1C2HA 3RXFA 5HM9A 1O31A 1AUTC 1BA8B 2W3KA 4DVAU 3EQ0H 1C4V2 1EKBB 2BDIA 1K28D 2SGPE 3SGBE 3S9CA 1S81A 3Q3KA 2ZFPH 4X0WU 1OKXA 2FOFA 2GV6A 4D7GA 2O8TA 3SQHE 3NPSA 5EQQA 2R0KA 5FPSA 1BRUP 1B0FA 1D3TB 3DSPA 2ODYB 1SGTA 4ZXYH 1E0FD 1WTGH 3FFGA 4NSYA 1V2MT 1GDQA 2BDHA 3KEEA 1P10A 3A7ZA 3PV2A 1EZQA 1GBLA 4I8HA 1W0JD 1D4PB 2FP7B 2QC2A 1W10U 1DX5M 3UQVA 1Y5AT 1C5SA 1W7XH 3G01A 2STAE 4A92A 1NBMD 1O2RA 1ELTA 1MMJN 1Z8GA 1AHTH 4JK5A 1HIAB 1GDNA 1DXPA 2VWLA 5EJZA 2SGFE 1QQUA 1ZHMA 2FYQA 1O2JA 2VGCB 4U30A 2ZEBA 4SGAE 4NIVA 1S6FA 1XUFA 2BD4A 2BDYA 1KMHB 2OC0A 1EPTC 2KX4A 3MU8A 3ELAH 5KEDA 6LPRA 1O5FH 5JPMH 3LC5A 2Q6DA 5FXLA 2TGDA 1C5ZB 3PROA 3DHKH 2XOKD 4I8JA 5FL7D 2V3OH 1HUTH 2PKSB 1LVOA 1UHBA 2BLVA 3FOAA 5DN6D 1H9IE 1EAXA 4X6MA 4GCHG 3RXRA 4AFQA 2J95A 1XMNB 3PO1C 3U1IB 3R3GB 1C5RA 1K2I1 1HAZB 5HKKD 1EOJA 5LGOA 1MKWH 1GMCG 3GDUA 1O32A 1P11E 3P92A 3VG8A 1YWUA 1O36A 1YCPK 3UNSA 4F55A 5HIZA 2V7QD 2GJGA 2BD3A 1KY9A 3E91A 3AAVA 1O2NA 1BOQA 4GHQA 1SLVB 5JB9S 2PKAB 1EASA 1OWEA 3QZRA 2L74A 4IC5A 4AGKA 1UK3A 3I29A 1BITA 4ISLA 2SGQE 1T4VH 1SSXA 3SJIA 3ZVCA 4IN2A 3ZVFA 1FY5A 2H9TH 3F9HA 3QN7A 4H42U 4XE4A 2CF9H 4YOIA 2FI5E 1SLXB 1KDQA 1QRZA 2H2ZA 1RFNA 4MG3A 4MPWA 2FLBH 3OFND 3RC6A 4CH2B 1FN6A 1MQ6A 3V7TA 2CF8H 1FNIA 3A8CA 1LPGB 1TB6H 2D1JA 5GPIB 2ZKSA 2GT7A 1K1LA 2NU4E 4CR9A 2GMTC 3M7UA 4O9VA 2AGIX 1HBTH 1GJCB 2Q6GA 2A45B 3FKSD 5I46H 2ZDKA 1TA2A 1O3DA 1NU9A 1ETRH 2OTVA 4H4FA 3CS0A 2VIVA 4CRBA 1TOCB 4AYVB 1SBWA 4ZH8A 1P01A 4UEHH 2C3SA 2WPDD 5EXNA 1V2TT 3DFJA 3ZZ4A 2FS9A 1RS0A 1SL3A 1A0HB 3GCTF 2ZI2H 3ZZ8A 2GZ9A 1L1JA 5EU8A 2A2QH 5GXPA 5K7RA 2SGEE 1SQTA 2PFEA 2XTTB 1C5UA 2Z9KA 3B8JA 3SN8A 4IN1A 1ZTJA 4BTIB 3HKIB 3QDZB 3SORA 1P8VC 3A8BA 2VIPA 2FIRH 1VGCC 3KHVA 1GBCA 1AN1E 7GCHF 3UY9A 1GJ7B 1OP8A 2RCEA 1QCPA 5DGJA 1GCTC 1HXEH 2LELA 3HK3B 5C0UA 2ZDNA 7ESTE 4DIHH 4WXIA 4E05H 2Z3DA 1O5EH 4OS7A 2W6JD 2L6OA 2EA3A 4FUHA 3ZV8A 1O2UA 1MBQA 2AERH 2O8WA 2P95A 1ZHPA 2D26C 2F9NA 3RXLA 4CRAA 5EPNA 3PRDA 1EOLA 2A4OA 4YT6H 1BTWA 1SGDE 5TJXA 3VXFH 4ASUD 4U32A 1O2IA 3A80A 4ISNA 2A2XH 2FPZA 3U8TH 1SQAA 3LU9B 4ZCNA 2AMPA 4AYYB 4DOQA 3GOVB 2AIPA 2YNAA 3FP8E 4WWYA 4MNWA 3STIA 1MTNC 4FETA 3GY2A 5F6MA 1IAUA 1GCDA 1UHBB 3BSQA 3B9FH 3M37A 4ABBA 1C2DA 5A09A 4TPIZ 4Y7AA 1SFIA 2W26A 1RTKA 3PMJA 3E8LA 1HAPH 1AVWA 3RU4T 1KLJH 1GBJA 1NROH 1FV9A 2NU3E 5FCRA 2O9QA 4MPUA 4Y76A 2OBOA 3RXDA 1N8OB 4AFSA 4JCNA 4UFFH 3RC4A 5A8XA 1O39A 1BDAA 1TMTH 2W3IA 1MQ5A 1XKAC 2KCOA 1UTLM 3BTHE 3GY4A 3KQCA 4AFUA 1GBIA 3A7TA 1KDQB 1PQ8A 3RDZA 2GCTC 2GCHF 8GCHG 3GY8A 2TIOA 5T1VA 4X2YA 4XFQA 2NU2E 2RDLA 3LH3A 5FPTA 5T6GA 3SHCH 1BRCE 1HB0B 1O3IA 1O5DH 1DPOA 4CRDA 1FONA 1QB1A 3SU5A 1YCPM 4WJG2 2FX6A 4K1TA 1MKWK 1QL9A 2EI6A 1TRMA 1F5LA 1ELCA 1DWCH 2OQ5A 3ITIA 4TYDA 1Y3WA 2H9HA 3ZV9A 1K9OE 1C5QA 1SLWB 4IW4E 6GCHF 3SU6A 2B8OH 1S85A 2CMYA 2WPKS 4LZ1H 1Z8JB 1P2JA 3Q3YA 2W7UA 4NG9H 2FS8A 1FIZA 1GI8B 1BQYA 2XWAA 3TNTA 2R0LA 3TGIE 1UTKA 1DE7H 1TABE 3TK6A 6CHAC 2Z3CA 3SU1A 1RIWC 1GBFA 4O3UA 3A7XA 3CENA 2OCVB 3KN2A 1LVBA 4KP0A 1UTQA 4X8TH 1AFEH 4FUBA 2FM2A 4FVBA 1OOKB 1YPHE 1RTLA 3MH4A 2ZHDA 1V3XA 1QFKH 1CHOG 1VCPA 2FOCA 4Y6DA 1ELAA 3ZYDA 1VKYA 1GJ6A 1GDUA 1AQ7A 2OINA 1HGTH 2XXLA 4INHA 1GL1A 1X7AC 1BRBE 5F8XA 3M61U 1FX0B 3UR6A 1FDPA 4BAHB 1FY4A 2VH6A 4BAQB 2BLQA 4KGAA 1KTSB 3K65B 1ZPBA 1Z8RA 1E36B 4H6TA 2BOKA 4WMEA 1CHGA 1WQSA 2KZ4A 3TVJB 1NRNH 1TPPA 1FMGA 1MKXH 3VGCB 3BEFB 1A1RA 4TPYA 5HIYA 3WW7A 3U8RH 3ZZCA 3LGYA 1O2QA 3AAUA 1TALA 1YPEH 2BZAA 5T6DA 1XXDA 1T4UH 3K2UA 4X1SU 4R8TB 1DLKB 1GBBA 2ANMH 2BX3A 4NFEA 1AFQB 3PMBB 3ZZAA 1GMDG 4YLQH 1DY9A 3PV5A 1QL8A 4ABAA 1DSUA 2FOBA 1UK2A 5FCKA 4XRNA 1GGDB 1PYTC 1K22H 2G55A 2HNTF 3TK9A 1GHYH 2ZP0H 2FYRA 1ZGVA 2WYJA 2WV9A 4DCDA 1WSSH 4HZHA 1CGIE 1BMLA 1TFXA 1JMOH 3FANA 3P6ZB 2A31A 2ZTYA 2V35A 2ZU1A 1HXFH 1IOEA 2ANWA 1O2HA 2Q1JA 4I8KA 1GI3A 3MH6A 2DE8A 2QAAA 4WH8A 4FVDA 2G4TA 3F1SB 1G3DA 3A82A 2IOTA 3A87A 1SGFG 3SJ8A 1CBWC 2NWNA 4K8YA 1O5BB 2EEKA 3P70B 1V2UT 1HAHH 1EX3A 3HKJB 5F03A 1O2VA 2VGCC 1OWIA 3F0PA 3V13A 5B6LA 5DP4A 3A8DA 1BTZA 2H9EH 2ZQ2A 4FU8A 1E38B 2VIQA 4A7IB 1C2MA 2P94A 3SUGA 1IQHA 1AVXA 1GBHA 5A2MH 3LH1A 2EC9H 2FZZA 3A83A 1XM1A 4WH6A 3WY8A 3ATIA 2OK5A 4SGBE 1ZMLA 4I86A 3ZVGA 4X8VH 9LPRA 3SO3A 2BHGA 5DPAA 3FZDA 3E90B 1O3NA 2XCFA 1LHDH 1YLNA 1EUFA 1A3BH 4J2YB 3SJKA 3EDXB 2HNTC 5BPEA 5K0HA 3EGKH 1EATA 5EJLA 1AMHA 1N6YA 4UD9H 3MI4A 1MZAA 1EZSC 3GDSA 1AUJA 1QB9A 1UO6A 3AASA 3KYFA 3CS7A 4DG4A 1XVMA 4F49A 2AEIH 1UVTH 3S7KB 4BTUB 2HVYB 1C2IA 2WINI 2ZGHA 1LDTT 1YC0A 4YT7H 1TGTA 4TY7A 3F9GA 5EW2H 1HRTH 3PRBA 1LMWB 5EJ1A 1ETSH 2BD9A 4ZKSU 1GI0A 3RU4D 1GJ9B 2VWOA 5GCHF 1O2XA 4KTSA 1ZSLA 1P12E 2C8XB 3DA9B 1P09A 3GYLB 3M5OA 3UOPA 1EJMA 1IQGA 2Y80A 3S0NA 3BG4B 2KCPA 1MCVA 2FOAA 3MU0A 2TPIZ 4LXBH 2GGVB 1P3CA 2SNWA 4XBBA 1GI2A 1ZSKA 2QY0B 1H1BA 1T32A 1UCYH 1YKTA 1ZTLA 2V3MA 2ZC9H 3E16B 1BUIA 3N7DA 2OUAA 2Q6FA 4RI0A 1AB9B 1CT0E 2W6ID 3P17H 4VGCB 3MMGA 2J98A 4ZHMU 4JZFH 4DIIH 3RMLH 2AYWA 1EQ9A 2ZU5A 3TJUA 1TX6A 2F9PA 1O5CB 1GPZA 3BEUA 2QXJA 4ABGA 4HGCA 4UONA 1UVUH 3OSYA 3HGPA 4THNH 1J8AA 2P3UB 1C5LH 1JWTA 1C5XB 4IC6A 4JZDH 1J14A 1UTOA 3P8OA 5LPEA 1BMFD 4B2CA 5LPFA 1C1QA 1O3KA 1PYTD 1W14U 2BVSH 4B2BA 5DP9A 2AGEX 3LGIA 3LGUA 2XC0A 3LKWA 1MKXK 1P04A 3Q3XA 2PTNA 1S0RA 2ZCLP 1P9UA 2VVUA 4RSPA
chains in the Genus database with same CATH topology
1YGCH 3SNDA 3LDXH 3QGNB 5FBIA 3EAJA 1GHBF 5IYTA 3TNSA 3M35A 2W7SA 1BMAA 3ESTA 2F3CE 1MAYA 1Z6EA 5TCCA 1NPMA 2F9OA 2VINA 3QZQA 1IQJA 2FO9A 3NXPA 6ESTA 1YLCA 2VWNA 5E0HA 1C5TA 5JDUB 1MTVA 1DSTA 1SQOA 4XBDA 1RGQA 2Y82A 4KELA 1VR1H 1Z1JA 1W13U 4K5ZA 1C4U2 1TNHA 5BRRE 3P8GA 3ZYEA 1O2OA 3EA9A 2VVVA 1FLEE 4Y0ZE 5E0GA 1NRRH 1P2NA 2GT8A 3A85A 4OS4A 1O3PB 4NIWA 1NS3A 2QGRA 4IS5A 1DXWA 3RXUA 4DW2U 4KTCA 4ISOA 4NGAH 3QGJA 1IQFA 4K2YA 4LK4A 1K1IA 2A1DB 2ZG0H 4FUDA 4MQAA 2R2WU 1LVMA 3VB7A 1N8OC 4IGDA 4Y71A 1ARCA 5JB8S 1ANEA 1BBRE 1HJ9A 1WQVH 2FXRA 2Y81A 3TJOA 1W3CA 2ZTZA 1HV7A 1KIGH 1BRAA 1DITH 3MU4A 4ZKNU 2R9PA 1GI1A 2Z6BD 2UWLA 1G2LA 1VJAU 1EAWA 2ALVA 2A0QB 3M7QA 2Z94A 5HMAA 4FUCA 5A8YA 5H4IB 3U9AH 1PQ7A 1ZSJA 3BTFE 2BTCE 3M3SA 2FESH 4GVUA 4IMQA 4CR5A 1PQAA 1DUEA 1V2KT 3RXHA 1QY6A 3SNEA 3VXEH 2D8WA 3C1KA 2XCNA 1VJ9U 1O3CA 3JZ1B 5HXFA 3O8CA 4X6NA 1GI7B 1ACBE 3SU3A 2OBQA 1QR3E 4Y8XA 3T2NA 1P2KA 1UTPA 3SGQE 4X2VA 5DO4H 1P0SH 4AOQA 2GD4B 1QBVH 2V0BA 1C9TA 1FPHH 1O3MA 1MTUA 3UIRA 5E2PA 5EODA 1Q3XA 2G52A 1ZOMA 2BY8X 1IQNA 2TGAA 1L4DA 4DGJA 3BN9A 1QJ6B 1ARBA 2CHAC 2G5NA 1AZ8A 2ESTE 1GJAB 1DT2A 2PSXA 3GCOA 4YOJA 1O37A 4X2XA 1FAXA 1C1WH 2SGDE 3SU4A 2P8OB 2OQUA 1UCYK 1YBWA 2H5DA 1O3BA 1GBEA 4HI3A 5SGAE 1MBMA 1GMHG 1DWDH 1UMAH 4AB8A 5E2OA 1AU8A 1FY8E 1TRNA 4BXWA 2VNTA 3S9AA 1LHFH 1MH0A 1BTUA 2FI4E 2W5EA 3ZZ7A 1ZGIA 2EI7A 3VGCC 1Y3XA 3C27B 3S7HB 1UVSH 3KQDA 2BXUH 4Y8YA 3ATWA 2PGQB 1GVZA 1HPGA 2H1UA 4YO9A 3A81A 1C2FA 2CGAA 1HAVA 2BB4A 4NA7A 4B76A 1NZQH 3TH4H 1AFQC 3PTBA 3F9FA 4INKA 3DD2H 3GY6A 2PWXA 3MO6A 1ZLRA 1KXFA 4Y11E 3STJA 5GWZA 1OX1A 1GGDC 1CQQA 2FOEA 2PUXB 2D2DA 3IG6B 4GPGA 1ELBA 1F0SA 1SB1H 2FWWA 1TMUH 1J9CH 1XUHA 1Y59T 1NT1A 2ZO3H 1OP0A 4U2WA 1H8DH 2JH6D 2ZA5A 1SGFA 2FOGA 1H4WA 3FZZA 3SV9A 1NO9H 1HAXB 2ZPQA 1QL7A 1WUNH 1A5GH 1HAIH 1EPTA 1GHXH 4ZROA 2ZFSA 1VITG 1LHGH 4TY6A 1K1PA 1XXFA 4I7YH 3LGWA 4U01A 1M9UA 2C90B 5DP8A 1G36A 1L0ZA 3SGAE 1V2QT 1C1SA 2STBE 1C1RA 2SNVA 1N1LA 1TOMH 2BXTH 1O3EA 3MO3A 2BD7A 2QXGA 4D76A 5L30H 3IITA 2PV9B 1OP2A 4MNVA 2VJ1A 2ZDLA 5L2YH 2F91A 4NA8A 4XDEA 1JOUB 2J94A 1TPAE 4KKDA 1O2LA 4RKOB 3F68H 1DS2E 1YPMH 2QYIA 2ZFRH 4LOYH 4Y79A 2HGTH 3QX5H 3SW2B 3RM2H 3RLYH 5F8ZA 2CN0H 1TGNA 3QUMP 1GHAG 3RMNH 3RXPA 1W0ZU 2THFB 2G51A 3T26A 2FI3E 4A1XA 2PTCE 3M5MA 3OY5U 4J1YA 1ESBA 3RM0H 1BJVA 1IHTH 2JETB 5AVDA 1A4WH 1B5GH 1J15A 1SGIB 4NZQA 2ZPRA 1ZPZA 1S84A 3BTGE 4HFPB 1W12U 5EQSA 4NWLA 5EOKA 4ABIA 3LGVA 4OS1A 5C67A 3T28A 1F5RA 1PFXC 1QIXB 1V2NT 2A32A 3OTJE 3SI4H 4B2AA 1O35A 1TIOA 1PQ5A 4K69A 4OGYA 1BTHH 1GBMA 4X8UH 3SQEE 1EXFA 4OS6A 1DY8A 1AVGH 3T25A 1T8NA 3S69A 3TH2H 3BG4C 4MPXA 5DP3A 3TJVA 2BLWA 1DOJA 3TJNA 1YPKH 1BB0B 2JH5D 4ZHLU 2BZ6H 1C1OA 1HAVB 1UJ1A 3GCHB 3M5NA 2JH0D 2BVXH 1AB9C 4A1TA 4GCHF 2ZFFH 2LNCA 1Q2WA 1A2CH 3SV7A 3ZZ6A 1D3QB 1YF4A 1Y3UA 3OX7U 1GMCF 1ORFA 2J4IA 2WPMS 3D62A 1SGCA 4ZUHA 1GJBB 4E7NA 2PSYA 1O38A 1G3BA 1SI5H 4NA9H 3ZZDA 4DJZB 1G37A 3RXMA 4B74A 2NU1E 1JXPA 5L2ZH 4BAMB 2BDAA 1TRYA 3ODFA 5B6OA 2QN5T 1V2VT 1OSSA 4HTCH 1K1MA 1BZXE 4X6OA 1HDTH 2P3TB 1C1VH 1EPTB 1NU7B 1TBRH 1HJ8A 1XKBC 2BYAX 2OLGA 2ZU4A 1EP5A 1W2KH 1XUKA 1G32B 3V12A 4X2WA 9ESTA 3AW0A 4ZXXH 2P16A 3RXTA 5HYOA 4GHTA 1AKSA 1T7CA 5ABWA 1O5GH 1FY3A 4MNYA 1G9IE 1Q31A 1TPSA 1D6RA 3SUEA 4BOHA 1O3JA 3SV2H 1SFQB 2VIOA 1IHSH 1O2MA 1YPGH 1GBTA 1C5NH 4WXVA 4K3JA 2QXHA 3ATLA 1C2JA 2B9LA 3NK8A 3PMAB 4MLFB 1O2YA 4E7RG 4TWYA 1UCYE 3E1XB 5L6NH 1SHHB 1C9PA 2VIDA 1A5IA 2FLRH 2PHBA 2HRVA 3KIDU 2ZU2A 5FAHA 4UFGH 1EAIA 4X6PA 1KXBA 4B1TA 1O34A 3BG8A 2WPIS 2C8WB 2ALPA 3KGPA 1K21H 1K1OA 2GX4A 1O2GH 3UR9A 3LT3A 4Y8ZA 3U8OH 2B0FA 3RXQA 3UFAA 1ZJDA 5T3HA 1OWJA 1O2TA 1DICA 1CVWH 3SU0A 2AFQB 2UUFB 1THRH 3A8AA 1F0TA 1SC8U 4CBOA 3RUOA 1TAWA 2GMTB 3BIUH 3E3TA 1QJ1B 5FX5A 3MTYA 1CGHA 1C1NA 1A0JA 2ZHEH 1EJNA 4JZIA 5JBBS 3OY6U 1H8IH 5DP6A 1GHVH 1ELVA 1SGPE 5IDKA 3MU1A 2FDAA 1FIWA 4MPVA 3T27A 1MTSA 2CXVA 4GAWA 2TBSA 2BD2A 2XBWA 1HJAB 2ZCKP 1EJAA 2RA3A 4K8BA 3H5CB 5AF9H 1AO5A 1O2KA 1C1TA 1E35B 2HVXA 1SOTA 1FN8A 3R0FA 1GJDB 3D23A 4YESB 1QGFA 3BV9B 4ISIH 1FPCH 1NTPA 5CE1A 5JBAS 1BJUA 2ZDVH 1GVLA 1N6XA 2PKSC 1GCTB 1SGNE 4AG1A 1EB2A 1L2EA 3SUDA 3U1JB 3L3TA 4BNRA 1SGEE 3IWMA 1MZDA 2YOLA 1O2ZA 1GI5A 4X1NU 2IPHA 1C1PA 4DT7B 2QCYA 1ID5H 3TK5A 2DUCA 2P8OC 2ZFQH 2AGGX 1S83A 8GCHF 2Z7FE 2A4RA 3TITA 3NUMA 5C3NA 1LCYA 1P06A 1WBGB 3HK6B 3HATH 3MFJA 4BAKB 1AKSB 3GY3A 2ANYA 2GKVE 2XRCA 3QTOH 3LC3A 1PPFE 1MTNB 3A86A 4X1QU 2GTBA 1NRPH 3GYMA 1JIMA 3EE0B 4YTAA 1BIOA 1GG6B 1ZMNA 1AE5A 2Y5FA 2H6MA 2F9UA 1C5MD 4NCYA 1T8LA 4FU7A 3DFLA 1EAUA 1SLUB 2RA0A 4X1RU 3URDA 1YPJH 5C1XA 3TLOA 2G8TA 1HAYB 3LPRA 1HAGE 2BLOA 3K6YA 2FTMA 1P2MA 1TNJA 2OXSA 1NFWA 1CHOF 2R2MB 2B7DH 5E0JA 2HOBA 1RRKA 1MU8B 4B73A 1W11U 1F0UA 5AHGH 1G30B 1AWFH 5HM2A 1DM4B 1CSOE 3LIWA 1KLTA 3W95A 1QRWA 3KCGH 5LPRA 8ESTE 3MNCA 1KXCA 4Z6AH 1DWBH 1O2WA 1GHWH 1GI9B 4AG2A 4FU9A 2DE9A 3UOUA 3F6UH 1HNEE 4IBLH 3Q77A 2FTLE 3QK1A 5DP5A 1Y3VA 1O3HA 1UTNA 1B0EA 2P59A 2P93A 1TNLA 3KL6A 5EGMA 2BM2A 4FUFA 4I8LA 1J17T 3A7YA 1EZUC 4OGXA 1RXPA 2HWLB 1GMDF 3P95A 1YPHC 1MAXA 1RTFB 3FVFB 5CMXH 1NRQH 1TMBH 4JK6A 1P05A 1CT4E 3GDVA 1F7ZA 2BMGB 4YLUA 4BANB 3UPEA 1SGQE 2TGTA 4DY7B 1TYNA 2ZCHP 1LHEH 3KNXA 4JYTA 1NFUA 4GLYA 3LGTA 1NN6A 1AY6H 1ELDE 1C4Y2 1BTXA 2RG3A 3GCTG 2XW9A 3SZNA 2TGPZ 3RP2A 4UFDH 1AIXH 3RLWH 1TGBA 1CA0B 1YYY1 1V6DA 3ZZ5A 3D65E 1KXDA 1TPOA 3SV8A 2PGBB 1G3CA 2JETC 5ETXA 1ZZZA 5C5NA 3EA7A 1MU6B 2PW8H 5FHTA 1PJPA 4WY3A 3ZZ3A 3K6ZA 3W94A 4DURA 2GZ8A 3SJ9A 1RD3B 4FXGH 2AS9A 2WUBA 3T5FH 3KQEA 7GCHG 4YM9A 1ANBA 3VFEA 1Y5BT 5C5OA 3L33A 4AB9A 2Y5GA 4FUIA 2A5IA 1QA0A 3SBKA 3SNAA 2J34A 1AGJA 1TX7A 1A5HA 1FUJA 2ZGJA 3K9XB 3A89A 3QWCH 3TH3H 2HLCA 1EP6A 3PLBA 1PPCE 4Q7XA 2ZNKH 3VB4A 2ZWLH 2BQ6B 5I25A 1VCQA 3SNBA 2I6QA 2GDEH 3ATMA 2G4UA 1A7SA 2V3HH 1L1GA 1Z7KA 3GCHC 3SOSA 1K1JA 2XBYA 1NRSH 2BVRH 4CBNA 1H9LB 3SV6A 4ZAEA 3UTUH 1JRSA 2A4GA 1NESE 2BDCA 2ODPA 1XUIA 3SHAH 4ABFA 1C5VA 1TBQH 1AD8H 3SNCA 1P2IA 1CBWB 2O8MA 1WYKA 3RC5A 3ZZ9A 2P3FH 3M5LA 4K1SA 1NM6A 1TQ0B 1F2SE 2ODQA 1O2SA 2VWMA 3LONA 1LTOA 2K1QA 1W8BH 5DK1A 3E6PH 4QT8C 3FP6E 3MYWA 1MD7A 3GCNA 1IQIA 2AIQA 2ZPSA 4INLA 3BIVH 1C2GA 1UVPA 2V6NA 1XX9A 1ESAA 1TX8A 1FZZA 2A5KA 4AZ2B 1HFDA 3EA8A 1WCZA 3GY7A 5HGGA 2HPPH 1S5SA 3RU4E 4D9QA 1D3DB 2Z9GA 3UREA 3U98H 2GCHG 1FI8A 2ULLA 1QBNA 2FODA 1LHCH 2GZ7A 3RXSA 5EQRA 3N7OA 3ODDA 3JZ2B 4UFEH 4A5TS 2J2UA 4FUJA 2XC4A 4B75A 1GI4A 2ZHWH 2AH4X 1A0LA 4RN6A 5J4SA 1YM0A 3UQOA 3TIUA 2ZGXH 2YNBA 6GCHG 1T8OA 1XUGA 1A46H 2OC1A 1ZJKA 5ESBA 5LH8A 3A7WA 2J92A 1O2PA 1Z6JH 1W7GH 2A4QA 3NCLA 1HLTH 1KXEA 1T31A 5EXMA 3PLPA 1KLIH 2G5VA 3SJOA 1ELGA 3SU2A 4O03A 2XBVA 5J4QA 1CT2E 4MDSA 4NFFA 3RXGA 3FAOA 1OWHA 3TPIZ 1V2ST 2AMDA 5A0CA 2C8ZB 1JRTA 3RXOA 1DANH 1L1NA 4MNXA 3PMHB 2SGAA 1V2PT 1P2QA 3PTNA 1QBOA 2ZGBH 2JKHA 3T29A 1GHZA 1GWAA 3MWIU 4IMZA 1CGJE 3DT0H 2Z3EA 2OC8A 1VCWA 2BY5X 3MNSA 2OP9A 4ABDA 2VB0A 1V2WT 3MH7A 2BDGA 4BXSA 1IQKA 1S0QA 1J16A 3H7OA 4UDWH 3NWUA 3ZVEA 1YPLH 1SGYE 1C5PA 3DUXH 1HJAC 2WYGA 1LPZB 2J9NA 1FAKH 4CRCA 1O3FA 2Z9LA 4CREA 4Y0YE 1WAYB 5CHAB 3RXAA 1ETTH 1PPEE 4Q2KA 1ZTKA 3MU5A 4CRFA 5EXLA 1BBRH 1AZZA 1TQ7B 2IN2A 5A0BA 2LPRA 3TGJE 2H5CA 3ATKA 3BTWE 4FUEA 3PM3A 2ZU3A 1THSH 4TWWA 2UUKB 1TNGA 3UWIA 1QQ4A 1GBAA 3UWJH 2VH0A 1V2JT 1GJ4H 5G4BA 4CHAB 4WF8A 4RKJB 5C2ZA 1W0YH 1KSNA 2HNTE 2C4FH 5AFYH 5DP7A 1G3EA 1PPBH 1AE8H 3A84A 1K1NA 1SPJA 3F9EA 3S9BA 3M36A 2BY9X 2Y7ZA 5T6FA 3TU7H 4WMDA 1CE5A 1QHRB 1VZQH 3BTTE 4XOJA 4NIYA 1QB6A 1H9HE 2GVFA 2BDBA 4AFZA 1HYLA 4Z0KA 1BTYA 1F0RA 5FBEA 4JYUH 2A5AA 3VEQB 2PLXA 1GG6C 4MVNA 1JBUH 4JYVH 3VB6A 3T62A 2BOHB 1QJ7B 1ESTA 1ZR0A 3EYDA 1C5OH 3Q00A 2WPLS 4AGJA 1QA7A 2G81E 4JZEH 3RXEA 3MNXA 4Q7YA 4JZ1A 1TNIA 2QXIA 7LPRA 1E34B 1TBZH 3Q76A 4VGCC 1O33A 1TE0A 2QF0A 2VVCA 1TLDA 2ZTXA 3I78A 2F9BH 1PPHE 4O97A 3GICB 2R3UA 1UK4A 1BHXB 1Y3YA 5GDSH 2KAIA 1CU1A 1ZMJA 3PWCA 3RXBA 2ASUB 3UUZA