4ZHLU

The crystal structure of mupain-1-ig in complex with murinised human upa at ph7.4
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title Selection of High-Affinity Peptidic Serine Protease Inhibitors with Increased Binding Entropy from a Back-Flip Library of Peptide-Protease Fusions.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2015-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zhlU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zhlU01
1THPB 4X2VA 3GDUA 1GCTC 3EE0B 4MNXA 4GPGA 4K3JA 2YNAA 1T8LA 5L2YH 1W0ZU 1MU6B 3T25A 2CHAC 1ESAA 1A0LA 1UHBA 1W0YH 3P6ZB 1T7CA 3GICB 3RXHA 1MQ5A 2VWOA 1O5FH 3MO6A 1TLDA 4Y0ZE 4ASHA 3K65B 1JXPA 2F9PA 4BNRA 1TYNA 1YCPH 4RKOB 1GMCG 5EPYA 4HZHA 1CGHA 4I8LA 2Y7XA 4UEHH 2BD3A 1MTNC 4NIWA 5SGAE 1L0ZA 2Q6DA 1NRRH 4ABDA 1MZDA 1S82A 3BTDE 3K2UA 1NESE 1Y5AT 1TPOA 1O2VA 2QXIA 4DW2U 1HJAB 1K1PA 2UWLA 1QA0A 2GZ8A 3A89A 1ZTKA 4MNVA 1BRUP 1VJ9U 1QJ6B 1BCUH 1SGDE 3V3MA 2AGEX 1LKBA 2A2QH 4GHTA 1IQEA 3RXQA 4BXSA 2BB4A 6LPRA 1QFKH 1YBWA 1SSXA 4GSOA 3RM2H 4Y76A 1O3MA 1F92A 5HM9A 1QQ4A 1C2KA 1O3BA 5C20A 3T26A 1FY8E 5L30H 1IQFA 5GCHG 2CMYA 3BEIB 1MKXH 2FI4E 3H5CB 4OS6A 1NRQH 2ZECA 3BTHE 2F3CE 3V0XA 1DWDH 1O2YA 1THRH 1SLXB 4JCNA 3LPRA 1O5EH 3ELAH 4YLUA 1UMAH 3PMBB 1GMHF 2ZCLP 1IHTH 2AMDA 4NCYA 3EGKH 1TB6H 1K1OA 2C8ZB 2G5VA 3GY4A 4HFPB 1ACBE 5TCCA 2OP9A 2FX4A 1OOKB 8ESTE 5EOKA 2CN0H 3B23B 3BG4C 1G3EA 1MZAA 1KIGH 3VXFH 1Z8RA 5DP4A 2V3OH 1HJ8A 2AERH 2ZO3H 3MU8A 4CH2B 1PPHE 1GJ7B 3P8GA 2GP9B 4X2WA 1C2DA 1XUKA 1HCGA 2HLCA 3ZZ4A 1O2QA 3QN7A 2Z9LA 4THNH 3C27B 1HJ9A 1QB9A 4DJZB 2BDBA 3RXGA 1H9LB 3M3TA 1IQKA 4RN6A 1NU7B 5DKMA 2AH4X 4IS5A 2ZDVH 2QCYA 2FOMB 1EZUC 1AB9B 1W10U 2OC8A 2CGAA 4Q7YA 1O2JA 1SHHB 1C5UA 1Y3YA 1ZPCA 3A82A 3B8JA 1QNJA 5A2MH 3RU4E 1HYLA 1DM4B 3OU0A 3OY5U 4PROA 1THSH 1RFNA 4MPXA 5GCHF 4AZ2B 4Y7AA 4U30A 1O2KA 5T6GA 1J15A 2B7DH 3ZZAA 2ZDLA 2EI6A 1C1OA 1KTTB 4UD9H 2KAIA 1P10A 4AFUA 2BLQA 1NRNH 2C8YB 3M3SA 2B8OH 3A88A 3BEUA 3D65E 2B9LA 4X8SH 2FS9A 3F6UH 2LNCA 1ZHMA 3QK1A 1AKSB 1C5SA 3U8RH 1O3NA 1UCYH 2Y82A 1C4U2 4JZFH 1HUTH 1FAXA 3KCGH 2ZTZA 2BDGA 1CSOE 1SGEE 4J1YA 4X1PU 1NPMA 4XFQA 1MH0A 1AO5A 2RG3A 1NU9A 1VITG 3MO3A 3UFAA 3U98H 4CRDA 1LVMA 3HATH 1QGFA 4TWWA 3VXEH 1HRTH 4UONA 1QB1A 1C9TA 1BTPA 2IOTA 1CBWC 2ZDAH 4YT7H 1ZSKA 3MTYA 1J8AA 2FEQH 1A7SA 1C5XB 1TNGA 1O38A 1NFYA 4BAHB 1P8VC 1TONA 2IJOB 2J95A 1TGNA 3UUZA 4CRAA 1O5BB 1AD8H 3RXFA 4MPUA 1DT2A 4X2YA 1W2KH 1XUFA 1GG6B 3WY8A 2BD2A 2O9QA 1GVKB 3PO1B 4NWKA 4YO9A 3TLOA 3GDVA 1GVZA 3RXBA 1W7XH 2TIOA 2ZFSA 1W8BH 2G00A 2ANWA 1ZGVA 3SQEE 4DG4A 2BQ6B 3F9FA 1UTOA 1PQ5A 2WYJA 4IMQA 1S81A 1SGNE 1C5YB 3UWIA 1DWEH 1PPGE 1AI8H 2WUBA 2BM2A 1P2IA 2OC7A 1Y3WA 1P2KA 3H7TA 4ZKRU 1F0UA 1SLUB 1D9IA 5HM2A 3SJKA 4AFQA 3EAJA 1F5RA 3KF2A 1KXFA 3TNSA 4MG3A 3TH2H 2ZQ1A 5EU8A 3LKWA 3SI3H 2OLGA 2A4QA 4Y8YA 3T28A 1OWKA 2HOBA 1C2GA 1AWHB 3Q3KA 4MDSA 2SGPE 3FZZA 1D6WA 3NWUA 1XUIA 1P04A 2AMQA 2ULLA 3FZDA 2ZNKH 3UOPA 4BANB 3DT0H 5A09A 1NO9H 1HJAC 1FDPA 1BDAA 1XM1A 5EW2H 1CT4E 2VINA 5JBAS 1GVLA 1DS2E 1HAXB 2ZQ2A 1A61H 2STBE 3T2NA 3MU5A 1GJAB 1Z8GA 3FVFB 3HK6B 3U9AH 1HIAB 4I8JA 9LPRA 4IW4E 4K1TA 3STIA 1IQGA 1DX5M 1FY5A 2ZDMA 2BX4A 1FY3A 1HNEE 2BVRH 1GMDF 2ANMH 1QRZA 4K69A 3M5OA 1AMHA 1V3XA 1WQSA 1BMMH 1DICA 2P8OB 4H6SB 1ELDE 4AYYB 2NU4E 2I6QA 2SGAA 3SJ9A 3TITA 4B2CA 1OWEA 2QY0B 1UK4A 1J17T 1HXFH 2BD7A 2OQUA 5DP5A 4INKA 1GI4A 2R9PA 5GXPA 3W95A 1Z6JH 4ABJA 1QCPA 3BIUH 4AB8A 2VGCB 2ZFRH 4HTCH 5E0HA 3I77A 4ISNA 8LPRA 1GI2A 5C5NA 1FQ3A 4MLFB 2BYAX 2G4TA 2XBYA 3RXVA 4R8TB 2PHBA 3AW1A 3RXJA 1TX6A 1UHBB 4TPYA 3DA9B 2BZAA 1D3QB 2H6MA 3EA8A 5DP8A 1UVSH 5FX5A 2TPIZ 1BTWA 5H4IB 1TX7A 1GCDA 4XOJA 3RMNH 1GBCA 1A2CH 1TGCA 2D8WA 6GCHG 1Y8TA 2O8TA 4Y11E 2FS8A 3GCTF 3RLYH 4B2BA 3BF6H 2FIRH 3RXSA 1GJ9B 3QDZB 3RXUA 2BD5A 3UNRA 1AB9C 1M9UA 1V2QT 1AE5A 1Z1JA 2G5NA 1VCWA 4BAOB 3A85A 3PTBA 2VIPA 3ZVBA 1SL3A 4YOGA 4ABAA 1LMWB 2A32A 3LGIA 3A81A 3R3GB 3BSQA 1UJ1A 2ANYA 4IC6A 2ZIQH 1SFIA 1A3BH 1O3LA 1OXGA 2XC5A 3M7QA 2GDDA 2XWAA 1GHYH 1HAZB 1O3KA 2XWBI 5G4BA 1MAYA 1VCPA 2ZGJA 3QWCH 1O2SA 4NG9H 4WXIA 4X6PA 3ODDA 3MMGA 1EASA 4Z0KA 7ESTE 3SU4A 2ZFPH 4ABGA 3KHVA 3DFJA 5HXFA 4JZEH 1ELTA 3MNBA 1LKAA 2QV1A 1EZXC 3LDXH 1GI1A 1NROH 1O2PA 5B6OA 3HK3B 3BTEE 5E0JA 5DPAA 1AZZA 5T6FA 2J4IA 2FYRA 1FN8A 1LHCH 1JIMA 3UY9A 2DE8A 1H9HE 1ZOMA 4ZHMU 1DLEA 1P2JA 4YLQH 1NRSH 3KQCA 2OC0A 3LC3A 6GCHF 2BDCA 3EA7A 1DLKB 1A5IA 4MTBA 1A4WH 1GI3A 3RXPA 3CP7A 1VCQA 1LPZB 5FCRA 1YF4A 4ISIH 4BAKB 2UUKB 5A0BA 1AIXH 1YP9A 3S7HB 3TJUA 1ZJKA 4FU8A 5FPTA 3E1XB 1O3FA 3Q3YA 7GCHG 2WPIS 2VWMA 3Q00A 4LZ4B 2SGQE 4FUIA 1OWHA 1Z6EA 1EAWA 5GJ4B 4TY7A 1F0SA 3G01A 3FP8E 1FV9A 1AGJA 3T62A 4AG1A 1SOTA 4TWYA 3PO1C 4JYUH 3ZV8A 1B5GH 2ZCHP 1GL0E 1N6YA 2ZHFH 4GHQA 2ALVA 2WINI 1SGTA 3ZZ7A 5DGJA 1O31A 2SNVA 3M5NA 3QZQA 1EAUA 4OGYA 1OSSA 2PWXA 3OY6U 4A1XA 1KXDA 5T6DA 1GHBF 4E05H 2VWNA 4YOIA 1TBRH 1C5TA 1O2MA 3PV4A 1ZTLA 3B9FH 2OCVB 5BRRE 4TYDA 2OTVA 3P95A 1W12U 4JMYA 4UFDH 3VB5A 1GBEA 2W3KA 2O8LA 1BBRK 2Z3DA 3OSYA 2V6NA 1P3CA 4K1SA 3UPEA 2PTNA 5J4QA 1GBDA 4BTTB 1NN6A 1TGBA 1XKBC 1EX3A 1AY6H 1Y3XA 1O33A 5A0AE 5EQRA 3GCHB 3KGPA 2IN2A 4AX9H 2P16A 1P06A 3M61U 1VZQH 4JYVH 1DWBH 2FOHA 1BJVA 1L4ZA 1AUTC 3TIUA 4FUBA 2BLWA 7GCHF 1J16A 2Y7ZA 3A86A 4GVUA 3TJVA 4NIXA 3LJOA 3UTUH 2XCNA 3RU4T 4WMEA 1H8IH 4FUDA 1TMBH 1QIXB 2FX6A 2PTCE 1ZRKA 2UUFB 2GZ9A 2QAAA 3F1SB 1H1BA 1MQ6A 2R2WU 1OX1A 2VJ1A 5FPYA 4GUXA 1C4Y2 4MPVA 2P8OC 1EATA 1PQ8A 2ZP0H 2GGVB 1D3DB 1A0JA 3F9HA 3S9BA 1O5DH 4GCHG 3F68H 4NSVA 2Z94A 1V2LT 2BD8A 2ZDKA 2ZEBA 2AMPA 3SI4H 5JYIA 4YM9A 3BV9B 2VH0A 1T8OA 3RXKA 1C1QA 1GL1A 2SGDE 3SUFA 2C8XB 4AGJA 2FOFA 2VGCC 1S0RA 4O3UA 5HMAA 3LGVA 5FPSA 1FPCH 1FLEE 3ZV9A 3SUGA 4A5TS 1FONA 1SFQB 3GY8A 1W14U 2QF3A 1ESBA 2Y5HA 4FUCA 1KSNA 1HGTH 3U8TH 1GBHA 2ZGCA 1V2PT 3O8DA 2UWOA 1GBIA 3DUXH 1U6QA 3RP2A 3M37A 1DXWA 4K1EA 1C1UH 3E90B 2Z6BD 2ZU5A 3Q3XA 5A0CA 4BTUB 2QF0A 2XBXA 3BTME 3SU5A 3A7XA 1ZMLA 2D2DA 2HALA 1TOCB 3O8BA 3GCNA 2FOCA 3QTOH 1KDQA 1S6FA 3DFLA 1T8NA 2Z9KA 1GJ4H 1UTKA 3AVZA 2QC2A 3ESTA 4ZROA 1YPGH 4JK6A 1RXPA 4ZUHA 1XUHA 1QA7A 1LDTT 1C2MA 3N7OA 2J34A 2BMGB 4JZDH 1O2XA 1ZLRA 2OINA 1FN6A 5JBTA 1C2LA 2V35A 4B75A 2Z3CA 1B7XB 4KP0A 1QTFA 2YNBA 5C3NA 2R3YA 1KXEA 4NA9H 1ID5H 4O03A 4UDWH 4GLYA 2XNIA 1C5NH 1EB1H 1TIOA 2SFAA 2FXRA 3PM3A 1MTVA 1L1NA 2P94A 6CHAC 1SGFG 4IC5A 3SV2H 3MU4A 1GMCF 2BD4A 1G32B 4X8UH 1SG8B 1ZR0A 2GMTB 4NZLA 1GBMA 2ZZUH 3OX7U 1K22H 3SU2A 1WTHD 2R3UA 2WV5A 4ESTE 4LK4A 2J92A 1EPTB 1LHFH 1H9IE 1XX9A 4X6MA 3PROA 3ZVFA 4ABFA 1D4PB 1GBBA 1HLTH 2ALPA 3SOSA 2BDYA 4I32A 1HXEH 1DPOA 3RXRA 1GBLA 3SU6A 2P3FH 4CREA 1YPHE 2FP7B 1O3IA 5GWZA 1ANBA 1O37A 4J2YB 1ETTH 5TCAA 3M3VA 1C1SA 3CENA 6ESTA 3SUDA 4X1NU 2ILNA 1O5GH 1VITH 3A84A 4ZXYH 1C1TA 1D3PB 2A0QB 2HVXA 3M36A 3E91A 1C5MD 3FP6E 3ZZ6A 1XXFA 2XXLA 3ZZ5A 4RSPA 1MKXK 1C2EA 4ZKOU 1ELBA 2ZC9H 3VB6A 1ELCA 4HGCA 5FXLA 2Q6FA 3QGJA 1PJPA 2GVFA 2BDHA 4KKDA 1WUNH 5CMXH 2BY9X 5ETXA 2EC9H 2XCFA 3SHAH 2H9TH 3VFEA 1C2IA 2RCEA 1IQNA 4BTIB 1MCVA 1HB0B 2QXJA 3A87A 3AW0A 1MKWH 2GZ7A 1ABIH 1DDJA 1GI9B 4ABHA 2C3SA 4CRGA 3RMMH 2W26A 1HAVA 1UVUH 4H4FA 4JK5A 3MNCA 2VNTA 4E7NA 1G9IE 4HI3A 5EQQA 3QTVH 2O8WA 1NY22 3TVJB 1IQJA 2GV6A 4ZXXH 2ASUB 1GHXH 1D6RA 1L4DA 4CRBA 1O39A 1ZMNA 3S69A 4UFEH 1DVAH 5FBEA 1C2JA 2FYQA 4B1TA 2BOKA 3E0PB 2Z3EA 4KELA 1ZMJA 4X1QU 3U8OH 3GY5A 3MH5A 1HDTH 4U2WA 1O3JA 1O2OA 3GCHC 4CBOA 2GCHG 3A7VA 1MTSA 3RXMA 1LQDB 3P17H 4Q80A 5EODA 5GDSH 1ZPZA 1GWAA 2ZHDA 3F9GA 3U1IB 1PPBH 1TGTA 1L1GA 1FUJA 1TNHA 5JBCS 2H1UA 3IITA 4B2AA 4Y8ZA 4ABIA 1G37A 2PUQH 1JWTA 4WJG2 1OWJA 5CE1A 2G81E 5C67A 1BTYA 4FUFA 3RC4A 1GI0A 1D3TB 3E6PH 4OS2A 2ZCKP 2GTBA 1AFEH 2QIQA 1ETSH 1K1IA 2RA0A 1BHXF 1JRSA 1O2ZA 1TMUH 2VVVA 1C1VH 2ZKSA 4YESB 3ZZCA 4XBDA 2FLRH 2PKAB 1TPPA 1WU1A 3EYDA 4MVNA 2XC0A 3ATKA 2NWNA 1PPEE 2BOHB 1KLTA 2UWPA 1KLJH 2ZU1A 5DP7A 4X6OA 2F9OA 1O2IA 2ODYB 5I46H 3ATWA 1DFPA 1UCYK 2QXGA 5AVDA 3QLPH 1V2MT 2O8MA 4INLA 3V12A 1QL9A 2ODPA 4ISLA 1K1MA 2FODA 3RMLH 2Z7FE 1WAYB 2G51A 1VITF 4K60A 1UK2A 3KQEA 5L6NH 1C5WB 1K21H 2ZHQH 4K5ZA 2FO9A 1ZYOA 1S84A 1EZQA 1SMFE 3KNXA 3M35A 4Z6AH 1AFQB 2TGDA 3ZZ8A 4KTUA 4CRFA 3LH3A 1EOLA 1YGCH 1DY8A 1JRTA 3GCOA 1VGCB 1G2MA 1LVOA 1ELGA 3TGKE 1C2FA 5EXMA 4D76A 2TRMA 2GCHF 2J94A 1O2HA 1RTKA 2Q1JA 1P2OA 3PLBA 1V2VT 3TK9A 3PWBA 1WYKA 1V2KT 1GBAA 1UVPA 1LHGH 5C1XA 3KQDA 1TALA 4D7GA 1YYY1 1WV7H 1HAGE 1EB2A 1RTLA 3FAOA 4Q7XA 2F9UA 3SGQE 1MCTA 1OWDA 3V7TA 1BHXB 3ITIA 3BIVH 1IQIA 3RDZA 2BHGA 4JZ1A 2A5AA 2PKSB 2R0LA 1EQ9A 1ESTA 4AB9A 2P93A 1EKBB 3PMAB 2BDIA 2OC1A 4ZKSU 1TNIA 1GDQA 1GJ8B 3LC5A 1T8MA 2HPPH 5C1YA 3SNDA 1BA8B 2ESTE 1V2OT 4E06H 2JH5D 2FWWA 1YPKH 1F0RA 1Z1IA 1Y5BT 1AUJA 1QB6A 5CHAB 3QO6A 1TE0A 3BTQE 3MU1A 2AIQA 2ZDNA 2GMTC 1MAXA 5JB8S 5FCKA 1C1NA 2BDAA 4YZUA 4ZH8A 1PPFE 2C8WB 1JOUB 1K28D 1LHDH 1S6HA 5DP3A 3SJOA 1V2TT 3MOCA 1GDNA 4FU7A 1BMAA 2OQ5A 1EPTC 1XUGA 1G3CA 1NS3A 2DE9A 2F91A 5A8YA 1P02A 2XC4A 1V2ST 4NFFA 3QZRA 1T31A 1QL7A 4NZQA 3AASA 5AFZH 4R0IA 1L1JA 4O97A 3W94A 1PYTC 1TBQH 1OP0A 3KN2A 4FVBA 3MU0A 2P59A 4CRCA 1V2RT 4X1SU 3RC5A 2A5KA 1YLDA 1NRPH 3ATIA 2TGPZ 1F5KU 2ZFQH 3SGAE 3A8AA 1YPHC 1C1WH 1ARBA 1ZRBA 1KTSB 3BTFE 4K8BA 4H6TA 2GD4B 3NZIA 1SGYE 1A0HB 2YOLA 1W3CA 4FUGA 1G36A 2BY6X 1C5RA 5AHGH 2F9NA 2G55A 3RXCA 1KXCA 1NT1A 5DJ7A 1CU1A 4JYTA 4CHAB 2F9BH 1TPSA 6CHAB 1A3EH 2WPJS 2H9EH 3LOXA 3T29A 1HAOH 4AG2A 2BVXH 3SNBA 1CHGA 1O2WA 4YTAA 2AS9A 5DP9A 1G3BA 4AOQA 5A8ZA 5ABWA 1O3OA 4K8YA 1EJMA 2A7HA 2VVUA 3PMHB 1GHWH 4TY6A 4DGJA 2ZA5A 3ZZ3A 3SV8A 4Y0YE 1AE8H 2VIOA 4FUHA 4A1TA 3A7ZA 1KXBA 4OS4A 1Z71A 3D23A 1AHTH 1TNKA 2FOGA 4MNWA 4WXVA 4NSYA 2FTLE 4FUJA 2CF8H 2AIPA 2GT7A 1O5AB 1O2LA 3MNXA 1PYTD 4F49A 3FANA 3UR6A 1P3EA 3LGWA 1F7ZA 2AFQB 2QGRA 3QX5H 2BZ6H 1C1RA 4IN1A 1BTXA 2EI8A 2HNTF 4KTSA 1O3CA 4D9RA 1QBNA 3M5MA 1CE5A 1BBRH 3RXOA 1V2NT 2W3IA 2J9NA 1V2UT 3NCLA 3PLPA 5FBIA 3RLWH 3V13A 4MNYA 1BITA 3OYPA 2GX4A 5HGGA 3A7TA 1AVXA 3GYLB 2GCTB 5L2ZH 5FHTA 2AGIX 1ANEA 2B5TB 3D62A 1YPJH 4ABEA 1C5ZB 1O3PB 5EGMA 1ZSJA 1OPHB 1MD8A 4B76A 5LH8A 3SQHE 2A7JA 3ATLA 4YOJA 1HAIH 3UQOA 1EP6A 1MTWA 2OBOA 2NU2E 1C5PA 2A4RA 4NFEA 1BRAA 1P9UA 1S85A 1P57B 2HWLB 1XXDA 1GJ6A 4FXGH 2ZPQA 5K7RA 1SQOA 1O32A 3EA9A 1EAXA 2GDEH 1P09A 4SGBE 1FPHH 2KAIB 5FX6A 1ETRH 1FXYA 3NKKA 2HNTE 4IN2A 2FMJA 3NPSA 4XE4A 5PTPA 2BTCE 1AFQC 5DO4H 1SLVB 3A8CA 1G30B 1BMNH 2TBSA 4B71A 1GJBB 4LXBH 4WWYA 1VGCC 2H5DA 1ANCA 5F8TA 1Q3XA 9ESTA 1J9CH 1MBMA 3GY2A 1O2TA 1LTOA 4I31A 4AFSA 3RMOH 1K2I1 4CR9A 1ZZZA 3BTWE 4I8KA 1SGIB 4AORA 1SI5H 1N6XA 1GPZA 1JIRA 3UOUA 2NU1E 1ELFA 2UUYA 1OYQA 2D26C 5TJXA 3D49H 3SHCH 3HPTB 2PW8H 2R0KA 3GY7A 3ZVGA 1A5HA 2PR3A 3EDXB 1GJCB 4E7RG 4NA7A 2PKSC 4WMFA 1MTUA 3GOVB 2ZU4A 4OS1A 4FVDA 5ESBA 4XBBA 5E0GA 2VIQA 3I29A 1S83A 5LGOA 1DE7H 3RC6A 4QT8C 2JETB 1BZXE 3TJNA 2J38A 1JMOH 4Q2KA 1SPJA 4RKJB 2STAE 1C5LH 2F83A 1K9OE 3VEQB 5JB9S 1QQUA 5CHAC 3LH1A 3TK6A 3UIRA 4X1RU 1F0TA 4YT6H 3SBKA 3P8NA 2BY5X 1NTPA 1C2HA 2WPLS 1ZJDA 3RUOA 1DOJA 1DANH 3JZ1B 1Z8JB 3HKIB 4VGCB 4MQAA 1BQYA 1H8DH 3K6YA 5FAHA 2ZPRA 1ELVA 1GMHG 2BLOA 2V0BA 5JBBS 1QRWA 4AGKA 4XSKU 1C4V2 1K1JA 4WMDA 4NA8A 1N8OB 2Z9GA 2Y5FA 2ZF0H 3SJIA 1H4WA 2A7CA 5IDKA 2VH6A 4D7FA 1INCA 1UTMA 3PTNA 1FJSA 4BAMB 2EEKA 3GISB 4X8VH 1GJ5H 5LPEA 5JDUB 1AVGH 2Z9JA 1SVPA 3SZNA 3MHWU 5IYTA 7KMEH 2XTTB 4DT7B 2PLXA 3SJ8A 1TRYA 2C4FH 4GCHF 2PV9B 4A1VA 3BTKE 2ZFFH 3CS0A 1BBRE 3S9AA 3LONA 3LT3A 3C1KA 1W7GH 1RTFB 3LGTA 1O3DA 4I7YH 1IQLA 4CHAC 1C5QA 2SGFE 4WY3A 5F03A 1B0EA 1YCPK 3TK5A 2QYIA 1ZHRA 4ISHH 1FIZA 1SBWA 1MUEB 5AF9H 1ELEE 1F5LA 3TU7H 2CF9H 1SR5C 5DP6A 1CHOG 1YKTA 3U69H 1Q2WA 1CGIE 1V2JT 1HAPH 3ENSB 5LPFA 2SNWA 5DG6A 1Y59T 1XVMA 4Y7BA 3HKJB 1PPCE 3AAUA 3KIDU 5GIBA 2FOBA 1AU8A 2BD9A 1BJUA 2ZHWH 5AFYH 1SGQE 3JZ2B 2LPRA 3ZZBA 2PFEA 2PSXA 5F8ZA 4WH6A 3UWJH 5EXLA 3BN9A 4A92A 3RXAA 4LZ1H 3E16B 3M5LA 2D1JA 1PQAA 4FUEA 2OXSA 1TRNA 8KME2 1BIOA 1QHRB 3O8CA 2EI7A 2GV7A 3FFGA 2ZG0H 2M5TA 1B0FA 2THFB 2C93B 1QJ1B 1WCZA 2J2UA 2GCTC 3QUMP 3TH4H 1CA8B 1FY1A 1FMGA 1P2MA 2XW9A 1EAIA 3IG6B 2A45B 2VIWA 4Y79A 3RXIA 3SNAA 4OS5A 1XKAC 2WV4A 5HYOA 2O8UA 1DITH 1Y3VA 4ZKNU 1LCYA 1MD7A 1O3AA 2BXUH 2G52A 1YCPM 3T27A 2VU8E 3U1JB 1O5CB 2ZGBH 1CA0B 1W13U 2RA3A 1G3DA 1GJDB 1NM6A 1SLWB 1AQ7A 1OP2A 3GY6A 2PUXB 1C9PA 3A7WA 1GBKA 1HAYB 5LPRA 1RD3B 2XYAA 5K0HA 1TX8A 2I6SA 3GYMA 4NWLA 1O35A 3VB7A 1FZZA 5EG4A 3P8OA 1CHOF 1QL8A 3ZVDA 3PYHA 1GHZA 3GDSA 5T3HA 4FU9A 1GI8B 4XDEA 1LPGB 2FLBH 2AGGX 2VIDA 1HV7A 2HRVA 1IQMA 2BQWB 5E2OA 3UNQA 1UTNA 1TBZH 1BRBE 3RXLA 4Y71A 1CQQA 3RM0H 1E0FD 1LVYA 2HNTC 2R2MB 5J4SA 1X7AC 2FZZA 1L2EA 1ZTJA 1UTLM 1GGDB 3PB1E 5EXNA 1HFDA 4DOQA 1O3HA 3URCA 4DCDA 1YC0A 4DY7B 1TA6A 4SGAE 2DUCA 2Q6GA 3RXDA 2ZPSA 1P03A 1TNLA 1UVTH 5F8XA 2Z9IA 1FI8A 1SOZA 1XMNB 1IAUA 1HBTH 5JPMH 1IOEA 1NZQH 1GBFA 1TMTH 2ZU3A 3VGCB 3S9CA 1A1RA 1MKWK 1CO7E 4UE7H 4UFGH 4DVAU 3STJA 1ZSLA 3LJJA 1G2LA 2JETC 1RIWB 5F6MA 4I8HA 2P95A 3NK8A 1GMDG 4NGAH 3SN8A 3DD2H 2PSYA 1E35B 5ESTE 1HAHH 3E3TA 3ZVEA 2RDLA 1QJ7B 1PFXC 1FAKH 4X6NA 1ZPBA 1P11E 4KTCA 2BY8X 4XBCA 4AN7A 2F9VA 1O34A 4ABBA 3CS7A 2CV3A 2OUAA 1XVOA 1E38B 1PQ7A 4OGXA 1GI6A 4VGCC 1TQ0B 1FIWA 2A4GA 1BMLA 1GHVH 1IHSH 4X0WU 3URDA 3ODFA 3FP7E 1RRKA 2ZTYA 3TPIZ 3Q76A 2SGEE 2G4UA 3VB4A 3ZYEA 4UFFH 1ZHPA 2W5EA 1QURH 1WTGH 2ZFTA 4DIHH 1O36A 3MWIU 1UVOA 1N8OC 3TGJE 1AWFH 3H7OA 1FY4A 4GAWA 3SORA 2H5CA 1C1PA 1OYTH 4IGDA 5C5OA 4JZIA 1Z7KA 2FM2A 1NC6A 2FOEA 2BX3A 1E36B 2FESH 1RJXB 1O2NA 1EJAA 1WBGB 1S5SA 4KGAA 1GBTA 2P3TB 2ZI2H 1QBVH 1P2NA 2ZGHA 2V3HH 3PMJA 1C5OH 3GCTG 1TGSZ 1P2QA 1OKXA 3BTGE 1WSSH 3P92A 4F4OC 4Y10E 1QBOA 2VB0A 2ANKH 3SO3A 2WPKS 3UNSA 4H42U 2AEIH 2NU3E 1GI7B 2C90B 3MH6A 1DSTA 1GCTB 1P0SH 1HPGA 1RGQA 1CT2E 1QY6A 4TPIZ 1KYNA 1TQ7B 1LPKB 3LU9B 3LIWA 3I78A 3A8BA 2OD3B 4O9VA 1WQVH 2VVCA 1SB1H 1VR1H 2CHAB 1ABJH 5GPIB 4U32A 4X8TH 1PPZA 2VIVA 4Y8XA 3K9XB 1V6DA 3E0NB 1TABE 3MH7A 2A4OA 1EPTA 3ZYDA 3EQ0H 1TNJA 3UQVA 1O3GA 2BVSH 1GI5A 1SGCA 2WYGA 2G8TA 1DUAA 1GHAG 2WPHS 1YPEH 4OS7A 1O2RA 1NFUA 3MYWA 3T5FH 3ZVCA 5EW1H 1SHYA 1VJAU 1TWXB 5BPEA 1P12E 3ZZ9A 1CGJE 3NXPA 1J14A 1LHEH 2NU0E 1MTNB 1SGPE 1QRXA 3RXTA 1E34B 1SQTA 4CR5A 2ZHEH 1TOMH 5A8XA 3IWMA 3SNEA 3TGIE 4BOHA 1UCYE 3BTTE 2VWLA 8GCHG 4B73A 1O2UA 1MMJN 3E8LA 3TNTA 4WH8A 4IMZA 3RXEA 1P01A 3ATMA 1NFWA 1SQAA 3SU1A 1ANDA 2ZWLH 4WF8A 1KDQB 3AAVA 2FDAA 1TAWA 2FPZA 3A83A 3MH4A 2ZTXA 3A7YA 1C1MA 3HGPA 2B0FA 1QR3E 3TH3H 4A7IB 1RS0A 3SV7A 1MBQA 4K2YA 1UTJA 4M7GA 3GY3A 1OS8A 1YM0A 1BTHH 1UO6A 4CBNA 7LPRA 1LQEA 1TRMA 1OWIA 3TJOA 1CVWH 1AKSA 3M7UA 1UK3A 3OTJE 1EZSC 5C2ZA 1F2SE 1CA0C 3P70B 5EQSA 2TGAA 4ZHLU 1Y3UA 1GBJA 4DIIH 4AYVB 3SUEA 2Y6TA 1S0QA 1EXFA 3O8RA 1SGRE 3L3TA 1DWCH 1SC8U 4NIVA 1N1LA 4B74A 1BOQA 1BTZA 1ZGIA 1K1LA 1GHAF 1DSUA 1KLIH 2OBQA 2A5IA 1GHBG 2QA9E 1UTPA 1TFXA 4CH8B 1CT0E 1T32A 5E8EH 1W11U 4ZAEA 2AYWA 1Z8IB 3S0NA 2Y5GA 3BG4B 4Y6DA 3SU3A 3VB3A 1KY9A 3MO9A 2CXVA 1YLCA 2HGTH 4ZHAA 8GCHF 3MI4A 3ZVAA 2BLVA 3QGNB 1BTUA 4D9QA 1AVWA 1GGDC 1BB0B 5EPNA 2QXHA 2CJIA 2K1QA 4I33A 2BY7X 2ZU2A 1DUEA 1O3EA 3SV9A 3L6PA 2A2XH 3SNCA 1TPAE 1EP5A 3BEFB 1JBUH 3SU0A 1MU8B 2XRCA 3SGBE 1DY9A 3M7TA 2PKAA 1V2WT 2GT8A 2P3UB 1ELAA 1DXPA 3MNSA 1P05A 1SGFA 2IPHA 3BG8A 3SV6A 3VGCC 2GKVE 3HGNA 2Y80A 4O3TA 4BAQB 2H2ZA 2Y81A 3A8DA 5I25A 1A46H 1GG6C 2JH0D 2PGQB 1OP8A 1LO6A 1Q31A 1RIWC 3F9EA 3KEEA 2TGTA 1T4VH 4LOYH 3LGYA 5E2PA 3Q77A 2XBVA 4INHA 1BT7A 2WPMS 2PGBB 2UUJB 3RU4D 1BRCE 2JKHA 1A5GH 1EOJA 1K1NA 3VPKA 1GDUA 1IQHA 1NFXA 1AN1E 1O2GH 2A31A 2WUCA 3UR9A 1XUJA 5C1UA 1LVBA 4D8NA 1TA2A 4DURA 4IBLH 4X2XA 2W7SA 1BUIA 2BXTH 4A6LA 1KXAA 1O0DH 3KQBA 3SW2B 2QN5T 1HAVB 1WOFA 3ZZDA 2FI5E 1ORFA 4Q7ZA 2H9HA 5DK1A 4WVPE 1AZ8A 1C5VA 4MPWA 2BQ7B 1E37B 3S7KB 2ODQA 1P9SA 4NIYA 3LGUA 4U01A 1FNIA 1HIAA 1Y5UT 2JH6D 1T4UH 3K6ZA 1CBWB 3KL6A 3P8FA 1EUFA 3PWCA 3R0FA 2W7UA 4ZMAH 1UTQA 2FOAA 3NUMA 3MFJA 4AFZA 1O30A 1EJNA 1YPLH 2FI3E 4I8GA 4ISOA 2FTMA 2XBWA 1ARCA 2A1DB 2HPQH 4BXWA 3UREA 2ZGXH 3PLKA 1YPMH 3L33A 3DHKH 2EA3A 3A80A
chains in the Genus database with same CATH superfamily
1THPB 4X2VA 3GDUA 3F2FA 1GCTC 3EE0B 4MNXA 4GPGA 4K3JA 3W1EA 2YNAA 1YY3A 1T8LA 5L2YH 1W0ZU 1MU6B 3T25A 2WHXA 2CHAC 1ESAA 1A0LA 3ZIAD 1UHBA 1W0YH 3P6ZB 1T7CA 3GICB 3RXHA 1MQ5A 2VWOA 1O5FH 2WSSD 3MO6A 1TLDA 4Y0ZE 4ASHA 3K65B 1W0JD 1JXPA 2F9PA 4BNRA 1TYNA 1YCPH 1YLNA 4RKOB 1GMCG 5EPYA 4HZHA 1CGHA 4I8LA 2Y7XA 4UEHH 2BD3A 1MTNC 4NIWA 5SGAE 1L0ZA 2Q6DA 1NRRH 4ABDA 1MZDA 1S82A 3BTDE 3K2UA 1NESE 1Y5AT 1TPOA 1O2VA 2KCOA 2QXIA 4DW2U 1HJAB 1K1PA 2UWLA 1QA0A 2GZ8A 3A89A 1ZTKA 4MNVA 1S6LA 1BRUP 1VJ9U 1QJ6B 1BCUH 1SGDE 2K8IA 3V3MA 2AGEX 1LKBA 4XRNA 2A2QH 4GHTA 1IQEA 3RXQA 3FOAA 3FKSD 4BXSA 2BB4A 6LPRA 1QFKH 1YBWA 1SSXA 4GSOA 3RM2H 4Y76A 1O3MA 1F92A 5HM9A 1QQ4A 1C2KA 1O3BA 5C20A 3T26A 1FY8E 5L30H 3AK5A 3FN8A 1IQFA 5GCHG 2CMYA 3BEIB 1MKXH 2FI4E 3H5CB 4OS6A 1NRQH 2ZECA 3BTHE 5GNDA 2F3CE 3V0XA 1DWDH 1O2YA 1THRH 1SLXB 4JCNA 3LPRA 1O5EH 3ELAH 4YLUA 1UMAH 3PMBB 4P00A 1GMHF 2ZCLP 1IHTH 2AMDA 4NCYA 3EGKH 1TB6H 1K1OA 2C8ZB 2G5VA 3GY4A 4HFPB 4HG6A 1ACBE 5TCCA 2OP9A 2FX4A 1OOKB 8ESTE 5EOKA 2CN0H 3B23B 3BG4C 1G3EA 1MZAA 1KIGH 3VXFH 1Z8RA 3N7DA 5DP4A 2V3OH 1HJ8A 2AERH 2ZO3H 3MU8A 4CH2B 3WWBA 1PPHE 1GJ7B 3P8GA 2GP9B 4X2WA 1C2DA 1H8HD 1XUKA 1HCGA 2HLCA 3ZZ4A 1O2QA 3QN7A 2Z9LA 4THNH 3C27B 1HJ9A 1QB9A 4DJZB 2BDBA 3RXGA 1H9LB 3M3TA 1IQKA 4RN6A 1NU7B 5DKMA 2AH4X 4IS5A 2ZDVH 2QCYA 2FOMB 1EZUC 1AB9B 1W10U 2OC8A 5KGOA 2CGAA 4Q7YA 1O2JA 1SHHB 1C5UA 1Y3YA 1ZPCA 3A82A 3B8JA 1QNJA 5A2MH 3RU4E 1HYLA 1DM4B 3OU0A 3OY5U 4PROA 1THSH 1RFNA 4MPXA 5GCHF 2YMSB 4AZ2B 4Y7AA 4U30A 1O2KA 5T6GA 1J15A 2B7DH 3ZZAA 2ZDLA 2EI6A 1C1OA 1KTTB 4UD9H 2KAIA 1P10A 4AFUA 2BLQA 1NRNH 2C8YB 3M3SA 1NBMD 2B8OH 3A88A 3BEUA 3D65E 3MQKC 2B9LA 4X8SH 2FS9A 3F6UH 2LNCA 1ZHMA 3QK1A 1AKSB 1C5SA 3U8RH 1O3NA 5C0UA 5KECA 1UCYH 2Y82A 1C4U2 4JZFH 1HUTH 1FAXA 3KCGH 2ZTZA 2BDGA 1CSOE 1SGEE 4J1YA 4X1PU 1NPMA 4XFQA 1MH0A 1AO5A 2RG3A 1NU9A 1VITG 3MO3A 3UFAA 3U98H 4CRDA 1LVMA 3HATH 1QGFA 4TWWA 3VXEH 1HRTH 4UONA 1QB1A 4I86A 1C9TA 1BTPA 2IOTA 1CBWC 2ZDAH 4YT7H 1ZSKA 3MTYA 1J8AA 2FEQH 1A7SA 3N99A 1C5XB 1TNGA 1O38A 1NFYA 4BAHB 1P8VC 1TONA 2IJOB 2J95A 1TGNA 3UUZA 4CRAA 1O5BB 1AD8H 3RXFA 1E79D 4MPUA 1DT2A 2EQNA 4X2YA 4F48B 1W2KH 1XUFA 1GG6B 3WY8A 4P02A 2BD2A 2O9QA 3U28C 1GVKB 3PO1B 4NWKA 4YO9A 3TLOA 3GDVA 3SZEA 1GVZA 3RXBA 1W7XH 2TIOA 2ZFSA 1W8BH 2G00A 2ANWA 1ZGVA 3SQEE 4DG4A 2BQ6B 3F9FA 1UTOA 1PQ5A 2WYJA 4IMQA 1S81A 4XD7D 1SGNE 1C5YB 3UWIA 1DWEH 1PPGE 1AI8H 2WUBA 2BM2A 1P2IA 2OC7A 1Y3WA 1P2KA 3H7TA 4ZKRU 1F0UA 1SLUB 1D9IA 5HM2A 3SJKA 4AFQA 3EAJA 1F5RA 3KF2A 1KXFA 3TNSA 4MG3A 3TH2H 2ZQ1A 5EU8A 4DT4A 3LKWA 3SI3H 2OLGA 2A4QA 4Y8YA 3T28A 1OWKA 2HOBA 1C2GA 1AWHB 3Q3KA 4MDSA 5EJ1A 2SGPE 3FZZA 1D6WA 3NWUA 1XUIA 1P04A 2AMQA 2ULLA 3FZDA 2ZNKH 3UOPA 4BANB 3DT0H 5A09A 1NO9H 1HJAC 1FDPA 1BDAA 1XM1A 5EW2H 1CT4E 2VINA 5JBAS 1GVLA 3CNRA 1DS2E 3PRBA 1HAXB 2ZQ2A 1A61H 2STBE 3T2NA 3MU5A 1GJAB 1Z8GA 3FVFB 3HK6B 3U9AH 1HIAB 4I8JA 9LPRA 2GJGA 4IW4E 4K1TA 3STIA 1IQGA 1DX5M 1FY5A 2ZDMA 2BX4A 1FY3A 1HNEE 2BVRH 1GMDF 2ANMH 1QRZA 4K69A 1MABB 3M5OA 1AMHA 1V3XA 1WQSA 1BMMH 1DICA 2P8OB 4H6SB 1ELDE 4AYYB 2NU4E 2I6QA 2SGAA 3SJ9A 3TITA 4B2CA 1OWEA 2QY0B 1UK4A 1J17T 1HXFH 2BD7A 2OQUA 5DP5A 4INKA 1GI4A 2R9PA 5GXPA 3W95A 1Z6JH 4ABJA 1QCPA 3BIUH 5F53A 4AB8A 2VGCB 2ZFRH 4HTCH 5E0HA 3I77A 4ISNA 8LPRA 1GI2A 5C5NA 1FQ3A 4MLFB 2BYAX 2G4TA 2XBYA 3RXVA 4R8TB 2PHBA 3AW1A 3RXJA 1TX6A 1UHBB 4TPYA 3DA9B 2BZAA 1D3QB 2H6MA 3EA8A 5DP8A 1UVSH 5FX5A 2TPIZ 1BTWA 5H4IB 1TX7A 1GCDA 4XOJA 1E1QD 3RMNH 1GBCA 1A2CH 1TGCA 2D8WA 6GCHG 1Y8TA 2O8TA 4Y11E 4OM9A 2FS8A 3GCTF 3RLYH 4B2BA 3BF6H 4ACBA 2FIRH 3RXSA 1GJ9B 3QDZB 3RXUA 2BD5A 5DSFA 3UNRA 1AB9C 1M9UA 1V2QT 1AE5A 1Z1JA 5HKKD 2G5NA 1VCWA 2LP6A 4BAOB 3A85A 3PTBA 2VIPA 3ZVBA 1SL3A 4YOGA 4ABAA 1LMWB 2A32A 3LGIA 3A81A 2YMSC 3R3GB 3BSQA 1NBME 1UJ1A 2ANYA 4IC6A 2ZIQH 1SFIA 1A3BH 1O3LA 1OXGA 2XC5A 3M7QA 2GDDA 2XWAA 1GHYH 1HAZB 1O3KA 2XWBI 5G4BA 1MAYA 1VCPA 2ZGJA 3QWCH 1O2SA 4NG9H 4WXIA 4X6PA 3ODDA 3MMGA 1EASA 4Z0KA 7ESTE 3SU4A 2ZFPH 4ABGA 3KHVA 3DFJA 5HXFA 4JZEH 1ELTA 3MNBA 1LKAA 2QV1A 1EZXC 3LDXH 1GI1A 1NROH 1O2PA 5B6OA 3F0PA 3HK3B 3BTEE 5E0JA 5DPAA 1AZZA 2QE7D 5T6FA 2J4IA 2FYRA 1FN8A 1LHCH 1JIMA 3UY9A 2DE8A 1H9HE 1ZOMA 4ZHMU 1DLEA 1P2JA 5T1VA 4YLQH 1NRSH 3KQCA 2OC0A 3LC3A 6GCHF 2BDCA 3EA7A 1DLKB 1A5IA 4MTBA 1A4WH 1GI3A 3RXPA 3CP7A 1VCQA 1LPZB 5FCRA 1YF4A 4ISIH 4BAKB 2UUKB 5A0BA 3KYFA 1AIXH 1YP9A 3S7HB 3TJUA 1ZJKA 4FU8A 5FPTA 3E1XB 1O3FA 3Q3YA 7GCHG 2WPIS 2VWMA 3H09A 2WV9A 3Q00A 4LZ4B 2SGQE 4FUIA 1OWHA 1Z6EA 1EAWA 5GJ4B 4TY7A 1F0SA 3G01A 3FP8E 1FV9A 1AGJA 3T62A 4AG1A 1SOTA 4TWYA 3PO1C 4JYUH 3ZV8A 1B5GH 2ZCHP 1GL0E 1N6YA 2ZHFH 3FO8D 4GHQA 2ALVA 2WINI 1SGTA 3ZZ7A 5DGJA 1O31A 2SNVA 3M5NA 3QZQA 1EAUA 4OGYA 4B6EA 1OSSA 2PWXA 3OY6U 4A1XA 1KXDA 5T6DA 1GHBF 4E05H 2VWNA 4YOIA 1TBRH 1C5TA 1O2MA 3PV4A 1ZTLA 3B9FH 2OCVB 5BRRE 4TYDA 2OTVA 3P95A 1W12U 4JMYA 4UFDH 2J98B 3SYJA 3VB5A 1GBEA 2W3KA 2O8LA 1BBRK 2Z3DA 4ACAA 3OSYA 2V6NA 1P3CA 4K1SA 3UPEA 2PTNA 1SQRA 5J4QA 1GBDA 4BTTB 1NN6A 1TGBA 1XKBC 1EX3A 1AY6H 1Y3XA 1O33A 5A0AE 5EQRA 3GCHB 3KGPA 2IN2A 4AX9H 2P16A 1P06A 3M61U 1VZQH 4JYVH 1DWBH 2FOHA 1BJVA 1L4ZA 1AUTC 3TIUA 4FUBA 2BLWA 7GCHF 1J16A 2Y7ZA 3A86A 4GVUA 3TJVA 4NIXA 3LJOA 3UTUH 2XCNA 3RU4T 4WMEA 1H8IH 4FUDA 1TMBH 1QIXB 2FX6A 2PTCE 1ZRKA 2UUFB 2GZ9A 2QAAA 3F1SB 1H1BA 1MQ6A 2R2WU 1OX1A 2VJ1A 5FPYA 4GUXA 1C4Y2 4MPVA 2P8OC 3KYGA 1EATA 1PQ8A 2ZP0H 2GGVB 1D3DB 1A0JA 3F9HA 3S9BA 1O5DH 4GCHG 3F68H 4NSVA 2Z94A 1V2LT 2BD8A 2ZDKA 2ZEBA 2AMPA 3SI4H 5JYIA 4YM9A 3BV9B 2VH0A 1T8OA 3RXKA 1C1QA 1GL1A 2SGDE 3SUFA 2C8XB 2L74A 4AGJA 2FOFA 2VGCC 1S0RA 4O3UA 5HMAA 3LGVA 5FPSA 1FPCH 1FLEE 3ZV9A 3SUGA 4A5TS 1FONA 2CK3D 1SFQB 3GY8A 1W14U 2QF3A 1ESBA 2Y5HA 4FUCA 1KSNA 1HGTH 3U8TH 1GBHA 2ZGCA 1V2PT 3O8DA 2UWOA 1GBIA 3DUXH 1U6QA 3RP2A 3M37A 1DXWA 4K1EA 1C1UH 3E90B 2Z6BD 2ZU5A 3Q3XA 5A0CA 4BTUB 2QF0A 2XBXA 3BTME 3SU5A 3A7XA 1ZMLA 2D2DA 2J5UA 2HALA 4Q63A 1TOCB 3O8BA 3GCNA 3F3BA 2FOCA 3QTOH 1KDQA 1S6FA 3DFLA 1T8NA 2Z9KA 1GJ4H 1UTKA 4YXWD 3AVZA 2QC2A 3ESTA 4ZROA 1YPGH 4JK6A 1RXPA 4ZUHA 1XUHA 1QA7A 1LDTT 1C2MA 3N7OA 2J34A 2BMGB 4JZDH 1O2XA 1ZLRA 2OINA 1FN6A 5JBTA 1C2LA 2V35A 4B75A 2Z3CA 1B7XB 4KP0A 1QTFA 2YNBA 5C3NA 2R3YA 1KXEA 4NA9H 1ID5H 4O03A 4UDWH 4GLYA 4TT3D 2XNIA 1C5NH 1EB1H 1TIOA 2SFAA 2FXRA 3PM3A 1MTVA 1L1NA 2P94A 6CHAC 1SGFG 4IC5A 3SV2H 3F2GA 3MU4A 1GMCF 2BD4A 1G32B 4X8UH 1SG8B 1ZR0A 2GMTB 4NZLA 5EJLA 1GBMA 2ZZUH 3OX7U 1K22H 3SU2A 1WTHD 2R3UA 2WV5A 4ESTE 4LK4A 2J92A 1SKYE 1EPTB 1LHFH 1H9IE 1XX9A 4X6MA 3PROA 3ZVFA 3OFND 4ABFA 1D4PB 1GBBA 5C17A 1HLTH 2WZQA 2ALPA 3SOSA 2BDYA 4I32A 1HXEH 4M9FA 1DPOA 3RXRA 1GBLA 3SU6A 2P3FH 3UAIC 4CREA 1YPHE 2FP7B 1O3IA 5GWZA 1ANBA 1O37A 4J2YB 1ETTH 5TCAA 3M3VA 1C1SA 3CENA 6ESTA 3SUDA 4X1NU 2ILNA 1O5GH 1VITH 3A84A 4ZXYH 1C1TA 1D3PB 2A0QB 2HVXA 3M36A 2EY4C 3E91A 1C5MD 3FP6E 2F43B 3ZZ6A 1XXFA 2XXLA 3ZZ5A 4RSPA 1MKXK 1C2EA 4ZKOU 1ELBA 2ZC9H 3VB6A 1ELCA 4HGCA 5FXLA 2Q6FA 5CHBA 2XNDD 1PJPA 2GVFA 3QGJA 2BDHA 4KKDA 1WUNH 5CMXH 2BY9X 5ETXA 2EC9H 2XCFA 3SHAH 2H9TH 3VFEA 1C2IA 2RCEA 1IQNA 4BTIB 1MCVA 1HB0B 2QXJA 3A87A 3AW0A 1MKWH 2GZ7A 1ABIH 1DDJA 1GI9B 4ABHA 2C3SA 4CRGA 3RMMH 2W26A 1HAVA 1UVUH 4H4FA 4JK5A 5C0TA 3MNCA 2VNTA 4E7NA 1G9IE 4HI3A 5EQQA 2JJ1D 3QTVH 2O8WA 1NY22 3TVJB 1IQJA 2GV6A 4ZXXH 2ASUB 1GHXH 1D6RA 1L4DA 4CRBA 1O39A 1ZMNA 3S69A 4UFEH 1DVAH 5FBEA 1C2JA 2FYQA 4B1TA 2BOKA 3E0PB 2Z3EA 4KELA 1ZMJA 4X1QU 3U8OH 3GY5A 3MH5A 1HDTH 4U2WA 1O3JA 1O2OA 3GCHC 2AHME 4CBOA 2GCHG 3A7VA 1MTSA 3RXMA 1LQDB 3P17H 4Q80A 5EODA 5GDSH 1ZPZA 1GWAA 2ZHDA 3F9GA 3U1IB 1PPBH 1TGTA 1L1GA 1FUJA 1TNHA 3OE7D 5JBCS 2H1UA 3IITA 4B2AA 4Y8ZA 4ABIA 1G37A 2PUQH 1JWTA 4WJG2 1OWJA 5CE1A 2G81E 5C67A 3UB0A 1BTYA 4FUFA 3RC4A 1GI0A 1D3TB 3E6PH 4OS2A 2ZCKP 2GTBA 1AFEH 2QIQA 1ETSH 2KFWA 1K1IA 2RA0A 1BHXF 1JRSA 1O2ZA 1TMUH 2VVVA 1C1VH 2ZKSA 4YESB 3ZZCA 4XBDA 2FLRH 2PKAB 1TPPA 1WU1A 3EYDA 4MVNA 2XC0A 3ATKA 3KQ5A 2NWNA 1PPEE 2BOHB 1KLTA 2UWPA 1KLJH 2ZU1A 5DP7A 4X6OA 2F9OA 1O2IA 2ODYB 5I46H 3ATWA 1DFPA 1UCYK 2QXGA 5AVDA 3QLPH 1V2MT 2O8MA 4INLA 3V12A 1QL9A 2ODPA 4ISLA 1K1MA 2FODA 3RMLH 2Z7FE 1WAYB 2G51A 1VITF 4K60A 1UK2A 3KQEA 2LELA 5L6NH 1C5WB 1K21H 2ZHQH 4K5ZA 2FO9A 1ZYOA 1S84A 1EZQA 1SMFE 3KNXA 3M35A 4Z6AH 1AFQB 2TGDA 3ZZ8A 4KTUA 4CRFA 3LH3A 1QZ8A 1EOLA 1YGCH 1DY8A 1JRTA 3GCOA 1VGCB 1G2MA 1LVOA 1ELGA 3TGKE 1C2FA 5EXMA 4D76A 2TRMA 2GCHF 2J94A 1O2HA 1RTKA 2Q1JA 1P2OA 3PLBA 1V2VT 3TK9A 3PWBA 1WYKA 1V2KT 1GBAA 1UVPA 1LHGH 5C1XA 3KQDA 1TALA 4D7GA 1YYY1 1WV7H 1HAGE 1EB2A 1RTLA 3FAOA 1EFRD 4Q7XA 2F9UA 3SGQE 1MCTA 1OWDA 3V7TA 1BHXB 1COWD 3ITIA 3BIVH 1IQIA 3RDZA 2OK5A 4AC9A 2BHGA 4JZ1A 2A5AA 2PKSB 2R0LA 1EQ9A 1ESTA 4AB9A 2P93A 1EKBB 3PMAB 2BDIA 2OC1A 4ZKSU 2W6JD 1TNIA 1GDQA 1GJ8B 2KCPA 3LC5A 1T8MA 2HPPH 5C1YA 3SNDA 1BA8B 2ESTE 1V2OT 4E06H 2JH5D 2FWWA 1YPKH 1F0RA 1Z1IA 4Z1MD 1Y5BT 1AUJA 1QB6A 5CHAB 3QO6A 1TE0A 3BTQE 3DSPA 3MU1A 2AIQA 2ZDNA 2GMTC 1MAXA 5JB8S 5FCKA 1C1NA 2BDAA 4YZUA 4ZH8A 1FX0B 1PPFE 2V7QD 2VBCA 2C8WB 1JOUB 2HLDD 1K28D 1LHDH 1S6HA 5DP3A 3SJOA 1V2TT 3MOCA 1GDNA 4FU7A 1BMAA 2OQ5A 1EPTC 1XUGA 1G3CA 1NS3A 2DE9A 2F91A 5A8YA 1P02A 2XC4A 1V2ST 4NFFA 3QZRA 1T31A 1QL7A 2QF5A 4NZQA 3F0OA 3AASA 5AFZH 4R0IA 1L1JA 4O97A 3W94A 1PYTC 1TBQH 1OP0A 3KN2A 4FVBA 3MU0A 2P59A 4CRCA 1V2RT 4X1SU 3RC5A 2A5KA 1YLDA 1NRPH 3ATIA 2TGPZ 1F5KU 2ZFQH 3SGAE 3A8AA 1YPHC 1C1WH 1ARBA 1ZRBA 1KTSB 3BTFE 4K8BA 4H6TA 2K0QA 2GD4B 3NZIA 5DN6D 1SGYE 1A0HB 4F55A 2YOLA 1W3CA 4FUGA 1G36A 2BY6X 1C5RA 5AHGH 2F9NA 2G55A 3RXCA 1KXCA 1NT1A 5DJ7A 1CU1A 4JYTA 4CHAB 2F9BH 1TPSA 6CHAB 1A3EH 2WPJS 2H9EH 3LOXA 3T29A 1HAOH 4AG2A 2BVXH 3SNBA 1CHGA 5EIYA 1O2WA 4YTAA 2AS9A 5DP9A 1G3BA 4AOQA 5A8ZA 5ABWA 1O3OA 4K8YA 1EJMA 2RDEA 2A7HA 2VVUA 3PMHB 1GHWH 4TY6A 4DGJA 2ZA5A 3OAAD 3ZZ3A 3SV8A 4Y0YE 1AE8H 2VIOA 4FUHA 4A1TA 3A7ZA 1KXBA 4OS4A 1Z71A 3D23A 1AHTH 1TNKA 2FOGA 4MNWA 4WXVA 4NSYA 2IPQX 2FTLE 4FUJA 2CF8H 2AIPA 2GT7A 1O5AB 1O2LA 5FL7D 3MNXA 1PYTD 4F49A 3FANA 3UR6A 1P3EA 3LGWA 1F7ZA 2AFQB 2QGRA 3QX5H 2BZ6H 1C1RA 4IN1A 1BTXA 2EI8A 2HNTF 4KTSA 1O3CA 4D9RA 1QBNA 3M5MA 1CE5A 1BBRH 4RI0A 3RXOA 1V2NT 2W3IA 2J9NA 1V2UT 3NCLA 3PLPA 5FBIA 3RLWH 3V13A 4MNYA 1BITA 3OYPA 2GX4A 5HGGA 3A7TA 1AVXA 3GYLB 5C94A 2GCTB 5L2ZH 5FHTA 2AGIX 1ANEA 2B5TB 3D62A 1YPJH 4ABEA 2KZ4A 1C5ZB 1O3PB 5EGMA 1ZSJA 4Q4LA 4B6FA 1OPHB 1MD8A 4B76A 5LH8A 3SQHE 2A7JA 3ATLA 4YOJA 5B6LA 1HAIH 3UQOA 1EP6A 1MTWA 2OBOA 2NU2E 1C5PA 2A4RA 4NFEA 1BRAA 1P9UA 1VKYA 1S85A 1P57B 2HWLB 1XXDA 1GJ6A 4FXGH 2ZPQA 5K7RA 1SQOA 1O32A 3EA9A 1EAXA 2GDEH 1P09A 4SGBE 1FPHH 2KAIB 5FX6A 1ETRH 1FXYA 3NKKA 2HNTE 4IN2A 2FMJA 3DCLA 3NPSA 4XE4A 5PTPA 2BTCE 1AFQC 5DO4H 1WXRA 1SLVB 3A8CA 1G30B 1BMNH 2TBSA 4B71A 1GJBB 4LXBH 4WWYA 1VGCC 2H5DA 1ANCA 5F8TA 1Q3XA 9ESTA 1J9CH 1MBMA 3GY2A 1O2TA 1LTOA 4I31A 4AFSA 3RMOH 1K2I1 4CR9A 1ZZZA 3BTWE 4I8KA 1SGIB 1OHHD 4AORA 1SI5H 1N6XA 1GPZA 1JIRA 3UOUA 2NU1E 1ELFA 2UUYA 1OYQA 2W6ID 2D26C 5TJXA 3D49H 3SHCH 3HPTB 2PW8H 2R0KA 3GY7A 3ZVGA 1A5HA 2PR3A 3EDXB 1GJCB 4E7RG 2KM0A 4NA7A 2PKSC 4WMFA 1MTUA 3GOVB 2ZU4A 4OS1A 4FVDA 5ESBA 4XBBA 5E0GA 2VIQA 3I29A 1S83A 5LGOA 1DE7H 4ZCNA 3RC6A 4QT8C 2JETB 1BZXE 3TJNA 2J38A 1JMOH 4Q2KA 1SPJA 4RKJB 2STAE 1C5LH 2F83A 1K9OE 3VEQB 5JB9S 1QQUA 5CHAC 3LH1A 3TK6A 3UIRA 4X1RU 1F0TA 4YT6H 3SBKA 3P8NA 2BY5X 5EJZA 1NTPA 1C2HA 2WPLS 1ZJDA 3RUOA 1DOJA 1DANH 3JZ1B 1Z8JB 3HKIB 4VGCB 4MQAA 1W0KD 1BQYA 2WPDD 1H8DH 3DSOA 3K6YA 5FAHA 2ZPRA 1ELVA 1GMHG 2BLOA 2V0BA 5JBBS 1QRWA 3N7EA 4AGKA 4XSKU 1C4V2 1K1JA 4WMDA 4NA8A 1N8OB 2Z9GA 2Y5FA 2ZF0H 3SJIA 4FOUC 1H4WA 2A7CA 5IDKA 2VH6A 4D7FA 1INCA 1UTMA 3PTNA 1FJSA 4BAMB 2EEKA 3GISB 4X8VH 1GJ5H 4RT1A 5LPEA 5JDUB 1AVGH 2Z9JA 1SVPA 3SZNA 3MHWU 5IYTA 7KMEH 2XTTB 4DT7B 2PLXA 3SJ8A 1TRYA 2C4FH 4GCHF 2PV9B 2J97A 3BTKE 2ZFFH 4A1VA 3CS0A 1BBRE 3S9AA 3LONA 3LT3A 3C1KA 1W7GH 1RTFB 3LGTA 1O3DA 4I7YH 1IQLA 4CHAC 1C5QA 2SGFE 4WY3A 5F03A 2F4LA 1B0EA 1YCPK 3TK5A 2QYIA 1ZHRA 4ISHH 1FIZA 1SBWA 1MUEB 5AF9H 1ELEE 1F5LA 3TU7H 2CF9H 1SR5C 5DP6A 1CHOG 1YKTA 3U69H 1Q2WA 1CGIE 1V2JT 1HAPH 3ENSB 5LPFA 2SNWA 5DG6A 1Y59T 1XVMA 4Y7BA 3HKJB 1PPCE 3AAUA 3KIDU 5GIBA 2FOBA 1AU8A 2BD9A 1BJUA 2ZHWH 5AFYH 1SGQE 3JZ2B 2LPRA 3ZZBA 2PFEA 2PSXA 5F8ZA 4WH6A 3UWJH 5EXLA 3BN9A 4A92A 3RXAA 3GS9A 4LZ1H 3E16B 3M5LA 2D1JA 1PQAA 4FUEA 2OXSA 1TRNA 8KME2 1BIOA 1QHRB 3VG8A 3O8CA 2EI7A 2GV7A 3FFGA 2ZG0H 2M5TA 1B0FA 2THFB 2C93B 1QJ1B 1WCZA 2J2UA 1YWUA 2GCTC 3QUMP 3TH4H 1CA8B 1FY1A 1FMGA 1P2MA 2XW9A 1EAIA 3IG6B 2A45B 2VIWA 4Y79A 3RXIA 3SNAA 4OS5A 1XKAC 2WV4A 5HYOA 2O8UA 1DITH 3OTPA 1Y3VA 4ZKNU 1LCYA 1MD7A 1O3AA 2BXUH 2G52A 1YCPM 3T27A 2VU8E 3U1JB 2HVYB 1O5CB 2ZGBH 1CA0B 1W13U 2RA3A 1G3DA 1GJDB 1NM6A 1SLWB 1AQ7A 1OP2A 3GY6A 2PUXB 1C9PA 3A7WA 3PV2A 1GBKA 1HAYB 5LPRA 1RD3B 2XYAA 2J98A 5K0HA 1TX8A 2I6SA 3GYMA 4NWLA 1O35A 1BMFD 3VB7A 1FZZA 5EG4A 3P8OA 1CHOF 1QL8A 3OEHD 1UW7A 3ZVDA 3PYHA 1GHZA 3GDSA 5T3HA 4FU9A 3OEED 1GI8B 4XDEA 1LPGB 2FLBH 2AGGX 2VIDA 1HV7A 2HRVA 1IQMA 2BQWB 5E2OA 3UNQA 1UTNA 1TBZH 1BRBE 3RXLA 4Y71A 1CQQA 3RM0H 1E0FD 1LVYA 2HNTC 2R2MB 5J4SA 1X7AC 2FZZA 1L2EA 1ZTJA 1UTLM 1GGDB 3PB1E 5EXNA 1HFDA 4DOQA 1O3HA 3URCA 4DCDA 1YC0A 4DY7B 1TA6A 4SGAE 2DUCA 2Q6GA 3RXDA 2ZPSA 1P03A 1TNLA 1UVTH 5F8XA 2Z9IA 1FI8A 1SOZA 1XMNB 1IAUA 1HBTH 5JPMH 1IOEA 1NZQH 1GBFA 1TMTH 2ZU3A 3VGCB 3S9CA 1A1RA 1MKWK 1CO7E 4UE7H 4UFGH 4DVAU 3STJA 1ZSLA 3LJJA 1G2LA 2JETC 1RIWB 5F6MA 4I8HA 2P95A 3NK8A 1GMDG 4NGAH 3SN8A 3DD2H 2PSYA 1E35B 5ESTE 1HAHH 3E3TA 3ZVEA 2RDLA 3PV5A 1QJ7B 1PFXC 1FAKH 4X6NA 1ZPBA 1P11E 4KTCA 2BY8X 4XBCA 4AN7A 2F9VA 1O34A 4ABBA 3CS7A 2CV3A 2OUAA 1XVOA 1E38B 1PQ7A 4OGXA 1GI6A 4VGCC 1TQ0B 1FIWA 2A4GA 1BMLA 1GHVH 1IHSH 4X0WU 3URDA 3ODFA 3FP7E 1RRKA 2ZTYA 3TPIZ 1H8ED 3Q76A 2SGEE 2G4UA 3VB4A 3ZYEA 4UFFH 1ZHPA 2W5EA 1QURH 1WTGH 2ZFTA 4DIHH 1O36A 3MWIU 1UVOA 1N8OC 3TGJE 1AWFH 3H7OA 1FY4A 4GAWA 3SORA 2H5CA 1C1PA 1OYTH 4IGDA 5C5OA 4JZIA 1Z7KA 2FM2A 1NC6A 2FOEA 2BX3A 1E36B 2FESH 1RJXB 2RFKC 1O2NA 1EJAA 1WBGB 1S5SA 4KGAA 1GBTA 2P3TB 2ZI2H 1QBVH 1P2NA 2ZGHA 2V3HH 2L6OA 3PMJA 1C5OH 3GCTG 1WDIA 1TGSZ 1P2QA 1OKXA 3BTGE 1WSSH 3P92A 4F4OC 3F2HA 4Y10E 1QBOA 2VB0A 2ANKH 3PRDA 2WPKS 3SO3A 3UNSA 4H42U 2AEIH 2NU3E 1GI7B 2C90B 3MH6A 1DSTA 1GCTB 1P0SH 1HPGA 2JIZD 3EE7A 1RGQA 1CT2E 1QY6A 4TPIZ 1KYNA 1TQ7B 1LPKB 3LU9B 3LIWA 3I78A 3A8BA 2OD3B 4O9VA 1WQVH 2VVCA 1SB1H 1VR1H 2CHAB 1ABJH 5GPIB 4U32A 4X8TH 1PPZA 2VIVA 4Y8XA 3K9XB 1V6DA 3E0NB 1TABE 3MH7A 2A4OA 1EPTA 3ZYDA 3EQ0H 4RT0A 1TNJA 3UQVA 1O3GA 2BVSH 1GI5A 1SGCA 2WYGA 2G8TA 1DUAA 3DSGA 1GHAG 2WPHS 1YPEH 3NRLA 4OS7A 1O2RA 1NFUA 3MYWA 3T5FH 3ZVCA 5EW1H 1SHYA 1VJAU 1TWXB 5BPEA 1P12E 3ZZ9A 1CGJE 3NXPA 2KCAA 1J14A 1LHEH 2NU0E 1MTNB 1SGPE 1QRXA 3RXTA 1E34B 1SQTA 4CR5A 2ZHEH 1TOMH 1KMHB 5HIZA 5A8XA 3IWMA 3SNEA 3TGIE 4BOHA 1UCYE 3BTTE 2VWLA 8GCHG 4B73A 1O2UA 1MMJN 3E8LA 3TNTA 4WH8A 4IMZA 3RXEA 1P01A 3ATMA 1NFWA 1SQAA 3SU1A 1ANDA 4ASUD 4TSFD 2QF4A 2ZWLH 1KDQB 3AAVA 4WF8A 2FDAA 1TAWA 2FPZA 3A83A 3MH4A 2ZTXA 3A7YA 1C1MA 3HGPA 2B0FA 1QR3E 3TH3H 4A7IB 1RS0A 3SV7A 1MBQA 4K2YA 1UTJA 4M7GA 3GY3A 1OS8A 1YM0A 1BTHH 1UO6A 4CBNA 7LPRA 1LQEA 1TRMA 1OWIA 3TJOA 1CVWH 1AKSA 3M7UA 1UK3A 3OTJE 1EZSC 5C2ZA 1F2SE 1CA0C 3P70B 5EQSA 2TGAA 2KR7A 4ZHLU 1Y3UA 5KEDA 1GBJA 4DIIH 4AYVB 3SUEA 2Y6TA 2KX4A 1S0QA 1EXFA 3O8RA 2M2AA 1SGRE 3L3TA 1DWCH 1SC8U 4NIVA 1N1LA 4B74A 1BOQA 1BTZA 1ZGIA 1K1LA 1GHAF 2PP6A 1DSUA 1KLIH 2OBQA 2A5IA 1GHBG 2QA9E 1UTPA 1TFXA 4CH8B 1CT0E 1T32A 5E8EH 3WWFA 1W11U 4ZAEA 2AYWA 1Z8IB 3S0NA 2Y5GA 3BG4B 4Y6DA 3SU3A 3VB3A 2KCYA 1KY9A 3MO9A 2CXVA 1YLCA 2HGTH 4ZHAA 8GCHF 3MI4A 3ZVAA 2BLVA 3QGNB 1BTUA 4D9QA 1AVWA 1GGDC 1BB0B 5EPNA 2QXHA 2CJIA 2K1QA 2V3MA 2BY7X 4I33A 2ZU2A 1DUEA 1O3EA 3SV9A 3L6PA 2A2XH 3SNCA 1TPAE 1EP5A 3BEFB 1JBUH 3SU0A 1MU8B 2XRCA 3SGBE 1DY9A 3M7TA 3WW7A 5HIYA 2PKAA 1V2WT 2GT8A 2P3UB 1ELAA 1DXPA 2JDID 3MNSA 1P05A 1SGFA 2IPHA 3BG8A 3SV6A 3VGCC 2GKVE 3HGNA 5IK2D 2Y80A 4O3TA 4BAQB 2H2ZA 2Y81A 3A8DA 2YMSD 5I25A 1A46H 1GG6C 2JH0D 2PGQB 1OP8A 1LO6A 1Q31A 1RIWC 3F9EA 3KEEA 2TGTA 1T4VH 4LOYH 5CDFE 3LGYA 5E2PA 3Q77A 2XBVA 4INHA 1BT7A 2WPMS 2PGBB 2UUJB 3RU4D 1BRCE 2JKHA 1A5GH 1EOJA 1K1NA 3VPKA 1GDUA 1IQHA 1NFXA 1AN1E 1O2GH 2A31A 2WUCA 3UR9A 1XUJA 5C1UA 1LVBA 4D8NA 1TA2A 4DURA 4IBLH 4X2XA 2W7SA 1BUIA 2BXTH 4A6LA 1KXAA 1O0DH 3KQBA 3SW2B 2QN5T 4FETA 1HAVB 1WOFA 3ZZDA 2FI5E 1ORFA 4Q7ZA 2H9HA 5DK1A 2IJD1 4WVPE 1AZ8A 1C5VA 4MPWA 2JJ2D 2BQ7B 1E37B 3S7KB 2ODQA 1P9SA 4NIYA 3LGUA 4U01A 2XOKD 1FNIA 1HIAA 1Y5UT 1E1RD 2JH6D 1T4UH 3K6ZA 1CBWB 3KL6A 3P8FA 1EUFA 3PWCA 3R0FA 2W7UA 4ZMAH 1UTQA 2FOAA 3NUMA 3MFJA 4AFZA 1O30A 1EJNA 1YPLH 2FI3E 4I8GA 4ISOA 2FTMA 1K0HA 2XBWA 1ARCA 2A1DB 2HPQH 4BXWA 3UREA 2ZGXH 3PLKA 1YPMH 3L33A 3DHKH 2EA3A 3A80A
chains in the Genus database with same CATH topology
1THPB 4X2VA 3GDUA 1GCTC 3EE0B 4MNXA 4GPGA 4K3JA 2YNAA 1T8LA 5L2YH 1W0ZU 1MU6B 3T25A 2CHAC 1ESAA 1A0LA 1UHBA 1W0YH 3P6ZB 1T7CA 3GICB 3RXHA 1MQ5A 2VWOA 1O5FH 3MO6A 1TLDA 4Y0ZE 4ASHA 3K65B 1JXPA 2F9PA 4BNRA 1TYNA 1YCPH 4RKOB 1GMCG 5EPYA 4HZHA 1CGHA 4I8LA 2Y7XA 4UEHH 2BD3A 1MTNC 4NIWA 5SGAE 1L0ZA 2Q6DA 1NRRH 4ABDA 1MZDA 1S82A 3BTDE 3K2UA 1NESE 1Y5AT 1TPOA 1O2VA 2QXIA 4DW2U 1HJAB 1K1PA 2UWLA 1QA0A 2GZ8A 3A89A 1ZTKA 4MNVA 1BRUP 1VJ9U 1QJ6B 1BCUH 1SGDE 3V3MA 2AGEX 1LKBA 2A2QH 4GHTA 1IQEA 3RXQA 4BXSA 2BB4A 6LPRA 1QFKH 1YBWA 1SSXA 4GSOA 3RM2H 4Y76A 1O3MA 1F92A 5HM9A 1QQ4A 1C2KA 1O3BA 5C20A 3T26A 1FY8E 5L30H 1IQFA 5GCHG 2CMYA 3BEIB 1MKXH 2FI4E 3H5CB 4OS6A 1NRQH 2ZECA 3BTHE 2F3CE 3V0XA 1DWDH 1O2YA 1THRH 1SLXB 4JCNA 3LPRA 1O5EH 3ELAH 4YLUA 1UMAH 3PMBB 1GMHF 2ZCLP 1IHTH 2AMDA 4NCYA 3EGKH 1TB6H 1K1OA 2C8ZB 2G5VA 3GY4A 4HFPB 1ACBE 5TCCA 2OP9A 2FX4A 1OOKB 8ESTE 5EOKA 2CN0H 3B23B 3BG4C 1G3EA 1MZAA 1KIGH 3VXFH 1Z8RA 5DP4A 2V3OH 1HJ8A 2AERH 2ZO3H 3MU8A 4CH2B 1PPHE 1GJ7B 3P8GA 2GP9B 4X2WA 1C2DA 1XUKA 1HCGA 2HLCA 3ZZ4A 1O2QA 3QN7A 2Z9LA 4THNH 3C27B 1HJ9A 1QB9A 4DJZB 2BDBA 3RXGA 1H9LB 3M3TA 1IQKA 4RN6A 1NU7B 5DKMA 2AH4X 4IS5A 2ZDVH 2QCYA 2FOMB 1EZUC 1AB9B 1W10U 2OC8A 2CGAA 4Q7YA 1O2JA 1SHHB 1C5UA 1Y3YA 1ZPCA 3A82A 3B8JA 1QNJA 5A2MH 3RU4E 1HYLA 1DM4B 3OU0A 3OY5U 4PROA 1THSH 1RFNA 4MPXA 5GCHF 4AZ2B 4Y7AA 4U30A 1O2KA 5T6GA 1J15A 2B7DH 3ZZAA 2ZDLA 2EI6A 1C1OA 1KTTB 4UD9H 2KAIA 1P10A 4AFUA 2BLQA 1NRNH 2C8YB 3M3SA 2B8OH 3A88A 3BEUA 3D65E 2B9LA 4X8SH 2FS9A 3F6UH 2LNCA 1ZHMA 3QK1A 1AKSB 1C5SA 3U8RH 1O3NA 1UCYH 2Y82A 1C4U2 4JZFH 1HUTH 1FAXA 3KCGH 2ZTZA 2BDGA 1CSOE 1SGEE 4J1YA 4X1PU 1NPMA 4XFQA 1MH0A 1AO5A 2RG3A 1NU9A 1VITG 3MO3A 3UFAA 3U98H 4CRDA 1LVMA 3HATH 1QGFA 4TWWA 3VXEH 1HRTH 4UONA 1QB1A 1C9TA 1BTPA 2IOTA 1CBWC 2ZDAH 4YT7H 1ZSKA 3MTYA 1J8AA 2FEQH 1A7SA 1C5XB 1TNGA 1O38A 1NFYA 4BAHB 1P8VC 1TONA 2IJOB 2J95A 1TGNA 3UUZA 4CRAA 1O5BB 1AD8H 3RXFA 4MPUA 1DT2A 4X2YA 1W2KH 1XUFA 1GG6B 3WY8A 2BD2A 2O9QA 1GVKB 3PO1B 4NWKA 4YO9A 3TLOA 3GDVA 1GVZA 3RXBA 1W7XH 2TIOA 2ZFSA 1W8BH 2G00A 2ANWA 1ZGVA 3SQEE 4DG4A 2BQ6B 3F9FA 1UTOA 1PQ5A 2WYJA 4IMQA 1S81A 1SGNE 1C5YB 3UWIA 1DWEH 1PPGE 1AI8H 2WUBA 2BM2A 1P2IA 2OC7A 1Y3WA 1P2KA 3H7TA 4ZKRU 1F0UA 1SLUB 1D9IA 5HM2A 3SJKA 4AFQA 3EAJA 1F5RA 3KF2A 1KXFA 3TNSA 4MG3A 3TH2H 2ZQ1A 5EU8A 3LKWA 3SI3H 2OLGA 2A4QA 4Y8YA 3T28A 1OWKA 2HOBA 1C2GA 1AWHB 3Q3KA 4MDSA 2SGPE 3FZZA 1D6WA 3NWUA 1XUIA 1P04A 2AMQA 2ULLA 3FZDA 2ZNKH 3UOPA 4BANB 3DT0H 5A09A 1NO9H 1HJAC 1FDPA 1BDAA 1XM1A 5EW2H 1CT4E 2VINA 5JBAS 1GVLA 1DS2E 1HAXB 2ZQ2A 1A61H 2STBE 3T2NA 3MU5A 1GJAB 1Z8GA 3FVFB 3HK6B 3U9AH 1HIAB 4I8JA 9LPRA 4IW4E 4K1TA 3STIA 1IQGA 1DX5M 1FY5A 2ZDMA 2BX4A 1FY3A 1HNEE 2BVRH 1GMDF 2ANMH 1QRZA 4K69A 3M5OA 1AMHA 1V3XA 1WQSA 1BMMH 1DICA 2P8OB 4H6SB 1ELDE 4AYYB 2NU4E 2I6QA 2SGAA 3SJ9A 3TITA 4B2CA 1OWEA 2QY0B 1UK4A 1J17T 1HXFH 2BD7A 2OQUA 5DP5A 4INKA 1GI4A 2R9PA 5GXPA 3W95A 1Z6JH 4ABJA 1QCPA 3BIUH 4AB8A 2VGCB 2ZFRH 4HTCH 5E0HA 3I77A 4ISNA 8LPRA 1GI2A 5C5NA 1FQ3A 4MLFB 2BYAX 2G4TA 2XBYA 3RXVA 4R8TB 2PHBA 3AW1A 3RXJA 1TX6A 1UHBB 4TPYA 3DA9B 2BZAA 1D3QB 2H6MA 3EA8A 5DP8A 1UVSH 5FX5A 2TPIZ 1BTWA 5H4IB 1TX7A 1GCDA 4XOJA 3RMNH 1GBCA 1A2CH 1TGCA 2D8WA 6GCHG 1Y8TA 2O8TA 4Y11E 2FS8A 3GCTF 3RLYH 4B2BA 3BF6H 2FIRH 3RXSA 1GJ9B 3QDZB 3RXUA 2BD5A 3UNRA 1AB9C 1M9UA 1V2QT 1AE5A 1Z1JA 2G5NA 1VCWA 4BAOB 3A85A 3PTBA 2VIPA 3ZVBA 1SL3A 4YOGA 4ABAA 1LMWB 2A32A 3LGIA 3A81A 3R3GB 3BSQA 1UJ1A 2ANYA 4IC6A 2ZIQH 1SFIA 1A3BH 1O3LA 1OXGA 2XC5A 3M7QA 2GDDA 2XWAA 1GHYH 1HAZB 1O3KA 2XWBI 5G4BA 1MAYA 1VCPA 2ZGJA 3QWCH 1O2SA 4NG9H 4WXIA 4X6PA 3ODDA 3MMGA 1EASA 4Z0KA 7ESTE 3SU4A 2ZFPH 4ABGA 3KHVA 3DFJA 5HXFA 4JZEH 1ELTA 3MNBA 1LKAA 2QV1A 1EZXC 3LDXH 1GI1A 1NROH 1O2PA 5B6OA 3HK3B 3BTEE 5E0JA 5DPAA 1AZZA 5T6FA 2J4IA 2FYRA 1FN8A 1LHCH 1JIMA 3UY9A 2DE8A 1H9HE 1ZOMA 4ZHMU 1DLEA 1P2JA 4YLQH 1NRSH 3KQCA 2OC0A 3LC3A 6GCHF 2BDCA 3EA7A 1DLKB 1A5IA 4MTBA 1A4WH 1GI3A 3RXPA 3CP7A 1VCQA 1LPZB 5FCRA 1YF4A 4ISIH 4BAKB 2UUKB 5A0BA 1AIXH 1YP9A 3S7HB 3TJUA 1ZJKA 4FU8A 5FPTA 3E1XB 1O3FA 3Q3YA 7GCHG 2WPIS 2VWMA 3Q00A 4LZ4B 2SGQE 4FUIA 1OWHA 1Z6EA 1EAWA 5GJ4B 4TY7A 1F0SA 3G01A 3FP8E 1FV9A 1AGJA 3T62A 4AG1A 1SOTA 4TWYA 3PO1C 4JYUH 3ZV8A 1B5GH 2ZCHP 1GL0E 1N6YA 2ZHFH 4GHQA 2ALVA 2WINI 1SGTA 3ZZ7A 5DGJA 1O31A 2SNVA 3M5NA 3QZQA 1EAUA 4OGYA 1OSSA 2PWXA 3OY6U 4A1XA 1KXDA 5T6DA 1GHBF 4E05H 2VWNA 4YOIA 1TBRH 1C5TA 1O2MA 3PV4A 1ZTLA 3B9FH 2OCVB 5BRRE 4TYDA 2OTVA 3P95A 1W12U 4JMYA 4UFDH 3VB5A 1GBEA 2W3KA 2O8LA 1BBRK 2Z3DA 3OSYA 2V6NA 1P3CA 4K1SA 3UPEA 2PTNA 5J4QA 1GBDA 4BTTB 1NN6A 1TGBA 1XKBC 1EX3A 1AY6H 1Y3XA 1O33A 5A0AE 5EQRA 3GCHB 3KGPA 2IN2A 4AX9H 2P16A 1P06A 3M61U 1VZQH 4JYVH 1DWBH 2FOHA 1BJVA 1L4ZA 1AUTC 3TIUA 4FUBA 2BLWA 7GCHF 1J16A 2Y7ZA 3A86A 4GVUA 3TJVA 4NIXA 3LJOA 3UTUH 2XCNA 3RU4T 4WMEA 1H8IH 4FUDA 1TMBH 1QIXB 2FX6A 2PTCE 1ZRKA 2UUFB 2GZ9A 2QAAA 3F1SB 1H1BA 1MQ6A 2R2WU 1OX1A 2VJ1A 5FPYA 4GUXA 1C4Y2 4MPVA 2P8OC 1EATA 1PQ8A 2ZP0H 2GGVB 1D3DB 1A0JA 3F9HA 3S9BA 1O5DH 4GCHG 3F68H 4NSVA 2Z94A 1V2LT 2BD8A 2ZDKA 2ZEBA 2AMPA 3SI4H 5JYIA 4YM9A 3BV9B 2VH0A 1T8OA 3RXKA 1C1QA 1GL1A 2SGDE 3SUFA 2C8XB 4AGJA 2FOFA 2VGCC 1S0RA 4O3UA 5HMAA 3LGVA 5FPSA 1FPCH 1FLEE 3ZV9A 3SUGA 4A5TS 1FONA 1SFQB 3GY8A 1W14U 2QF3A 1ESBA 2Y5HA 4FUCA 1KSNA 1HGTH 3U8TH 1GBHA 2ZGCA 1V2PT 3O8DA 2UWOA 1GBIA 3DUXH 1U6QA 3RP2A 3M37A 1DXWA 4K1EA 1C1UH 3E90B 2Z6BD 2ZU5A 3Q3XA 5A0CA 4BTUB 2QF0A 2XBXA 3BTME 3SU5A 3A7XA 1ZMLA 2D2DA 2HALA 1TOCB 3O8BA 3GCNA 2FOCA 3QTOH 1KDQA 1S6FA 3DFLA 1T8NA 2Z9KA 1GJ4H 1UTKA 3AVZA 2QC2A 3ESTA 4ZROA 1YPGH 4JK6A 1RXPA 4ZUHA 1XUHA 1QA7A 1LDTT 1C2MA 3N7OA 2J34A 2BMGB 4JZDH 1O2XA 1ZLRA 2OINA 1FN6A 5JBTA 1C2LA 2V35A 4B75A 2Z3CA 1B7XB 4KP0A 1QTFA 2YNBA 5C3NA 2R3YA 1KXEA 4NA9H 1ID5H 4O03A 4UDWH 4GLYA 2XNIA 1C5NH 1EB1H 1TIOA 2SFAA 2FXRA 3PM3A 1MTVA 1L1NA 2P94A 6CHAC 1SGFG 4IC5A 3SV2H 3MU4A 1GMCF 2BD4A 1G32B 4X8UH 1SG8B 1ZR0A 2GMTB 4NZLA 1GBMA 2ZZUH 3OX7U 1K22H 3SU2A 1WTHD 2R3UA 2WV5A 4ESTE 4LK4A 2J92A 1EPTB 1LHFH 1H9IE 1XX9A 4X6MA 3PROA 3ZVFA 4ABFA 1D4PB 1GBBA 1HLTH 2ALPA 3SOSA 2BDYA 4I32A 1HXEH 1DPOA 3RXRA 1GBLA 3SU6A 2P3FH 4CREA 1YPHE 2FP7B 1O3IA 5GWZA 1ANBA 1O37A 4J2YB 1ETTH 5TCAA 3M3VA 1C1SA 3CENA 6ESTA 3SUDA 4X1NU 2ILNA 1O5GH 1VITH 3A84A 4ZXYH 1C1TA 1D3PB 2A0QB 2HVXA 3M36A 3E91A 1C5MD 3FP6E 3ZZ6A 1XXFA 2XXLA 3ZZ5A 4RSPA 1MKXK 1C2EA 4ZKOU 1ELBA 2ZC9H 3VB6A 1ELCA 4HGCA 5FXLA 2Q6FA 3QGJA 1PJPA 2GVFA 2BDHA 4KKDA 1WUNH 5CMXH 2BY9X 5ETXA 2EC9H 2XCFA 3SHAH 2H9TH 3VFEA 1C2IA 2RCEA 1IQNA 4BTIB 1MCVA 1HB0B 2QXJA 3A87A 3AW0A 1MKWH 2GZ7A 1ABIH 1DDJA 1GI9B 4ABHA 2C3SA 4CRGA 3RMMH 2W26A 1HAVA 1UVUH 4H4FA 4JK5A 3MNCA 2VNTA 4E7NA 1G9IE 4HI3A 5EQQA 3QTVH 2O8WA 1NY22 3TVJB 1IQJA 2GV6A 4ZXXH 2ASUB 1GHXH 1D6RA 1L4DA 4CRBA 1O39A 1ZMNA 3S69A 4UFEH 1DVAH 5FBEA 1C2JA 2FYQA 4B1TA 2BOKA 3E0PB 2Z3EA 4KELA 1ZMJA 4X1QU 3U8OH 3GY5A 3MH5A 1HDTH 4U2WA 1O3JA 1O2OA 3GCHC 4CBOA 2GCHG 3A7VA 1MTSA 3RXMA 1LQDB 3P17H 4Q80A 5EODA 5GDSH 1ZPZA 1GWAA 2ZHDA 3F9GA 3U1IB 1PPBH 1TGTA 1L1GA 1FUJA 1TNHA 5JBCS 2H1UA 3IITA 4B2AA 4Y8ZA 4ABIA 1G37A 2PUQH 1JWTA 4WJG2 1OWJA 5CE1A 2G81E 5C67A 1BTYA 4FUFA 3RC4A 1GI0A 1D3TB 3E6PH 4OS2A 2ZCKP 2GTBA 1AFEH 2QIQA 1ETSH 1K1IA 2RA0A 1BHXF 1JRSA 1O2ZA 1TMUH 2VVVA 1C1VH 2ZKSA 4YESB 3ZZCA 4XBDA 2FLRH 2PKAB 1TPPA 1WU1A 3EYDA 4MVNA 2XC0A 3ATKA 2NWNA 1PPEE 2BOHB 1KLTA 2UWPA 1KLJH 2ZU1A 5DP7A 4X6OA 2F9OA 1O2IA 2ODYB 5I46H 3ATWA 1DFPA 1UCYK 2QXGA 5AVDA 3QLPH 1V2MT 2O8MA 4INLA 3V12A 1QL9A 2ODPA 4ISLA 1K1MA 2FODA 3RMLH 2Z7FE 1WAYB 2G51A 1VITF 4K60A 1UK2A 3KQEA 5L6NH 1C5WB 1K21H 2ZHQH 4K5ZA 2FO9A 1ZYOA 1S84A 1EZQA 1SMFE 3KNXA 3M35A 4Z6AH 1AFQB 2TGDA 3ZZ8A 4KTUA 4CRFA 3LH3A 1EOLA 1YGCH 1DY8A 1JRTA 3GCOA 1VGCB 1G2MA 1LVOA 1ELGA 3TGKE 1C2FA 5EXMA 4D76A 2TRMA 2GCHF 2J94A 1O2HA 1RTKA 2Q1JA 1P2OA 3PLBA 1V2VT 3TK9A 3PWBA 1WYKA 1V2KT 1GBAA 1UVPA 1LHGH 5C1XA 3KQDA 1TALA 4D7GA 1YYY1 1WV7H</