1LTOA

Human alpha1-tryptase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCLGPDVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFPPGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDMLCAGNSQRDSCKGDSGGPLVCKVNGTWLQAGVVSWDEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha tryptase I
publication title The Crystal Structure of Human alpha1-Tryptase Reveals a Blocked Substrate-binding Region
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ltoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ltoA01
1RRKA 1BOQA 5EG4A 4INLA 2EI8A 2IN2A 3S69A 2BQ7B 3IWMA 2IPHA 8KME2 5H4IB 3UQOA 1TLDA 3ZZ7A 3A89A 1ELTA 4CHAB 2ANKH 1GHWH 1RTLA 4JMYA 2HNTC 1C1TA 3GDSA 2C8ZB 2BB4A 3PTBA 1F0TA 3P8FA 1C5MD 3RXQA 4I32A 4KP0A 1OSSA 1TX6A 1SR5C 7GCHG 1O5DH 2OD3B 3ESTA 4ABEA 3BTHE 2FWWA 1AUJA 1H9HE 4K69A 3RXVA 3TK6A 2FOEA 4WMDA 3ZZ5A 5E0JA 5C3NA 1NFWA 3ZZ4A 2D2DA 1DDJA 1F2SE 3E8LA 3U1JB 1B5GH 1D6WA 1O3MA 5C67A 1BMNH 1WAYB 1SHHB 3A83A 5C1YA 4ZKOU 4RN6A 2A2XH 1CGIE 1GVLA 3BG4C 3KCGH 4GCHF 4KGAA 4B2BA 3RXCA 5C2ZA 1UVOA 1O3EA 5T6GA 4TWWA 2HPQH 2ZFPH 2XWAA 4CH8B 1RD3B 1PPHE 4JZEH 1EP5A 3K2UA 3SZNA 1MAXA 4YESB 1B7XB 3KGPA 2V3HH 4BAKB 5FBIA 1C5VA 1YF4A 4CREA 3K9XB 1EX3A 1LHFH 2A4RA 4FVDA 2R3YA 4FUCA 4YT7H 1HIAA 1L4DA 3QZRA 3SHAH 1H9IE 4RKJB 3VGCB 1C5OH 1O2SA 1TB6H 1TGNA 1QA0A 3M5NA 3Q00A 5JB8S 3TGKE 2VVUA 9ESTA 5ESBA 1MKWK 2FOFA 1O3GA 2TIOA 2UWPA 1KXAA 1BT7A 5BRRE 6GCHF 1PPCE 1MTVA 2VU8E 1CT2E 1N6XA 3M61U 4VGCB 1XUGA 1DS2E 1C5LH 3MH4A 3QZQA 2PKAB 1IQJA 4FUJA 2ANYA 1BRCE 1MMJN 4A7IB 3P17H 2VWLA 1EZSC 1H8DH 2EEKA 2H5DA 1VITF 2GV6A 2AYWA 3H5CB 4KKDA 3MWIU 1Z7KA 3SNCA 4A6LA 1GHAF 4ABHA 3T62A 5G4BA 1AIXH 1DLKB 1TYNA 5ABWA 4X2YA 3RXRA 2RG3A 1FAXA 4X8TH 2OINA 8GCHF 4BXWA 2C8XB 5EU8A 1F5RA 1SHYA 1HDTH 2ASUB 2WPJS 1CGHA 2VH6A 1E37B 1Z71A 2ZDVH 4YM9A 4MDSA 2J9NA 1NN6A 3QK1A 1RS0A 2A5AA 2H9EH 3A8DA 1UHBB 4FUFA 4RSPA 3SJ8A 2ZGXH 1BMMH 3SHCH 1GI3A 1Z1IA 4UD9H 3QTOH 2A4QA 4NA7A 4OGYA 3SORA 3VB4A 1ABIH 3DT0H 1ETSH 1RJXB 1O2UA 1HJ9A 5A8XA 3QGNB 2SGEE 1TNLA 3RXKA 2A32A 3QLPH 3MNBA 3RXDA 1SGRE 1XX9A 1C2FA 3UWJH 1GVKB 1SLXB 2BD9A 5TCCA 3RXLA 1VGCB 4U32A 5HM2A 1LHCH 1SFQB 4BTUB 2ZQ2A 2IOTA 1QQUA 2PKSC 7ESTE 4WMEA 2F83A 1K1LA 3A84A 5CMXH 4CRFA 4YLQH 1IQFA 1GBCA 4FUGA 3LGIA 2G5VA 2RA0A 3MI4A 1ELCA 2G4TA 3T28A 4HGCA 1QB1A 1YPHC 5DO4H 2ZHEH 3A7WA 4F4OC 1B0EA 1ZSKA 1O5CB 1DICA 1VCQA 1O3NA 1P9UA 4BTTB 1PPEE 4AORA 4R8TB 4X8VH 3RMLH 4E7RG 1NM6A 1NPMA 3F6UH 3EYDA 3FP8E 1JIRA 4YT6H 1A5GH 1DY9A 1OWDA 3F68H 2ZCLP 4DW2U 2ZKSA 1H8IH 1HAIH 1YKTA 1JBUH 4DIIH 5EGMA 5E0GA 4I8LA 1L4ZA 1MCVA 3LC3A 1GDUA 2ZGBH 1HNEE 1P9SA 5HM9A 2BVRH 1GMHG 2HLCA 1IAUA 5DP5A 2ZA5A 4NA9H 4ZAEA 8LPRA 5LH8A 3VPKA 1A46H 2DE8A 1GBDA 1Z6EA 1WU1A 2A31A 1DM4B 1HUTH 3PMAB 3D62A 2HOBA 1CU1A 4O3TA 1T32A 1JMOH 3ZVGA 1MZDA 5E0HA 2FOGA 2SGPE 4OS7A 1KXEA 1J14A 3T2NA 1FIWA 1EAXA 5DGJA 1AQ7A 4K1TA 3RU4E 4LZ1H 1O2ZA 4WXVA 4X2VA 1JXPA 2G52A 3A7ZA 1SBWA 3VB6A 1O2YA 3PV4A 2AGIX 4WVPE 2V6NA 1QRXA 2BD2A 1C5XB 4U2WA 2F9VA 5E2PA 3UIRA 5DPAA 2O8LA 1HAYB 1UTOA 3ITIA 5E2OA 2ANWA 1UK4A 3SV9A 2PV9B 2ZDMA 1F7ZA 3PMJA 1HJAC 1UCYE 2Q6GA 1CT4E 1LDTT 1DOJA 1F5LA 1SL3A 1BB0B 1HAPH 2SGAA 1G3BA 2HNTE 1GI7B 1BRUP 1W12U 3GY5A 5HXFA 4D76A 3UNRA 3A8CA 4ZROA 1CVWH 1GJBB 2A0QB 2W3KA 1O38A 2ZPRA 4D8NA 4X8UH 4D7FA 3T5FH 1ESBA 2SNWA 2SGQE 5EPNA 3SU5A 1HAZB 1HV7A 1TGCA 1A3BH 2Q6DA 2QC2A 2ODQA 1FLEE 1TPOA 2J4IA 3M7UA 5EXLA 1Y59T 4K2YA 4JZIA 3RXSA 1O3LA 1V2MT 1P03A 3LGYA 2ZHWH 2BVXH 4CBOA 3CS0A 4X1PU 2UWOA 2BX3A 1S0RA 1JRTA 3ZVEA 1XUFA 4ZUHA 1GL1A 1ZOMA 1GI5A 2GKVE 1NT1A 1A5HA 3SJKA 5F03A 3KN2A 1TPSA 1O5EH 3PM3A 3SNAA 4BNRA 3DA9B 1T7CA 3RC6A 1F0UA 1L0ZA 2C8YB 5I25A 2A4GA 5A8YA 1TABE 1GI1A 2BXTH 2OC1A 1HAVB 2XRCA 1O2OA 1SVPA 2A7HA 3TLOA 3S9AA 4ASHA 4IMQA 3FZZA 3GOVB 1TPPA 3GISB 2Z9GA 3BIVH 4CHAC 1SQAA 4UE7H 5JBCS 3FAOA 3M36A 1EXFA 3V0XA 3P95A 5EQSA 4DG4A 4A1TA 3SUGA 1EAIA 3E0PB 3LPRA 1KIGH 1F5KU 1ZJKA 1BRAA 1MTNB 1ELAA 3O8BA 1QL8A 2BDGA 1QIXB 1C1SA 4R0IA 1OXGA 1KLJH 2V0BA 1F0RA 1GBTA 4H4FA 2BY9X 4OS1A 3VFEA 2ZFRH 3UWIA 2J94A 2KAIA 4CRDA 1P06A 1ESTA 5L30H 3M7QA 2BOKA 3MH5A 3AAUA 3ZZAA 4IC5A 1N6YA 1O3AA 3MO9A 1EZXC 4ZKSU 1G30B 4ISIH 3BEUA 2J2UA 1V2QT 2R0KA 3HK6B 2QIQA 1OPHB 2EI7A 3Q77A 1AUTC 2VWMA 1GCDA 3TJVA 2J38A 2PUXB 2TGDA 3A85A 2GCHF 2BDBA 1AZZA 1K2I1 2ZHDA 1FPCH 3U9AH 3UTUH 1VCPA 1A0JA 2PSYA 1QNJA 3ZVCA 1NZQH 1QJ1B 1GI0A 1TRNA 1YCPH 4X1SU 1ELGA 1G9IE 2XTTB 4WY3A 1SQOA 1BBRH 4MPXA 1V6DA 3LIWA 4IGDA 1O3HA 2Z6BD 1O2PA 2FM2A 2ZO3H 3H7OA 3QTVH 1FN6A 3D65E 1P2OA 2FZZA 2OCVB 1O39A 4MTBA 1SPJA 1FNIA 1HYLA 2FI4E 1ZGVA 3RLYH 2FODA 2TGAA 3VGCC 3MH7A 5DKMA 5FPSA 2FO9A 2GZ7A 1G3DA 1NROH 1QBOA 1MQ6A 4X1RU 3F9EA 1P2QA 1C2JA 3VXFH 1GDQA 5DP3A 3RM0H 2VINA 3SU4A 3NWUA 1O2WA 5AVDA 4O3UA 4AN7A 1O2TA 3G01A 4UFGH 2BD4A 1H4WA 1K1MA 1UK2A 1A0LA 1ZTLA 1ZPBA 4GHTA 2FYQA 1NRRH 5IYTA 4VGCC 1FY1A 1A2CH 3CENA 3UOPA 4AZ2B 1HAHH 1KDQA 5FXLA 1O5GH 4Y0ZE 1ZTJA 2VIQA 1GJCB 3Q76A 2G00A 1NO9H 2OTVA 1QY6A 2O8MA 1ZMNA 1O3BA 2QV1A 1C1WH 1GHAG 1MH0A 2CMYA 3B8JA 1T4UH 3F9HA 1LKAA 2IJOB 1RIWC 3SU1A 1GL0E 1YPHE 2Z3EA 2GTBA 3EA9A 4MPVA 5GCHF 1HJAB 5EW1H 1QB6A 4CRAA 2P3UB 1GMCF 1TNIA 1BUIA 3RU4T 2ZTXA 1PQ8A 4O97A 1O32A 1AFQC 1CHOG 1ZLRA 2O8WA 1DFPA 3BEFB 4K5ZA 2QA9E 2Y5FA 3B9FH 3SUEA 5LGOA 1Z8GA 1S81A 4UFFH 5TCAA 4ABJA 1SLVB 3CP7A 3LC5A 3EAJA 1GBKA 1EPTA 3F9GA 1QCPA 3RMNH 5LPFA 3TK9A 1D6RA 2BQ6B 4CR9A 2AEIH 3PO1B 1THRH 1FY5A 5LPRA 2ZECA 4YLUA 3LGVA 1P2JA 1VGCC 4SGAE 1FJSA 2ZPQA 5F8TA 3SV6A 3PWBA 4H6SB 3UR9A 2Y7ZA 1IHTH 1RGQA 1V2ST 2VH0A 1Q3XA 3PWCA 3RP2A 1T4VH 1K22H 3E16B 2V35A 1J15A 2WPHS 1WUNH 1UK3A 1JIMA 4TY6A 2YNBA 2XCNA 2W5EA 4FUEA 5J4SA 1V2PT 3M5LA 2QAAA 2A5IA 1M9UA 3ENSB 4X6NA 1IQKA 2OC8A 3GY3A 1NRPH 4B75A 1LHDH 2W7SA 1ANDA 1RTFB 1OYQA 2TGPZ 1GJ7B 4YZUA 1C5NH 1AWFH 1DWBH 4MG3A 3ZZ6A 3DUXH 1QURH 3MU0A 4DY7B 2XYAA 5L2ZH 1O2GH 2WYJA 3ZZDA 2VIOA 2YNAA 3TH4H 3SI3H 1FXYA 1V2OT 3A8BA 3HKJB 4FUIA 3ZZ8A 1T8MA 4B2AA 1PYTC 4B71A 3V12A 1Z8IB 3RXHA 2EA3A 4DVAU 1W13U 1S6FA 3HGPA 1Z6JH 1S6HA 1ARCA 1SGIB 1V2KT 2GMTC 2FESH 1DWEH 4AX9H 1O2NA 1BMAA 1NFXA 2QXGA 4OS2A 3GDVA 2ZF0H 1ANCA 2FTMA 1WBGB 4AB8A 3PB1E 1S0QA 3SGAE 1ESAA 1C4V2 1TOMH 1IHSH 2QF3A 2B9LA 3BG8A 1GBMA 2H5CA 3PROA 3EA7A 2PHBA 4ZXYH 2ZWLH 3TJNA 3O8CA 3MU1A 3PLBA 1TRYA 2VWNA 4BAMB 5DP6A 5C1UA 1SGYE 1ETRH 1C1PA 1MU6B 4Q7XA 2WPIS 3TIUA 5AHGH 4YOGA 2ZDNA 1A5IA 4FU9A 1DY8A 1O0DH 2BDYA 3SU3A 1ZPCA 1BTHH 1EOJA 3C1KA 3KL6A 3BTEE 4GPGA 3UREA 3RXPA 3QX5H 1ZPZA 4AB9A 3PMBB 1GI8B 2AGGX 2GZ8A 1LVYA 1C1UH 1MKXK 1QR3E 3K6ZA 1PPFE 1GI6A 3VB7A 2ZFFH 2ZDAH 1UCYK 1X7AC 3ZV9A 1ELEE 2CV3A 1BCUH 1SGNE 4IMZA 3S9BA 1BIOA 1IQLA 2RA3A 3URDA 3GDUA 2ZC9H 1PQ5A 3LH3A 2RCEA 3GCOA 2Y5HA 5GDSH 1D3DB 1HJ8A 3H7TA 1RIWB 3TJOA 2ZCHP 1TMTH 3BTFE 1MQ5A 1QFKH 3MMGA 4ABIA 2VNTA 1QA7A 2FOAA 4NIXA 2GX4A 3TH3H 4NCYA 1LQEA 3FANA 3U69H 1UJ1A 3BTQE 1G32B 4MNVA 1QQ4A 2ODYB 2BQWB 3RUOA 1MU8B 1XXFA 3I29A 1O3KA 1AVXA 1AFQB 2CJIA 2OQ5A 2BZAA 3P8NA 1CA0B 2OP9A 2AH4X 2STBE 5K0HA 1GJDB 5GJ4B 4I8KA 2FIRH 5E8EH 5L6NH 1LVBA 4IBLH 3U8TH 5T3HA 2VIWA 1LO6A 3UUZA 4Y8XA 1O2HA 2ALVA 3I77A 3VB3A 1JRSA 1E35B 2TGTA 4FU7A 4DGJA 1C2MA 3CS7A 2PLXA 2TRMA 3KNXA 4Y11E 1OWHA 1TWXB 5DJ7A 3GY6A 3V7TA 3SO3A 2D26C 1EUFA 1C1VH 2GZ9A 1BJUA 5C5NA 1SGFG 1MTNC 4AOQA 2BVSH 2GDEH 2ZI2H 4K1SA 2FOBA 2AS9A 3GCTG 5EQQA 3QN7A 2H6MA 5GXPA 3OY5U 2BDIA 3BTDE 4WXIA 2VB0A 2P94A 2P16A 4I7YH 3BSQA 3W95A 3LGUA 1GJ4H 5GPIB 1YM0A 4ZHMU 2SGFE 2ZU5A 1BBRE 3LGTA 4JZFH 5LPEA 4Z6AH 5B6OA 2FLBH 2UWLA 4GSOA 3A7VA 1D3TB 2ZTZA 4AGJA 3P92A 4U30A 1K1PA 2NWNA 1EKBB 2F9OA 5GIBA 4MVNA 1G36A 1XUJA 3V3MA 2P93A 1TBZH 4E7NA 2ZU4A 1J9CH 3TVJB 4JK6A 1GI4A 1HRTH 1O2XA 2G55A 1CGJE 1CA8B 1S83A 4B2CA 4JYVH 1EJMA 3MHWU 1P05A 4JCNA 4HI3A 2TBSA 1GHXH 1NU7B 3GY7A 1AKSB 1EB2A 2WPKS 1DE7H 2PSXA 3MOCA 2GMTB 2Y82A 4IS5A 4O03A 4WJG2 2AGEX 2PKAA 1SGTA 1AZ8A 3VB5A 1J16A 6LPRA 1XKBC 3LOXA 3MH6A 1Y5BT 1O33A 1MCTA 1P3CA 2A4OA 2EC9H 1W8BH 4M7GA 5BPEA 1PJPA 3SUFA 1NS3A 1RXPA 1SGPE 4B76A 1O3FA 1OKXA 2NU0E 3L33A 1P04A 1TNGA 1TGTA 4X0WU 3MNXA 2H9TH 2FX4A 1ETTH 3F9FA 1Z8JB 1GGDB 3A87A 4O9VA 1WCZA 3LJJA 5T6FA 1NU9A 1BDAA 1DWDH 1C5PA 1GPZA 1BTWA 3SV7A 3T26A 4FUHA 1FONA 1UHBA 1GHBG 2FXRA 3U8RH 1D9IA 2CHAC 4B73A 1BZXE 4JK5A 2Y7XA 1V2VT 2B0FA 1C1RA 1ABJH 4UEHH 1O35A 2ZGCA 4Y8YA 2W26A 3DFLA 1GDNA 4YO9A 3ZVBA 1H1BA 2XBVA 1HGTH 2FX6A 2R9PA 1LVMA 3B23B 2CF8H 1C5ZB 2K1QA 1FAKH 1QGFA 3KHVA 4AFQA 1BQYA 1QL7A 3D49H 1SB1H 1WQVH 1C5QA 2FPZA 3E90B 1O34A 1GCTC 1THPB 4ESTE 1CSOE 3TPIZ 3OTJE 3PO1C 4TYDA 4NZLA 2P59A 3U8OH 4X1NU 2ZGHA 2ANMH 2XCFA 1BJVA 1O31A 2CGAA 3LJOA 4H42U 5A09A 3EE0B 6CHAC 3K6YA 2FTLE 1TAWA 3TNSA 1P3EA 1UTJA 1GBIA 3LGWA 2UUJB 1DWCH 2VIVA 4NIVA 1O2JA 4ZHLU 1FPHH 1XUHA 1T31A 5GWZA 5DG6A 2BLVA 1KLIH 3KQDA 2R0LA 1C2KA 3OX7U 2ZNKH 3RXBA 4BANB 3BEIB 1P0SH 1SQTA 2ZTYA 3UNQA 1TQ7B 4OGXA 2C90B 4D7GA 2WV5A 1IQNA 3GCHB 1GMDF 3FP7E 1O3IA 1GJ6A 3TU7H 1OP8A 1OP0A 5EXMA 5JB9S 1W14U 2A1DB 1C5SA 1HBTH 5ESTE 2A2QH 2ZDLA 3ATMA 2XBWA 1XUIA 3SU2A 3A8AA 3P8GA 1J17T 4ABGA 1AVGH 5EPYA 1PPGE 3SJOA 4GAWA 1ZRKA 1ZSLA 4A92A 1G3EA 4CRBA 4X6MA 4UFDH 8ESTE 4XBBA 1G2LA 3BTKE 3MTYA 1C2EA 1QRWA 1OWEA 1XKAC 4KTSA 4X6PA 4NZQA 1P2MA 3AAVA 1LPKB 1V3XA 5FX6A 1ANBA 2P95A 1LTOA 1ZJDA 1YP9A 1EPTB 1TPAE 4GCHG 3SJ9A 1VCWA 5A2MH 1Y3VA 1MD7A 2FLRH 2PW8H 3IITA 2H1UA 4INHA 2GCTB 1FUJA 1C5WB 2BLQA 3KQEA 1QJ7B 4LK4A 2JETB 6ESTA 1FY8E 1SI5H 3Q3KA 1UTMA 4ZHAA 1NTPA 1HAOH 2HWLB 1YPMH 4LZ4B 3A82A 3KF2A 1HAGE 1ZHPA 1C5RA 3GY4A 5HYOA 3LKWA 3KQCA 4X6OA 1GBHA 4D9QA 4MNYA 2WINI 2C93B 3RXGA 1SGCA 3ZZBA 4DURA 2VGCB 3BF6H 3SGBE 1YPKH 2OUAA 4I8JA 4XBCA 4BTIB 1E0FD 3BTME 1GBBA 2ULLA 1TNKA 4I8GA 1C9TA 3S7HB 2BDCA 1TBRH 2OXSA 4IW4E 1YPJH 1IQEA 4FVBA 4ABDA 1UVSH 3O8DA 3P70B 3RXAA 2PTCE 4ABFA 6GCHG 3M3TA 4NA8A 1O36A 4HFPB 4NFFA 4MPUA 1NRNH 2ESTE 1SSXA 1P8VC 3P6ZB 1BHXF 5EOKA 1XVMA 4UFEH 2QXIA 1C9PA 1RTKA 2LPRA 1GBEA 1UTLM 4INKA 4BAQB 1ANEA 1VITG 3STIA 1EOLA 1CQQA 2BY8X 2RDLA 4Y71A 1GHZA 2J92A 4ABAA 3ATIA 2BMGB 1VZQH 1Y3UA 1BITA 3JZ2B 3EGKH 2PFEA 5FX5A 2THFB 2W3IA 2ZGJA 5JDUB 1Y8TA 2H2ZA 2PR3A 1SOTA 1TQ0B 2XWBI 2Q6FA 2CHAB 8GCHG 1E34B 4CR5A 1TE0A 4B1TA 1HAVA 2AMPA 1O3JA 2QGRA 3M3SA 2HGTH 1OWIA 3M35A 1N8OC 1CHGA 3MFJA 1UTNA 2BX4A 2ALPA 4X2XA 1FDPA 3NUMA 3SOSA 1O5FH 1W0YH 2F3CE 4TWYA 1SLWB 1GHVH 1GG6B 2PGQB 1CA0C 2PWXA 3U1IB 1V2JT 3ZZCA 1HXFH 2OBQA 1P2NA 5PTPA 1O5AB 1AO5A 1O2VA 3E6PH 1P09A 2M5TA 3A7XA 4Q2KA 1MKWH 1YCPM 5FBEA 3WY8A 1GCTB 1HIAB 3SV2H 1O3OA 1THSH 1OP2A 1XUKA 1KXCA 1EP6A 1XVOA 1TX7A 4I31A 6CHAB 1C2HA 1BTPA 1KXDA 1OYTH 4Y10E 2FOCA 3SJIA 5C1XA 4UONA 3KQBA 3FZDA 3QDZB 2BOHB 3GYMA 1CE5A 3OYPA 4XSKU 2B8OH 1AFEH 1LMWB 3S9CA 1TOCB 1JWTA 1TFXA 1Y3XA 2G81E 1C1MA 7KMEH 4IN2A 4THNH 1O3PB 2BLWA 4NSYA 4OS6A 4WWYA 3A88A 3QGJA 3RXIA 4H6TA 1Y5AT 2OBOA 2G8TA 4NFEA 3RXFA 3D23A 2BY6X 4JYTA 2OC0A 4FUDA 1YGCH 1Y3WA 3MNSA 1TRMA 1YCPK 4NIYA 1N1LA 1XMNB 5FCKA 3P8OA 1BBRK 1IQHA 2NU2E 3W94A 4CBNA 1QB9A 1GI2A 2Z9JA 2ZFTA 1Q31A 5DK1A 5EXNA 3BV9B 1EZUC 3ATLA 4XBDA 3PTNA 3SGQE 1G37A 2GT7A 1PPBH 2HNTF 4IN1A 1V2LT 2AMQA 1BTUA 2Z9IA 1ZTKA 3QO6A 2F9UA 5C5OA 1EJAA 1P11E 1HLTH 5CHAB 4LXBH 5DP7A 1GBLA 3EDXB 1GJ5H 1OOKB 3T25A 1KXFA 1P2IA 1K28D 1NRSH 2P8OB 1A7SA 1OS8A 3DD2H 1VITH 4BXSA 1MAYA 3FFGA 1L2EA 2I6SA 2AFQB 3ZZ9A 3FVFB 1F92A 1MBQA 2WPMS 2O8UA 3SI4H 1UTKA 1GGDC 2AIPA 2JKHA 4PROA 1K9OE 3NZIA 2QF0A 4HZHA 2A7JA 2HALA 2TPIZ 4NSVA 1B0FA 1LHGH 3SQEE 1K1NA 3SU6A 2SNVA 4K8YA 3O8RA 3TH2H 5J4QA 4AYVB 3NKKA 1L1JA 2FS8A 1Y3YA 1YLCA 1J8AA 4K60A 1D4PB 2D8WA 3E91A 4K1EA 5A0AE 1BHXB 1KYNA 4JZDH 3T27A 2QXHA 2ZHQH 2O9QA 1V2WT 1W2KH 3UNSA 1ARBA 4X8SH 2BD3A 1FN8A 3ATKA 4XE4A 3ODDA 1LPGB 3STJA 1LKBA 4IC6A 2BLOA 2FEQH 2BYAX 1GWAA 1W0ZU 1TGBA 2Y80A 2ZDKA 2QYIA 2F9NA 1FZZA 2ZZUH 2OLGA 1FQ3A 4HTCH 2YOLA 3HATH 2ZCKP 1NFYA 1AB9B 2FI3E 1VR1H 3R0FA 1O2RA 2XC5A 1KLTA 3MU5A 1GJAB 1D3PB 3E0NB 1EQ9A 3ZYDA 1W7XH 1GJ8B 1IQGA 2QN5T 4BAHB 3VEQB 3OY6U 1C5YB 1KXBA 2C3SA 3V13A 1N8OB 1HXEH 2ZEBA 3E3TA 1AD8H 2G4UA 5HMAA 1BA8B 1UVPA 4D9RA 2WUCA 3I78A 2FP7B 1SG8B 1ZGIA 1NY22 1C1NA 4X2WA 1QBVH 1SGFA 2QCYA 2STAE 2JH6D 3RXJA 2DE9A 2XC4A 3ZYEA 1IQIA 4GVUA 1EZQA 1GMDG 2GD4B 3ZVDA 3UOUA 3GCHC 3TJUA 1P12E 3UQVA 2P3FH 1INCA 1T8NA 4A1XA 5AFZH 1HPGA 2Z3DA 2B5TB 2PGBB 1YBWA 3TK5A 1CHOF 4DOQA 1AHTH 4AGKA 2ZU1A 4I33A 1ELBA 1AY6H 4XFQA 1TNJA 2NU4E 3AW0A 1E38B 4Y76A 3HPTB 5C20A 4WF8A 4GUXA 3ZVFA 2D1JA 1QRZA 1GBJA 4A1VA 3BN9A 1FMGA 3ZVAA 4DCDA 3GY2A 2PTNA 3RXOA 3T29A 2GGVB 3R3GB 1V2UT 2BDAA 3L3TA 1YLDA 2AERH 2R2WU 4U01A 5AF9H 1MTUA 1UVUH 1JOUB 3A7TA 2F91A 5HGGA 3SNDA 1EPTC 1TMUH 1QTFA 4JZ1A 1DXPA 2LNCA 3OU0A 1P2KA 2GCHG 1P02A 3RM2H 3DHKH 3ATWA 1KSNA 2GCTC 2VJ1A 1S85A 7LPRA 2JETC 1C1QA 1O2QA 1V2TT 2FOMB 2HVXA 1YYY1 1AU8A 1GJ9B 3SU0A 3IG6B 3N7OA 4FUBA 1L1NA 3SNEA 2J95A 1PQAA 1O2IA 5JPMH 2XXLA 2ZIQH 4J2YB 2VGCC 3S7KB 5FHTA 4MNXA 3A80A 1ZYOA 5A0BA 2BTCE 2GV7A 1TA2A 3RC5A 1O3CA 4ISOA 4Q80A 7GCHF 1BMLA 2VIPA 2XW9A 1V2NT 1TA6A 1QBNA 2FI5E 2GDDA 3UPEA 1WYKA 2G51A 4A5TS 3GYLB 4FXGH 5EW2H 3AW1A 1K21H 2ILNA 1DITH 3UFAA 3ZZ3A 3F1SB 1W7GH 2FMJA 2Y6TA 4AFUA 2BHGA 2H9HA 3S0NA 1AVWA 5IDKA 2VWOA 1DSTA 3A7YA 3BG4B 3RU4D 3SUDA 1GBAA 1KTTB 4F49A 2KAIB 3GCNA 1TNHA 2HRVA 3AASA 1DUEA 1O30A 1K1OA 1SFIA 2A45B 1V2RT 1SGDE 3ODFA 4Y7AA 1ZHRA 3PLKA 4XDEA 5GCHG 1TX8A 2AMDA 4K8BA 1UTPA 1C4U2 1UVTH 1Q2WA 4YTAA 1GMCG 1UMAH 2CXVA 5F6MA 1DSUA 4TY7A 4NGAH 2V3OH 4Y6DA 3U98H 3NCLA 1WV7H 1S84A 4I8HA 1EASA 1G3CA 1CT0E 4LOYH 4XOJA 1EATA 1SC8U 1GG6C 4Y7BA 4CRGA 3TGJE 1FV9A 4NWKA 4ZKNU 3K65B 2A5KA 1AI8H 1AE8H 1CBWC 1DANH 2XNIA 4SGBE 2J34A 2CN0H 4X1QU 2GVFA 1MUEB 5CE1A 3UY9A 4WMFA 4E06H 3RMMH 2NU3E 2ZHFH 4UDWH 5ETXA 5K7RA 1W10U 4KTUA 2Z9KA 4YOIA 4CRCA 5DP9A 1EJNA 4OS4A 3RC4A 1PYTD 2FYRA 1YPLH 1OWKA 1YPEH 4AFZA 3LONA 5FPTA 2VVVA 3PLPA 5TJXA 2PUQH 3M7TA 2BY5X 3RDZA 1IOEA 5JYIA 2W7UA 2F9PA 1YPGH 4Q7ZA 1AE5A 1TBQH 2A7CA 1C4Y2 1ZSJA 2FS9A 4DT7B 1NRQH 5F8ZA 1KDQB 1GVZA 1DX5M 1DVAH 5FAHA 2Z7FE 1ELVA 2Q1JA 2ZU2A 3HGNA 1FY3A 5SGAE 3Q3YA 1IQMA 4B74A 5FCRA 3RXUA 4JYUH 1VJAU 5F8XA 1P01A 2I6QA 1VJ9U 4Y0YE 1AKSA 1AN1E 1C5UA 2HPPH 1ORFA 3BTGE 1EAWA 3GY8A 5JBBS 5AFYH 2JH5D 2OC7A 1SOZA 2UUYA 5A0CA 1DT2A 2ODPA 1QL9A 4ZMAH 1LQDB 1C2DA 4J1YA 3QWCH 1ZR0A 2NU1E 1EB1H 1KTSB 3RXEA 1T8OA 1K1IA 1Z8RA 1O2MA 4MNWA 2Z94A 1BTXA 1LVOA 1MTWA 2Z9LA 1FIZA 4ZKRU 3MNCA 2PKSB 3BTTE 3TNTA 5CHAC 2ZFQH 2EI6A 4TPIZ 1AMHA 5A8ZA 4MLFB 2UUFB 1WTGH 2WUBA 1ZHMA 4CH2B 2G5NA 1HCGA 3GCTF 3MO6A 3RMOH 4AG2A 1NESE 2R2MB 2P8OC 2P3TB 1BRBE 2O8TA 1FI8A 2XBYA 1TALA 1SGEE 2UUKB 3A81A 3KIDU 4MPWA 3LT3A 4MQAA 1DUAA 3NK8A 3HKIB 3RXTA 4YOJA 1SMFE 1O5BB 4NG9H 1WQSA 1ELDE 1O3DA 2BD7A 2SFAA 2JH0D 1H9LB 1A1RA 2XBXA 2ZP0H 2C8WB 3DFJA 4GHQA 2FDAA 4NIWA 1W3CA 1S82A 2Z3CA 1UTQA 1ID5H 1GMHF 3MYWA 3URCA 1S5SA 1QHRB 1DXWA 1BTZA 1O2LA 3FP6E 3SV8A 4KELA 1ACBE 3SNBA 1A61H 1MBMA 1SGQE 1MD8A 3MU4A 1WTHD 3KEEA 1BTYA 3C27B 2Y81A 2ZQ1A 1YC0A 1ZMLA 2WYGA 5JBAS 1GHYH 1U6QA 1TIOA 1P10A 1HB0B 3JZ1B 1O2KA 1PPZA 3BTWE 1LPZB 1C2LA 2FOHA 2BXUH 5EQRA 3RXMA 4BAOB 1AWHB 1D3QB 2BD8A 3ELAH 1A0HB 4AG1A 1LHEH 1TMBH 4FU8A 3RLWH 1AB9C 3A86A 3LDXH 4KTCA 3EQ0H 1WSSH 2BY7X 1UO6A 4Y8ZA 2Y5GA 3MO3A 1XM1A 2QXJA 5T6DA 1A4WH 1Y5UT 2C4FH 3VXEH 2R3UA 2BM2A 1AGJA 1KY9A 1ZZZA 1LCYA 4BOHA 3SW2B 1GBFA 1QJ6B 3GICB 2WV4A 2AIQA 3SQHE 5DP4A 2VVCA 4AFSA 1C2GA 2GT8A 2DUCA 3NPSA 2WPLS 3SBKA 1K1JA 1CO7E 5L2YH 1PQ7A 3LU9B 2BZ6H 2CF9H 1MTSA 2ZU3A 4ISNA 4ZXXH 1GHBF 4DIHH 1DLEA 4ISLA 4Y79A 1HFDA 4OS5A 4WH8A 4Q7YA 1CBWB 4GLYA 3L6PA 3E1XB 3HK3B 1OWJA 3NXPA 1C5TA 1ZMJA 1FY4A 4QT8C 3BIUH 1TONA 1HAXB 3AVZA 3M3VA 2ZG0H 1MKXH 3TGIE 3LH1A 3QUMP 1C2IA 2F9BH 3M37A 1NFUA 3UR6A 1UCYH 1Z1JA 1MZAA 1O37A 1WOFA 4RKOB 4E05H 1TGSZ 1W11U 4TPYA 1GI9B 1A3EH 1DPOA 2GP9B 1ZRBA 4ABBA 3Q3XA 2XC0A 2SGDE 5JBTA 4K3JA 4ZH8A 9LPRA 3TITA 2BD5A 3EA8A 1ELFA 3PMHB 4NWLA 5EODA 2VIDA 1F0SA 2BDHA 4DJZB 1P57B 3ZV8A 5I46H 1RFNA 4AYYB 1NC6A 2B7DH 1OX1A 5DP8A 1PFXC 1EAUA 2ZPSA 4WH6A 1G2MA 2ZFSA 1T8LA 1E36B 4ISHH 1XXDA 2QY0B 5FPYA 3SN8A 3MU8A 3PYHA 3OSYA 3M5MA 1L1GA 3M5OA 4Z0KA 2OQUA 1SLUB 1C1OA
chains in the Genus database with same CATH superfamily
1RRKA 1BOQA 5EG4A 4INLA 2EI8A 2IN2A 3S69A 2BQ7B 3IWMA 2IPHA 8KME2 5H4IB 3UQOA 1TLDA 3ZZ7A 3A89A 1ELTA 2KZ4A 2ANKH 4CHAB 3EE7A 1GHWH 1RTLA 4JMYA 2HNTC 1C1TA 3GDSA 2C8ZB 2BB4A 3PTBA 1F0TA 3P8FA 1C5MD 3RXQA 4I32A 4KP0A 1OSSA 1TX6A 1SR5C 7GCHG 1O5DH 2OD3B 3ESTA 4ABEA 3BTHE 2FWWA 1AUJA 1H9HE 4K69A 3RXVA 3TK6A 2FOEA 4WMDA 3ZZ5A 5E0JA 5C3NA 1NFWA 3ZZ4A 2D2DA 1DDJA 1F2SE 3E8LA 3U1JB 1B5GH 1D6WA 1O3MA 5C67A 1BMNH 1WAYB 1SHHB 3A83A 5C1YA 4ZKOU 4RN6A 2A2XH 1CGIE 1GVLA 3BG4C 3KCGH 4GCHF 4KGAA 4B2BA 3RXCA 5C2ZA 1UVOA 1O3EA 5T6GA 4TWWA 2HPQH 2M2AA 2ZFPH 2XWAA 4CH8B 1RD3B 1PPHE 4JZEH 1EP5A 3K2UA 3SZNA 1BMFD 1MAXA 4YESB 1B7XB 3KGPA 2V3HH 4BAKB 5FBIA 1C5VA 1YF4A 4CREA 3K9XB 1EX3A 3DSGA 1LHFH 2A4RA 4FVDA 2R3YA 4FUCA 4YT7H 1HIAA 1L4DA 3QZRA 3SHAH 1H9IE 4RKJB 3VGCB 1C5OH 1O2SA 1TB6H 1TGNA 1QA0A 2WSSD 3M5NA 3Q00A 5JB8S 2VVUA 9ESTA 3TGKE 5ESBA 1MKWK 2FOFA 1O3GA 2TIOA 2KX4A 2UWPA 1KXAA 1BT7A 5BRRE 6GCHF 1PPCE 1MTVA 2VU8E 1CT2E 1N6XA 3M61U 4VGCB 1XUGA 1DS2E 1C5LH 3MH4A 3QZQA 2PKAB 1IQJA 4FUJA 2ANYA 1BRCE 1MMJN 4A7IB 3P17H 2VWLA 1EZSC 1H8DH 2EEKA 2H5DA 1VITF 2GV6A 2AYWA 3H5CB 4KKDA 3MWIU 1Z7KA 3SNCA 4A6LA 1GHAF 4ABHA 3T62A 2KCPA 1AIXH 1DLKB 5G4BA 1TYNA 5ABWA 4X2YA 3RXRA 2RG3A 1FAXA 4X8TH 2OINA 8GCHF 4BXWA 2C8XB 5EU8A 1F5RA 1SHYA 1HDTH 2ASUB 2WPJS 1CGHA 2VH6A 1E37B 1Z71A 2ZDVH 4YM9A 4MDSA 2J9NA 1NN6A 3QK1A 4Z1MD 1RS0A 2A5AA 2H9EH 3A8DA 1UHBB 4FUFA 4RSPA 3SJ8A 2ZGXH 1BMMH 3SHCH 1GI3A 1Z1IA 4UD9H 3QTOH 2A4QA 4NA7A 4OGYA 3SORA 3VB4A 1ABIH 3DT0H 1ETSH 1RJXB 1O2UA 1HJ9A 5A8XA 3QGNB 2SGEE 1TNLA 3RXKA 2A32A 3QLPH 3MNBA 3RXDA 1SGRE 1XX9A 1C2FA 3UWJH 1GVKB 1SLXB 2BD9A 5TCCA 3RXLA 1VGCB 4U32A 5HM2A 1LHCH 1SFQB 4BTUB 2VBCA 2ZQ2A 5C0TA 2IOTA 2GJGA 1OHHD 1QQUA 2PKSC 7ESTE 4WMEA 2F83A 1K1LA 3A84A 5CMXH 2LELA 4YLQH 4CRFA 1IQFA 1GBCA 4FUGA 3LGIA 2G5VA 2RA0A 2J98A 1ELCA 3MI4A 2G4TA 3T28A 4HGCA 2EQNA 1QB1A 1YPHC 5DO4H 2ZHEH 3A7WA 4F4OC 1B0EA 1ZSKA 1O5CB 1DICA 1VCQA 1O3NA 1P9UA 4BTTB 1PPEE 4AORA 4R8TB 4X8VH 3RMLH 4E7RG 1NM6A 1NPMA 5GNDA 3F6UH 3EYDA 3FP8E 1JIRA 4YT6H 1A5GH 1DY9A 1OWDA 3F68H 2ZCLP 4DW2U 2ZKSA 1H8IH 1HAIH 1YKTA 1JBUH 4DIIH 5EGMA 5E0GA 5EIYA 4I8LA 1L4ZA 1MCVA 3LC3A 1FX0B 3OTPA 1GDUA 2ZGBH 1HNEE 1P9SA 5HM9A 2BVRH 1GMHG 2HLCA 1IAUA 5DP5A 2ZA5A 4NA9H 4ZAEA 8LPRA 5LH8A 3VPKA 4AC9A 1A46H 2DE8A 1GBDA 1Z6EA 3UB0A 1WU1A 2A31A 1DM4B 2WZQA 3PMAB 1HUTH 3D62A 2HOBA 1CU1A 4O3TA 1T32A 1JMOH 3ZVGA 1MZDA 5E0HA 2FOGA 2SGPE 4OS7A 1KXEA 4B6EA 1J14A 3T2NA 1FIWA 1EAXA 5DGJA 1AQ7A 4K1TA 3RU4E 4LZ1H 1O2ZA 4WXVA 4X2VA 1JXPA 2G52A 3A7ZA 3FN8A 1SBWA 3VB6A 1O2YA 3PV4A 2AGIX 4WVPE 2V6NA 1QRXA 2BD2A 1C5XB 4U2WA 2F9VA 1WXRA 5E2PA 3UIRA 5DPAA 2O8LA 1HAYB 1UTOA 3ITIA 5E2OA 2ANWA 1UK4A 3SV9A 2PV9B 2ZDMA 1F7ZA 3PMJA 1HJAC 1UCYE 2Q6GA 1CT4E 1LDTT 1DOJA 1F5LA 1SL3A 1BB0B 1HAPH 2SGAA 1G3BA 2HNTE 2PP6A 1GI7B 1BRUP 1W12U 3GY5A 5HXFA 4D76A 3UNRA 3A8CA 4ZROA 3DSOA 1CVWH 1GJBB 2A0QB 2W3KA 1O38A 2ZPRA 4D8NA 4X8UH 4D7FA 3T5FH 1ESBA 2SNWA 2SGQE 1SQRA 5EPNA 3SU5A 2HLDD 1HAZB 1HV7A 1TGCA 1A3BH 2Q6DA 2QC2A 2ODQA 4RI0A 1FLEE 1TPOA 3UAIC 2J4IA 3M7UA 5EXLA 1Y59T 4K2YA 4JZIA 1E1RD 3RXSA 1O3LA 1V2MT 1P03A 3LGYA 2ZHWH 2BVXH 4CBOA 3CS0A 2KFWA 4X1PU 2UWOA 2BX3A 1S0RA 1JRTA 3ZVEA 1XUFA 4ZUHA 1GL1A 1ZOMA 1GI5A 2GKVE 1NT1A 1A5HA 3SJKA 5F03A 3KN2A 1TPSA 1O5EH 3PM3A 3SNAA 4BNRA 3DA9B 1T7CA 3RC6A 1F0UA 1L0ZA 2C8YB 5I25A 2A4GA 5A8YA 1TABE 1GI1A 2BXTH 2OC1A 1HAVB 2XRCA 1O2OA 1SVPA 2A7HA 3TLOA 3S9AA 4ASHA 4IMQA 3FZZA 3GOVB 1TPPA 3GISB 2Z9GA 3BIVH 4CHAC 1SQAA 4UE7H 5JBCS 3FAOA 3M36A 1EXFA 2W6ID 3OEED 3V0XA 3P95A 5EQSA 4DG4A 4A1TA 3SUGA 1EAIA 3E0PB 3LPRA 1KIGH 1F5KU 1ZJKA 1BRAA 1MTNB 1ELAA 3O8BA 1QL8A 2BDGA 1QIXB 2HVYB 1C1SA 4R0IA 1OXGA 1KLJH 2V0BA 1F0RA 1GBTA 4H4FA 2BY9X 4OS1A 3VFEA 2ZFRH 3UWIA 2J94A 2KAIA 4CRDA 1P06A 1ESTA 5L30H 3M7QA 2BOKA 3MH5A 3AAUA 3ZZAA 4IC5A 1N6YA 1O3AA 3MO9A 1EZXC 4ZKSU 1G30B 4ISIH 3BEUA 2J2UA 1V2QT 2R0KA 3HK6B 2QIQA 1OPHB 2EI7A 3Q77A 1AUTC 2VWMA 1GCDA 3TJVA 2J38A 2PUXB 2TGDA 3A85A 2GCHF 2BDBA 1AZZA 1K2I1 2ZHDA 1FPCH 3U9AH 3UTUH 1VCPA 1A0JA 2PSYA 1QNJA 3ZVCA 1NZQH 1QJ1B 1GI0A 1TRNA 1YCPH 4X1SU 1ELGA 1G9IE 2XTTB 4WY3A 1SQOA 1BBRH 4MPXA 1V6DA 3LIWA 4IGDA 1O3HA 2Z6BD 1O2PA 2FM2A 2ZO3H 3H7OA 3QTVH 1FN6A 3D65E 1P2OA 2FZZA 2OCVB 1O39A 4MTBA 1SPJA 1FNIA 1HYLA 2FI4E 1ZGVA 3RLYH 2FODA 2TGAA 3VGCC 3MH7A 5DKMA 5FPSA 2FO9A 2GZ7A 1G3DA 1NROH 1QBOA 1MQ6A 4X1RU 3F9EA 1P2QA 3KQ5A 1C2JA 3VXFH 1GDQA 5DP3A 3RM0H 2VINA 3SU4A 3NWUA 1O2WA 5AVDA 4O3UA 4AN7A 1O2TA 3G01A 4UFGH 2BD4A 1H4WA 1K1MA 1UK2A 1A0LA 1ZTLA 1ZPBA 4GHTA 2FYQA 1NRRH 5IYTA 4VGCC 1FY1A 1A2CH 3CENA 3UOPA 4AZ2B 1HAHH 1KDQA 5FXLA 1O5GH 4Y0ZE 1ZTJA 2VIQA 1GJCB 3Q76A 2G00A 1NO9H 2OTVA 1QY6A 2O8MA 1ZMNA 1O3BA 2QV1A 1C1WH 1GHAG 1MH0A 2CMYA 3B8JA 1T4UH 3F9HA 1LKAA 2IJOB 1RIWC 3SU1A 1GL0E 1YPHE 2Z3EA 2GTBA 3EA9A 4MPVA 5GCHF 1HJAB 5EW1H 1QB6A 4CRAA 5B6LA 2P3UB 1GMCF 1TNIA 1BUIA 3RU4T 2ZTXA 1PQ8A 4O97A 1O32A 1AFQC 1CHOG 1ZLRA 2O8WA 1DFPA 3BEFB 4K5ZA 2QA9E 2Y5FA 3B9FH 3SUEA 5LGOA 1Z8GA 1S81A 4UFFH 5TCAA 4ABJA 3W1EA 1SLVB 3CP7A 3LC5A 3EAJA 1GBKA 1EPTA 3F9GA 1QCPA 3RMNH 5LPFA 3TK9A 1D6RA 2BQ6B 5F53A 4CR9A 2AEIH 3PO1B 1THRH 1FY5A 5LPRA 2ZECA 3N99A 4YLUA 3LGVA 1P2JA 1VGCC 4SGAE 1FJSA 2ZPQA 5F8TA 3SV6A 1H8ED 3PWBA 4H6SB 3UR9A 2Y7ZA 1IHTH 1RGQA 1V2ST 2VH0A 1Q3XA 3PWCA 3RP2A 1T4VH 1K22H 3E16B 2V35A 1J15A 2WPHS 1WUNH 1UK3A 1JIMA 4TY6A 2YNBA 2XCNA 2W5EA 4FUEA 5J4SA 1V2PT 3M5LA 2QAAA 2A5IA 1M9UA 3ENSB 4X6NA 1IQKA 2OC8A 3VG8A 3GY3A 1NRPH 4B75A 1LHDH 1H8HD 2W7SA 1ANDA 1RTFB 1OYQA 2TGPZ 1GJ7B 4YZUA 1C5NH 1AWFH 1DWBH 4MG3A 3ZZ6A 3DUXH 1QURH 3MU0A 4DY7B 4F55A 2XYAA 5L2ZH 1O2GH 2WYJA 3ZZDA 2VIOA 2YNAA 3TH4H 3SI3H 1FXYA 1V2OT 3A8BA 3HKJB 4FUIA 3ZZ8A 1T8MA 4B2AA 2YMSD 1PYTC 4B71A 3V12A 1Z8IB 3RXHA 2EA3A 4DVAU 1W13U 1S6FA 3HGPA 1Z6JH 1S6HA 1ARCA 1SGIB 1V2KT 2GMTC 2FESH 1DWEH 4AX9H 1O2NA 1BMAA 1NFXA 2QXGA 4OS2A 3GDVA 2ZF0H 1ANCA 2FTMA 1WBGB 4AB8A 3PB1E 1S0QA 3SGAE 5HIZA 1ESAA 1C4V2 1TOMH 1IHSH 2QF3A 3FOAA 5KECA 2B9LA 3BG8A 1GBMA 2H5CA 3PROA 3EA7A 2PHBA 4ZXYH 3F2HA 2ZWLH 3TJNA 3O8CA 3MU1A 3PLBA 1TRYA 2VWNA 4BAMB 5DP6A 5C1UA 1SGYE 1ETRH 1C1PA 1MU6B 4Q7XA 2WPIS 3TIUA 5AHGH 4YOGA 2ZDNA 1A5IA 4FU9A 1DY8A 1O0DH 2BDYA 3SU3A 1ZPCA 1BTHH 1EOJA 3C1KA 3KL6A 3BTEE 4GPGA 3UREA 3RXPA 3QX5H 1ZPZA 4AB9A 3PMBB 1GI8B 2AGGX 2GZ8A 1LVYA 1C1UH 1MKXK 1QR3E 3K6ZA 1PPFE 1GI6A 3VB7A 2ZFFH 2JJ1D 5EJ1A 2ZDAH 1UCYK 1X7AC 3ZV9A 1ELEE 2CV3A 1BCUH 1SGNE 4IMZA 3S9BA 1BIOA 1IQLA 1SKYE 2RA3A 3URDA 3GDUA 2ZC9H 1PQ5A 3LH3A 2RCEA 3GCOA 2Y5HA 5GDSH 1D3DB 1HJ8A 2RDEA 3H7TA 1RIWB 3TJOA 2ZCHP 1TMTH 3BTFE 1MQ5A 1QFKH 3MMGA 4ABIA 2VNTA 1QA7A 2FOAA 4NIXA 2GX4A 3TH3H 4NCYA 1LQEA 3FANA 3U69H 3OE7D 1UJ1A 3BTQE 1G32B 4MNVA 1QQ4A 2ODYB 1NBME 2BQWB 3RUOA 3PRBA 1MU8B 1XXFA 3I29A 1O3KA 1AVXA 1AFQB 3U28C 2CJIA 2OQ5A 2BZAA 3P8NA 1CA0B 2OP9A 2AH4X 2STBE 5K0HA 1GJDB 5GJ4B 4I8KA 2FIRH 5E8EH 5L6NH 1LVBA 4IBLH 3U8TH 5T3HA 2VIWA 1LO6A 3UUZA 4Y8XA 1O2HA 2ALVA 3I77A 3VB3A 1JRSA 1E35B 2TGTA 4FU7A 4DGJA 1C2MA 3CS7A 2PLXA 2TRMA 3KNXA 4Y11E 1OWHA 1TWXB 5DJ7A 3GY6A 3V7TA 3SO3A 2D26C 1EUFA 1C1VH 2GZ9A 1BJUA 5C5NA 1SGFG 1MTNC 4AOQA 2BVSH 2GDEH 2ZI2H 1YWUA 4K1SA 2FOBA 2AS9A 3GCTG 5EQQA 3QN7A 2H6MA 5GXPA 3OY5U 4ACAA 2BDIA 3BTDE 4WXIA 2VB0A 2P94A 2P16A 4I7YH 3BSQA 3W95A 3LGUA 1GJ4H 5GPIB 1YM0A 4ZHMU 2SGFE 2ZU5A 1BBRE 3LGTA 4JZFH 5LPEA 4Z6AH 5B6OA 2FLBH 2UWLA 4GSOA 3A7VA 1D3TB 2ZTZA 4AGJA 3P92A 4U30A 1K1PA 2NWNA 1EKBB 2F9OA 5GIBA 3AK5A 4MVNA 1G36A 1XUJA 3V3MA 2P93A 5DSFA 1TBZH 4E7NA 2ZU4A 2F4LA 3CNRA 3WWFA 4RT1A 1J9CH 3TVJB 4JK6A 1GI4A 1HRTH 1O2XA 2G55A 1CGJE 5C0UA 1CA8B 1S83A 4B2CA 4JYVH 1EJMA 3MHWU 1P05A 2XOKD 4HI3A 4JCNA 2TBSA 1GHXH 1NU7B 3GY7A 1AKSB 1EB2A 2WPKS 1DE7H 2PSXA 3MOCA 2GMTB 2Y82A 4IS5A 4O03A 4WJG2 2AGEX 2PKAA 1SGTA 1AZ8A 3VB5A 1J16A 6LPRA 1XKBC 3LOXA 1VKYA 1Y5BT 3MH6A 1O33A 1MCTA 1P3CA 2A4OA 2EC9H 1W8BH 4M7GA 3PRDA 5BPEA 1PJPA 3SUFA 1NS3A 1RXPA 1SGPE 4B76A 4ASUD 1O3FA 1OKXA 2NU0E 3L33A 3DCLA 1P04A 1TNGA 1TGTA 4X0WU 3MNXA 2H9TH 2FX4A 1ETTH 3F9FA 1Z8JB 1GGDB 3A87A 2K8IA 4O9VA 1WCZA 4TSFD 3LJJA 5T6FA 1NU9A 1BDAA 1DWDH 1C5PA 1GPZA 1BTWA 3SV7A 3T26A 4FUHA 1FONA 1UHBA 1GHBG 2FXRA 3U8RH 1D9IA 2CHAC 4B73A 1BZXE 4JK5A 2RFKC 2Y7XA 1V2VT 2B0FA 1C1RA 1ABJH 4UEHH 1O35A 2ZGCA 4Y8YA 2W26A 4DT4A 3DFLA 1GDNA 4HG6A 4YO9A 3ZVBA 1H1BA 2XBVA 1HGTH 2KCOA 2FX6A 2R9PA 1LVMA 3B23B 2CF8H 1C5ZB 2K1QA 1FAKH 1QGFA 3KHVA 4AFQA 1BQYA 1QL7A 3D49H 1SB1H 1WQVH 1C5QA 2FPZA 3E90B 1O34A 1GCTC 1THPB 4ESTE 1CSOE 3TPIZ 3N7EA 3OTJE 3PO1C 4TYDA 4NZLA 2P59A 2L74A 3U8OH 4X1NU 2ZGHA 2ANMH 2XCFA 1BJVA 1O31A 2CGAA 3LJOA 4H42U 5A09A 3EE0B 6CHAC 3K6YA 2FTLE 1TAWA 3TNSA 1P3EA 4Q4LA 1UTJA 1GBIA 3LGWA 2UUJB 1DWCH 2VIVA 4NIVA 1O2JA 4ZHLU 1FPHH 1XUHA 5KEDA 1T31A 5GWZA 5DG6A 2BLVA 1KLIH 3KQDA 2R0LA 1C2KA 3OX7U 2ZNKH 3RXBA 4BANB 3BEIB 1P0SH 1SQTA 2ZTYA 3UNQA 1TQ7B 4OGXA 2C90B 4D7GA 2WV5A 1IQNA 3GCHB 1GMDF 3FP7E 1O3IA 1GJ6A 3TU7H 1OP8A 1OP0A 5EXMA 5JB9S 1W14U 4F48B 2A1DB 1C5SA 1HBTH 5ESTE 2A2QH 2ZDLA 3ATMA 2XBWA 1XUIA 3SU2A 3A8AA 3P8GA 1J17T 4ABGA 1AVGH 5EPYA 1PPGE 3SJOA 4GAWA 1ZRKA 1ZSLA 4A92A 1G3EA 4CRBA 4X6MA 4UFDH 8ESTE 4XBBA 1G2LA 3BTKE 3MTYA 1C2EA 1QRWA 1OWEA 1XKAC 4KTSA 4X6PA 4NZQA 1P2MA 5FL7D 3AAVA 1LPKB 1V3XA 5FX6A 1ANBA 2P95A 1LTOA 4FETA 1ZJDA 1YP9A 1EPTB 1TPAE 4GCHG 3SJ9A 1VCWA 5A2MH 1Y3VA 1MD7A 2FLRH 2PW8H 3IITA 2H1UA 4INHA 2GCTB 1FUJA 1C5WB 2BLQA 3KQEA 1QJ7B 4LK4A 2JETB 6ESTA 1FY8E 1SI5H 3Q3KA 1UTMA 4ZHAA 1NTPA 1HAOH 2HWLB 1YPMH 4LZ4B 3A82A 3KF2A 1HAGE 1ZHPA 3OEHD 1C5RA 3GY4A 5HYOA 3LKWA 2KCYA 3KQCA 4X6OA 1GBHA 4D9QA 4MNYA 2WINI 2C93B 3RXGA 1SGCA 3ZZBA 4DURA 2VGCB 2OK5A 3BF6H 3SGBE 1YPKH 2OUAA 4I8JA 4XBCA 4BTIB 1E0FD 3BTME 1GBBA 2ULLA 1TNKA 4I8GA 1C9TA 3S7HB 2BDCA 1TBRH 2OXSA 3F2FA 4IW4E 1YPJH 1IQEA 4FVBA 4ABDA 1UVSH 3O8DA 3P70B 3RXAA 2PTCE 4ABFA 6GCHG 3M3TA 4NA8A 1O36A 4HFPB 4NFFA 4MPUA 1NRNH 2ESTE 1SSXA 1P8VC 3P6ZB 1BHXF 5EOKA 1XVMA 4UFEH 2QXIA 1C9PA 4B6FA 1RTKA 2LPRA 1GBEA 1UTLM 4INKA 4BAQB 1ANEA 1VITG 3STIA 1EOLA 1CQQA 2BY8X 2RDLA 4Y71A 1GHZA 2J92A 4ABAA 3ATIA 2BMGB 1VZQH 1Y3UA 1BITA 3JZ2B 3EGKH 2PFEA 5FX5A 2THFB 2W3IA 2ZGJA 5JDUB 1Y8TA 2H2ZA 2PR3A 1SOTA 1TQ0B 2XWBI 2Q6FA 2CHAB 8GCHG 1E34B 4CR5A 2W6JD 1TE0A 4B1TA 1HAVA 2AMPA 1O3JA 2QGRA 4ZCNA 3M3SA 2HGTH 1OWIA 3M35A 1N8OC 1CHGA 3MFJA 1UTNA 2BX4A 2ALPA 4X2XA 1FDPA 3NUMA 3SOSA 1O5FH 1W0YH 2F3CE 2YMSB 5EJLA 3GS9A 4TWYA 1SLWB 1GHVH 1GG6B 2PGQB 1CA0C 2PWXA 3U1IB 1V2JT 3ZZCA 1HXFH 2OBQA 4YXWD 1P2NA 5PTPA 1O5AB 1AO5A 1O2VA 3E6PH 1P09A 2M5TA 3A7XA 4Q2KA 1MKWH 1YCPM 5FBEA 3WY8A 1GCTB 1HIAB 3SV2H 1O3OA 3MQKC 1THSH 1OP2A 1XUKA 1KXCA 1EP6A 1XVOA 1TX7A 4I31A 6CHAB 1C2HA 1BTPA 1KXDA 1OYTH 4Y10E 2FOCA 2QF4A 2AHME 1YY3A 3SJIA 4UONA 5C1XA 3KQBA 3FZDA 3QDZB 2BOHB 3GYMA 1CE5A 3OYPA 4XSKU 2B8OH 1AFEH 1LMWB 3S9CA 1TOCB 1JWTA 1TFXA 1Y3XA 2G81E 1C1MA 1W0KD 7KMEH 4IN2A 4THNH 4ACBA 1O3PB 2BLWA 4NSYA 4OS6A 4WWYA 3A88A 3QGJA 3RXIA 4H6TA 1Y5AT 3F0OA 2OBOA 2G8TA 4NFEA 3RXFA 3D23A 2BY6X 4JYTA 2OC0A 4FUDA 1YGCH 1Y3WA 3MNSA 1TRMA 1YCPK 4NIYA 1N1LA 1XMNB 5FCKA 3P8OA 1BBRK 1IQHA 2NU2E 3W94A 4CBNA 1QB9A 1GI2A 2Z9JA 2ZFTA 1Q31A 5DK1A 5EXNA 3BV9B 1EZUC 3ATLA 4XBDA 3PTNA 3SGQE 1G37A 2GT7A 1PPBH 2HNTF 4IN1A 1V2LT 2AMQA 1BTUA 2Z9IA 1ZTKA 3QO6A 2F9UA 5C5OA 1EJAA 1P11E 1HLTH 5CHAB 4LXBH 5DP7A 1GBLA 3EDXB 1GJ5H 1OOKB 3T25A 1KXFA 1P2IA 1K28D 1NRSH 2P8OB 1A7SA 1OS8A 3DD2H 1VITH 4BXSA 1MAYA 3FFGA 1L2EA 2I6SA 5T1VA 2AFQB 3ZZ9A 3FVFB 1F92A 1MBQA 2WPMS 2O8UA 3SI4H 1UTKA 1GGDC 2AIPA 3ZIAD 2JKHA 4PROA 2J98B 1K9OE 3NZIA 2QF0A 4HZHA 3F0PA 4XRNA 2A7JA 2HALA 2TPIZ 4NSVA 5C17A 1B0FA 1LHGH 3SQEE 1K1NA 3SU6A 2SNVA 4K8YA 3O8RA 3TH2H 5J4QA 2LP6A 4AYVB 3NKKA 1L1JA 2FS8A 1Y3YA 1YLCA 4I86A 1J8AA 2XNDD 1D4PB 4K60A 2D8WA 3E91A 3KYGA 4K1EA 5A0AE 1BHXB 1KYNA 4JZDH 3T27A 2QXHA 2ZHQH 2O9QA 1V2WT 1W2KH 3UNSA 1ARBA 4X8SH 2BD3A 1FN8A 3ATKA 4XE4A 3ODDA 1LPGB 3STJA 1LKBA 4IC6A 2BLOA 2FEQH 2BYAX 1GWAA 1W0ZU 1TGBA 2Y80A 2ZDKA 1YLNA 2QYIA 2F9NA 1FZZA 2ZZUH 2OLGA 1FQ3A 4HTCH 2YOLA 1EFRD 3HATH 2ZCKP 3FO8D 1NFYA 1AB9B 2FI3E 1VR1H 5EJZA 3R0FA 1O2RA 2XC5A 1KLTA 3MU5A 3FKSD 3SZEA 1GJAB 1D3PB 3E0NB 1EQ9A 3ZYDA 1W7XH 1GJ8B 4P00A 1IQGA 2QN5T 4BAHB 3VEQB 3OY6U 1C5YB 1KXBA 2C3SA 3V13A 1N8OB 1HXEH 2J97A 2ZEBA 3E3TA 1AD8H 2G4UA 5HMAA 1BA8B 1UVPA 4D9RA 2WUCA 3I78A 2FP7B 1SG8B 1ZGIA 1NY22 1C1NA 4X2WA 1QBVH 1NBMD 1SGFA 4M9FA 3KYFA 2QCYA 2STAE 2JH6D 3RXJA 2DE9A 2XC4A 3ZYEA 1IQIA 4GVUA 1EZQA 1GMDG 2GD4B 3ZVDA 3UOUA 3GCHC 3TJUA 1P12E 3UQVA 2P3FH 1INCA 1T8NA 4A1XA 5AFZH 1HPGA 2V7QD 2Z3DA 2B5TB 2PGBB 2WPDD 1YBWA 3TK5A 2JDID 1CHOF 4DOQA 1AHTH 4AGKA 2ZU1A 1MABB 4I33A 1ELBA 1AY6H 4XFQA 1TNJA 2NU4E 3AW0A 1E38B 4Y76A 3HPTB 5C20A 4WF8A 4GUXA 3ZVFA 2D1JA 1QRZA 1GBJA 4A1VA 3BN9A 1FMGA 3ZVAA 4DCDA 3GY2A 2PTNA 3NRLA 3RXOA 2K0QA 2GGVB 3T29A 3R3GB 1V2UT 2BDAA 3L3TA 1YLDA 2AERH 2R2WU 4U01A 5AF9H 1MTUA 1UVUH 1JOUB 3A7TA 2F91A 5HGGA 3SNDA 1EPTC 1TMUH 1QTFA 4JZ1A 1DXPA 2LNCA 3OU0A 1P2KA 2GCHG 1P02A 3RM2H 3DHKH 3ATWA 1KSNA 2GCTC 2VJ1A 1S85A 7LPRA 2JETC 1C1QA 1O2QA 1V2TT 2FOMB 2HVXA 1YYY1 1AU8A 1GJ9B 3SU0A 3IG6B 3N7OA 4FUBA 1L1NA 3SNEA 2J95A 1PQAA 1O2IA 5JPMH 2QF5A 2XXLA 2ZIQH 4J2YB 2VGCC 3S7KB 5FHTA 4MNXA 3A80A 1ZYOA 5A0BA 2BTCE 2GV7A 1TA2A 3RC5A 1O3CA 4ISOA 4Q80A 7GCHF 1BMLA 2VIPA 2XW9A 1V2NT 1TA6A 1QBNA 2FI5E 2GDDA 3UPEA 1WYKA 2G51A 4A5TS 3GYLB 4FXGH 5EW2H 3AW1A 2KR7A 1K21H 2ILNA 1DITH 3UFAA 5CHBA 3ZZ3A 3F1SB 1W7GH 2FMJA 2Y6TA 4AFUA 2BHGA 2H9HA 3S0NA 1AVWA 5IDKA 2VWOA 1DSTA 3A7YA 3BG4B 3RU4D 3SUDA 1GBAA 1KTTB 4F49A 2KAIB 3GCNA 1TNHA 2HRVA 3AASA 1DUEA 3WW7A 1O30A 1K1OA 1SFIA 2A45B 1V2RT 1SGDE 3ODFA 2JIZD 1ZHRA 2L6OA 4Y7AA 3PLKA 4XD7D 2KCAA 4XDEA 5GCHG 1TX8A 2AMDA 4K8BA 1UTPA 1C4U2 1UVTH 1COWD 1Q2WA 4YTAA 1GMCG 1UMAH 2IPQX 2CXVA 3OFND 5F6MA 1DSUA 4TY7A 4NGAH 2V3OH 4Y6DA 3U98H 3NCLA 1WV7H 5IK2D 3WWBA 1S84A 3N7DA 4I8HA 1EASA 1G3CA 1CT0E 4LOYH 4XOJA 2YMSC 1EATA 1SC8U 1GG6C 4Y7BA 4CRGA 3TGJE 1FV9A 4NWKA 4ZKNU 3K65B 2A5KA 1AI8H 1AE8H 1CBWC 1DANH 2XNIA 4SGBE 2J34A 2CN0H 4X1QU 2GVFA 1MUEB 5CE1A 3UY9A 4WMFA 4E06H 3RMMH 2NU3E 2ZHFH 4FOUC 4UDWH 5ETXA 5K7RA 1W10U 4KTUA 2Z9KA 4YOIA 4CRCA 5DP9A 1EJNA 4OS4A 3RC4A 1PYTD 2FYRA 1YPLH 1OWKA 1YPEH 5C94A 4AFZA 3H09A 3LONA 5FPTA 2VVVA 3PLPA 5TJXA 1UW7A 2PUQH 3M7TA 1S6LA 2BY5X 3PV2A 3RDZA 1IOEA 5JYIA 2W7UA 2F9PA 1YPGH 4Q7ZA 1AE5A 1TBQH 2A7CA 1C4Y2 1ZSJA 2FS9A 4DT7B 2QE7D 1NRQH 2CK3D 1KDQB 5F8ZA 1GVZA 1DX5M 1DVAH 5FAHA 2WV9A 2Z7FE 1ELVA 2Q1JA 2ZU2A 3HGNA 1FY3A 5SGAE 3Q3YA 1IQMA 4B74A 5FCRA 3RXUA 4JYUH 1VJAU 5F8XA 1P01A 2I6QA 1VJ9U 4Y0YE 1AKSA 1AN1E 1C5UA 2HPPH 1ORFA 3BTGE 1EAWA 3GY8A 3PV5A 2JJ2D 5AFYH 2JH5D 2OC7A 5JBBS 5DN6D 1SOZA 2UUYA 5A0CA 1DT2A 2ODPA 1QL9A 4ZMAH 1LQDB 1C2DA 4J1YA 3QWCH 1ZR0A 2J5UA 2NU1E 1EB1H 1KTSB 3RXEA 1T8OA 1E79D 1K1IA 1Z8RA 1O2MA 2WHXA 2Z94A 4MNWA 1BTXA 1LVOA 1MTWA 2Z9LA 1FIZA 4ZKRU 3MNCA 4Q63A 2PKSB 3BTTE 3TNTA 5CHAC 2ZFQH 3F3BA 2EI6A 4TPIZ 1AMHA 5A8ZA 4MLFB 2UUFB 1WTGH 3OAAD 2WUBA 1ZHMA 4CH2B 5HKKD 2G5NA 5CDFE 1HCGA 2V3MA 3GCTF 3MO6A 3RMOH 4AG2A 1NESE 2R2MB 2P8OC 2P3TB 1BRBE 2O8TA 1FI8A 2XBYA 1TALA 1SGEE 2UUKB 3A81A 3KIDU 4MPWA 3LT3A 4MQAA 1DUAA 3NK8A 3HKIB 3RXTA 4YOJA 1SMFE 3DSPA 1O5BB 4NG9H 1WQSA 1ELDE 1O3DA 2BD7A 2SFAA 2JH0D 1H9LB 1A1RA 2XBXA 2ZP0H 2C8WB 3DFJA 4GHQA 2FDAA 4NIWA 1W3CA 1S82A 2Z3CA 1UTQA 1ID5H 1GMHF 2F43B 3MYWA 3URCA 1S5SA 1QHRB 1DXWA 1BTZA 1O2LA 3FP6E 3SV8A 4KELA 1ACBE 3SNBA 1A61H 1MBMA 1SGQE 1MD8A 3MU4A 1WTHD 3KEEA 1BTYA 3C27B 2Y81A 2ZQ1A 1YC0A 1ZMLA 2WYGA 5JBAS 1GHYH 1U6QA 1TIOA 1P10A 2IJD1 1HB0B 3JZ1B 1O2KA 1PPZA 1W0JD 3BTWE 1LPZB 1C2LA 2FOHA 2BXUH 5EQRA 1QZ8A 3RXMA 4BAOB 1AWHB 1D3QB 2BD8A 3ELAH 1A0HB 4AG1A 1LHEH 1TMBH 4FU8A 3RLWH 1AB9C 3A86A 3LDXH 4KTCA 3F2GA 3EQ0H 4RT0A 1WSSH 2BY7X 1UO6A 4Y8ZA 2Y5GA 3MO3A 1XM1A 2QXJA 2KM0A 5T6DA 1A4WH 1Y5UT 2C4FH 3VXEH 2R3UA 2BM2A 1AGJA 1KY9A 1ZZZA 1LCYA 4BOHA 3SW2B 1GBFA 1QJ6B 1KMHB 3GICB 2WV4A 2AIQA 3SQHE 5DP4A 2VVCA 4AFSA 1C2GA 2GT8A 2DUCA 3NPSA 2WPLS 3SBKA 1K1JA 1CO7E 5L2YH 1PQ7A 3LU9B 2BZ6H 2CF9H 1MTSA 2ZU3A 4ISNA 4ZXXH 1GHBF 1K0HA 4DIHH 1DLEA 4ISLA 2EY4C 4Y79A 1HFDA 4OS5A 4WH8A 4Q7YA 1CBWB 4GLYA 3L6PA 3E1XB 3HK3B 1OWJA 3NXPA 1C5TA 1ZMJA 1FY4A 4QT8C 3BIUH 1TONA 1HAXB 3AVZA 3M3VA 2ZG0H 1MKXH 3TGIE 3LH1A 3QUMP 1C2IA 2F9BH 3M37A 1NFUA 3UR6A 1UCYH 4TT3D 1Z1JA 1MZAA 1O37A 1WOFA 4RKOB 4E05H 1TGSZ 1W11U 1E1QD 4TPYA 1GI9B 1A3EH 1DPOA 2GP9B 1ZRBA 4ABBA 3Q3XA 2XC0A 2SGDE 5JBTA 4K3JA 4ZH8A 9LPRA 3TITA 3SYJA 2BD5A 3EA8A 4P02A 1ELFA 3PMHB 4OM9A 4NWLA 5EODA 2VIDA 1F0SA 2BDHA 4DJZB 1P57B 3ZV8A 5I46H 1WDIA 1RFNA 5HIYA 5KGOA 4AYYB 1NC6A 2B7DH 1OX1A 5DP8A 1PFXC 1EAUA 2ZPSA 4WH6A 1G2MA 2ZFSA 1T8LA 1E36B 4ISHH 1XXDA 2QY0B 5FPYA 3SN8A 3MU8A 3PYHA 3OSYA 3M5MA 1L1GA 3M5OA 4Z0KA 2OQUA 1SLUB 1C1OA
chains in the Genus database with same CATH topology
1RRKA 1BOQA 5EG4A 4INLA 2EI8A 2IN2A 3S69A 2BQ7B 3IWMA 2IPHA 8KME2 5H4IB 3UQOA 1TLDA 3ZZ7A 3A89A 1ELTA 4CHAB 2ANKH 1GHWH 1RTLA 4JMYA 2HNTC 1C1TA 3GDSA 2C8ZB 2BB4A 3PTBA 1F0TA 3P8FA 1C5MD 3RXQA 4I32A 4KP0A 1OSSA 1TX6A 1SR5C 7GCHG 1O5DH 2OD3B 3ESTA 4ABEA 3BTHE 2FWWA 1AUJA 1H9HE 4K69A 3RXVA 3TK6A 2FOEA 4WMDA 3ZZ5A 5E0JA 5C3NA 1NFWA 3ZZ4A 2D2DA 1DDJA 1F2SE 3E8LA 3U1JB 1B5GH 1D6WA 1O3MA 5C67A 1BMNH 1WAYB 1SHHB 3A83A 5C1YA 4ZKOU 4RN6A 2A2XH 1CGIE 1GVLA 3BG4C 3KCGH 4GCHF 4KGAA 4B2BA 3RXCA 5C2ZA 1UVOA 1O3EA 5T6GA 4TWWA 2HPQH 2ZFPH 2XWAA 4CH8B 1RD3B 1PPHE 4JZEH 1EP5A 3K2UA 3SZNA 1MAXA 4YESB 1B7XB 3KGPA 2V3HH 4BAKB 5FBIA 1C5VA 1YF4A 4CREA 3K9XB 1EX3A 1LHFH 2A4RA 4FVDA 2R3YA 4FUCA 4YT7H 1HIAA 1L4DA 3QZRA 3SHAH 1H9IE 4RKJB 3VGCB 1C5OH 1O2SA 1TB6H 1TGNA 1QA0A 3M5NA 3Q00A 5JB8S 3TGKE 2VVUA 9ESTA 5ESBA 1MKWK 2FOFA 1O3GA 2TIOA 2UWPA 1KXAA 1BT7A 5BRRE 6GCHF 1PPCE 1MTVA 2VU8E 1CT2E 1N6XA 3M61U 4VGCB 1XUGA 1DS2E 1C5LH 3MH4A 3QZQA 2PKAB 1IQJA 4FUJA 2ANYA 1BRCE 1MMJN 4A7IB 3P17H 2VWLA 1EZSC 1H8DH 2EEKA 2H5DA 1VITF 2GV6A 2AYWA 3H5CB 4KKDA 3MWIU 1Z7KA 3SNCA 4A6LA 1GHAF 4ABHA 3T62A 5G4BA 1AIXH 1DLKB 1TYNA 5ABWA 4X2YA 3RXRA 2RG3A 1FAXA 4X8TH 2OINA 8GCHF 4BXWA 2C8XB 5EU8A 1F5RA 1SHYA 1HDTH 2ASUB 2WPJS 1CGHA 2VH6A 1E37B 1Z71A 2ZDVH 4YM9A 4MDSA 2J9NA 1NN6A 3QK1A 1RS0A 2A5AA 2H9EH 3A8DA 1UHBB 4FUFA 4RSPA 3SJ8A 2ZGXH 1BMMH 3SHCH 1GI3A 1Z1IA 4UD9H 3QTOH 2A4QA 4NA7A 4OGYA 3SORA 3VB4A 1ABIH 3DT0H 1ETSH 1RJXB 1O2UA 1HJ9A 5A8XA 3QGNB 2SGEE 1TNLA 3RXKA 2A32A 3QLPH 3MNBA 3RXDA 1SGRE 1XX9A 1C2FA 3UWJH 1GVKB 1SLXB 2BD9A 5TCCA 3RXLA 1VGCB 4U32A 5HM2A 1LHCH 1SFQB 4BTUB 2ZQ2A 2IOTA 1QQUA 2PKSC 7ESTE 4WMEA 2F83A 1K1LA 3A84A 5CMXH 4CRFA 4YLQH 1IQFA 1GBCA 4FUGA 3LGIA 2G5VA 2RA0A 3MI4A 1ELCA 2G4TA 3T28A 4HGCA 1QB1A 1YPHC 5DO4H 2ZHEH 3A7WA 4F4OC 1B0EA 1ZSKA 1O5CB 1DICA 1VCQA 1O3NA 1P9UA 4BTTB 1PPEE 4AORA 4R8TB 4X8VH 3RMLH 4E7RG 1NM6A 1NPMA 3F6UH 3EYDA 3FP8E 1JIRA 4YT6H 1A5GH 1DY9A 1OWDA 3F68H 2ZCLP 4DW2U 2ZKSA 1H8IH 1HAIH 1YKTA 1JBUH 4DIIH 5EGMA 5E0GA 4I8LA 1L4ZA 1MCVA 3LC3A 1GDUA 2ZGBH 1HNEE 1P9SA 5HM9A 2BVRH 1GMHG 2HLCA 1IAUA 5DP5A 2ZA5A 4NA9H 4ZAEA 8LPRA 5LH8A 3VPKA 1A46H 2DE8A 1GBDA 1Z6EA 1WU1A 2A31A 1DM4B 1HUTH 3PMAB 3D62A 2HOBA 1CU1A 4O3TA 1T32A 1JMOH 3ZVGA 1MZDA 5E0HA 2FOGA 2SGPE 4OS7A 1KXEA 1J14A 3T2NA 1FIWA 1EAXA 5DGJA 1AQ7A 4K1TA 3RU4E 4LZ1H 1O2ZA 4WXVA 4X2VA 1JXPA 2G52A 3A7ZA 1SBWA 3VB6A 1O2YA 3PV4A 2AGIX 4WVPE 2V6NA 1QRXA 2BD2A 1C5XB 4U2WA 2F9VA 5E2PA 3UIRA 5DPAA 2O8LA 1HAYB 1UTOA 3ITIA 5E2OA 2ANWA 1UK4A 3SV9A 2PV9B 2ZDMA 1F7ZA 3PMJA 1HJAC 1UCYE 2Q6GA 1CT4E 1LDTT 1DOJA 1F5LA 1SL3A 1BB0B 1HAPH 2SGAA 1G3BA 2HNTE 1GI7B 1BRUP 1W12U 3GY5A 5HXFA 4D76A 3UNRA 3A8CA 4ZROA 1CVWH 1GJBB 2A0QB 2W3KA 1O38A 2ZPRA 4D8NA 4X8UH 4D7FA 3T5FH 1ESBA 2SNWA 2SGQE 5EPNA 3SU5A 1HAZB 1HV7A 1TGCA 1A3BH 2Q6DA 2QC2A 2ODQA 1FLEE 1TPOA 2J4IA 3M7UA 5EXLA 1Y59T 4K2YA 4JZIA 3RXSA 1O3LA 1V2MT 1P03A 3LGYA 2ZHWH 2BVXH 4CBOA 3CS0A 4X1PU 2UWOA 2BX3A 1S0RA 1JRTA 3ZVEA 1XUFA 4ZUHA 1GL1A 1ZOMA 1GI5A 2GKVE 1NT1A 1A5HA 3SJKA 5F03A 3KN2A 1TPSA 1O5EH 3PM3A 3SNAA 4BNRA 3DA9B 1T7CA 3RC6A 1F0UA 1L0ZA 2C8YB 5I25A 2A4GA 5A8YA 1TABE 1GI1A 2BXTH 2OC1A 1HAVB 2XRCA 1O2OA 1SVPA 2A7HA 3TLOA 3S9AA 4ASHA 4IMQA 3FZZA 3GOVB 1TPPA 3GISB 2Z9GA 3BIVH 4CHAC 1SQAA 4UE7H 5JBCS 3FAOA 3M36A 1EXFA 3V0XA 3P95A 5EQSA 4DG4A 4A1TA 3SUGA 1EAIA 3E0PB 3LPRA 1KIGH 1F5KU 1ZJKA 1BRAA 1MTNB 1ELAA 3O8BA 1QL8A 2BDGA 1QIXB 1C1SA 4R0IA 1OXGA 1KLJH 2V0BA 1F0RA 1GBTA 4H4FA 2BY9X 4OS1A 3VFEA 2ZFRH 3UWIA 2J94A 2KAIA 4CRDA 1P06A 1ESTA 5L30H 3M7QA 2BOKA 3MH5A 3AAUA 3ZZAA 4IC5A 1N6YA 1O3AA 3MO9A 1EZXC 4ZKSU 1G30B 4ISIH 3BEUA 2J2UA 1V2QT 2R0KA 3HK6B 2QIQA 1OPHB 2EI7A 3Q77A 1AUTC 2VWMA 1GCDA 3TJVA 2J38A 2PUXB 2TGDA 3A85A 2GCHF 2BDBA 1AZZA 1K2I1 2ZHDA 1FPCH 3U9AH 3UTUH 1VCPA 1A0JA 2PSYA 1QNJA 3ZVCA 1NZQH 1QJ1B 1GI0A 1TRNA 1YCPH 4X1SU 1ELGA 1G9IE 2XTTB 4WY3A 1SQOA 1BBRH 4MPXA 1V6DA 3LIWA 4IGDA 1O3HA 2Z6BD 1O2PA 2FM2A 2ZO3H 3H7OA 3QTVH 1FN6A 3D65E 1P2OA 2FZZA 2OCVB 1O39A 4MTBA 1SPJA 1FNIA 1HYLA 2FI4E 1ZGVA 3RLYH 2FODA 2TGAA 3VGCC 3MH7A 5DKMA 5FPSA 2FO9A 2GZ7A 1G3DA 1NROH 1QBOA 1MQ6A 4X1RU 3F9EA 1P2QA 1C2JA 3VXFH 1GDQA 5DP3A 3RM0H 2VINA 3SU4A 3NWUA 1O2WA 5AVDA 4O3UA 4AN7A 1O2TA 3G01A 4UFGH 2BD4A 1H4WA 1K1MA 1UK2A 1A0LA 1ZTLA 1ZPBA 4GHTA 2FYQA 1NRRH 5IYTA 4VGCC 1FY1A 1A2CH 3CENA 3UOPA 4AZ2B 1HAHH 1KDQA 5FXLA 1O5GH 4Y0ZE 1ZTJA 2VIQA 1GJCB 3Q76A 2G00A 1NO9H 2OTVA 1QY6A 2O8MA 1ZMNA 1O3BA 2QV1A 1C1WH 1GHAG 1MH0A 2CMYA 3B8JA 1T4UH 3F9HA 1LKAA 2IJOB 1RIWC 3SU1A 1GL0E 1YPHE 2Z3EA 2GTBA 3EA9A 4MPVA 5GCHF 1HJAB 5EW1H 1QB6A 4CRAA 2P3UB 1GMCF 1TNIA 1BUIA 3RU4T 2ZTXA 1PQ8A 4O97A 1O32A 1AFQC 1CHOG 1ZLRA 2O8WA 1DFPA 3BEFB 4K5ZA 2QA9E 2Y5FA 3B9FH 3SUEA 5LGOA 1Z8GA 1S81A 4UFFH 5TCAA 4ABJA 1SLVB 3CP7A 3LC5A 3EAJA 1GBKA 1EPTA 3F9GA 1QCPA 3RMNH 5LPFA 3TK9A 1D6RA 2BQ6B 4CR9A 2AEIH 3PO1B 1THRH 1FY5A 5LPRA 2ZECA 4YLUA 3LGVA 1P2JA 1VGCC 4SGAE 1FJSA 2ZPQA 5F8TA 3SV6A 3PWBA 4H6SB 3UR9A 2Y7ZA 1IHTH 1RGQA 1V2ST 2VH0A 1Q3XA 3PWCA 3RP2A 1T4VH 1K22H 3E16B 2V35A 1J15A 2WPHS 1WUNH 1UK3A 1JIMA 4TY6A 2YNBA 2XCNA 2W5EA 4FUEA 5J4SA 1V2PT 3M5LA 2QAAA 2A5IA 1M9UA 3ENSB 4X6NA 1IQKA 2OC8A 3GY3A 1NRPH 4B75A 1LHDH 2W7SA 1ANDA 1RTFB 1OYQA 2TGPZ 1GJ7B 4YZUA 1C5NH 1AWFH 1DWBH 4MG3A 3ZZ6A 3DUXH 1QURH 3MU0A 4DY7B 2XYAA 5L2ZH 1O2GH 2WYJA 3ZZDA 2VIOA 2YNAA 3TH4H 3SI3H 1FXYA 1V2OT 3A8BA 3HKJB 4FUIA 3ZZ8A 1T8MA 4B2AA 1PYTC 4B71A 3V12A 1Z8IB 3RXHA 2EA3A 4DVAU 1W13U 1S6FA 3HGPA 1Z6JH 1S6HA 1ARCA 1SGIB 1V2KT 2GMTC 2FESH 1DWEH 4AX9H 1O2NA 1BMAA 1NFXA 2QXGA 4OS2A 3GDVA 2ZF0H 1ANCA 2FTMA 1WBGB 4AB8A 3PB1E 1S0QA 3SGAE 1ESAA 1C4V2 1TOMH 1IHSH 2QF3A 2B9LA 3BG8A 1GBMA 2H5CA 3PROA 3EA7A 2PHBA 4ZXYH 2ZWLH 3TJNA 3O8CA 3MU1A 3PLBA 1TRYA 2VWNA 4BAMB 5DP6A 5C1UA 1SGYE 1ETRH 1C1PA 1MU6B 4Q7XA 2WPIS 3TIUA 5AHGH 4YOGA 2ZDNA 1A5IA 4FU9A 1DY8A 1O0DH 2BDYA 3SU3A 1ZPCA 1BTHH 1EOJA 3C1KA 3KL6A 3BTEE 4GPGA 3UREA 3RXPA 3QX5H 1ZPZA 4AB9A 3PMBB 1GI8B 2AGGX 2GZ8A 1LVYA 1C1UH 1MKXK 1QR3E 3K6ZA 1PPFE 1GI6A 3VB7A 2ZFFH 2ZDAH 1UCYK 1X7AC 3ZV9A 1ELEE 2CV3A 1BCUH 1SGNE 4IMZA 3S9BA 1BIOA 1IQLA 2RA3A 3URDA 3GDUA 2ZC9H 1PQ5A 3LH3A 2RCEA 3GCOA 2Y5HA 5GDSH 1D3DB 1HJ8A 3H7TA 1RIWB 3TJOA 2ZCHP 1TMTH 3BTFE 1MQ5A 1QFKH 3MMGA 4ABIA 2VNTA 1QA7A 2FOAA 4NIXA 2GX4A 3TH3H 4NCYA 1LQEA 3FANA 3U69H 1UJ1A 3BTQE 1G32B 4MNVA 1QQ4A 2ODYB 2BQWB 3RUOA 1MU8B 1XXFA 3I29A 1O3KA 1AVXA 1AFQB 2CJIA 2OQ5A 2BZAA 3P8NA 1CA0B 2OP9A 2AH4X 2STBE 5K0HA 1GJDB 5GJ4B 4I8KA 2FIRH 5E8EH 5L6NH 1LVBA 4IBLH 3U8TH 5T3HA 2VIWA 1LO6A 3UUZA 4Y8XA 1O2HA 2ALVA 3I77A 3VB3A 1JRSA 1E35B 2TGTA 4FU7A 4DGJA 1C2MA 3CS7A 2PLXA 2TRMA 3KNXA 4Y11E 1OWHA 1TWXB 5DJ7A 3GY6A 3V7TA 3SO3A 2D26C 1EUFA 1C1VH 2GZ9A 1BJUA 5C5NA 1SGFG 1MTNC 4AOQA 2BVSH 2GDEH 2ZI2H 4K1SA 2FOBA 2AS9A 3GCTG 5EQQA 3QN7A 2H6MA 5GXPA 3OY5U 2BDIA 3BTDE 4WXIA 2VB0A 2P94A 2P16A 4I7YH 3BSQA 3W95A 3LGUA 1GJ4H 5GPIB 1YM0A 4ZHMU 2SGFE 2ZU5A 1BBRE 3LGTA 4JZFH 5LPEA 4Z6AH 5B6OA 2FLBH 2UWLA 4GSOA 3A7VA 1D3TB 2ZTZA 4AGJA 3P92A 4U30A 1K1PA 2NWNA 1EKBB 2F9OA 5GIBA 4MVNA 1G36A 1XUJA 3V3MA 2P93A 1TBZH 4E7NA 2ZU4A 1J9CH 3TVJB 4JK6A 1GI4A 1HRTH 1O2XA 2G55A 1CGJE 1CA8B 1S83A 4B2CA 4JYVH 1EJMA 3MHWU 1P05A 4JCNA 4HI3A 2TBSA 1GHXH 1NU7B 3GY7A 1AKSB 1EB2A 2WPKS 1DE7H 2PSXA 3MOCA 2GMTB 2Y82A 4IS5A 4O03A 4WJG2 2AGEX 2PKAA 1SGTA 1AZ8A 3VB5A 1J16A 6LPRA 1XKBC 3LOXA 3MH6A 1Y5BT 1O33A 1MCTA 1P3CA 2A4OA 2EC9H 1W8BH 4M7GA 5BPEA 1PJPA 3SUFA 1NS3A 1RXPA 1SGPE 4B76A 1O3FA 1OKXA 2NU0E 3L33A 1P04A 1TNGA 1TGTA 4X0WU 3MNXA 2H9TH 2FX4A 1ETTH 3F9FA 1Z8JB 1GGDB 3A87A 4O9VA 1WCZA 3LJJA 5T6FA 1NU9A 1BDAA 1DWDH 1C5PA 1GPZA 1BTWA 3SV7A 3T26A 4FUHA 1FONA 1UHBA 1GHBG 2FXRA 3U8RH 1D9IA 2CHAC 4B73A 1BZXE 4JK5A 2Y7XA 1V2VT 2B0FA 1C1RA 1ABJH 4UEHH 1O35A 2ZGCA 4Y8YA 2W26A 3DFLA 1GDNA 4YO9A 3ZVBA 1H1BA 2XBVA 1HGTH 2FX6A 2R9PA 1LVMA 3B23B 2CF8H 1C5ZB 2K1QA 1FAKH 1QGFA 3KHVA 4AFQA 1BQYA 1QL7A 3D49H