1LTOA

Human alpha1-tryptase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCLGPDVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFPPGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDMLCAGNSQRDSCKGDSGGPLVCKVNGTWLQAGVVSWDEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords alpha tryptase I
publication title The Crystal Structure of Human alpha1-Tryptase Reveals a Blocked Substrate-binding Region
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ltoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ltoA01
1FI8A 1NO9H 1WTGH 1ELEE 2BDGA 4HI3A 1MCTA 2FP7B 3P95A 3BTFE 3TGKE 2FOGA 5F8XA 3UNRA 1XXDA 1TBRH 3ZZ3A 1SG8B 3MU1A 1NRRH 1V2JT 1EUFA 1KXCA 1MTSA 1F7ZA 5CHAB 2XBWA 4HGCA 2PSXA 2ANYA 4NCYA 4ZH8A 2ZCLP 1J15A 1WU1A 1TPAE 5L30H 2OC1A 1OP2A 1Y3XA 2ZFRH 4LZ4B 1QRXA 4E05H 1P04A 4ABDA 1P8VC 1EXFA 3LPRA 1HDTH 1HUTH 2STBE 3U9AH 1L1GA 4D9QA 1IQKA 1GBTA 1CE5A 1BRBE 2BZ6H 1GBLA 3BTQE 1C5PA 1SGNE 1UO6A 3QLPH 4H4FA 3UPEA 2I6QA 4BAKB 3PO1B 1SQTA 3KGPA 1FY3A 1H8DH 5GCHG 2Q6DA 2GCHG 4AYVB 2VWMA 4O03A 5JBCS 4CRBA 5EXLA 1AQ7A 2QC2A 1SGEE 3PV4A 2BOHB 3P8OA 1FY5A 2ZP0H 3M5NA 1BZXE 3M7TA 1KY9A 1MBQA 2BD5A 1OP0A 4THNH 2XNIA 2O8UA 2G81E 1SSXA 1P02A 1PJPA 3TNSA 6GCHG 1MTNB 4TPIZ 1TFXA 3SN8A 4A6LA 2ZTZA 1C5QA 3MU8A 3SU0A 3TU7H 5DKMA 2KAIB 1G30B 1Y3UA 3CS0A 1YP9A 2FO9A 3BG4B 1O5EH 1C9TA 3SI3H 3AAUA 2RA3A 1B0EA 1MKXK 4MPXA 2QV1A 1O3BA 1FY1A 4FUHA 1K1IA 2JETC 2F9OA 1GI7B 1O3FA 1F92A 1UTLM 1O5CB 2OC0A 3PO1C 1P57B 2P93A 1TBQH 3SOSA 1NS3A 1KYNA 1TGTA 1W10U 1HAZB 1OWIA 3RLWH 3SNCA 3RXEA 1LQDB 1SQOA 1BTUA 1Y5AT 2FOMB 4A7IB 1C4U2 4K3JA 1EB2A 5LPRA 2TGPZ 2QCYA 1MKWH 2ZTYA 3F9HA 2GTBA 3A83A 4IMQA 3P8FA 3RXUA 3GCTG 2Z3EA 1ZHMA 2ZFFH 4FU9A 4AYYB 1CT4E 1A61H 1GCTB 2G55A 1DWDH 3TK5A 1Z8RA 3V0XA 1F5RA 1BITA 1ELTA 2QGRA 3BG4C 1D6RA 4ASHA 4Q7YA 3GDUA 3KN2A 1ZMLA 2AGEX 2BX3A 3IITA 1T32A 2C3SA 1HJAC 2VH6A 1K1LA 4I33A 4FU8A 4U2WA 4A92A 3MNCA 2FPZA 2J92A 2CGAA 4LXBH 3PTNA 1C2IA 3MU4A 1HCGA 3O8BA 3K6YA 3W95A 3E0NB 1YYY1 4BXWA 1MMJN 5DP5A 1SLXB 2W7UA 1P03A 1P2KA 1NU7B 3FFGA 2FS8A 4FUEA 2GCTB 2ZHFH 1O3LA 4I8HA 1OWHA 4CH2B 1O2PA 2PKSC 3UOPA 4CR5A 2OD3B 2FZZA 1YPEH 1FPHH 1GCTC 2G5NA 3PMHB 1EPTA 1O2OA 4GCHG 3MMGA 1AWHB 1LHGH 1BMMH 3BTTE 1J17T 1P06A 1SGFG 1F5KU 5JB9S 1T8LA 2H1UA 2PFEA 4ABIA 4ZUHA 3RU4E 1INCA 1BTZA 4AG1A 3RC4A 3LH1A 1QBVH 4A1VA 1K2I1 1FZZA 1HYLA 1ARCA 3EA7A 1YCPH 4YOIA 5JDUB 1FAKH 1ZTJA 1OSSA 3F68H 1P2MA 1O3JA 5EU8A 3T27A 3ZZAA 4AN7A 2BX4A 1LDTT 1NY22 2J94A 2A2XH 1WUNH 2Z9GA 5H4IB 4M7GA 4GLYA 3ZVFA 4BTTB 1P3EA 2BY7X 3EYDA 3SJKA 1QR3E 1BT7A 1IQLA 2XRCA 1DUEA 1KDQA 1LHEH 4FUIA 3RXHA 2PUQH 1C5ZB 2UWOA 5C2ZA 5EGMA 1BUIA 1N6YA 5E2OA 4FU7A 2IPHA 1SB1H 2ZDMA 5A8YA 1UTMA 1GG6C 3ZZBA 1LKBA 2FI4E 4TWYA 2EC9H 1EJAA 4B73A 1AVXA 3RU4D 2ODYB 1WYKA 3QTVH 4WXIA 2WPHS 4OS5A 1K1MA 5FCRA 1O3PB 1BTXA 4SGBE 3SW2B 1THSH 3D23A 5EXNA 1FN6A 1H4WA 5K7RA 5EW1H 3ZVEA 1TB6H 3MH4A 1B0FA 2RG3A 4KP0A 5C5NA 1QRWA 1W11U 4CREA 3SNBA 3ZVBA 1TGNA 3C27B 1TQ0B 1CT0E 1XUHA 1A2CH 1BRAA 1YM0A 1O2UA 1VITH 2ALPA 1AFEH 1ZRBA 4XE4A 1O3KA 3ODDA 1Y5BT 1O2MA 4AX9H 1C5MD 1KXFA 1O3OA 1FUJA 2A4QA 1XVOA 1NFWA 1J9CH 1C1SA 2ESTE 5CE1A 3MI4A 3Q3YA 4OS7A 1YPHE 2ILNA 3M7QA 1RTFB 2ZU1A 1HJ9A 1SVPA 3KQCA 2BY9X 1YPHC 1ABJH 2AYWA 2GKVE 2A32A 1LCYA 4ABEA 5T3HA 3ZZ9A 2ZGCA 4MPVA 4Y6DA 3URDA 3QN7A 2VIWA 1Z8JB 3RXSA 2CN0H 1TX6A 1V2MT 1KXDA 2NU1E 1EKBB 3LC3A 3UNSA 5C3NA 3BTME 5HMAA 3UTUH 8ESTE 4FVBA 4Y0YE 4DCDA 3U69H 2Z94A 3NPSA 3CENA 4ISOA 1ELCA 1EASA 3SQEE 3OY5U 3RLYH 3RMMH 1GJ5H 1UVPA 1FONA 5JPMH 1F0UA 1RD3B 3SORA 4K8BA 4Y0ZE 2G00A 1SLVB 1PPCE 4ZXYH 1UHBA 3TH2H 2AIQA 4HTCH 1GBMA 5ESBA 4Q2KA 1QFKH 1FV9A 2NWNA 1TE0A 5EQSA 3OSYA 1E35B 7GCHF 3ATMA 1AHTH 1TNJA 4CHAB 3UQOA 1C2KA 3FP6E 1VR1H 2FIRH 3A8AA 4WMDA 4O9VA 2BY6X 2FYQA 1W0YH 1BMAA 1AZZA 3K6ZA 1EAWA 3BIUH 1TGCA 1ZTKA 1XUJA 1E36B 1DWCH 3AW1A 2SGQE 2BTCE 2YOLA 3U8OH 4E7RG 1EZSC 2C8ZB 2R2MB 1BTPA 3MO3A 3SU1A 3F9GA 1ZGIA 4AGJA 3H5CB 1ZMNA 4ISLA 1BHXF 1TGBA 4ZAEA 1C4V2 1DICA 1ZPZA 3KQEA 2Y5GA 4K2YA 3VXEH 2XXLA 4SGAE 1ZJKA 3A84A 1QJ1B 5L6NH 4YT6H 1SR5C 4A1TA 3A8DA 3MO9A 1AE8H 5HM2A 2ZKSA 4CHAC 2GMTB 1KIGH 2GDEH 4O3TA 2ZU4A 3ZVCA 3PLBA 1THPB 1SGDE 4NSVA 3RXVA 3UREA 2H2ZA 2NU0E 3PLPA 1KXAA 2CHAB 1SC8U 4IC6A 1TNLA 3M3SA 3RC6A 1BJVA 3CS7A 1GHVH 3TJUA 4UFFH 1EAXA 1CGJE 4HFPB 1QTFA 3Q77A 3JZ1B 4OS1A 4A5TS 1C2DA 1DLKB 1LHFH 4ISHH 3ATKA 2H5CA 1MQ6A 4Q7ZA 2VINA 1QGFA 2BZAA 2SNVA 3GY5A 1GBEA 4LOYH 3NXPA 1NFUA 3EA9A 5ETXA 1NRPH 6CHAB 4YZUA 1BIOA 3V3MA 3R0FA 3UQVA 2ZZUH 7ESTE 1QL9A 1NU9A 5SGAE 1XUKA 4K8YA 3RM0H 3WY8A 2CF8H 2WV4A 1XKAC 1T8MA 3SUDA 4X6OA 1RFNA 1C5UA 4K1TA 5FX5A 1UTOA 4MQAA 7KMEH 3KIDU 3SZNA 1C2FA 3BV9B 1OXGA 1KSNA 1NESE 2HWLB 4XDEA 3ZZDA 1Z6EA 2WV5A 2AIPA 1Z1IA 1C1UH 3ZVDA 1FN8A 1GPZA 1RIWC 2ZU3A 1GMDF 1V3XA 2BQ6B 2FI5E 2QY0B 2OC7A 1H1BA 1MTVA 2FTLE 3PLKA 2FXRA 2VIVA 1F0RA 1HIAB 1Y59T 2ZNKH 4NIWA 4Y7AA 4ESTE 1O34A 2A5KA 2ZFSA 4GPGA 2SGPE 1JRTA 4NA8A 1SGIB 3MNBA 1YCPM 2IN2A 1VJ9U 2VWOA 2FM2A 4VGCB 2HNTF 1CT2E 3SU3A 1S83A 2A4GA 3K9XB 1QY6A 1W7XH 5FBEA 1O2LA 1H9HE 1NPMA 6CHAC 2Z3DA 1L0ZA 1DY8A 2BD7A 5FHTA 5GXPA 1O32A 1XUIA 1A0HB 5EPYA 1TX8A 3FZZA 2C90B 1IQFA 1C9PA 2QXGA 1IQEA 3KEEA 1VJAU 1A1RA 5FCKA 2W7SA 2AGIX 3RU4T 1EZQA 1O3AA 1DXWA 1GHWH 2FOHA 4XFQA 4E7NA 1ZHRA 2BM2A 1J14A 1H9IE 1NC6A 1O2NA 2F91A 4AFZA 3SQHE 2QN5T 3T25A 3TK9A 2OINA 3AASA 1OWKA 1HAXB 2ZU2A 4BAOB 4FXGH 1AI8H 2UWLA 3CP7A 3E1XB 1NRNH 1SGTA 4I8KA 4WJG2 4IS5A 3A8BA 3QX5H 1SFIA 5J4QA 3F9EA 3A7XA 2PGQB 1QB1A 3K2UA 1C1OA 1GVKB 2DE8A 1IHTH 2WPJS 2P95A 1OYQA 1ANDA 4XBDA 1GBDA 4U32A 1HXFH 4NZLA 4UFGH 2XC0A 2A1DB 3A7WA 1GI5A 2G51A 3S9AA 1UK2A 1SGQE 5JBAS 1CU1A 1YC0A 1BBRK 2EA3A 2Q6GA 3Q3XA 3A88A 1YLDA 1C2JA 3SU4A 5L2YH 2BDHA 3M5MA 3TLOA 1LQEA 1G2MA 5EXMA 3QZQA 1SI5H 3STIA 1ACBE 1OP8A 4JYVH 2I6SA 4INHA 5JYIA 2VGCB 2XW9A 3UR9A 1PPGE 2B0FA 3UR6A 1O39A 1L1NA 2J95A 2P8OB 1DWEH 4I32A 3SUGA 4F49A 4MLFB 2QXIA 3DHKH 3LJJA 4D76A 4RKJB 1GI9B 3A80A 2O8TA 5DG6A 3UWJH 1HAVA 3PTBA 3MU5A 1A46H 1DPOA 5HYOA 4AOQA 2H9HA 1C5XB 3K65B 4QT8C 4AORA 4KTCA 4Q80A 3BTGE 4IN2A 4D7FA 1O2ZA 1UTKA 4HZHA 1HAIH 2BVXH 1XM1A 1V2OT 1ETTH 4CRFA 3RXJA 3AAVA 1AVGH 1CQQA 1CO7E 3UNQA 1F0SA 4R0IA 1O2QA 4ISIH 1EJNA 2FYRA 2OBOA 3TJOA 1AB9B 1E0FD 2ZHDA 5CHAC 4O3UA 2PKAB 2A7CA 1DUAA 8GCHF 2CMYA 4X8TH 3RXBA 2GGVB 3Q00A 5DJ7A 1XUGA 4FUCA 2VGCC 1GHZA 1CGIE 2PGBB 1EX3A 3RXGA 1DITH 2P8OC 2QAAA 1QHRB 1S81A 2TBSA 2P3UB 1FY4A 1O2XA 5C20A 2HPPH 5FPTA 1QJ6B 2GVFA 5IYTA 3RXKA 1GI6A 1AMHA 3QK1A 4DIHH 3RXLA 1DM4B 2ZDVH 3NCLA 4ABAA 4D7GA 1P9UA 2G4UA 3IWMA 5A0CA 4DW2U 2FOAA 3OYPA 1T8NA 2J2UA 2GZ7A 2WINI 2FX6A 4B2AA 5LPEA 1ETRH 3SJOA 4DOQA 3SHCH 1JMOH 5LGOA 1TA2A 1TOCB 4I8LA 9ESTA 2ANMH 2VU8E 4ABFA 4DJZB 3GYMA 4FUFA 3GY7A 3DA9B 3VB3A 1W7GH 2Y7ZA 1ZLRA 4Y10E 1MTNC 2GV6A 2GT8A 7GCHG 1GBCA 3MH7A 2B8OH 1D6WA 1LVBA 4WXVA 3ZZ6A 4ZKOU 1WV7H 1C2HA 1TBZH 5ABWA 2SGEE 1W14U 1UVSH 3NKKA 2ZQ1A 3EE0B 1ABIH 4BAHB 3HPTB 1IQNA 1O5FH 1W2KH 2HVXA 1ZR0A 3UUZA 4B76A 1GBJA 1TPPA 1HJ8A 3H7OA 1O3IA 5F8TA 3KQBA 3M3TA 1V6DA 3MH6A 1UCYE 2XYAA 3A8CA 2H6MA 3QGJA 2Y7XA 3GOVB 3UIRA 3P8NA 1BQYA 4AG2A 2DUCA 1O5AB 5F03A 1MU6B 4CRDA 1IQGA 2ZA5A 4NA9H 3LU9B 2AFQB 5E0GA 3DFJA 4RKOB 2ZPRA 1XMNB 1Q2WA 5J4SA 1V2WT 1SGFA 1GHYH 1G3DA 3KF2A 2TRMA 1LMWB 1AO5A 3BN9A 3O8RA 2BVRH 1O5GH 3Q76A 2Z9IA 2DE9A 1L1JA 1CSOE 3GY2A 4CBOA 4B75A 1K9OE 3SNEA 1SL3A 3TIUA 1LVMA 1H8IH 1BRCE 1HAHH 4OS6A 4Y76A 1FNIA 2O8LA 4DIIH 3T28A 1TOMH 2ZF0H 1DOJA 2ZGXH 1CHOF 3HKIB 3UOUA 1O35A 4CRGA 4R8TB 5PTPA 2AEIH 2WPMS 3T26A 2VIOA 1BOQA 2A4OA 3GY4A 8KME2 5DP3A 2EI6A 2WPKS 2C4FH 1MCVA 3PWBA 4TY7A 4X6NA 5JB8S 3SJ9A 1WCZA 5T6FA 2GX4A 5A8ZA 1O31A 2V6NA 1O2GH 2GCTC 3VGCB 1NZQH 1MD7A 2A5AA 2R9PA 2YNBA 1P3CA 3BTEE 3MTYA 4FUBA 4ABJA 1GBBA 2Z9JA 3S9BA 5LH8A 2JH5D 1AKSB 2F9VA 3SV7A 2QIQA 2ZEBA 3ATIA 4GUXA 2P59A 1V2NT 3B23B 1ZMJA 1F0TA 3LGWA 3ITIA 4MG3A 2FEQH 3HGPA 3M36A 3G01A 4NFEA 4WF8A 1QB9A 2BYAX 4YT7H 4E06H 2QYIA 3ESTA 2Y81A 2V3HH 4ZKNU 1UCYH 1KLIH 2VJ1A 3L33A 2VB0A 3OY6U 3ELAH 2PV9B 1J16A 4KTUA 2XTTB 1GMDG 2ZFPH 3A81A 1AIXH 3L3TA 1HB0B 1IQHA 1O30A 3F9FA 5TJXA 1K1PA 3MOCA 1GBHA 1EAIA 1GJ4H 2OP9A 1G3BA 1MTWA 1NFYA 1ZJDA 1GHBF 4H42U 1TALA 2SFAA 2OC8A 4X2VA 4X1NU 1JBUH 1O2SA 1GJCB 1LPKB 3RXOA 1FIWA 2VVVA 2ODPA 5HM9A 4Z6AH 3F1SB 1OWJA 1VCWA 3BG8A 1UK3A 2BMGB 1YPJH 1SMFE 1O3HA 2BY5X 1GMHG 1MQ5A 4UONA 5AVDA 4NIXA 1BBRH 2RCEA 2PW8H 1UMAH 1TA6A 3QZRA 4JMYA 3U8TH 1GHXH 4AGKA 3FANA 3OTJE 2R3YA 2C8WB 2ODQA 3E16B 5F6MA 1G36A 3MNXA 3EDXB 2HLCA 1SLUB 2ZPSA 2G4TA 1ELDE 3BTKE 1QRZA 5EW2H 1OOKB 2VIDA 4X6MA 2BHGA 3RXPA 1D3QB 1ZSLA 3BTWE 5A0BA 6LPRA 1CVWH 1P10A 1S85A 2V0BA 2VH0A 1DSTA 3FP7E 1EP6A 1GI3A 1O38A 1D3DB 2FLRH 1IQIA 3ZZ7A 1O0DH 6GCHF 1CA0B 2D2DA 3BEUA 1LHDH 1NN6A 1BRUP 1TONA 2HRVA 2C8YB 4BNRA 5FPSA 2TPIZ 4NIYA 1JOUB 1PFXC 3DUXH 1EZUC 3TJVA 1JIMA 2OTVA 2BY8X 1C5WB 4NSYA 2WUBA 5DO4H 3VB4A 1C5RA 3SO3A 4GHQA 4WWYA 3S9CA 1EOLA 1GDUA 1XXFA 4Z0KA 4Y8YA 4UD9H 4X8VH 3VB5A 1BJUA 1PPZA 3GY3A 3LKWA 1YKTA 4A1XA 1AE5A 3AW0A 1P2IA 3QTOH 2ZDLA 3S69A 3E3TA 2ANKH 1A3BH 3SBKA 1KTSB 1RRKA 2XWBI 3RMOH 3LGUA 3PWCA 1JWTA 3UY9A 3VPKA 1K22H 3MHWU 1BHXB 1V2UT 2CJIA 3BEFB 1GMCF 1TNHA 1C1RA 1WBGB 3RP2A 1MKXH 1HAOH 3QDZB 3GCTF 2F9PA 5TCAA 3NWUA 3VEQB 2ZFQH 1JXPA 3ZZ5A 3A87A 1TQ7B 2OLGA 1TGSZ 4MVNA 2O8MA 1MZDA 1GI4A 1VCQA 1FMGA 1SGRE 2BDAA 4GHTA 5T6DA 3LOXA 2GP9B 1O3CA 4X2WA 1AUJA 1P12E 3PMAB 1PYTC 1TNIA 3MO6A 2PHBA 1ZGVA 1GVLA 2TGAA 8GCHG 1QQUA 2ZIQH 2KAIA 5FBIA 3T5FH 1ELVA 1O2WA 3A7VA 3E90B 1OKXA 2RA0A 1AFQB 2BQ7B 5GDSH 2UUKB 1LPZB 3LDXH 3FAOA 1S84A 1LVOA 1MKWK 3PMBB 4YOGA 1LKAA 1FAXA 2BD4A 1HLTH 4K5ZA 1NRSH 1SHHB 1NRQH 1TNKA 1EOJA 3BF6H 1T7CA 4IW4E 1C5OH 4NA7A 1QB6A 2F9UA 1AU8A 1Q3XA 1YPKH 1TRYA 4J2YB 1J8AA 3E8LA 1JRSA 4CH8B 1TLDA 4INKA 1EPTB 4JZEH 4Y79A 1LPGB 1V2TT 1RTLA 2VIPA 4CBNA 5FX6A 2HGTH 1AVWA 3KL6A 4DGJA 3E91A 3S0NA 2VNTA 2GDDA 1LO6A 1GDQA 2ZHQH 5AF9H 4TWWA 1GJBB 1W0ZU 1SGPE 1HPGA 3NUMA 2R0LA 3GCNA 2J9NA 4FVDA 2BDIA 2STAE 1DXPA 2OQUA 5GWZA 4IBLH 1A7SA 4K1SA 3UFAA 4ZXXH 5A09A 1GBIA 1HAPH 1GI1A 2GMTC 2PUXB 2F9BH 1AUTC 2BLVA 5JBBS 2GT7A 1DX5M 1T8OA 2BD3A 1FLEE 2CHAC 2Y82A 1TPSA 4RSPA 4BXSA 1ID5H 1O3DA 5EPNA 4XBBA 3M5LA 1KDQB 1Y3YA 2K1QA 2O9QA 1W12U 1AZ8A 4BAMB 1C5TA 1P2OA 2D8WA 1P2NA 2HPQH 1S6FA 3EGKH 1N8OB 1Z1JA 2C93B 2P94A 3P8GA 2ZTXA 2M5TA 3ATWA 4DT7B 4BOHA 1K1NA 2P3TB 5L2ZH 1FQ3A 1GBFA 1YCPK 3RDZA 3TNTA 1GL1A 1DWBH 3SJ8A 2NU3E 2FESH 1QBOA 3N7OA 5C1XA 2SNWA 2Y5FA 3LJOA 2CV3A 2ZWLH 4XSKU 1GL0E 2F83A 2VWLA 4NIVA 3U1IB 4X6PA 2ZCHP 4BAQB 1GHAF 2AMPA 4X1SU 2R0KA 1O2HA 1P11E 1PQ8A 2PR3A 4WY3A 3TH4H 1G32B 1XX9A 2W5EA 4I7YH 2ZU5A 1EAUA 1WQVH 2HNTE 3M7UA 1NROH 2ZHWH 1WQSA 1T4VH 4YM9A 2Z7FE 1SHYA 1SGYE 4WH8A 3S7KB 2HNTC 3PROA 1V2PT 3C1KA 4DVAU 3IG6B 3SNAA 1XVMA 2SGDE 3SNDA 1P2JA 3EAJA 1GBAA 1O2RA 1SQAA 2FOCA 1HXEH 4FUGA 1HGTH 3U1JB 1O2YA 4WH6A 4YESB 1HAGE 1C1TA 5AFZH 1E38B 1ZRKA 1DFPA 1MU8B 3P70B 4VGCC 5A2MH 1UTJA 1T4UH 1YPLH 3RXFA 5HXFA 1S6HA 1ORFA 3M5OA 1WSSH 5GIBA 2J4IA 3KQDA 4I31A 1YPMH 2QF3A 2UWPA 3KNXA 1MAXA 1V2RT 4JCNA 4ZHLU 1IAUA 1CA8B 1OS8A 2ZPQA 4YOJA 3BEIB 5FXLA 1DSUA 2OQ5A 5E8EH 3M3VA 1EZXC 4MNVA 1GGDB 2ZGBH 1ELAA 4ZROA 3FVFB 1S5SA 2UUJB 1MAYA 1QL8A 2R2WU 1O2IA 5G4BA 1TPOA 2FMJA 1QQ4A 1GBKA 1KXBA 1ELFA 1GVZA 1KLTA 3LGIA 2FOEA 3FZDA 1L4ZA 1GHBG 1GJDB 1K21H 2A2QH 2WPLS 4BTIB 4JYTA 2VIQA 2XCFA 1A5HA 1UHBB 1GJ9B 5BPEA 1SPJA 4NFFA 4JK5A 4KTSA 1C4Y2 1DDJA 1C1VH 2XBVA 2Y6TA 1G2LA 1A3EH 1PPEE 2BD9A 4X2XA 1EQ9A 4IGDA 1A0LA 3VB6A 2VWNA 3MWIU 2JETB 3SV9A 3GCOA 1O37A 1PPBH 6ESTA 1C5LH 2ALVA 1ARBA 2FDAA 3RC5A 5GJ4B 1Y8TA 1HBTH 4IMZA 4OS4A 1GGDC 3O8CA 4Y11E 1Y5UT 1QNJA 3KHVA 3M37A 1O33A 1TX7A 3VFEA 3RXRA 3BIVH 2Y5HA 1ANBA 1ZPCA 2A4RA 3B9FH 3FP8E 4GVUA 3HK6B 1O5BB 2F9NA 4UEHH 3A7TA 2NU4E 3NK8A 3QWCH 1OWEA 2JH0D 2ZDNA 1ELGA 1RXPA 1PQ7A 2YNAA 1JIRA 1LHCH 1ELBA 4TYDA 1O3NA 4LZ1H 4Y8XA 2WUCA 1GJ8B 5A0AE 1AY6H 3P17H 3ODFA 1MTUA 3U8RH 1Y3VA 1W8BH 1HJAB 2BDBA 1RGQA 2G52A 4MTBA 4Y71A 2H9EH 1O3MA 1SBWA 3V13A 5DP9A 1V2LT 1ZSKA 1LVYA 1AB9C 2PSYA 1G3EA 2EI8A 3P92A 1T31A 2SGAA 3VXFH 3NZIA 2QF0A 3I78A 5JBTA 1QCPA 1CBWB 2F3CE 3EA8A 3SU2A 3GISB 4X1RU 4MPUA 1ZTLA 1G3CA 3LGTA 1X7AC 4IN1A 4D8NA 1GMCG 1O2VA 2PKSB 5FAHA 1EATA 1AGJA 3BTDE 3QGNB 1WOFA 1NT1A 1RJXB 2FLBH 4U01A 1MBMA 2AS9A 5B6OA 1VZQH 3I77A 1DVAH 1QA0A 1FPCH 4DY7B 3TK6A 1TYNA 4BTUB 3HK3B 3ZYDA 1QA7A 1TMTH 1L2EA 1KXEA 2B7DH 2EI7A 4NWLA 4KGAA 4UE7H 5DP4A 5T6GA 1QJ7B 2ZGJA 1KTTB 2OUAA 3A7YA 1OX1A 4PROA 1TNGA 2LNCA 3OU0A 5ESTE 4JZFH 2W26A 2RDLA 1V2VT 2R3UA 1TMBH 3D65E 3MNSA 4AFSA 3GDSA 4AFQA 3SGAE 3MYWA 1AN1E 7LPRA 2TGTA 2JH6D 2Z6BD 1DY9A 1S82A 4ZMAH 1C1NA 1N1LA 1C5VA 5TCCA 1VITF 2XC4A 1PPHE 4ISNA 3TVJB 1CBWC 1C1PA 1UK4A 3A7ZA 1W3CA 1GI2A 1YLCA 3PB1E 1SFQB 1BBRE 3U98H 3LH3A 2CXVA 5LPFA 1OWDA 2VVCA 4JK6A 3OX7U 3GYLB 1UVOA 5FPYA 3RXDA 4LK4A 1RTKA 2PWXA 3EQ0H 1ANCA 1GWAA 1Z7KA 4YO9A 1BTHH 3SJIA 4YTAA 2J34A 4INLA 1ZSJA 1FXYA 2AGGX 1C2LA 2BXUH 1A5IA 1GG6B 1V2KT 4H6TA 3TGIE 1TMUH 1BTWA 2XWAA 4TY6A 5GPIB 1C5NH 1A0JA 2QXJA 1EP5A 5DK1A 2JKHA 2Z3CA 1C2EA 1CHGA 1L4DA 2BLOA 2FODA 1K1JA 2AMQA 1GCDA 5EOKA 1ESTA 2P3FH 1M9UA 4ZKRU 3GY6A 3W94A 3HATH 9LPRA 5AFYH 3T29A 5A8XA 1YGCH 2H5DA 1BB0B 1K1OA 3E0PB 3TITA 1HIAA 5C67A 1YPGH 1C5YB 4AB9A 1GJ7B 1IOEA 2OBQA 1P0SH 5DP6A 1E34B 3M35A 4B2BA 2W3KA 3R3GB 5EODA 3L6PA 3DT0H 4X1QU 4JZ1A 1SOZA 2ZG0H 1C1MA 1Z71A 3UWIA 3PMJA 3B8JA 2NU2E 4B2CA 4ABGA 1HNEE 1BA8B 1MUEB 2BLQA 1F5LA 2LPRA 3RXTA 1IQJA 1MH0A 3VGCC 2BD8A 2B5TB 5I25A 2FOFA 1ZYOA 4MPWA 1MD8A 1GHAG 4U30A 3ATLA 1HAVB 4Y8ZA 2FOBA 3TGJE 2ANWA 2J38A 1CGHA 4MNWA 4CRAA 2QA9E 1S0RA 1Z8IB 3ZV8A 2ZGHA 1ANEA 2ZC9H 1P05A 2IOTA 2BDYA 1HRTH 5GCHF 4UDWH 5EG4A 1IQMA 2G5VA 2GCHF 3A89A 1ZOMA 5EQQA 1ESAA 4YLQH 4K1EA 1GI8B 3DD2H 5IDKA 3JZ2B 4WVPE 1SOTA 2V35A 4B71A 3H7TA 2ASUB 5EQRA 4ABBA 4OGXA 3MU0A 5DPAA 4AFUA 4XOJA 2PLXA 2FI3E 3LGVA 5CMXH 2BLWA 3Q3KA 2Y80A 1Q31A 3TJNA 1D4PB 1TABE 1BDAA 1O2KA 3AVZA 3ZZ8A 1TRMA 1QL7A 4TPYA 3ZVGA 1V2QT 3BSQA 3LIWA 1OPHB 4X8SH 1PPFE 1UTPA 2A45B 3RUOA 3SGQE 3SV8A 3RXIA 1W13U 2FTMA 3RMNH 4NZQA 3E6PH 3D49H 4JYUH 2ZI2H 1G37A 2IJOB 2A31A 4K69A 4AB8A 1XUFA 1DANH 1DE7H 5DGJA 5BRRE 2BQWB 3A86A 1QBNA 2XC5A 1ZHPA 1S0QA 2ZDKA 1KLJH 1O5DH 4K60A 1CA0C 1O2JA 1GJ6A 5AHGH 3PM3A 1P09A 4JZDH 3KCGH 3STJA 4FUDA 3ENSB 4ZHMU 3TH3H 1ZPBA 4KKDA 2OXSA 1BTYA 2A7JA 1EJMA 2QXHA 2BOKA 2ZQ2A 4BANB 4ZKSU 1UTNA 1UTQA 4GAWA 3QO6A 2PKAA 3VB7A 5E0JA 2HALA 4F4OC 1EB1H 1O3EA 5C1UA 1P2QA 2ULLA 3ZZCA 3SV2H 2B9LA 1GJAB 3MH5A 3RXAA 2AH4X 1TWXB 3HKJB 1GDNA 4Q7XA 1N6XA 1IHSH 2FWWA 3ZVAA 5F8ZA 2WPIS 2Q1JA 1FIZA 2ZFTA 1OYTH 1TIOA 1VGCB 1A5GH 4UFDH 3RM2H 8LPRA 1C1QA 2WYJA 3SGBE 2PTNA 3T62A 1UVTH 3LONA 1TRNA 1B7XB 5DP8A 5C5OA 1RS0A 1DLEA 1ZZZA 1FDPA 1TAWA 4X2YA 5E0HA 2BXTH 2Q6FA 3P6ZB 2TIOA 2P16A 2XBXA 3A82A 4GCHF 4NG9H 4OS2A 4X0WU 1BCUH 5DP7A 4YLUA 1ETSH 1K28D 1QURH 1WAYB 2UUFB 4I8JA 3TPIZ 1PYTD 3DFLA 2Z9KA 4Y7BA 1RIWB 1AWFH 2XCNA 3SI4H 4ABHA 4RN6A 2A7HA 1Y3WA 4DURA 4J1YA 2V3OH 3LGYA 2GV7A 2XBYA 1Z6JH 3RMLH 1D3TB 1PQAA 3GY8A 2Z9LA 1B5GH 2GZ8A 5C1YA 1U6QA 3F6UH 1FJSA 2EEKA 1AFQC 2PTCE 3ZV9A 1HV7A 1VGCC 5HGGA 2AERH 2BVSH 1THRH 1ESBA 4NWKA 2SGFE 1D3PB 3RXQA 1VCPA 5K0HA 2WYGA 1YBWA 1QIXB 4JZIA 4IC5A 1HAYB 1P01A 1C2MA 2D1JA 2BB4A 1P9SA 4NGAH 1O36A 2VVUA 2ZO3H 1NM6A 2AMDA 2H9TH 3LC5A 3SU5A 4FUJA 1EPTC 4ZHAA 3A85A 3GCHB 4KELA 1A4WH 3SV6A 1H9LB 3URCA 4X8UH 1G9IE 4UFEH 2HOBA 4WMEA 4H6SB 4I8GA 2C8XB 1F2SE 2FX4A 4O97A 1MZAA 3HGNA 1O3GA 2THFB 2UUYA 1E37B 3O8DA 4B74A 3MFJA 3RXMA 1C5SA 3S7HB 2CF9H 4MDSA 1VITG 3SHAH 1WTHD 3PYHA 1DT2A 1UJ1A 2W3IA 1LTOA 1HFDA 4X1PU 3SU6A 3V7TA 2O8WA 1GI0A 3M61U 4CRCA 1BMNH 3ZZ4A 4GSOA 2A0QB 1PQ5A 3QUMP 3ZYEA 3RXCA 3LT3A 1AD8H 3SUFA 4AZ2B 2FS9A 1YF4A 2ZHEH 4WMFA 2GD4B 3T2NA 1V2ST 3SUEA 1SGCA 1O2TA 1CHOG 4MNXA 1NFXA 1GMHF 4B1TA 1Z8GA 2ZCKP 1NTPA 2GZ9A 3BTHE 1UCYK 2A5IA 1D9IA 1XKBC 2ZECA 1C2GA 2BDCA 2G8TA 1BMLA 3GICB 1N8OC 1DS2E 3GDVA 4XBCA 3I29A 4MNYA 4D9RA 3V12A 4DG4A 5I46H 3GCHC 2D26C 1C1WH 1FY8E 4CR9A 3D62A 2OCVB 2ZDAH 5E2PA 1SLWB 1UVUH 2TGDA 4OGYA 2BD2A 1AKSA
chains in the Genus database with same CATH superfamily
1FI8A 1NO9H 1WTGH 1ELEE 2BDGA 4HI3A 1MCTA 2FP7B 2KM0A 3P95A 3BTFE 3TGKE 2FOGA 5F8XA 3UNRA 1XXDA 1TBRH 3ZZ3A 1SG8B 3MU1A 1NRRH 1V2JT 1EUFA 1KXCA 1MTSA 1F7ZA 5CHAB 2XBWA 4HGCA 2PSXA 2ANYA 4NCYA 4ZH8A 2ZCLP 1J15A 1WU1A 1TPAE 5L30H 2OC1A 1OP2A 1Y3XA 2ZFRH 4LZ4B 1QRXA 4E05H 1P04A 4ABDA 1P8VC 1EXFA 3LPRA 1HDTH 1HUTH 2STBE 3WWBA 3U9AH 1L1GA 4D9QA 1IQKA 1GBTA 5B6LA 1CE5A 1BRBE 2BZ6H 1GBLA 3BTQE 1C5PA 1SGNE 1UO6A 3QLPH 4H4FA 3UPEA 2I6QA 4BAKB 3PO1B 1SQTA 3KGPA 1FY3A 1H8DH 5GCHG 2Q6DA 2GCHG 4AYVB 2VWMA 4O03A 3UAIC 5JBCS 4CRBA 5EXLA 1AQ7A 2QC2A 1SGEE 3PV4A 2BOHB 3P8OA 1FY5A 1W0KD 2ZP0H 4HG6A 2K8IA 1BZXE 3M5NA 3M7TA 1KY9A 1MBQA 2BD5A 1OP0A 4THNH 2XNIA 2O8UA 3VG8A 2G81E 1SSXA 1P02A 1PJPA 3TNSA 6GCHG 1MTNB 4TPIZ 1TFXA 3SN8A 4A6LA 2ZTZA 1C5QA 3MU8A 3SU0A 3TU7H 5DKMA 2KAIB 1G30B 1Y3UA 3CS0A 1YP9A 2FO9A 3BG4B 1O5EH 1C9TA 3SI3H 3AAUA 2RA3A 1B0EA 1MKXK 3KYGA 4OM9A 4MPXA 2QE7D 2QV1A 1O3BA 1FY1A 4FUHA 1K1IA 2JETC 2F9OA 1GI7B 1O3FA 1F92A 1UTLM 1O5CB 3OEHD 2OC0A 3PO1C 1P57B 2P93A 1TBQH 3SOSA 1NS3A 1KYNA 1TGTA 1W10U 2HVYB 1HAZB 1OWIA 3RLWH 3SNCA 3RXEA 3F2HA 1LQDB 1SQOA 1BTUA 5HIYA 1Y5AT 2FOMB 4A7IB 1C4U2 4K3JA 1EB2A 5LPRA 2TGPZ 2QCYA 1MKWH 2ZTYA 3F9HA 2GTBA 3A83A 4IMQA 3P8FA 3RXUA 3GCTG 2Z3EA 1ZHMA 2ZFFH 2JJ1D 4FU9A 1CT4E 4AYYB 1A61H 1GCTB 2G55A 1DWDH 3TK5A 1Z8RA 3V0XA 1F5RA 1BITA 1ELTA 2QGRA 3BG4C 1D6RA 4ASHA 4Q7YA 3GDUA 3KN2A 2GJGA 2KCPA 1ZMLA 2AGEX 2BX3A 3IITA 1T32A 2C3SA 1HJAC 2VH6A 1K1LA 4I33A 4FU8A 4U2WA 4A92A 3MNCA 2FPZA 2J92A 2CGAA 4LXBH 3PTNA 5KGOA 1C2IA 3MU4A 1HCGA 3O8BA 3K6YA 3PV5A 3W95A 3E0NB 1YYY1 4ACAA 4BXWA 1MMJN 5DP5A 3OE7D 1SLXB 2W7UA 1P03A 1P2KA 1NU7B 3FFGA 2FS8A 4FUEA 2GCTB 2ZHFH 1O3LA 4I8HA 1OWHA 4CH2B 4ACBA 1O2PA 2PKSC 3UOPA 4CR5A 2OD3B 2FZZA 1YPEH 1FPHH 1GCTC 2G5NA 3PMHB 1EPTA 1O2OA 4GCHG 3MMGA 1AWHB 1LHGH 1BMMH 3BTTE 1J17T 1P06A 1SGFG 1F5KU 5JB9S 1COWD 1T8LA 2H1UA 2PFEA 4ABIA 4ZUHA 3RU4E 1INCA 4P02A 1BTZA 4AG1A 3RC4A 3LH1A 1QBVH 4A1VA 1K2I1 1FZZA 1HYLA 1ARCA 3EA7A 1YCPH 4YOIA 5JDUB 1FAKH 1ZTJA 1OSSA 3F68H 1P2MA 1O3JA 5EU8A 3T27A 3ZZAA 4AN7A 2BX4A 1LDTT 1NY22 2J94A 2A2XH 1WUNH 2Z9GA 5H4IB 4M7GA 4GLYA 2J98B 3ZVFA 4BTTB 1P3EA 3FKSD 2BY7X 2KCAA 3EYDA 3SJKA 1QR3E 1BT7A 1IQLA 2XRCA 1DUEA 1KDQA 1YY3A 1LHEH 4FUIA 3RXHA 2PUQH 1C5ZB 2UWOA 5C2ZA 2W6ID 5EGMA 1BUIA 1N6YA 5E2OA 4FU7A 2IPHA 1SB1H 2QF4A 2ZDMA 5A8YA 1UTMA 1GG6C 3ZZBA 1LKBA 2XNDD 4XRNA 2FI4E 4TWYA 2EC9H 1EJAA 4B73A 1AVXA 3RU4D 2ODYB 1WYKA 3QTVH 4WXIA 2WPHS 4OS5A 1K1MA 5FCRA 1O3PB 1BTXA 4SGBE 3SW2B 1THSH 3D23A 5EXNA 1FN6A 1H4WA 5K7RA 5EW1H 3ZVEA 1TB6H 3MH4A 1B0FA 2RG3A 4KP0A 5C5NA 1QRWA 2L6OA 1W11U 4CREA 3N7EA 3SNBA 3ZVBA 1TGNA 3C27B 4Q4LA 1TQ0B 2V7QD 1CT0E 1XUHA 1A2CH 1BRAA 1YM0A 1O2UA 1VITH 2ALPA 1AFEH 1ZRBA 4XE4A 3PRBA 5KEDA 1O3KA 3ODDA 1Y5BT 1O2MA 4AX9H 1C5MD 1KXFA 1O3OA 1FUJA 2A4QA 1XVOA 1NFWA 1J9CH 1C1SA 2ESTE 3U28C 5CE1A 3MI4A 3Q3YA 4OS7A 1YPHE 2ILNA 3M7QA 1RTFB 2ZU1A 1HJ9A 1SVPA 3KQCA 2BY9X 1YPHC 1ABJH 2AYWA 2GKVE 2A32A 1LCYA 4ABEA 2WHXA 5T3HA 3ZZ9A 2ZGCA 4MPVA 4Y6DA 3URDA 3QN7A 3F2FA 2VIWA 1Z8JB 3RXSA 2CN0H 1TX6A 1V2MT 1KXDA 2NU1E 1EKBB 3LC3A 3UNSA 5C3NA 3BTME 5HMAA 4FOUC 3UTUH 8ESTE 4FVBA 4Y0YE 4DCDA 3U69H 2Z94A 3NPSA 3CENA 4ISOA 1ELCA 1EASA 3SQEE 5C0UA 3OY5U 3RLYH 3RMMH 1GJ5H 1UVPA 1FONA 5JPMH 1F0UA 1RD3B 3SORA 4K8BA 4Y0ZE 2G00A 4Z1MD 1SLVB 5EJ1A 1PPCE 4ZXYH 1UHBA 3TH2H 2VBCA 2AIQA 4HTCH 1GBMA 5ESBA 4Q2KA 1QFKH 1FV9A 2NWNA 1TE0A 5EQSA 3OSYA 1E35B 7GCHF 3ATMA 1AHTH 1TNJA 4CHAB 1NBMD 3UQOA 1C2KA 3FP6E 1VR1H 2FIRH 3A8AA 4WMDA 4O9VA 2BY6X 2FYQA 1W0YH 1BMAA 1AZZA 3K6ZA 1EAWA 3BIUH 1TGCA 1ZTKA 1XUJA 1E36B 1DWCH 3AW1A 2SGQE 2BTCE 2YOLA 3U8OH 4E7RG 1EZSC 2C8ZB 2R2MB 1BTPA 3MO3A 3SU1A 3F9GA 1ZGIA 4AGJA 3H5CB 5T1VA 1ZMNA 4ISLA 1BHXF 5C0TA 1TGBA 4ZAEA 1C4V2 1DICA 3CNRA 1ZPZA 3KQEA 2Y5GA 4K2YA 3VXEH 2XXLA 4SGAE 1ZJKA 3A84A 1QJ1B 5L6NH 4YT6H 1SR5C 4A1TA 3A8DA 3MO9A 1AE8H 5HM2A 2JJ2D 2ZKSA 4CHAC 2GMTB 1KIGH 2GDEH 4O3TA 2ZU4A 3ZVCA 3PLBA 1THPB 1SGDE 4NSVA 3RXVA 3UREA 2H2ZA 2NU0E 3PLPA 1KXAA 2CHAB 1SC8U 4IC6A 1TNLA 3M3SA 3RC6A 1BJVA 3CS7A 1GHVH 3TJUA 2YMSD 4UFFH 1EAXA 1CGJE 4HFPB 1QTFA 3Q77A 3JZ1B 4OS1A 4A5TS 1C2DA 1DLKB 1E1RD 1LHFH 4ISHH 3ATKA 2H5CA 1MQ6A 4Q7ZA 2VINA 1QGFA 2BZAA 2SNVA 2RDEA 3GY5A 1GBEA 4LOYH 3NXPA 1NFUA 5DN6D 3EA9A 5ETXA 1NRPH 2W6JD 6CHAB 4YZUA 1BIOA 3V3MA 3R0FA 3UQVA 2ZZUH 7ESTE 1QL9A 1NU9A 5SGAE 1XUKA 4K8YA 3RM0H 3WY8A 2CF8H 2WV4A 2RFKC 1XKAC 1T8MA 3SUDA 4X6OA 1RFNA 1C5UA 4K1TA 5FX5A 1UTOA 1WDIA 4MQAA 7KMEH 3KIDU 3SZNA 1C2FA 3BV9B 1OXGA 1KSNA 1NESE 2HWLB 1S6LA 4XDEA 3ZZDA 1Z6EA 2WV5A 2AIPA 1Z1IA 1C1UH 3ZVDA 1FN8A 1GPZA 1RIWC 2ZU3A 1GMDF 1V3XA 2BQ6B 2FI5E 2QY0B 2OC7A 1H1BA 1MTVA 2FTLE 3PLKA 2FXRA 2VIVA 1F0RA 1HIAB 1Y59T 2ZNKH 4NIWA 4Y7AA 4ESTE 1O34A 2A5KA 2ZFSA 4GPGA 2SGPE 1JRTA 4NA8A 1SGIB 3MNBA 1YCPM 2IN2A 1VJ9U 2VWOA 2FM2A 4VGCB 2HNTF 4XD7D 1CT2E 3SU3A 1S83A 2A4GA 3K9XB 1QY6A 1W7XH 5FBEA 1O2LA 1H9HE 1NPMA 6CHAC 2Z3DA 1L0ZA 1DY8A 2BD7A 5FHTA 5GXPA 1O32A 1XUIA 1A0HB 5EPYA 1TX8A 3FZZA 2C90B 1IQFA 1C9PA 2QXGA 1IQEA 3KEEA 1VJAU 1A1RA 5FCKA 4RT1A 2W7SA 2AGIX 3RU4T 1EZQA 1O3AA 1DXWA 1GHWH 2FOHA 4XFQA 4E7NA 1ZHRA 2BM2A 1J14A 1H9IE 1NC6A 1O2NA 2F91A 4AFZA 3SQHE 1K0HA 2QN5T 3T25A 4ASUD 3TK9A 2OINA 3AASA 1OWKA 1OHHD 1HAXB 2ZU2A 4BAOB 4FXGH 1AI8H 2UWLA 3CP7A 3E1XB 1NRNH 1SGTA 4I8KA 4WJG2 4IS5A 3A8BA 3QX5H 1SFIA 5J4QA 3F9EA 3A7XA 2PGQB 1QB1A 3K2UA 4YXWD 1C1OA 1GVKB 2DE8A 1IHTH 2WPJS 2P95A 1OYQA 3KQ5A 1ANDA 1WXRA 4XBDA 1GBDA 4U32A 1HXFH 4NZLA 4UFGH 2XC0A 2A1DB 3A7WA 1GI5A 2G51A 3S9AA 1UK2A 1SGQE 5JBAS 1CU1A 1YC0A 1BBRK 2EA3A 2Q6GA 3Q3XA 3A88A 1YLDA 4FETA 1C2JA 3SU4A 5HIZA 3FN8A 5L2YH 2BDHA 3M5MA 3TLOA 5GNDA 1LQEA 1G2MA 5EXMA 3QZQA 1SI5H 3STIA 1ACBE 1OP8A 4JYVH 2I6SA 4INHA 2KZ4A 5JYIA 2VGCB 2XW9A 3UR9A 1PPGE 2B0FA 3UR6A 1O39A 1L1NA 2J95A 2P8OB 1DWEH 4I32A 3SUGA 4F49A 4MLFB 2QXIA 3DHKH 3LJJA 4D76A 4RKJB 1GI9B 3A80A 2O8TA 5DG6A 3UWJH 1HAVA 3PTBA 3MU5A 1A46H 1DPOA 5HYOA 4AOQA 2H9HA 1C5XB 1E1QD 3K65B 4QT8C 4AORA 4KTCA 4Q80A 3BTGE 4IN2A 4D7FA 1O2ZA 2OK5A 1UTKA 4HZHA 1HAIH 2BVXH 1XM1A 1V2OT 1ETTH 4CRFA 3RXJA 3AAVA 1AVGH 1CQQA 1CO7E 5IK2D 3UNQA 1F0SA 4R0IA 1O2QA 4ISIH 1EJNA 2FYRA 1UW7A 2OBOA 3TJOA 1AB9B 1E0FD 2ZHDA 5CHAC 4O3UA 2PKAB 3N99A 2A7CA 1DUAA 8GCHF 3DSGA 2CMYA 4X8TH 3RXBA 2GGVB 3Q00A 5DJ7A 1XUGA 4FUCA 2VGCC 1GHZA 1CGIE 2PGBB 1EX3A 3RXGA 1DITH 2P8OC 2QAAA 1QHRB 1S81A 2TBSA 2P3UB 1FY4A 1O2XA 5C20A 2HPPH 5FPTA 1QJ6B 2GVFA 5IYTA 3RXKA 1GI6A 1AMHA 3QK1A 4DIHH 3RXLA 1DM4B 2ZDVH 3NCLA 4ABAA 4D7GA 1P9UA 2G4UA 3F0OA 3IWMA 5A0CA 4DW2U 2FOAA 3OYPA 1T8NA 1YLNA 2J2UA 2GZ7A 2WINI 2FX6A 4B2AA 5LPEA 1ETRH 3SJOA 4DOQA 3SHCH 1JMOH 5LGOA 1TA2A 1TOCB 4I8LA 9ESTA 2ANMH 2VU8E 4ABFA 4DJZB 3GYMA 5EJLA 4FUFA 3GY7A 3DA9B 3VB3A 1W7GH 2Y7ZA 1ZLRA 3H09A 4Y10E 1MTNC 2GV6A 2GT8A 7GCHG 1GBCA 3MH7A 2B8OH 1D6WA 1LVBA 4WXVA 3ZZ6A 4ZKOU 2EY4C 4RT0A 1WV7H 1C2HA 1TBZH 5ABWA 2SGEE 1W14U 1UVSH 3NKKA 2ZQ1A 3EE0B 1ABIH 4BAHB 3HPTB 1IQNA 1O5FH 1W2KH 2HVXA 1ZR0A 3UUZA 4B76A 1GBJA 1TPPA 1HJ8A 3H7OA 1O3IA 5F8TA 3KQBA 3M3TA 1V6DA 3MH6A 1UCYE 2XYAA 2EQNA 3A8CA 2H6MA 3QGJA 2Y7XA 3GOVB 3UIRA 3P8NA 1BQYA 2KCOA 2DUCA 1O5AB 5F03A 4AG2A 1MU6B 4CRDA 1IQGA 1SKYE 2ZA5A 4NA9H 3LU9B 2AFQB 5E0GA 3DFJA 4RKOB 2ZPRA 1XMNB 1Q2WA 5J4SA 1V2WT 1SGFA 1GHYH 1G3DA 3KF2A 1BMFD 2TRMA 1LMWB 1AO5A 3BN9A 3UB0A 3O8RA 2BVRH 1O5GH 3Q76A 2Z9IA 2DE9A 1L1JA 1CSOE 3GY2A 4CBOA 4B75A 1K9OE 3SNEA 1SL3A 3TIUA 3MQKC 1LVMA 1H8IH 1BRCE 1HAHH 4OS6A 4Y76A 1FNIA 2O8LA 4DIIH 3T28A 1TOMH 2LELA 2ZF0H 1DOJA 2ZGXH 1CHOF 3HKIB 3UOUA 1O35A 4CRGA 4R8TB 5PTPA 2AEIH 2WPMS 3T26A 2VIOA 1BOQA 2A4OA 4F55A 3GY4A 8KME2 5DP3A 2EI6A 2WPKS 2JIZD 2C4FH 1MCVA 3PWBA 4TY7A 4X6NA 5JB8S 3SJ9A 1WCZA 5T6FA 2GX4A 5A8ZA 1O31A 2V6NA 1O2GH 2GCTC 3VGCB 1NZQH 1MD7A 2A5AA 2R9PA 2YNBA 1P3CA 3BTEE 3OAAD 3MTYA 4FUBA 4ABJA 1GBBA 2Z9JA 3S9BA 5LH8A 2JH5D 2WZQA 1AKSB 2F9VA 3SV7A 2QIQA 2ZEBA 3ATIA 4GUXA 2P59A 1V2NT 3B23B 1ZMJA 1F0TA 3LGWA 3ITIA 4MG3A 2FEQH 3HGPA 3M36A 3G01A 4NFEA 4WF8A 1QB9A 2BYAX 4YT7H 4E06H 2QYIA 3ESTA 2Y81A 2V3HH 4ZKNU 1UCYH 1KLIH 2VJ1A 3L33A 2HLDD 2VB0A 3OY6U 3ELAH 2PV9B 1J16A 4KTUA 2XTTB 1GMDG 1SQRA 2ZFPH 3A81A 1AIXH 3L3TA 1HB0B 1IQHA 1O30A 3F9FA 5TJXA 1K1PA 3F3BA 3MOCA 1GBHA 1EAIA 1GJ4H 2OP9A 1G3BA 1MTWA 1NFYA 1ZJDA 1GHBF 4H42U 1TALA 2SFAA 2OC8A 3EE7A 1KMHB 4X2VA 4X1NU 1JBUH 1O2SA 1GJCB 1LPKB 3RXOA 1FIWA 2VVVA 2ODPA 5HM9A 4Z6AH 3F1SB 1OWJA 1VCWA 3BG8A 1UK3A 2BMGB 1YPJH 1SMFE 1O3HA 2BY5X 1GMHG 1MQ5A 4UONA 5C94A 5AVDA 4NIXA 1BBRH 2RCEA 2PW8H 3PV2A 1UMAH 1TA6A 3QZRA 4JMYA 3U8TH 1GHXH 4AGKA 3FANA 3OTJE 2R3YA 2C8WB 2ODQA 3E16B 5F6MA 1G36A 3MNXA 3EDXB 2HLCA 1SLUB 2ZPSA 2G4TA 1ELDE 3BTKE 1QRZA 5EW2H 1OOKB 2VIDA 4X6MA 2BHGA 3RXPA 1D3QB 1ZSLA 3BTWE 3F2GA 5A0BA 6LPRA 1CVWH 1P10A 1S85A 2V0BA 2VH0A 1DSTA 3FP7E 1EP6A 1GI3A 1O38A 1D3DB 2FLRH 1IQIA 2IJD1 1O0DH 3ZZ7A 6GCHF 1CA0B 2D2DA 3BEUA 1LHDH 1NN6A 1BRUP 1TONA 2HRVA 2C8YB 4BNRA 5FPSA 2TPIZ 4NIYA 1JOUB 1PFXC 3DUXH 1EZUC 3TJVA 1JIMA 2OTVA 2BY8X 1C5WB 4NSYA 3W1EA 2WUBA 5DO4H 3VB4A 2WPDD 1C5RA 3SO3A 4GHQA 4WWYA 3S9CA 1EOLA 1GDUA 1XXFA 2YMSB 4Z0KA 4Y8YA 4UD9H 4TT3D 4X8VH 3VB5A 1BJUA 1PPZA 3GY3A 3LKWA 1YKTA 4A1XA 1AE5A 3AW0A 1P2IA 3QTOH 2ZDLA 3S69A 3E3TA 2ANKH 1A3BH 3SBKA 1KTSB 1RRKA 2XWBI 3RMOH 4B6FA 3LGUA 3PWCA 1JWTA 3UY9A 3VPKA 1K22H 3MHWU 1BHXB 1V2UT 2CJIA 3BEFB 1GMCF 1TNHA 1C1RA 1WBGB 3RP2A 1MKXH 1HAOH 3QDZB 3GCTF 2F9PA 5TCAA 3NWUA 3VEQB 2ZFQH 1JXPA 3ZZ5A 4AC9A 3A87A 1TQ7B 2OLGA 1TGSZ 4MVNA 2O8MA 1MZDA 1GI4A 1VCQA 1FMGA 1SGRE 2BDAA 4GHTA 5T6DA 3LOXA 2GP9B 1O3CA 4X2WA 1AUJA 3N7DA 1P12E 3PMAB 1PYTC 1TNIA 3MO6A 2WV9A 1FX0B 2PHBA 1ZGVA 1GVLA 2TGAA 8GCHG 1QQUA 2ZIQH 2KAIA 5FBIA 3T5FH 1ELVA 1O2WA 3A7VA 3E90B 1OKXA 2RA0A 1AFQB 2BQ7B 5GDSH 2UUKB 1LPZB 3LDXH 3FAOA 1S84A 1LVOA 1MKWK 3PMBB 4YOGA 1LKAA 1FAXA 2BD4A 1HLTH 4K5ZA 1NRSH 1SHHB 1NRQH 1TNKA 1EOJA 3BF6H 1T7CA 4IW4E 5DSFA 1C5OH 4NA7A 1QB6A 2F9UA 1AU8A 1Q3XA 1YPKH 1TRYA 4J2YB 1J8AA 3E8LA 1JRSA 2KX4A 4CH8B 1TLDA 4INKA 1EPTB 4JZEH 4Y79A 1LPGB 1V2TT 1RTLA 2VIPA 4CBNA 5FX6A 2HGTH 1AVWA 3KL6A 4DGJA 3E91A 3S0NA 2VNTA 2GDDA 1LO6A 1GDQA 2ZHQH 5AF9H 4TWWA 1GJBB 1W0ZU 1SGPE 1HPGA 3OFND 3NUMA 2R0LA 3GCNA 2J9NA 4RI0A 4FVDA 2BDIA 2STAE 1DXPA 2OQUA 5GWZA 4IBLH 1A7SA 4K1SA 3UFAA 4ZXXH 5A09A 1GBIA 1HAPH 1GI1A 2GMTC 2KFWA 2F9BH 2PUXB 1AUTC 2BLVA 2K0QA 5JBBS 2GT7A 1DX5M 1T8OA 2J5UA 2BD3A 1FLEE 2CHAC 2Y82A 1TPSA 4RSPA 4BXSA 1ID5H 1O3DA 5EPNA 4XBBA 3M5LA 1KDQB 1Y3YA 2K1QA 2O9QA 1W12U 1AZ8A 4BAMB 1C5TA 1P2OA 2D8WA 1P2NA 2HPQH 1S6FA 2M2AA 3EGKH 1N8OB 1Z1JA 2C93B 2P94A 3P8GA 2ZTXA 2M5TA 3ATWA 4DT7B 4BOHA 1K1NA 2P3TB 5L2ZH 1FQ3A 1GBFA 1YCPK 3RDZA 3TNTA 1GL1A 1DWBH 3SJ8A 2NU3E 2FESH 1QBOA 2WSSD 3N7OA 5C1XA 2SNWA 2Y5FA 3LJOA 2CV3A 2ZWLH 4XSKU 1GL0E 2F83A 2VWLA 4NIVA 3U1IB 4X6PA 2ZCHP 4BAQB 1GHAF 2AMPA 4X1SU 2R0KA 3NRLA 1O2HA 1P11E 1PQ8A 2PR3A 4WY3A 3TH4H 1G32B 1XX9A 2W5EA 4I7YH 2ZU5A 1EAUA 1WQVH 2HNTE 3M7UA 1NROH 2ZHWH 1WQSA 1T4VH 4YM9A 2Z7FE 1SHYA 1SGYE 4WH8A 3S7KB 2HNTC 3PROA 1V2PT 3C1KA 4DVAU 3IG6B 3SNAA 1XVMA 2SGDE 3SNDA 1P2JA 3EAJA 1GBAA 1O2RA 1SQAA 2FOCA 1HXEH 1EFRD 1HGTH 4FUGA 3U1JB 1O2YA 4WH6A 4YESB 1HAGE 2J98A 1C1TA 5AFZH 1E38B 1ZRKA 1DFPA 1MU8B 3P70B 4VGCC 5A2MH 1UTJA 1T4UH 1YPLH 3RXFA 5HXFA 1S6HA 1ORFA 3M5OA 1WSSH 5GIBA 2J4IA 3KQDA 4I31A 1YPMH 2QF3A 2UWPA 3KNXA 1MAXA 1V2RT 4JCNA 4ZHLU 1IAUA 1CA8B 1OS8A 2ZPQA 4YOJA 3BEIB 5FXLA 1DSUA 2OQ5A 5E8EH 3M3VA 1EZXC 4MNVA 1GGDB 2ZGBH 1ELAA 4ZROA 3FVFB 1S5SA 3FO8D 2UUJB 1MAYA 1QL8A 2R2WU 1O2IA 5G4BA 1TPOA 2FMJA 1QQ4A 1GBKA 1KXBA 1ELFA 1GVZA 1KLTA 3LGIA 2FOEA 3FZDA 1L4ZA 1GHBG 1GJDB 1K21H 2A2QH 2WPLS 4BTIB 4JYTA 2VIQA 2XCFA 1A5HA 1UHBB 1GJ9B 5BPEA 1SPJA 4NFFA 4JK5A 4KTSA 1C4Y2 1DDJA 1C1VH 2XBVA 2Y6TA 1G2LA 1A3EH 1PPEE 2BD9A 4X2XA 1EQ9A 4IGDA 1A0LA 3VB6A 2VWNA 3MWIU 2JETB 3SV9A 3GCOA 5CDFE 1O37A 1PPBH 6ESTA 1C5LH 2ALVA 1ARBA 2FDAA 3RC5A 4I86A 5GJ4B 1Y8TA 1HBTH 4IMZA 4OS4A 1GGDC 4ZCNA 3O8CA 3GS9A 4Y11E 1Y5UT 3ZIAD 1QNJA 3KHVA 3M37A 1O33A 1TX7A 3VFEA 3RXRA 3BIVH 2Y5HA 1ANBA 1ZPCA 2A4RA 3B9FH 3FP8E 4GVUA 3HK6B 1O5BB 2F9NA 4UEHH 3A7TA 2NU4E 3NK8A 3QWCH 1OWEA 2JH0D 2ZDNA 1ELGA 1RXPA 1PQ7A 2YNAA 1JIRA 1LHCH 1ELBA 4TYDA 1O3NA 4LZ1H 4Y8XA 2WUCA 1GJ8B 5A0AE 1AY6H 3P17H 3ODFA 1MTUA 3U8RH 1Y3VA 1W8BH 1HJAB 2BDBA 1RGQA 2G52A 4MTBA 2JDID 2AHME 4Y71A 2H9EH 1O3MA 1SBWA 3V13A 5DP9A 1V2LT 1ZSKA 1LVYA 1AB9C 2PSYA 1G3EA 2EI8A 3P92A 1T31A 2SGAA 3VXFH 3NZIA 2QF0A 3I78A 5JBTA 1QCPA 1CBWB 2F3CE 3EA8A 5EIYA 3SU2A 3GISB 4X1RU 4MPUA 1ZTLA 1G3CA 4B6EA 3LGTA 1X7AC 4IN1A 4D8NA 1GMCG 1O2VA 2PKSB 5FAHA 1EATA 1AGJA 3BTDE 3QGNB 1WOFA 1NT1A 1RJXB 2FLBH 4U01A 1MBMA 2AS9A 5B6OA 1VZQH 3I77A 1DVAH 1QA0A 1FPCH 4DY7B 3TK6A 1TYNA 4BTUB 3HK3B 3ZYDA 1QA7A 1TMTH 1L2EA 1KXEA 2B7DH 2EI7A 4NWLA 4KGAA 4UE7H 5DP4A 3F0PA 5T6GA 1QJ7B 2ZGJA 1KTTB 2OUAA 3A7YA 1OX1A 4PROA 1TNGA 2LNCA 3OU0A 5ESTE 4JZFH 2W26A 2RDLA 1V2VT 2R3UA 1TMBH 3D65E 3MNSA 4AFSA 3GDSA 4AFQA 3SGAE 3MYWA 1AN1E 7LPRA 2TGTA 2JH6D 2Z6BD 1DY9A 1S82A 4ZMAH 1C1NA 1N1LA 1C5VA 5TCCA 1VITF 2XC4A 1PPHE 4ISNA 3TVJB 1CBWC 1C1PA 1UK4A 3A7ZA 1W3CA 2KR7A 1GI2A 1YLCA 3PB1E 1SFQB 1BBRE 3U98H 3LH3A 2CXVA 5LPFA 1OWDA 2VVCA 4JK6A 3OX7U 3GYLB 1UVOA 5FPYA 3RXDA 4LK4A 1RTKA 2PWXA 3EQ0H 1ANCA 1GWAA 1Z7KA 4YO9A 1BTHH 3SJIA 2LP6A 2J34A 4INLA 4YTAA 1ZSJA 3SYJA 1FXYA 2AGGX 1C2LA 2BXUH 1A5IA 1GG6B 1V2KT 4H6TA 3TGIE 4Q63A 1TMUH 1BTWA 2XWAA 4TY6A 5GPIB 1C5NH 1A0JA 2QXJA 1EP5A 5DK1A 2JKHA 2Z3CA 1C2EA 1CHGA 1L4DA 2BLOA 2J97A 2FODA 1K1JA 2AMQA 1GCDA 5EOKA 1ESTA 2P3FH 1M9UA 4ZKRU 3GY6A 3W94A 3HATH 9LPRA 5AFYH 4M9FA 3T29A 5A8XA 1YGCH 1H8ED 5CHBA 2H5DA 2L74A 1BB0B 1K1OA 5EJZA 3E0PB 3TITA 1HIAA 5C67A 1YPGH 1C5YB 4AB9A 1GJ7B 1IOEA 2OBQA 1P0SH 5DP6A 1E34B 3M35A 4B2BA 2W3KA 3R3GB 5EODA 3L6PA 3DT0H 4X1QU 4JZ1A 1SOZA 2ZG0H 1C1MA 1Z71A 3UWIA 3PMJA 3B8JA 2NU2E 4B2CA 4ABGA 1HNEE 1BA8B 1MUEB 2BLQA 1F5LA 2LPRA 3RXTA 1IQJA 1MH0A 2KCYA 3DSPA 3VGCC 2BD8A 2B5TB 5I25A 2FOFA 1ZYOA 5FL7D 4MPWA 1MD8A 3KYFA 1GHAG 4U30A 3ATLA 1HAVB 4Y8ZA 1MABB 2FOBA 3TGJE 2ANWA 2J38A 1CGHA 4MNWA 4CRAA 2QA9E 1S0RA 1Z8IB 3ZV8A 2ZGHA 1ANEA 2ZC9H 1P05A 2IOTA 2BDYA 1HRTH 5GCHF 4UDWH 5EG4A 1IQMA 2G5VA 2GCHF 3FOAA 3A89A 1ZOMA 5EQQA 2QF5A 1ESAA 4YLQH 4K1EA 3WW7A 1GI8B 3DD2H 5IDKA 3JZ2B 4TSFD 3AK5A 4WVPE 1E79D 2F4LA 1SOTA 2PP6A 1NBME 2V35A 4B71A 3H7TA 2IPQX 2ASUB 5EQRA 4ABBA 4OGXA 3DCLA 3MU0A 5DPAA 4AFUA 4XOJA 2PLXA 2FI3E 3LGVA 5F53A 5CMXH 2BLWA 3Q3KA 2Y80A 4P00A 1W0JD 1Q31A 3TJNA 1D4PB 1TABE 1BDAA 2XOKD 1O2KA 3AVZA 3ZZ8A 1TRMA 1QL7A 4TPYA 3ZVGA 1V2QT 3BSQA 3LIWA 1OPHB 4X8SH 1PPFE 3DSOA 1UTPA 2A45B 3RUOA 3SGQE 3SV8A 3RXIA 1W13U 2FTMA 3RMNH 5C17A 4NZQA 3E6PH 3D49H 4JYUH 2ZI2H 1G37A 2IJOB 2A31A 4K69A 4AB8A 1XUFA 1DANH 1DE7H 5DGJA 5BRRE 2BQWB 3A86A 1QBNA 2XC5A 1ZHPA 1S0QA 2ZDKA 1KLJH 3PRDA 1O5DH 4K60A 1CA0C 1O2JA 1GJ6A 5AHGH 3PM3A 1P09A 4JZDH 3KCGH 3STJA 4FUDA 3ENSB 4ZHMU 3TH3H 1ZPBA 4KKDA 2OXSA 1BTYA 2A7JA 1EJMA 2QXHA 2BOKA 2ZQ2A 4BANB 4ZKSU 1UTNA 1UTQA 4GAWA 3QO6A 2PKAA 3VB7A 5E0JA 2HALA 4F4OC 1EB1H 1O3EA 5C1UA 1P2QA 2ULLA 3ZZCA 3SV2H 2YMSC 2B9LA 1GJAB 3MH5A 3RXAA 5HKKD 2AH4X 1YWUA 1TWXB 3HKJB 1GDNA 4Q7XA 1N6XA 1IHSH 2FWWA 3ZVAA 5F8ZA 2WPIS 2Q1JA 1FIZA 2F43B 2ZFTA 1OYTH 1TIOA 1VGCB 1A5GH 4UFDH 3RM2H 8LPRA 1C1QA 2WYJA 3SGBE 2PTNA 5KECA 3T62A 1UVTH 3LONA 1TRNA 1B7XB 5DP8A 2V3MA 5C5OA 1RS0A 1DLEA 1ZZZA 1FDPA 3WWFA 1TAWA 3OEED 4X2YA 5E0HA 2BXTH 2Q6FA 3P6ZB 2TIOA 2P16A 2XBXA 3A82A 4GCHF 4NG9H 4OS2A 4X0WU 1BCUH 5DP7A 4YLUA 1ETSH 1K28D 1QURH 1WAYB 2UUFB 4I8JA 3TPIZ 1QZ8A 1PYTD 3DFLA 2Z9KA 4Y7BA 1RIWB 1AWFH 2XCNA 3SI4H 4ABHA 4RN6A 2A7HA 1Y3WA 4DURA 4J1YA 2V3OH 3LGYA 2GV7A 2XBYA 1Z6JH 3RMLH 1D3TB 1PQAA 3GY8A 2Z9LA 1B5GH 2GZ8A 5C1YA 1U6QA 3F6UH 1FJSA 2EEKA 1AFQC 2PTCE 3ZV9A 1HV7A 1VGCC 5HGGA 2AERH 2BVSH 1VKYA 1THRH 1ESBA 4NWKA 1H8HD 2SGFE 1D3PB 3RXQA 1VCPA 5K0HA 2WYGA 1YBWA 1QIXB 4JZIA 3OTPA 4IC5A 1HAYB 1P01A 1C2MA 2D1JA 2BB4A 1P9SA 4NGAH 1O36A 2VVUA 2ZO3H 1NM6A 2AMDA 2H9TH 3LC5A 3SU5A 4FUJA 1EPTC 4ZHAA 3A85A 3GCHB 4KELA 1A4WH 3SV6A 1H9LB 3URCA 4X8UH 1G9IE 4UFEH 2HOBA 4WMEA 4H6SB 4I8GA 2C8XB 1F2SE 2FX4A 4O97A 1MZAA 3HGNA 1O3GA 2THFB 2UUYA 1E37B 3O8DA 4B74A 3MFJA 3RXMA 1C5SA 3S7HB 2CF9H 4MDSA 1VITG 3SHAH 1WTHD 3PYHA 1DT2A 1UJ1A 2W3IA 1LTOA 1HFDA 4X1PU 3SU6A 3V7TA 2O8WA 1GI0A 3M61U 4CRCA 1BMNH 3ZZ4A 4GSOA 4F48B 2A0QB 1PQ5A 3QUMP 3ZYEA 3RXCA 3LT3A 1AD8H 3SUFA 4AZ2B 2FS9A 1YF4A 2ZHEH 4WMFA 3SZEA 2GD4B 3T2NA 1V2ST 3SUEA 1SGCA 1O2TA 1CHOG 4MNXA 1NFXA 1GMHF 4B1TA 1Z8GA 2ZCKP 1NTPA 2GZ9A 3BTHE 1UCYK 2A5IA 1D9IA 1XKBC 2ZECA 1C2GA 2BDCA 2G8TA 1BMLA 3GICB 1N8OC 1DS2E 3GDVA 4XBCA 3I29A 4MNYA 4D9RA 3V12A 4DG4A 2CK3D 5I46H 3GCHC 2D26C 1C1WH 1FY8E 4CR9A 4DT4A 3D62A 2OCVB 2ZDAH 5E2PA 1SLWB 1UVUH 2TGDA 4OGYA 2BD2A 1AKSA
chains in the Genus database with same CATH topology
1FI8A 1NO9H 1WTGH 1ELEE 2BDGA 4HI3A 1MCTA 2FP7B 3P95A 3BTFE 3TGKE 2FOGA 5F8XA 3UNRA 1XXDA 1TBRH 3ZZ3A 1SG8B 3MU1A 1NRRH 1V2JT 1EUFA 1KXCA 1MTSA 1F7ZA 5CHAB 2XBWA 4HGCA 2PSXA 2ANYA 4NCYA 4ZH8A 2ZCLP 1J15A 1WU1A 1TPAE 5L30H 2OC1A 1OP2A 1Y3XA 2ZFRH 4LZ4B 1QRXA 4E05H 1P04A 4ABDA 1P8VC 1EXFA 3LPRA 1HDTH 1HUTH 2STBE 3U9AH 1L1GA 4D9QA 1IQKA 1GBTA 1CE5A 1BRBE 2BZ6H 1GBLA 3BTQE 1C5PA 1SGNE 1UO6A 3QLPH 4H4FA 3UPEA 2I6QA 4BAKB 3PO1B 1SQTA 3KGPA 1FY3A 1H8DH 5GCHG 2Q6DA 2GCHG 4AYVB 2VWMA 4O03A 5JBCS 4CRBA 5EXLA 1AQ7A 2QC2A 1SGEE 3PV4A 2BOHB 3P8OA 1FY5A 2ZP0H 3M5NA 1BZXE 3M7TA 1KY9A 1MBQA 2BD5A 1OP0A 4THNH 2XNIA 2O8UA 2G81E 1SSXA 1P02A 1PJPA 3TNSA 6GCHG 1MTNB 4TPIZ 1TFXA 3SN8A 4A6LA 2ZTZA 1C5QA 3MU8A 3SU0A 3TU7H 5DKMA 2KAIB 1G30B 1Y3UA 3CS0A 1YP9A 2FO9A 3BG4B 1O5EH 1C9TA 3SI3H 3AAUA 2RA3A 1B0EA 1MKXK 4MPXA 2QV1A 1O3BA 1FY1A 4FUHA 1K1IA 2JETC 2F9OA 1GI7B 1O3FA 1F92A 1UTLM 1O5CB 2OC0A 3PO1C 1P57B 2P93A 1TBQH 3SOSA 1NS3A 1KYNA 1TGTA 1W10U 1HAZB 1OWIA 3RLWH 3SNCA 3RXEA 1LQDB 1SQOA 1BTUA 1Y5AT 2FOMB 4A7IB 1C4U2 4K3JA 1EB2A 5LPRA 2TGPZ 2QCYA 1MKWH 2ZTYA 3F9HA 2GTBA 3A83A 4IMQA 3P8FA 3RXUA 3GCTG 2Z3EA 1ZHMA 2ZFFH 4FU9A 4AYYB 1CT4E 1A61H 1GCTB 2G55A 1DWDH 3TK5A 1Z8RA 3V0XA 1F5RA 1BITA 1ELTA 2QGRA 3BG4C 1D6RA 4ASHA 4Q7YA 3GDUA 3KN2A 1ZMLA 2AGEX 2BX3A 3IITA 1T32A 2C3SA 1HJAC 2VH6A 1K1LA 4I33A 4FU8A 4U2WA 4A92A 3MNCA 2FPZA 2J92A 2CGAA 4LXBH 3PTNA 1C2IA 3MU4A 1HCGA 3O8BA 3K6YA 3W95A 3E0NB 1YYY1 4BXWA 1MMJN 5DP5A 1SLXB 2W7UA 1P03A 1P2KA 1NU7B 3FFGA 2FS8A 4FUEA 2GCTB 2ZHFH 1O3LA 4I8HA 1OWHA 4CH2B 1O2PA 2PKSC 3UOPA 4CR5A 2OD3B 2FZZA 1YPEH 1FPHH 1GCTC 2G5NA 3PMHB 1EPTA 1O2OA 4GCHG 3MMGA 1AWHB 1LHGH 1BMMH 3BTTE 1J17T 1P06A 1SGFG 1F5KU 5JB9S 1T8LA 2H1UA 2PFEA 4ABIA 4ZUHA 3RU4E 1INCA 1BTZA 4AG1A 3RC4A 3LH1A 1QBVH 4A1VA 1K2I1 1FZZA 1HYLA 1ARCA 3EA7A 1YCPH 4YOIA 5JDUB 1FAKH 1ZTJA 1OSSA 3F68H 1P2MA 1O3JA 5EU8A 3T27A 3ZZAA 4AN7A 2BX4A 1LDTT 1NY22 2J94A 2A2XH 1WUNH 2Z9GA 5H4IB 4M7GA 4GLYA 3ZVFA 4BTTB 1P3EA 2BY7X 3EYDA 3SJKA 1QR3E 1BT7A 1IQLA 2XRCA 1DUEA 1KDQA 1LHEH 4FUIA 3RXHA 2PUQH 1C5ZB 2UWOA 5C2ZA 5EGMA 1BUIA 1N6YA 5E2OA 4FU7A 2IPHA 1SB1H 2ZDMA 5A8YA 1UTMA 1GG6C 3ZZBA 1LKBA 2FI4E 4TWYA 2EC9H 1EJAA 4B73A 1AVXA 3RU4D 2ODYB 1WYKA 3QTVH 4WXIA 2WPHS 4OS5A 1K1MA 5FCRA 1O3PB 1BTXA 4SGBE 3SW2B 1THSH 3D23A 5EXNA 1FN6A 1H4WA 5K7RA 5EW1H 3ZVEA 1TB6H 3MH4A 1B0FA 2RG3A 4KP0A 5C5NA 1QRWA 1W11U 4CREA 3SNBA 3ZVBA 1TGNA 3C27B 1TQ0B 1CT0E 1XUHA 1A2CH 1BRAA 1YM0A 1O2UA 1VITH 2ALPA 1AFEH 1ZRBA 4XE4A 1O3KA 3ODDA 1Y5BT 1O2MA 4AX9H 1C5MD 1KXFA 1O3OA 1FUJA 2A4QA 1XVOA 1NFWA 1J9CH 1C1SA 2ESTE 5CE1A 3MI4A 3Q3YA 4OS7A 1YPHE 2ILNA 3M7QA 1RTFB 2ZU1A 1HJ9A 1SVPA 3KQCA 2BY9X 1YPHC 1ABJH 2AYWA 2GKVE 2A32A 1LCYA 4ABEA 5T3HA 3ZZ9A 2ZGCA 4MPVA 4Y6DA 3URDA 3QN7A 2VIWA 1Z8JB 3RXSA 2CN0H 1TX6A 1V2MT 1KXDA 2NU1E 1EKBB 3LC3A 3UNSA 5C3NA 3BTME 5HMAA 3UTUH 8ESTE 4FVBA 4Y0YE 4DCDA 3U69H 2Z94A 3NPSA 3CENA 4ISOA 1ELCA 1EASA 3SQEE 3OY5U 3RLYH 3RMMH 1GJ5H 1UVPA 1FONA 5JPMH 1F0UA 1RD3B 3SORA 4K8BA 4Y0ZE 2G00A 1SLVB 1PPCE 4ZXYH 1UHBA 3TH2H 2AIQA 4HTCH 1GBMA 5ESBA 4Q2KA 1QFKH 1FV9A 2NWNA 1TE0A 5EQSA 3OSYA 1E35B 7GCHF 3ATMA 1AHTH 1TNJA 4CHAB 3UQOA 1C2KA 3FP6E 1VR1H 2FIRH 3A8AA 4WMDA 4O9VA 2BY6X 2FYQA 1W0YH 1BMAA 1AZZA 3K6ZA 1EAWA 3BIUH 1TGCA 1ZTKA 1XUJA 1E36B 1DWCH 3AW1A 2SGQE 2BTCE 2YOLA 3U8OH 4E7RG 1EZSC 2C8ZB 2R2MB 1BTPA 3MO3A 3SU1A 3F9GA 1ZGIA 4AGJA 3H5CB 1ZMNA 4ISLA 1BHXF 1TGBA 4ZAEA 1C4V2 1DICA 1ZPZA 3KQEA 2Y5GA 4K2YA 3VXEH 2XXLA 4SGAE 1ZJKA 3A84A 1QJ1B 5L6NH 4YT6H 1SR5C 4A1TA 3A8DA 3MO9A 1AE8H 5HM2A 2ZKSA 4CHAC 2GMTB 1KIGH 2GDEH 4O3TA 2ZU4A 3ZVCA 3PLBA 1THPB 1SGDE 4NSVA 3RXVA 3UREA 2H2ZA 2NU0E 3PLPA 1KXAA 2CHAB 1SC8U 4IC6A 1TNLA 3M3SA 3RC6A 1BJVA 3CS7A 1GHVH 3TJUA 4UFFH 1EAXA 1CGJE 4HFPB 1QTFA 3Q77A 3JZ1B 4OS1A 4A5TS 1C2DA 1DLKB 1LHFH 4ISHH 3ATKA 2H5CA 1MQ6A 4Q7ZA 2VINA 1QGFA 2BZAA 2SNVA 3GY5A 1GBEA 4LOYH 3NXPA 1NFUA 3EA9A 5ETXA 1NRPH 6CHAB 4YZUA 1BIOA 3V3MA 3R0FA 3UQVA 2ZZUH 7ESTE 1QL9A 1NU9A 5SGAE 1XUKA 4K8YA 3RM0H 3WY8A 2CF8H 2WV4A 1XKAC 1T8MA 3SUDA 4X6OA 1RFNA 1C5UA 4K1TA 5FX5A 1UTOA 4MQAA 7KMEH 3KIDU 3SZNA 1C2FA 3BV9B 1OXGA 1KSNA 1NESE 2HWLB 4XDEA 3ZZDA 1Z6EA 2WV5A 2AIPA 1Z1IA 1C1UH 3ZVDA 1FN8A 1GPZA 1RIWC 2ZU3A 1GMDF 1V3XA 2BQ6B 2FI5E 2QY0B 2OC7A 1H1BA 1MTVA 2FTLE 3PLKA 2FXRA 2VIVA 1F0RA 1HIAB 1Y59T 2ZNKH 4NIWA 4Y7AA 4ESTE 1O34A 2A5KA 2ZFSA 4GPGA 2SGPE 1JRTA 4NA8A 1SGIB 3MNBA 1YCPM 2IN2A 1VJ9U 2VWOA 2FM2A 4VGCB 2HNTF 1CT2E 3SU3A 1S83A 2A4GA 3K9XB 1QY6A 1W7XH 5FBEA 1O2LA 1H9HE 1NPMA 6CHAC 2Z3DA 1L0ZA 1DY8A 2BD7A 5FHTA 5GXPA 1O32A 1XUIA 1A0HB 5EPYA 1TX8A 3FZZA 2C90B 1IQFA 1C9PA 2QXGA 1IQEA 3KEEA 1VJAU 1A1RA 5FCKA 2W7SA 2AGIX 3RU4T 1EZQA 1O3AA 1DXWA 1GHWH 2FOHA 4XFQA 4E7NA 1ZHRA 2BM2A 1J14A 1H9IE 1NC6A 1O2NA 2F91A 4AFZA 3SQHE 2QN5T 3T25A 3TK9A 2OINA 3AASA 1OWKA 1HAXB 2ZU2A 4BAOB 4FXGH 1AI8H 2UWLA 3CP7A 3E1XB 1NRNH 1SGTA 4I8KA 4WJG2 4IS5A 3A8BA 3QX5H 1SFIA 5J4QA 3F9EA 3A7XA 2PGQB 1QB1A 3K2UA 1C1OA 1GVKB 2DE8A 1IHTH 2WPJS 2P95A 1OYQA 1ANDA 4XBDA 1GBDA 4U32A 1HXFH 4NZLA 4UFGH 2XC0A 2A1DB 3A7WA 1GI5A 2G51A 3S9AA 1UK2A 1SGQE 5JBAS 1CU1A 1YC0A 1BBRK 2EA3A 2Q6GA 3Q3XA 3A88A 1YLDA 1C2JA 3SU4A 5L2YH 2BDHA 3M5MA 3TLOA 1LQEA 1G2MA 5EXMA 3QZQA 1SI5H 3STIA 1ACBE 1OP8A 4JYVH 2I6SA 4INHA 5JYIA 2VGCB 2XW9A 3UR9A 1PPGE 2B0FA 3UR6A 1O39A 1L1NA 2J95A 2P8OB 1DWEH 4I32A 3SUGA 4F49A 4MLFB 2QXIA 3DHKH 3LJJA 4D76A 4RKJB 1GI9B 3A80A 2O8TA 5DG6A 3UWJH 1HAVA 3PTBA 3MU5A 1A46H 1DPOA 5HYOA 4AOQA 2H9HA 1C5XB 3K65B 4QT8C 4AORA 4KTCA 4Q80A 3BTGE 4IN2A 4D7FA 1O2ZA 1UTKA 4HZHA 1HAIH 2BVXH 1XM1A 1V2OT 1ETTH 4CRFA 3RXJA 3AAVA 1AVGH 1CQQA 1CO7E 3UNQA 1F0SA 4R0IA 1O2QA 4ISIH 1EJNA 2FYRA 2OBOA 3TJOA 1AB9B 1E0FD 2ZHDA 5CHAC 4O3UA 2PKAB 2A7CA 1DUAA 8GCHF 2CMYA 4X8TH 3RXBA 2GGVB 3Q00A 5DJ7A 1XUGA 4FUCA 2VGCC 1GHZA 1CGIE 2PGBB 1EX3A 3RXGA 1DITH 2P8OC 2QAAA 1QHRB 1S81A 2TBSA 2P3UB 1FY4A 1O2XA 5C20A 2HPPH 5FPTA 1QJ6B 2GVFA 5IYTA 3RXKA 1GI6A 1AMHA 3QK1A 4DIHH 3RXLA 1DM4B 2ZDVH 3NCLA 4ABAA 4D7GA 1P9UA 2G4UA 3IWMA 5A0CA 4DW2U 2FOAA 3OYPA 1T8NA 2J2UA 2GZ7A 2WINI 2FX6A 4B2AA 5LPEA 1ETRH 3SJOA 4DOQA 3SHCH 1JMOH 5LGOA 1TA2A 1TOCB 4I8LA 9ESTA 2ANMH 2VU8E 4ABFA 4DJZB 3GYMA 4FUFA 3GY7A 3DA9B 3VB3A 1W7GH 2Y7ZA 1ZLRA 4Y10E 1MTNC 2GV6A 2GT8A 7GCHG 1GBCA 3MH7A 2B8OH 1D6WA 1LVBA 4WXVA 3ZZ6A 4ZKOU 1WV7H 1C2HA 1TBZH 5ABWA 2SGEE 1W14U 1UVSH 3NKKA 2ZQ1A 3EE0B 1ABIH 4BAHB 3HPTB 1IQNA 1O5FH 1W2KH 2HVXA 1ZR0A 3UUZA 4B76A 1GBJA 1TPPA 1HJ8A 3H7OA 1O3IA 5F8TA 3KQBA 3M3TA 1V6DA 3MH6A 1UCYE 2XYAA 3A8CA 2H6MA 3QGJA 2Y7XA 3GOVB 3UIRA 3P8NA 1BQYA 4AG2A 2DUCA 1O5AB 5F03A 1MU6B 4CRDA 1IQGA 2ZA5A 4NA9H 3LU9B 2AFQB 5E0GA 3DFJA 4RKOB 2ZPRA 1XMNB 1Q2WA 5J4SA 1V2WT 1SGFA 1GHYH 1G3DA 3KF2A 2TRMA 1LMWB 1AO5A 3BN9A 3O8RA 2BVRH 1O5GH 3Q76A 2Z9IA 2DE9A 1L1JA 1CSOE 3GY2A 4CBOA 4B75A 1K9OE 3SNEA 1SL3A 3TIUA 1LVMA 1H8IH 1BRCE 1HAHH 4OS6A 4Y76A 1FNIA 2O8LA 4DIIH 3T28A 1TOMH 2ZF0H 1DOJA 2ZGXH 1CHOF 3HKIB 3UOUA 1O35A 4CRGA 4R8TB 5PTPA 2AEIH 2WPMS 3T26A 2VIOA 1BOQA 2A4OA 3GY4A 8KME2 5DP3A 2EI6A 2WPKS 2C4FH 1MCVA 3PWBA 4TY7A 4X6NA 5JB8S 3SJ9A 1WCZA 5T6FA 2GX4A 5A8ZA 1O31A 2V6NA 1O2GH 2GCTC 3VGCB 1NZQH 1MD7A 2A5AA 2R9PA 2YNBA 1P3CA 3BTEE 3MTYA 4FUBA 4ABJA 1GBBA 2Z9JA 3S9BA 5LH8A 2JH5D 1AKSB 2F9VA 3SV7A 2QIQA 2ZEBA 3ATIA 4GUXA 2P59A 1V2NT 3B23B 1ZMJA 1F0TA 3LGWA 3ITIA 4MG3A 2FEQH 3HGPA 3M36A 3G01A 4NFEA 4WF8A 1QB9A 2BYAX 4YT7H 4E06H 2QYIA 3ESTA 2Y81A 2V3HH 4ZKNU 1UCYH 1KLIH 2VJ1A 3L33A 2VB0A 3OY6U 3ELAH 2PV9B 1J16A 4KTUA 2XTTB 1GMDG 2ZFPH 3A81A 1AIXH 3L3TA 1HB0B 1IQHA 1O30A 3F9FA 5TJXA 1K1PA 3MOCA 1GBHA 1EAIA 1GJ4H 2OP9A 1G3BA 1MTWA 1NFYA 1ZJDA 1GHBF 4H42U 1TALA 2SFAA 2OC8A 4X2VA 4X1NU 1JBUH 1O2SA 1GJCB 1LPKB 3RXOA 1FIWA 2VVVA 2ODPA 5HM9A 4Z6AH 3F1SB 1OWJA 1VCWA 3BG8A 1UK3A 2BMGB 1YPJH 1SMFE 1O3HA 2BY5X 1GMHG 1MQ5A 4UONA 5AVDA 4NIXA 1BBRH 2RCEA 2PW8H 1UMAH 1TA6A 3QZRA 4JMYA 3U8TH 1GHXH 4AGKA 3FANA 3OTJE <