1LTOA

Human alpha1-tryptase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCLGPDVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFPPGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDMLCAGNSQRDSCKGDSGGPLVCKVNGTWLQAGVVSWDEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha tryptase I
publication title The Crystal Structure of Human alpha1-Tryptase Reveals a Blocked Substrate-binding Region
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ltoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ltoA01
1MAXA 1GI7B 3RXEA 1YPGH 3EGKH 1Z71A 3MO9A 2WINI 2AH4X 4TWWA 2BMGB 5G4BA 4E7RG 2JH0D 1IQNA 2OCVB 1J15A 1LCYA 2HPQH 3SW2B 3H5CB 1TOCB 2CN0H 1VCPA 5F8TA 2BD4A 5FPTA 3SJKA 3RXGA 2W5EA 1TQ0B 3PLKA 1BBRE 1LPKB 3ZYDA 2BM2A 2G5VA 4KTUA 1DOJA 4AGJA 2QN5T 2I6SA 4AFUA 1FV9A 1FIZA 1TNKA 3T62A 1Q31A 2OBQA 4Z6AH 5EQQA 3EE0B 5GIBA 1G3BA 2HALA 3RLYH 2OQUA 1SOZA 4SGAE 3MO3A 1O33A 1GHYH 3QGJA 1OP8A 3D23A 1EP5A 1PPFE 4AORA 3UR6A 3ATWA 3FP7E 3U8RH 4U2WA 1BQYA 1BRBE 4NGAH 1ETRH 2CJIA 3A8DA 3G01A 2VIPA 1O0DH 1TGTA 4A1TA 2F9OA 3LGYA 1GBLA 1YCPM 1IAUA 1L1JA 1H9HE 6CHAC 1GJCB 1GHBF 5DGJA 3ESTA 1L0ZA 4JZFH 3K6YA 3K6ZA 1NFXA 5HXFA 1QL9A 5FX5A 1WV7H 2ODQA 1DPOA 3PTBA 5K0HA 1C2KA 2GKVE 2A5KA 4YO9A 2BTCE 2JH5D 3SU2A 1TGBA 3M7QA 2J2UA 1XUHA 2XTTB 2ZQ1A 5JDUB 1AFQB 5E2OA 1W2KH 1N8OB 1Y3YA 1IQMA 2CXVA 3V7TA 2Y80A 3BEIB 1T8NA 4XBBA 3WY8A 1A2CH 4Q80A 4UFEH 3P8OA 1V3XA 4LOYH 1L4ZA 5AVDA 3GCHC 1NY22 3T29A 4FUEA 3UPEA 1GJ7B 3DFJA 1P04A 1C2JA 1L1GA 2J34A 5EW1H 3DHKH 4TY7A 3GDVA 4A5TS 1SGCA 1HAPH 4OS1A 3HGNA 1NFWA 4F49A 3RXVA 3T27A 2O8TA 1UVUH 5L30H 4TYDA 3OTJE 3F68H 3A80A 3ATIA 1SHHB 1QRWA 3H7OA 1BOQA 2BOHB 5ETXA 1N6YA 4TPIZ 2PKAB 2FI4E 4RN6A 3T26A 3VB3A 2G4TA 5GDSH 4OS6A 3JZ1B 1MH0A 1E0FD 1O30A 3A7WA 5T3HA 4R8TB 2QXGA 3URDA 5FBEA 2FXRA 5ABWA 1DITH 4ABHA 4ABAA 1AU8A 4X0WU 3SJIA 1ZPCA 1OPHB 3QO6A 1HYLA 2KAIA 1ZRKA 1BDAA 8GCHG 1ELEE 3VB4A 2PKSB 1C1WH 2HLCA 3GY2A 3PMHB 4ASHA 4B74A 4Y7AA 4CBOA 5FAHA 3M3TA 5DP4A 3GY6A 3PM3A 2VVCA 1TX8A 1AB9B 1WTHD 1OWJA 1IHSH 3QGNB 7GCHF 3Q3YA 4UE7H 2A5AA 1HPGA 1S82A 1GMCG 4X8TH 1UTLM 2EA3A 2F9NA 3MH5A 1Y59T 1GWAA 1BIOA 1MQ6A 3LDXH 3TVJB 1X7AC 1BBRK 1MTWA 4ZUHA 4X6NA 2R0LA 3Q76A 3QN7A 1T4VH 1SGEE 3BTHE 1HLTH 1P0SH 3LJOA 1SC8U 2BY7X 2ZG0H 4AFZA 2W7SA 1DY8A 4OS2A 1DWBH 3UOPA 3PMBB 4Y11E 3ELAH 1TIOA 2FS9A 3SI3H 1AMHA 4X2VA 4Y76A 2PV9B 3BG4B 5EPYA 3ZZ7A 2THFB 1AN1E 1UHBA 4DJZB 1QHRB 1EUFA 2H6MA 3DFLA 1GI0A 2I6QA 1DSUA 2BD2A 2NU4E 5T6FA 1OWIA 2R3UA 4I8LA 4ISIH 2Z7FE 4ABEA 3DA9B 1MAYA 1O3IA 1ID5H 4NA9H 5CMXH 1GI8B 2P8OC 1KLJH 3SGAE 1C5ZB 2QXHA 4ISHH 4MPVA 3DUXH 1GGDB 1QBVH 1D9IA 1UTJA 2Y6TA 1E38B 4Y8XA 3RU4T 1M9UA 1SFIA 2FX4A 3GY4A 3LKWA 4NA8A 3RXRA 1PQ7A 1HAGE 2ZDAH 2ZA5A 2P93A 3SUDA 3UNQA 1GMHF 3M37A 1SQOA 4X2YA 1O5CB 4H6TA 2PW8H 3TJVA 1H8IH 1ESBA 4AB9A 2XRCA 4A7IB 1TRNA 2CGAA 1ZMNA 2XBYA 3OSYA 1P12E 2XWBI 5HGGA 3SORA 1IQEA 3SHCH 5CHAC 3DT0H 1WQSA 3BTGE 4H6SB 4I8KA 1V2JT 3AASA 3HKIB 1AI8H 1AVGH 5JBBS 1GI3A 1EJNA 3P95A 3O8CA 4RSPA 5J4SA 3U1IB 1KXFA 4ZMAH 3GDSA 3SV2H 1E35B 3UWJH 3LIWA 5TJXA 3F9FA 1P3CA 1GHAG 2FZZA 2FOHA 1MU6B 3MNCA 2ZHEH 2Z3DA 2TBSA 1ZSJA 2FOFA 1H8DH 2ZDNA 2ZPRA 1EAXA 4QT8C 1P11E 2FO9A 1SBWA 5EODA 3RMOH 1ZTLA 1O3NA 2HPPH 1O5FH 1O32A 1O3CA 2WPKS 3NUMA 2ILNA 1UVTH 3KQCA 2ZFRH 2ZDVH 5FHTA 4DT7B 4K60A 3TK5A 4NZQA 2P3UB 1RFNA 1UCYH 4THNH 4BTIB 1O2UA 1CHGA 1AKSA 2CV3A 1BMAA 2Z94A 1FPCH 2PGBB 2PTNA 4H4FA 3LU9B 1OWDA 2SGQE 3SV8A 3LH3A 3TK9A 5FXLA 7ESTE 2JKHA 2BQ7B 2ZFQH 4RKJB 3BTDE 2ANWA 4B71A 4JZDH 1ZJDA 3KQEA 2AERH 3UY9A 1NZQH 3STJA 1ESAA 4DOQA 3LT3A 5DP8A 1P09A 3I78A 3MNSA 2SGAA 1K21H 1GBDA 2GMTB 4O9VA 4YLQH 3RXJA 2ZFTA 1BITA 1IQHA 4ZKOU 2H5CA 1LQDB 1S6HA 4FUJA 1A5GH 1B5GH 1P2JA 1SGYE 4CRDA 3E1XB 5AHGH 2CHAC 5LH8A 2O8WA 1NU7B 1AHTH 1A5HA 1XUJA 2A31A 3ZVGA 1ZTJA 3BF6H 4IMQA 1NM6A 3BV9B 1AIXH 1BTZA 4WXIA 1OXGA 4Y0ZE 5A2MH 1NPMA 1F5KU 1CHOG 4GCHF 3NCLA 4IN2A 2G8TA 2FOEA 4IBLH 4FUDA 2WPJS 5HYOA 2BDIA 1OX1A 3SU1A 2ZTXA 3PLPA 1EXFA 1SLWB 2ZFPH 1P8VC 2ZO3H 2GV7A 1NRSH 4PROA 1LHGH 1O2VA 1ELAA 3MYWA 5EXNA 1TPSA 1MKWH 2VH6A 1DS2E 1FI8A 2Y5GA 1F5LA 2NWNA 3IG6B 2GTBA 1MQ5A 3HKJB 4ZKNU 2O8MA 3IITA 2WPMS 1SOTA 1GVKB 1BTHH 2VIWA 1GJ9B 1JBUH 4KP0A 3M3SA 1VJ9U 1THRH 2ESTE 1UVOA 1FPHH 1CT2E 1HJAB 1YCPH 2FS8A 2OC1A 3FP8E 2P59A 3RXKA 4MLFB 1SGIB 5EQSA 1V2QT 3NK8A 1LVMA 2P95A 1KY9A 4VGCC 2BD8A 1OS8A 4BNRA 1BCUH 1C1PA 4YOGA 4CHAB 1PQ5A 1BZXE 3TJNA 1SGRE 4CRFA 3GCOA 1Y3XA 3MO6A 2O9QA 3ZZ4A 2XW9A 4K1TA 3P8FA 1ZJKA 2F83A 2ZIQH 2GGVB 1G3DA 5A0CA 3MH6A 2SGEE 3AW0A 1AVWA 1C5PA 1SGTA 1TE0A 1LHFH 1BUIA 1YPHC 1V2KT 2XC0A 2IOTA 2Q6DA 4MNYA 4UDWH 1O3AA 3A8AA 3M5LA 5BRRE 1GJBB 2BD7A 1N1LA 1XM1A 2PKAA 5A8ZA 3U8OH 4GUXA 8KME2 1C1MA 1VZQH 2C90B 3NWUA 1P05A 4AN7A 1GBKA 4BAQB 1HDTH 2DE9A 2W3KA 3KQBA 1EPTB 2G81E 3BN9A 5BPEA 4Q7YA 4AFSA 1BTUA 3T25A 3ZZBA 3ATKA 1QJ7B 1GPZA 1PPZA 3JZ2B 1B0FA 4KTCA 5A8XA 3EQ0H 3LGIA 4X6OA 3RXDA 1BTPA 3TU7H 2GZ7A 3ATLA 1UJ1A 1RIWC 1Y3VA 1G2MA 1EAIA 2HNTE 4NSYA 5C2ZA 1UTQA 3ZVCA 3AAVA 1FY5A 4ZKSU 2GCTC 3RUOA 2V0BA 2Y82A 1FAXA 2F9UA 1EOLA 4ZXYH 5C3NA 3UQVA 5A0AE 1GCTC 1Z1JA 1KLTA 3QWCH 1C5NH 1ZRBA 3QTOH 1Z8GA 4ABDA 3MOCA 4JK6A 5GWZA 1JIMA 5IDKA 4AG1A 1G3EA 3SV6A 1NN6A 3CS0A 4B2BA 4CBNA 1O3KA 3RXHA 1S0RA 1EB1H 1ARBA 2AS9A 1O35A 3P8NA 1THPB 2PSXA 1SI5H 4SGBE 3AVZA 1SMFE 3MHWU 5C1XA 2FTLE 1E37B 4KELA 2AGIX 1QR3E 4AGKA 3RXFA 1MBQA 3A7VA 2QA9E 4X1PU 2C8WB 1DVAH 1RTKA 1P02A 2EI6A 2GDEH 1ELCA 3A7YA 3HK6B 2ZNKH 5EQRA 4XSKU 2PHBA 3M7UA 3QZRA 1KDQB 2EC9H 3PYHA 1O3BA 1K1IA 2GT7A 2RCEA 1A5IA 1VGCC 1SG8B 2FOBA 3BTQE 2ULLA 3RXTA 2ZCKP 1MTNC 2GP9B 1LHCH 4K1SA 1HJ8A 4I33A 2K1QA 2TGDA 2WYJA 4B2CA 2ZPQA 3LJJA 2Q1JA 4BTUB 5CE1A 1UTKA 3KL6A 1ELBA 1ZMLA 2FYRA 1K1OA 4INLA 4CH8B 1C5WB 3M3VA 2AMQA 3RM2H 3KF2A 1W13U 3A81A 2BY5X 3A8BA 1QB1A 2AEIH 1O36A 4B1TA 5EXLA 1PJPA 3RXLA 1MTSA 4NWKA 3ZYEA 3PTNA 2PUXB 2H5DA 3P8GA 5DP3A 1S81A 2ZHQH 4CRCA 4U01A 2J92A 3RC4A 1W0ZU 3UREA 2SFAA 2WYGA 1IQGA 4FUBA 2GD4B 1CU1A 1QFKH 1P2NA 3PMJA 3FZZA 3SU3A 1NS3A 4YESB 3D62A 5EGMA 1NU9A 2VGCC 2BY8X 5AFZH 2BB4A 2J95A 2ZGBH 5JB9S 3S9CA 1WSSH 1PPHE 4NIYA 3UNRA 1XVMA 3A82A 1GL0E 3U69H 1VCQA 1O3LA 2R9PA 1YBWA 3KHVA 1V2TT 3BTME 3PO1C 2G5NA 3E0NB 2BDYA 4YOJA 5JPMH 3P6ZB 3SUFA 1TLDA 4HFPB 1FAKH 4UD9H 2BX4A 4K69A 1AD8H 3T2NA 4CR9A 3M7TA 1B7XB 1SLXB 3F9EA 2ZU1A 2C3SA 4WVPE 3TH2H 3HPTB 1TQ7B 1OP0A 2O8LA 2V35A 2XCNA 1WU1A 4ZHLU 5LPEA 1EAUA 1AWFH 1SGNE 1CGJE 1LPGB 4U32A 1CT0E 2GZ8A 2SGDE 5DP7A 4UEHH 2JETB 2GCHF 2QXIA 3V3MA 2D8WA 1ETTH 2VIOA 1BA8B 3I29A 4JZ1A 5EW2H 1YP9A 1FIWA 1TBQH 3STIA 4K8BA 1TMBH 3TJUA 2ZCLP 2HNTF 4Y10E 5PTPA 1DDJA 1T8OA 4HTCH 2NU3E 1CA8B 1GJ5H 5ESBA 3C27B 3HK3B 3PLBA 3A84A 3TITA 1XXFA 1P06A 3SV9A 1TNGA 1CVWH 1UTNA 3MMGA 1FONA 5E0JA 1XMNB 3PMAB 2BHGA 1ETSH 2XBXA 3BIUH 1BJUA 1IOEA 2PUQH 3ZV8A 3W94A 3FANA 1HAXB 3SBKA 1NO9H 1O3DA 3ITIA 3SNAA 2Z9LA 1TA2A 1O5DH 1O34A 1RRKA 2H2ZA 1HAVB 5E0GA 2TGAA 1O5GH 2UUFB 1TMUH 1TYNA 1K1MA 2QF3A 1QJ6B 1ARCA 1GBHA 4DCDA 4Y71A 1FLEE 4FUFA 1GVLA 2BDBA 1PPEE 2GV6A 1K1PA 3TH4H 1C5TA 1ZGVA 1CA0B 4IN1A 5L6NH 4DGJA 2ZPSA 1O3GA 5E0HA 3TIUA 1W14U 4ISOA 4ZHMU 1BJVA 2XC4A 2TRMA 3F9GA 2TGPZ 1PYTC 2W7UA 1O2XA 3MI4A 2OTVA 3LGUA 4X8SH 4CRBA 3VGCB 1O2PA 2F9VA 4JYUH 1C2MA 3MU1A 1G36A 2ZHWH 1O3HA 4WJG2 1EZSC 3NKKA 2ZP0H 1ZZZA 1RS0A 5HM9A 1YKTA 4YLUA 3SI4H 2ZTZA 4ZHAA 1CBWC 1ZMJA 1HXEH 1A3EH 1C5VA 1VITG 1Y5BT 2A0QB 3HGPA 3OX7U 4NA7A 1W8BH 1GVZA 2Y5HA 5FPYA 3ZZAA 1Z8IB 2J38A 2R0KA 1P3EA 1PPBH 1F0SA 1NRRH 3MH7A 2BLVA 4WMFA 3RM0H 5C1UA 1RJXB 1MKWK 2HOBA 4WY3A 4BOHA 1MD7A 2QCYA 2WPIS 1GBBA 2VINA 2WUCA 4B2AA 4D8NA 1YPLH 1HXFH 1JIRA 3F9HA 2OBOA 1LKAA 2FEQH 4E7NA 1TALA 4NG9H 1V2PT 1GBTA 3RXPA 1EPTA 5JB8S 1ELDE 2ALPA 1SGQE 2ZF0H 1QA7A 1YCPK 1K1NA 3GICB 2VWOA 1DICA 2NU1E 2VVVA 3GYLB 4FU9A 2B9LA 4FUCA 4D9RA 1A4WH 2ZEBA 2C93B 3KIDU 3DD2H 2BXUH 4D7GA 1TBZH 1H4WA 1MZAA 1BMLA 1EP6A 1ZGIA 5HMAA 5C5OA 1SFQB 2DUCA 1FN8A 1GMDG 5L2YH 2ZHDA 3PROA 3SGQE 2SNWA 1MBMA 2B8OH 1XKAC 5GXPA 2Q6GA 1SB1H 1TA6A 2BD3A 3F6UH 4MNWA 3E6PH 3RC5A 1CE5A 2WUBA 4KGAA 3NZIA 1BHXB 4IMZA 3UTUH 1MKXH 1W7GH 4YT7H 1SHYA 4MPWA 2SNVA 3LH1A 2P3TB 3K65B 1E36B 1PPGE 3GCTG 2IJOB 1CO7E 5H4IB 2ZZUH 1MZDA 4ZAEA 4LZ1H 1RXPA 1PYTD 1RGQA 3RU4E 2FYQA 2FP7B 1P01A 1KSNA 1CGIE 2ZCHP 3UFAA 1UVSH 3F1SB 2VGCB 3RXOA 3RXUA 1LPZB 2SGPE 2F9PA 2A4QA 1ANCA 3RMMH 1UK2A 1D3DB 1D3QB 3LGTA 1EOJA 1Z6EA 3UOUA 1OWKA 1K1JA 1W0YH 1KDQA 6CHAB 1A0JA 1LHDH 2LPRA 2YOLA 3ZVFA 8GCHF 1WBGB 3SU0A 4K8YA 3TJOA 2VIVA 4JZIA 3RXCA 6GCHG 2EI8A 3PWCA 1BT7A 1C2GA 1CGHA 4YM9A 1O2IA 2STAE 1BRAA 4DW2U 2ZI2H 2RA3A 1D4PB 3P92A 5DPAA 1GMCF 2BQWB 2BVXH 1H9IE 1UTPA 7LPRA 2BVRH 2Z9JA 3U1JB 1BTYA 2A1DB 3OY6U 1S84A 2A7JA 1P2IA 1C4V2 2R2WU 4AZ2B 3GCHB 5JBTA 1W12U 1L1NA 2G51A 2QF0A 1NRPH 4UFFH 5F03A 1CSOE 1K28D 1NC6A 1O3JA 2UUYA 5JYIA 2O8UA 2Z9IA 3RXQA 1QURH 3NXPA 1TGSZ 4BAKB 4CREA 1SR5C 1Y3UA 2ANYA 3S0NA 3T28A 6ESTA 2OLGA 2OQ5A 3OY5U 4IC6A 5E2PA 1OP2A 1O37A 3TNTA 5EPNA 1AZ8A 4BXWA 1MU8B 4MNXA 3LOXA 3SU5A 1QIXB 4WH6A 3P70B 4FVDA 5GCHG 1O3PB 1T8MA 2QAAA 4LK4A 3E91A 3RXIA 2H1UA 4Y8ZA 4I8JA 3O8BA 2BDGA 4B76A 2H9TH 4X8VH 1HFDA 5GJ4B 1ELGA 2C8ZB 1HAIH 1EJAA 2A4OA 3UWIA 2QC2A 1C1UH 4Y6DA 3OU0A 3S69A 1W10U 4CRGA 5LGOA 1UMAH 1NTPA 5DP9A 3UR9A 1EAWA 1QJ1B 1YM0A 1O2ZA 1AFQC 2VIDA 3B9FH 3M5NA 2BLOA 1NRNH 1N8OC 1GHXH 1A46H 4TY6A 5AFYH 5JBAS 1O2LA 4XDEA 3AW1A 1DM4B 1AWHB 2RA0A 1GI6A 2ODPA 3BTEE 1G30B 2FM2A 3QX5H 4TPYA 1AE8H 3S7HB 3SJ9A 5K7RA 1TMTH 3SNCA 1D6WA 3GY3A 4ZXXH 3ATMA 2A45B 4TWYA 1H9LB 1DT2A 5ESTE 5FCRA 1BRCE 3VB6A 1GHAF 3VEQB 4FVBA 2G52A 3MNXA 1O3OA 4B73A 1XVOA 1ANDA 1TFXA 2BLWA 2Y81A 3KCGH 1H1BA 1K9OE 1N6XA 1C4Y2 1TNIA 1TPPA 1Y5AT 4WH8A 4O3UA 1O5BB 1NFUA 1XKBC 1D3TB 1DXWA 3AAUA 2F3CE 1C2IA 1AY6H 2HGTH 1DANH 4HZHA 1TNLA 1A0HB 4GPGA 1Z6JH 1V2NT 1GHBG 1ORFA 3MH4A 2FDAA 1HAVA 2P8OB 3D49H 1L4DA 1TNJA 1G37A 2BZAA 2NU0E 3A89A 3B23B 3KNXA 4LXBH 2QIQA 1HRTH 2PKSC 1C2LA 3TNSA 1GDQA 2A5IA 1CT4E 1BB0B 4BAOB 1DX5M 1F0UA 1QCPA 4OGYA 4ABJA 3D65E 1PQAA 2XXLA 1F7ZA 1QY6A 1JXPA 9LPRA 1Y3WA 1AB9C 4ESTE 3ZZDA 3BEFB 2PFEA 3BEUA 1GBIA 4JYVH 2HWLB 1RD3B 2A7HA 1LKBA 5DO4H 1FMGA 2VB0A 2BDCA 1DLKB 1QL7A 5CHAB 3SU4A 2P94A 1KLIH 1Z8RA 3LONA 4X1NU 1ZYOA 3SUGA 1ZHMA 1VITH 1F92A 1AE5A 5C5NA 2A4GA 3S9AA 2VNTA 3LC3A 3N7OA 3A88A 3ZZ8A 1TABE 2PSYA 5LPRA 1SGFG 3O8DA 1C5LH 4D7FA 3ZVDA 1THSH 1AQ7A 3ZZ6A 1AFEH 1QL8A 1CHOF 3H7TA 3BG4C 3TGKE 2EI7A 1UCYE 2AIQA 4ZROA 1S85A 1SLUB 2WV4A 4ISNA 1T31A 3EA7A 5J4QA 3PB1E 1SLVB 3GOVB 1O38A 1HGTH 2AYWA 1GBJA 3URCA 4X6PA 1DWCH 3BIVH 3MTYA 5AF9H 4DIHH 1EKBB 3Q3KA 5EOKA 3EDXB 1TOMH 2BD9A 2CF9H 1S5SA 1JOUB 2ZDMA 5IYTA 4MDSA 3L33A 1GGDC 3SNDA 5FBIA 1IQJA 1AUTC 2TIOA 1IQFA 2ZFSA 1KXAA 3ENSB 4H42U 4LZ4B 1C5MD 1UTOA 3E90B 5T6GA 2Q6FA 1F2SE 1J8AA 1EJMA 1WQVH 1L2EA 2QGRA 3MFJA 2FOAA 4BXSA 2YNAA 2R3YA 1TBRH 2BLQA 5I46H 1QBNA 1QRZA 2TPIZ 3EAJA 3QLPH 4Y8YA 3VPKA 2Y7XA 3W95A 4GAWA 5TCAA 4I7YH 4X2XA 1NT1A 1LQEA 2Z3EA 7GCHG 4XFQA 1ABJH 4JCNA 4A1VA 1ANEA 1QA0A 3MU0A 4I32A 3RXAA 1QTFA 4BAHB 2DE8A 3NPSA 2A32A 2OC7A 1P2MA 3M5OA 1ZHPA 1WOFA 2CHAB 2PWXA 2Z3CA 1W7XH 3MU4A 4FU8A 3M61U 1O2WA 5F8ZA 4X1RU 1EATA 1FQ3A 4FUHA 1O2HA 1XUKA 2ZGHA 4WMEA 1FXYA 1C2DA 1V6DA 2J4IA 1ZOMA 1C2HA 1DFPA 2A2QH 2Y7ZA 1ZHRA 4YT6H 3SZNA 1ESTA 1EZQA 4FUGA 4GHTA 3SNBA 1UTMA 2GZ9A 1JMOH 3MWIU 1C2FA 1BTXA 4NFEA 2BY9X 1FN6A 1MCTA 1G9IE 1GBCA 5F6MA 1EASA 4ZKRU 2BD5A 4OS5A 2P16A 4U30A 3L6PA 1C2EA 1ZTKA 4DURA 2OP9A 3FFGA 3SGBE 5L2ZH 1GJ8B 1TGCA 2W26A 1GMHG 4J1YA 4NIVA 2ZECA 3UQOA 1OYTH 3VB7A 3SHAH 5DG6A 3GY7A 1BTWA 2VH0A 1W3CA 1W11U 2ZU2A 3KEEA 1DWDH 2GMTC 2IN2A 4AOQA 4AB8A 1P9UA 1QB6A 2FODA 1K1LA 1FDPA 1C5UA 4DY7B 2FWWA 4NSVA 1HAHH 3IWMA 3I77A 3RU4D 4VGCB 4Y7BA 1GHWH 3SO3A 2OINA 1WUNH 4GHQA 1O2NA 1TRYA 2ALVA 4WWYA 4GVUA 1IQLA 3BTTE 4D76A 4HGCA 1DWEH 3FAOA 4ABGA 1MKXK 2AFQB 4M7GA 1AVXA 2F9BH 3A83A 1J14A 3LGVA 2ZHFH 2ZGCA 4AFQA 4IGDA 5GPIB 2WPLS 1GI2A 1WYKA 2PTCE 2FX6A 2G55A 1P2QA 4K2YA 5JBCS 1GI1A 1MD8A 1V2ST 3UNSA 2XWAA 4GSOA 1EQ9A 1IHTH 3CS7A 1UCYK 1ACBE 1O3FA 1BMNH 2B5TB 2FTMA 4XE4A 4HI3A 1T4UH 2G00A 3U98H 1GI5A 3ZZ5A 3VFEA 4AX9H 1T32A 1TX6A 2QXJA 4AYVB 3GISB 1OSSA 1SVPA 1DXPA 2VU8E 1HIAB 1MTVA 1QRXA 3TGIE 1GI4A 1HNEE 4DVAU 4UONA 2FESH 1O3MA 3A7TA 1GDUA 3BG8A 2XCFA 5EU8A 2GX4A 4MPXA 1HJAC 1MUEB 2AIPA 6LPRA 3RC6A 3V12A 1HB0B 1EB2A 1T7CA 4WMDA 3K9XB 1TRMA 1A0LA 3ODDA 1S0QA 2HNTC 1A3BH 2AGGX 4FU7A 1DSTA 1EZXC 1PPCE 1C5OH 3GDUA 3QUMP 1NFYA 2OXSA 4GLYA 1C5XB 1RIWB 3LPRA 4CHAC 2CMYA 1QB9A 1ZR0A 3A7XA 3KN2A 1V2VT 2GCTB 2HRVA 2ODYB 4XBDA 4B75A 1C1QA 1JWTA 1BMMH 1HCGA 1SGFA 3RXBA 4X2WA 1OYQA 1ELTA 1VCWA 1YLCA 1GCTB 4ABBA 3BTWE 3ZVEA 3K2UA 1TNHA 1TB6H 4JZEH 3KQDA 1GHVH 1B0EA 4K1EA 1YYY1 2YNBA 4GCHG 2BDAA 1C1RA 1C5QA 1V2LT 4XBCA 2C8YB 3PWBA 1JRSA 1O31A 1YPHE 1FNIA 1LTOA 2ZC9H 4INHA 1O2KA 4CRAA 1C1NA 1J17T 3LGWA 1Z8JB 3MU8A 4UFGH 1SPJA 5DP6A 5HM2A 1EPTC 1O39A 4J2YB 4OS7A 5T6DA 1J9CH 2XNIA 2GDDA 1GJAB 1YGCH 2AMPA 1OWEA 4BAMB 3BTFE 4BANB 1A7SA 1SQAA 2ZU4A 3SJ8A 1HAZB 1UK3A 4JYTA 2ASUB 4Y0YE 4ZH8A 4O97A 1TWXB 1GJ6A 3RDZA 1VGCB 1AGJA 1WAYB 1MTNB 4A92A 1ZLRA 1G2LA 1YC0A 2FLRH 3LC5A 3T5FH 1LVOA 2D26C 2FMJA 2AMDA 1NRQH 1PQ8A 2OUAA 1HAOH 1MTUA 1XUGA 3QDZB 1TPAE 1TGNA 2TGTA 1V2WT 1A1RA 2XBVA 1QBOA 5E8EH 3Q77A 1QQ4A 2OD3B 1PFXC 1OOKB 1O2MA 1C1OA 3SQHE 1C5YB 2BQ6B 3A8CA 2PR3A 3A87A 1GJDB 2UWPA 4MVNA 4NWLA 4Q7XA 2VVUA 4IC5A 1GBEA 1GG6C 4MQAA 1FY8E 3S7KB 2ZGJA 3RXSA 4Y79A 2BZ6H 2ZDLA 4NZLA 3ZZCA 4OGXA 1C9TA 1XX9A 4ABFA 1G32B 2ZGXH 4ABIA 1DUAA 2BY6X 1KXDA 1QNJA 4NIWA 4A6LA 1S83A 1Q3XA 3U9AH 1P2OA 4E06H 3GCNA 5C1YA 3R0FA 3EA8A 1F0TA 3V0XA 1Z1IA 2ZU5A 3TPIZ 1XXDA 3R3GB 4INKA 1TX7A 3SJOA 1MMJN 2G4UA 5A8YA 2UWOA 1HUTH 4AG2A 1LO6A 2D2DA 3PO1B 1GBFA 1LVYA 1AZZA 1O5EH 4ISLA 1C1TA 1UO6A 3Q3XA 4NCYA 2AGEX 3M5MA 2ANKH 4X1QU 1TPOA 2FI5E 3QZQA 4KKDA 2BYAX 2ZDKA 4D9QA 3EA9A 5FCKA 4WXVA 4DIIH 2NU2E 2XBWA 2Z9GA 4E05H 2PGQB 1NESE 1UK4A 4I8GA 3BTKE 1S6FA 1FY3A 3SN8A 1GBAA 1TONA 2GVFA 5TCCA 1ABIH 4IW4E 1YPEH 1O2SA 2SGFE 2VWNA 3V13A 3A85A 4MTBA 1KTSB 3GY5A 1E34B 1YLDA 3HATH 2CF8H 2F91A 1BBRH 2JH6D 3ZV9A 1LVBA 1CQQA 1MCVA 1FY4A 1HAYB 1C9PA 4K5ZA 1VITF 3ZZ3A 1F0RA 3MNBA 3M35A 1GCDA 1ZSLA 3CENA 3B8JA 5B6OA 4XOJA 3FP6E 2WPHS 3BSQA 1ELFA 2C4FH 4O3TA 2STBE 1J16A 1O3EA 3SU6A 3E0PB 2Z9KA 2V3OH 2UUJB 2UUKB 2BVSH 1HBTH 1VJAU 4KTSA 1DY9A 2XYAA 2FOGA 2QY0B 3TK6A 1LHEH 2RDLA 4X1SU 1ZPBA 4FUIA 3P17H 4I31A 2BX3A 4UFDH 2KAIB 1RTFB 3QTVH 1K2I1 5DK1A 1ZSKA 1U6QA 2C8XB 1C5SA 1GI9B 2BXTH 5EG4A 1LDTT 2V6NA 1DE7H 8ESTE 1QGFA 1DUEA 3VXFH 4MPUA 2FPZA 1O2GH 1INCA 1VR1H 1C5RA 1YPMH 1O2RA 1HJ9A 1O5AB 3TLOA 1UVPA 2JETC 4I8HA 1GBMA 1NROH 3SNEA 7KMEH 2VWMA 3GY8A 1BRUP 1GMDF 2A4RA 4X6MA 1GHZA 3A7ZA 2P3FH 1KXCA 1WTGH 2B7DH 2R2MB 3GYMA 1Y8TA 2OC8A 2ZWLH 1OKXA 1P10A 1FY1A 1JRTA 3KGPA 2LNCA 5C67A 2FI3E 3QK1A 5A0BA 2RG3A 3Q00A 2PLXA 2FOMB 3M36A 4MG3A 1CBWB 1SL3A 1T8LA 1YPJH 2IPHA 3MU5A 1IQIA 1V2OT 1UHBB 3GCTF 2Z6BD 1FUJA 1Y5UT 4Q7ZA 4CH2B 1HV7A 1O2YA 3UUZA 2OC0A 2M5TA 5DP5A 1TAWA 4A1XA 2WV5A 1O2JA 1LMWB 4FXGH 5A09A 3O8RA 3RMLH 1FZZA 5SGAE 1ELVA 1V2MT 5LPFA 1EX3A 3RP2A 1KXEA 2A7CA 1HIAA 4RKOB 1YPKH 4O03A 2EEKA 2Y5FA 1C1VH 3TH3H 2UWLA 4JK5A 2ANMH 4WF8A 3VXEH 3SUEA 2QV1A 2VJ1A 1D6RA 4MNVA 1RTLA 1GL1A 3SQEE 5EXMA 3RXMA 1V2UT 2J94A 1CA0C 1AUJA 1O2TA 2ZTYA 1FJSA 3UIRA 1QQUA 4Z0KA 1G3CA 3C1KA 1SGPE 4JMYA 1DLEA 1ZPZA 4K3JA 1KYNA 1F5RA 5DKMA 1Q2WA 6GCHF 3S9BA 1C4U2 2D1JA 3VGCC 1V2RT 4Q2KA 9ESTA 5FPSA 1EZUC 4X8UH 4YZUA 3SV7A 2GCHG 1P9SA 2BOKA 2GT8A 3E16B 4NIXA 1ANBA 2FIRH 4AYYB 3A86A 2V3HH 2W3IA 4OS4A 2HVXA 1KIGH 2ZKSA 4CR5A 1P03A 4YOIA 1P2KA 1SSXA 4R0IA 5DJ7A 3E8LA 3RLWH 3FVFB 1GDNA 1YF4A 1SGDE 2FOCA 2ZQ2A 2H9EH 1GG6B 2A2XH 3TGJE 1BHXF 3OYPA 1KXBA 2ZU3A 1GJ4H 5C20A 3ZVBA 3ODFA 1WCZA 2VIQA 1K22H 1O2OA 3CP7A 2J9NA 1D3PB 3FZDA 4BTTB 1C1SA 2VWLA 3U8TH 5GCHF 1XUFA 8LPRA 3RMNH 5I25A 3SOSA 1AKSB 2BDHA 5F8XA 4YTAA 3ZVAA 5FX6A 1P57B 3VB5A 1A61H 1O2QA 1XUIA 1KTTB 4NFFA 1AO5A 3PV4A 4F4OC 1OWHA 1SQTA 4DG4A 3EYDA 2XC5A 2ZFFH 2B0FA 4IS5A 1Z7KA 1IQKA 2H9HA 3E3TA 2FLBH 3L3TA 3ZZ9A 2QYIA
chains in the Genus database with same CATH superfamily
1MAXA 2K8IA 1GI7B 3RXEA 1YPGH 3EGKH 1Z71A 3MO9A 2WINI 2AH4X 4TWWA 2BMGB 5G4BA 4E7RG 2JH0D 1IQNA 2OCVB 1J15A 1LCYA 2HPQH 3SW2B 3H5CB 1TOCB 2CN0H 4RT0A 1VCPA 2L6OA 5F8TA 2BD4A 5FPTA 3SJKA 3RXGA 2W5EA 1TQ0B 3PLKA 1BBRE 1LPKB 3ZYDA 2BM2A 2G5VA 3F2FA 4KTUA 1DOJA 4AGJA 2QN5T 2I6SA 4AFUA 1FV9A 2IJD1 1FIZA 1TNKA 1QZ8A 3T62A 1Q31A 2OBQA 4Z6AH 5EQQA 3EE0B 5GIBA 1G3BA 3WWFA 2HALA 3RLYH 2OQUA 1SOZA 4SGAE 3MO3A 1O33A 1GHYH 3QGJA 1OP8A 3D23A 5HIYA 1EP5A 1PPFE 4AORA 3UR6A 3ATWA 3FP7E 3U8RH 4U2WA 1BQYA 1BRBE 4NGAH 1ETRH 2HVYB 2CJIA 3A8DA 3G01A 2VIPA 1O0DH 1TGTA 4A1TA 2F9OA 3LGYA 1GBLA 1YCPM 1IAUA 1L1JA 1H9HE 6CHAC 1GJCB 1GHBF 5DGJA 3ESTA 1L0ZA 4JZFH 3K6YA 3K6ZA 1NFXA 5HXFA 1QL9A 5FX5A 1WV7H 2ODQA 1DPOA 3PTBA 4FOUC 4I86A 5K0HA 1C2KA 2GKVE 2A5KA 4YO9A 2BTCE 2JH5D 3SU2A 1TGBA 3M7QA 2J2UA 1XUHA 3PV2A 2XTTB 2ZQ1A 5JDUB 1AFQB 5E2OA 1W2KH 1N8OB 1Y3YA 1IQMA 3MQKC 2CXVA 3V7TA 2Y80A 3BEIB 1T8NA 4XBBA 3WY8A 1A2CH 4Q80A 4UFEH 3P8OA 1V3XA 4LOYH 1L4ZA 5AVDA 3GCHC 1NY22 2QF4A 3T29A 4FUEA 3UPEA 2J98B 1GJ7B 3DFJA 1P04A 1C2JA 1L1GA 2J34A 5EW1H 3DHKH 4TY7A 3GDVA 4A5TS 1SGCA 1HAPH 4OS1A 3HGNA 1NFWA 4F49A 3RXVA 3T27A 2O8TA 1UVUH 5L30H 4TYDA 1YLNA 3OTJE 3F68H 3A80A 3ATIA 1SHHB 1QRWA 3H7OA 1BOQA 2BOHB 5ETXA 1N6YA 4TPIZ 2PKAB 2FI4E 4RN6A 3T26A 3VB3A 2G4TA 5GDSH 4OS6A 3JZ1B 1MH0A 1E0FD 1O30A 3A7WA 5T3HA 4R8TB 2QXGA 3URDA 3U28C 5FBEA 2FXRA 5ABWA 1DITH 4ABHA 2IPQX 4ABAA 3F3BA 1AU8A 4X0WU 3SJIA 1ZPCA 1OPHB 3QO6A 1HYLA 2KAIA 1ZRKA 1BDAA 8GCHG 2WV9A 1ELEE 3VB4A 2HLCA 1C1WH 2PKSB 3GY2A 3PMHB 4ASHA 4B74A 4Y7AA 4CBOA 5FAHA 3M3TA 5DP4A 3GY6A 3PM3A 2VVCA 1TX8A 1AB9B 1WTHD 1OWJA 1IHSH 3QGNB 7GCHF 3Q3YA 4UE7H 4ACBA 2A5AA 1HPGA 1S82A 1GMCG 4X8TH 1UTLM 2EA3A 2F9NA 3MH5A 1Y59T 1GWAA 1BIOA 1MQ6A 3LDXH 3TVJB 1X7AC 1BBRK 1MTWA 4ZUHA 4X6NA 1OHHD 2R0LA 3Q76A 3QN7A 1T4VH 1SGEE 3BTHE 1HLTH 1P0SH 3LJOA 1SC8U 2BY7X 2ZG0H 4AFZA 2W7SA 1DY8A 4OS2A 1E1QD 1K0HA 4F55A 1DWBH 3UOPA 3PMBB 4Y11E 3ELAH 1TIOA 2FS9A 3SI3H 1AMHA 4X2VA 4Y76A 2PV9B 3BG4B 5EPYA 3ZZ7A 2THFB 1AN1E 1UHBA 4DJZB 1QHRB 1EUFA 2H6MA 3DFLA 1GI0A 2I6QA 1DSUA 3OAAD 2BD2A 2NU4E 4XRNA 5T6FA 1OWIA 2R3UA 4I8LA 4ISIH 2Z7FE 4ABEA 3DA9B 1MAYA 1O3IA 1UW7A 1ID5H 4NA9H 5CMXH 1GI8B 2P8OC 1KLJH 3SGAE 1C5ZB 2QXHA 4ISHH 4MPVA 3DUXH 1GGDB 1QBVH 1D9IA 1UTJA 2Y6TA 1E38B 4Y8XA 3RU4T 1M9UA 1SFIA 2FX4A 3GY4A 3LKWA 4NA8A 3RXRA 1PQ7A 1HAGE 2ZDAH 2ZA5A 2P93A 3SUDA 3UNQA 1GMHF 3M37A 1SQOA 5C0UA 4X2YA 1O5CB 4H6TA 2PW8H 3TJVA 1H8IH 1ESBA 4AB9A 2XRCA 4A7IB 1TRNA 2CGAA 1EFRD 1ZMNA 2XBYA 3OSYA 4HG6A 1P12E 2XWBI 5HGGA 3SORA 1IQEA 3SHCH 5CHAC 3DT0H 1WQSA 3BTGE 4H6SB 5C17A 4I8KA 1V2JT 3AASA 3HKIB 1AI8H 1AVGH 5JBBS 1GI3A 1EJNA 3P95A 3O8CA 4RSPA 5J4SA 3U1IB 1KXFA 4ZMAH 3GDSA 3SV2H 1E35B 3UWJH 3LIWA 5TJXA 3WWBA 3F9FA 1P3CA 1GHAG 2FZZA 2FOHA 1MU6B 3MNCA 2ZHEH 2Z3DA 2TBSA 1ZSJA 2FOFA 1H8DH 2ZDNA 2ZPRA 1EAXA 4QT8C 1P11E 2FO9A 1SBWA 5EODA 3RMOH 1ZTLA 1O3NA 2HPPH 1O5FH 1O32A 1O3CA 2WPKS 3NUMA 2ILNA 1UVTH 3KQCA 2ZFRH 2ZDVH 5FHTA 4DT7B 4K60A 3TK5A 4NZQA 2P3UB 1RFNA 1UCYH 4THNH 4BTIB 1O2UA 3F0PA 1CHGA 1AKSA 2CV3A 1BMAA 2Z94A 1FPCH 2PGBB 2PTNA 4H4FA 3LU9B 1OWDA 2SGQE 3SV8A 3LH3A 3TK9A 5FXLA 7ESTE 2JKHA 2BQ7B 2ZFQH 4RKJB 3BTDE 2ANWA 4B71A 4JZDH 1ZJDA 3KQEA 2AERH 3UY9A 3W1EA 1NZQH 3STJA 1ESAA 4DOQA 3LT3A 5DP8A 1P09A 3I78A 3MNSA 2SGAA 1K21H 1GBDA 2GMTB 4O9VA 4YLQH 3RXJA 2ZFTA 1BITA 1IQHA 4ZKOU 2H5CA 1LQDB 1S6HA 4FUJA 1A5GH 1B5GH 1P2JA 1SGYE 4CRDA 3E1XB 5AHGH 2CHAC 5LH8A 2O8WA 1NU7B 1AHTH 1A5HA 1XUJA 2A31A 3ZVGA 1ZTJA 3BF6H 4IMQA 1NM6A 3BV9B 1AIXH 1BTZA 4WXIA 1OXGA 4Y0ZE 5A2MH 1NPMA 1F5KU 1CHOG 4GCHF 3NCLA 4IN2A 2G8TA 2FOEA 4IBLH 5B6LA 4FUDA 2WPJS 5HYOA 2BDIA 1OX1A 3SU1A 2ZTXA 3PLPA 1EXFA 1SLWB 2ZFPH 1P8VC 2ZO3H 2GV7A 1NRSH 4PROA 1LHGH 1O2VA 4M9FA 1ELAA 3MYWA 5EXNA 1TPSA 1MKWH 2VH6A 1DS2E 1FI8A 2Y5GA 1F5LA 2NWNA 3IG6B 2GTBA 1MQ5A 3HKJB 4ZKNU 2O8MA 3IITA 2WPMS 1SOTA 1GVKB 1BTHH 2VIWA 1GJ9B 1JBUH 4KP0A 3M3SA 1VJ9U 1THRH 2ESTE 1UVOA 1FPHH 1VKYA 1CT2E 1HJAB 1YCPH 2FS8A 2OC1A 2LELA 3FP8E 2P59A 3RXKA 4MLFB 1SGIB 5EQSA 1V2QT 3NK8A 1LVMA 2P95A 1KY9A 4VGCC 2BD8A 1OS8A 4BNRA 1BCUH 1C1PA 4YOGA 4CHAB 1PQ5A 1BZXE 3TJNA 1SGRE 4CRFA 3GCOA 1Y3XA 3MO6A 2O9QA 2AHME 2JJ1D 3ZZ4A 2XW9A 4K1TA 3P8FA 1ZJKA 2YMSC 2F83A 2ZIQH 2W6ID 2J98A 2GGVB 1G3DA 5A0CA 3MH6A 2SGEE 3AW0A 1AVWA 1C5PA 1SGTA 5CDFE 1TE0A 1LHFH 1BUIA 1YPHC 1V2KT 2XC0A 2IOTA 2Q6DA 4Q63A 4MNYA 4UDWH 1O3AA 3A8AA 3M5LA 5BRRE 1GJBB 2BD7A 1N1LA 1XM1A 2PKAA 5A8ZA 3U8OH 4GUXA 8KME2 1C1MA 1VZQH 2C90B 3NWUA 1P05A 4AN7A 1GBKA 4BAQB 1HDTH 2DE9A 2W3KA 3KQBA 1EPTB 2G81E 3BN9A 5BPEA 4Q7YA 4AFSA 1BTUA 3T25A 3ZZBA 3ATKA 1QJ7B 1GPZA 1PPZA 3JZ2B 1B0FA 4KTCA 5A8XA 3EQ0H 3LGIA 4X6OA 3RXDA 1BTPA 3TU7H 2GZ7A 5KGOA 2JDID 3ATLA 1UJ1A 1RIWC 1Y3VA 1G2MA 3FOAA 1EAIA 2HNTE 4NSYA 5C2ZA 5C0TA 1UTQA 3ZVCA 3H09A 3AAVA 1FY5A 4ZKSU 2GCTC 3RUOA 2V0BA 3F2HA 2Y82A 1FAXA 2F9UA 1EOLA 4XD7D 4ZXYH 5C3NA 3UQVA 5A0AE 1GCTC 1Z1JA 1KLTA 3QWCH 1C5NH 1ZRBA 3QTOH 3KYFA 1Z8GA 4ABDA 3MOCA 4JK6A 5GWZA 4B6EA 1JIMA 5IDKA 4AG1A 1G3EA 3SV6A 1NN6A 3CS0A 4B2BA 4CBNA 1O3KA 3RXHA 1S0RA 5DN6D 1EB1H 1ARBA 2AS9A 1O35A 3P8NA 1THPB 2PSXA 1SI5H 4SGBE 3AVZA 1SMFE 3MHWU 5C1XA 2FTLE 1E37B 4KELA 2AGIX 1QR3E 4AGKA 3RXFA 1MBQA 3A7VA 2QA9E 4X1PU 2C8WB 1DVAH 1RTKA 1P02A 2EI6A 2GDEH 1ELCA 3A7YA 3HK6B 2ZNKH 5EQRA 4XSKU 2PHBA 3M7UA 3QZRA 1KDQB 2YMSD 2EC9H 3PYHA 1O3BA 1K1IA 2L74A 2GT7A 2RCEA 1A5IA 1VGCC 1SG8B 2FOBA 3BTQE 2ULLA 3RXTA 2ZCKP 1MTNC 2GP9B 1LHCH 4K1SA 1HJ8A 4I33A 2K1QA 2TGDA 2WYJA 4B2CA 2ZPQA 3LJJA 2Q1JA 4BTUB 5CE1A 1UTKA 3KL6A 1ELBA 1ZMLA 2FYRA 1K1OA 4INLA 4CH8B 3KYGA 1C5WB 3M3VA 2AMQA 2RDEA 3RM2H 4Q4LA 3KF2A 1W13U 2JIZD 2BY5X 3A81A 1QB1A 3A8BA 2AEIH 4TT3D 1O36A 4B1TA 5EXLA 1PJPA 3RXLA 1MTSA 4NWKA 3ZYEA 3PTNA 2PUXB 2H5DA 3P8GA 5DP3A 1S81A 2ZHQH 4CRCA 4U01A 2J92A 3RC4A 1W0ZU 3UREA 2SFAA 1H8HD 2WYGA 1IQGA 4FUBA 2GD4B 1CU1A 1QFKH 1P2NA 3PMJA 3FZZA 3SU3A 1NS3A 4YESB 3D62A 5EGMA 1NU9A 2VGCC 2BY8X 5AFZH 2BB4A 2J95A 2ZGBH 5JB9S 3S9CA 1WSSH 1PPHE 4NIYA 3UNRA 1XVMA 3A82A 1GL0E 3U69H 2KM0A 1VCQA 1O3LA 1W0KD 2R9PA 1YBWA 3KHVA 5T1VA 1V2TT 3BTME 3PO1C 2G5NA 3E0NB 2BDYA 4YOJA 5JPMH 3P6ZB 3SUFA 1TLDA 4HFPB 1FAKH 4UD9H 2BX4A 4K69A 1AD8H 3T2NA 4CR9A 3M7TA 1B7XB 1SLXB 3F9EA 2ZU1A 2C3SA 4WVPE 3TH2H 3HPTB 1TQ7B 1OP0A 2O8LA 2V35A 2XCNA 1WU1A 3PRDA 4ZHLU 5LPEA 1EAUA 1AWFH 1SGNE 1CGJE 1LPGB 4U32A 1H8ED 1CT0E 2GZ8A 2SGDE 5DP7A 4UEHH 2JETB 2GCHF 2QXIA 3V3MA 2D8WA 1ETTH 2VIOA 1BA8B 3I29A 4JZ1A 5EW2H 1YY3A 1YP9A 1FIWA 1TBQH 3STIA 4K8BA 1TMBH 3TJUA 2VBCA 2ZCLP 2HNTF 4Y10E 5PTPA 1DDJA 1T8OA 4HTCH 2NU3E 1CA8B 1GJ5H 5ESBA 3C27B 4YXWD 3HK3B 3PLBA 3A84A 3TITA 1XXFA 1P06A 3SV9A 1TNGA 1CVWH 1UTNA 3MMGA 1FONA 5E0JA 1XMNB 1FX0B 3PMAB 2BHGA 1ETSH 2XBXA 3BIUH 1BJUA 1IOEA 2PUQH 3ZV8A 3W94A 3FANA 1HAXB 3SBKA 1NO9H 1O3DA 3ITIA 3SNAA 2Z9LA 1TA2A 1O5DH 1O34A 1RRKA 2H2ZA 1HAVB 5E0GA 2KZ4A 2TGAA 1O5GH 2UUFB 1TMUH 1TYNA 1K1MA 2QF3A 1QJ6B 1ARCA 4AC9A 1GBHA 4DCDA 4Y71A 1FLEE 4FUFA 1GVLA 2BDBA 1PPEE 2GV6A 1K1PA 3TH4H 1C5TA 1ZGVA 5HKKD 1CA0B 4IN1A 5L6NH 4DGJA 2ZPSA 1O3GA 5E0HA 3TIUA 1W14U 4ISOA 4ZHMU 1BJVA 2XC4A 2TRMA 2EQNA 3F9GA 2TGPZ 1PYTC 2W7UA 1O2XA 3MI4A 2OTVA 3LGUA 4X8SH 4CRBA 3VGCB 1MABB 1O2PA 2F9VA 4JYUH 1C2MA 3MU1A 1G36A 2ZHWH 1O3HA 4WJG2 1EZSC 3NKKA 2ZP0H 1ZZZA 1RS0A 5HM9A 1YKTA 1NBME 4YLUA 3SI4H 2ZTZA 4ZHAA 1CBWC 1ZMJA 1HXEH 1A3EH 1C5VA 1VITG 1Y5BT 2A0QB 3HGPA 3OX7U 4NA7A 1W8BH 1GVZA 2Y5HA 5FPYA 3ZZAA 1Z8IB 2J38A 2R0KA 1P3EA 1PPBH 1F0SA 1NRRH 3MH7A 2KCYA 2BLVA 4WMFA 5EIYA 3RM0H 5C1UA 1RJXB 1MKWK 2HOBA 4WY3A 4BOHA 1MD7A 2QCYA 2WPIS 1GBBA 2VINA 2WUCA 4B2AA 4D8NA 1YPLH 1HXFH 1JIRA 3F9HA 2OBOA 1LKAA 2FEQH 2PP6A 4E7NA 1TALA 4NG9H 3KQ5A 1V2PT 1GBTA 3RXPA 1EPTA 5JB8S 1ELDE 2ALPA 1SGQE 2ZF0H 1QA7A 1YCPK 1K1NA 3GICB 2VWOA 1DICA 2NU1E 2VVVA 3GYLB 4FU9A 2B9LA 4FUCA 4D9RA 1A4WH 2ZEBA 2C93B 3KIDU 3DD2H 2BXUH 4D7GA 1TBZH 1H4WA 1MZAA 1BMLA 3VG8A 1EP6A 1ZGIA 5HMAA 5C5OA 1SFQB 2DUCA 1FN8A 1GMDG 5L2YH 2ZHDA 3PROA 3SGQE 2SNWA 1MBMA 2B8OH 1XKAC 5GXPA 2Q6GA 1SB1H 1TA6A 2BD3A 3F6UH 4MNWA 3E6PH 3RC5A 1CE5A 1WDIA 2WUBA 4KGAA 3NZIA 5F53A 1BHXB 4IMZA 3UTUH 1MKXH 1W7GH 4YT7H 1SHYA 4MPWA 2SNVA 3LH1A 2P3TB 3K65B 3PRBA 1E36B 1PPGE 3GCTG 2IJOB 1CO7E 5H4IB 2ZZUH 1MZDA 4ZAEA 4LZ1H 1RXPA 1PYTD 1RGQA 3RU4E 2FYQA 2FP7B 1P01A 1KSNA 1CGIE 2ZCHP 3UFAA 1UVSH 3F1SB 2VGCB 3RXOA 2GJGA 1WXRA 3RXUA 1LPZB 2SGPE 2F9PA 2A4QA 1ANCA 3RMMH 1UK2A 1D3DB 1D3QB 3LGTA 1EOJA 1Z6EA 3UOUA 1OWKA 1K1JA 1W0YH 1KDQA 6CHAB 3DCLA 1A0JA 1LHDH 2LPRA 2YOLA 3ZVFA 8GCHF 1WBGB 3SU0A 4K8YA 3TJOA 2VIVA 4JZIA 3RXCA 2W6JD 6GCHG 2EI8A 3PWCA 1BT7A 1C2GA 1CGHA 4YM9A 1O2IA 2STAE 1BRAA 4DW2U 2ZI2H 2RA3A 1D4PB 3P92A 5DPAA 1GMCF 2BQWB 2BVXH 1H9IE 1UTPA 7LPRA 2BVRH 2Z9JA 3U1JB 1BTYA 2A1DB 3OY6U 1S84A 2A7JA 1P2IA 1C4V2 2R2WU 4AZ2B 3GCHB 5JBTA 1W12U 1L1NA 2G51A 2QF0A 1NRPH 4UFFH 5F03A 1CSOE 1K28D 1NC6A 2QE7D 1O3JA 2UUYA 5JYIA 2O8UA 1S6LA 2Z9IA 3RXQA 1QURH 3NXPA 1TGSZ 4BAKB 4CREA 1SR5C 1Y3UA 3F0OA 2ANYA 3S0NA 3T28A 6ESTA 2KCPA 2OLGA 2OQ5A 3OY5U 4IC6A 5E2PA 1OP2A 1O37A 3TNTA 5EPNA 1AZ8A 4BXWA 5CHBA 1MU8B 4MNXA 3LOXA 5FL7D 3SU5A 1QIXB 4WH6A 3P70B 4FVDA 5GCHG 1O3PB 1T8MA 2QAAA 4LK4A 3E91A 3RXIA 2H1UA 4Y8ZA 4I8JA 3O8BA 2BDGA 4B76A 2H9TH 4X8VH 1HFDA 5GJ4B 1ELGA 2C8ZB 1HAIH 1EJAA 2A4OA 3UWIA 2QC2A 1C1UH 4Y6DA 3OU0A 3S69A 1W10U 4CRGA 5LGOA 1UMAH 1NTPA 5DP9A 3UR9A 1EAWA 1QJ1B 1YM0A 1O2ZA 1AFQC 2VIDA 3B9FH 3M5NA 2BLOA 1NRNH 1N8OC 1GHXH 1A46H 4TY6A 5AFYH 5JBAS 1O2LA 4XDEA 3AW1A 1DM4B 1AWHB 2RA0A 1GI6A 2ODPA 3BTEE 1G30B 2FM2A 3QX5H 4TPYA 1AE8H 3S7HB 3SJ9A 5K7RA 2V3MA 1TMTH 3SNCA 1D6WA 3GY3A 4ZXXH 3ATMA 2A45B 4TWYA 1H9LB 1DT2A 5ESTE 5FCRA 1BRCE 3VB6A 1GHAF 3VEQB 4FVBA 2G52A 3MNXA 1O3OA 4B73A 1XVOA 1ANDA 3CNRA 1TFXA 2BLWA 2Y81A 3KCGH 2F4LA 1H1BA 1K9OE 1N6XA 1C4Y2 1TNIA 1TPPA 1Y5AT 2KCOA 4WH8A 3SZEA 4O3UA 1O5BB 1NFUA 1XKBC 1D3TB 3OEED 1DXWA 2WZQA 3AAUA 2F3CE 1C2IA 1AY6H 2HGTH 1DANH 4HZHA 1TNLA 5GNDA 1A0HB 4GPGA 3EE7A 1Z6JH 1V2NT 1W0JD 1GHBG 1ORFA 3MH4A 2QF5A 2FDAA 1HAVA 2P8OB 3D49H 1L4DA 1TNJA 1G37A 2BZAA 2NU0E 3A89A 3B23B 3KNXA 4LXBH 2QIQA 1HRTH 2PKSC 1C2LA 3TNSA 1GDQA 2A5IA 1CT4E 1BB0B 3OE7D 1DX5M 1F0UA 4BAOB 1QCPA 4OGYA 4ABJA 3D65E 1PQAA 2XXLA 1F7ZA 1QY6A 1JXPA 9LPRA 1Y3WA 1AB9C 4ESTE 2WPDD 4ASUD 3ZZDA 3BEFB 2PFEA 3BEUA 1GBIA 4JYVH 2HWLB 1RD3B 2A7HA 1LKBA 5DO4H 1FMGA 2VB0A 2BDCA 1DLKB 1QL7A 5CHAB 3SU4A 2P94A 1KLIH 1Z8RA 3LONA 4X1NU 1ZYOA 3SUGA 1ZHMA 4FETA 1VITH 1F92A 1AE5A 1E1RD 5C5NA 2A4GA 3S9AA 2VNTA 3LC3A 3N7OA 3A88A 3ZZ8A 1TABE 2PSYA 5LPRA 1SGFG 3O8DA 1C5LH 4D7FA 3ZVDA 1THSH 1AQ7A 3ZZ6A 1AFEH 1QL8A 1CHOF 3H7TA 3BG4C 3TGKE 2EI7A 1UCYE 2AIQA 4ZROA 1S85A 1SLUB 2WV4A 4ISNA 1T31A 3EA7A 5J4QA 3PB1E 1SLVB 3GOVB 1O38A 1HGTH 2AYWA 1GBJA 3URCA 4X6PA 1DWCH 3OFND 3BIVH 3MTYA 5AF9H 4DIHH 1EKBB 3Q3KA 5EOKA 3EDXB 1TOMH 2BD9A 2CF9H 1S5SA 1JOUB 2ZDMA 5IYTA 4MDSA 3L33A 1GGDC 5KECA 3SNDA 5FBIA 1IQJA 1AUTC 2TIOA 2KR7A 2K0QA 1IQFA 2ZFSA 1KXAA 3ENSB 3PV5A 4H42U 4LZ4B 1C5MD 1UTOA 3E90B 5T6GA 4F48B 2Q6FA 1F2SE 1J8AA 1EJMA 1WQVH 1L2EA 2QGRA 3MFJA 2FOAA 4BXSA 2YNAA 2R3YA 1TBRH 2BLQA 5I46H 1QBNA 2EY4C 1QRZA 2TPIZ 4ZCNA 3EAJA 3QLPH 1E79D 4Y8YA 3VPKA 2Y7XA 2LP6A 3W95A 4GAWA 5TCAA 4I7YH 4X2XA 1NT1A 1LQEA 2Z3EA 1SQRA 7GCHG 4XFQA 1ABJH 4JCNA 4A1VA 1ANEA 1QA0A 3MU0A 4I32A 3RXAA 1QTFA 4BAHB 3F2GA 2DE8A 3NPSA 2A32A 2OC7A 1P2MA 3M5OA 1ZHPA 1WOFA 2CHAB 2PWXA 1KMHB 2Z3CA 1W7XH 3MU4A 4FU8A 3M61U 1O2WA 4RI0A 5F8ZA 4X1RU 1EATA 1FQ3A 4FUHA 1O2HA 3WW7A 1XUKA 2ZGHA 4WMEA 1FXYA 1C2DA 1V6DA 2J4IA 1ZOMA 1C2HA 1DFPA 2A2QH 2Y7ZA 1ZHRA 4YT6H 3SZNA 1ESTA 1EZQA 4FUGA 4GHTA 3SNBA 1UTMA 2GZ9A 2J5UA 1JMOH 3MWIU 2JJ2D 1C2FA 1BTXA 4NFEA 2BY9X 1FN6A 1MCTA 1G9IE 1GBCA 5F6MA 1EASA 4ZKRU 2BD5A 4OS5A 2P16A 4U30A 3L6PA 2XNDD 1C2EA 1ZTKA 4DURA 2OP9A 3FFGA 5HIZA 3SGBE 5L2ZH 5EJ1A 1GJ8B 1TGCA 2W26A 1GMHG 4J1YA 4NIVA 2ZECA 3UQOA 1OYTH 3VB7A 3SHAH 5DG6A 3GY7A 1BTWA 2VH0A 1W3CA 1W11U 2ZU2A 3KEEA 1DWDH 2GMTC 2IN2A 3FKSD 4AOQA 4AB8A 1P9UA 1QB6A 2FODA 1K1LA 1FDPA 1C5UA 4DY7B 2FWWA 4NSVA 1HAHH 3IWMA 3I77A 3RU4D 4VGCB 2RFKC 4Y7BA 1GHWH 3SO3A 2OINA 1WUNH 4GHQA 1O2NA 1TRYA 2ALVA 4WWYA 4GVUA 1IQLA 3BTTE 4D76A 4HGCA 1DWEH 3FAOA 4ABGA 1MKXK 2J97A 2AFQB 4M7GA 1AVXA 2F9BH 3A83A 1J14A 3LGVA 2ZHFH 2ZGCA 3DSOA 2YMSB 4AFQA 4IGDA 5GPIB 2WPLS 1GI2A 1WYKA 2PTCE 2FX6A 2G55A 1P2QA 4OM9A 4K2YA 5JBCS 1GI1A 1MD8A 1V2ST 3UNSA 2XWAA 4GSOA 3AK5A 1EQ9A 1IHTH 3CS7A 3N99A 1UCYK 4B6FA 1ACBE 1O3FA 4TSFD 1BMNH 2B5TB 2FTMA 4XE4A 4HI3A 1T4UH 2G00A 4P02A 3U98H 1GI5A 3ZIAD 3ZZ5A 3VFEA 4AX9H 1T32A 3GS9A 1TX6A 2QXJA 4AYVB 3DSGA 3GISB 1OSSA 1SVPA 1DXPA 2VU8E 1HIAB 1MTVA 1QRXA 3TGIE 1GI4A 1HNEE 4DVAU 4UONA 2FESH 1O3MA 3A7TA 1GDUA 3BG8A 2XCFA 5EU8A 2GX4A 4MPXA 2M2AA 1HJAC 1MUEB 2AIPA 6LPRA 3RC6A 3V12A 1HB0B 1EB2A 1T7CA 4ACAA 4WMDA 3K9XB 1TRMA 1A0LA 3ODDA 5C94A 1S0QA 2HNTC 1A3BH 2AGGX 4FU7A 1DSTA 1EZXC 1PPCE 1C5OH 3GDUA 3QUMP 1NFYA 2OXSA 4GLYA 1C5XB 1RIWB 3LPRA 4CHAC 2CMYA 1QB9A 1ZR0A 3A7XA 3KN2A 1V2VT 2GCTB 2KX4A 2HRVA 2ODYB 4XBDA 4B75A 1C1QA 1JWTA 1BMMH 1HCGA 1SGFA 3RXBA 4X2WA 1OYQA 1ELTA 1VCWA 1YLCA 1GCTB 4ABBA 3BTWE 3ZVEA 3K2UA 1TNHA 1TB6H 4JZEH 3KQDA 1GHVH 1B0EA 4K1EA 1YYY1 2YNBA 4GCHG 2BDAA 1YWUA 1C1RA 1C5QA 1BMFD 1V2LT 4XBCA 2C8YB 3PWBA 1JRSA 1O31A 1YPHE 1FNIA 1LTOA 2ZC9H 4P00A 4INHA 1O2KA 4CRAA 1C1NA 1J17T 3LGWA 1Z8JB 3MU8A 4UFGH 1SPJA 5DP6A 1SKYE 5HM2A 1EPTC 1O39A 4J2YB 4OS7A 5T6DA 1J9CH 3OEHD 2XNIA 2GDDA 1GJAB 1YGCH 2AMPA 1OWEA 4BAMB 3BTFE 4BANB 1A7SA 1SQAA 2ZU4A 3SJ8A 1HAZB 1UK3A 5KEDA 4JYTA 2ASUB 4Y0YE 4ZH8A 4O97A 1TWXB 1GJ6A 3RDZA 1VGCB 1AGJA 1WAYB 1MTNB 4A92A 1ZLRA 1G2LA 1YC0A 2FLRH 3LC5A 3T5FH 1LVOA 2D26C 2FMJA 2V7QD 2AMDA 1NRQH 1PQ8A 2OUAA 1HAOH 1MTUA 1XUGA 3QDZB 1TPAE 1TGNA 2TGTA 1V2WT 1A1RA 2XBVA 1QBOA 5E8EH 3Q77A 1QQ4A 2OD3B 1PFXC 1OOKB 1O2MA 1C1OA 3SQHE 1C5YB 2BQ6B 3A8CA 2PR3A 3A87A 1GJDB 2UWPA 4MVNA 4NWLA 4Q7XA 2VVUA 4IC5A 1GBEA 1GG6C 4MQAA 1FY8E 3S7KB 2ZGJA 5EJZA 3RXSA 4Y79A 2BZ6H 2ZDLA 4NZLA 3ZZCA 4OGXA 3FN8A 1C9TA 1XX9A 4ABFA 1G32B 2ZGXH 4ABIA 1DUAA 2BY6X 1KXDA 1QNJA 4NIWA 4A6LA 1S83A 1Q3XA 3U9AH 1P2OA 4E06H 3GCNA 5C1YA 3R0FA 5EJLA 3EA8A 1F0TA 3V0XA 1Z1IA 2WSSD 2ZU5A 3TPIZ 1XXDA 3R3GB 4INKA 1TX7A 3SJOA 1MMJN 2G4UA 5A8YA 2UWOA 1HUTH 4AG2A 1LO6A 2D2DA 3PO1B 1GBFA 1LVYA 1AZZA 1O5EH 4ISLA 1C1TA 1UO6A 3Q3XA 4NCYA 2AGEX 3M5MA 2ANKH 4X1QU 1TPOA 2FI5E 3QZQA 4KKDA 2BYAX 2ZDKA 4D9QA 3EA9A 5FCKA 4WXVA 4DIIH 2NU2E 2XBWA 2Z9GA 4E05H 2PGQB 1NESE 1UK4A 4I8GA 4Z1MD 3BTKE 2KCAA 1S6FA 1FY3A 3SN8A 1GBAA 1TONA 2GVFA 5TCCA 1ABIH 4IW4E 1YPEH 1O2SA 2SGFE 2VWNA 3V13A 3A85A 4MTBA 1KTSB 3GY5A 2WHXA 1E34B 1YLDA 3HATH 2CF8H 2F91A 1BBRH 2JH6D 3ZV9A 1LVBA 1CQQA 1MCVA 1FY4A 1HAYB 1C9PA 4K5ZA 2F43B 1VITF 3ZZ3A 1F0RA 3MNBA 3M35A 1GCDA 1COWD 1ZSLA 3CENA 3B8JA 5B6OA 4XOJA 3FP6E 2WPHS 3BSQA 5IK2D 1ELFA 2C4FH 4O3TA 2STBE 1J16A 1O3EA 3SU6A 3E0PB 2Z9KA 2V3OH 2UUJB 3UB0A 2UUKB 2BVSH 1HBTH 1VJAU 4KTSA 1DY9A 2XYAA 2FOGA 2QY0B 3TK6A 1LHEH 2RDLA 4X1SU 1ZPBA 4FUIA 3P17H 4I31A 2BX3A 4UFDH 2KAIB 1RTFB 3QTVH 1K2I1 5DK1A 1ZSKA 1U6QA 2C8XB 1C5SA 1GI9B 2BXTH 5EG4A 1LDTT 2V6NA 1DE7H 8ESTE 1QGFA 1DUEA 3VXFH 4MPUA 2FPZA 1O2GH 1INCA 1VR1H 1C5RA 1YPMH 1O2RA 3FO8D 1HJ9A 1O5AB 3TLOA 1UVPA 2JETC 4I8HA 3DSPA 1GBMA 1NROH 3SNEA 7KMEH 2VWMA 3GY8A 1BRUP 1GMDF 2A4RA 3N7DA 4X6MA 4DT4A 2XOKD 1GHZA 3A7ZA 2P3FH 1KXCA 1WTGH 2B7DH 2R2MB 3GYMA 1Y8TA 2OC8A 2ZWLH 1OKXA 1P10A 1FY1A 1JRTA 3KGPA 2LNCA 5C67A 2FI3E 3QK1A 5A0BA 2RG3A 3Q00A 2PLXA 2FOMB 3M36A 4MG3A 1CBWB 1SL3A 1T8LA 1YPJH 2IPHA 3OTPA 5DSFA 3MU5A 1IQIA 1V2OT 1UHBB 3GCTF 2Z6BD 3SYJA 1FUJA 1Y5UT 4Q7ZA 4RT1A 4CH2B 1HV7A 1O2YA 3UUZA 2OC0A 2M5TA 5DP5A 1TAWA 4A1XA 2WV5A 1O2JA 1LMWB 4FXGH 5A09A 3O8RA 3RMLH 1FZZA 5SGAE 1ELVA 1V2MT 5LPFA 1EX3A 3RP2A 1KXEA 2A7CA 1HIAA 4RKOB 1YPKH 4O03A 2EEKA 2Y5FA 1C1VH 3TH3H 2UWLA 4JK5A 2ANMH 4WF8A 3VXEH 3SUEA 2QV1A 2VJ1A 1D6RA 4MNVA 1RTLA 1GL1A 3SQEE 5EXMA 3RXMA 1V2UT 2J94A 1CA0C 1AUJA 1O2TA 2ZTYA 1FJSA 3UIRA 1QQUA 4Z0KA 1G3CA 3C1KA 1SGPE 4JMYA 1DLEA 1ZPZA 4K3JA 1KYNA 2CK3D 1F5RA 5DKMA 1Q2WA 6GCHF 3S9BA 1C4U2 2D1JA 3VGCC 1V2RT 4Q2KA 9ESTA 5FPSA 1EZUC 4X8UH 4YZUA 3SV7A 2GCHG 1P9SA 2BOKA 2GT8A 3E16B 4NIXA 1ANBA 2FIRH 2HLDD 4AYYB 3A86A 2V3HH 2W3IA 4OS4A 2HVXA 3NRLA 1KIGH 2ZKSA 4CR5A 1P03A 4YOIA 1P2KA 1SSXA 4R0IA 5DJ7A 3E8LA 3RLWH 3FVFB 1GDNA 1YF4A 1SGDE 2FOCA 3UAIC 2ZQ2A 2H9EH 1GG6B 2A2XH 3TGJE 1BHXF 3OYPA 1KXBA 2ZU3A 1GJ4H 5C20A 3ZVBA 3ODFA 1WCZA 2VIQA 1K22H 1O2OA 3CP7A 2J9NA 1D3PB 3FZDA 4BTTB 1C1SA 2VWLA 2OK5A 3U8TH 5GCHF 1XUFA 8LPRA 3RMNH 5I25A 3SOSA 1AKSB 2BDHA 5F8XA 3N7EA 4YTAA 3ZVAA 5FX6A 1P57B 3VB5A 1A61H 1O2QA 1NBMD 1XUIA 1KTTB 4NFFA 1AO5A 3PV4A 4F4OC 1OWHA 1SQTA 4DG4A 3EYDA 2XC5A 2ZFFH 2B0FA 4IS5A 1Z7KA 1IQKA 2H9HA 3E3TA 2KFWA 2FLBH 3L3TA 3ZZ9A 2QYIA
chains in the Genus database with same CATH topology
1MAXA 1GI7B 3RXEA 1YPGH 3EGKH 1Z71A 3MO9A 2WINI 2AH4X 4TWWA 2BMGB 5G4BA 4E7RG 2JH0D 1IQNA 2OCVB 1J15A 1LCYA 2HPQH 3SW2B 3H5CB 1TOCB 2CN0H 1VCPA 5F8TA 2BD4A 5FPTA 3SJKA 3RXGA 2W5EA 1TQ0B 3PLKA 1BBRE 1LPKB 3ZYDA 2BM2A 2G5VA 4KTUA 1DOJA 4AGJA 2QN5T 2I6SA 4AFUA 1FV9A 1FIZA 1TNKA 3T62A 1Q31A 2OBQA 4Z6AH 5EQQA 3EE0B 5GIBA 1G3BA 2HALA 3RLYH 2OQUA 1SOZA 4SGAE 3MO3A 1O33A 1GHYH 3QGJA 1OP8A 3D23A 1EP5A 1PPFE 4AORA 3UR6A 3ATWA 3FP7E 3U8RH 4U2WA 1BQYA 1BRBE 4NGAH 1ETRH 2CJIA 3A8DA 3G01A 2VIPA 1O0DH 1TGTA 4A1TA 2F9OA 3LGYA 1GBLA 1YCPM 1IAUA 1L1JA 1H9HE 6CHAC 1GJCB 1GHBF 5DGJA 3ESTA 1L0ZA 4JZFH 3K6YA 3K6ZA 1NFXA 5HXFA 1QL9A 5FX5A 1WV7H 2ODQA 1DPOA 3PTBA 5K0HA 1C2KA 2GKVE 2A5KA 4YO9A 2BTCE 2JH5D 3SU2A 1TGBA 3M7QA 2J2UA 1XUHA 2XTTB 2ZQ1A 5JDUB 1AFQB 5E2OA 1W2KH 1N8OB 1Y3YA 1IQMA 2CXVA 3V7TA 2Y80A 3BEIB 1T8NA 4XBBA 3WY8A 1A2CH 4Q80A 4UFEH 3P8OA 1V3XA 4LOYH 1L4ZA 5AVDA 3GCHC 1NY22 3T29A 4FUEA 3UPEA 1GJ7B 3DFJA 1P04A 1C2JA 1L1GA 2J34A 5EW1H 3DHKH 4TY7A 3GDVA 4A5TS 1SGCA 1HAPH 4OS1A 3HGNA 1NFWA 4F49A 3RXVA 3T27A 2O8TA 1UVUH 5L30H 4TYDA 3OTJE 3F68H 3A80A 3ATIA 1SHHB 1QRWA 3H7OA 1BOQA 2BOHB 5ETXA 1N6YA 4TPIZ 2PKAB 2FI4E 4RN6A 3T26A 3VB3A 2G4TA 5GDSH 4OS6A 3JZ1B 1MH0A 1E0FD 1O30A 3A7WA 5T3HA 4R8TB 2QXGA 3URDA 5FBEA 2FXRA 5ABWA 1DITH 4ABHA 4ABAA 1AU8A 4X0WU 3SJIA 1ZPCA 1OPHB 3QO6A 1HYLA 2KAIA 1ZRKA 1BDAA 8GCHG 1ELEE 3VB4A 2PKSB 1C1WH 2HLCA 3GY2A 3PMHB 4ASHA 4B74A 4Y7AA 4CBOA 5FAHA 3M3TA 5DP4A 3GY6A 3PM3A 2VVCA 1TX8A 1AB9B 1WTHD 1OWJA 1IHSH 3QGNB 7GCHF 3Q3YA 4UE7H 2A5AA 1HPGA 1S82A 1GMCG 4X8TH 1UTLM 2EA3A 2F9NA 3MH5A 1Y59T 1GWAA 1BIOA 1MQ6A 3LDXH 3TVJB 1X7AC 1BBRK 1MTWA 4ZUHA 4X6NA 2R0LA 3Q76A 3QN7A 1T4VH 1SGEE 3BTHE 1HLTH 1P0SH 3LJOA 1SC8U 2BY7X 2ZG0H 4AFZA 2W7SA 1DY8A 4OS2A 1DWBH 3UOPA 3PMBB 4Y11E 3ELAH 1TIOA 2FS9A 3SI3H 1AMHA 4X2VA 4Y76A 2PV9B 3BG4B 5EPYA 3ZZ7A 2THFB 1AN1E 1UHBA 4DJZB 1QHRB 1EUFA 2H6MA 3DFLA 1GI0A 2I6QA 1DSUA 2BD2A 2NU4E 5T6FA 1OWIA 2R3UA 4I8LA 4ISIH 2Z7FE 4ABEA 3DA9B 1MAYA 1O3IA 1ID5H 4NA9H 5CMXH 1GI8B 2P8OC 1KLJH 3SGAE 1C5ZB 2QXHA 4ISHH 4MPVA 3DUXH 1GGDB 1QBVH 1D9IA 1UTJA 2Y6TA 1E38B 4Y8XA 3RU4T 1M9UA 1SFIA 2FX4A 3GY4A 3LKWA 4NA8A 3RXRA 1PQ7A 1HAGE 2ZDAH 2ZA5A 2P93A 3SUDA 3UNQA 1GMHF 3M37A 1SQOA 4X2YA 1O5CB 4H6TA 2PW8H 3TJVA 1H8IH 1ESBA 4AB9A 2XRCA 4A7IB 1TRNA 2CGAA 1ZMNA 2XBYA 3OSYA 1P12E 2XWBI 5HGGA 3SORA 1IQEA 3SHCH 5CHAC 3DT0H 1WQSA 3BTGE 4H6SB 4I8KA 1V2JT 3AASA 3HKIB 1AI8H 1AVGH 5JBBS 1GI3A 1EJNA 3P95A 3O8CA 4RSPA 5J4SA 3U1IB 1KXFA 4ZMAH 3GDSA 3SV2H 1E35B 3UWJH 3LIWA 5TJXA 3F9FA 1P3CA 1GHAG 2FZZA 2FOHA 1MU6B 3MNCA 2ZHEH 2Z3DA 2TBSA 1ZSJA 2FOFA 1H8DH 2ZDNA 2ZPRA 1EAXA 4QT8C 1P11E 2FO9A 1SBWA 5EODA 3RMOH 1ZTLA 1O3NA 2HPPH 1O5FH 1O32A 1O3CA 2WPKS 3NUMA 2ILNA 1UVTH 3KQCA 2ZFRH 2ZDVH 5FHTA 4DT7B 4K60A 3TK5A 4NZQA 2P3UB 1RFNA 1UCYH 4THNH 4BTIB 1O2UA 1CHGA 1AKSA 2CV3A 1BMAA 2Z94A 1FPCH 2PGBB 2PTNA 4H4FA 3LU9B 1OWDA 2SGQE 3SV8A 3LH3A 3TK9A 5FXLA 7ESTE 2JKHA 2BQ7B 2ZFQH 4RKJB 3BTDE 2ANWA 4B71A 4JZDH 1ZJDA 3KQEA 2AERH 3UY9A 1NZQH 3STJA 1ESAA 4DOQA 3LT3A 5DP8A 1P09A 3I78A 3MNSA 2SGAA 1K21H 1GBDA 2GMTB 4O9VA 4YLQH 3RXJA 2ZFTA 1BITA 1IQHA 4ZKOU 2H5CA 1LQDB 1S6HA 4FUJA 1A5GH 1B5GH 1P2JA 1SGYE 4CRDA 3E1XB 5AHGH 2CHAC 5LH8A 2O8WA 1NU7B 1AHTH 1A5HA 1XUJA 2A31A 3ZVGA 1ZTJA 3BF6H 4IMQA 1NM6A 3BV9B 1AIXH 1BTZA 4WXIA 1OXGA 4Y0ZE 5A2MH 1NPMA 1F5KU 1CHOG 4GCHF 3NCLA 4IN2A 2G8TA 2FOEA 4IBLH 4FUDA 2WPJS 5HYOA 2BDIA 1OX1A 3SU1A 2ZTXA 3PLPA 1EXFA 1SLWB 2ZFPH 1P8VC 2ZO3H 2GV7A 1NRSH 4PROA 1LHGH 1O2VA 1ELAA 3MYWA 5EXNA 1TPSA 1MKWH 2VH6A 1DS2E 1FI8A 2Y5GA 1F5LA 2NWNA 3IG6B 2GTBA 1MQ5A 3HKJB 4ZKNU 2O8MA 3IITA 2WPMS 1SOTA 1GVKB 1BTHH 2VIWA 1GJ9B 1JBUH 4KP0A 3M3SA 1VJ9U 1THRH 2ESTE 1UVOA 1FPHH 1CT2E 1HJAB 1YCPH 2FS8A 2OC1A 3FP8E 2P59A 3RXKA 4MLFB 1SGIB 5EQSA 1V2QT 3NK8A 1LVMA 2P95A 1KY9A 4VGCC 2BD8A 1OS8A 4BNRA 1BCUH 1C1PA 4YOGA 4CHAB 1PQ5A 1BZXE 3TJNA 1SGRE 4CRFA 3GCOA 1Y3XA 3MO6A 2O9QA 3ZZ4A 2XW9A 4K1TA 3P8FA 1ZJKA 2F83A 2ZIQH 2GGVB 1G3DA 5A0CA 3MH6A 2SGEE 3AW0A 1AVWA 1C5PA 1SGTA 1TE0A 1LHFH 1BUIA 1YPHC 1V2KT 2XC0A 2IOTA 2Q6DA 4MNYA 4UDWH 1O3AA 3A8AA 3M5LA 5BRRE 1GJBB 2BD7A 1N1LA 1XM1A 2PKAA 5A8ZA 3U8OH 4GUXA 8KME2 1C1MA 1VZQH 2C90B 3NWUA 1P05A 4AN7A 1GBKA 4BAQB 1HDTH 2DE9A 2W3KA 3KQBA 1EPTB 2G81E 3BN9A 5BPEA 4Q7YA 4AFSA 1BTUA 3T25A 3ZZBA 3ATKA 1QJ7B 1GPZA 1PPZA 3JZ2B 1B0FA 4KTCA 5A8XA 3EQ0H 3LGIA 4X6OA 3RXDA 1BTPA 3TU7H 2GZ7A 3ATLA 1UJ1A 1RIWC 1Y3VA 1G2MA 1EAIA 2HNTE 4NSYA 5C2ZA 1UTQA 3ZVCA 3AAVA 1FY5A 4ZKSU 2GCTC 3RUOA 2V0BA 2Y82A 1FAXA 2F9UA 1EOLA 4ZXYH 5C3NA 3UQVA 5A0AE 1GCTC 1Z1JA 1KLTA 3QWCH 1C5NH 1ZRBA 3QTOH 1Z8GA 4ABDA 3MOCA 4JK6A 5GWZA 1JIMA 5IDKA 4AG1A 1G3EA 3SV6A 1NN6A 3CS0A 4B2BA 4CBNA 1O3KA 3RXHA 1S0RA 1EB1H 1ARBA 2AS9A 1O35A 3P8NA 1THPB 2PSXA 1SI5H 4SGBE 3AVZA 1SMFE 3MHWU 5C1XA 2FTLE 1E37B 4KELA 2AGIX 1QR3E 4AGKA 3RXFA 1MBQA 3A7VA 2QA9E 4X1PU 2C8WB 1DVAH 1RTKA 1P02A 2EI6A 2GDEH 1ELCA 3A7YA 3HK6B 2ZNKH 5EQRA 4XSKU 2PHBA 3M7UA 3QZRA 1KDQB 2EC9H 3PYHA 1O3BA 1K1IA 2GT7A 2RCEA 1A5IA 1VGCC 1SG8B 2FOBA 3BTQE 2ULLA 3RXTA 2ZCKP 1MTNC 2GP9B 1LHCH 4K1SA 1HJ8A 4I33A 2K1QA 2TGDA 2WYJA 4B2CA 2ZPQA 3LJJA 2Q1JA 4BTUB 5CE1A 1UTKA 3KL6A 1ELBA 1ZMLA 2FYRA 1K1OA 4INLA 4CH8B 1C5WB 3M3VA 2AMQA 3RM2H 3KF2A 1W13U 3A81A 2BY5X 3A8BA 1QB1A 2AEIH 1O36A 4B1TA 5EXLA 1PJPA 3RXLA 1MTSA 4NWKA 3ZYEA 3PTNA 2PUXB 2H5DA 3P8GA 5DP3A 1S81A 2ZHQH 4CRCA 4U01A 2J92A 3RC4A 1W0ZU 3UREA 2SFAA 2WYGA 1IQGA 4FUBA 2GD4B 1CU1A 1QFKH 1P2NA 3PMJA 3FZZA 3SU3A 1NS3A 4YESB 3D62A 5EGMA 1NU9A 2VGCC 2BY8X 5AFZH 2BB4A 2J95A 2ZGBH 5JB9S 3S9CA 1WSSH 1PPHE 4NIYA 3UNRA 1XVMA 3A82A 1GL0E 3U69H 1VCQA 1O3LA 2R9PA 1YBWA 3KHVA 1V2TT 3BTME 3PO1C 2G5NA 3E0NB 2BDYA 4YOJA 5JPMH 3P6ZB 3SUFA 1TLDA 4HFPB 1FAKH 4UD9H 2BX4A 4K69A 1AD8H 3T2NA 4CR9A 3M7TA 1B7XB 1SLXB 3F9EA 2ZU1A 2C3SA 4WVPE 3TH2H 3HPTB 1TQ7B 1OP0A 2O8LA 2V35A 2XCNA 1WU1A 4ZHLU 5LPEA 1EAUA 1AWFH 1SGNE 1CGJE 1LPGB 4U32A 1CT0E 2GZ8A 2SGDE 5DP7A 4UEHH 2JETB 2GCHF 2QXIA 3V3MA 2D8WA 1ETTH 2VIOA 1BA8B 3I29A 4JZ1A 5EW2H 1YP9A 1FIWA 1TBQH 3STIA 4K8BA 1TMBH 3TJUA 2ZCLP 2HNTF 4Y10E 5PTPA 1DDJA 1T8OA 4HTCH 2NU3E 1CA8B 1GJ5H 5ESBA 3C27B 3HK3B 3PLBA 3A84A 3TITA 1XXFA 1P06A 3SV9A 1TNGA 1CVWH 1UTNA 3MMGA 1FONA 5E0JA 1XMNB 3PMAB 2BHGA 1ETSH 2XBXA 3BIUH 1BJUA 1IOEA 2PUQH 3ZV8A 3W94A 3FANA 1HAXB 3SBKA 1NO9H 1O3DA 3ITIA 3SNAA 2Z9LA 1TA2A 1O5DH 1O34A 1RRKA 2H2ZA 1HAVB 5E0GA 2TGAA 1O5GH 2UUFB 1TMUH 1TYNA 1K1MA 2QF3A 1QJ6B 1ARCA 1GBHA 4DCDA 4Y71A 1FLEE 4FUFA 1GVLA 2BDBA 1PPEE 2GV6A 1K1PA 3TH4H 1C5TA 1ZGVA 1CA0B 4IN1A 5L6NH 4DGJA 2ZPSA 1O3GA 5E0HA 3TIUA 1W14U 4ISOA 4ZHMU 1BJVA 2XC4A 2TRMA 3F9GA 2TGPZ 1PYTC 2W7UA 1O2XA 3MI4A 2OTVA 3LGUA 4X8SH 4CRBA 3VGCB 1O2PA 2F9VA 4JYUH 1C2MA 3MU1A 1G36A 2ZHWH 1O3HA 4WJG2 1EZSC 3NKKA 2ZP0H 1ZZZA 1RS0A 5HM9A 1YKTA 4YLUA 3SI4H 2ZTZA 4ZHAA 1CBWC 1ZMJA 1HXEH 1A3EH 1C5VA 1VITG 1Y5BT 2A0QB 3HGPA 3OX7U 4NA7A 1W8BH 1GVZA 2Y5HA 5FPYA 3ZZAA 1Z8IB 2J38A 2R0KA 1P3EA 1PPBH 1F0SA 1NRRH 3MH7A 2BLVA 4WMFA 3RM0H 5C1UA 1RJXB 1MKWK 2HOBA 4WY3A 4BOHA 1MD7A 2QCYA 2WPIS 1GBBA 2VINA 2WUCA 4B2AA 4D8NA 1YPLH 1HXFH 1JIRA 3F9HA 2OBOA 1LKAA 2FEQH 4E7NA 1TALA 4NG9H 1V2PT 1GBTA 3RXPA 1EPTA 5JB8S 1ELDE 2ALPA 1SGQE 2ZF0H 1QA7A 1YCPK 1K1NA 3GICB 2VWOA 1DICA 2NU1E 2VVVA 3GYLB 4FU9A 2B9LA 4FUCA 4D9RA 1A4WH 2ZEBA 2C93B 3KIDU 3DD2H 2BXUH 4D7GA 1TBZH 1H4WA 1MZAA 1BMLA 1EP6A 1ZGIA 5HMAA 5C5OA 1SFQB 2DUCA 1FN8A 1GMDG 5L2YH 2ZHDA 3PROA 3SGQE 2SNWA 1MBMA 2B8OH 1XKAC 5GXPA 2Q6GA 1SB1H 1TA6A 2BD3A 3F6UH 4MNWA 3E6PH 3RC5A 1CE5A 2WUBA 4KGAA 3NZIA 1BHXB 4IMZA 3UTUH 1MKXH 1W7GH 4YT7H 1SHYA 4MPWA 2SNVA 3LH1A 2P3TB 3K65B 1E36B 1PPGE 3GCTG 2IJOB 1CO7E 5H4IB 2ZZUH 1MZDA 4ZAEA 4LZ1H 1RXPA 1PYTD 1RGQA 3RU4E 2FYQA 2FP7B 1P01A 1KSNA 1CGIE 2ZCHP 3UFAA 1UVSH 3F1SB 2VGCB 3RXOA 3RXUA 1LPZB 2SGPE 2F9PA 2A4QA 1ANCA 3RMMH 1UK2A 1D3DB 1D3QB 3LGTA 1EOJA 1Z6EA 3UOUA 1OWKA 1K1JA 1W0YH 1KDQA 6CHAB 1A0JA 1LHDH 2LPRA