4B6EA

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
646
structure length
645
Chain Sequence
ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVTGSVVIVGRIILSGSGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
total genus 202
structure length 645
sequence length 646
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b6eA04
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b6eA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6eA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6eA02
1XTQA 3SHWA 4JMYA 3QVUA 4LJAA 1E2NA 2IS1A 1GKUB 3Q5DA 4PR0A 4AYXA 1KHTA 3SV6A 4LHZA 4NHOA 3AVUA 4RY2A 2QRNA 2GAOA 2O0HA 2R6AA 4TTQA 3RAPR 4PQYA 1SVKA 4C0BA 1DAIA 4JLAA 4LJ9A 1E2LA 3PQCA 2C9YA 3M5OA 2VP9A 2WWYA 3K0FB 2XB4A 1VTKA 1ZNXA 5DNYB 4Q7LA 4G5SA 5J47A 3THXA 2FFQA 2HJVA 3Q72A 1H8ED 1BIFA 4LY6A 3KKPA 3GPLA 1T6NA 1TL7C 2Q3FA 4CT5A 4LBYA 3LDAA 3FTQA 2OG2A 3LA6A 4BLOA 1ONBA 4QL3A 1N6IA 3FMIA 2IYTA 4ARZB 1JALA 4FINA 4F4CA 4M1WA 1U0HC 2ONKA 3G82C 1Z6YA 3DDCA 3TQCA 3CWZA 2C77A 5BXQC 3WXMA 4B3DA 4KLZA 3OIYA 1VG0B 1NN1A 1P60A 5KPDA 2P5SA 1MRSA 3EG5A 4KU4A 2PLRA 1OH6A 4W7SA 1O3YA 4PO1A 1FP6A 4DCTA 1VECA 2OFXA 3AEZA 1DBSA 3LLMA 1AS2A 3QUSA 5DLQC 1YZNA 1CS4C 2O8BB 3FE2A 1ZM9A 1E0KA 3THYA 2Q9CA 2AHOA 3L6PA 3CLVA 4B32A 1TAGA 1OFHA 2ORWA 3WMFA 4DLXA 4PQFA 4B43A 5JBQA 4JBWA 5FOVA 4DRZA 5G53C 2DPXA 3SZRA 1YZTA 3QKUA 3WRXC 1AS3A 3MJRA 5GJVC 4IDOA 3P8OA 4TWZA 2OSBA 4Q5IA 2IJOB 4ZO4A 3U7EB 3NEJA 1NL3A 2C03A 2OC7A 5IK2A 3TW8B 1L2TA 1AGPA 2NQ2C 3NVAA 4B2IA 3HU1A 1H8EA 2FOLA 4D25A 5AR1A 1J70A 1VG9B 2R9VA 3OEHD 2FSHA 3SHFA 1CRPA 1QHGA 1S3SA 3K09C 4A92A 1XTRA 2ZUDA 3RC4A 3PUWA 4LJ7A 3TIFA 4K8OA 2IEYA 4IOLA 1SKYB 2H8KA 3BERA 4GSYA 4WZ6A 3U6KA 2QQEA 4XWOA 2QV1A 2D62A 3C41J 3NBFA 4OL0A 1OW3B 4JS0A 3RRNA 1DAMA 1IBRA 1JECA 3B9PA 4TMZA 1O87A 2XTNA 3VR2A 1SXJE 2REXB 2F43A 3J81k 2IS2A 1XD2B 3BC1A 3EAQA 3NXSA 5G41A 4BLQA 5BYKA 4JVLA 2WSMA 4ZKDA 1IY2A 2IYWA 2BIFA 1E0JA 1QHIA 3T12A 1F5NA 2O5VA 4M1MA 3CRW1 4BWYA 3E70C 3AP2A 3PEVA 4BFUA 1G7CA 2OFOA 2O8EB 2IYUA 3SU5A 1E2QA 1XZQA 1T8UA 1MRNA 1IN7A 2EFEB 3VKWA 2GGVB 3KXKA 1KGDA 2GF0A 3EZ7A 2GF9A 2H5EA 2RMKA 1QF9A 5D3MA 3TSOA 5L8VA 2OZEA 4DEXA 1P75A 3IUYA 3KJGA 4M9ZA 1JNYA 1ZYUA 1E2MA 2D74A 4OQMA 2H92A 1OPXA 2Q3HA 4LYFA 4XD7A 4QJ4A 2WSSD 5AUNB 4TZ6A 5FOWA 1KMHB 3T15A 4HYYA 4QC2A 1QHNA 3K70B 3QIAA 3LX8A 1KY2A 1G17A 4UNPA 1G4AE 1T91A 1RGQA 2NO1A 3I73A 1CRQA 2NG1A 1L4UA 1XPUA 5E7MA 2RB4A 4HEJA 4IOMA 4TMKA 1OXUA 1ZUHA 2ATXA 4W5HA 3ZVRA 2QY9A 1GRNA 1GAJA 1MKYA 1M74A 1E2IA 2OBQA 5JJLA 1DY8A 3CH5A 4X8MA 3KFXA 4DVGA 4EJSA 5CDFE 4M1TA 1I2DA 4PXAA 2ZI3A 2OV2A 2UZ3A 4OHXA 5GPIB 3B7GA 2BBOA 3CW2A 3F8TA 3SBEA 4F91B 2JLSA 5KPJA 4B2LA 4DJTA 5EE1A 1Z07A 1Z3IX 2NPFA 2OXRA 3BH0A 1X8LA 2ZRGA 2ZRCA 3GQBA 1XXHE 2BMDA 2A3RA 3OF5A 4GMDA 4KODA 1Z0DA 3OIVA 3LQQA 4US0R 5EUQB 3TLXA 4EUNA 4OI0A 2QPTA 4ZIRA 1Y3AA 1AZSC 2ORVA 2ZI9A 3EYDA 4LHYA 5JWOA 4PPNA 5DI3A 5HR5A 1W5SA 3QPUA 4XD7D 1VMAA 4KV9A 4XSGA 1G8PA 1JQJC 3LBNA 3HWSA 1Q3HA 1XPOA 5FUYA 1R0ZA 4JL6A 3B1XA 3ZGXA 2HEIA 3O8BA 1GIAA 5TB5A 4US2R 4UXIA 3HPRA 3C4JA 2PEYA 2IYXA 5EXSA 2AFIE 1XPRA 2EFHB 1G3IA 3ZIAD 2ZYVX 3AB3A 5DSZA 2MSCB 3SOPA 1G5RA 2Q3MA 4BEBA 5JRJA 5JEEA 2J41A 4Q01A 2HJGA 3IKJA 3NH9A 1SXJB 2WMOB 3TUJC 2O0JA 1KJWA 1W5TA 2AX4A 3AP3A 1WBDA 2HDNB 1C1YA 1Z0JA 3VR4A 1SXJA 2WJVA 3BS4A 3OE7D 4V03A 3W8RA 1R6BX 4TSFA 3ZS8A 4A2WA 2NOAA 4MGZR 4LV5B 4LBWA 1HUQA 3O47A 2LKDA 1E79D 4A6XA 4NYIR 1P2TA 3SUEA 1TEVA 2JLUA 2J46A 2QAGA 2OINA 3X2SA 2QL6A 2VQSA 1ETUA 2J7PD 2QA5A 2MMCA 1A2BA 2IWHA 2WJIA 2GJ9A 2ZJBA 4BFSA 3SQXA 3RS5A 4LX0A 3PUVA 4H9GA 4BFYA 3EA0A 3AVXA 4TL8A 1W44A 4L16A 4B33A 3AH8A 1U8YA 2G0TA 4Q4AA 4QOSA 2J0SA 3RSLA 4LK2A 1Z6XA 121PA 2KE5A 4TZ0A 2BMEA 4CIDA 1D8TA 1D2NA 3W90A 4JLVA 3VX3A 1LTQA 4I1OA 4M2LA 2IA5A 4M1KA 4G5GA 4HAZA 3RWMB 4EFNA 1EXMA 1E2FA 4KYIB 1W2GA 5D3QA 4CT4B 4DSUA 2XNSA 2XCNA 1KAOA 1Q1EA 3UATA 3VKGA 1HEIA 3D3QA 2GTPA 4QBGB 1PVOA 1U99A 1IAQA 3GLHB 5LD2C 3UXMA 2QTVB 4URVR 2E87A 2GEUA 4HATA 4MDFA 1JEEA 4M1OA 4A6PA 4BLRA 2ORIA 4QKQA 5H1YA 5CK4A 5DH9A 2F6RA 1Z29A 3QXCA 3C15C 5L3QA 4OQLA 1UF9A 1Z6TA 3R7WB 2RGNC 3OAAA 3OFNA 4B34A 3JZAA 3RABA 2RGXA 2ZANA 3L0IB 3TKLA 1ZP6A 3NWJA 2ZVQX 2ZRBA 2J7PA 2X77A 2ZU6A 2CK3A 2BEKA 4WXRA 1KSJA 2J45A 2K5UA 3WBJA 2LWIA 2TMKA 3KJIA 4MQBA 4TQ9A 4TQAA 1UADA 4MGYR 4Q1EA 1A1RA 2XSZD 2UZIR 3DM9B 3HYRA 1N5LA 1T3LA 1TPZA 1KI1A 1YZGA 5H68A 4G3XA 3AK5A 3O8CA 2FV8A 2FJUA 2ZJOA 1Z06A 4GOKA 4D80A 3CX8A 3T06B 1XJ0A 4H1UA 2Q6TA 2C78A 2J0UB 3P1JA 1W7AA 1XJQA 2QG6A 2FH5B 4TYPA 2GVZC 2V1XA 4E07A 3DM5A 4FW9A 3ZZTA 3L0SA 5FOSA 1G3RA 1YKSA 4HZUA 3MUFA 2YJTD 5C4MA 2IYVA 2QU8A 2C96A 1LB1B 3BORA 4PANA 4OK5A 1Q1ZA 4HZUB 2H18A 1E3MA 1D9ZA 3CR7A 3K0EA 2ZM5A 3IILA 3CRVA 2RGAA 1DXWA 2QT1A 4V0ME 3S1AA 1SVOA 3GFPA 3SEAA 1TQDA 4B3FX 4UNQA 1M34E 3AP1A 4BQSA 3TNFA 3OFND 4MRRA 2V6JA 2ZSEA 2DCUA 1NRJB 2O8DB 2ZETA 2J0VA 1ZRHA 4PC2A 3WMGA 4TYWA 2BOVA 1XRJA 3B85A 2CK3D 5FR2A 4NONA 3ICQB 1OH8A 3CB4A 3PUZA 4Q9HA 4LWZA 2ZQ5A 3PENA 4OI1A 2WM9B 5K8LA 4A82A 4A4DA 1XD8A 1HY3A 2CEAA 4FCWA 1OFIA 4JLOA 1KY3A 1XCGB 4L9WA 4NCIA 2BVNA 1DOAA 1E4YA 5F2EA 1L4YA 2VSXA 1W0JD 3TVTA 3Q5EA 2GEVA 1GG2A 1OIWA 2HLDD 3PEUA 4CYMA 3W5IA 1FQKA 1XXHA 2G6BA 4UJ3A 1HT1E 2IYLD 3SC3A 4ZI2A 2Z5FA 2NO6A 2GK6A 4TYDA 2IK8A 1VYTA 3LAWA 2IEZA 4OQXA 1NF3A 3R7WA 5AK0A 2XZOA 2G9NA 2J3EA 3CUEF 4EJSC 1U0LA 4R9UC 3I8SA 3TUZC 1DE0A 1EWQA 3AVTA 2XZLA 4LYHA 1K5DA 2P67A 4W5WA 2RHDA 1ZCBA 5JI3E 2XAUA 2ZE7A 3BFXA 3MGCA 5EXXA 5B6LA 3QBVA 3BE4A 3GLHA 5A5GA 2GCOA 2HV8A 4JBXA 5CDFA 2CL0X 1AA9A 2CCJA 3SBDA 3VTKA 4EDHA 1JPNA 1U9IA 5DE3A 4C0QC 3AV0B 1Q1QA 1SQ5A 4YMSA 5AJXA 1Z0AA 1G18A 2C8VA 3IQXA 4KXFB 3HU2A 5E7IA 4F7WA 4LHVA 2GJSA 3U7GA 3VNUA 1X8JA 1Z22A 3HU3A 2IJD1 3AKDA 3SFVA 4B48A 3U3OA 3GP8A 3UMFA 1LVGA 3CRMA 5FOTA 1OLOA 1CJTC 3NKVA 3QKTA 4P0TA 3NDBB 3PV2A 3PIRA 3Q85A 1SHKA 3D7MA 2XX3A 3I5XA 5IT5A 1U8ZA 3M0EA 1SVWA 4LI0A 1N6KA 2Z4SA 2V1UA 5E4FA 4LZZA 1ESMA 3D8BA 3ND9A 3U5ZB 4PO8A 3SYNA 1KI9A 1A4RA 1N0UA 5EE5B 2I1QA 4NCHA 3W34A 2GZAA 3V4RA 2F43B 4C0AC 3DKVA 1JXPA 4Q21A 1NKTA 1KZGB 2FE4A 2HT6A 3A1TA 2GWHA 4I1SA 1QHHA 2B7BA 1Q21A 2J7KA 1R8QA 4PC3A 1NG1A 3BK7A 1W4BA 3TW4A 3HR8A 4A8JB 1BYIA 3RC5A 5BN5A 2X19A 5EZ5A 2VRWA 1SVIA 5EXPA 1TX4B 1FZQA 2JATA 3KQKA 4FMDF 3RRMA 3T1QA 3UPUA 4F92B 4KTCA 1COWA 2QGNA 1GTVA 1S4QA 3QEOA 1IHUA 4MRSA 4QRHA 1VCIA 1W4CA 3K9LA 5H8WA 4K46A 2D7DA 1LY1A 5AUQA 2CLDX 4D6PA 5DIFA 2BWJA 3RVBA 2EWVA 1ZD8A 4MDEA 4P31A 4XVQA 4B3BA 4DKXA 4DWJA 4G01B 1OSNA 1P62B 4IVQA 4MRNA 5KSPA 4D4KA 4NL4H 1XD2A 5FL7A 2W6ID 3KNXA 1I4LD 1VHLA 4II7A 4YONB 3KQNA 1KI4A 5ANRB 3EIQA 2DY1A 1P2UA 2VLIA 2ATVA 3TQFA 2W83A 3P20A 4PX9A 3AQ4A 3LBHA 4NCJA 3V4FA 1T0HB 3KL4A 1HH4A 1J8MF 3QKSA 1FOEB 3GLIA 3KEEA 3CZPA 2X2EA 4BZQA 5EQSA 1Z08A 1KI6B 1VIAA 1Y63A 2FSIA 2F55A 3IQWA 2W6JA 1GKYA 2FM2A 3U60B 2YYZA 2A5GA 3T1TA 1LF5A 2V54A 5D3MB 2WKRA 3W9YA 3C5CA 2E1RA 2W2XA 1R5OA 4HDQB 5P21A 5FUXA 3KKOA 3CBQA 5B30A 2OLJA 1ZM2A 1MO5A 3KQLA 4A1TA 1ANKA 4B3CA 2D7CA 3FFBA 3IDQA 2FFBA 2XJ4A 1X8KA 1X6VA 3NC1C 5CJPA 2QBYA 4GP6A 5FTKA 2WZQA 3GJ3A 2QTHA 3MJHA 1XB2A 3Q8XB 4JT2A 4MKIA 2YOGA 2NO9A 3VKHA 1JEDA 4FWTA 1E9SA 1AZTA 2QAGC 5FPTA 2GXQA 2IXFA 1Z6AA 5CIQA 5CM9C 2DFTA 2VHTA 5FL7D 5AUPB 2VPPA 4NYJR 4RZUA 3H1TA 3AF2A 5IRCD 1Z5ZA 4AY2A 4AI6A 5JECA 5IK2D 2YWFA 4NYMQ 1I4DD 1Z28A 5KNBA 5SZIA 2OXCA 3GFOA 4Q7JB 5LDDC 5FTMA 1E4VA 3K0CC 2BCJQ 2FMXA 4WF8A 1FMJA 4C2TA 5F9HA 4GNKA 2GNOA 2F1HA 1LW7A 4IDNA 4PAMA 1E2EA 3OEHA 4JIMA 3HDTA 4B47A 1NN3A 2REBA 3QNUA 1XP8A 3K70C 1KI8A 4CDGA 1Z6GA 1RE0A 2QM7A 1WF3A 2VP4A 1U0JA 2W6JD 4G1UC 3RS0A 4OHZA 4K81B 4EFLA 1QRAA 3EARA 4RD0A 1YZKA 2FNAA 4HAVA 4UXHA 5J4VA 1Z2CA 2AN9A 2QMEA 5FUVA 1Z63A 2FSGA 4HLCA 1NS3A 3MWKA 3ZQ6A 2HCJB 1KAGA 3EC1A 3BB1A 1IN5A 1OKKA 2O8CB 4OJQA 5DGXA 2B7CA 4WAUA 2C98A 1PLJA 1DG3A 3IHLA 1XD9A 3RANA 5CB6A 2XTMA 3U44B 3AVQA 4NWKA 1DY9A 3OTPA 1E2HA 3WP0A 1FTNA 4FI3C 4C7OA 4MKFA 3THWB 4RZ3A 3B1YA 3ZH9B 5BQ5A 2BBWA 4MYHA 3KDSE 1CBUA 2DFLA 5DYGA 2C99A 2IYRA 4JJKA 4ESVA 4RJLA 2XEXA 1A7JA 1XNJA 2XNIA 1DO2A 2PJZA 3QOFA 2ZRKA 1MOZA 5J5CA 3KKMA 1ZM7A 1EFRD 4IRUB 3QXHA 4TLDA 3I4LA 3LKWA 1ZINA 5HKKD 3B8HA 5JS8A 1GITA 1H8HD 1T3SA 4ZKEA 1W36C 5DYIA 2V55B 2O52A 3IBYA 4PPFA 1E9EA 4TYQA 3K8YA 2XGJA 3VQTA 4ZDJA 4Q4HA 5FTNA 1L7VC 4Q47A 4MA4A 3TR0A 2YZ2A 1W48A 2GCPA 2G3YA 4Q4JB 3U6BA 1ESNA 1E9DA 2V3CC 4GRAA 4BLTA 4U02A 3CRRA 3LXRA 4M9SA 1II0A 2KJQA 1XBTA 4WVFA 3W5JA 3I5YA 4I31A 1E1QA 1T9HA 4GMXA 2PX3A 1M1YE 1S0UA 3WHKA 3CH4B 3PEWA 4XJXA 4PHTA 4C9BA 4MYCA 3RC8A 3H86A 4P4TA 2NZJA 4LV6A 3RRZA 1S1MA 2ANCA 2FZ4A 1RJ9A 5TY0A 4JLDA 1D2EA 2ZR0A 3CX7A 2OM2A 3B60A 2OCAA 4DDUA 5JI2E 4Q1DA 4HUTA 2EFDB 3OEEA 3EPJA 3EPLA 1KDPA 1YRBA 1N6RA 4OK3A 4EPYA 1EESA 4KAXA 3DKPA 3AVYA 5LB4A 2Z83A 2FGKA 2A4QA 2IHBA 5FR1A 1D9XA 1TF5A 2VHCA 4L9SA 5G3YA 1G16A 1I4TD 5J4KA 4NZYA 5H70A 3SJZA 2BHRA 2GAAA 3N2IA 3WP1B 3U44A 1H8HA 1LNZA 1Z0KA 2C2HA 3MMPA 1ZC4A 4IEEA 2REOA 4AURA 1IXZA 3EZFA 1A1VA 5FPSA 4EKDA 1NY6A 4HZIA 2V4ZA 4IFBA 4KHZA 4K8BA 4TTRA 1ZNZA 2F9VA 1RIFA 3BXZA 2W58A 1KO4A 2ODNA 4GZMA 5K8TA 1Z0FA 2ZR9A 2QAGB 2WIBA 4CVNA 1FQJA 1NMZA 2QP9X 3VR1A 1E1QD 2RAPA 3ZQJA 4HB3A 4M21A 1OB2A 2H17A 2J87A 2QAJA 3ZIAA 2W00A 1P9NA 4HDOB 3U3MA 1AGRA 5JZVA 1JPJA 3SYLA 2X2FA 4ZCLA 5LPNA 1M8PA 4M4SA 2VP2A 1YR8A 3QXJA 3TAHA 1P9WA 4FMBB 4JL5A 1SXJD 3OE7A 4R7ZA 4TSFD 4DSOA 3W6NA 2JASA 4US1R 4MGIR 1QG2A 1DXPA 3Q7QA 2RGCA 4OKSA 4KI0A 1E79A 4C7OB 4GPTA 5B2ZA 4DCUA 1OJLA 2PEZA 4C0LA 2O8FA 4EPXA 2A4RA 4RCZA 4Q4AB 1HE1C 1G6OA 1N25A 3RDPA 4I99A 4C30A 1AM4D 2ZROA 1R7RA 3ZZ0A 5EPNA 4BZPA 4HB0A 4DXAA 4PAQA 1E2GA 1H65A 2UKDA 5EJEA 3GD7A 1KK1A 1XTSA 3IIMA 2OC8A 3KKNA 5JFGA 4F38A 5JCZA 1JR3D 1JI0A 2ZSFA 2JDID 2D2FA 1OT3A 3B1ZA 2QM8A 2BEJA 3SFZA 2WWIA 3VU9A 5ELXA 4WA7A 1G7SA 3H2YA 4JSYA 5M04A 1A5TA 3CR8A 3HPQA 1ZNYA 2PT5A 3ETLA 3PFIA 4A0GA 5B58C 5J4HA 3L43A 1EGAA 5FTJA 4BLSA 1OXXK 2J5XA 1G3UA 3E90B 1W47A 3N70A 2OCYC 4NMMA 4PPQA 2ASEA 3WHLA 3X1DA 4TLCA 3MSXA 4GOJA 3FMOB 4V0NA 3AVVA 4EJSB 3G0HA 3CPEA 2ODWA 1VKJA 1VCOA 4A1FA 1N0VC 2WWXA 4PFSA 3OAAD 1CULC 1WXQA 2IF2A 3F0TA 3SU4A 1CR1A 1DAGA 2JJ1D 5FL3A 3VU9B 5K8IA 2R6GA 1BT7A 3V00A 4DT1B 1GNPA 1G7RA 1R8SA 4P33A 1JBKA 1IN6A 1UDXA 1PZNA 4DUGD 1XEXB 1S9HA 1XMVA 1ZCAA 4TMTA 5SZJA 1WA5A 2X1VA 1F2TA 1OYYA 1P73A 4M1SA 2ZTSA 4NTZA 4XVRA 5J4YA 1JR3A 1XEWY 4Q4LA 1U81A 4IW3B 4Q18A 2HF8A 1UDWA 3AGQA 1F60A 4B44A 3MD0A 3L8ZA 5KU1A 1NBMD 2Q21A 3EXAA 3H09A 1G8GA 1R0YA 2MMGA 3IEVA 3ZD6A 1GWNA 4JLPA 1DS6A 1G8HA 4BZXA 4X8LA 2XXAB 4NCNA 1CU1A 2VYFA 2BMJA 3ONWA 1MT0A 1DTSA 3TK1A 2R8RA 2VTKA 4A0RA 1DEKA 4CW7A 3SUGA 1US8A 5ETXA 4A1VA 1M7HA 3EW9A 4JLJA 3ZYCA 2BJVA 3EPHA 3GMTA 3SU6A 4RI0A 2GETA 2HCBA 1KK3A 3KX2A 5EQTA 2PL3A 4ZV4A 2BM1A 1GM5A 2CJWA 4XVUA 3SJCA 3B1WA 4RD2A 2RHMA 3WNCA 2QMHA 4HSEA 2D06A 5CB8A 4JMPA 1W4AA 5KNDA 1OE0A 1T5LA 5FTLA 1C4OA 2O8FB 1OIVA 3A4MA 1ZIOA 4LBVA 4URYR 2ZE5A 3LW7A 3LNCA 3AF3A 2QSZA 4G5RA 5TXGA 1QVAA 2YOLA 4TQUS 3ZJYA 4DUGA 1FNMA 4AK9A 4ZDKA 1CR4A 3EWSA 2CHVA 2OT3B 4TL6A 1XTIA 2GCNA 2EYUA 3L82B 4UKDA 1W0JA 4RD6A 1I2MA 2BDTA 3QPWA 2GCOB 2DFNA 2HLDA 2CL6X 2P5TB 3FVQA 4AKIA 1NBMA 4M9FA 3I3SR 3QENA 2D2EA 3ZS9A 5EUMA 4ERNA 3F3YA 1AN0A 1DVRA 4CZ2A 1N6HA 4OI4A 4FMCB 4I33A 5CYOA 1U8AA 1KMQA 2R65A 5FBQB 4OJKA 3QXXA 3A6PC 3FGNA 3RLFA 4DDTA 4ABYA 3SU0A 1RTLA 4LHWA 4ASUD 1DG1G 5JMTA 4R8TB 1W4RA 4AKGA 2AR7A 5KDLA 5AJYA 2GBLA 2NIPA 1FPMA 5AJWA 1G291 2OBLA 5EP3A 4F93B 1RRPA 5BYJA 2VIIA 3JZMA 3X1WA 5FH9A 1K5GA 3X1XA 1KK0A 1NIJA 2ANBA 4LV8B 3THOA 1P61B 3A8TA 3OZXA 5F9FA 1KKMA 1JQLB 3CX6A 4R98A 2QPAA 1XEFA 2F1RA 2C5LA 3BFKA 4FMCF 3DEFA 4DCNA 3U7FB 4DLUA 2A5FA 5EQQA 2EW1A 1P2VA 4QFMA 2FN4A 4LJYA 3BFVA 4QBHA 3DVLA 4C2UA 2NO7A 4GOXA 1QHHB 2ZRNA 5CYPA 4DLTA 2PZFA 2GKSA 3RC6A 1HTWA 2H7VA 1BH2A 2HYDA 2AK2A 2YV5A 4N0EA 3ADCA 4D0NA 3HP1A 1S2MA 1JXOA 5GJWC 2AD5A 2OCBA 1XDBA 5GJCA 4WZAE 4KCGA 3W3AA 4ACBA 2JLYA 1N6OA 3CWQA 1P4SA 4LBZA 1V5WA 4HI0E 3LWNA 1XEWX 2RGEA 1UBGA 3P27A 3TSZA 1S3GA 4CEJA 1A82A 1F2UA 4DDWA 3SS8A 2Q0HA 3MWJA 3GJ7A 2OFWA 4ASUA 4QG7A 4LC1A 2QI9C 1II8A 1MO3A 1VG1A 4CEIB 1D6JA 4RD3A 2F9MA 2YWEA 4NWLA 3DMDA 5HCNA 1D5CA 4B6FA 4N1AA 3EX7C 3QG5A 2FGJA 3BRWD 1CLUA 4NDZA 3IIKA 4QBIA 3BH6A 4I32A 3ZD7A 3B6EA 5JCPA 1SZPA 3A1VA 2QGZA 4WH8A 2O8MA 2G1KA 2ZE8A 1GFIA 3TH5A 2JLXA 1KZ7B 1WRBA 4RCYA 3GJ8A 2V6IA 1G6HA 2JEOA 2QBYB 2Z43A 2IW3A 3I8XA 5HCIA 2VSOA 4Y0VA 3KXIA 5JJKA 2FEMA 3UKDA 3JVVA 2PX0A 4KVGA 1IOZA 1YZQA 2W6IA 4RKFA 4HB4A 2ZRDA 4LHXA 4TMVA 3WNDA 1NSFA 3B1VA 1HURA 1OYWA 2A30A 2I1VB 3BOSA 2QMUA 5A0FA 5JSZB 1LS6A 1RRGA 2ZJ5A 3EZ9A 2WBLC 4PAOA 5JHGB 3R9WA 2IF0A 3I92A 2CHGA 2ZYWX 4GP7A 3P4YA 1IJFA 1KO1A 4L15A 4B35A 4QJ5A 1U94A 4Q19A 1GILA 2CVFA 1WXRA 2DR3A 1T4GA 3FHOA 4Q02A 4KSCA 1XJCA 4IDQA 2EU8A 2ZAMA 2OBNA 1EFTA 1K6MA 2ZJ2A 2VP0A 3GJ4A 4YMVA 621PA 2ZRAA 1X86B 1BO6A 3BB3A 4C0HA 1PLKA 3BGWA 3FOZA 3B9QA 1E1RA 1Z8FA 4IJMA 5J4LA 2H57A 5BW8A 2G83A 1KNXA 2KB0A 2Z6VA 1AS0A 3OIWA 3DOFA 4MKGA 4F4IA 4QM7A 2FSFA 2XOKA 4DSTA 1YRAA 4JVNA 4TLEA 3PEYA 2JLVA 4AWXA 1DAFA 2QROA 4EPVA 2ZIAA 4V0MA 4Q66C 2A5JA 3CF2A 4ZI3A 5LBIA 3I62A 3VX4A 1EFHA 1UEJA 3LH5A 2ZAOA 1KKLA 2GDJA 2VL7A 4PC7A 1LF0A 2DBYA 4HLQB 4TYYA 2XCFA 4ACAA 2CL7X 2F7SA 4WH6A 1RVDA 2PBRA 2OESA 2KBEA 4PQRA 5KO2A 1G4UR 4W9MC 3NHBA 3SU3A 1FX0A 3H4MA 4O2LA 3M5NA 1ZMXA 4RKEA 5EZ6B 4E5UA 3C8UA 1DO0A 4FCVA 4AKHA 3U2QA 3CO5A 2JLRA 2A4GA 1ELOA 2RH5A 3TVDA 3U3KA 1W46A 4PC6A 1OHHD 3RC3A 2GJKA 1ZM4A 2CE2X 3GLFA 1G9XA 1KI7A 5KOYA 2ZITA 3EC2A 2YWHA 1YHNA 2VHJA 1TUIA 2N42A 3BWDD 3EIEA 3H0KA 5A4JA 1FP7A 4RD4A 1JB1A 5FBLB 1Q12A 4L8GA 1U98A 3REGA 1GL7A 1E32A 2ZE6A 1F2UB 3P4XA 1NJGA 4JYBA 1E0SA 4NYMR 4Y0AA 5C1BA 1GZSA 2ERYA 1PUJA 2R6FA 1NVVQ 1E1RD 3IHWA 3KKQA 2O8BA 2JCSA 4E22A 1W3CA 1XFAA 4BFZA 5L3SB 2IXGA 2QNRA 3U7HB 1OKKD 2XOKD 3CF0A 2ZI7A 1K8RA 4QNMA 1M7GA 3KN2A 3AVPA 1Q20A 2BBSA 5LD2B 1R5BA 1KO8A 1VYUA 2R44A 4EQ6A 1NVXQ 4QGHA 2ZS7A 3TUIC 1G5PA 1RFLA 2ZJAA 3FDIA 4YDHB 3LLUA 4NBSA 2ONJA 4P3YA 1UKVY 4B76A 3P8NA 4OQNA 1ZW6A 5JEDA 4B74A 1QBKC 2OEPA 1NBME 3PUYA 1X3SA 1TNDA 1WP9A 1UBEA 1XTKA 2Q9BA 2MSEB 4QHSA 4DB4A 2E9SA 3IPYA 4AD8A 1NLZA 4I81A 2PH1A 4QGAA 2B92A 4DC9A 2VP5A 3K9GA 1XX6A 3KTAA 5FI0B 4RSGA 1EFRA 3UK6A 4BRUA 4M1YA 2GJ8A 4HLUC 1VCMA 4RD1A 4XTCS 3ADDA 3VNVA 2F9LA 2GJAA 1VYVA 5HKKA 2V8OA 2F3RA 3QKSB 5EE3A 5FBRB 4S2EA 4IDPA 3KUCA 5KUTA 2CMKA 3EASA 4TL9A 5C4GB 5DISB 1HE8B 1TQ2A 3JVUA 2GBLC 1GL6A 2PT7A 4M8NE 3WY9A 4A9AA 5T1VA 1RZ3A 3HR7A 2HUPA 1AQYA 4OI2A 2OO7A 1TU4A 3UWOA 3LQRA 3LBIA 5SZHB 4JT4A 4BPBA 1CF4A 1M6NA 1GVNB 3V9PA 4NYJQ 1XMIA 3WRYC 2WVJA 5E7JA 1EWRA 4BFWA 4FMDB 5AWFC 4M22A 1PLLA 1CR2A 1ZBDA 2ZI5A 2ZSDA 1CEEA 3CIOA 3GFTA 4D0GA 1Q1BA 1R0XA 4A0FA 3S1AB 4DT1A 1RRCA 4HAUA 4M9XA 1CJMA 4LDJA 1IY0A 3B5JA 3AF1A 2N46A 3OEED 4Z51A 4QGGA 4M0LA 3UANA 1VHTA 3AUYA 3GCGA 5CK5A 1P7CA 2FPKA 4N0DA 3T1VA 3R8FA 5JHHB 4TLAA 3CNOA 1NSTA 1QHSA 2WOOA 5JWHA 1KSFX 3KZ1E 3MLEA 4UQOA 3BJIC 2IBMA 2WAYA 4IXNA 3EIHA 3M4YA 2DFKB 3R20A 1FUUA 1AKEA 2IYQA 4MRPA 4C3ZA 4DIDA 4EPRA 4QGFA 2ZUBA 3AUXA 1OB5A 1DAEA 5KNCA 1J99A 4LGMA 2IUUA 3EZ6A 3UG6A 1R4AA 2BV3A 1NKSA 2Z4RA 3FFAA 2ZPTX 1ZD1A 4M9QA 1SXJC 2IYSA 3VAAA 2VP6A 3LO5A 1E99A 3SUFA 2O8DA 2AXPA 2IS6A 1T0JB 3B82A 3PG5A 4UJ5A 3SJBA 4POAA 2NGRA 3SR0A 3A36A 4LJ5A 2YOHA 2ERXA 4URWR 3SN6A 3K1JA 4LC0A 2F3TA 3QXSA 5JWRA 1N5KA 4KO8A 4URZR 1KJYA 3C7KA 1SVMA 3LVQE 4JVMA 3U1IB 4XTRA 2OILA 3REFA 3X1YA 2YKGA 1E9AA 2OCPA 2YWGA 2OUKA 3TR5A 3ZVNA 1N5JA 4Q4JA 5CIWA 3MWYW 4WZBE 4YDSA 4D4JA 5LB2A 3I1FA 1EX7A 4X8OA 2GILA 5GJBA 2WWWA 2ZS9A 2ZU0C 4WW0A 4QHTA 1KDOA 3NTUA 4XOIA 1NVVR 4PPGA 5CLLA 3DO6A 4LPSA 3NEYA 1AK2A 5CLQA 4JYCA 4KBFA 4KFRA 1DELA 3QE0A 3FKQA 2WKPA 1QHYA 5FFMA 2OHFA 1RKBA 2EVWX 3QF4A 2CLSA 3GLGA 4CEHB 4BECA 2KBFA 2JDIA 3LD9A 1E96A 2OAQ1 4HB2A 4JVSB 3WBKA 1ZU4A 3WYGA 4U5XA 1F2TB 4O0MA 1KOFA 1NNEA 4Q1AA 2FP7B 2XNDA 1G1MA 3AF0A 1NJFA 4JSTA 5FPYA 3KQHA 2JLZA 3MFYA 4Q48A 1E2KA 4IKEA 3M5LA 4P32A 2KSQA 4NYIQ 1MR3F 2O8CA 2F9UA 1TQ4A 2R6DA 3ASZA 5DN6A 1G41A 2AXNA 3SDZA 1S8FA 3ASYA 5EE0A 2KI5A 3ZDQA 1JJ7A 3B2EA 1G64A 4U7DA 1IXSB 1L8QA 4QXAA 1P72A 3DOEA 1UFQA 1BOFA 2JJ1A 1MO4A 4QM6A 2FA9A 3FYHA 1WBBA 3TBKA 5CITA 3GLFE 4H1VA 2WPDA 2ZEJA 2QORA 4BFTA 2VSFA 721PA 3A4LA 2GZHA 1CR0A 1ZC3A 5EE9A 5KTYA 1XCPA 2O0KA 2CE7A 3AGPA 3DZ8A 2IL1A 3RNLA 1G8FA 2ZI4A 5B57C 2GEDA 3K0SA 2J0QA 2MSDB 2AD1A 2P0EA 1W0KA 2R6CA 2GHIA 1EX6A 1AJEA 2OC0A 2Y8EA 4XIGS 2WV9A 1N5IA 3BBPA 4B3XA 4LSGA 2BC9A 4DCVA 4FIDA 4OBEA 2JJ2A 3MWLA 2W0MA 4A1XA 1IN4A 1IY1A 2FWRA 1E69A 4DHEA 5KHOC 1TU3A 2P65A 1US8B 2WWFA 1J90A 1B23P 4Q1CA 4DCSA 2AKYA 521PA 1SGWA 1A2KC 1OFTA 2CLCX 5F98A 4YMWA 3BB4A 2ZVPX 5FOUA 3THWA 1N1LA 1TTTA 1ZVQA 3TGPA 4TMXA 5DN6D 3WMEA 4I4LA 1JAHA 1OXTA 2P59A 3SU2A 2YNMA 3P32A 2IS4A 1SVLA 3UWKA 1QDEA 1ZM3A 4IHQA 3RS7A 2CDNA 4ILEA 2DB3A 4JLMA 2VHQA 5HE8A 5KSOA 2F1JA 4PSVA 4I1VA 2GK7A 5TDHA 1HYQA 4D2IA 4N3NA 1CKEA 1E9RA 5DI9A 3CPJB 4CF7A 2WPDD 4GL2A 1GOTA 2EQBA 1WE2A 4L4UA 4YMUA 1F48A 1KSHA 4QBFA 3A58B 2BMFA 3CZQA 5HZKA 3KB2A 1C9KA 3LXXA 1W1WA 4ZCMA 1MABA 1YZUA 2BBTA 4BFXA 2J9RA 2J0UA 3CKLA 3U3JA 3T61A 1XEXA 4U01A 2I4IA 1W0KD 4HAYA 4AG6A 4JZKA 4PHHA 2DHRA 3QVVA 5C46F 3ADKA 1NP6A 3HJNA 4Q1BA 3TJZA 4PHGA 3E2IA 2PMDA 1GP2A 3L0OA 2JJ2D 3Q9LA 2HF9A 5DO9A 2G77B 1JR3E 2FFAA 4WXPA 1J2JA 2RGBA 3QEJA 3T5DA 3G5UA 3THYB 1KDRA 4KSBA 4U00A 1TUEA 2B8WA 2I3BA 2H1LA 3BIFA 3K0AB 5EXTA 3VFDA 1XXHB 2JIZD 4PZLA 4LOAA 4EPTA 1JAIA 1XF9A 3FMFA 3KJEA 3QF7A 2YC2C 1AIPA 2C04A 1CJKC 4KFSA 1YU9A 5FPKA 1ZIPA 2EFGA 5L3QB 2V7QA 1RRFA 4V0KA 3W3ZB 2ZI6A 1ZAKA 4GDFA 2NMVA 4O25A 4PTLA 4LPKA 1UM8A 2IHYA 2QP4A 2WWGA 1LV7A 4Q7KA 5BN4A 1P5ZB 3DL0A 3N5CA 1VPLA 1CTQA 1Q57A 1ZUNB 4OQFA 4IDHA 5BN3A 5CM8B 3LRPA 3RS3A 3CPHA 3GLFB 1IJEA 1LS1A 1VDZA 4IFEA 5HTKA 1S1CA 3QJYA 3RWOA 1ODFA 1XU4A 3DZDA 3CF6R 4NE2A 3LOXA 4HLUA 4ON9A 4EIWA 5KSYA 1OXSC 4DZZA 4A2QA 1IM2A 3A37A 4LJ6A 5TV2A 2FEOA 4BE7B 3PVSA 4RZ2A 3OHMA 2BKEA 1CJUC 4JKIA 3QY0A 3U1JB 2Q9AA 421PA 2B21A 4DLRA 4QHYA 3QQ5A 2FG5A 1GRRA 4TMWA 2WJHA 3P26A 2OAP1 3D31A 3QPVA 4BFVA 3FKSA 4DLSA 4O3MA 3RRYA 3PJRA 2K1QA 5IDVA 1NG9A 3KFVA 1RYHA 1CIPA 3IO3A 4ESHA 4IOJA 5UKDA 2HXYA 1N2CE 3FPAA 1Q0UA 3ECCA 1E6CA 3FHTA 2ZS8A 3GLGE 1NLFA 1WCV1 4IOKA 4HAXA 3QKRA 1XCMA 2V7QD 4B6EA 4EQ6B 2GXUA 2OBMA 1MV5A 1GKIA 1R10A 1UKZA 4NPHA 1MABB 4Q9IA 4D81A 1E98A 2A7QA 1TADA 2VEDA 1T8TA 1TQ6A 1E94E 3GEHA 3TSWA 2QMOA 4D0LB 2OBOA 1YQTA 3E5HA 4S35A 3R9XA 1KNQA 2IUSA 4FD2A 4PSAA 3O8DA 1EK0A 1CXZA 1FFHA 1OV4A 6Q21A 3CONA 2GRJA 5IF9A 3K70D 3LW8A 3ZVMA 3U4QA 1ZNWA 1TF2A 3ZVLA 1ZD9A 4Q03A 1N6PA 4XH9B 3OYPA 1E9CA 1LFDB 2NO0A 4FXPA 4KFTA 5IHPA 5AJZA 5HZHA 1M7BA 1QG4A 4B75A 3SE0A 3SYJA 2G88A 4ARZA 1P3JA 1VIYA 3L8YA 4XWAA 3ZZUA 4LYAA 4IEIA 3A4NA 1XWIA 4RZXA 2C9CA 4BUJA 1XTJA 2PCJA 2V9PA 3FKSD 2ZRFA 3U61B 4CGZA 4FWIB 1V43A 3T34A 5DHAA 2JLWA 2ODBA 4MUAA 4BRWA 1JR6A 1J7KA 4NCKA 4D26A 4URXR 1AQUA 3DMNA 1WDTA 3K09A 2HYIC 2L0XA 2ZSAA 1KO5A 3IEUA 4KBGA 1KI6A 1KI3A 2VA8A 4DEYA 4PZYA 4D4MA 2G0NA 5IDKA 1II8B 1S96A 5JSZA 4Q9KA 5C2JB 4RVCA 1YZLA 1G3QA 1NLYA 4F4JA 3D6TB 3GJXC 3GJ5A 1BMFD 2P3SA 3GEIA 4Z1MD 2BCGY 4AYTA 4A36A 1DARA 3UIEA 2IYYA 3K0CA 2CCGA 3M1IA 3UMRA 1P2SA 3TRFA 1W36D 2ZUCA 5C18A 2YVUA 1II9A 3LVRE 2ZRLA 1HQCA 3A1WA 1NI3A 3FMPB 3NDPA 1FW6A 3NC0C 8OHMA 4C0SA 1U2RA 3QKRB 3TE6A 4UXJA 1R2QA 4OK6A 1ZUIA 2ZRJA 2QENA 3PXGA 1U9IC 1KTVA 1FMLA 2GVFA 2JGNA 1OHHA 1WMSA 3A1UA 1OIXA 2P6RA 3C16C 3MAAC 4PHFA 2GA8A 2GVDC 2VBCA 2NZ8A 4E03A 1HA3A 3SV7A 2HT1A 1GL9B 3GEEA 4YMTA 2B6HA 2WHXA 4B3GA 1SHZA 3KTAB 2WSSA 4NH0A 1G19A 4P4SB 5E95A 2FF7A 3W6OA 4ZCIA 1UBFA 1EFUA 1X1RA 1RPZA 4LYJA 3K9HA 3RS4A 5K8UA 2J1LA 4MKHA 1UKYA 1SKYE 4EFMA 5H4IB 4Q9JA 1KI2A 5ESBA 2FX3A 4WIAA 3I72A 3VR6A 2YHSA 4MUBA 3AKEA 3SYKA 5EQRA 1UKEA 1AKYA 3K9NA 1BMFA 5AJVB 4Z1MA 5TMPA 4LJ4A 1YR6A 2XZPA 1BYUA 2HXSA 2QE7D 2RGGA 2OK5A 4CRWB 2WKQA 4D82A 2A78A 3LX5A 4Z54A 3AKCA 1N6LA 1GNQA 4A8JC 3K53A 4R71A 1KJZA 1W36B 2WWHA 3N2EA 3RYTC 2CBZA 2JLQA 3T5GA 1BKDR 2QPOA 2IC5A 1E9BA 2ZRHA 4UNNA 1RC8A 1D2MA 2JAQA 3SI7A 1E2DA 1Z47A 5JS7A 3SZEA 3BD9A 2FFHA 4PSKA 2NTYC 2IXEA 4JL8A 3GLGB 4CEHA 4DLVA 1YVDA 2BM0A 4M53A 1YR7A 2CNWD 2WIAA 1IXRC 2FOMB 5CJ2A 1IQPA 1FTSA 3E1SA 2PMKA 4MH0R 1XMJA 1G7TA 1N0WA 1GSIA 5FPHA 2OE2A 1YJ5A 2IX3A 1S9DA 2GESA 2VF7A 2DWQA 4C0KA 2BJWA 5EP4A 2QT0A 1JJVA 1HV8A 1KDTA 4R2IA 1F6BA 3AVOA 1U90A 3OIUA 3PUXA 2ZJ8A 4FN5A 3AVWA 1KYIA 2ZJYA 3K0AA 4RFVA 1FL9A 3QG1A 3UG7A 3NBZC 4TN1A 3KF2A 2PJRA 1GNRA 3EZ2A 4IXMA 4Z8YA 2QE7A 4V0LA 3VHLB 2J59A 3QSYA 4PO9A 5DI3B 5EP2A 821PA 3CM0A 4DB2A 1EG7A 4AG5A 2GXSA 2F1IA 4JLBA 3DHWC 2G1JA 2EYQA 4WOPA 4P4UA 2W0SA 2VO1A 3B78A 4B2PA 4QJ3A 5JRZA 3ND8A 1NMYA 4OHVA 1FNNA 3R8CA 4UNSA 1KO7A 4O2RA 4JBYA 5B64A 3NH6A 2YINC 4X8HA 3OESA 4PZZA 1KMHA 2ZJZA 4Z8XA 2OC1A 2QZ4A 3SU8A 4LRWA 1GUAA 2W2VA 1UJ2A 2ZRIA 3VHXA 1JXMA 2CNWA 5JLJA 3NBYC 3Q3JB 3NBXX 1G21E 3THXB 1XMSA 2CHQA 2LCFA 3Q7PA 4GT1A 3M5MA 3DPUA 1UEIA 1W2HA 4ZPXA 2WAXA 2WJGA 4KLNA 2CVHA 2VH5R 5L3VA 4PC1A 2B8TA 4P4SA 4L5BA 4V0OA 3SJAA 1W49A 1P6XA 221PA 3CNLA 4E09A 1OF1A 2QUZA 1TF7A 4OHYA 5L3SA 2JJ8A 3PV5A 2WJYA 3TMKA 3VMFA 5KSZA 4MYTA 2A5YB 1R5NA 2XB2A 4TYNA 1UPTA 4J0QA 1MH1A 1VG8A 2AFHE 2IUTA 4HUQB 4YXWA 4DBLC 3RS2A 3ICEA 3GJ0A 3TAUA 3T35A 4HUQA 1Z2AA 5E3HA 4JLNA 4DLWA 5GVSA 3BH7A 2DWPA 2FPMA 4JLKA 4Q7MB 5TVKA 3EPKA 4KVAA 1YR9A 3FHCB 3C14C 4G5QA 4V02A 3U3RA 2PZGA 3LFUA 3SQWA 2OLKA 2IT1A 2XJ9A 3FB4A 3VR5A 3K0FA 1DPFA 2CCKA 4W5JA 4YLGA 2IWRA 4TL7A 4B73A 1DADA 1Q3TA 4EAQA 3AKYA 4R2HA 5FBVB 3O8RA 1E2JA 2X8AA 3A1SA 3BAFA 3EA5A 1X1SA 5BWMA 5KDOA 3CRQA 3IGFA 2RKOA 4TT3A 4YC7A 2W2TA 4A15A 2XSZA 2FDCA 1FX0B 5FI1B 1VCNA 3WYAA 1N3BA 1MO6A 3GLIB 3VR3A 4LCBA 2A9KA 4DLYA 4EPWA 3H84A 2F4LA 2RGDA 1G5TA 3LONA 3X1ZA 4I1UA 3PR1A 2Z0MA 5FUWA 4NU0A 4GZLA 4GI7A 5GADl 1G20E 4QNRA 1P9RA 5L3RA 2XNDD 3F5FA 4ZDWA 3T1OA 4Q1FA 1RYFA 2D3WA 2C95A 2WOJA 5TARA 3PV0A 5GJ4B 2ZYUX 4MRVA 3CNNA 4OHWA 5FBWB 2WJJA 5AUOB 3GLHE 5EPYA 2P6NA 1NN0A 2DYKA 4DDVA 4ZDIA 4YXWD 5F3WB 4CEIA 2ZREA 2QP3A 1J8YF 4JJZA 4TLBA 5HPYB 1Q22A 4IVPA 2NPIA 2ECKA 5HE9A 4XSHA 2BKUA 2KWIA 1Q44A 3LY5A 4G0NA 1CJVC 2ZR7A 1DAKA 1PJRA 1R0WA 3IIJA 1DAHA 2ZYTX 4JKYA 1FUKA 4A2PA 2O8EA 3QBTA 4LJ8A 3UMSA 3I32A 2C9OA 5J40A 5SZKB 2LKCA 3C5HA 3RSOA 4AIIA 4LUCA 4KYUA 2AKAB 2ZXUA 3MCAA 4YQFA 2XTZA 4MITA 4BLPA 4TT3D 3KXLA 2QSYA 4Q9LA 4AYWA 4DSNA 3L2OB 4BASA 2RGNA 2R62A 2QTFA 4RFSA 3B13B 5JJIA 1IONA 2EFCB 4KFUA 4AKEA 4C4PA 2WMNB 5DHFA 1KIMA 2N1BA 2DWOA 4TTPA 4DIEA 2FU5C 2GXAA 2WICA 1M2OB 2P2LA 4WBSA 4GBMA 1SVSA 3U4QB 1G3MA 2ZRMA 2IYZA 1PUIA 4Q00A 1HQYE 4IVRA 2XITA 1N6NA 1OH5A 3MRSA 4URUR 1OH7A 1QZXA 3AM1A 1Z0IA 3SNHA 5G3ZA 1T5IA 1NY5A 3M6AA 2FPLA 5GVRA 1OXVA 1QVRA 4BEJA 2VHUA 1G8YA 2H16A 2RCNA 1B0UA 2ZRPA 4A8JA 4HDCA 1QHXA 2P6UA 3QF4B 4HAWA 4XWKA 1WB9A 4OM9A 4CEJB 2JA1A 3HYTA 1KSGA 1IN8A 1TEXA 2A5DA 1T3HA 2AL7A 4G5OA 1XZPA 2AK3A 1ZU5A 3EWAA 2A2ZA 4Q4HB 5KDDA 1NN5A 2PCLA 1UBCA 3PCRB 3L0PA 5KYKA 3W8NA 2QEQA 1NIPA 3ZLJA 1E2PA 2FZLA 2ZSBA 4MGKR 4OYHA 2WTUA 1F3OA 3SV8A 2CJWB 1E0AA 1E9FA 2YOFA 3NHAA 3KB1A 3QI2A 2AWNA 4ZIRB 3IO5A 5FOXA 4BGDA 2QN6A 3KUDA 2EWWA 4FCTA 4A0HA 2R2AA 2UVQA 4D4LA 3NG1A 3KJHA 1PV4A 1CP2A 1TMKA 1ZJ6A 2AWOA 1WQ1R 3GJ6A 3IBGA 3GLIE 4KITB 1EFCA 1HT2E 1SULA 2XXAA 1GDDA 3ADBA 2VF8A 1YE8A 5EP1A 4ITRC 3R9IA 2YC4C 1NVWQ 1OFUX 3NIBA 4GFDA 4MYUA 3IPXA 3MG9A 3KQUA 4NP6A 2QRZA 1NMXA 3AF4A 3PITA 3W6PA 3WNBA 2JIZA 4AC9A 1KK2A 5GNDA 2ODEA 5G40A 2GZDA 3LV8A 2CXXA 3I61A 3SU1A 4DLZA 2QQ0A 2SHKA 3RHFA 3SUDA 4RFSB 1NVUQ 2D4HA 1RJ9B 4C0JA 2PLFA 1GRQA 4KJZA 3FWYA 1UAAA 4NKRA 4HLDA 4B71A 1BS1A 1RW4A 1Z83A 3SV9A 1SKQA 2PZEA 3WYFA 4UNRA 1COWD
chains in the Genus database with same CATH superfamily
2HWXA 1B74A 4UHHA 1SGQE 4CL8A 1SOTA 2WWVD 2IS1A 4ZOLA 3NUQA 4H27A 1XT6A 2C5HA 3Q3XA 4K0RA 1UMAH 1DZIA 4HNHA 3V2UA 1JIMA 1Q1NA 4YYZA 4O2BF 3FVTA 2JZNA 1DRVA 2C00A 3IUNA 2R6AA 3FVWA 4C0BA 4F3CA 4RGYA 4NABA 4L7VA 2BLWA 1K2WA 3FCYA 2J4DA 1C5KA 3PQCA 2G8TA 4EX6A 5AM4A 1HLPA 2XE7A 5AT1A 3PDJA 5H16A 3M5OA 1QYRA 2WD9A 1O2SA 2G07A 4LMRA 3ABOB 4H6VA 1WUTA 1XNRB 1P77A 2Q4OA 3QEBZ 4S1VA 4Q7LA 4IEFB 1C81A 1CGIE 2V5UA 1GYQA 3BK2A 2FFQA 2I78A 1QO7A 4G5SA 1IRIA 1H8ED 4LJSA 3WFJA 1BIFA 4EY6A 2FJPA 1T6NA 4M0MA 4LBYA 1NUHA 3STIA 4KV7A 5JYDA 2OG2A 5IC4A 4PFQA 4BLOA 1ONBA 2J0QA 1GTMA 1QO9A 1P80A 2J2UA 3MU1A 1N6IA 2J32A 3JYPA 4WNIA 5EJ2A 1GCTB 4B8ZA 2DPGA 4DBVO 7ESTE 2IYTA 3EJWA 1MC5A 3ZZAA 1O97D 1R18A 1SC9A 1CG6A 1PGPA 1W73A 2IZ5A 2MOKA 4H7DA 4HWKA 4KVFA 1W5FA 1TX6A 4F4CA 1H23A 1U0HC 1B3RA 2P1ZA 1ZPZA 4MLFB 1PFVA 2W7SA 1Z6YA 2QTNA 2W2KA 3EYWA 5ADHA 3P9SA 1WW3A 3GEPA 3D2AA 3WXMA 3EF0A 2BOHB 1GBIA 2AYXA 1H4VB 1P60A 2QA9E 1V11B 2HA5A 2R66A 4LQ4A 4DCTA 5CP8A 1GEEA 2OFXA 3AEZA 1DBSA 1QTRA 4GKJB 2NU0E 5IM4A 1GI3A 2WP8J 5IJ9A 4J91A 1VFNA 4M36A 2FPIA 1YR3A 3OJWA 2PX4A 1IIRA 2COKA 5ALSA 3L6PA 4B32A 4NG9H 2FOFA 5KWSA 1OFHA 1OQAA 1O95C 4M38A 1KMNA 3SNCA 3MCTA 4JBWA 1OFUA 3IQHX 3NU1A 3FI9A 4OCZA 4E5NA 4LGCA 1J0CA 1YZTA 4RVDA 3SZRA 3S29A 4YP0A 1CE8A 2Q5LA 4TWZA 5COBA 1JEYA 2ZUSA 1NFYA 1DUIA 1PYGA 4KO2S 2NVUA 4M0UA 2BFOA 1DXYA 3NEJA 4JBLA 1NL3A 5JV5A 2PR3A 1L2TA 2VWOA 1FPCH 1AGPA 2NQ2C 3WKCA 1XDGA 1CUJA 2J5RA 3HKBB 3HU1A 2I62A 4JLBA 2FOLA 4K40A 1NMSA 2QHXA 3ENVA 1J70A 1VG9B 2B20A 3HACA 5EGSA 5CB4F 1SQ6A 2FSHA 4FJ0A 3GCOA 3L1HA 5HFNA 1CRPA 2QF0A 1S3SA 3RXIA 2AS0A 2J9XB 3TIFA 4IDBA 1GBCA 1NRXA 2ZAYA 4IOLA 2NVOA 4C7JA 1TNKA 1MB3A 3SNKA 2OXTA 3OSUA 3U6KA 4DIBA 4QUBA 1GHWH 3HJHA 3N0VA 3WY8A 3CT6A 3P0EA 1QH0A 3KP1A 3NVKI 1K8YB 4OL0A 2IY7A 4JS0A 3NRJA 4ZKRU 4U7HA 5E6SA 3B9PA 1O31A 4WN3A 5C1YA 1B8VA 4LOLA 1PYDA 4TMZA 3HCRA 1O87A 3A6GA 1NQVA 2BZGA 2ST1A 3DOJA 4FXOA 4XIFA 4DZRA 1C2FA 1XD2B 1Y89A 3IT1A 4E15A 3U62A 5ITSA 2IYWA 4CRDA 3ETDA 1V45E 1W4LA 2DCMA 4GI2A 4J43A 1F5NA 2O5VA 2CJYA 2JLBA 3GVPA 4QASA 4AN4A 1KAHA 4RK1A 2IOFA 2NU9A 2PT6A 1IJKA 2R00A 3AP2A 5LUAA 1JFTA 1AXRA 1A7KA 5AK5A 2HDWA 2OFOA 2O8EB 3SU5A 3HB9A 1AKVA 1VCPA 1CJCA 2HDHA 5THXA 5LYJF 2H1WA 3DQZA 2OBFA 1E2QA 1NKVA 2YHBA 1T8UA 5I6DA 3OPXA 1O08A 5BNWA 1P2NA 4EKIA 5ISMA 4X1OA 1C0KA 1CCWA 1PIWA 3BIWA 1ISHA 4OOFA 3TSOA 2GA9A 5D3MA 1HNWB 2WM8A 4A5TS 3O83A 1WULS 3U1BA 3EBPA 1K2VN 4UOQA 1KZYC 1S2LA 1QYWA 3B6IA 4QDTA 3EFHA 1QL9A 4M9ZA 2RA3A 1Q2XA 3BEOA 3FUTA 4BVLA 1MZAA 1TVCA 3J80A 4OQMA 5E1BA 4XD7A 4TZ6A 1VITH 1C4V2 1LU9A 1DCFA 4U2GA 5FOWA 1KMHB 1WOMA 1JIRA 3AF5A 4QC2A 2QD5A 3NM5A 1KY2A 3DT9A 1T91A 1G3EA 2NO1A 3I73A 4WQMA 1CRQA 1FIZA 4I66A 1KPIA 4F9TA 4DY4A 5KVAA 4PROA 2OUIA 4TMKA 4XR4A 3CZMA 3ETNA 2ZDHA 5DJ7A 1PK9A 4TWIA 2P3QA 1RLJA 1UDAA 1TA2A 1SQAA 1OT5A 3IRVA 1GRNA 4W5HA 1M74A 4FKBA 4RVUA 3L4JA 2E85A 4R5MA 1XZDA 4B3TB 1QCCA 1GZDA 2WD8A 2FEKA 4DVGA 2AS9A 2P8OB 3B9FH 3P2EA 4M1TA 4RK6A 1ZK0A 3T0IA 2E4AA 2ZW9A 2OV2A 4KN8A 3B7GA 3OPYA 4P83A 3F8TA 4QELA 3OMLA 4K6OA 2JLSA 3QX3A 4Q9DA 1NHWA 3GFQA 3PXEA 4AZ0B 4L6IA 4MS1B 1Z07A 1Z3IX 2I99A 3ILHA 1EB9A 2W8BA 1X8LA 3AFHA 3BH0A 3LPMA 1ZOLA 2CXNA 3ORSA 4NEQA 4RPGA 1O2LA 2I6FA 2ZRCA 4X1IB 2PUBA 2AIPA 5ECWA 1ZH2A 2BMDA 3T7SA 1VLZA 1RIIA 4KODA 4EUNA 3WWFA 1LJUA 2SECE 1GQSA 1NTPA 1SEVA 1HB0B 2RHHA 1WV1A 5E9WA 1QA7A 5A8ZA 2IOTA 1A4UA 3HNRA 3SQDA 2A5AA 1AZSC 3EXFB 2ORVA 4HAIA 2X8JA 3NYQA 5JWOA 3JQGB 5B3JC 4PPNA 3UMYA 4JGBA 3RVQA 1VMAA 4KV9A 3SWWA 1RHJA 1CUDA 3RVDA 3S0NA 1JQJC 2PBFA 3LBNA 3OIFA 2VWLA 4NIWA 1Q3HA 2E6KA 3W5SA 4MS1A 1K9OE 5JTTA 1V2WT 1WSDA 3B1XA 4M6WB 1VITF 2ZHFH 1ONSA 4UXIA 5A4IS 2F9FA 4WGFA 1JKJA 4XX0B 4HS9A 3C4JA 4PW0A 1RC0A 2IYXA 1PGQA 4AX4A 4H77A 4CR7A 3I4FA 3QV1A 3WXBA 4TY7A 1NATA 1G3IA 1GPDG 2PMBA 1B42A 3ZDRA 3ZIAD 2ZYVX 3I64A 2VPWA 5HZMA 1O36A 2ASUB 1P4HA 4P08A 4R2XA 4BEBA 1G9SA 5AM5A 1UK7A 2JNWA 4ZI5A 1G37A 1TGNA 4R40A 5JASA 3OEYA 1Q7CA 3NH9A 4IC6A 1ZOSA 3OT5A 4PCAA 1KJWA 1H2RS 2J6IA 1C1YA 3LVFO 4YJHA 2WJVA 2IHVA 5LUBA 4V03A 5T8KA 1ABBA 3GNQA 4LV5B 4X6OA 2J6BA 2OHVA 2GZ8A 1I5EA 4JZFH 4E21A 1UTNA 2F67A 1H3NA 3LSYA 3PNBA 3RT1A 5EW2H 4PNPA 1KHHA 1CE5A 3Q2KA 1B16A 4LA4A 4LRQA 2Q6GA 2GUWA 4HWRA 4X65B 2PGBB 1E5DA 2QA5A 2IWHA 1N2CB 3OD5A 4OMFG 1L7EA 2I4NA 2GJ9A 4ABBA 2PTHA 2ZJBA 1XNHA 3DE0X 3KEMA 3QWFA 4BFSA 2CKMA 4EELA 3ESRA 1C5XB 3HKEA 2X7JA 1LTKA 2I2XB 4GMHA 1R5JA 3CE6A 4TS1A 5EC8A 5BP7A 5LPRA 1EAMA 1QC5A 1QJ4A 3FP6E 4L16A 2GM3A 5AVQA 5HIYA 1FUJA 2G0TA 2Q2VA 3IERA 3T38A 3RSLA 1SN7A 5A6SA 5KMGB 1Z6XA 3FUCA 1TMOA 3RV4A 2KE5A 1RYNA 2BMEA 1P2KA 5AKZA 4ZALA 5F2KA 1D8TA 2FPXA 2X15A 3V3TA 4JAVC 1CV2A 2WG1A 1ML3A 5AW5A 1SKMA 1LTQA 4FDUA 4BVJA 4EFNA 2PWZA 4G5GA 1F9AA 2Q6OA 1FTQA 5EPEA 3TINA 3L02A 1W2GA 3NHLA 5D3QA 2J38A 4RKQA 4DSUA 1BG6A 2LTAA 4IX9A 4LFBB 1KAOA 1NF2A 4IUYA 3PWZA 5JXJA 1U99A 3GLHB 3QE3A 5F9MA 3UXMA 1ELTA 1E3WB 2E87A 1UK4A 2GEUA 3H42B 3K9BA 2H2WA 3N58A 4URVR 1PSDA 2PKSB 4JJGA 4E5KA 4BLRA 3HEBA 3HPTB 3UNXA 1M2KA 4M7WA 1JDBB 4FYVA 5JJCA 5E4YA 3H5RA 3QHPA 1Z29A 3QXCA 5DNCA 1TMYA 3GCTF 4P54A 4PGMA 4WRRA 2Z30A 5L3QA 1SFRA 3LXUX 4D0RA 4QJBA 4OHUA 5IJWA 5TT1A 1AFEH 1FYEA 1G5FA 2I3AA 3PLRA 4OP3A 2JG3A 1E7RA 3GLFB 1IPFA 3AHHA 3URCA 3D0QA 5EQJB 4QUAA 3TNDA 1E8DA 3SHOA 2IITA 5AI4A 3TKLA 2ZVQX 1SXPA 3GRUA 3VR5D 2CK3A 4BWVA 2NUPB 3P70B 2R4TA 4FZ5A 5IYTA 4G81A 4UHDA 3T1HB 4MQBA 4MHTA 1FMTA 3DDUA 3PHLA 4TQ9A 1NPTO 4TQAA 5BMVA 1RI3A 4AJ9A 1UADA 4RUKA 3DAOA 4XYGA 1ZQ9A 3OLYA 3R44A 4OVKA 1QGYA 2C82A 2HPAA 4BVGA 5ENDA 3WOHA 3VPKA 1TPZA 1O2PA 3RUDA 3GNSA 4Y2TA 2DQ4A 2ZUEA 1GHAF 1O97C 3GAAA 1DIOB 2FV8A 3ZC3A 5FDFA 1IN1A 2ZIVB 4D8NA 3GFSA 4GOKA 4AJ2A 3DPSA 3JZDA 2CVQA 1XJ0A 3SC4A 2HBZA 3DW1X 2Q6TA 4QUJA 4EHAA 1ZJ5A 1X0VA 4FGLA 5CVVA 3BEFB 3UQZA 4IMQA 2YR0A 4W9RA 2XMQA 3M5PA 1MB9A 4WKBA 2L19A 3V8PA 1XRQA 4Q4CA 4WZAA 2HSJA 1OTYA 1Z26A 4D42A 3SS9X 1ZR4A 1I51A 3Q9NA 2EAUA 4XDGA 1FSFA 1D6MA 2C96A 3BORA 2W26A 5E6UA 3RYIA 1X1AA 2AN5A 2TGTA 5D6OA 4E4RA 2QXJA 4Q3NA 3DONA 4ZC1A 1CYEA 4XUGB 4K6HA 4JX9A 3HCBA 4D8VA 2RGAA 1NPYA 4DA4A 4YQZA 3W8EA 1CRWG 1Y8AA 2QT1A 4MK4A 2X5OA 4OXXA 1TQDA 4BQSA 5DNUA 1BW9A 3TNFA 2FHPA 2V6JA 1CHNA 1Y9EA 2DCUA 1QBGA 4BGEA 4EI7A 3P9KA 1GHXH 1G6Q1 4AFSA 2YXNA 4PC2A 1YS9A 2BSQA 4TYWA 4WK6A 3UJCA 2JRCA 1DLEA 1NVKA 1N9KA 4RIIA 3T9EA 4CCYB 2ODPA 5FHTA 1MJGA 4FU8A 3K2EA 2ZSHA 3K8QA 3L41A 2WWRA 4FKZA 1CSEE 3HRKA 4OEHA 3VVCA 4ZZIA 4OM7A 1D4ZA 3VEQB 1TUGA 4F97A 2EGUA 2WM9B 1ZMBA 2B5VA 3H04A 4DLWA 1YR2A 1EYZA 1DTWA 2WJAA 3IA2A 1X7DA 3FTEA 2CEAA 3VZBA 3DV9A 1OFIA 4FCWA 6ESTA 1WEKA 3I9KA 4NDAA 3LWZA 3LS2A 1ZCFA 5HK8A 4ETNA 5A62A 2KM1A 3UFXA 4CF3A 4E11A 5B55A 5A9SA 5JD4A 3TD9A 1DOAA 4BNGA 2VSXA 4ERXA 2E4YA 3Q5EA 2GEVA 3ENNA 2JH9A 5CJJA 5K0LA 4E05H 3ZZ8A 1L7RA 1AVTA 1FQKA 1ZN7A 1EJNA 1XXHA 1O2RA 2RGYA 3UC5A 1Y3CE 1HT1E 4LVOA 4PXYA 4MJ7A 1JB9A 2JFNA 4TYDA 4BNKA 1WSWA 2WTXA 3H3XA 4BVKA 1F5RA 1VPVA 2FI5E 1R0KA 4OQXA 3IV7A 4PSUA 4KQ6A 4GVLA 1B2LA 5INTA 3R7WA 4PV7A 1JG1A 4MQ6A 2PD6A 2WVGA 1FZZA 1W5AA 3WLSA 4RHFA 4EJSC 4WBNA 3I8SA 5MFPA 1KZ6A 1J8DA 1AVXA 4F84A 3HUTA 3MTAA 5HKAA 4N5IX 3HK2A 2YV4A 1JQKA 2RHDA 3O7MA 3JQ9A 1KQFA 4J0GA 1O03A 1Z1JA 2XAUA 3BFXA 3MGCA 4ISNA 1R66A 5B6LA 2C3MA 3QBVA 2Z5GA 5EXXA 5I51A 3GLHA 1U7HA 3DL7A 3SKVA 4JBXA 3WLRA 3ZQ4A 2XLBA 2UUOA 5LP6C 2W2LA 2QVZX 3S8MA 2XQFA 3WQRA 3KETA 5HBGA 3SBDA 3VTKA 4GPIB 3F2FA 1B6SA 5DE3A 2Y0BA 4QAJA 5ALPA 3W1VA 1E18A 4ABAA 5AJXA 1DIGA 5A0BA 2FSVC 4AY5A 3HGQA 4TXMA 2C8VA 3QX5H 1C1DA 1SUBA 4KXFB 4F7WA 3L84A 4BN4A 3VNUA 3HU3A 1JZQA 4OB8A 3RU4E 2GZMA 4KE8A 5AHKA 2AOTA 3LT3A 1YL5A 4A5SA 4JYMA 5T6MA 3SIXA 4EHFA 4S12A 1QGZA 1K7SN 2I4MA 3HJGA 5FOTA 3PPXA 1OLOA 5IJZA 1GZHB 3F68H 3SJOA 1NASA 5B12A 1JEQA 3WZ2A 2J6CA 1NYLA 1H2EA 5IT5A 3KAKA 3S8YA 2WB2A 4Z2YA 2DF8A 1AHHA 1RWOA 4LI0A 1EINA 3RMLH 1BHXB 1WQVH 4ZH8A 1HYHA 2BR3A 1DCKA 3PC7A 2ZSUA 3LHIA 3D7SA 3D8BA 3ND9A 2ZCKP 3ZH2A 3GY5A 4KH1A 3IAEA 3ONDA 3U5ZB 3AEUA 1N8OC 4IIFA 4P86A 2WE8A 3T7RA 1IEQA 2CYCA 4FSXA 3IMFA 3DKVA 3ZN2A 1JXPA 1DQYA 1WZUA 4B3SB 2AR9A 4R0VA 1KJJA 3WYBA 2HT6A 2X23A 2GWHA 5GM2A 3B3GA 3BWMA 3HB5X 3GPDG 1QHHA 4I1SA 1FAXA 2J7KA 1R8QA 2YJZA 2O2IA 4P0PB 4YS6A 1EBUA 1W4BA 1V25A 4NBUA 3IDFA 3BIJA 3EODA 2PGOA 3CY6A 5BVHB 5ICGA 3BILA 3FTFA 1SVIA 5EXPA 1JEJA 2BY5X 4QTYA 1ZHRA 4MR7A 3ZWCA 3VJMA 4BMZA 4HGQA 1N78A 3EZYA 2BMGB 4IGKA 1GQYA 3IUQA 4ECEA 1MAHA 1GTVA 1K97A 1S4QA 1GL1A 1SBYA 3N8HA 3QEOA 4MRSA 5MF6A 3ZOZA 4K46A 1C9MA 1LY1A 5AUQA 5GONB 3VHXB 1Q0RA 5DIFA 1W96A 1BITA 4JELA 3KSBC 1CSOE 1GCAA 1DUEA 3RP2A 2BWJA 2WIDA 1ZD8A 4Y2SA 4P31A 3A6FA 1J17T 3ISJA 2QR5A 1TWXB 4G01B 2XUJA 1NLMA 2XCUA 4MRNA 4PLYA 2Y3IA 1AB9C 4NL4H 5GCHF 2AMVA 2VVTA 4I1PA 4MB2A 5JCOC 3KNXA 5KS2A 1I4LD 4P3OA 4II7A 4ZI7F 5JDCA 4X92A 1E5VA 5ANRB 2DY1A 1KIAA 2VLIA 4KB5A 5K0TA 2X0JA 3OOYA 2W83A 2X8BA 3ZDYB 4Z4FA 1M6VB 3A7ZA 2MIIA 3L7OA 4UHEA 5BSRA 1OXGA 1HH4A 4N4AA 2B3DA 3QUBA 3CZPA 4BZQA 2IRWA 1OP8A 1QZ8A 1Z08A 1A7AA 2X9LA 1JOUB 4AORA 1Z2PX 3KBOA 3O1IC 1Y63A 3DOHA 1P09A 2FSIA 5C8YF 5I7EA 2W6JA 2Z2KA 1MA0A 1Y4ZA 1P05A 5LLSA 2A5GA 5ICEA 1TI7A 1DIRA 3UWJH 4KIJA 2GPSA 5P21A 2QXYA 3ZV9A 4U2DA 4K1TA 2QRUA 4LHEA 5B30A 2J5QA 3KQYA 1EP3B 2VHWA 2CGAA 5AVKA 2DPLA 4KAAA 5AF9H 1ZJJA 1YJXA 1ZN9A 3A9SA 3OWHA 3PKJA 5T4HA 3RRJA 2BAGA 1W11U 3S2EA 2FTKE 3NC1C 1O54A 1X6VA 3BGOS 1L4ZA 3A87A 1OXKB 3PHHA 4OXKA 4B1TA 5H3HA 1O2MA 2QBYA 2SFAA 4BQOA 2WZQA 1HLDA 2ROQA 4B6RA 3K6SA 3BSFA 2QTHA 1AQJA 3I9NA 3EH2A 3FNGA 1UO6A 3TL2A 3AASA 4KE6A 5DEOA 2NO9A 4EZIA 4GOOD 5K0HA 1MG0A 5LL6P 4FWTA 2A7CA 1AZTA 1XKXA 4GMKA 3WWEA 1MVNA 4KXLA 2ZVDA 3FRJA 1NT2A 4WEQA 3ABQB 3LCCA 4LVCA 3UNQA 4PX5A 4AJIA 2YMLA 5CIQA 2TSYB 3BXEA 1G2OA 4NEGA 4EF5A 3FBWA 3Q8KA 3DFLA 1KWKA 2VPPA 1E6EA 3IBTA 4NYJR 2HWUA 3IVAA 3SQOA 2BZ0A 1ZD2P 1N92A 3DYVA 1N2IA 1ENYA 2QXIA 3GWZA 4NG5A 4WX2B 5IRCD 2YIJA 4DA7A 2OCKA 4H3SA 4NYMQ 5LLTA 4UUMA 1KXDA 1XZHA 5SZIA 2OXCA 4LEIA 4RF2A 2QRPA 4J3JA 3K0CC 1V2KT 4QEZA 2A67A 2GSWA 4C2TA 4R4JA 4CBNA 4GNKA 2GNOA 2F1HA 1LW7A 4V2IA 1Z7GA 1QYIA 1RPAA 3HDTA 4JIMA 4X6NA 2J3KA 2P9ZA 4PPYA 5GIPE 2O8BB 4D6XA 2NTNA 3IODA 2ZDKA 3ZWYA 1ILWA 1RE0A 5LPFA 2FXIA 4G1UC 3K70C 4EFLA 3OSYA 1XA0A 1NZQH 1G2PA 1TOAA 1Z2DA 2QX4A 3HBNA 4H3KB 4U6NA 5CH5A 3SC2B 1OYOA 1TRKA 1XMXA 1M10A 4HAVA 4EHLA 4WUTA 1D0IA 2AN9A 3W2IA 3OFJA 3RWBA 1VZ2A 2RCYA 3RXAA 2ARKA 3KVRA 2BFBB 3M2PA 4D3ZA 1CUXA 1PS0A 4TWJA 5F7JA 3EC1A 1XKBC 1Y8RA 1H8IH 2V3OH 5ALFA 2O8CB 1Y6JA 2HMSA 5EPUA 5LOVF 4WAUA 1FP2A 3U8RH 1PLJA 1TAQA 3PS9A 4O3UA 1Y0BA 5CB6A 2J0EA 4NWKA 2BYTA 3DD1A 2IVFA 3HB1A 4D8YA 2ID4A 3PGA1 1U2PA 3HKEB 3FSEA 1DFIA 3V8MA 1E2HA 2B69A 4PZUA 4FI3C 3SX4A 2WIFA 4MKFA 5GTDA 4AFUA 3THWB 4AECA 3WGOA 4ND7A 2YHAA 2BBWA 2AFVA 2FVXA 1CBUA 2MYNA 1L1QA 2O2GA 3FX2A 4MI1A 3OCJA 2EG5A 3L4SO 2OZLB 2O3JA 5TGDA 1D3AA 1QNJA 2XEXA 1CF9A 2IHZA 3V3KA 5M29A 1VBFA 4FYKA 4J2HA 3VISA 5AW4A 4DPLA 3FB1A 3HGNA 3DV0B 2FCAA 3KSMA 2VRNA 3GGOA 1EFRD 5DP8A 1MDFA 3GLVA 2AQHA 4IRUB 2E4ZA 4QTTB 4TKLA 4DR1B 2GN6A 3PGKA 4KPEC 3AY0A 2IP4A 1GITA 4PLHA 1PVVA 4MCJA 3A0RB 1U9YA 3HCDA 4R6WA 4ZKEA 2NSJA 4K6KA 3ZNPA 4PPFA 5F23A 1MCVA 3L49A 4HGYA 5ITZB 3MS4A 3NOOA 4Q4HA 4QA9A 1L7VC 4Q47A 5DASA 3TR0A 3KEQA 3LY9A 3ZXUB 2YY6A 5JOQA 1E9DA 1E1YA 3CGGA 3U40A 3OFVA 4CF5A 4NBTA 2V3CC 3NNNA 1IOEA 3A89A 2IIQA 4SGBE 3CRRA 1C4WA 3ITKA 3EIOA 3UOWA 4BLTA 3I5YA 1EDEA 4WVFA 4I31A 2WUWE 1E1QA 1T9HA 3DEZA 3N7UA 5ESRA 2AW3A 2FW7A 5C5OA 2WUDA 4F3NA 6CHYA 4R8MA 2QM0A 5F8ZA 5EKXA 2DT8A 3CH4B 3HKBA 1QOZA 3FUUA 4J9UE 4PHTA 2X9VA 4HDRA 4WV3A 2IX9A 3A3OA 3H86A 2NZJA 4P4TA 4LV6A 4EMSA 3WNVA 4AYYB 1JG4A 3ZWQA 2WFAA 5C8DA 3BEUA 2VVVA 1GDTA 1A2CH 4NFEA 1U80A 4IDFA 3R6GA 1J8VA 3FWKA 2PWAA 2B36A 2ZIXA 3OIDA 1NYQA 5D5QA 4BNMA 3ROFA 1UFOA 1SHTX 4V1CA 2Q99A 2VF4X 4AN7A 4BN5A 5ABPA 3EPLA 4RA9A 4AZTA 1QNLA 4QOFA 4OIMA 4W82A 2CJXA 5BNFA 4NVRA 1EESA 1WAYB 4NGAH 1L2EA 1X15A 1WTCA 2FGKA 3E7WA 2A4QA 3WK7A 1BD4A 4F7DA 1E77A 5FR1A 3VYWA 4C87A 2FZEA 2VHCA 1MHPA 1G16A 4EABA 3I1IA 2H0RA 3ROQA 1JBQA 2C57A 3N2IA 1H8HA 1LNZA 3FYUA 3IKLA 2C2HA 3WP1B 4BEWA 5B7GA 1ZC4A 2H5IA 2ZXFA 2REOA 2Z98A 3M83A 4QT4A 4YCCA 1TLLA 5E4JA 4EUFA 4B6PA 3G2OA 4WXEA 2R5WA 4W9NC 2V4ZA 3ADPA 4KHZA 4K8BA 1G8KA 1QJ1B 4TTRA 2F9VA 5E7QA 2A4MA 1PBNA 3UB4A 3F8SA 2W58A 1KO4A 2ODNA 3L1VA 1AE1A 3OTQA 2IU4A 5DMHA 4JZEH 1NZDA 3L6DA 4YTEA 2QRGA 3JYNA 2B2CA 2QP9X 3TZQA 2A0KA 4NESA 1E1QD 2GAJA 3P96A 4M21A 4PLGA 4IS2A 4EAAA 4MV5A 1R15A 1NOIA 1REQB 4TWYA 2RFKC 1P9NA 2QAJA 1AQ7A 3IJPA 5EERA 3WLKX 4AB1A 1KARA 3SYLA 4ZP1A 5LPNA 3QVKA 4UOEA 3NHKA 5K3EA 1ZSKA 1YR8A 4G5YA 3MNCA 2EY4C 3TCNA 3U4AA 3QXJA 3Q9SA 1PL0A 1I6LA 1WDKA 3LRTA 4TZKA 2Z3EA 1YPHE 4AY6A 3W6NA 3ZWAA 1QG2A 3CRZA 1OGIA 2VBGA 1X87A 4OKSA 3GYMA 1QFMA 3FROA 3QVMA 4HLNA 4KI0A 3TZLA 3O26A 1WABA 4DV4B 1UVPA 2HSEA 5FCDA 3EXIA 5IAEA 2PEZA 5EZSA 3VU1A 4E2WA 1SVPA 3DCLA 4U1RA 2O8FA 2A4RA 3GOVB 1L7PA 1XQVA 2FN3A 4IKOA 4RCZA 4XGKA 4EB6B 4KMRA 1G6OA 1N25A 3H11B 4FR5A 3TKAA 3IXQA 1AM4D 2VPTA 2ZROA 3K5IA 5ADVA 1OWEA 1ZR2A 5EPNA 3RUOA 4BZPA 2D8WA 2NZVG 4DXAA 4RTKA 5I4BA 2J97A 1QIIA 5F53A 2CFTA 4CLXA 2UKDA 3VZPA 3GD7A 4AUMA 2NTVA 1KK1A 3SW2B 2OC8A 4YJHB 4ZANA 1YMUA 2C8WB 3VKFA 1T15A 2OCDA 5JCZA 1T2AA 1TYNA 5A7HA 2QXGA 3TZHA 1MTSA 1JI0A 1OXBB 1UMKA 2D0OB 2OZVA 3G2QA 4J9VA 4MP6A 1DWBH 2ZZKA 2AMPA 3NKLA 4DRYA 4BCBA 3RXQA 2Q7DA 1IBLB 4ZVVA 3AETB 3T5MA 2AERH 3E0PB 3VU9A 1PZMA 1L1RA 2FPPA 1G7SA 2OENG 4JSYA 4R3NA 3M4XA 5M04A 2ZKIA 2AOWA 2PT5A 3BV9B 4MPWA 4QYWA 5KYWB 2WTMA 4PY2A 3R7SA 4D9IA 1WSBA 5HXAA 3SHWA 4EG4A 1MIHA 4LMPA 3TRDA 3F5MA 4D4HA 3N70A 4FK8A 5DPAA 2DKOA 2QVLA 3IBFA 4NMMA 4PPQA 3RFXA 1UM9B 4MKZA 4YAGA 1YH3A 2WB4A 1FUEA 2EGGA 4GOJA 4YAEA 4FJ1A 1BH6A 3SZLA 2P75A 2I2WA 1D3TB 3CPEA 2QTRA 1ESBA 2ODWA 2W2KB 2FSPA 3A28A 2JGAA 5AKLA 3A3YA 4EG8A 1M5TA 1HAVB 1N0VC 2WWXA 5A3QA 4RYDA 1VJRA 2TGDA 1X9IA 1QOQB 2BY4A 4DY7B 4CV1A 5LPEA 3SU4A 1CQZA 4F56A 3PGMA 3U1VA 2CF8H 3EMKA 4QU0A 1WLYA 3ZW8A 3I29A 3L33A 3FWPA 3WTBA 3VU9B 3AESB 1BT7A 1UTLM 3V00A 3W7BA 2XXBA 2JIDA 1DBRA 2AV6A 5JPIA 5PGMA 4GBGA 1I5OA 4BAHB 4HXEB 4MVYA 4R9NA 4XFJA 3RC9A 4EYEA 3O3CA 1F1JA 3LZ6A 1UDXA 3FZQA 4F4DA 1RBZA 3ZHUA 4DUGD 1GZ4A 4F86A 4YUAA 2C88A 1XMVA 4TMTA 1ZCAA 5SZJA 5ILOA 5CTAA 1UVUH 2X1VA 3L8HA 4B81A 1OYYA 1JAYA 4HQFA 3TGWA 3QYFA 4NTZA 4GRDA 3M82A 4XVRA 5K2MA 3IUJA 5U4XA 1INLA 3HCPA 3I3OA 2XPCA 4HDAA 5HF6A 5K0NA 4Q4LA 1BRUP 1BN6A 2AZTA 2WYVA 4FI3F 3FIJA 2JIQA 4IW3B 4XARA 5IT9A 3AGQA 1F60A 3AJEA 5E3JA 2BEUB 3L8ZA 3UTCA 5HQJA 2ORED 1G38A 2XDAA 3ER6A 3SPXA 3LGYA 1KXAA 2EATA 4CR9A 3C43A 4BS9A 5IS2A 3IEVA 4YDQA 3ZD6A 1PPFE 2CVPA 1OU4A 4N12A 2VCHA 1QS0B 1P0PA 4MR7B 3MQ4A 1HFDA 2IXTA 4ZROA 4BQQA 5DHPA 5HUHA 4Y6RA 2PKQP 5IC5A 1MT0A 2YZGA 2UUPA 3HSYA 1DFHA 3P2KA 4KXQA 4PLFA 3AI7A 1W34A 4BNTA 1PFYA 1BAPA 1HDZA 3M6UA 1QFZA 3SUGA 5ETXA 4A1VA 1NULA 1US8A 3EW9A 3EPHA 4I8JA 3OQPA 1FBNA 3GMTA 1SH7A 2IE8A 5DN9A 3SU6A 3AI3A 1YK1A 1DC4A 4PLVA 5ALMA 3D3JA 4CH8B 4BUZA 1N3LA 2HI0A 2ZAGA 2F59A 1O0BA 1HQKA 4GI3A 5CB4B 1MB2A 2YWXA 5B1IA 2GDZA 3SJCA 2RHMA 1USVA 4LISA 3ANXA 2NSYA 4JJ4A 4IMJB 3SV2H 4PG6A 4Q7MB 3WNCA 5BN4B 4A26A 3X43A 4BUCA 4CDNA 5CB8A 5F78A 1EI9A 2NXWA 3L7JA 5BW5A 5TS2A 3UJ8A 3BPSA 1GI6A 2EW2A 2NZWA 3UAVA 1PQWA 2VZ9A 3NLLA 3A4MA 4URYR 4MWOA 3LW7A 5DGIA 4UC0A 3LC0A 2AE2A 3AF3A 4MRAA 5TXGA 3ZHSA 5GIBA 4Y9SA 4NCAA 1NRSH 1OZFA 3INYA 1SUCA 4ISHH 1NVGA 1VSTA 3KT8A 3KUUA 3OLVA 3GPCA 5D00A 4D45A 3HA2A 5ALGA 1VE1A 1K4KA 2V6BA 3BIXA 4MPJA 3WISA 1W8DA 2A1IA 3L82B 1HV7A 4UKDA 3T6KA 3TO5A 4DV6B 4FSDA 2BDTA 2GCOB 2HLDA 1J0XO 3RRBA 2OK7A 2C0QA 1WZIA 3DTVA 3KSAC 3EMBA 1U8TA 2FY8A 2LPMA 2D2EA 3I3SR 3QENA 3ZS9A 4EHIA 2GTIA 3TRHA 1BXZA 4UM5A 4ERNA 1ZH8A 1E7QA 3V4VB 4UCWA 3FZYA 2FI4E 3RYCA 3LU9B 3TGJE 1NTRA 4V2UA 4I33A 2R3UA 3V0XA 1IQ0A 5CYOA 3E03A 3PNMA 3HYNA 1IHDA 4QEKA 4AZSA 3I9LA 3QXXA 1I01A 1CQIA 3T9DA 4DQVA 4MPPA 2XKBA 3RLFA 5C2ZA 3LYLA 3PUHA 5G2OA 4NRDA 4UUOA 2HV9A 2O8WA 4ASUD 5HG0A 2FWPA 1JKJB 2IU6A 1MENA 1PPGE 3ZZDA 1O7JA 4TRJA 4UHBA 4YLYA 2RA0A 5AJYA 5KOHB 1WY5A 1G291 2OBLA 3UJDA 3A25A 1X38A 3IC5A 4ZOLB 2WUVA 1DLKB 2A2QH 2VHXA 1K5GA 2O05A 3PDWA 4FU0A 4TVBA 1KK0A 1NIJA 3UKOA 5JH7B 1TEZA 4ZQFA 3THOA 1MU6B 2CFRA 2W2MA 2VXYA 1JDJA 4HLQB 4WFKA 4DNOA 2EERA 2BDUA 2PGLA 1EBBA 4MB6A 4OUKX 2OP9A 2O57A 5AQ1A 1Q6ZA 1VPTA 4ONEA 2QPAA 3ZVBA 2C5LA 3BFKA 3A9WA 4DLUA 1YBHA 3S2UA 2OQUA 4QFMA 5KU7A 2AG0A 3BFVA 5DULA 4YXFA 2J07A 1S7GA 4ROTA 5HS6A 4DEVA 2F17A 1SGDE 3TH3H 5CYPA 1ZK2A 1J1IA 3MUNA 3PPYA 4AY4A 1SIOA 1MTVA 2C0CA 3T3IA 2F8MA 2GKSA 1MPXA 5CVCA 2H7VA 3ADCA 3GYBA 2XBVA 3GDVA 1KBZA 1U0OC 3HM2A 3D54D 3VYUB 3DLBA 4GE3A 5L6NH 1UPFA 3CXUA 3OEWA 5GJCA 3FSJX 9LPRA 1IPHA 1R9GA 2B8NA 1UOEA 2QV0A 4NHEA 4B0OA 2OB1A 3DNPA 5TMBA 3IV9A 3SJ7A 1YB1A 2P40A 3UAOA 3ZTYA 4CTJA 4C89A 4DLKA 1P1FA 4E08A 2JLYA 1I30A 3O92A 1N6OA 3HLYA 1G6KA 4I08A 5DGCA 1IB0A 4NF2A 1PJ8A 3MD9A 3E91A 4HI0E 4TN5A 4MCAA 3ELYA 3QEAZ 4Q9NA 4J0IA 1T0PA 1MJGM 2HK6A 3TSZA 1GTL1 3P8FA 3UMJA 4EL5A 5F21A 3LF1A 4Y0NA 4CM9D 3C5WP 3VSAA 1V11A 2QRLA 3GJ7A 3ZHTA 5LMNB 1KMIY 2BM2A 1GBLA