4B6EA

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
646
structure length
645
Chain Sequence
ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVTGSVVIVGRIILSGSGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
total genus 202
structure length 645
sequence length 646
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b6eA04
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b6eA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6eA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6eA02
4C30A 2GRJA 3PFIA 4XD7D 4EIWA 1OXUA 5GVSA 4ZIRB 4WZBE 1VDZA 4DSOA 1N6KA 1L7VC 2Q9CA 3KX2A 2XNDD 1U9IA 4F38A 5FR1A 2DYKA 1W5TA 1OKKD 3GQBA 2GJKA 5M04A 1KI4A 1WCV1 4F4CA 3SJBA 2B8WA 721PA 2BOVA 2OT3B 1TU4A 1W0JD 5F9HA 3RC4A 3KKOA 2IS2A 2V1XA 4I99A 2MSEB 3G82C 1E0JA 3UMFA 2FH5B 4XWOA 1XD9A 2N1BA 4V0ME 4BZXA 3UG7A 2D74A 4GFDA 4Q7KA 4RSGA 3SUFA 2VP4A 4DCUA 4QGFA 1CRPA 4P0TA 2CXXA 4CEHB 3B9PA 4HEJA 1DADA 1QHHA 3AF0A 2C95A 1KOFA 3EIQA 1U90A 4HAVA 1GL7A 3BRWD 2IW3A 4X8LA 1W47A 1VHLA 3O47A 4P3YA 5CDFA 4ZIRA 5FUVA 4URYR 2PX0A 3Q3JB 4Q1EA 3MFYA 3EASA 2ZJAA 1GTVA 3IIJA 3MRSA 4H9GA 1Z06A 5HPYB 4A1TA 4DUGD 1SXJC 4R71A 2G1JA 2H1LA 2EFEB 2WJVA 3HYTA 3A4MA 1FX0B 4A15A 3U2QA 4BLQA 4C4PA 1NMZA 1Q1QA 3V00A 5F9FA 1JQJC 3KXKA 3W34A 4MGYR 4TL9A 2I1VB 3U7GA 3RS4A 2JLUA 3QG5A 2QA5A 2A30A 2MSDB 1GL6A 2P6UA 1EXMA 2ZI5A 2HT1A 2SHKA 3TQFA 1SZPA 2LKCA 4AI6A 1T3SA 1SVMA 5G40A 4CEHA 4AG6A 2EFDB 4M1WA 4D4JA 2LCFA 3GLGB 1NVVQ 5JECA 4LHWA 4PPFA 3SJZA 1Z0JA 1IONA 1MABB 4L16A 1P72A 1JAHA 1E32A 4KYUA 5FBWB 2V6JA 4P33A 4XJXA 1E0SA 4UNQA 2RKOA 1KK2A 2QBYB 2IUTA 4R8TB 1KGDA 3LA6A 1ESNA 1Q57A 4LJAA 1GKYA 3RSLA 4A4DA 2OAQ1 1XX6A 3KTAB 1LS6A 2DWQA 1CU1A 3LV8A 5DO9A 3LVRE 2Y8EA 4RFVA 4A6PA 1BYUA 2GWHA 3IKJA 4PFSA 3PEVA 3CR7A 2WSSA 1FX0A 4EAQA 1WB9A 4AKEA 3MWLA 1GNRA 4KYIB 4BASA 1NBMA 3EIEA 3ZZTA 1N25A 1CJTC 4QHYA 1JXOA 1ZNWA 1YZGA 2ZVQX 4UKDA 3ZVLA 5JWRA 1MT0A 2OBQA 4Q01A 2QT0A 4X8HA 4EPXA 1M6NA 4DWJA 2WSMA 3QJYA 4JSTA 4QJ4A 1DOAA 5AJWA 5JS8A 4U01A 1G5TA 3GLGA 3KUDA 2YC2C 2HV8A 2PJZA 3A8TA 1TX4B 2YWGA 1MABA 2JIZD 3WXMA 3J81k 3WP1B 2DWPA 4XOIA 1K5DA 4UNPA 1S96A 5EXXA 3GLIE 5H1YA 1GKUB 2L0XA 3EA0A 1D6JA 5IDKA 3D8BA 4D4KA 4HLUA 2GESA 3THWB 4F7WA 2WWHA 1YZKA 1X8LA 2GKSA 1COWA 2QAGB 1S1CA 3KTAA 2NQ2C 4B43A 3NKVA 3QXJA 1CJKC 2GZHA 5JHGB 3KEEA 3SHFA 2RGXA 4WVFA 2QPTA 1G5PA 1L8QA 2O8MA 3ADKA 2IS6A 1QBKC 2NGRA 3QKUA 2Q3MA 4DT1A 1A82A 3AQ4A 3B7GA 3I62A 4UXHA 3SS8A 2OBOA 2C9OA 2AFIE 3MWKA 2FFQA 3GJ0A 4RD0A 1HEIA 4B6FA 4WF8A 4WBSA 3LXRA 2ZYTX 4PO8A 5DIFA 3KF2A 2VRWA 4FWTA 1D9XA 3X1XA 5GNDA 4BRUA 5LPNA 3A1TA 4C0SA 2GVZC 4US0R 5BN3A 1GAJA 3RAPR 3H09A 2QMEA 1E4VA 4URUR 5L3QB 4NBSA 1U8YA 1DXWA 4DCNA 1KMHB 2QGZA 2W0SA 4JLBA 5DSZA 4E22A 2RHMA 5L3VA 1XJCA 4M9XA 3HU2A 4FCVA 1CBUA 4FCTA 4M21A 4R2HA 3VNVA 1Q3HA 3TUIC 3X2SA 4ARZB 2QAGA 5EE3A 2H5EA 1W4CA 1D5CA 3LD9A 4PAOA 3W5JA 2OAP1 1E9FA 4IVPA 1ZNXA 2QG6A 3FKQA 3GJ5A 3OESA 4LBVA 1Z6TA 4PANA 3HR7A 1J90A 3NH9A 1PLKA 4G3XA 1U0HC 4IW3B 2XZOA 1XMIA 1KTVA 2WWWA 2J0SA 3FPAA 2IBMA 2ZJYA 4IKEA 1U81A 4HAWA 4Q1CA 4XVRA 2KBFA 2PEYA 3W8NA 1W5SA 4OHVA 3U44A 4NCKA 1DAIA 1UKZA 2WWFA 2NZ8A 4XSHA 3AH8A 3P4YA 4QL3A 2QRZA 5DGXA 2XEXA 1CLUA 5TY0A 4DDVA 4ASUD 4RZXA 1KMHA 2EVWX 4E09A 1E0KA 1X3SA 2VF7A 1E9AA 1UADA 1E4YA 3RHFA 5BXQC 5IRCD 2IL1A 1RRCA 1IN4A 5CK5A 4TYDA 2FU5C 1ZAKA 2PEZA 1X86B 2XTNA 3ASZA 3I1FA 3M5MA 2NO1A 3AF3A 1NN1A 1O3YA 1UBEA 2NG1A 4R2IA 2JLYA 4QC2A 4WZ6A 3TUZC 3SV9A 4JS0A 3U7FB 4G01B 1WF3A 1KI3A 1X6VA 4JIMA 2D7DA 3RC5A 1VYUA 5GJCA 1YR9A 4B73A 1P4SA 2G3YA 1W36B 2NO7A 5ANRB 4CEIA 1SXJA 1E98A 2VSXA 1KI1A 1OF1A 3EZ7A 3K0AB 4LHXA 3M5LA 3NTUA 3TK1A 2GETA 1N0WA 4HZIA 1OFTA 1ZIPA 2ZI9A 3OAAA 2OCAA 4TWZA 1E2GA 2GEVA 1KDPA 4A1FA 1N6HA 5A0FA 1ZCAA 4LJ7A 2G77B 1MH1A 1OYWA 2B7CA 2BM1A 2GF0A 1QHXA 1GVNB 2DFTA 3A36A 1EFRD 1Q21A 2ZR0A 5DLQC 1YZTA 2XJ9A 3P27A 1JPNA 2GEUA 4KVAA 2J7PA 2QROA 3CWQA 4TN1A 3THOA 1D2NA 2I3BA 3NC0C 2AK3A 3RDPA 1Z0FA 4LYFA 2CL7X 1KO7A 2ZUDA 2R9VA 4POAA 2ZJBA 3CRVA 4UJ3A 4DIDA 4D81A 1G64A 1DTSA 1KO4A 3BERA 4LJ8A 3TNFA 4DIEA 4C0LA 2O8CA 1YRAA 2QRNA 4FN5A 2IYWA 2OBLA 1B0UA 4I1UA 5FL3A 2WKRA 4IOMA 5CJ2A 3I61A 5FL7D 4C0QC 1VYVA 1FW6A 3B1XA 5FPYA 3K0CC 4OJKA 3N2EA 421PA 1XCPA 2QENA 3AVQA 3CWZA 3MUFA 5F3WB 5K8TA 1A5TA 3GJXC 4MUAA 2KE5A 5HZKA 2PT7A 3GLHE 1E2NA 1NRJB 2GVFA 2W00A 2OHFA 3IBGA 4NYJR 5JSZB 2OC7A 1CJMA 2F3RA 2FG5A 1T4GA 4DDTA 2Z4SA 1FNNA 3GLFA 3K9HA 521PA 3FGNA 2ZE7A 2QTHA 1TL7C 1VIYA 1UFQA 3TH5A 4QBIA 1G7TA 5KOYA 4LHVA 2PH1A 3LQRA 4BFXA 2V9PA 2O0HA 1JR3A 3R8FA 2E9SA 3TUJC 3SV7A 5CLLA 4TQAA 3EC1A 2YWFA 1RIFA 2VPPA 4P4TA 3EZFA 1XB2A 3VAAA 3P1JA 2XOKD 2ZRFA 4NH0A 3X1DA 4RY2A 4Y0AA 2BKUA 3PV0A 4OHWA 1VCIA 2GJ9A 2ZSAA 4RD3A 4F91B 1IN6A 2RB4A 5FOXA 4JLOA 1KK1A 4MYUA 1G6HA 1TNDA 5EE9A 3TR0A 1KY2A 3FE2A 5JSZA 4HB3A 2CCJA 3UMSA 3C5HA 4QG7A 5E95A 3H86A 1WQ1R 1OE0A 1ZC4A 1DEKA 3W3ZB 3CRMA 5AJYA 3WHLA 4LJ5A 2FWRA 4W5WA 3UANA 3AVXA 1KK3A 1YZNA 4FMCF 5C1BA 3AP1A 4LX0A 1Z08A 4KSCA 5JEEA 4NWLA 3T5GA 2WKQA 3IILA 4E5UA 2W58A 4BLTA 1T0HB 4QOSA 1Q0UA 2DR3A 4BEJA 2REXB 3NG1A 3CRW1 4EKDA 3EARA 3THYA 4TL7A 4OK5A 2BBSA 3TAHA 1DPFA 3QKSB 3QXHA 4LBYA 4TMZA 1W2HA 2MMCA 821PA 3CPHA 2F9LA 3AM1A 3ZD6A 4O2RA 3B5JA 4URVR 2CHGA 3IBYA 2FPLA 3AGQA 1T0JB 4JVSB 2Z5FA 4CVNA 2QMUA 3TE6A 3C4JA 3U3JA 1E0AA 4YXWA 4UNNA 2FZ4A 1KI2A 5LB2A 3ZH9B 1US8B 3K70B 1R10A 2QMOA 5JI3E 5BYKA 4CT4B 2ZJOA 2FPMA 2R6AA 3GJ8A 2GK7A 5FR2A 3VR4A 4GT1A 4NP6A 1LF0A 3OEED 1QZXA 3QBVA 1XXHB 2WTUA 1NMYA 4Q1AA 5FOTA 4BLOA 1UKEA 1XEWY 2ONKA 4FMCB 3Q5EA 3E90B 4Q9HA 2OC0A 3A4LA 3AVOA 4YDSA 1UBCA 4IOKA 1T8TA 1EFHA 4TQ9A 3KKNA 2KI5A 4ZKEA 2QV1A 1U99A 2WPDD 1FQKA 3H2YA 4LYJA 3TLXA 4Q9LA 4ZPXA 4AYXA 4G5OA 1D8TA 1H8HD 3LDAA 4KVGA 3JVVA 4TT3D 4XWAA 3MLEA 3QNUA 3ZLJA 2IA5A 2AXPA 3WNBA 1I2DA 4NCHA 1E2DA 4URXR 1IY2A 1A2BA 2RMKA 3RRYA 1E9EA 2P2LA 2QE7A 2OXRA 1L4UA 1SHKA 2GCOA 1VHTA 1K6MA 1Z3IX 2VSFA 3BH0A 1OH8A 3BFVA 1EFCA 3FKSA 2DY1A 1Z5ZA 4B3FX 3QUSA 1T6NA 2C04A 4XH9B 2J5XA 2ZE8A 4OI1A 2RGCA 2ZRAA 3RS2A 1N6OA 3L43A 1YJ5A 4K46A 2VP5A 2YOHA 2WJIA 4O0MA 2GNOA 4NYMR 4MKIA 2GXAA 1YE8A 1II9A 2RGNC 1NJFA 1EK0A 4TMWA 1TEXA 4P4UA 3F0TA 2O5VA 4XTRA 4KFSA 3FMPB 2ODNA 1T8UA 2GHIA 1GWNA 4PZZA 3ZYCA 5E7IA 4LUCA 2ZAMA 2VA8A 3IUYA 4Z8XA 4LYHA 5G3YA 3T61A 5HCNA 3K0CA 4D80A 4MDEA 2JJ1A 3KFVA 3KJIA 4IXMA 3LBIA 4GL2A 5FTLA 2W6ID 2PMDA 2GVDC 3NIBA 2ZSDA 2ZJ5A 3UK6A 4BLSA 2VHQA 5FBLB 1JEDA 2IK8A 4LI0A 4DB2A 5LD2C 4BLPA 5FI0B 3B82A 3RS7A 1AIPA 4M9FA 4PHFA 2NZJA 1DO0A 1YZQA 3PR1A 2Z0MA 4DEXA 3FWYA 5EZ6B 2QL6A 4TLCA 1O87A 5FPTA 1KDTA 5KDDA 5JI2E 3P26A 4HUQB 4IVQA 2NIPA 1LTQA 2IYUA 1QHIA 1FNMA 1CR4A 4JBYA 4M0LA 2REBA 1DARA 3IQWA 2AWOA 4JVNA 4QKQA 1Z63A 4C2TA 3TKLA 3KKQA 3K0FB 1CF4A 3RS0A 4G5SA 3EZ9A 3W6OA 2WOJA 5HE8A 4UNRA 3GP8A 2ZROA 1W36D 1JAIA 3L2OB 3P4XA 4RKFA 2WICA 4HLCA 2EFHB 5CB6A 5JMTA 1RYFA 1VG0B 4GI7A 5FBVB 4CT5A 4Q1FA 4LZZA 3I8XA 4GMXA 4LK2A 3SFZA 5E4FA 2A3RA 1ZU5A 1OW3B 1XF9A 5EQSA 1MR3F 1ZVQA 4RCYA 2GAOA 4FD2A 3ICQB 4OQXA 4PHGA 3JVUA 3U3MA 2CK3A 3CF6R 2AFHE 4A0HA 3RWOA 5AK0A 2DFLA 4IXNA 3IGFA 2ZRLA 3OIYA 4LWZA 1SVLA 2C2HA 4KITB 3A6PC 2CNWD 2VP6A 4ILEA 3SJCA 1PLLA 2Z43A 3GJ3A 3N5CA 2XCFA 1AA9A 3K0FA 3X1WA 3KJHA 4A0FA 4MKHA 1OH7A 1F2TB 1GP2A 2EW1A 2BVNA 4D6PA 2QQ0A 3L0PA 3G5UA 3NBFA 4HAUA 3EXAA 3NBZC 3SDZA 4C0JA 4Q7LA 3U6BA 1JJVA 2RCNA 1E2HA 4KU4A 2K5UA 2VHUA 1E79D 2J87A 3QXCA 3ZQJA 4BWYA 4TSFA 1GITA 3FDIA 3ZQ6A 3SR0A 2E1RA 2JJ2A 2GBLC 3MSXA 1NVVR 5IK2A 3AUYA 5KO2A 3VNUA 1NIPA 1XD2B 1R0ZA 5EUMA 2BEJA 3P8OA 2OINA 1N5IA 2FM2A 2BJWA 1YU9A 3KQLA 4HDQB 5CIWA 4CRWB 2WV9A 1DXPA 4BFYA 4HYYA 4BFUA 3QSYA 3KJEA 5KNCA 4I31A 1GFIA 1Z6XA 4GSYA 5AJVB 3TJZA 2WWXA 2IS1A 2EU8A 3B60A 5CDFE 1XZPA 1CP2A 3VKWA 3ADDA 1GZSA 3DKPA 4QNRA 3CX8A 1IHUA 4NCIA 4YMUA 1G1MA 4JBXA 1F2TA 5FUXA 4RKEA 1CEEA 3WP0A 1G291 2GEDA 2A4QA 3ONWA 4HDOB 4L4UA 5CM8B 1ZM3A 1UKVY 3RRZA 3LRPA 1P62B 2ERYA 3PEYA 1II8B 1N2CE 1IXZA 1LFDB 2V55B 4UXJA 3CH4B 1QHNA 1QG2A 5BQ5A 4N0EA 2C98A 1NNEA 5FOWA 3CW2A 3VR6A 1XTQA 5IHPA 3SU5A 5GJ4B 4BE7B 1S4QA 4A2PA 4V02A 3LVQE 3QXSA 1MO5A 2LWIA 1XD2A 2HDNB 3W9YA 4CGZA 1KYIA 2P5TB 1BOFA 1ANKA 1VCNA 1R5BA 1W1WA 3A37A 2CJWA 3L0SA 2O8FA 2JASA 1G8YA 1QVAA 2J7KA 4BZQA 3PITA 4ASUA 1KNXA 1E2LA 3VR1A 3PV2A 3DPUA 4TMKA 1KJYA 1M7GA 3KL4A 4NDZA 4PAQA 1Q1EA 2OESA 2RGNA 1KSGA 3H1TA 1Z47A 3WNDA 3REFA 5FPKA 2NPIA 4GPTA 3X1YA 2ODBA 1HUQA 4C0BA 1UEJA 2XTMA 4B3BA 1II8A 1VKJA 4B3XA 4HATA 2GGVB 1OV4A 4Q1DA 1NBME 5CITA 4XTCS 1RYHA 5L3SB 1IM2A 3LQQA 3QI2A 1NP6A 2GXSA 3M6AA 2QM8A 4OHZA 1OT3A 1ODFA 1R4AA 1ZINA 2G0NA 2IF2A 2C8VA 3GLGE 4Z1MA 2NO6A 2DBYA 4D25A 5B2ZA 1M74A 4IDOA 4M1YA 4LYAA 1F6BA 2FOMB 3FVQA 1Z83A 2ANBA 4G5RA 5J47A 1AS2A 4US1R 2NO9A 2V54A 1A1VA 1NL3A 5SZJA 2OK5A 1E9BA 2J9RA 5CM9C 2CBZA 1G8PA 1DO2A 2BBTA 4TLBA 3UPUA 3U61B 1G18A 1JPJA 1R0WA 1XTRA 2IYQA 4RZUA 3AVPA 1EFUA 5C18A 3CB4A 4ACBA 4DLXA 1NLZA 1TF2A 3SUEA 2KSQA 4D0LB 3IHLA 2CDNA 2QZ4A 3HYRA 1NMXA 3I4LA 3UMRA 1OFHA 4F4JA 5EPNA 1I2MA 5FH9A 3ZS9A 3BC1A 2JJ8A 1KDOA 1G20E 2WKPA 3OE7D 4HZUB 2R6DA 4MRRA 4NTZA 3T1QA 4C9BA 5L3SA 1NVXQ 2YJTD 3MG9A 4C2UA 1J70A 1FPMA 2VHJA 1JXPA 4JLMA 4MRPA 1VCOA 2J45A 2OSBA 4LBWA 2G9NA 1MV5A 2ZRHA 3ECCA 4A0GA 2RGAA 3AF4A 1VIAA 4IDNA 1HH4A 3C41J 3K09C 1WBBA 3B1WA 2O8BB 2IT1A 3CX7A 4FMDF 4IDPA 4C7OB 4X8OA 1E6CA 4RVCA 3EC2A 1G21E 4AKHA 3PVSA 1JECA 3MMPA 4U00A 4YMWA 3O8DA 2GTPA 2V3CC 1DG1G 1KI8A 2Z83A 2ORVA 3WYGA 3S1AB 4ESHA 3A4NA 3K8YA 4DT1B 1E1RD 2R44A 1A1RA 3SNHA 4W5JA 1ZM7A 4Q19A 1KI6B 1OH6A 4A1VA 1QVRA 3DDCA 4WH6A 4HZUA 1VG9B 3LAWA 1MOZA 2HJGA 1CR2A 1TUIA 4OQNA 1G3IA 2Z4RA 3SU3A 2F9UA 1PV4A 4JL5A 1DBSA 2AHOA 5HTKA 2DPXA 4RI0A 2AKAB 2BM0A 4GNKA 1B23P 1N0UA 2QNRA 1Q12A 2RGEA 2OE2A 1XPUA 2J59A 4RD6A 2OLKA 5KDLA 4B76A 1IAQA 2MSCB 2GBLA 2CE2X 4PC2A 4Q48A 5CYPA 2O8BA 3PUXA 2IJOB 3AUXA 4C7OA 3OEHD 1WXRA 1MO6A 1H8EA 1UKYA 3C7KA 4LOAA 3AVVA 1RFLA 3RSOA 1HY3A 1OHHA 1TEVA 3ZDQA 4KLNA 1GUAA 4LV8B 3P8NA 1OJLA 4FMDB 4K8OA 4JLNA 3RYTC 3S1AA 4PQRA 5TV2A 3ZIAA 3LOXA 5FOUA 4Q03A 4QFMA 2J0QA 3PXGA 2AX4A 1IN8A 3F5FA 2V7QA 2H57A 5P21A 1KI6A 4W9MC 1FTSA 2AN9A 3PJRA 2Q3HA 2XXAB 3U44B 2OCBA 3UG6A 4Q02A 1P61B 2KWIA 4M4SA 4PZLA 4BEBA 2H7VA 1JALA 3W90A 1DAHA 3CRQA 4QM6A 1EG7A 4I1VA 1N6IA 4MKFA 1TTTA 1EGAA 1Z2AA 4BFWA 5L3RA 1CR0A 2YOFA 2FNAA 4PPGA 4B3CA 3CZQA 4OK6A 3UIEA 4EFLA 3ADCA 1RGQA 3LW7A 1ZCBA 1R8QA 1W44A 4L9WA 2UZ3A 4TTPA 2AR7A 4EQ6B 3K1JA 5CIQA 5EE0A 1IN5A 4DLWA 1AQYA 5SZIA 3WMFA 4B3GA 3PUZA 5FPSA 4TYWA 3PUVA 4CEIB 1SXJB 4D4MA 3IQXA 1YQTA 3U6KA 3L0IB 2FF7A 2IJD1 1NLFA 2OLJA 2F6RA 4ITRC 4LCBA 4HAYA 5AUOB 5J4KA 2XXAA 1NN0A 4PX9A 1G8HA 1ZC3A 1G4AE 1G16A 1GSIA 2PX3A 4LHYA 5C4GB 2QQEA 1HTWA 2WWIA 3R9WA 2PZEA 4PO9A 2OBNA 1OSNA 4NONA 3R8CA 3CPJB 2QP4A 1HE8B 1Z8FA 4OKSA 4TYPA 2VEDA 2V1UA 3A1SA 2O52A 3SU8A 2ZETA 3KQHA 2F1HA 3RVBA 1BMFD 1EESA 4DLVA 3SFVA 2WAYA 4AYWA 3SV8A 3EZ6A 2F1IA 4XSGA 5EE1A 4QM7A 2JDID 4YMTA 4IRUB 2QTFA 4EQ6A 4QGGA 3WYFA 1NY5A 2G83A 2Q9AA 1P73A 3DZDA 1JR3E 4JL6A 2O8CB 3OIWA 1LS1A 1Z0DA 4Q21A 1XTSA 2DFNA 3KXIA 4B47A 2AKYA 2BCGY 3CRRA 2N42A 2XNSA 3KB1A 4JT2A 4CYMA 4MDFA 4EJSC 3FMFA 2YV5A 3BOSA 2E87A 1BKDR 2P65A 3AF1A 3M0EA 4U5XA 3RS3A 3ZS8A 4GOKA 2YZ2A 3I5XA 1BYIA 3OFNA 2ATXA 4Q5IA 4Q47A 4M8NE 1S9DA 2FEOA 3CR8A 4OQFA 4AURA 4L9SA 2FP7B 1KIMA 3GLFB 1ZUNB 1DAKA 4PC6A 3GJ7A 4KFUA 1MO3A 1K5GA 4PPNA 4Q4HB 3M4YA 5EQQA 1YZLA 1KSFX 1Z0IA 4AIIA 4Q4JA 1W2GA 3U3OA 1Q22A 2IXEA 3AK5A 5JBQA 2ZJ2A 1CR1A 2B92A 1YZUA 3QF4A 4CW7A 2YKGA 2F1RA 2HLDA 2IC5A 1N3BA 1I4LD 1Q1ZA 2XB4A 3Q8XB 1BO6A 3OYPA 1PUIA 1YVDA 2A2ZA 2MMGA 2PJRA 2C9CA 4BFVA 1N6LA 4F92B 1E1QA 3DO6A 2GCPA 1W4AA 1XCMA 5HKKA 4ABYA 1XFAA 1LB1B 3GPLA 4B75A 4Q9JA 2GA8A 4WIAA 2ERXA 4TZ6A 4B34A 4BECA 4LC0A 4CF7A 2V8OA 4HLQB 4DCSA 3NEYA 5FTNA 4D4LA 3EW9A 3PUWA 3E1SA 4QBFA 4HUTA 4DLRA 1FUUA 1BH2A 1VPLA 2OZEA 4KODA 4M2LA 4PTLA 3PEWA 1CJUC 4DSTA 3L0OA 4M1TA 4DBLC 4Q4HA 4PR0A 1U0JA 4D26A 5EZ5A 1GL9B 4GBMA 4BPBA 2IEYA 5EQTA 2HCJB 4C3ZA 2HCBA 1G17A 4FI3C 1JXMA 1XDBA 2XSZA 3THYB 2XX3A 3PENA 2FPKA 2K1QA 1OXXK 2P67A 3NDPA 4AYTA 3SV6A 1HQYE 1X8KA 3DEFA 3QPVA 1N5LA 2J1LA 1ZYUA 4N3NA 3GEHA 1OB2A 3CKLA 3ZVRA 3EPKA 1Y63A 1IOZA 4PSKA 4WXPA 4TYNA 2QP9X 2F9VA 4NCJA 2QUZA 4DVGA 3ZD7A 3WBJA 1A2KC 3SEAA 1WMSA 2AXNA 4TLAA 2O0JA 2X19A 3PEUA 3A1WA 2J0VA 2WSSD 3NDBB 2VH5R 2OC1A 5KNBA 4DXAA 4PO1A 1WP9A 2A5JA 1NBMD 2NO0A 2H16A 3RC6A 4B2LA 5TMPA 2VIIA 3PUYA 2J0UB 4IHQA 2IYSA 3QE0A 1YR7A 4R98A 1E2FA 3Q85A 3EPJA 1XMJA 1XJQA 2ZRMA 2ATVA 1XTIA 5BWMA 3GEIA 3SBDA 4UXIA 1AKYA 1P5ZB 3PCRB 4R9UC 1XXHE 1LY1A 2EWVA 2VL7A 3IPXA 1W0KA 3KN2A 4JLAA 4NE2A 3KNXA 1ZRHA 1G9XA 4RD2A 4D0GA 1P9WA 4PQYA 4LJYA 1UDXA 3Q7PA 1FL9A 2VLIA 3FMOB 3GCGA 5JCPA 1G3UA 1IN7A 1COWD 5CLQA 3FFBA 3CX6A 4LC1A 5DE3A 3TSZA 2IEZA 2ZUCA 2OG2A 2BDTA 4AKGA 1AS0A 5CYOA 5AJZA 3WYAA 2X77A 4OQMA 1NJGA 3WY9A 5C4MA 2HEIA 1SHZA 2EWWA 3ND9A 3Q7QA 5K8UA 3HPQA 2ANCA 1JJ7A 4DDUA 1JQLB 4BGDA 2GCOB 1WA5A 2GDJA 2J0UA 1FZQA 1M7BA 1UDWA 2WMNB 2ZI4A 5JLJA 1CULC 1OXVA 4BFTA 1QHYA 2ODWA 3B1YA 3SC3A 1UPTA 3W3AA 5KPJA 3KQUA 1G3QA 5T1VA 1XEFA 4TLDA 3T34A 2EFCB 1F5NA 4MGZR 5FTJA 4YMSA 1W4BA 2J41A 3SJAA 4FCWA 4MUBA 4JT4A 2D06A 3DVLA 1VG1A 4V03A 1TMKA 2QT1A 2ZIAA 3UATA 1RPZA 4B2IA 5DN6A 3SU0A 4YLGA 1RJ9B 3H0KA 3CF0A 2Q0HA 3ZZ0A 2BEKA 1GDDA 3AKCA 2ZU6A 1OFIA 4XD7A 3OF5A 4ZCIA 4URZR 2WVJA 2XNDA 2JCSA 3MAAC 1C9KA 2IYLD 4HI0E 4LRWA 1E9DA 1U2RA 1P75A 1OKKA 2ZJZA 4EJSA 1DAFA 1S2MA 4QJ5A 2RAPA 3UWKA 1KK0A 2WBLC 2ZI3A 1R7RA 1TPZA 1W0JA 2FDCA 4GP7A 1NKSA 3LO5A 3V4FA 5BN5A 5TB5A 1DELA 2GJ8A 3GD7A 3TW8B 2FSFA 5JHHB 1EX7A 3GEEA 1XTKA 3BB1A 1RVDA 3O8CA 4GRAA 2WWYA 1K8RA 1NVUQ 3A1VA 4MA4A 3T1OA 3AKYA 3LBHA 4LDJA 4IOJA 3TQCA 1ZNZA 1KI7A 5LB4A 1LVGA 3D3QA 4DDWA 4IDHA 2XZLA 1W3CA 1RJ9A 4TLEA 1DY8A 2YNMA 2G6BA 1D2EA 4DSUA 2C9YA 5TXGA 3MGCA 2EFGA 3ETLA 4EPVA 2BKEA 1CXZA 3Q5DA 2BV3A 1XPRA 2PLRA 3IHWA 1U8ZA 5JWOA 2JA1A 3HJNA 4A92A 1U9IC 2ZTSA 3H84A 1OXTA 4PQFA 4PZYA 4DUGA 1SXJD 2ZRJA 2BCJQ 5HZHA 4PHHA 2REOA 3SYJA 2OBMA 4HLDA 4LV6A 1VECA 4XIGS 5GJBA 1DAEA 3X1ZA 1PJRA 5H4IB 3OAAD 1ESMA 3U60B 1J8YF 1UJ2A 3IPYA 1AK2A 3CM0A 1ZUHA 3BB4A 1ZM2A 2BBOA 3VKHA 4QGHA 4Q7JB 3VHLB 3VQTA 4Y0VA 1KY3A 1ZJ6A 1Q3TA 2J7PD 5TARA 2ORIA 3W5IA 2P59A 2X8AA 4MH0R 1HQCA 2QSYA 1EWQA 3T12A 3DHWC 3WRXC 4M22A 3AKEA 2WJYA 2OCYC 1DVRA 4A1XA 4BFZA 1D2MA 1R0YA 1FUKA 3QXXA 3TVDA 3VU9B 4EPYA 4OK3A 3EX7C 2BMDA 2ZI7A 5EXTA 1P7CA 4MKGA 4LV5B 2IYRA 1N1LA 1E2JA 3M5OA 3AVYA 1TQ2A 5JCZA 2ZPTX 5ESBA 5IF9A 2ZM5A 4PHTA 2RGBA 1GNPA 2UVQA 3SZEA 4A8JC 4P32A 2W0MA 5B30A 5DNYB 1FFHA 1T3HA 4IEEA 3KB2A 1NY6A 2PMKA 2EQBA 1JI0A 1AN0A 3Q72A 4Q66C 2QMHA 1HT2E 3MWYW 4PXAA 1G3RA 1S9HA 2D3WA 2LKDA 1LNZA 1SVWA 4LPKA 3SU6A 3RC3A 2JIZA 5EP4A 1JR3D 1LW7A 4M9SA 4QBHA 4LY6A 1R0XA 4HDCA 3AP3A 1XCGB 3VR3A 1FP6A 1AQUA 1ZM4A 2O0KA 3VU9A 3BD9A 4ON9A 1BS1A 4H1UA 1U98A 1N0VC 3I32A 1Z28A 3QVVA 2ZXUA 2YWHA 4BFSA 2IYXA 2WIAA 4UQOA 1XEWX 2GK6A 4V0NA 3RRMA 4Z8YA 2Q3FA 5CJPA 1KSHA 2DHRA 4AC9A 2Q9BA 1VYTA 1OYYA 4B48A 4GP6A 1X8JA 3LWNA 1ZP6A 1S3SA 2FZLA 2QAJA 3GJ4A 3SHWA 4C0HA 2AD1A 4TQUS 2IWRA 2C03A 2DWOA 4URWR 3MJHA 1W46A 1WE2A 3TR5A 3WMGA 4ESVA 1NSFA 2QU8A 1WRBA 4WOPA 3WRYC 4EPWA 2GXQA 1H65A 5SZHB 2CJWB 2O8FB 2PZFA 1GILA 4GZMA 1QHSA 3ZVMA 4NYIR 3PG5A 5ETXA 4Q7MB 4ZI2A 1CRQA 3IIKA 4N0DA 4AK9A 2C5LA 3BB3A 3SBEA 2IYTA 4II7A 1XP8A 3BFKA 4A2QA 4Q9KA 4JVLA 3RWMB 4HLUC 5JS7A 3L8ZA 3D7MA 3NBXX 5J4YA 2VF8A 2D4HA 3LH5A 1ZUIA 3SOPA 1HV8A 4KO8A 3M5NA 5JZVA 1UBFA 1KJWA 2ZAOA 4JJKA 5EP1A 3VR5A 3NVAA 4B33A 3VKGA 1UAAA 5DI3A 2D62A 2ZITA 3QEJA 4YXWD 4KFTA 5FBRB 3SZRA 3HPRA 3OTPA 1DAGA 3TBKA 5K8IA 1ZD9A 1WBDA 4KCGA 2C77A 4Q4AA 4C0KA 2FFBA 4IDQA 3V4RA 4WW0A 1VMAA 1RKBA 2FOLA 1TADA 3BJIC 4AWXA 3ZVNA 4K81B 3BIFA 2ZRNA 2A5DA 3TMKA 5LD2B 4Q1BA 4DKXA 2TMKA 1KZ7B 4OHYA 4JJZA 4XWKA 2PL3A 1TAGA 1XNJA 4JLJA 4LPSA 3SU1A 2ZRKA 5GJVC 2ZYUX 2J46A 4QRHA 5JEDA 2D2EA 4JMYA 1XTJA 5JJIA 1NLYA 1P2VA 3MCAA 2A5FA 2WJJA 3D6TB 4LJ6A 2FE4A 1OB5A 4G5GA 1YHNA 4B6EA 4JSYA 4ZCLA 4ZDIA 1CJVC 2FJUA 2QP3A 621PA 4GOJA 2G0TA 3LNCA 3K0SA 1NSTA 3CNLA 5HCIA 4ZCMA 4B35A 3L82B 4I4LA 1DG3A 2QAGC 4JLDA 4TL8A 2ZSBA 2XGJA 2HJVA 5FBQB 4O25A 1OH5A 1G7CA 1S3GA 3LW8A 2FN4A 4Q4LA 1RC8A 2ZU0C 3SU2A 2A9KA 4UNSA 4NMMA 4I1OA 4FMBB 4CZ2A 3K70D 3ZJYA 2QE7D 1BIFA 1FQJA 3SYLA 4GDFA 4MYTA 3RRNA 1CS4C 2FFAA 2KB0A 3EPHA 4A8JB 1W49A 1G41A 1U8AA 3UXMA 2RHDA 3FKSD 3IO3A 4HB2A 1EFRA 5TDHA 1AGRA 3BE4A 1P6XA 1MRSA 1Y3AA 4NU0A 2GXUA 3BS4A 1ZBDA 2OC8A 2ZE5A 1UEIA 3LONA 1MO4A 2B6HA 4Z54A 2OM2A 3BBPA 3NXSA 2DCUA 2ORWA 3TGPA 1TQ6A 4PC1A 1KAOA 3FFAA 5B6LA 5C2JB 3REGA 2XTZA 3FHOA 3TVTA 2H17A 3GJ6A 1Z29A 5AWFC 4OQLA 1VG8A 4TYYA 1Q20A 3E5HA 5FL7A 1ZIOA 2Z6VA 3K9GA 4XVUA 4RD4A 4HAZA 3SI7A 4I1SA 2ZREA 2OCPA 2YYZA 4KI0A 1M8PA 2W6JD 2R6CA 2JJ1D 1W7AA 4FW9A 6Q21A 2W2XA 3JZAA 1DE0A 3K9NA 3NHAA 3P32A 1ZNYA 2CE7A 5FFMA 4A8JA 4KAXA 4NKRA 5B64A 4NZYA 4K8BA 4L15A 3LXXA 4MRVA 3RS5A 3CPEA 1IJEA 3CUEF 4M53A 4MGKR 3IEUA 4NYIQ 5H8WA 1AKEA 2CL0X 4M9ZA 4OI4A 4B71A 1M34E 3C16C 3QKRB 4XVQA 2WOOA 2VBCA 2H8KA 5B58C 5B57C 2IX3A 2ZRIA 1PLJA 4W5HA 5E7JA 5FUWA 5KDOA 3Q9LA 4F4IA 2XOKA 2UZIR 2A5GA 2AD5A 1SKYE 1SVKA 2P5SA 3B78A 4OI0A 4B32A 2BMFA 4JZKA 3QBTA 4JVMA 1W36C 4M1KA 1JBKA 4RFSB 3RABA 1KKMA 1YR6A 2BMJA 2QGNA 5D3MB 4V0MA 2OFWA 4B2PA 4YQFA 4PSAA 2ECKA 2F1JA 1UF9A 2F43B 2J3EA 2QTVB 2ZYWX 3KKMA 4LJ4A 3NC1C 3QY0A 1CKEA 3DOFA 5ELXA 3ZGXA 2ZANA 3B6EA 1KHTA 4WZAE 3IIMA 5KSYA 1E94E 1GRRA 3QKRA 4OL0A 3U7HB 1NF3A 2A78A 3LX5A 4M1SA 5JRZA 1F2UB 2CMKA 1KMQA 2CK3D 5A4JA 1FP7A 1E2MA 3U4QB 2PCLA 1N5KA 1SKYB 5JFGA 2F4LA 1AM4D 2CL6X 4BRWA 2IWHA 2BBWA 221PA 2IUUA 1OLOA 4G5QA 2QBYA 4DCTA 5J4VA 2YVUA 1J7KA 1SXJE 3EA5A 1NKTA 4ZV4A 1Z6YA 5KSZA 1GRQA 2X2FA 4RFSA 3CF2A 3I5YA 2O8DB 1NVWQ 2IHYA 4J0QA 4KBFA 1ZMXA 5D3MA 2HYDA 3HU1A 3U1JB 1QDEA 2ZR7A 1AZSC 5E3HA 3K0EA 2ODEA 3CH5A 2F43A 1II0A 1Z6GA 2GF9A 4N1AA 5JJKA 4ZDWA 2VP2A 2R6FA 3HP1A 4P31A 4TSFD 5EE5B 5KNDA 1P3JA 4DC9A 2P0EA 3OEEA 4ZO4A 3BWDD 5F98A 2JJ2D 1YKSA 3TAUA 5IK2D 1DAMA 3ADBA 5GVRA 3NH6A 3GFTA 4TL6A 3WHKA 5CK4A 1WDTA 2OV2A 1QF9A 5FTMA 1E99A 1F2UA 4RZ2A 2CHQA 2YC4C 3QOFA 3EYDA 3GLIB 2GJSA 3U4QA 1KJZA 2WWGA 3B2EA 2EYUA 3KQKA 2WM9B 3V9PA 1E2QA 2WPDA 1IY0A 2W83A 1QRAA 3ZZUA 4TMVA 3EZ2A 3E2IA 1FMLA 4DLTA 1H8HA 4C0AC 3THWA 1T5IA 3LX8A 4AY2A 3B8HA 2QPOA 4TT3A 1ZD1A 3OHMA 4DEYA 2CLDX 1EWRA 2OFXA 1WXQA 2O8DA 2GZDA 5FOVA 2X2EA 1JEEA 4BLRA 1F3OA 1FMJA 2C96A 3BGWA 4RZ3A 5E7MA 5KSPA 3TW4A 3B9QA 4QBGB 4NHOA 5F2EA 1ELOA 4OJQA 3GLFE 1P9NA 3L6PA 1E2KA 1HA3A 4Q4JB 2VYFA 1PZNA 3OIVA 5KTYA 2CVHA 4MRNA 4U7DA 3LBNA 4OHXA 1SKQA 1NN3A 2AK2A 3QF4B 5H70A 1NG9A 2CLSA 1KDRA 3T06B 5A5GA 1G6OA 1Z2CA 1T91A 3G0HA 1G5RA 3C5CA 3OIUA 1KI9A 1R6BX 4JL8A 3GLIA 3C14C 4GMDA 4AG5A 1X1SA 3FB4A 2XJ4A 4JLKA 3B13B 2EYQA 3DM5A 1R2QA 3BH6A 5HE9A 5LBIA 2JLSA 5L3QA 3RANA 8OHMA 2YHSA 2GJAA 2BJVA 1XRJA 3CIOA 5DISB 1AGPA 3AEZA 4TZ0A 1OPXA 3VX3A 3BXZA 3CNOA 5FUYA 3KKPA 2VO1A 4RD1A 4KJZA 4QNMA 3RLFA 3EIHA 3N70A 4ARZA 5FPHA 3O8RA 4V0OA 4DLUA 3M1IA 5BN4A 5JJLA 1DY9A 4I33A 4DJTA 1L4YA 1G4UR 2FSHA 4TMTA 1CIPA 1E9SA 4DLYA 1R5OA 1OIWA 3BORA 3LY5A 4EFMA 2NMVA 3K70C 1G8FA 2C78A 1X1RA 2AL7A 2W6IA 2BIFA 5KPDA 2ZSEA 3NEJA 4EPTA 1P2UA 1R8SA 3R7WB 3SUGA 4LGMA 1Z07A 2XITA 4G1UC 4QGAA 3PQCA 1F48A 2CHVA 4ZI3A 2OO7A 3R9IA 2DFKB 1RZ3A 3K09A 5BW8A 4D82A 4DRZA 3JZMA 3WMEA 3WNCA 3I92A 4Z1MD 2QY9A 4HSEA 1TUEA 2F3TA 1RRFA 2ZE6A 1VCMA 3UKDA 2W2TA 2A5YB 2XB2A 2D2FA 1S0UA 3RNLA 2HT6A 4JMPA 1XWIA 3MJRA 3F3YA 2JLVA 2R62A 4L5BA 3CO5A 4M1MA 4PC3A 1E2EA 3K53A 3MD0A 4DHEA 1E2PA 1Z22A 5KHOC 3U5ZB 3FTQA 3KUCA 5AUQA 4ZKDA 5SZKB 2IXGA 4Q00A 5DI9A 5FOSA 3T1VA 3EPLA 3VFDA 1NG1A 4NCNA 4MQBA 2CEAA 2NOAA 3K0AA 3R7WA 1W48A 2ZS7A 4L8GA 4QXAA 2XCNA 1Z0AA 2PLFA 3QPUA 1G8GA 3IEVA 1G3MA 3KFXA 4JBWA 4TMXA 4BZPA 1LV7A 4JKYA 5J5CA 2OFOA 1Q1BA 2ZVPX 2FA9A 4MYCA 1TQ4A 3WBKA 3SQXA 3CBQA 2FGKA 2VHCA 3DM9B 3HR8A 4CIDA 4GOXA 3TRFA 5FTKA 2B7BA 5DH9A 4KXFB 2IF0A 1KO8A 4LHZA 3QPWA 2IXFA 1NIJA 1AZTA 2NTYC 2IS4A 2CNWA 3SN6A 4QHTA 3O8BA 4OM9A 1GOTA 2GILA 4IEIA 4X8MA 4Q18A 4A9AA 1ZD8A 1SULA 2FGJA 5HR5A 4E03A 1OFUX 4A0RA 1DS6A 3GLHB 3B85A 3IDQA 4US2R 1HURA 2ZRCA 4TYQA 3LLMA 1P2TA 2BMEA 2VHTA 3AKDA 1E79A 2PBRA 3U3RA 1J2JA 4RJLA 2JLXA 1NS3A 2ZS9A 2CCGA 4OI2A 2OILA 2YWEA 1ONBA 3B1VA 1J8MF 1GG2A 3D31A 1S1MA 3U3KA 3AF2A 4YC7A 1XMVA 2B21A 5D3QA 2ZUBA 2QEQA 3BK7A 4NL4H 1H8ED 3DOEA 3CNNA 4P4SB 3GMTA 4JLVA 2YINC 4YDHB 3LLUA 1OHHD 1EFTA 2VQSA 4EJSB 1MKYA 1P60A 4PPQA 3ZIAD 2IYVA 3QG1A 3KJGA 4O3MA 2CLCX 3FMIA 4LBZA 2WMOB 2ZJ8A 1V5WA 2JGNA 2V7QD 2R2AA 3I73A 3GFPA 2ZR9A 2QI9C 4Z51A 4ZDJA 4WA7A 3GLHA 1JNYA 5BYJA 1I4TD 4EFNA 4A82A 1RW4A 1TU3A 3AV0B 1GRNA 4KSBA 4PSVA 3K9LA 3MWJA 4MGIR 2JAQA 3E70C 4A2WA 3BFXA 3CLVA 3HWSA 2QM7A 5EXSA 3VMFA 3DMDA 3F8TA 2FSIA 2H18A 4PC7A 3AVTA 2G1KA 1LF5A 5EXPA 3EG5A 2G88A 2GCNA 1NI3A 2I4IA 2KBEA 4G0NA 4P4SA 1N6RA 1G7SA 3FOZA 5GJWC 4I81A 1HE1C 3FHCB 1UBGA 4A6XA 2XNIA 1Q44A 2ZRGA 4KV9A 3I8SA 1E69A 5GADl 3QKSA 1L2TA 2GAAA 2V4ZA 3QIAA 3SQWA 4JYCA 1A7JA 1SVSA 1GKIA 1KAGA 2RGDA 4S35A 4FWIB 4LJ9A 2FEMA 3HU3A 4DZZA 1NN5A 1IXSB 1M1YE 3KDSE 1JR6A 2W2VA 3I3SR 3CONA 1M2OB 1TF5A 4WXRA 4BUJA 1SVOA 1T3LA 5G3ZA 3NHBA 1US8A 1D9ZA 4V0KA 5C46F 2ZS8A 1RTLA 3ND8A 1E9CA 4NYJQ 3SYKA 2Q6TA 2RGGA 2ZQ5A 4ACAA 5KU1A 4LSGA 1I4DD 1ZM9A 2HF9A 2HF8A 2PT5A 4M9QA 4OYHA 4NWKA 3EAQA 5DHAA 3QKTA 3RC8A 1G7RA 3GFOA 2IYYA 1XD8A 1XXHA 2VP0A 3P20A 2P3SA 4DLZA 1ZW6A 1IQPA 2FMXA 5JWHA 3SU4A 4IVRA 3TIFA 3T15A 3L8YA 2V6IA 2F55A 2YOGA 1AS3A 3AP2A 2IHBA 3BAFA 3VHXA 3AVUA 2GZAA 3OZXA 3AVWA 1GNQA 2PZGA 1BT7A 2BC9A 1V43A 4QHSA 1TF7A 2ZEJA 4V0LA 3FYHA 4DSNA 1SVIA 4RCZA 4M1OA 5EP2A 4ERNA 3OFND 4D2IA 2QN6A 4TTQA 4S2EA 2KJQA 5G53C 2ZSFA 2ZRDA 4KTCA 3OE7A 1FOEB 5AJXA 1KKLA 1T5LA 1XZQA 3NWJA 5EJEA 3LKWA 4GZLA 4YONB 5IDVA 2OUKA 2W6JA 1Z0KA 4FINA 4B44A 4YMVA 1OIXA 4B3DA 5FI1B 3EWAA 1VTKA 2JLWA 2X1VA 3KXLA 2H92A 3PIRA 1N5JA 1OXSC 2JLZA 4HB4A 1C1YA 1ETUA 4QJ3A 2P6RA 121PA 2XAUA 2ASEA 2D7CA 5DHFA 5L8VA 2HLDD 5KUTA 4UJ5A 2VP9A 3BH7A 3T35A 3W6NA 3LFUA 1U94A 5J4LA 1XJ0A 1G19A 1E1QD 3T5DA 2BWJA 5GPIB 3QQ5A 5HKKD 2R8RA 4U02A 2B8TA 2HXSA 4OBEA 2CVFA 1PUJA 1T9HA 5DYIA 5IT5A 4CDGA 3ICEA 4A36A 2P6NA 1KSJA 3B1ZA 1E1RA 1KNQA 3EWSA 1IY1A 3HDTA 3KZ1E 3U7EB 4FXPA 4JYBA 5JRJA 1N6PA 2WIBA 3C15C 4R7ZA 2O8EB 2AWNA 3C8UA 2QORA 4KBGA 1UM8A 1A4RA 4MYHA 4IJMA 2ONJA 3VR2A 1IJFA 3DKVA 3R9XA 5EUQB 1M7HA 2WAXA 3KQNA 3FHTA 5J40A 2JLQA 3NBYC 5AR1A 3ASYA 2XSZD 2QPAA 4D0NA 1XEXB 4BQSA 1F60A 3W6PA 3AB3A 3IO5A 3OEHA 4TTRA 1RE0A 5UKDA 4AKIA 4WAUA 1PVOA 1KZGB 1R5NA 1YR8A 1EX6A 1KO5A 4IFBA 2NPFA 2XZPA 2ZYVX 3AGPA 3VX4A 1IBRA 4IFEA 4HUQA 5DI3B 5LDDC 1KO1A 2R65A 3DZ8A 2FFHA 3DMNA 2HUPA 4E07A 3QF7A 4IOLA 4W7SA 1GIAA 2I1QA 4MITA 2O8EA 2WJGA 1FTNA 2OXCA 4Q4AB 4Q9IA 5EQRA 2IUSA 2VTKA 1XBTA 3CZPA 1HYQA 3R20A 2CCKA 4KLZA 4DB4A 3W8RA 2ZI6A 1P2SA 3TSWA 1MRNA 3A1UA 4KHZA 4EUNA 4MRSA 5KSOA 3DL0A 2R6GA 2WJHA 1XEXA 5KYKA 2F7SA 1SQ5A 2YOLA 2A7QA 2HXYA 4KFRA 2DB3A 4HB0A 2Q21A 1W0KD 2OEPA 5EPYA 1P9RA 5CB8A 4AD8A 2ZRPA 3THXB 3PV5A 4EDHA 2FSGA 4CEJB 3SYNA 1HT1E 5AUPB 2C99A 3VTKA 5H68A 5AUNB 4NYMQ 5K8LA 4EPRA 1SGWA 4F93B 3H4MA 2WHXA 3SUDA 1XMSA 3TSOA 3A58B 2PCJA 3QVUA 4WH8A 4HAXA 2IYZA 4FIDA 1S8FA 3N2IA 1N6NA 2JEOA 4ZDKA 1JB1A 5J4HA 1Z6AA 1ZU4A 1E9RA 1RRPA 1QHGA 4B74A 3U1IB 1OIVA 1GM5A 1U0LA 5TVKA 3I72A 1E3MA 2QSZA 4PAMA 2WZQA 2RH5A 5EP3A 2F9MA 2BHRA 4JKIA 1CTQA 1J99A 1YRBA 2FX3A 1QG4A 2JATA 3QENA 1TQDA 4H1VA 1W4RA 4NPHA 4DCVA 3T1TA 2N46A 4O2LA 5DYGA 4DLSA 2VSOA 1C4OA 5G41A 2UKDA 1BMFA 1E96A 2HYIC 2A4GA 3QEOA 3SE0A 3THXA 2A4RA 1IXRC 1RRGA 1QHHB 1E2IA 2ZRBA 4CEJA 2FV8A 3UWOA 5DN6D 1AJEA 2JDIA 1XPOA 1XU4A 4I32A 4JLPA 2JLRA
chains in the Genus database with same CATH superfamily
4XD7D 5G0VA 4WZBE 2NU4E 3ZWPA 2DYKA 3QLPH 2EQNA 3TU7H 3RTCA 2WPLS 2C2OA 721PA 2J4IA 2PFGA 2V0GA 1W10U 1PWEA 5BV8A 3R9KA 4UAUA 1NP3A 3IVAA 4D3DA 4TXLA 3ZGOA 3I78A 1CRPA 4HEJA 5JO9A 3KBBA 2W7UA 2BFCA 1GDUA 2ZJ6A 3O47A 1VCHA 1YACA 4O4HB 4C1NA 2XWSA 2XBYA 1U3WA 4P5EA 2V6FA 2WT8A 3PNOA 4XRGA 3QJ5A 2ZBEA 1N8TA 3UJNA 4HADA 2QXHA 3EDOA 1EDEA 2I9PA 1NZDA 4AG6A 2PHZA 4L6CA 2B6NA 4ZAVA 1AGJA 3RRXA 4KYUA 4XA8A 3GYMA 1Y6JA 3CKKA 2FYQA 2AQIA 2FW8A 2IZ5A 1Y3VA 1IWBB 4X7RA 3D0RA 2HK9A 4AKEA 3S2YA 4PRZA 4X97A 4IRXA 1MT0A 2C57A 2QLNA 3AL0C 1DOAA 5AJWA 4I1RA 4CQLB 1TX4B 2YWGA 3NRLA 3NGLA 2BF4A 1FFXB 3MWIU 2WP8J 4GZ3A 3EA0A 2JAXA 2HIMA 3ODPA 1JGTA 1O6ZA 4XSVA 3W5UA 1O3OA 2J9ZB 5K8CA 3DWFA 3D7RA 1XROA 4BNKA 4UVEA 1X7GA 5G0UA 4EG0A 3FP7E 3MWKA 5IZCC 3ZH2A 3ZWQA 4O2AF 3TBFA 5LPNA 2GVZC 3H09A 4DMCA 2V4MA 4GLOA 1TJPB 1W2KH 1B8PA 5BUSA 3EFHA 3TZQA 3VYTB 4X2WA 4ZQEA 1EWKA 7GCHF 1BC5A 3LY7A 1N36B 1SY7A 2WWWA 4XASA 4CM4B 4IIFA 3P52A 1DXHA 4GECA 4PBRA 3P4YA 4FDVA 5KOJA 4V2UA 4FFBA 3PMBB 2PSDA 3VSDA 4W82A 1TYNA 4IIHA 5IRCD 3RHFA 4DBZA 1ZSNA 3LJJA 1ZCJA 2GYVA 3H9BA 1LBHA 1KAEA 4NQRA 4H6TA 4RNCA 1VGCB 2PGBB 1R00A 2BONA 1X6VA 1VYUA 3OY5U 3B5IA 2NO7A 1NRIA 3AAUA 3ZZ1A 1VSUA 2JA2A 2VSXA 1Q3XA 2EI7A 1N7JA 5AKJA 1ECFA 4A7PA 2ZIWB 4NA8A 1JLRA 1LDGA 2WYGA 4YPFA 1YIOA 3CRVA 4Q93A 3O31A 3BERA 4LJ8A 4ES6A 3RAFC 3GDOA 6GPBA 4NEQA 2JANA 3OJCA 3K94A 2FX5A 1ZRKA 3GJXC 2KE5A 4R0MA 3TG8A 4DDTA 3GLFA 4PYNA 4HEA1 3UJ3X 1U02A 7REQB 1XMOB 1Y1LA 1UCYH 2RI6A 5EC8A 1UMBA 2WK1A 5CLLA 1QVZA 4RM2A 4K1SA 4BN5A 4C2BA 4COOA 4ZAXA 1ZHFA 2V3HH 4Y18A 3LGUA 3C5HA 3EGDB 4G63A 2VWHA 2G25A 4GYYA 4KSCA 2IP2A 3T5GA 1U65A 3FOEC 1U1GA 3J80A 4PZDA 3QVXA 2GD1O 4L5IA 4RX1A 1MH0A 4RL4A 3B5JA 2VK2A 3GW8A 2CHGA 5EPUA 3FPEA 2HHHB 1ZHRA 1EIZA 4X71A 3TE6A 3OTOB 4MUIA 5FYQA 3WW7A 1UZAA 3LGVA 1Q83A 2FPMA 3WAJA 4Q1AA 1P2MA 4YALA 1K1LA 1WNFA 4TQ9A 1QURH 1U99A 3RT1A 1OCEA 3TLXA 4Q9LA 2GCTC 5TJ9A 3OQIB 1P0QA 1T29A 1RWMA 4ALNA 1PSWA 1XCJA 1E2DA 4XB6B 3R6DA 2OXRA 4DLPA 4D43A 5GWZA 3E3OA 2FETA 5H4GA 4BKRA 3BFVA 3A83A 4XH9B 1DXOA 4W5QA 2RGCA 3L43A 1TNGA 2YOHA 1YBHA 4FFPA 3WLPA 2VCYA 3DYVA 5KAPA 2LP6A 4YT5A 1Y7LA 4TMWA 4KFSA 1K4KA 2GRAA 3SYRA 1SEPA 3LQYA 3PGVA 5CLGA 3MGAA 5FLXA 5BSHA 1JHPA 4LYHA 5DWVA 5HCNA 4LF6B 2F9PA 4RE5A 1LC0A 4LXBH 3R9XB 2PMDA 1V35A 1JEDA 4BUZA 2NZUG 3ESBA 5FI0B 3S7ZA 1IQHA 5AW3A 2V8BA 5FPTA 1SHJA 4DR5B 3M82A 3P26A 6YASA 4XLTA 3A4VA 1BWPA 1CR4A 1U2GA 1UWKA 2B35A 4ZYYA 4C2TA 4NG9H 4P80A 2PYZA 3MWGA 2EFHB 2BQWB 3I9KA 1KEKA 5AVJA 1F0TA 4W7HA 4OQXA 1AVTA 1ZGGA 3PO1B 3PF9A 2PXXA 3UO8B 1QQAA 1I3OA 1T4BA 2WVGA 2OHXA 4UTVA 5JDUB 1M2EA 2XCFA 3RM0H 1JXAA 3K9BA 1Y42X 3TB6A 3AO0B 3AW0A 2ZZMA 1L1NA 2VHUA 3EVGA 3HSSA 2F3CE 3ZQJA 1N7HA 4KN5A 3U98H 3E7FA 2BJWA 2VDJA 4YLEA 1QGED 5C35A 5KNCA 3DSGA 1FDOA 2EU8A 3QWCH 2IV2X 3CX8A 3P0IA 2IH5A 2XWJI 3WP0A 1UKVY 5BQ5A 4GR4A 5E1OA 3CCFA 1ACLA 3D8HA 5GJ4B 2EL7A 1KYVA 1H5QA 1GBDA 1IHXA 3AI7A 1UVTH 2H4JA 1MJNA 3PTBA 2CJWA 5AIAA 5EHXA 4ASUA 3CKMA 3PV2A 5BOVA 3AM4A 3H1TA 4OMDA 2R6R1 1UEJA 3GCDA 2OQUA 4LMBA 3DMGA 2ZYDA 4W6ZA 4XTCS 4BNYA 2DPHA 3GXOA 5LSAA 3VH4A 4AP6A 3AB8A 2PA3A 3ROEA 5KWEA 2YDYA 4HX2A 2G0AA 2ANBA 1RVV1 3NKKA 1I14A 3ZYZA 5K3OA 3RQIA 5C18A 3TNDA 1IOEA 1NYLA 3PB3A 1D3PB 4JZEH 5FO0A 3BTWE 4EI7A 2PSEA 2F3SA 5T67A 3DEKA 3T95A 4Z6AH 4MRPA 3HVHA 1VCOA 4I5DA 1CHOG 1MV5A 3AT1A 3H6KA 2G9QA 1HH4A 1WBBA 3I52A 5D8DA 4YQEA 3DEZA 4ESTE 3L7AA 1NQVA 3MTIA 1PDOA 1NJSA 2EKLA 1OAAA 1SHYA 3JSXA 3HH8A 4A1VA 2V9CA 3MS2A 4OQNA 3C6BA 2H52A 2BFPA 4MI6A 5KDLA 4XGIA 4CKXA 2V5VA 4N01A 2JJMA 3SVLA 2ZGJA 1P0SH 2SCUB 1QOPB 1V5FA 4GW3A 4AZTA 2WUDA 4FS8A 1XKAC 4M7WA 2G40A 1QFXA 1EK1A 4REQA 3IAXA 3GLUA 4HRXA 4MWCA 4DRXA 1XC7A 3L4BC 2QTVA 4Y6DA 1Y89A 1LBQA 2QC2A 2Q41A 1OWEA 2GDEH 3NV9A 4OGWA 4NULA 3VR5D 2Y1WA 2BX3A 3PUVA 4MW6A 3ZDEA 1EP3B 3TTYA 2FF7A 2PZJA 1O3PB 2XBUA 4ITRC 5C20A 1QQTA 3PRJA 5KYYA 1R6XA 1JSRA 1GSIA 3BG4B 3FOBA 5LMNB 1MW9X 1PR1A 2ZBVA 4XSGA 5F77A 3PDJA 1NY5A 3UEOA 2YQ4A 3OLYA 3QEBZ 2VWQA 3ATLA 5HRCA 4N12A 3H1PA 1L7NA 3Q3KA 2XUPA 4MVJM 5LZ7A 2XKJE 5HMLA 2FEOA 4OQFA 1DBIA 4JWTA 1X70A 1FF9A 3M4YA 1YZLA 3WMRA 3USES 1JILA 2XT9A 1PD0A 3CWCA 1HPLA 4Q7EA 1SC4A 3MIIA 2Y2VA 1FMTA 4GZ5A 3MTAA 3OZVA 4CF7A 4CRFA 4D4LA 5BR4A 3ANYB 3VYVA 2BFOA 4J6EA 2ZKLA 3LCUA 3KYJB 4GBMA 1UPXA 2IEYA 4J49A 2ZUEA 4JQCA 1TVMA 2G07A 4F86A 3THYB 1V2JT 4OFXA 1RQ2A 3GEHA 3CKLA 4LWPA 2FWPA 1Y63A 3A9WA 4AX4A 2K7FA 4GOLD 3AEXA 3IT3A 5ILQA 1AB6A 2PXCA 2PNJA 2QGRA 5J5VA 1SK9A 5IUKC 5KNBA 4KSYA 3PUYA 2BTOA 4IHQA 3QE0A 1GI1A 1E62A 3EJ6A 4RK6A 2Z6AA 3Q0IA 4KWHA 3SHQA 3F9GA 1QNLA 1M75A 2Y7ZA 2QJFA 1ACJA 1UXJA 1KAMA 2FOFA 3GCGA 3Q4GA 1PFKA 1HGTH 1G3UA 1IN7A 2Y1FA 4LC1A 2Z2XA 1H2WA 5HDBB 3MCWA 4OQMA 4B4DA 3VGPA 3NCTA 2QRLA 2P27A 5K8UA 3HPQA 4TS9A 4HDSB 5C3MA 2WMNB 4UPEA 3VZQA 4PLCA 4EW3A 1I2CA 1T8YA 2YXBA 4R41A 3MH4A 4WGGA 1OROA 1OKXA 1CY8A 4C1BA 3F74A 2W2LD 4CRCA 3CF0A 2ZU6A 4XD7A 1PPZA 3W4KA 1MZVA 1IHYA 2P3UB 2R6HA 1OTHA 2EGHA 3BCSA 1QWSA 1YIAA 3EF3A 1GA4A 4F1KA 2ZWIA 2FN9A 1WU8A 2BVRH 5GONA 3O8CA 3N0RA 4GRAA 4MA4A 1LPAB 1YTLA 1BVHA 5LB4A 3OH8A 1W3CA 3WMXA 3TAXA 4Y9UA 4F55A 1MB2A 1P05A 1QGDA 3QY9A 4RK7A 1RS0A 3TS1A 1SXJD 1CPYA 4X63A 4O6VA 3IPYA 4BO5A 1ZUHA 1T6XA 4KDFA 1E77A 2G8LA 1ZN2A 4XB2A 1XE3A 4R5MA 2ROQA 1EWQA 1VFPA 5A04A 1YOVA 4MKGA 2Y93A 3LXUX 4IHJB 3CCCA 1L1QA 3C3WA 4R4JA 1A76A 2UVQA 2I2WA 3FSEA 3N7TA 2FPIB 3FPCA 5JT1A 1MBMA 2OYSA 3MWYW 2QRVA 1JA9A 1O2XA 4LPKA 3TKAA 2BR5A 4HDCA 2THFB 3VU9A 5ELLA 1GNLA 4ON9A 1BZYA 2CD9A 3IT2A 1U7TA 1ESEA 1KSHA 2DHRA 3CNEA 4UBIA 4K8RB 4QRDA 3TXXA 3W8FA 1E63A 3F2VA 4EUSA 3NR2A 2V7TA 1PPCE 2PZFA 1QHSA 2DG2A 1BQ4A 2O9JA 1DANH 3DMYA 3PIIA 1CRQA 4AK9A 2OGSA 4FTWA 3QDZB 3CINA 4JVLA 2D4HA 4WVLA 4BRZA 3TIGA 1EJAA 4KFTA 3DOUA 2A88A 4BMDA 2KX7A 4WSOA 4AUNA 2H4WA 3CLUC 1FDVA 4Q1BA 3CPSA 4XWKA 3G9QA 2RHBA 4ZCRA 3MCAA 4ZCLA 4ZDIA 1GZDA 1NSTA 2V03A 2HU5A 1YONA 4NMMA 4RIEA 5K6RA 1CS4C 1H2FA 3HCDA 4YAGA 1E0DA 4JGBA 5JBBS 1ZA2A 1P6XA 1MRSA 4WMFA 4RJJA 5TNXA 2BLVA 4MMXB 1GXSB 4CM5A 2ORWA 4JI0B 1JLLB 3IDAA 3FFAA 3WWYA 1ISFA 1UVPA 2XTZA 2Q1JA 5AKYA 4UFOA 4BYMA 3ZV8A 2JFZA 2OV3A 1T9GS 5D5HA 5SY9A 3TRKA 3WNQA 8ESTE 1ORDA 4ZVNA 3ISJA 4JXJA 2M2IA 1RTFB 1GCUA 3CUEF 1U1CA 5ECWA 4ABJA 1CRLA 4Z5XA 2HMYB 5B7QA 4J7AA 1NPDA 3DAYA 1CUAA 4QOFA 2CHFA 2XMPA 3H5OA 1GJ8B 3UV3A 4CLRA 5JFTA 3V2GA 2SGAA 3B78A 1WDWB 2I1WA 4YLQH 2YW9A 3G1WA 1ZEMA 3ENSB 2DMRA 5KSYA 5B1EA 3LU1A 2ZPQA 2C4VA 5DMXA 3L01A 2I8CA 1SLUB 4G25A 4X93A 2CNOA 4KBFA 1Y6QA 3VPDA 1AH2A 1ZY2A 1Y4ZA 3INTA 1RIWB 1Z6ZA 3A87A 5FTMA 3LGXA 4FD3A 1N7GA 2EYUA 1BD4A 1QRAA 3PSAA 4C03A 4WK2B 1DEXA 2EZ8A 1LO6A 3Q87B 4WGFA 3OOEA 5F9MA 3F2GA 1FRFS 3DCJA 1ESDA 2ZIZA 1V2OT 3GLFE 1P9NA 3CHYA 1J4AA 4ITUA 3PHGA 2W7SA 2V0CA 1YMQA 2Q6GA 2CLSA 2H4XA 3OIUA 1U3GA 2JFGA 1H8DH 5F8ZA 1R2QA 3VPKA 5LBIA 4TV9A 5A4FS 4KN6A 3KL6A 5CE1A 2HIHA 4TKUA 4JI2B 3LUCA 5JQGB 3QWHA 3UK1A 3IEIA 1NROH 1V3UA 1Y3IA 3WHIA 3SUGA 1WSAA 1TE0A 2LTAA 1JTEA 1BJKA 1CE8A 2XQIA 1Q6YA 3P96A 3V12A 3ZY2A 3R3VA 4AB8A 1SRRA 1BOOA 2FPRA 1XI2A 4AB9A 4FFMA 1X1QA 5ALZA 2UVDA 4WCFB 3WZMA 1E61A 4QXAA 1N78A 4RQTA 3BTQE 1U8CB 3FLMA 1W76A 2WZDA 1VPDA 5KYUB 6REQB 4XDHA 5A4MS 1K0FA 3SQXA 4QYXA 1TNJA 3O2JA 2NTEA 4D76A 4F3KA 2EKPA 3I53A 1NONA 3D6UA 1O2JA 1GOTA 1M0WA 2VT6A 5I9IA 4EAAA 3UQVA 2ZFPH 2YWEA 2Q5OA 2XE7A 3FTDA 4GI1A 2QEQA 1T32A 2VK1A 1ZIDA 3R3HA 4ZICA 1WR8A 1T2VA 1PK9A 4WCVA 3TN7A 1MKYA 4I19A 4LBZA 3I73A 1NQTA 3PTZA 2PMEA 2ZR9A 1I4TD 2FMKA 5AK3A 2Z57A 5HA5A 3USCS 3R6GA 3VMFA 1WM1A 1EWVA 2ZKSA 4BAOB 5A0CA 1GN9A 2PKXA 3M4NA 1YVUA 1R37A 1PX2A 4I81A 3KYDA 5I9TA 4WUTA 2HIAA 3I8SA 3D8SA 1GKIA 3I9OA 5BMVA 4Q2KA 5ERXA 2ZGXH 4BUJA 2Q6KA 4NBWA 2QUJA 1CUJA 3D1JA 5TS2A 3WG9A 1ENOA 2VCEA 1F0PA 2DH6A 3GFOA 1VHWA 3UW1A 2HLHA 3ZX4A 3ITDA 3AVWA 1Y4SA 2PO5A 1S2DA 7AT1A 4K7JA 4D2IA 4CTMA 4HHEA 1L2EA 4P5DA 5G1NA 1E3TA 1RAAA 1GT91 1V7CA 1F0YA 2J3LA 1I24A 3AC0A 4YUYA 1WWKA 4KYVA 1EA5A 3K2IA 5EL0A 3MCTA 2ZGCA 4MVJF 1E1QD 2JD2A 1YQ9A 4P53A 2CVFA 5FV4A 1CUCA 4A36A 3ICEA 1M2VB 2P6NA 3ZUPA 3FW1A 1LK5A 1UIRA 4MVJE 1UM8A 1WVMA 2ONJA 5JZSA 1F20A 1MQ8B 1HAIH 2G7ZA 3AM3A 4JB8A 5CDSA 2J3HA 3ASYA 1V8PA 4BQSA 1GDNA 4QUKA 2G17A 2NP7A 1U0RA 4DGJA 3ABSB 5DW3A 4ZZIA 3ESQA 4D9EA 1GARA 3H19A 2FFHA 1JLMA 3U56A 4FBGA 1PJLA 4DUPA 4NFYA 4YREA 1O3KA 4WXYB 2I6UA 1I9CA 5MGNA 3CZAA 5K0SA 3DL0A 1SUSA 3QELB 4RWEA 1QCDA 1GHYH 2EY4C 1FY4A 3G79A 1Y5AT 4EDHA 3LQ4A 4RS3A 4A8PA 5H59A 1KQNA 1XMSA 4F4DA 3GQBB 1OIVA 3VTAA 1HJAC 2Z58A 4HN9A 1I32A 1MW8X 2P11A 1NDQA 3AJRA 3QENA 1QG4A 1AOXA 4CL3A 4I8XA 2Q5FA 2YIVX 3E03A 4TWYA 2A4RA 1H2XA 1RZVA 1XPOA 3NM6B 2C97A 3K1AA 1MJGM 1UOOA 1U9IA 5ALUA 3TK5A 5L2ZH 4KNVA 4TLMB 2F9BH 4F4CA 2BDHA 2VJYA 3UJ6A 1W0JD 3RC4A 1NW7A 4I99A 3UMYA 5DM2A 1QS0B 5ADWA 4DCUA 3V1MA 4QGFA 4FGUA 5C7IO 3T7RA 1EJBA 3DB1A 2IPQX 1F0SA 1Y1SA 4JR0A 4DJZB 2C83A 3OE4A 1MB0A 1Z06A 2WJ6A 2CLEB 5EMLA 2CV0A 3CG4A 5A9TA 4AX9H 2GUWA 4UD6A 1RXIA 1B6TA 5ABWA 4AULA 2B7LA 1O36A 4IH9A 3SORA 1HM5A 2EFDB 4J0FA 4D4JA 3SJZA 4G2NA 1IONA 1OOKB 2XD4A 2BKXA 4JXXA 1C7EA 2QBYB 3RU7A 1FX1A 3D64A 2GJ4A 2JRLA 5DO9A 1VJRA 2UXCB 1MAAA 3F7NA 1SGRE 4FGLA 4RZSA 1A1SA 2JBAA 3SJUA 3GEMA 2QE6A 3CLSC 1M6NA 1JIUA 3MUOA 3WTCA 4EP1A 2YS6A 2P4UA 4MQLA 4TVOA 4XZ3A 3EGOA 5MN4A 3O8QB 2WLSA 4IZOA 4D4KA 2VI5A 3MU0A 3QXJA 4FW8A 2NV6A 4M8SA 3OT5A 2IS6A 2VJQA 2OAGA 1Z2DA 3AG6A 4ZI7A 1EVIA 3GJ0A 1WD7A 2O3RA 5JS2A 3BA1A 2BSQA 2GNPA 4X0WU 2GRUA 1XJCA 2W2LA 2QLLA 3W6UA 3NM4A 4H1HA 1Q3HA 3G0DA 4PAOA 3MOSA 3GPDG 3ECSA 4CV0A 4V39A 1RHJA 2G06A 2C4FH 3CNHA 4HD8A 3H99A 4YO9A 1DAIA 4KWCA 4HO1X 5JH7A 4RLQA 1UZNA 1BD3A 5H02A 3I1FA 3Q9SA 4BCBA 4ZOLA 3NOQA 1QJ4A 1CQJB 5AD1A 4B73A 4L6AA 1SXJA 5K05A 3K0AB 5EHGA 4HWSA 5AI9A 1DJPA 4NZNA 4BNXA 3PROA 3O4JA 1J0EA 3FLEA 4RY9A 4JU9A 4DV0B 2Y1LA 3RK1A 2QROA 1B43A 5THQA 5IG2A 1GPWB 3M6WA 1RPJA 4LYFA 1MD9A 4DIDA 5P8WA 1DTSA 2UUOA 4U3JA 3OCVA 2WKRA 1IHPA 4JLWA 1SIUA 3M1AA 4OJKA 1NRJB 3ROKA 3KWMA 1URPA 3PGKA 3UENA 3E9NA 1TTQB 2EJUA 1JRLA 3D8TA 1SBHA 4HNAA 3LQRA 4ZKOU 5IABA 4ZQCB 4DDMA 4TQAA 2OD9A 3FRIA 3RXBA 2ZRFA 3DBRA 1XAIA 2IDZA 3IUNA 4MV5A 1O33A 4LVNA 3MWDA 3RXTA 4LX0A 3HP7A 3W5DA 2NVBA 2I7TA 2QN8A 2OY0A 4JC8A 2GZ2A 3C39A 1Q0UA 5GTDA 1JOUB 821PA 5IXSA 3AM1A 1GQSA 3GLVA 4FGWA 3R3ZA 3GEPA 3T4PA 1T0JB 1XALA 2XYHA 3NNDA 3SN8A 4CU5A 3FUCA 1SGQE 5D51S 1BVRA 1CUWA 1W19A 4D3FA 1X7AC 3ZQKA 5JB9S 5AKKA 4MWEA 2FI5E 3QBVA 4FUEA 1UKEA 4RHUA 1XEWY 2P40A 4Q9HA 4FHGA 1U28A 4H3HB 2WFLB 1T8TA 1TPOA 3I2FA 1KFBB 1WXDA 4KAJA 3EGCA 4EHIA 4KELA 4XWAA 2Y99A 4WN3A 2QRJA 1FY3A 1Z0ZA 1C0PA 2R8OA 1GGMA 2PQ2A 3FBWA 5E4JA 1SHKA 3CT4A 3FFTA 3IUJA 1MZAA 5TC4A 3L1VA 4LQ4A 1DFIA 2OMKA 3KOYA 1JI3A 1NZJA 2ZRAA 5JS6A 3SKYA 1OLXB 2Q7OE 4X1KA 2Z2YA 1FVXA 1TEXA 2FWWA 1C29B 4XTRA 4ND2A 1YYY1 2DRIA 2C3PA 1VKRA 1OPRA 5HMAA 3T61A 4QE3A 3VH2A 1MIOB 1J9CH 2ZSDA 4BLSA 4DB2A 3O26A 4ZHLU 3RMOH 2YFHA 4W99A 1G2QA 3CJQA 4BNUA 2QL6A 1PR3A 2XQVA 5KDDA 4IG4A 2PUXB 4MVXA 5FBIA 3JAWB 4CIVA 3K0FB 1Y3CE 1NVEA 4ABTA 4LZZA 1E92A 2XMDA 2OA0A 3E22A 3D2BA 4AJ1A 4DXHA 2QRQA 1G2OA 5FNVF 4JAVC 1WUNH 3L7YA 2FOIA 2Q3BA 4LWZA 1Z38A 4KITB 1QORA 3BAZA 4PS0A 4MKHA 1K9OE 4GYJA 1ODKA 2BX4A 3G0BA 4ND7A 4M0DA 4J1TC 4LZLA 2PX4A 3DE4X 2I71A 1V8OA 2FFJA 4DQUA 4X6UA 5I25A 2VR1A 4BAKB 3KJEA 1TVKB 1BEZA 1W59A 3ADDA 1DUEA 3E9CA 2BXUH 4DSAA 3ZV6A 1NJ8A 4ENQA 2C98A 5LWQA 5DP4A 2C8XB 1TGTA 1IULA 4RPHA 5J23A 5CG2A 3ZNQA 1UUFA 3DZGA 3P0RA 1W1WA 3RKUA 3ZE6A 5D5PA 1ODJA 2BM2A 4LQLA 1V8FA 1KSGA 5M7EA 3GJRA 2R25B 2NPIA 4FJ2A 3LT5A 1II8A 1VKJA 4GI5A 4G65A 1C7JA 3EJWA 1L1RA 4KQIA 2QTBA 1EPTA 1E7RA 1R4AA 4CFZA 4D25A 4LYAA 5I7EA 3RC2A 3FPKA 3QQPA 1C30B 1DP4A 1A1VA 2NVUA 2CBZA 4OQQA 1O2TA 1ZONA 3BDVA 2NWNA 2QXIA 4F6RA 4TXNA 2IH2A 3DHVA 5C81A 4NTZA 5LYJF 2ONYA 4IF6A 4YJFA 1NOKA 1FU8A 3MG9A 4ZU6X 2PQMA 1QHFA 3MNCA 1W6RA 3NORA 3V9AA 1QB7A 3A3KA 4YOJA 1R1DA 1E6CA 4LQCA 1JDJA 2HNTF 1C5MD 1P5HA 2Z83A 4FJ0A 4NE7A 4ESHA 5DP5A 1IL0A 3FJYA 3O84A 3R5HA 4JHLA 5DM0A 4R68A 3BJZA 3WQSB 3K31A 2YWXA 1LRJA 3EZLA 2GMTC 2F9UA 4JP2A 3K35A 1N0UA 1DRUA 5FI5A 3PX7A 1MC1A 3TD6A 1IAQA 4R84A 2FE1A 2JJYA 2QGFA 4BNWA 3TGLA 4B0OA 3AVVA 2DBRA 2NXEA 4I50F 1EVYA 1RRVA 4E5DA 3O9MA 1OBVA 3ONVA 2QF7A 1XR3A 4W9MC 4DR7B 4LK4A 4DG9A 3TLJA 1GCTB 2I3GA 4KC0A 3CRQA 3RIEA 4AO7A 4MVJH 4IQGA 4KN9S 3TDMA 3Q8LA 1GD1O 3GRAA 2KFWA 1WPRA 4LKOA 1IN5A 2XTJA 1M54A 1Z6PA 3RCBA 2FP4A 4CEIB 3OP4A 3T3DA 2UXBB 5J4KA 1NW6A 4HKTA 1EX9A 3UH0A 1S3FA 1ODCA 1EHCA 3K0KA 5C0OE 1AWHB 3RUDA 4AYWA 5GP1A 8KME2 5C8YF 2G83A 1JVBA 3CX4A 2BFFA 1F7VA 4AAYA 1H4QA 5DNDA 1OYQA 3D4BA 3ZS8A 2FEWB 2ATXA 4ABBA 4M8NE 4NZPA 1XZKA 3CR8A 1VYHA 3L3TA 1WU7A 1WPQA 3OJWA 2V3OH 3UGKA 1TZ2A 1ZUNB 2FIRH 1N2OA 3E9YA 4O9VA 3V1LA 5JBIA 2L19A 3ZVFA 1ZMLA 3H42B 3PGJA 4CTOA 1DKQA 1E1QA 1L5SA 4YB8A 1U7PA 5ALHA 2W3IA 4LC0A 3O92A 5A5VA 3GPLA 1Q15A 4EEXA 2JGEA 4K26A 3EVEA 4CG1A 3U81A 4F56A 1P3CA 2HCBA 4R7TA 3DEFA 4LQDA 1N5LA 2J5RA 1C2EA 3HDJA 2JIOA 1K3UB 2Y9PB 5DG6A 4DVGA 2X19A 4ZYZA 2WYHA 1MORA 5KC8A 1F5SA 2H16A 1RCTE 5CH3A 1M1NA 3PM3A 3RXAA 2Z08A 4XAQA 1I51A 4DCPA 1W93A 1BUIA 3DXZA 3F4LA 4YI3A 3IOCA 2BDIA 4JEIA 1D6SA 4NE2A 2V96A 1RMTA 2QUAA 3LX6A 3FFBA 3CX6A 2IEZA 2ZUCA 3GDSA 2OG2A 5BNZA 1AS0A 5AJZA 2X77A 1X7ZA 4PFQA 4MWOA 5T4FA 5IZ4A 4I8DA 4BGDA 1UZUA 2G5PA 3MS4A 3GDVA 4MYSA 1RI5A 5C5EA 2EFCB 3ST7A 4RV5A 4GU5A 1Q0TA 3E9ZA 4K6FA 4FJ1A 2DWCA 3PFNA 5KYTA 3MNBA 4URZR 3KHVA 2IYLD 3NIDB 4FUBA 2DQYA 3ZZ6A 1R7RA 1W0JA 4GP7A 2FDAA 3MH5A 4AOQA 2FSFA 3IP7A 1EX7A 2R4QA 3P45A 4J0CA 1AQ6A 4A5TS 1LVGA 3UM9A 2W5UA 1RJ9A 2VXYA 1GVZA 3JQAB 2ZHFH 4K60A 1C7RA 3L5OA 5ILGA 1NRSH 4UE3S 1U0FA 3WL4A 1DC6A 1GI7B 5C4IA 5M34A 1PJRA 1UJ2A 1TPPA 3CM0A 1Y4AE 4YMLA 1Z7BA 3S1SA 5EJZA 3V7UA 1WL8A 1YPGH 5H3CA 1FW8A 2WJYA 1EAIA 1L9XA 4KQ6A 4LV5B 1EB8A 3VC7A 1KJQA 3ZTTA 5LOVF 1F2DA 3HFJA 4WCDA 4IINA 4P32A 2CMHA 2ZG0H 1AN0A 2A84A 3MTGA 5TF0A 1HT2E 1BGVA 5L6MB 1LNZA 5DP2A 4QBHA 3RK0A 3HJRA 2WPIS 1E2UA 1N0VC 1TYDE 4BFCA 3RRMA 1SSXA 1G36A 2XC0A 2WE8A 4GNRA 1NYRA 1K7CA 3OE5A 3S7KB 2Q7DA 1OWOA 3A84A 3VYSB 2FWBA 2B4KA 2PQ6A 3HJAA 3TQIA 3FFWA 2VVVA 4TXHA 2H5DA 4XWGA 3LH5A 5JZVA 4RPLA 5EXEA 4FHDA 1QVWA 3HPRA 1SQAA 1QQBA 5K8IA 2M6KA 4Q4AA 2NVOA 1R16A 4HC4A 2AOTA 1U6KA 4ZAWA 5C1XA 1AQJA 3BIFA 1WVGA 2CHEA 1NLYA 2A5FA 3PDHA 4JSYA 4K9SA 1CJVC 1R4NB 2QN3A 2BR3A 2GD0A 1M2FA 3HKCA 1QR2A 5H0IA 4GVXA 5AQEA 5C5OA 5IWAB 3MWEA 3REQB 2PS9A 2GJGA 1Z62A 3U4MA 1PFYA 2KB0A 3EPHA 4A8JB 3G8DA 2RHDA 1XEAA 3IO3A 3MI4A 3BE4A 1L5NA 4NU0A 3V8MA 4I7EA 4HNQA 2A1TS 1FXWF 4LRQA 2M6LA 3RU4D 4QJIA 3REGA 1L5LA 3DXYA 1KS2A 3DCLA 4MV4A 3U8OH 4ZVRA 4I1SA 1CVLA 5DSTA 2YS7A 3P32A 1ZTLA 3CJTA 1SU7A 1M6VB 4UMEA 4XYGA 1WB4A 2WM8A 4XVQA 2EW8A 3E27A 1HNXB 4W5HA 2TRMA 3N0WA 3I77A 2NUPA 2YXEA 3I0ZA 1SVKA 4PW0A 4OI0A 2BMFA 3VU0A 1V11A 4RJIA 3KZCA 2BMJA 5A9SB 3KZMA 3VSAA 2R66A 4F72A 4YQFA 2NTNA 2ECKA 1ADYA 5JAIA 4NGAH 3DLAA 3UWPA 2BY6X 1T13A 1VKZA 1F2UB 4ZT3A 1A7SA 1O6FA 4J4TA 3TZBA 4YACA 1AKVA 4JZDH 1EKXA 2YVUA 1SXJE 4JI3B 1MPXA 2YXLA 2O8DB 2QKYA 5JPDA 4WZAB 5AKXA 2F43A 1ZK2A 4P31A 3S8MA 4DC9A 1RPTA 2CWWA 3MNXA 1YKSA 3RVMA 2IZ1A 4ZKSU 3M34A 3ZKWA 3EOBI 5HRUA 1ZHPA 4C0AC 1Q0RA 1R9NA 3EVBA 2GZDA 2CJFA 1NNUA 1DITH 1UPCA 3FYUC 3KS9A 4CCSA 1FXUA 1HA3A 4Q4JB 3OIVA 5KTYA 2IKQA 1SKQA 4J94A 4GOMD 3L6BA 5A9RA 4NOMA 4AG5A 4Y7DA 3CIOA 5DISB 5F1KA 2HJWA 5CIYA 4WDRA 2CLLB 1L4YA 1ZIYA 3GDFA 5HKLA 1E9SA 3SM9A 3K70C 2QYIA 3PA8A 2BIFA 1P2UA 5LWHA 2HA2A 1F48A 2BFBA 1QZTA 5SICE 3JZMA 1JQAA 2Y5HA 3UJ7A 2RH8A 5CFLA 3FZEA 3SNBA 4KQEA 4L5BA 1HZJA 4L0MA 3TTUA 1RCFA 1Z22A 3U5ZB 3KHKA 5CNMA 1NG1A 4J4BA 3LDXH 2ZS7A 2FI1A 1ZWLA 3LG2A 3ZBPA 1SKBA 2GX4A 2YBDA 1LV7A 1U31A 2IE0A 2FA9A 1H5NA 2WUEA 5COQA 1E6WA 1CDZA 5JAQA 1HRDA 1OA0A 3AZQA 3LF1A 1CY4A 1SULA 5HR5A 1Z7GA 2ZUVA 1A69A 4OQZA 1I94B 2QVYX 3AERA 1AZWA 4US2R 4C7JA 4RSRA 2B5OA 3ELUA 1A9QA 2HIGA 3B1VA 2QMYA 2HMTA 1POWA 4ZMRA 4YT6H 3C8ZA 3O3MB 3P9RA 5AK6A 1GG6C 3JY6A 3B8JA 3LLUA 4ESEA 4I1IA 2FKAA 4RGBA 3LOQA 3OD5A 3ZZ3A 1SLWB 4P98A 3F9HA 1LMWB 3FMIA 5AXCA 1CVRA 2WMOB 4LOIA 4FFOA 1JNYA 2JCVA 1B6GA 2BD2A 5KJCA 2CGEA 3MWJA 1UK9A 1NV9A 3F8TA 1ULHA 3WADA 2DM6A 4DJDC 4JEUA 2F83A 1SN7A 2CFSA 1NESE 2R2WU 2PKEA 1UBGA 1G3CA 3PU6A 2F9FA 5GGYA 2DE9A 1NN5A 2A33A 4B6OA 4O2BB 5LGOA 5G3ZA 2HUNA 4CKYA 1RTLA 5E9QA 3ZHSA 3VB3A 3DMHA 3RS8A 3BXGA 3T7AA 4DLZA 4ABEA 3PRDA 2FMXA 3SU4A 3TIFA 2QTGA 3T15A 1YS9A 1FTQA 2KM0A 3NT2A 2GEFA 3AP2A 3Q1KA 2LBPA 1AHTH 4CLHA 1SVIA 2A1IA 4PS1A 1IMJA 4PFKA 1C4Y2 4B44A 3UJCA 5FI1B 4KQGA 4EABA 2FEPA 4H7HA 1ZWKA 4YN3A 1V96A 2VP9A 1MEEA 3GA7A 1C2FA 4L95C 4I55F 2RHTA 1T36B 3L6RA 1TX7A 1D0SA 2ZWPA 4E21A 1EE9A 4FXPA 4N4AA 1FY2A 3C8UA 5LPRA 2PZLA 4E0BA 1V37A 2B3TA 2BDBA 1QMPA 3NOVA 4WH0A 5I5GA 1VSQA 1C5OH 1R0SA 4ZAFA 1K7FB 1KZGB 1EX6A 1I1QB 3L6OO 2ZG6A 2BD7A 3AEQB 3C3BA 1XA4A 3N3BC 4ZGBA 1SMFE 2W26A 4YAFA 1SKUA 1WSDA 1UT6A 3U40A 4BJ1A 2F7SA 3HBAA 2ZRPA 4ADSG 3TFWA 3C70A 1UBRS 2PR7A 2Y76A 1SM4A 4XLZA 3WISA 2AS9A 3BIOA 4RBNA 3Q6MA 9ESTA 4OFBA 3PI7A 5ALIA 1GMCG 3VVLA 1YRBA 3PQ3A 3T1TA 4O2LA 3WGNA 1RWWA 4RYLA 1E96A 3H4TA 3CMCO