4B6EA

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
646
structure length
645
Chain Sequence
b'ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVTGSVVIVGRIILSGSGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 202
structure length 645
sequence length 646
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b6eA04
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b6eA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6eA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6eA02
2GKSA 4V0MA 2J5XA 3CNNA 2H1LA 1OFIA 2QQEA 2OCBA 2GWHA 2HT6A 3CF2A 5FUXA 3HR8A 2ZUDA 3K0CC 2YWEA 4FINA 3K70D 4K81B 5AWFC 2RMKA 4C2TA 3K0AB 3ZVNA 4G0NA 1TQDA 1KMHB 1NKTA 2AD5A 2Z83A 2N1BA 5EXPA 4R71A 4DCTA 1R0YA 1SVKA 4MRSA 4FMCB 2F6RA 4P33A 3SUGA 3U4QA 1AZSC 1G20E 1R0WA 4KFRA 3PV5A 1KSHA 3A8TA 3MG9A 2P5SA 2XZOA 3SU1A 4AYWA 1OJLA 4TLDA 3C14C 4RCYA 2XXAA 3CRW1 2WSSA 1N0VC 5LD2B 4U7DA 1IY1A 4GL2A 1ZCAA 1ZJ6A 2F3RA 2G1KA 2XSZD 2EWVA 1FUKA 5BW8A 1OYWA 2I1QA 2O8DB 3JZAA 4KFSA 3GLHE 3QNUA 2F9LA 2C04A 4Q4LA 3VAAA 3QKSA 3GJ7A 3F3YA 1A2BA 4PO8A 2PZGA 4BFVA 2GAAA 5CIWA 3QKRA 4TLEA 5H8WA 2ZU0C 4HEJA 2JJ2D 5JEEA 1AJEA 2D7DA 1VIYA 2F3TA 1Q12A 2AWNA 1VG8A 3KTAA 1KZ7B 2FPKA 1E0KA 2XTMA 5HR5A 1XEXA 3UKDA 2R6FA 4N3NA 1A5TA 5IDVA 3V00A 5HPYB 3T5DA 2A5JA 3IBGA 4Q7JB 3GCGA 3GEEA 4L5BA 1OB5A 2D62A 3LRPA 4CGZA 2GRJA 4NYIR 3VHXA 5KPJA 3B1WA 1FQKA 1IXZA 5EE3A 4B3CA 3BB3A 5F9FA 2J7PA 2Q0HA 1KI7A 4OHXA 2VF7A 5DNYB 2OILA 3KUCA 2Z0MA 4FN5A 5FFMA 2XJ4A 1EFTA 1I2MA 5FUVA 3U5ZB 5E95A 2D2EA 1NG9A 4ACBA 3IQWA 1E99A 3R9WA 5FOXA 2DWPA 2H16A 3MFYA 5DISB 5FUYA 4M2LA 1VTKA 4BFTA 1CR2A 3SJBA 4P3YA 4KSCA 2IYRA 4PQFA 2ZEJA 2KJQA 4OM9A 3PUXA 2ZETA 4HAWA 1RVDA 2FSFA 4LUCA 2IS6A 1E6CA 3BE4A 5EP3A 1S3GA 2BM1A 1TQ2A 3TSWA 2R6CA 2NTYC 4OHWA 5BYKA 2I3BA 4E07A 5JHHB 3P4XA 3K70C 3UANA 1HEIA 2G88A 3AVTA 2JLXA 5E3HA 1U8YA 1CXZA 3DHWC 4U5XA 4MH0R 5GJVC 1VG9B 4M9XA 1NY5A 4GP7A 3LDAA 3EZFA 2ODWA 1DPFA 1EFRA 5CLLA 1JPNA 2QP3A 3BK7A 4W7SA 1M74A 4ZI3A 4TLAA 2QE7D 4OK6A 1ODFA 1Q57A 3BFVA 4PO9A 3TIFA 4C2UA 2EFDB 4TTPA 1YZKA 3KJHA 2DR3A 4GMDA 4I1VA 1P2UA 1S9HA 4MKHA 2QBYA 4HLQB 4Z1MA 4UJ5A 2F43A 2ZRNA 4AWXA 1B23P 2IUUA 1E4VA 2ZVQX 3WP1B 3WYAA 4TYWA 1GILA 3TKLA 3U6BA 1HY3A 3I8XA 2CLDX 4GBMA 1KAOA 4YDHB 2P5TB 2GZAA 2R6DA 2Q3MA 2PZEA 3SU4A 1XDBA 5DYIA 4EPRA 4E5UA 1N6PA 4Q47A 4GOXA 2RGGA 2ZR7A 3GJ6A 4KV9A 5IK2D 3SJCA 4KJZA 3AQ4A 3CUEF 2V7QA 4LJ5A 4JSTA 5G53C 1P4SA 1T5IA 4YMSA 5JWOA 1QRAA 2QAGA 2AWOA 3LD9A 2FEMA 3QOFA 3BAFA 1P7CA 1UM8A 4MKFA 2WWGA 3AGQA 3KN2A 1E1RA 2O0JA 2G83A 1H8HA 5FOTA 4BLPA 4JLMA 4ASUA 2NQ2C 4WIAA 2P3SA 3U7FB 3IUYA 5KPDA 2GESA 1OYYA 2O0HA 4BE7B 2CCGA 4C0HA 2QP9X 4GI7A 3FHTA 1XD9A 4GZMA 3T34A 3SYKA 3HP1A 5FL7A 2UZ3A 3HU2A 4BRUA 4DIDA 3ECCA 5TB5A 1P61B 2IEZA 1ONBA 2IT1A 4R98A 3B1XA 3TE6A 1MABA 4R2IA 1Z0DA 1CTQA 1W0KD 2GCOB 4LHYA 4D4JA 1NVVR 2VHQA 221PA 4HUTA 5HZKA 1YR9A 2PT5A 1JEDA 4KAXA 2HYIC 3QUSA 1RTLA 1KDOA 1II9A 1Q1QA 2KE5A 2WIBA 4HI0E 2WTUA 2O8FB 4JSYA 2CL7X 5EUQB 3LQRA 4EDHA 1NJGA 1FTNA 2F1JA 3RS0A 3R8CA 1E2EA 1MT0A 3OYPA 1U0LA 1GKUB 4BLSA 2FNAA 2JASA 3B82A 4H1VA 3EA5A 1HUQA 3PIRA 4AG6A 3B1YA 4Q7MB 1SHZA 3EZ2A 1ZUHA 1F6BA 3AP2A 1Z0IA 5L3VA 4YXWA 2UKDA 2ZR0A 4V0OA 4NONA 5TDHA 1G8GA 2DCUA 4N1AA 5D3MA 2W6JA 3QF4B 4DLVA 2K1QA 4B6FA 2NPIA 2IJD1 3EIQA 3SHWA 1NIJA 2EFGA 4LSGA 2H92A 3WHLA 4HAVA 2VIIA 3PVSA 3AP3A 4RVCA 5GJ4B 3ZZTA 3PEWA 4QJ4A 4G5GA 1XMJA 1Y63A 1QHSA 2RGDA 4DCUA 3GFPA 2ZRCA 5GPIB 5L3QB 3X1YA 3MRSA 5FPSA 2BCGY 3I72A 2C99A 1JECA 2JAQA 4ON9A 4LRWA 1Z07A 2FV8A 3T1OA 1KO7A 2KWIA 5KOYA 2ZIAA 2ZS9A 5DLQC 3ZVMA 1UDXA 1VHTA 3BB1A 1Z6GA 4M8NE 3IO3A 4MRNA 3NC0C 4Z8YA 1XNJA 5JSZB 2XZPA 3O8DA 1RKBA 4TTQA 4OL0A 4D2IA 3L0PA 4EKDA 3QPWA 1AM4D 4AYTA 3A1UA 3TW4A 2ORWA 5F9HA 4PZZA 3DVLA 2FFQA 5EE0A 3AF2A 2AXNA 5KTYA 4JVSB 3NHBA 2LWIA 2Z43A 1G3QA 1U98A 2ZM5A 1L7VC 1GM5A 3FKSD 1YR7A 4WOPA 3RNLA 3Q9LA 1AKEA 4KHZA 5B64A 4JBWA 1F2UA 3DKVA 3U7HB 4OQMA 4IOKA 1N5LA 1KKLA 1TEXA 2QUZA 3P20A 4M1MA 4U00A 1E0JA 1XTKA 2GAOA 4H1UA 4LV8B 3RANA 2B8TA 1E9DA 2G6BA 4W5HA 3UG6A 1W48A 2DWOA 2QT0A 2VHJA 3V4RA 2WWXA 1FTSA 3FE2A 3SDZA 3U3OA 4Z54A 2JLZA 4F91B 1ZNXA 5IT5A 4WZBE 2FA9A 1SZPA 2HF8A 4B75A 3F8TA 1R10A 3RRYA 3U4QB 5HZHA 3U44A 4OKSA 2JJ2A 4OI2A 2ZYVX 1G7TA 1MRSA 2VF8A 1EK0A 3M6AA 5JJLA 2ZE8A 4MRVA 4TTRA 1COWD 1JPJA 1W46A 2XXAB 2KBEA 4I1OA 4Q7LA 3WXMA 1D6JA 3SU0A 4CEHA 4UXHA 2YV5A 2CMKA 3TGPA 1JAHA 1KAGA 1T3LA 1ZD8A 3N2EA 2BBOA 1G4UR 3PQCA 5HE8A 2ZAOA 1PLJA 4W5WA 1NLFA 3PXGA 1H8EA 2OM2A 1LNZA 3QG1A 4Q4HA 2OFWA 3QKSB 4V0KA 3U7EB 4D4KA 3RSOA 3EZ9A 1HURA 3OF5A 3QKRB 4EJSA 2RGNC 3ZDQA 1NVWQ 2K5UA 4XSHA 1WB9A 1E3MA 2P65A 4LYFA 3X1WA 2ZRGA 2P59A 1ZNWA 2EYUA 5GNDA 3KTAB 3K0FA 3LLUA 3U1JB 5DGXA 4XWKA 1DADA 1M1YE 1XEXB 2GBLC 2IYWA 4TSFD 4OHYA 4KCGA 2XCFA 4LJ8A 3PFIA 4G3XA 2QI9C 1G6HA 3P26A 1E79D 4TLBA 3NH9A 1XJQA 4A1FA 4BWYA 4A1XA 2GF0A 2R8RA 4JJZA 3EWSA 3I5XA 2QRZA 4C3ZA 5FTMA 2QEQA 5CB8A 1MO3A 1UADA 4Z8XA 2GVFA 2PT7A 3EWAA 2P6NA 4NP6A 4B2IA 4EAQA 1D2EA 1OKKA 1UEIA 3SYLA 3KJGA 3BFKA 1IXSB 3RLFA 3L8ZA 3UMSA 3AF1A 1PJRA 1KYIA 4IVPA 3NXSA 4Q03A 1KI1A 5JWRA 4CW7A 3HDTA 2O8DA 3A4NA 2ZRIA 4OQFA 2D7CA 1QBKC 2C9YA 4A6XA 4A8JC 4JLOA 4QHTA 2B21A 1ANKA 2B8WA 1W36C 5TMPA 1XBTA 4OJQA 4WW0A 2CLSA 4QHSA 1N0WA 2FX3A 4NYJQ 3M5NA 1T91A 2AK2A 3X1ZA 3UIEA 3RS3A 3ETLA 4CF7A 5SZJA 4OK5A 2REOA 2WSSD 2VH5R 4MA4A 3AM1A 3VR2A 4G5RA 4JIMA 2W6IA 1G5TA 1DAHA 2JJ8A 2W83A 3GEHA 4MYHA 1KIMA 2FPLA 3BB4A 2PMKA 3FVQA 4WBSA 1N0UA 4Q21A 5B57C 3K9NA 1NL3A 3TJZA 1VDZA 2QZ4A 1JBKA 3WYFA 3QEOA 2YKGA 1JQLB 1QHYA 4B47A 2X2FA 2QSZA 4G5SA 1E1QA 2PH1A 3EPLA 5K8IA 4C7OA 2D3WA 2DPXA 4NPHA 3PEUA 1ZAKA 1R0XA 2XOKA 2ZSBA 5KU1A 2QBYB 4CEJA 2F43B 2VSFA 4ACAA 1W2HA 1ZIPA 2ECKA 4JYCA 3LKWA 4I32A 1AQYA 3VU9B 4Q9HA 4MITA 3LBIA 2FZLA 4XIGS 2NG1A 3ZVRA 3P32A 4Q18A 5BWMA 3GLGE 2IXEA 4PHTA 1UPTA 3QKUA 5JECA 2OO7A 2FWRA 5CITA 2J7PD 4Q7KA 5TXGA 2E87A 1GL6A 1EGAA 8OHMA 2AKAB 1LFDB 1X8LA 1XMIA 4LCBA 2QAGB 5DH9A 3SI7A 4R2HA 1ZD1A 2JEOA 4A15A 1FNMA 1NKSA 3C41J 3OEED 2A4GA 2ZJYA 1QZXA 2FPMA 1OPXA 1K5GA 4BFYA 3LXXA 5K8LA 1BYUA 3KKQA 4Q1DA 3OIUA 1P62B 2A4QA 4QJ3A 4TLCA 1RFLA 3REFA 4DCSA 4IEEA 5FPKA 4B34A 3U1IB 2RHMA 1E2KA 1DVRA 4MYUA 4NHOA 3QPVA 1U9IA 2ZROA 2ZSDA 1KO8A 5GVSA 5SZIA 4BLQA 4L9SA 3CF6R 5EE5B 1SVOA 1XEWX 2ASEA 3KKOA 1ELOA 3SUFA 1G8HA 3L0IB 3Q7QA 4KODA 2W58A 1MABB 4M22A 4S35A 5J5CA 5JCPA 3GLFE 1U90A 4R9UC 3CNOA 3W3AA 1EFHA 1KI2A 1RYHA 1WRBA 2FU5C 1M7HA 3BRWD 1EFRD 4B3FX 3B6EA 3NDBB 3LBHA 3IIKA 2WOJA 1U2RA 4NDZA 4JL6A 4Q1AA 3TAHA 1OH8A 1W5SA 5FBRB 4A0HA 4MGYR 4US0R 5B30A 3SU2A 3FMFA 1SULA 4Z1MD 1E9BA 3PUWA 5C18A 2NO7A 3UK6A 4B76A 1WMSA 4PC1A 4OHZA 4MKIA 1JJ7A 2CHGA 4ZKDA 2GXUA 3K9LA 1W5TA 5D3MB 5FTKA 4QNMA 4KLNA 1Z0JA 3TSOA 1CJUC 1UKZA 4PC3A 5D3QA 1SXJE 5B6LA 1OSNA 5FOSA 1SKYE 3ADCA 3EPHA 4GOJA 1TNDA 3AVQA 4NU0A 3G5UA 2O5VA 1DTSA 4M9SA 1AA9A 2ORVA 2ZVPX 2V7QD 1G4AE 3K0EA 2XNIA 2FSHA 1EXMA 3ZQ6A 1W0JA 2P2LA 3BWDD 2GCOA 3GJ8A 2MMGA 3LNCA 1E1RD 1JR3A 3QXCA 4QBHA 3SQXA 2WJYA 1H8HD 2Q9AA 2ZUCA 4ASUD 3HU1A 4PFSA 2YNMA 2RH5A 2C78A 2VRWA 1Q44A 2QMOA 3HPQA 4ARZA 3RS2A 3WNCA 1N6KA 4OYHA 1W7AA 1SVWA 2QG6A 2QTFA 1GKYA 3DM5A 1AGPA 4LC0A 4LJ4A 4Q19A 5FL7D 2ODBA 3WNDA 4WZ6A 3CWQA 3I32A 4TN1A 2ONKA 3GLIE 1L4YA 3NEYA 1EX7A 2QGNA 2GJ8A 5A0FA 2J46A 1ZU5A 1E9SA 2ZI5A 1UBEA 4LHZA 1F60A 2W2XA 4HAUA 3KKPA 3BFXA 4TL6A 4WH6A 4YDSA 2FSGA 4BEJA 1UBGA 3MCAA 4UKDA 1KO5A 2D06A 4A4DA 1DXPA 3KQUA 1KI4A 3IKJA 3PEVA 4WF8A 4BRWA 4LI0A 4S2EA 2CL6X 2Z4RA 3RC5A 1TADA 3FB4A 4DDUA 3OAAD 3FWYA 3IBYA 4YLGA 5DN6A 4AURA 1XXHE 3PUYA 1F2UB 3GFTA 4BFSA 1M8PA 2XGJA 2E1RA 3NTUA 1US8A 1W1WA 1IN4A 4GMXA 4CT4B 2BBSA 2ZUBA 3AB3A 4KXFB 1OH7A 4YXWD 1GNPA 2QORA 1DEKA 1G3IA 3ASZA 1HQCA 4EFNA 4HATA 2W6JD 2X2EA 2OSBA 1ZW6A 4C9BA 1R6BX 3U44B 2IYTA 1A7JA 2J0VA 4BZQA 2BC9A 4GSYA 4TL7A 5CDFA 4A1TA 2CHVA 3EC2A 4P4SA 2IYSA 4GNKA 1CULC 3OIVA 4NCJA 4TMVA 1BKDR 3BOSA 4EQ6A 4TSFA 5J4LA 4CEHB 2V9PA 3Q3JB 5AJVB 4G5QA 1CRPA 2H5EA 1E79A 2EYQA 2RB4A 2FP7B 1R2QA 3H4MA 4AI6A 4KVAA 3IIMA 3W8NA 3ZS9A 1CR0A 4Q4HB 1T8UA 2IXGA 4Q01A 1JAIA 1DARA 4EJSB 1E9RA 4KBFA 1OIVA 3KZ1E 1P75A 3VNUA 4K8BA 2JIZD 4XD7A 5FI1B 4YC7A 2QAGC 5DI3A 3DMNA 3H2YA 4ZCLA 4W9MC 3EZ6A 4FMDF 1P5ZB 3K0FB 1CJVC 1Q1BA 2GNOA 4OI0A 3B5JA 3WBKA 1U94A 2QNRA 5AUNB 3SV9A 5EP1A 4TT3A 3AF0A 3FDIA 2C9OA 1OV4A 2WHXA 1VIAA 2ZU6A 5M04A 3AF4A 3AH8A 5IRCD 1YHNA 5DIFA 3QKTA 5JBQA 5EZ6B 3RHFA 4BEBA 1VCNA 4WXPA 3AUYA 3AEZA 1ZM4A 4FMBB 4WZAE 4F4JA 4FXPA 2QGZA 3RRNA 5E4FA 4QRHA 1V43A 4LGMA 1KO4A 1N5KA 3LOXA 2RGAA 1NN1A 2OCYC 5KDOA 3E5HA 4PTLA 4GPTA 1KJYA 3W6PA 1XTIA 1YRBA 2C2HA 2FGKA 1MKYA 5F98A 1HT1E 5BN3A 4TMWA 3D7MA 4IFEA 4A2WA 1LTQA 3VQTA 3EYDA 3C8UA 3TMKA 5L8VA 4POAA 3LONA 2F1HA 5HCNA 4CZ2A 4EPVA 2GK7A 5H68A 1E9CA 2HCBA 1RRFA 5CJPA 4I1SA 5EQRA 2E9SA 3TK1A 2VQSA 2WM9B 3X1XA 1E9AA 4IXNA 4F4IA 4M1YA 1ZINA 5ESBA 3F5FA 2HXYA 4QJ5A 2DFTA 1YZGA 3UPUA 1HV8A 4BFUA 4OJKA 1Q1ZA 3K1JA 3MUFA 4A0GA 1M2OB 5JS7A 3AP1A 1SGWA 2FE4A 2JGNA 1Z28A 2IS1A 2YOLA 1E32A 4X8HA 1E2HA 1H8ED 2CVFA 3FMOB 5KDLA 5A4JA 1C4OA 1MH1A 2L0XA 2QTHA 4CDGA 1QHHA 4O2RA 2JJ1A 4Q00A 2A30A 3ZS8A 4C7OB 2ZJZA 1G19A 1OXXK 1RZ3A 4CEJB 4PPQA 3U7GA 3EXAA 3OEEA 2JLYA 4CEIA 2IA5A 2HLDA 2O52A 3IO5A 4AIIA 4PPNA 3FMIA 2IJOB 3KQLA 3EASA 5FUWA 2Q9CA 1KK1A 5FBVB 1A82A 1S3SA 1G17A 4CT5A 3A1SA 3M0EA 1MO4A 1IM2A 2WICA 1JJVA 1N6HA 1Q3TA 1GTVA 3QBTA 3QQ5A 5TV2A 3GP8A 3B1VA 4HB3A 1MOZA 1OB2A 4WA7A 5FTNA 1OKKD 1VG1A 1ZRHA 5CIQA 4JLDA 2WIAA 3FKQA 2A7QA 4PQRA 2BMEA 4X8MA 4I99A 1UBFA 3GMTA 1T3SA 2H57A 1GFIA 1ZD9A 2GJKA 3BH7A 4HLCA 3GJ5A 1NLYA 1VCIA 1YR6A 2RAPA 3DDCA 4AC9A 4C0AC 1XX6A 1SXJA 2R6AA 4NMMA 1W44A 4HZUB 2BMFA 2A3RA 2AFIE 2NMVA 4XJXA 3BORA 4PPFA 3QF7A 1O3YA 3JVUA 3WBJA 4ZV4A 1DBSA 2RGXA 1NLZA 2LKCA 3QIAA 4Q02A 1XTJA 2IL1A 3VU9A 4D80A 2W6ID 3WHKA 3N2IA 5JI3E 2ZRMA 2OBOA 3B7GA 5EJEA 4FCVA 4PHGA 3K09C 2VYFA 4KFTA 5EQSA 4LJ7A 3AVYA 4RI0A 3FYHA 2FMXA 1G7RA 4TQAA 3CH5A 4URZR 4PZYA 1L2TA 4HAZA 5JMTA 2BBWA 1U0JA 2FFHA 3U3RA 3CR8A 1E1QD 3IQXA 3MWLA 4CRWB 4DDTA 4A36A 1JALA 1M6NA 4O0MA 3KXIA 3QSYA 2XOKD 1HYQA 1NP6A 3SC3A 1G18A 3QVUA 1TF5A 3SU5A 1A4RA 2UZIR 2O0KA 5KO2A 4NWKA 4PZLA 4P0TA 5SZHB 2DFLA 2D4HA 5JJIA 3TUZC 4PAOA 2LKDA 2IS2A 3IGFA 3CRVA 2VTKA 4DEYA 5J4HA 3W6NA 4OHVA 3KNXA 2ZS7A 2HV8A 2JLUA 5E7JA 4IFBA 5TVKA 4EPWA 1BMFD 1ZC3A 2GEVA 4A2PA 2ZYWX 3CX8A 2NPFA 2XTNA 4TQUS 5AJXA 4RY2A 3ICQB 4V02A 4AKIA 5L3SA 2W0MA 3RS5A 1DG1G 5FI0B 4EPYA 1G8YA 2C77A 4XSGA 1VCMA 2CEAA 4AK9A 2WWHA 4NH0A 4NYJR 1CU1A 1OXUA 3MWJA 4GFDA 4ARZB 3OAAA 3R8FA 4JVNA 2O8MA 1Z6TA 3ZLJA 1SVMA 2GJAA 4GDFA 4XOIA 2YOHA 3L2OB 2QT1A 4DC9A 2QQ0A 5F2EA 4DLYA 5LD2C 1G7SA 2KI5A 1TEVA 2HUPA 4ZCIA 3UG7A 4RZ2A 2WSMA 3HR7A 2DBYA 1UKYA 2OEPA 1D9ZA 5ETXA 1D9XA 2IW3A 4RD2A 2OT3B 2WBLC 5H1YA 3DZ8A 4Q66C 2A5DA 1XPOA 1A1RA 4DB4A 3W9YA 3H0KA 2GEDA 1CP2A 2WJHA 3PENA 4JLJA 3SV6A 3KL4A 1UBCA 1QG2A 4HB0A 4RKEA 3QJYA 2ZRKA 1GUAA 2IYQA 4HYYA 4M4SA 4US1R 1L8QA 3WMEA 4D82A 4DLUA 1BOFA 1JEEA 3SQWA 2J0SA 1GDDA 1C9KA 1US8B 2ERYA 2VEDA 1G7CA 2HT1A 2R62A 4TYYA 1IN7A 4A92A 4CYMA 2MMCA 1KI6A 1CJKC 3WNBA 2F4LA 2CCJA 5FOVA 4DCNA 2C5LA 4IDPA 2XCNA 5C4MA 1U81A 2RHDA 2HJVA 4O25A 2WWIA 1NSFA 4MKGA 4YMWA 4A82A 2C9CA 4NCIA 4BLRA 3OEHD 2XB2A 1G41A 5EQTA 3SZRA 2JIZA 2A5FA 2REBA 3VKGA 3L6PA 1EFCA 1AS2A 2PX0A 2ZI7A 4P4SB 4UNSA 3VNVA 5K8TA 1NSTA 1NF3A 1QG4A 1W0JD 2YYZA 3HPRA 4DB2A 1P2VA 5EP2A 4MRRA 521PA 4EQ6B 4TMTA 3LY5A 1JR3D 5EZ5A 2C03A 5FPTA 4JS0A 4HUQA 4DLRA 4L4UA 3GLHA 1S96A 1Z2CA 1OH6A 1Z83A 4TL8A 4RFSA 3RS7A 2X1VA 3WYGA 3SU6A 1H65A 1N25A 4UNNA 3I1FA 2OC1A 3CPEA 2FM2A 2VHCA 1Q1EA 4NCNA 3C5HA 4M53A 1GG2A 1XRJA 1XJ0A 4JLVA 5DI3B 4BFXA 3NBFA 5EE9A 4KYUA 5KSYA 4QL3A 4B35A 4M9ZA 1E2DA 4KITB 3KEEA 2W2VA 3L82B 3N70A 2R6GA 3CO5A 1JQJC 4URVR 3THXA 1ZM2A 4JLBA 3L0SA 2O8CA 1ZIOA 1KI3A 1MV5A 4D4LA 1ZMXA 5AUQA 5CYPA 1K6MA 2OG2A 4F38A 3M5OA 1NRJB 3ZVLA 5FPHA 4QM7A 4IXMA 2YINC 3VKHA 1LW7A 2X8AA 4HLUA 5L3RA 3KDSE 4BFZA 1CR1A 2D74A 2IBMA 1XB2A 1XU4A 5DN6D 3RC8A 3KQKA 4OI1A 1SQ5A 1CLUA 1Z0KA 2NO0A 3O47A 2HDNB 2PBRA 4BFWA 3LX8A 4KI0A 4KSBA 4PSVA 4ZI2A 4LHWA 3KJIA 1KY2A 1Z6AA 4JKIA 3TNFA 1YU9A 4F4CA 1AIPA 2QTVB 3BBPA 1ZYUA 3NIBA 1AGRA 1CR4A 3U3KA 4G5OA 4Q9LA 3DM9B 1LVGA 3GLGB 4D4MA 4F92B 3CZPA 1CIPA 2YHSA 3FPAA 3GJ0A 4MGIR 5JRJA 3Q8XB 5FR2A 1E2MA 1RPZA 1DAIA 4UNPA 4I1UA 2XEXA 4XWAA 1OE0A 3QI2A 3SU3A 3VR6A 4LZZA 4JVMA 2HYDA 1KSJA 1HA3A 1IY0A 3ASYA 5JS8A 2VSOA 3VTKA 2Z4SA 1CS4C 1QHNA 2ODNA 1MO6A 4LBVA 2CK3A 3ZYCA 4KU4A 1J90A 1G8FA 3LW7A 1HT2E 3K8YA 1PLLA 2GK6A 4I81A 2FF7A 4QNRA 5FBQB 4FW9A 4LJ6A 4IDOA 1DAEA 1QHHB 5FPYA 1GNRA 3B9PA 1G291 2ZE5A 2EU8A 4XD7D 4TZ0A 3H1TA 2FN4A 4TL9A 2J0UA 4YONB 1ESMA 1P9NA 2ZJ2A 3CRQA 4R8TB 4ERNA 4CEIB 1W4RA 4TT3D 1XEWY 2ZPTX 1VYTA 4DKXA 3FTQA 6Q21A 4MDFA 3IILA 3AVVA 1X86B 1NBME 4ZDKA 1S2MA 3O8RA 2NGRA 2GVZC 4DSTA 1WBBA 2NOAA 3PJRA 4TZ6A 1TX4B 2Q3FA 5GJWC 1U8ZA 3TR5A 3PUZA 3MLEA 1WA5A 1X3SA 5E7MA 1NMYA 4OQXA 2GCNA 2IYYA 3K9GA 1UAAA 2AX4A 2RGCA 4TMKA 2A78A 4E09A 3R7WA 3RRMA 1J7KA 3AVWA 1AS0A 3I61A 2J41A 5KUTA 5C4GB 4ZIRA 5CJ2A 4Q1EA 2F9UA 2ANCA 4MYCA 3TW8B 1SXJB 4V0ME 4WVFA 1PV4A 4RD0A 2GJSA 2CDNA 3OFNA 4ITRC 4PSAA 3RAPR 2C98A 1KOFA 3R9XA 4L9WA 1E9EA 4HDOB 5KSZA 1E0AA 2VSXA 2P6RA 3LWNA 2XNSA 4BLTA 4GT1A 4RSGA 3VHLB 2IUSA 4H9GA 4UNRA 1DAGA 1VYUA 3FFAA 3KFVA 1IXRC 4DLWA 4JLAA 3ZH9B 4O3MA 1OFUX 1VG0B 1DAFA 4YMTA 2DYKA 4X8OA 1M7GA 3FHCB 1WDTA 3Q7PA 4IOJA 2PLRA 4RFVA 3QBVA 4MDEA 4LHXA 1X8KA 4NZYA 2XZLA 3W6OA 2JJ1D 3W5IA 2YOFA 1BMFA 1Q3HA 1YVDA 2AD1A 1R5OA 2QA5A 1GITA 4GP6A 4FMCF 4M1OA 1IOZA 3GLIB 3AVUA 2JA1A 2ZE6A 3UWKA 2BDTA 2IWRA 1KDRA 3ZZUA 3LVQE 2BCJQ 1DO0A 2HLDD 2WWWA 4QM6A 1HE1C 1AN0A 2OE2A 3C7KA 2BM0A 3R20A 1XD2A 4JKYA 5JFGA 1AQUA 2JLWA 4A2QA 1DAMA 2ZE7A 3OE7A 4LPSA 5CK5A 1Z6YA 4HZUA 1XCMA 3NBZC 4C0KA 4Y0VA 1XWIA 4RZ3A 1ETUA 3HYRA 2EFEB 2ZRBA 4OQLA 1KTVA 3NG1A 2CBZA 1EG7A 2EQBA 2VP2A 3AKDA 2O8EA 1G64A 4K8OA 1R5BA 3WRYC 1YKSA 1S4QA 2FDCA 1P3JA 3U3JA 5L3SB 1JR6A 1KJZA 2J87A 3A1WA 3BXZA 1Z08A 4RZUA 3M4YA 2ZJ8A 2QMHA 3RC4A 2NO9A 1EX6A 1SXJD 2NO1A 4C30A 4V0NA 1TUIA 1KY3A 3RC6A 1W4CA 2P6UA 4DDWA 4B2LA 3F0TA 2AK3A 4LPKA 1OIWA 5C1BA 4V03A 1XMSA 1ZC4A 2H18A 1XZPA 4Q1FA 1GRNA 2TMKA 1GL9B 4BLOA 4DHEA 1W3CA 4QGAA 1XD8A 1JXOA 2ZJAA 1C1YA 1XMVA 4M1TA 5JHGB 4LYHA 1KGDA 2AKYA 4FWTA 1TMKA 2ZYUX 5KSOA 1KK3A 3ZIAA 1D2NA 4JMPA 3OEHA 3LA6A 5EXTA 3HJNA 1A1VA 4P31A 5FBWB 2WAXA 2ZJBA 2IYZA 3H09A 1Q22A 2EW1A 2CLCX 3ADDA 5H70A 2WZQA 3QPUA 1KK2A 2QP4A 5AUOB 1E96A 2PX3A 1G16A 1Y3AA 2O8BA 1RC8A 3UMRA 4IVRA 4BUJA 2C96A 2GJ9A 1KI6B 2W0SA 3K9HA 4PQYA 3TR0A 1N6NA 5HKKA 3SUEA 4UXJA 1MR3F 1EFUA 2BWJA 3I5YA 4FCWA 1NG1A 1UF9A 3TAUA 1II0A 4LDJA 4PPGA 2ZSFA 3C15C 3KXKA 5E7IA 5KNDA 2A4RA 1J99A 4N0DA 3I8SA 4PX9A 4NKRA 3JZMA 4Z51A 5EPYA 4B48A 1QF9A 1T0HB 3QY0A 4JLPA 4MRPA 4DIEA 4DLTA 4OK3A 1TL7C 3AVXA 4BPBA 4M0LA 1IJEA 3VR1A 4HUQB 2ZSAA 3GLHB 3RSLA 4MGKR 3SU8A 4A8JA 3U60B 1N6RA 2IUTA 2BBTA 4RFSB 3THYA 2ZI4A 1F3OA 5FOUA 3LFUA 2A5YB 3B9QA 4XTCS 3RABA 2WKRA 2ZXUA 3IHWA 3GJ4A 4ILEA 1FNNA 1KNXA 4E22A 5J47A 1P9WA 5AR1A 2QPAA 3IPXA 4B71A 1D8TA 3THXB 2EVWX 2R44A 3ONWA 3T1TA 3GD7A 3OZXA 4Q4AA 2O8CB 2IYXA 1Z6XA 4Q9IA 2JLSA 1CRQA 2YJTD 3IHLA 4F93B 2IF0A 1E2NA 3EIHA 1LV7A 4DSNA 2OCAA 3Q85A 2VP6A 1G21E 3HWSA 1Z0AA 3RRZA 1E2IA 2GILA 2Q9BA 1D2MA 1VMAA 1E0SA 1RGQA 2X19A 2ZRPA 1Z63A 2ZRJA 3WY9A 3LVRE 4U01A 3BD9A 3PITA 1YZTA 1ZNZA 4L16A 2ZTSA 2QV1A 4IJMA 1JNYA 1IAQA 5AK0A 5J40A 5TY0A 4P4TA 1NBMA 1E2FA 3SBEA 3CM0A 2OK5A 1XZQA 3SUDA 1T4GA 2HJGA 1GSIA 2GCPA 3KQHA 3KB2A 3IEVA 4B73A 1NMZA 1G6OA 3D3QA 4PHHA 1NY6A 4JLNA 1X1RA 4I31A 4BQSA 2F1IA 1N1LA 1F5NA 4DLXA 3L0OA 2QRNA 4OBEA 2FH5B 4PC2A 2ZJ5A 2V3CC 3TRFA 1OIXA 1NN5A 2WMNB 1ZNYA 4IOMA 4V0LA 5J4VA 3HYTA 1OH5A 2ANBA 2OAP1 1KSFX 2VP9A 3MD0A 3IPYA 4J0QA 4B33A 1ZU4A 2QROA 1Z8FA 4QKQA 5KYKA 3PR1A 5IHPA 4JL8A 1RW4A 2XTZA 1F2TA 1I4LD 5DE3A 3BJIC 3B8HA 4G01B 1QHGA 1YZLA 2WKQA 3SS8A 1RRCA 5DO9A 2OBLA 2YC4C 2J0UB 4C4PA 4A6PA 1KK0A 4XVRA 1NVXQ 1XEFA 5DHFA 3D8BA 3S1AA 2PMDA 5ELXA 1GAJA 2J1LA 4Q1CA 4AKHA 4QGGA 4YMVA 2CJWA 4JYBA 3KXLA 5EPNA 3SJAA 2NIPA 4NYMR 2XNDD 3PCRB 3GLGA 1KSGA 1UEJA 4NL4H 3I92A 5AJYA 5A5GA 2IYUA 3LLMA 4QGFA 2VPPA 3BH0A 3CRRA 2AN9A 5BXQC 3DKPA 3T15A 4ESHA 1Q20A 2FFAA 3M5MA 2G3YA 3P8OA 4QBGB 5FL3A 1T6NA 1N6LA 2W2TA 5LBIA 3R7WB 2QM8A 2QMUA 1OXSC 3NBYC 5CM9C 2JATA 4LK2A 4TYQA 1FQJA 3REGA 4TYDA 2OBMA 5EUMA 4C0SA 1S8FA 4WXRA 4FIDA 4DT1A 4DDVA 1XPRA 4ZIRB 2PJZA 3PV0A 3TBKA 3DOFA 2CXXA 2NO6A 4LBWA 2GVDC 5H4IB 2BMDA 3U3MA 3NBXX 2C95A 5G41A 3CB4A 1RIFA 1CKEA 3WP0A 3LX5A 1PUJA 2QY9A 3LXRA 3QXSA 4D26A 4TMZA 5JRZA 3MJHA 1ZP6A 2J9RA 4RZXA 3GLFA 1TU4A 5SZKB 1M34E 3FGNA 1NN0A 4JLKA 5K8UA 2PLFA 2VBCA 3MWYW 4I33A 4ZCMA 4ESVA 2CK3D 4M21A 3KX2A 3LO5A 3DO6A 4JL5A 4ZDWA 4QBFA 1GZSA 2WJIA 1T3HA 3DPUA 4RD6A 2IHBA 2QN6A 2FG5A 2Q3HA 4TMXA 1CBUA 2ERXA 4DWJA 1MRNA 1E9FA 2WJVA 3U6KA 1OHHA 5F3WB 2J3EA 4RD1A 4BZXA 4DJTA 2GGVB 1VHLA 3RVBA 4OQNA 1IN8A 5AUPB 2WOOA 3WMGA 1NJFA 1TAGA 4FD2A 3U61B 2P0EA 1NN3A 1TTTA 2H7VA 2OINA 1GWNA 4PHFA 2GXQA 3FHOA 1XD2B 3E2IA 5BQ5A 2CHQA 3CIOA 4PR0A 3EW9A 2JDIA 3K53A 4NCKA 4UQOA 2AXPA 2VA8A 3LAWA 4PAMA 4DZZA 1KO1A 2ZANA 1EWQA 2BOVA 4URUR 3EA0A 4JBYA 1HE8B 3MJRA 3SFZA 2B92A 3T12A 5FTLA 1R4AA 3P27A 1BO6A 2O8EB 2N46A 1R0ZA 2IYLD 3AK5A 2ZJOA 1GIAA 3SFVA 5GVRA 1UJ2A 4LJ9A 4YQFA 5LDDC 1G3UA 3C16C 4IDQA 5TARA 4Q4JA 1GL7A 1II8A 4HLUC 4DLSA 4M1SA 2REXB 2DB3A 3MAAC 5G3ZA 2B7BA 3KJEA 4QXAA 3OFND 4XH9B 1W47A 2VHTA 3TQCA 3MSXA 3VR5A 4D6PA 3I3SR 2B7CA 3GLIA 5BYJA 4EPXA 4JT2A 2QU8A 3H84A 1E2JA 3NC1C 1XCGB 2QL6A 3RWMB 3W8RA 2FZ4A 3TLXA 5P21A 4B3BA 3ZJYA 1UKEA 2ZQ5A 1T9HA 3B1ZA 1QVRA 3VR4A 1P60A 3FOZA 3M5LA 3B60A 3BERA 2ZI3A 1P2SA 4EJSC 4TYPA 3CF0A 2A5GA 2XAUA 1YQTA 3B78A 1XXHA 1RRGA 3EG5A 1T0JB 621PA 4TYNA 2RGBA 1FOEB 2BIFA 2V4ZA 1PLKA 3KUDA 3TVDA 3K0CA 4W5JA 1IQPA 3CRMA 1LF0A 4NCHA 4RD4A 5FBLB 4Q48A 2ZITA 2O8BB 4IVQA 3KFXA 4X8LA 3LV8A 5EP4A 4D0NA 1E98A 3AVOA 4B3XA 4FI3C 4JVLA 3NWJA 4LV6A 3SYNA 3AUXA 4KYIB 4ZKEA 2OHFA 4HB4A 3OE7D 4MUAA 3TSZA 2ZRFA 3QXXA 5JI2E 3TUIC 3CW2A 3VX4A 5HTKA 4FCTA 2ZRHA 4ZO4A 2OC8A 2C8VA 3QXJA 1FP7A 4AY2A 2GZDA 1ZUNB 4B74A 3EZ7A 3KKMA 5CM8B 3UWOA 1XP8A 1JI0A 2J59A 1P72A 1N3BA 1DY9A 1KI8A 2IHYA 5J4YA 3B13B 2V54A 3OHMA 4FMDB 4LC1A 4RD3A 4A8JB 121PA 4C0JA 2BMJA 5G40A 3THYB 1DG3A 1W36B 2HCJB 3EPJA 4ZPXA 3THWA 5CK4A 3PEYA 1LS1A 3EARA 1VYVA 1SHKA 3ICEA 4NYMQ 4AKGA 2CE7A 1FX0A 5DYGA 1E2QA 1ZVQA 4UXIA 2JLVA 2A9KA 3A4LA 4M9FA 4US2R 1OFTA 4KTCA 3O8CA 2HXSA 1XTQA 1Z06A 2AHOA 4QBIA 4BGDA 2I4IA 1UDWA 1VPLA 1Z5ZA 2YWGA 4PO1A 4Q4AB 1E4YA 2V55B 2F9MA 2ZS8A 4KO8A 1LF5A 2Q21A 4HSEA 4B43A 3FFBA 1DE0A 4LJAA 3ZIAD 1GOTA 4A0RA 1N6IA 4JBXA 1FUUA 3MGCA 4BZPA 4ABYA 4C0BA 1E94E 1W4BA 2ZI6A 3DEFA 1SKQA 2GDJA 2MSDB 5FTJA 3SV7A 5AJZA 4GZLA 3QVVA 5JLJA 3CPJB 2IYVA 4M1WA 2GF9A 4KBGA 1FPMA 1Q0UA 2F9VA 1R7RA 1DY8A 2CVHA 2Q6TA 2FOLA 3QXHA 2RGEA 1OXTA 4DUGD 1IONA 2QMEA 3C5CA 2PEYA 2Y8EA 1Z0FA 1KZGB 4A9AA 3NDPA 4XWOA 4TWZA 3LQQA 3O8BA 1AK2A 4R7ZA 1M7BA 3T06B 4HDQB 1KDPA 5HKKD 5BN4A 5JJKA 1I2DA 2FEOA 2Z5FA 1ZM9A 2WJGA 4HLDA 421PA 4JT4A 5C2JB 3NEJA 2IXFA 1FMLA 4Q1BA 3ND8A 3GFOA 4AKEA 4NYIQ 2H17A 4Q9JA 1HTWA 1S9DA 4P32A 1TUEA 3SBDA 4Y0AA 2ODEA 1KHTA 2OUKA 3JVVA 3EIEA 1V5WA 5ANRB 4ZDJA 2OLJA 4DSOA 1NS3A 3G82C 5IF9A 2PZFA 1WCV1 4B3GA 2DFKB 2DWQA 3HU3A 5KNCA 3BH6A 2WPDD 1XF9A 4DEXA 4DBLC 4EUNA 3D31A 3EAQA 2FJUA 2XNDA 3CLVA 1OLOA 2JCSA 1AZTA 3T61A 1W36D 2OESA 3CX6A 4QFMA 1P73A 2OC7A 1U9IC 1OW3B 1F2TB 1YRAA 2V6IA 3DOEA 3L43A 1Z29A 3CONA 3I73A 4KLZA 2ZRAA 3AKCA 4XVQA 3SHFA 2XSZA 5IDKA 3VKWA 4WAUA 4D0GA 1J2JA 3LH5A 4PC6A 3SZEA 2OXCA 1J70A 1JR3E 2UVQA 3MMPA 4IDHA 1YE8A 2J7KA 3EPKA 1ZM3A 4HAYA 4LV5B 3S1AB 3RS4A 3BC1A 2VLIA 3K09A 2CJWB 2KSQA 4U02A 1GRQA 3RWOA 1U99A 4B6EA 3E90B 3SNHA 1RJ9A 5KDDA 3RDPA 1TU3A 1NIPA 3UATA 1XPUA 2AR7A 2ZI9A 3BIFA 4P4UA 3NKVA 4PXAA 1DO2A 2BJWA 1XTRA 2OAQ1 4EFMA 1YJ5A 4Q5IA 3CWZA 2CNWD 4XTRA 1HH4A 721PA 1J8MF 1VCOA 3E1SA 5HCIA 3SN6A 3V9PA 4DT1B 1N5IA 4NWLA 1NBMD 1WBDA 2JLQA 1P2TA 1BH2A 2FOMB 1W2GA 1NI3A 3VR3A 4I4LA 3GQBA 4PAQA 3WMFA 4AD8A 5KHOC 1DOAA 5DI9A 3C4JA 2EFCB 4L15A 1EESA 5CLQA 4BASA 3K0AA 1S0UA 1L4UA 2CCKA 1YZUA 1KMHA 4NTZA 3GJXC 1Z47A 3GLFB 4IEIA 5KNBA 2V8OA 3FMPB 4EIWA 3VFDA 4QOSA 5FH9A 1DELA 3KF2A 2WVJA 1TQ4A 3SJZA 3CR7A 1Q21A 3X1DA 2EFHB 3EC1A 1FP6A 2OFXA 2QENA 2F55A 1SVLA 2G0NA 2OLKA 2WMOB 5HE9A 1SVIA 2AL7A 4B32A 4DCVA 1E2LA 1WF3A 5CDFE 2J45A 1J8YF 2J0QA 3AF3A 1IN5A 1W49A 4C0QC 2YZ2A 4G1UC 2IWHA 5CB6A 1IN6A 1FL9A 3DZDA 4URWR 3ADKA 1JXPA 3CBQA 3LW8A 3G0HA 3RYTC 3D6TB 2VP0A 2BEKA 2GXAA 3KQNA 1S1CA 3OIYA 1NVUQ 3W5JA 2GHIA 3E70C 1BYIA 2P67A 1NVVQ 2QAJA 3KB1A 2QE7A 2KB0A 4NE2A 2ZREA 4LYAA 1SKYB 4HZIA 2IK8A 1S1MA 2FGJA 4XVUA 3EX7C 3R9IA 1BIFA 4RKFA 1FW6A 4E03A 4JJKA 2BHRA 1TF7A 5JZVA 4QC2A 1MO5A 4OI4A 2V1XA 1G8PA 1FMJA 4CVNA 4LBZA 2OC0A 4LYJA 3RC3A 4DLZA 2YWFA 1D5CA 2ZRLA 3THOA 2CL0X 1XTSA 3NVAA 1Z22A 2GZHA 1GVNB 1OF1A 1HQYE 3QE0A 3OTPA 2WJJA 4Q4JB 3UXMA 1II8B 3OIWA 5IK2A 1VECA 3GEIA 3CNLA 1U0HC 1XCPA 2QPTA 4DSUA 1T8TA 3SR0A 3AVPA 2CE2X 1GNQA 3ADBA 3Q72A 1TPZA 3L8YA 5EXXA 1ZUIA 1YZNA 1G3MA 3GPLA 5DSZA 5LB2A 3CX7A 4MGZR 3SEAA 5KSPA 1ZM7A 2HEIA 1LY1A 2Z6VA 2QM7A 4BECA 3KKNA 2DY1A 1G5PA 1DXWA 1IJFA 4LJYA 4N0EA 1ESNA 3PV2A 1WXRA 1VKJA 3I62A 2WAYA 5LB4A 4UNQA 1KMQA 4URYR 4UJ3A 2VP4A 5J4KA 1FFHA 1W4AA 2X77A 1XXHB 3K0SA 1JXMA 2QPOA 2HF9A 2JLRA 5JWHA 2GA8A 5GADl 1KI9A 1OHHD 2NZJA 3X2SA 5AJWA 3IIJA 4WH8A 1P9RA 1W0KA 3P1JA 3NHAA 1G1MA 2YC2C 1XFAA 821PA 4PC7A 4EPTA 1R8SA 5JEDA 1LB1B 3ND9A 2R65A 1WP9A 1K5DA 1RYFA 4D0LB 4KVGA 2WKPA 1AKYA 2G0TA 3SV8A 1G5RA 2JDID 2V1UA 3TQFA 3A4MA 3AGPA 3CKLA 4GRAA 5DHAA 4YMUA 3A36A 3A37A 2BV3A 2IS4A 4NBSA 2OFOA 2DFNA 4LBYA 3AV0B 4GOKA 4IDNA 3CH4B 3ZD6A 1G9XA 5G3YA 2SHKA 3H86A 2EWWA 1RE0A 4KFUA 3N5CA 1CEEA 2WWYA 4LWZA 1R8QA 3DMDA 2XJ9A 2MSCB 2ORIA 1Z2AA 4FWIB 5LPNA 3TH5A 2G77B 1LS6A 2PL3A 1E2GA 2VL7A 1UFQA 2RGNA 3SOPA 1AS3A 1TQ6A 3THWB 2IEYA 4M9QA 4O2LA 1CJMA 1GRRA 4L8GA 3ZZ0A 2AFHE 2OCPA 1E69A 3P8NA 2PCLA 2F1RA 1FX0B 1OFHA 2GEUA 3LBNA 3T5GA 4LY6A 4A1VA 4EFLA 3A6PC 1JB1A 4DUGA 3T1VA 3PG5A 3TUJC 2GBLA 1UKVY 4CIDA 1WQ1R 3ZQJA 3CZQA 2H8KA 3GJ3A 2BEJA 2FFBA 3W34A 1ZBDA 4QGHA 4AG5A 4RJLA 5C46F 2R9VA 3T1QA 3Q5EA 3DL0A 1I4TD 1RRPA 2OXRA 3Q5DA 4LX0A 2YOGA 1N5JA 3B2EA 4ZDIA 3MWKA 2GXSA 4B2PA 5T1VA 2VHUA 2ATXA 5CYOA 2W00A 3ZD7A 1X6VA 2FSIA 5EXSA 1CJTC 4IOLA 5B2ZA 4LOAA 4IHQA 2ZYTX 3M1IA 2B6HA 3NH6A 3BS4A 2WPDA 2YVUA 3W3ZB 3V4FA 1IHUA 1OXVA 4IKEA 4TQ9A 1CF4A 1QDEA 1Z3IX 4MUBA 2WWFA 1ZCBA 1NMXA 4HDCA 2O8FA 2DHRA 3FKSA 1X1SA 3IEUA 1KNQA 1PUIA 4HAXA 3SE0A 2ONJA 3QENA 1QHXA 2RCNA 1FZQA 1BT7A 2OBNA 2I1VB 2G1JA 3OESA 4II7A 3CPHA 3VMFA 1GP2A 4MYTA 4AYXA 2R2AA 1YR8A 2PEZA 2F7SA 2BKUA 3IDQA 3T35A 1DAKA 1SVSA 3A58B 3K70B 2IF2A 3UMFA 2XITA 4D25A 1OT3A 1PZNA 2VP5A 3BGWA 3QF4A 4IW3B 5FR1A 3AKEA 1IY2A 2KBFA 2VO1A 2ZRDA 4PANA 2OBQA 1SXJC 1F48A 2ZAMA 3J81k 4URXR 2OZEA 1BS1A 2A2ZA 1YZQA 5GJBA 1DS6A 1KJWA 2PJRA 4F7WA 1GKIA 2ZR9A 3I4LA 5EE1A 2V6JA 1TF2A 1COWA 1E2PA 2NZ8A 3U2QA 4HB2A 4LHVA 2MSEB 4MQBA 1QVAA 1EWRA 2G9NA 4D81A 5L3QA 1KDTA 1O87A 1QHIA 1N6OA 1XJCA 3VX3A 2PCJA 2XX3A 4A0FA 5FOWA 5B58C 3A1TA 3WRXC 2QSYA 3PUVA 1B0UA 3AKYA 3TVTA 1P6XA 1PVOA 2CNWA 1A2KC 1WXQA 3ZGXA 1K8RA 4PSKA 1N2CE 1NNEA 2ATVA 2D2FA 4RCZA 3W90A 4B44A 1U8AA 1G3RA 2IX3A 3QEJA 5JSZA 4C0LA 2BVNA 4DRZA 5BN5A 1RJ9B 3QG5A 3B85A 4JZKA 5UKDA 2IC5A 2BJVA 4K46A 3P4YA 1R5NA 3A1VA 1X8JA 4IRUB 4QHYA 4DXAA 2ZSEA 4JMYA 2XB4A 2GETA 2BKEA 2GTPA 5GJCA 4QG7A 2N42A 2WV9A 5EQQA 1T5LA 2LCFA 2OV2A 4M1KA 1WE2A 4DVGA 5JCZA 4B3DA 1IBRA 3SYJA 4Q9KA 2RKOA 1I4DD 1KKMA 2YWHA
chains in the Genus database with same CATH superfamily
2VPIA 2JGAA 1OFIA 4OAQA 1UCYE 4K2HA 1PZEA 4P5EA 2AD5A 3ZKWB 3MNXA 4O4JB 1F0NA 2FPIA 3MG9A 2WSSA 4PCUA 1T13A 2EWVA 1W7XH 1ETTH 1KBQA 3JAWB 3KU1A 4H7FA 1QGUB 1A2BA 4FB4A 2JJ2D 3HCFA 5JEEA 1O0SA 3UTUH 1EPTC 2F90A 4QNNA 1KZ7B 3U9LA 3M6IA 3GEEA 1W1IA 2V6NA 2QSUA 3VHXA 3KOOA 2Z0MA 3ATIA 4G8DA 1HZZA 2XCOA 2HSDA 4BKQA 1JS1X 1TGYA 5GDSH 2Y3IA 2FUKA 5LLSA 2OXSA 4OJYA 1KEEB 1UVTH 2QZ9A 1E58A 3H2IA 3K70C 3JASB 4UHJA 1OLUB 2UYHA 1IC6A 3EF0A 4ALKA 3T0FA 5C37A 3BK7A 3C3DA 1C2LA 3EXHA 2IGTA 5I9MA 2ZRNA 3KSDO 4X62B 3NKKA 4EARA 4YDHB 2P5TB 4KGAA 2G55A 1T8SA 4Q47A 4YRSA 2GD4B 1RCTE 2AWOA 2NSLA 2O8UA 3WADA 5TGZA 1KXZA 1XD9A 3QX5H 5K3FA 2FRXA 3SI4H 4P7FA 1TZMA 5TB5A 5J2TB 1P3EA 1EOLA 5AICA 3HB1A 3B1XA 1GTRA 1QQ6A 5M3BA 1Z0DA 4D4JA 1XJWA 1PJQA 1YR9A 4R1MA 1RP7A 1MOPA 4KR0A 2Y93A 3AR7A 1QCZA 2ZKIA 1U0LA 3P6ZB 2I65A 4Q7MB 3ZZ6A 1SHZA 5HRAA 3RXOA 4G5YA 1NNSA 5P8WA 3D2CA 3JQBA 4EMUA 2HFKA 3ZZTA 4NR0A 1Y63A 5AKJA 3BGSA 5L3QB 1E1MA 2HC9A 1ZWKA 4UC0A 4LRWA 1SUDA 1W8BH 1NU6A 1T8MA 3NC0C 2B1GA 4NZPA 3L0PA 2GZ9A 2HU5A 4ZARA 3TW4A 2I2CA 4ODIA 4DFDA 1H05A 1G3QA 1GM5A 1NDQA 3E0XA 3NHPA 2ZGCA 2QLNA 2QT0A 1S0RA 1YKFA 5KTPA 4DIFA 1AO0A 3NUMA 4HRXA 3BL8A 4YXFA 1UDCA 2BLOA 2DUJA 1B00A 4JK6A 5DSTA 4RTRA 5CA0A 3A3KA 5F7JA 2CMKA 1ZD8A 4FXGH 2BBOA 4UZEA 3BK1A 3AUAA 4M9RA 3PXGA 3D6FA 5LWHA 1WABA 1G6Q1 3QKRB 4CRGA 1T4UH 4DNQA 4X20A 3ANNA 1U3FA 2QRZA 3SHCH 2RIRA 3RMMH 2F3PA 3JSXA 4NP6A 1TC1A 2FUG6 1IXSB 4I5DA 1USKA 4CNQA 2QDKA 4IX9A 4CH8B 4A6XA 1OWPA 2J85A 5TMPA 3EH1A 4BHTA 1YHZA 2HPQH 5EJ9A 3F6BX 2AK2A 2WTXA 1M2OA 1D6NA 3PWCA 3BB4A 3EQ9A 1KZ6A 3IG6B 3E9DA 1NC6A 4B31A 2X2FA 4FGSA 3R7NA 2WTAA 1YI1A 1D07A 1TAQA 2EZ4A 3V2UA 5JXWA 3M6UA 3EYWA 3IEMA 2YRFA 2OOSA 1LBQA 1Q31A 4R68A 4KE9A 3UOPA 4BAQB 2RFKC 2E87A 3ZOZA 3FG9A 3P0FA 3KUUA 3IPAA 4NFFA 3F6EX 2YTZA 4LCBA 1Z82A 4R2HA 4A10A 2BHLA 4DWOA 2VCYA 1K5GA 2ROQA 2PSXA 1OWDA 3K2BA 1UBOS 1OV6A 1ELOA 2R1VB 4AZSA 1V2OT 3PMBB 4F11A 2Y1GA 3VAZA 1GGJA 4I36A 3B6EA 5EWLB 3KQBA 3A7EA 3NKFA 2G71A 3QP9A 1DKOA 2ZB8A 3SU2A 2G8LA 4PC1A 1YB7A 4WASA 2GXUA 4D44A 1Y8RA 2BLNA 4GBGA 5D3QA 4Y9RA 2HBZA 1WDKA 4ZRMA 4HG2A 1DTSA 4J03A 4Z2AA 1OP0A 1EYZA 1N6KA 5HS4A 2ODBA 4LF8B 1DAPA 1PFVA 4Y8VA 1U6KA 1JLKA 3NEYA 2QGFA 4TY7A 1E9SA 1M6VA 1TM1E 4TM7A 4YDSA 3C3JA 4BRWA 3UFXA 2SBTA 4J6FA 2O54A 3GFTA 4BFSA 1AFQC 2WHPA 2YBEA 3BWMA 1WMBA 4C9BA 5IT9A 1N9GB 2BYAX 3OCXA 3ACDA 4RSHA 2IYTA 1X38A 5HOQA 2ZM6B 4GSYA 2Z94A 1SSXA 2VXYA 1O6FA 2QRHA 4TMVA 2JK0A 5NLLA 4HKTA 2XF2A 3QMWA 4AJNA 1ZZGA 4Q01A 2ARKA 1TUGA 2ACVA 3PI7A 3NW9A 4DIKA 4MINA 1EVYA 3L6CA 1NZQH 3RU4E 5EP1A 5AI6A 2X41A 3LC2O 4BQEA 3U4MA 3AF4A 4JODA 2Q0XA 4KBYA 2QLMA 3IUSA 1P57B 4AXXA 1F7ZA 4OFXA 3RMNH 2BEUB 4YT7H 1XTIA 4B79A 3LCVB 1ZZZA 2GAFA 1QP4A 4YAWA 3EUAA 5K0EA 3F5FA 2HXYA 3TFOA 3UPUA 4OJKA 2OBXA 1CFZA 1PQUA 2HSEA 3I2HA 1H8ED 3WWBA 3H7AA 4BEVA 3ILVA 4ZTBA 1DBIA 3QUBA 1DO8A 1M1NB 2GCGA 1K86A 2FX2A 1Z6JH 1A2QA 2WVGA 3SM3A 1Z88A 4W5TA 2ZWPA 4BGVA 2DM6A 1G17A 1IEXA 1OB2A 3JD2A 2Q1XA 2C8JA 2IIQA 1B0PA 1TBQH 3D3NA 2VIOA 5JCXA 1QGDA 2FE1A 4V1CA 4EY5A 5FNZA 4ZHLU 1Z5GA 1OD6A 3EE0B 4MQUA 2KCAA 2OAGA 4BAOB 4BCCA 4H7EA 2NMVA 1ISMA 3OURA 5CBKA 3L6DA 1P2BA 1ECGA 2HK8A 3AKZA 4MB6A 4HAZA 4Z4CA 3WQRA 3PR3A 1XPJA 1A4RA 3RTAA 2IS2A 1UZNA 4F46A 2WZDA 3RSCA 1FZTA 4IFBA 2QTBA 2X9VA 2O59A 3CZ4A 4YCCA 3V55A 1SLWB 2FOEA 5AFZH 4MIOA 4NYJR 5IUJC 3CZRA 2FUCA 1NQ5A 5BNWA 3KHSA 1T6ZA 1KYTA 5F2EA 3ZZ7A 3UG7A 1ELCA 3F9HA 2PVSA 4HNUA 4KZKA 4IN1A 3OUZA 1H3FA 1TO6A 2R7MA 2V7EA 2GB4A 3SR3A 2O9JA 1O2GH 3EEBA 3SQWA 3INGA 3CCBA 2C82A 3OOWA 5F2KA 4CR8A 2C3YA 4OA5A 2OTCA 3M5PA 2C5LA 1U81A 4Z9BA 4M8LA 5EQTA 2E0IA 2A5FA 3KVNA 5I9BA 3L6PA 4LY0A 2PX0A 1L7DA 4RXMA 4ZOLA 2A9JA 1XZDA 1BHXB 5EPEA 3W5VA 4TL8A 2H51A 2X1VA 1M9UA 3I1FA 4NFYA 3IUPA 4NCNA 3UKJA 1JEJA 3KEEA 4B45A 2O8CA 1MV5A 4R2KA 2VJOA 1M0EA 4HLUA 4BFZA 2K7FA 1YB5A 4EO4A 4BFWA 4KSBA 5LQSA 3JS5A 4Q34A 5A71A 2C3OA 4Q9LA 1FNIA 1HDGO 1VL8A 4NY1A 3PQ8A 5L4SA 3W2FA 4L6IA 3H2BA 2ADMA 1KSJA 2ZSJA 2VSOA 1KFKB 1DRWA 2BFBB 3OM0A 1I9GA 1AN9A 3URDA 4UM8B 3RUIA 4WN9B 3GGGA 1O5AB 1SQOA 4LXXA 3FOFC 1E1YA 1KJIA 1FDIA 1ESMA 1VZQH 1CSOE 2BD4A 5HEKA 4J16C 3RFTA 3CIFA 1VYTA 4MDFA 2M6LA 4MG3A 1ZUWA 2HPHA 2YV3A 4FUIA 2WG0A 2ZSHA 1DIGA 3OJOA 4DZRA 4H6PA 3STHA 3D6JA 3FIUA 2XQGA 1QSGA 4ZVRA 2CD9A 1WUJS 4IHKA 5KVCA 2VI5A 2B3DA 2VWMA 4H9GA 1VYUA 2DUNA 4HC4A 4R16A 3R0FA 3QELB 1QOPB 2V7UA 1IUNA 3Q7PA 2WYJA 4BPRA 3FCXA 1PPEE 2GBGA 2GLXA 4GSKA 2WUGA 4UU8A 3ZZUA 3KC2A 1XUFA 4G5XA 2XT0A 1SGPE 4HZUA 2SGQE 1N8TA 2H1RA 1OWKA 2VHVA 3AKDA 4QUBA 1G64A 3WRYC 4YTAA 1PJ3A 1RWBA 2E21A 4AMYA 1Z08A 3HWRA 2ZJ8A 3AQIA 2D0PB 3P17H 4V03A 4PBTA 3HXLA 3I1YA 5JAPA 3BHNA 2OM6A 3NALA 3JXEA 3GS9A 4FFBB 5C1PA 4JYTA 2QYTA 2WAXA 3M2PA 2PLWA 4O4HA 1GPZA 5C53B 2PX3A 4MGHA 2VSNA 4QDOA 2H1FA 5FJIA 3UMRA 3MFJA 2DAPA 4PQYA 5TMBA 3SUEA 4GZ3A 1P2FA 3LG2A 3DBHB 1NG1A 4DIMA 5AK6A 2Q6IA 1W5EA 3L4BC 3KXKA 2QF3A 3NAZA 3CURA 3RV3A 4MGEA 4JLPA 4F2DA 2YIDA 2C7VA 4BPBA 2W4IA 3NT4A 1KQ3A 4MCIA 3VR1A 3V0XA 2ZSAA 2NVBA 2JGLA 3KVRA 5KWIA 4LF9B 4IH4A 1FI8A 3CLSC 4CBNA 4ILEA 3ZY5A 4MV3A 4B71A 4QVIA 4KO1S 2VRNA 5G4BA 4X6OA 5HS6A 4V0QA 3EIHA 3LBFA 3N2GA 2XKKA 3T1YB 2Q9BA 3NHKA 1GAWA 3UCEA 2YXLA 2F9BH 4P08A 2QV1A 4CTJA 1SVUA 1TZJA 3LWDA 3AIIA 1WX1A 2ZT8A 3BWXA 4RO0A 1NMZA 4PHHA 4NZ9A 1F5NA 5E9AA 1EDZA 2PRZA 2G5VA 4C6TB 4JL8A 5TJXA 3RO7A 3HM9A 4DGSA 3SS8A 3S28A 5DO9A 4I4TF 3NOQA 4PR3A 3V8PA 1G2PA 1XEFA 4S04A 4HDAA 4FVBA 3SJAA 4IJKA 5AJYA 6REQA 1LHEH 2WE8A 5CHAC 2HA0A 5DP4A 3DKPA 1HAVA 3M5MA 5JMOA 4R8KA 2JS7A 3K35A 4TGLA 8ATCA 4LK2A 5KINB 1RYEA 1VM6A 1TA9A 3DEIA 3NBXX 4DC0A 1IU9A 4LISA 3H7IA 3RXGA 3MGAA 2MOKA 3LYHA 2F2TA 2BGLA 4XZ3A 2GT7A 3C45A 1T3HA 3DPUA 4Y9SA 1S8OA 1FMGA 2XKBA 5EMHA 2ERXA 1EX1A 5FA5A 3FOEC 4ISBA 4ROTA 2GGVB 1DWPA 3G3EA 1XVVA 2WOOA 4YV7A 1IZ0A 2O1EA 1C1XB 2ZTLA 4Z3DA 1H85A 4NSYA 3NAGA 4FVDA 4HH1A 4RQBA 3TW6A 2UYYA 3JQ8A 1LQTA 2OQUA 1PPFE 3EXFB 1G3UA 3C16C 2POQX 2CBXA 3MAAC 2BEVB 4YCAA 5FLXA 1I7LA 3RIEA 3I2FA 4EJ2A 4GPGA 4MV1A 4RK7A 3B1ZA 3VXKA 2ZYRA 2VXBA 3E53A 4NCBA 1WBJB 1T1EA 1GI6A 1NXTA 1UMDB 3EQZA 2BIFA 4IMPA 1MQ6A 3E91A 1CDOA 3JARB 4AZ3B 1V6DA 3OQHA 2JCXA 4FZ5A 3WGZA 5LZ9A 3KK0A 4ZO4A 1FP7A 2HPZA 2WU4A 2ZJ1A 3F2VA 2ODPA 4RY0A 2WPKS 1EASA 3CRNA 3IHKA 2HCJB 3O75A 4L8LA 1NASA 1Y5RA 2MTBA 4FU8A 4QOFA 1GGVA 2QN1A 1XTQA 1KE1A 2WYUA 2GYUA 3OO0A 1KY5A 4DBLE 3PQ6A 4I3GA 1F3LA 3CGGA 4GKJB 3HDQA 5I7OA 5CEJA 1H1LB 4DUGD 2RGEA 4P3NA 2EZUA 1UC4B 3FKJA 2HR1A 2WJGA 4NMXB 4Y0AA 1KHTA 2R11A 4CIVA 2PD4A 2FI5E 2BZSA 2DWQA 1LSUA 5E0HA 4KIFA 4KXXA 3BSYA 2NUTA 2LD4A 4PZCA 2ZGVA 3EAQA 1TKCA 1CIVA 2JCSA 1XNHA 3T61A 1W36D 2BY7X 3CX6A 1U9IC 5JOQA 1Z29A 4CTMA 3SHFA 4XVQA 4E14A 7REQB 4WAUA 3FCUB 3MMPA 1U8FO 1HBJA 3VV2A 2I22A 3K1AB 4G24A 3OU7A 4K03A 5DBHX 1EVQA 3MCTA 4F1KA 3PROA 5HCIA 1WBDA 5PGMA 4CM5A 1PNRA 1BH2A 5F12A 3I8OA 3I29A 3GBPA 1PT9A 3OTJE 1S0UA 2G4TA 4R4JA 3GJXC 1Z47A 4WACA 3RXJA 1R66A 1C50A 3FMPB 5FH9A 4DARA 4RIEA 2F55A 5HE9A 3EVTA 3OI7A 3X1MA 1FL9A 4AMGA 1O6GA 4WESB 2EC9H 2BY6X 1B7GO 3DR3A 1VE5A 1WO8A 2NV2B 3GCXA 1TF7A 5DT9A 5G02A 4IUBS 4AOQA 2CL0X 2L74A 2PGJA 2A7JA 4HLNA 4FKBA 3OIWA 3SC2B 3DKKA 4UHDA 4KQHA 3AT1A 5KSPA 2PGAA 1G5PA 1IEVA 5DNEA 1IJFA 4OMUA 3P2IA 3L6BA 1H9HE 4J2TA 5EGSA 1DJQA 2MYTA 2GCHG 3ANMA 1AO3A 4IGDA 1K4YA 1VMIA 4K28A 1GYRA 3UN1A 4ZAGA 5AW1A 2JIDA 4W7IA 1V2ST 4QT0A 2JFPA 2VYQA 1AKYA 5AM5A 4X7RA 3SW2B 1A9XB 3A36A 2DFNA 1SBZA 2PPLA 2H9HA 1MN6A 5LQKA 2JFXA 1RE0A 3Q00A 3OEYA 2VQ3A 3PBKA 3DJFA 5FLKA 4OM7A 1IYZA 4TM8A 1RJEA 2AJ8A 3GPDG 2W3KA 2GEUA 2HWWA 1CIJA 1OFGA 3TUJC 3A3YA 4Y2RA 3O1IC 3DL0A 1RRPA 1X80A 3F3BA 4EL5A 1B42A 5AFSA 2BGRA 2KW5A 3D7SA 5CYOA 1MJNA 1X6VA 1H4TA 2J33A 2AN1A 3V4FA 5FQOA 4W7HA 2OD9A 4E5NA 1P2GA 1UK9A 1HLFA 1KJQA 3DVAA 4W9NC 2RDLA 1EGMB 2ALPA 1VSQA 4RT1A 1IIRA 1SOWA 3F7MA 3T27A 4RNCA 1BMDA 3AR8A 4UEHH 1UJNA 4URXR 1QGAA 1BS1A 3TBFA 1WG8A 3G0GA 4HB2A 4LHVA 3AJ9A 2XX3A 1AKVA 5D86A 5B58C 3LUGA 6ABPA 1U6QA 4KSYA 2ZPUA 2ATVA 2QGRA 2OV3A 3E9CA 3L1KA 2J9FA 3LQFA 2BY9X 4HPJB 4Y0YE 5EIOA 2GTPA 5YASA 2DWUA 3AETA 3COYA 4P8RA 1I4DD 3ZYZA 3MSCA 1YJBA 2J5XA 3DL7A 4KMSA 2WF7A 2PO5A 1YMVA 3ZVNA 4N8EA 4YR7A 2Y9PB 3T0GA 3O4FA 3LPMA 4UARA 2OMKA 3H5TA 3A7XA 3Q8WA 3CRW1 4GL2A 3PX7A 5BW8A 4EO7A 1WW2A 2NQTA 2V0NA 2O8DB 1I80A 4JOSA 1QX4A 3DP9A 4TLEA 2ZU0C 3LVBA 1VIYA 1MCVA 3TQQA 4CMAA 3KJNA 4DMLA 1W30A 2EARA 1W8IA 2PS1A 4WBNF 5AVQA 4PZ9A 1HCGA 2R8BA 2QK4A 3MIIA 3BB3A 4RV9A 4ZRDA 1W4LA 1F5RA 3DSPA 3LSYA 5AESA 3HE3A 1AV6A 3OCUA 5E95A 4UU0A 4HQ6A 1IXYA 4F86A 1TE2A 4RTSA 3P7MA 2PMEA 5JMWA 1XQVA 1NT4A 3OLWA 1YB4A 3UWMA 1RCUA 1YRHA 3AW0A 2PR2A 4E07A 5F78A 2ZI2H 2CDAA 3BZBA 1EWKA 3RS9A 3EZFA 3KXPA 2BLQA 2KLHA 3A1DA 4UDYX 4TLAA 1PQAA 4MYRA 1YZKA 3KJHA 2GK3A 1ABEA 2QBYA 3CU5A 1CEYA 1T2AA 2IUUA 3TPCA 3IV9A 5MFZA 3E4DA 1YKGA 1ECPA 4WCVA 3RTEA 1JF8A 2PZEA 1E36B 3OVMA 2QAGA 3KHUA 3HI4A 3LD9A 2RG3A 4MKFA 2O0JA 1FUIA 4BLPA 4F5EA 4BKOA 1GDNA 3FN8A 4DIDA 2A5KA 1FSPA 1ZJDA 3MYYA 3TE6A 1T2DA 3MOGA 3L1IA 2P3UB 3CX4A 5HZKA 1FMFA 1II9A 4ZICA 2Q3DA 2FFJA 2BM9A 2AVDA 1L5GB 3ZZ5A 1VQ1A 3LT3A 2X3FA 3AP2A 5L3VA 2Q4TA 2UKDA 3OZDA 4PYKA 1M6YA 1F7VA 2GO7A 1FNBA 2FLWA 2EFGA 5ALXA 3WHLA 1J9ZA 5DK6A 1U1DA 3GU3A 4DCUA 1JTFA 5LR6A 5BSRA 2OUAA 3AIKA 4YMGA 2P3LA 4PBSA 2KM1A 1WSBA 1UZMA 1XNJA 1R6DA 4LWQA 4MUNA 4P22A 1GU0A 4URHA 2OGWA 1PZHA 5EXDA 4B6QA 3NHBA 1UBTS 1YR7A 1BMMH 3Q9LA 1K3UB 3EWNA 2O8WA 3WLJA 2CF8H 3TOXA 4L5CA 2HD4A 3N2KA 2FRVA 4KYTA 1E9DA 1CF9A 4IMZA 2G80A 1C3LA 1G3DA 1IHTH 3OBBA 1G7TA 4RANA 4MVYA 1V9SA 3PQFA 4DA0A 5LXTB 4EJ6A 3LZDA 4OVKA 1JHPA 1NXVA 5AI0A 2BGWA 5I9SA 4MYSA 2G82A 1KAGA 3WY8A 5EMKA 4ZEVA 3ZZ9A 4ZCNA 4D4KA 2NSHA 1QCDA 3S7ZA 1Y5UT 5JASA 3QLPH 1QHFA 4X3PA 3K0FA 3NRJA 5H9VA 8AT1A 4AU1A 5DGXA 1XEXB 4RGYA 4WY3A 4HGOA 1VHWA 4JJIA 1AHIA 2LBPA 3B48A 5IXYA 1CT9A 2VH1A 4R81A 3RYFB 4A1FA 3KV3O 4BWYA 3I5XA 1GDTA 4RVDA 5KQPA 1XK7A 2IYNA 4A6EA 2Q8PA 4XQGA 3TZKA 2D3TA 3VI3B 4X8TH 1SBYA 4RKYA 3LGXA 3UAWA 1AKTA 4WT7A 4HV4A 1IN1A 3WS7A 3AM1A 4F2WA 1B0AA 1I7PA 4HY3A 2ZNKH 4DJDC 4JP5A 3KZCA 1C3EA 3KR0A 3D6NB 4GR5A 5K7RA 2G52A 3JVDA 1QHYA 3ITNA 5EC8A 4BWGA 2EX0A 2QUIA 1ZAKA 4ACAA 1SC9A 1AQYA 4Q9HA 4CIXA 2BLLA 4OM8A 8LPRA 2QMZA 4ZAVA 4HQ0A 1W94A 3K05A 3QKUA 4CTOA 2IPNA 1GL6A 1U2EA 3HUEA 4IGKA 5IN4A 3NLLA 3BRSA 4B1TA 3RAFC 2A4QA 4DQDA 1U9ZA 3FOWA 3E35A 3M6FA 1KZ9A 4FLMA 4J7XA 3GICB 2F00A 3LUCA 5EE5B 4KODA 2WI8A 2TPIZ 5HF5A 1KXDA 4BVKA 2RD2A 5HFAA 2HA5A 2PWAA 1Y6GA 1Z2DA 3TAHA 2UWOA 4PG4A 2IEIA 1ACMA 1Q74A 3WE7A 4MKIA 1TALA 2RBEA 3DZJA 2YY5A 3PUIA 4CKBB 2FI3E 4PC3A 3EPHA 2JFUA 5B58T 2ZFFH 3L7LA 4NZMA 2V7QD 3KE9A 2NT4A 1ZYOA 4FLFA 4F12A 1PZXA 1K68A 2WJYA 1YRYE 1QFKH 2X3YA 2WPLS 5HK8A 3PLRA 1DAOA 1HQKA 3DM5A 4OMFG 4RZSA 1YMUA 1QC5B 2FTKE 3T5AA 3R6WA 2J3DA 4KDEA 4BEJA 4E5PA 3WHIA 3UK2A 3RVLA 1TADA 3FB4A 3L9WA 3OAAD 2EKPA 4RLFA 4TKVA 1O5IA 3RLIA 3L46A 2XUIA 1M1YA 2W22A 2H1OA 4BNIA 1GNPA 5ESDA 2OSBA 1H4SA 3CHYA 1R6BX 1P1IA 3EWIA 5M5BA 2RONA 4A0SA 1NM6A 1POXA 3O95A 4GNKA 1IHOA 5DXFA 3EXEA 1PO7A 2QG9A 2W9XA 2EYQA 4DG4A 3FNRA 2YDYA 2NZXA 3IIMA 3RU4T 3O74A 3UW3A 4S12A 3LBAA 2B30A 4H4CA 2QN9A 2QNRA 5U4QA 4GVUA 4EL0A 2BKAA 3AF0A 1Y89A 2REQB 5M04A 1VIAA 3GUYA 3CVWA 2IPHA 3EUFA 3AY6A 4BV3A 1FVHA 4J2OA 3PF8A 5AKZA 3RRNA 4YGXB 1IQIA 4VGCB 1E38B 2OCYC 8ADHA 3QPCA 4D7GA 2XRYA 1DDGA 1W88A 2A86A 3L5OA 2E7ZA 1E9CA 3WWZA 2FR8A 3VDRA 1GFSA 3KXDA 5ESBA 1MCZA 5KVSA 3N6VA 2I7XA 5CLJA 1WP4A 5JS7A 1GR0A 4FB5A 1FP2A 2OV6A 2C2GA 3ROTA 1H0SA 4FYHA 1U0SY 3KB6A 4MWGA 3OEEA 1YB1A 3DG9A 3TZ6A 1KYWA 2XD4A 2PRYA 1MB2A 5FBVB 5CDUA 3QQ5A 3G8BA 2D8MA 4RT0A 1P0CA 1ZRHA 2YRXA 2WUFA 4M38A 3WSTA 3TQHA 4UUBA 5FNVB 1MMFB 1GFIA 2C61A 4C0AC 4Y2QA 2R6AA 1W44A 2GP9B 4FT4A 3GAAA 1QIHA 1YLNA 2QX9A 2H1CA 5C81A 1NLZA 3CG4A 1L7RA 3HBMA 1TD9A 3RVKA 1ZGHA 1F5SA 4Z9FA 4X2WA 4HGQA 2XZDA 2OVFA 1MXFA 1GMHG 2FFHA 2PKEA 1GQSA 3A27A 4O0MA 3HY6A 1ZXXA 2HMUA 5SZHB 1G60A 3IVXA 2R8PA 3TK9A 3ESXA 4A5SA 4GAWA 4PCVA 3NV9A 3T7KA 1UDAA 1A0HB 3H6GA 4WOKA 1Y6ZA 4EPYA 1G8YA 4Z0NA 1E3IA 1E5XA 1G32B 2KMLA 4XOIA 4OGYA 4WEOA 3REOA 4J3JA 1QFSA 1LJUA 4YUYA 4RD2A 1HE3A 1AX9A 2QF4A 3DZ8A 3BMOB 1FN8A 3PMJA 4UAVA 5KKAA 3PENA 2TGDA 1FIWA 1DUIA 2ZTXA 4MTCA 1BOFA 2Z9CA 9GPBA 3RUHA 1TU0A 3WL3A 3VOAA 3CSDA 2NU7B 3AVZA 1ECLA 3MFQA 1DC4A 3WFIA 5B4VA 5FQNA 4UNSA 5EP2A 4RX1A 2FWNA 4JS0A 3GLHA 1Y1KE 3W9SA 2IEGA 4JROA 1H65A 2JBAA 3OT1B 2RAFA 4R0IA 1FYVA 4JOQA 1ST3A 4P4LA 4Y3UA 4TS9A 3BE5A 4MUHA 4L27A 1KS9A 2QRKA 1CR1A 5L3RA 4LDPA 3P2KA 5EIYA 4X6UA 3KQKA 4QPZA 1CY2A 3O92A 4C4TA 5KVVA 4IHJB 4IS3A 5F33A 4ITUA 1NXPA 1NE7A 3SG0A 2EWMA 3G5MA 4F92B 2PBLA 1T1IA 5KNCH 3ZBUA 1KP2A 1QB7A 3ML1A 3VTKA 3LY9A 4ZT2A 4JP3A 4WX2B 1XE3A 1PLLA 5LL6P 1RXYA 2CZCA 4LJ6A 1FTWA 5ADVA 2FN4A 1HXEH 3FHJA 1MIOA 2QV7A 3IP1A 3PPYA 1AZLA 1PQPA 3AG6A 2ZT5A 3V4OA 2YNMC 2ZPTX 3OQ1A 1LC0A 2GZ1A 4D8YA 4MAAA 3T9CA 2CUTA 3V3KA 5HQ3B 1PL6A 3HRIA 5ES3A 1ZMJA 4TMKA 1H3EA 5BYAA 1JWLA 3AFOA 3A9RA 3F78A 4Y2SA 1WXEA 4ZT5A 1DEXA 2XCQA 4GZ5A 1Q14A 2A5AA 1QJ6B 1KOFA 2Y2UA 2AX3A 3GZ4A 2XNSA 2R66A 1RAHA 4DN6A 1YCHA 3E8MA 1DAGA 4WFIA 2HNAA 4K3VA 2ATEA 1P5FA 4XRNA 2F9FA 4NVRA 1FUYB 1R12A 3W6OA 5DWDA 5E38A 1Y8AA 4U7HA 2C8XB 1EE1A 3H9UA 1SKMA 2OV4A 1GSHA 3S70A 1C5RA 2WWWA 1AN0A 3M3HA 4FNGA 5EKDA 1AQUA 1D4PB 1XWIA 4RF5A 1U9CA 1JQ5A 1BN6A 1XHFA 2FPZA 1EG7A 4F56A 3DFMA 3A1WA 3W9BA 4EFKA 5AT1A 1L3BA 1V1MB 3NTVA 2P2DA 3T5PA 3K1YA 4DHEA 4PINA 5C1IA 4A8HA 3I28A 4FWTA 1OS8A 5E2PA 1WS6A 4JMPA 3JD3A 3C6BA 3ICOA 3G0CA 1EKXA 4NX2A 1M2EA 3NPMA 1FY5A 3IVAA 3FCAA 3BMNA 4LDJA 4FYMA 1MF7A 1SIBE 2BMAA 3ZHYA 3VGCB 4NKRA 1PU2A 2I67A 2D0DA 2JKYA 3IDFA 1QF9A 2NU9B 4YAKA 1ABJH 1DGQA 1RAFA 1CUYA 1KFBB 1U2DA 2ZI4A 5AVZA 4KAJA 2WFLB 2PS0A 2VAPA 1B7XB 4XGKA 1L3CA 1FFGA 5JCOA 3U4GA 3CH6A 2EVWX 4G9GA 3ZC3A 2IF0A 3UUGA 5LPEA 3GCOA 2Y05A 1PGOA 2VP6A 3LUPA 5KTNA 2X19A 4MI6A 3ETEA 2B99A 3FWPA 4UUOA 4W8GA 2IZZA 1C1QA 2KLBA 2UZAA 3IVMA 2PZAA 3V9AA 4ZMBA 4J43A 1E2FA 4INZA 3NANA 2JCGA 2GCPA 3DE0X 4YWHA 4DLXA 4MJLA 3D3WB 2A59A 2IZ1A 4D3SA 3BDAA 2WC1A 2OFPA 5DHFA 3D8BA 4NS4A 1FLNA 5ELXA 1GAJA 2J1LA 4CXMA 1GHZA 4UEQA 4E4RA 3A89A 1VXOA 1DKNA 1DINA 3ERCA 2AN5A 3HSSA 5JTTA 1UQRA 2IYUA 4U2EA 4IVNA 3C6YA 3VOSA 4ESOA 3G49A 1NUSA 1Y4SA 2LDBA 1TPYA 3NBYC 4C0SA 1ZS9A 2PUXB 3F7OA 2OLEA 3LXRA 1WPRA 1ZP6A 3GLFA 2Z56A 1CQIB 3LY7A 1JXAA 2VGCB 3KX2A 3BD6A 1GZSA 1O2JA 2IHBA 2H85A 2P27A 3AEKB 3VH2A 1OKXA 5L30H 1Z4JA 2VTEA 5KNBD 2BGGA 4WCFA 4BB9A 3AHEA 3FHOA 1XD2B 1PFYA 3HDHA 2ALJA 3JZ1B 3TGJE 4HEA1 2H0AA 5FTLA 1DC3A 4H59A 5EJGA 1ORIA 1T6YA 2B0FA 5GVRA 3ZXUB 5TARA 4Q4JA 1GL7A 2CNBA 2XMRA 3AB8A 4QXAA 4XPZA 4D6PA 4AKTA 3QNWA 3NXKA 2XYAA 4F49A 3DFFA 3TLXA 1MTUA 4NIVA 3WHPA 2XUDA 3B60A 4KO3S 3W5SA 1P2SA 1X7XA 3V2IA 2IDZA 2V4ZA 5AK4A 1IQPA 2VUUA 3AL3A 3DMFA 5FCRA 4BNJA 3MT0A 1Z8IB 3DL2A 1MC1A 1CA0C 1HRDA 1FMCA 1O1YA 3QUCA 3R3HA 1OFUA 3OLCX 4JFRA 3CZMA 3THYB 2IHZA 2H3HA 1RI4A 1QIGA 1E2QA 1JPVA 2J9GA 4UFPA 2B4AA 1S2IA 4NS1A 2AC2A 2YWGA 1MORA 3GUHA 3ODPA 2H8GA 2E49A 4XX0A 2SFAA 4L0MA 3TZQA 3UA3A 4GZLA 3QVVA 4EOGA 1KLJH 4HX9A 2H9EH 4OKIA 1ZM9A 4D92A 1LTOA 4UFDH 1ZH6A 2H2FA 1J17T 3AERB 1E7SA 1G98A 2CC2A 3BJEA 2TBSA 3JZ2B 1CBWC 3MMZA 4B6GA 2ESTE 5IKOA 1ZESA 2XCIA 4HX5A 3ZCUA 5CDTA 1OLOA 4QFMA 1BHJA 1SHTX 2QYSA 5K03A 2C4WA 1Y1SA 3JSAA 3G59A 3ROZA 5IBCA 5IDKA 4CKZA 2VBIA 1FCJA 2YV2A 1ZONA 5ALTA 1O9HA 1AUQA 3RS4A 4MMXB 2PIAA 3K09A 4U02A 3JZDA 2CF9H 3QN7A 1IQGA 3CVXA 2R1TA 4R7GA 2BQWB 3GF4A 2J31A 4MIYA 3RWBA 4INAA 1DO2A 4IWYA 1XCBA 2Z30A 2IZ7A 4XTRA 1SKUA 5GP1A 3V9PA 1NBMD 3V8RA 4NK4A 3VRHA 2J38A 1A5GH 2EG9A 2HA3A 1DOAA 3QPBA 2W37A 3D7RA 1ESDA 1U7XA 2X14A 2P94A 2WUEA 1WKVA 3QVSA 2QENA 5BSWA 3R0XA 2WMOB 2J3QA 3N39C 2J45A 4GG1A 3TTSA 2ZHWH 1YDGA 3O8QA 2IWHA 5TJ9A 2PY6A 3CBQA 1K28D 1E4OA 2QKYA 3VTZA 5JR3A 3E70C 2P67A 2VNHA 6ESTA 5DGTA 3R9IA 3IVGA 1UC9A 5K4GA 1M67A 3WAGA 1JKJB 2SCUB 4YJ2F 1U3DA 4G67A 4YJHB 4NF2A 5IK2A 5D51S 4K8RB 3ES9A 4CMEA 1BCSB 3SEAA 2CFTA 1MX3A 5DHRA 2BD2A 4LKOA 2VLBA 2RC5A 2IOHA 1C5OH 4OOEA 3HXQA 3PQ3A 4MNYA 2EFYA 2X77A 4X7MA 3VBCA 1YBVA 3LU9B 5JBIA 2IXAA 3KT0A 4UMVA 4ZK6A 1BJKA 1Q0QA 1V5FA 3HMQA 5ECWA 2J95A 3A37A 1ZJWA 3TLGB 1O6BA 3PPXA 3ESYA 1JR4A 3JX9A 2OYCA 4LC9A 4K87A 1GDHA 3HJAA 4RENA 5FT9A 3QQPA 2G77B 3TR6A 4K9RA 1CJMA 1VSTA 2H4WA 2VNSA 4EFLA 1FU4A 2B8EA 4OLFA 3DHYA 2COEA 1UR5A 3AOEC 4LEIA 4DIHH 3W34A 2B1JA 3Q5EA 5B1IA 4XPIA 3Q7IA 4B2PA 4R1UA 4M7PA 3N8NA 5EXSA 1CJTC 2PPVA 4LDZA 1D2RA 5AJUA 4BC0A 3IVCA 2XDAA 2M2AA 1AQLA 2X5XA 1VKRA 4IMQA 2BKUA 4A91A 3KAJA 4NNPA 4BGUA 1QOZA 4C87A 1AWHB 4LGCA 4RJIA 1ZIXA 3K1TA 7LPRA 3B3AA 3F8SA 4ZVKA 4EH1A 4R9VA 4YUWA 2YUTA 2FZ5A 1FY8E 4MVJG 4MQBA 1GPAA 1R0BA 1ZA2A 3AKYA 1N2CE 3LF1A 4X7BA 5FFNA 3Q11A 4CRFA 3AFHA 3LY8A 3A88A 2YN4A 5BW4A 5JSZA 3DKRA 2BB4A 3RTGA 2C4KA 4NC9A 3RQIA 2E55A 5JCZA 3LGAA 1UVSH 1O2RA 3O94A 2JFWA 3RODA 1BU5A 2GWHA 1XRQA 2YWEA 1UC5B 3TZEA 4MRSA 1RPJA 1N8OC 2Z8XA 4KPFC 3U4QA 3FOBA 1V6AA 1XNGA 1DDIA 4TLLB 4UUMA 1MD9A 3PWKA 3D0QA 2GPWA 1CVRA 3MTJA 4NIWA 3KYCB 4KFSA 4C01A 3GJ7A 4TKUB 1SHUX 1Q5PA 1A0JA 3KTAA