4B6EA

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
646
structure length
645
Chain Sequence
ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVTGSVVIVGRIILSGSGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 202
structure length 645
sequence length 646
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b6eA04
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b6eA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6eA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6eA02
2VP2A 3P26A 2QEQA 2HDNB 4IOKA 4N0DA 4G5GA 4OQNA 1KDPA 5L8VA 3FPAA 5DGXA 2ZVPX 3CZQA 3EPKA 4I1OA 3LXXA 4XD7D 1E79D 4D4MA 4L15A 3CBQA 1MO3A 3PEVA 2KJQA 3A4LA 3A4MA 4UJ3A 2B7BA 3BD9A 2NGRA 2OBNA 4Q4HA 4U02A 1YZUA 2PMDA 5A0FA 4QRHA 4D0GA 3D3QA 2FSGA 4A15A 4ZI3A 4RD1A 2CDNA 4R2HA 3RVBA 1II9A 3C4JA 1NN5A 2OFXA 2GZAA 2CJWA 1FP6A 1P73A 2V8OA 1EWRA 4TMKA 2JCSA 3PXGA 1WMSA 2RGAA 5EXXA 2H16A 1CLUA 4P4SA 1LS6A 3K0CA 3TNFA 4DKXA 3H4MA 2ZM5A 2BCJQ 2GCPA 3K0FA 4A1FA 2WWIA 2WSSD 4Q03A 4F93B 3U3RA 1S3SA 2YWEA 1T6NA 1OXVA 2Z0MA 3QIAA 4M9FA 1PUIA 4LJYA 5D3MA 2WIBA 1H8EA 1WCV1 1FZQA 4AWXA 1CIPA 1JEDA 3R9XA 2RGEA 2X1VA 2GJKA 1KJWA 4Z1MD 2FA9A 3PCRB 3ETLA 1TUIA 4PPNA 1EESA 3QXXA 4F4CA 4QXAA 3T35A 2HV8A 1QRAA 3VX4A 4BFTA 4KBFA 5AK0A 5FPKA 3OTPA 1E2LA 1UKEA 4X8LA 1DAKA 3U5ZB 4AK9A 1K5DA 1OXSC 1W5SA 1CKEA 4GPTA 5FFMA 2ZIAA 2ZUCA 1Z0AA 2R6DA 3BRWD 5JECA 3QSYA 2ZRCA 2ZI6A 4IVPA 1I4LD 2NO9A 4OK3A 4JYBA 4CDGA 4ITRC 4TTQA 1E79A 2EWWA 1OF1A 3D6TB 5HKKD 4A0RA 3FB4A 2WJHA 3WBJA 4KFSA 5J47A 4B33A 1N6RA 1OW3B 1E2FA 3BC1A 3E70C 4V0NA 4A2QA 3RC6A 2WOJA 2A78A 2WWFA 2RGGA 3QXHA 2FZLA 3ZS9A 5B58C 1N3BA 1ZD8A 5TXGA 4FMCF 3CRMA 3HYRA 4OQMA 1W4BA 1F2TB 2HEIA 3LLUA 2HCJB 4GOJA 2C95A 5AJZA 4HUTA 1KAOA 1U8ZA 2F3RA 3U2QA 1XTQA 5DHFA 1L2TA 3CR7A 2O8CA 4CZ2A 2AKAB 2V9PA 3ZS8A 5KSYA 5E7IA 5CB6A 3RWMB 2QORA 3M5LA 1W2GA 1OV4A 3BFXA 3SUGA 2WSSA 4MRNA 1T3SA 2C9OA 4B34A 1ZAKA 3SV9A 2G6BA 2J3EA 4I1SA 5CLLA 3V9PA 4EDHA 2QGNA 3RHFA 4LYJA 3FKSD 3RRZA 3T5DA 2VP6A 4JLPA 3RS5A 2CMKA 3AUXA 3NC1C 3T12A 4IFEA 4JMPA 2ZSEA 1TEXA 4NTZA 5H4IB 3NH9A 1E9RA 1LF5A 3ADBA 2XXAB 1E2HA 3EIQA 1UBFA 3QE0A 4B35A 2ZSAA 3WMGA 2RGNC 1YQTA 1OH7A 1M7BA 3RC4A 3EZ2A 1E9DA 3PG5A 4C2TA 4PHTA 3UATA 3IBGA 2LWIA 2QE7D 4JLDA 3F8TA 1HV8A 3ZGXA 2K5UA 5EXPA 3AVUA 2GGVB 3TQCA 3KX2A 1JAIA 1TQ4A 4Q1FA 2W0SA 1AS2A 2GTPA 1HQYE 2AX4A 2OAP1 2ONKA 2Q0HA 1IJEA 1KK0A 4B3XA 1IJFA 3GEEA 3KQLA 2BJVA 4RD0A 3K0SA 1SULA 1IN7A 2HXSA 3KB1A 3KEEA 3CH4B 2A5DA 3TUIC 3ADCA 5TARA 1IN5A 2ZJYA 1FUKA 1PLKA 2FPMA 4NYIQ 1UF9A 1O3YA 4OI1A 4BFWA 4V0OA 3LVQE 1UBCA 1CU1A 2JASA 5KDLA 1OXUA 2FSFA 1YR6A 2VSXA 2GJSA 5EXSA 2P6NA 3EAQA 2NQ2C 1ELOA 4XTCS 3OIWA 5LD2C 1A1RA 1GL7A 1K8RA 1DO0A 1GIAA 1W4AA 2LKDA 2YC4C 5FBRB 3LH5A 5GJCA 5DN6D 4F92B 3DM5A 5TY0A 1E9BA 1NVVQ 3FMOB 1Z06A 1G18A 3ZQ6A 4B6FA 2WAYA 1W49A 4PO9A 2A7QA 5H1YA 2V4ZA 4Q1CA 2H5EA 4AG5A 3OE7D 4LBZA 3D7MA 4QHSA 4B3DA 3DPUA 4QBHA 4OHWA 4R98A 1CRPA 3VX3A 3UMRA 4YMWA 2XGJA 3O8RA 3RSLA 5GJWC 1E2IA 1Z07A 3K1JA 1Z0JA 4CEJB 1DAEA 4MUBA 3QKRB 4GP7A 1E2JA 2R8RA 3CRW1 3AM1A 3TLXA 2XZPA 4Q9JA 2O8BA 4PO1A 5DYGA 2WVJA 4G5QA 4NL4H 1BIFA 4EFLA 1QF9A 2O0HA 1VMAA 1KI1A 3NEJA 4DSNA 2IUTA 4LCBA 1WBBA 1NVXQ 4RZ2A 2DWQA 1N6HA 1DG3A 1PVOA 1FTNA 2WMNB 4LOAA 2ERXA 5IT5A 2F9VA 2GVFA 1CR2A 5KU1A 4BFYA 5FL7D 4P3YA 1F2UA 1G8YA 2C5LA 3PV0A 4NYMR 4O0MA 3KQNA 3HPRA 5DISB 3U3MA 4B44A 3AVVA 3GLFA 1QHHA 1GFIA 3H1TA 1X8KA 4TLCA 2KWIA 3N2IA 4HATA 1DXPA 2GRJA 2QT0A 4TQAA 4FMBB 2A4QA 3TR0A 1AGPA 1VECA 4A2PA 4B48A 4WH6A 4QM6A 3LXRA 1WA5A 3QKUA 4A36A 4NCNA 3DVLA 4OM9A 2RGXA 2ASEA 2J0VA 4IKEA 5IDKA 3AF4A 3K70B 2QAGA 3IPXA 2BM1A 5TB5A 3X1XA 4A1VA 2IYVA 4M1OA 3I92A 1A82A 4L9SA 1XTRA 3Q85A 4A2WA 4A8JA 2ZROA 3GLHA 4DBLC 1LW7A 4ZO4A 5FBVB 1KY2A 4RVCA 1NG9A 3S1AA 4Q4JB 1W3CA 5FPYA 2ZS7A 3OE7A 5B6LA 3LBNA 2XNIA 4B43A 5FOVA 3I8SA 5LBIA 1N1LA 4HUQA 4B76A 3THXB 4Q4AB 2CBZA 2C98A 4M22A 4M21A 4AYWA 4JVMA 2FFHA 1G3UA 4H1VA 4ESHA 1G291 1KKLA 1X1RA 1X86B 2IYUA 2GCOA 1LB1B 2ZYTX 3UK6A 5KNCA 2K1QA 1F3OA 1DVRA 5DSZA 5C46F 1E1RA 3BBPA 4IDOA 1UPTA 1NBMA 2WIAA 1XCMA 2DWOA 4QG7A 4QGFA 2Q9AA 3Q7QA 4NWLA 2HLDD 4DJTA 2NPFA 5G3YA 1HH4A 1Q21A 4NONA 4WXPA 1E1QD 3GLFE 4DCVA 4PSAA 2WWGA 4NPHA 4CEIA 3EZ9A 2DPXA 1CP2A 2WJJA 1G4UR 4U5XA 3RS2A 1VYTA 1OSNA 4I1VA 3LQRA 3SYNA 4JVSB 2IYLD 4PAOA 4Q4LA 1OIVA 4EKDA 3HWSA 4HLQB 1DAGA 5FL7A 2FWRA 4S35A 3DZ8A 2ZJ8A 2EWVA 2PLFA 4M9ZA 3AKDA 1YR8A 1SKQA 1VCOA 1C4OA 4URZR 3VR3A 3EWSA 1GITA 3QOFA 1E4VA 4GOKA 1Q44A 2JJ2D 4JYCA 3EZFA 5EXTA 2ORWA 2V54A 1XTSA 1W47A 2OXCA 2IF2A 3ZIAA 1Z47A 1JAHA 3U7EB 3A58B 1TQDA 3E1SA 4KSBA 3I1FA 4EPVA 1JECA 2VSOA 1CEEA 2FOMB 3K8YA 4KLNA 4WZAE 1TNDA 2ZI4A 3A1VA 2J59A 3B7GA 1NBME 1US8B 3ZYCA 3SN6A 3AEZA 2HUPA 3LFUA 4GMXA 3VKGA 4L8GA 2IUUA 4K8OA 2GXUA 5KDDA 4PHHA 3GJ3A 1U81A 4TMVA 2ZE8A 3M5OA 1BT7A 2B7CA 1SGWA 2FP7B 1KI2A 1MABB 3C41J 4LX0A 3RSOA 2J5XA 2C9YA 3G82C 3ZVMA 1FPMA 2QROA 1OKKD 1NRJB 1IN8A 4R2IA 4GBMA 2HLDA 4N0EA 8OHMA 5E7JA 1E0AA 3PJRA 4AKEA 3T1OA 2OCYC 4GOXA 3JZMA 1E1QA 3FOZA 3TIFA 1T3HA 4RD4A 3REGA 4OK6A 1KI6A 1L4UA 3B1XA 4DIEA 4BLQA 1RE0A 2JJ1D 1AN0A 1M74A 1TL7C 2OEPA 3PVSA 4PQYA 2AK2A 3UG6A 3DDCA 5J4KA 3TKLA 2VP0A 1PJRA 3Q3JB 1F60A 3W6OA 3CIOA 4PHFA 4WZ6A 1BS1A 2VTKA 2J9RA 4Q02A 2WPDA 3AK5A 3CRRA 4Q7KA 4DDVA 4URVR 2I1QA 1T0HB 1G8GA 1OIWA 2XNSA 3ZH9B 1ZUHA 1IXZA 2PBRA 3KTAA 3ZZUA 5IDVA 4JKYA 1AGRA 1ANKA 2D3WA 5BYKA 1U0JA 4P0TA 1SXJA 4RKEA 4NU0A 1QHGA 2BBSA 5SZJA 3Q72A 5CYOA 2WSMA 1FUUA 1Y63A 2G1JA 5BW8A 3L8ZA 4Q00A 3MCAA 4E09A 1JJVA 2REXB 5L3QA 3B60A 4KI0A 4LHYA 4JJKA 2IEYA 3ICEA 2R9VA 2QPTA 5FH9A 2Q9CA 1VCIA 2NO7A 1LS1A 1GTVA 5ESBA 3QG5A 1I4TD 2OLJA 4TZ6A 2P0EA 4H1UA 2OBLA 1VCMA 2ZS8A 2R6CA 3MMPA 3VR2A 2HYIC 1U8YA 1DARA 1IBRA 3P8OA 2VPPA 4W5WA 3RC5A 2QSZA 4WZBE 1Z22A 4QGHA 4ZDJA 4TLDA 5FUYA 1XD8A 3LV8A 2HT1A 3U4QA 3C5CA 3UKDA 2X2FA 2EVWX 3BERA 5DH9A 1Q3TA 2C96A 2IS2A 2REBA 2RKOA 5EP3A 2WZQA 3SQXA 4TLBA 5KO2A 4ZIRB 3KJIA 4DLRA 3KQHA 2TMKA 3UMSA 3GLGA 2JJ1A 3ND8A 1XEWX 3LOXA 2ZUDA 3DOFA 2I4IA 3GJ7A 1Q1BA 3QF7A 3ZLJA 3WRYC 2CCGA 5JSZA 2B92A 5JI2E 4TL8A 3ZVRA 2F9UA 2QN6A 3HYTA 2DFKB 1SXJE 1XP8A 3NBXX 3UIEA 4M9QA 3ICQB 1ZUNB 3FHTA 5K8TA 3GFPA 4X8OA 1E96A 1XWIA 4QBIA 2JLUA 3NKVA 1AZTA 3WYGA 4AKIA 1N6OA 2NG1A 2QP4A 1F48A 4DLSA 3LX8A 3EPJA 4PO8A 1XZQA 4URYR 3TBKA 1ZM2A 3K70C 2AD1A 4WH8A 1KZGB 1XEXA 2ORIA 2FMXA 4RZ3A 2WAXA 2IYXA 5L3SB 1LY1A 1YHNA 2P3SA 4JLKA 1UDXA 1VHTA 2O8DA 1KNQA 2AD5A 3IEVA 4TQ9A 2ZI5A 3U6KA 4R7ZA 4BE7B 4LHWA 3KQUA 3GJ8A 2WWHA 2JLYA 3T61A 1ZVQA 2NZ8A 1FOEB 2BOVA 5HZHA 3PIRA 1E2GA 1NVUQ 4JMYA 3RS3A 4NKRA 1L4YA 3SHFA 1Q0UA 3CF6R 1KNXA 1RJ9B 1KI8A 1MKYA 1U8AA 3PUWA 5FTNA 4ZDWA 4LJ6A 1M6NA 3WNBA 1KI3A 3TK1A 3GLGE 1Z6AA 2P5SA 1JQJC 3IILA 4GZMA 2ZJ2A 5H70A 4AYTA 2IXGA 2XOKA 4A92A 1A4RA 4ARZA 2VBCA 3CF0A 4NE2A 4EPTA 4Q18A 1NP6A 2A9KA 3DHWC 5UKDA 2ZE6A 1X3SA 3QXCA 2QAJA 1JR3A 5B2ZA 1UBEA 3FHCB 4KSCA 1T4GA 1W0KA 1RTLA 4M4SA 3QKSB 1N0UA 3RABA 2ZITA 4NCJA 3R9IA 1YKSA 1FL9A 3ADDA 5EE3A 2XEXA 5T1VA 3D8BA 2AFIE 2OM2A 2F1HA 1HEIA 1E69A 4M1MA 5AJYA 2IXFA 3DM9B 2FGJA 3AUYA 4FWTA 1SVMA 3LO5A 2VHQA 4MRSA 2BBWA 4D4KA 4N1AA 3O8BA 2GJ8A 1G3RA 1T8UA 3R7WA 3VMFA 1DAFA 3EPLA 3W5JA 5EQSA 2ZR9A 1G8PA 2WHXA 1IAQA 2WOOA 1OE0A 3THOA 1D2NA 1U9IC 4MQBA 4RY2A 4G3XA 2ONJA 4TYNA 4LHVA 3PUXA 2ZANA 1FNNA 3CKLA 3PEYA 2OBQA 1E94E 1II8A 1NNEA 3SUEA 3HU3A 1GNQA 3RS0A 1Z63A 2P59A 3EPHA 1FX0B 4TT3A 5IF9A 1KGDA 3H84A 4HB2A 1Z2CA 4D6PA 3FGNA 2ZRKA 2IWRA 1T5IA 1KJZA 1KK1A 4TMTA 3T1QA 3LAWA 2BV3A 3THWA 4RFVA 3T06B 4IOLA 4US1R 3BS4A 1VCNA 1RZ3A 1E98A 5CJPA 1TU4A 2RGBA 1ZM3A 4I4LA 5LB2A 3TQFA 2ZXUA 4Q47A 1WDTA 3M5MA 2BDTA 2WMOB 4WVFA 2JJ8A 3KQKA 2EU8A 2QENA 4KLZA 2W58A 2D7CA 1JPNA 1P61B 4C9BA 4MDFA 1Q57A 2AR7A 2VYFA 3MSXA 2EW1A 1Z28A 2QRNA 4FCTA 1H8ED 2C77A 1OFHA 4LY6A 1FW6A 3AF3A 2YHSA 4LJ5A 1VPLA 3HR8A 2IS1A 2HF9A 3TUZC 2KBFA 2F1JA 4IVRA 1VYUA 1KO1A 3U44B 2EYUA 2OC8A 121PA 5JZVA 2CVHA 3VR6A 2CVFA 3PR1A 3GJ6A 3TMKA 1GL9B 3SQWA 2GHIA 4C3ZA 4Z51A 1U98A 2QV1A 4D2IA 5JHHB 2FEOA 1E0KA 2CLSA 1CJVC 4B3CA 2MMGA 1G5PA 2WKRA 3CNNA 5FL3A 3IPYA 1G6OA 2JAQA 2PH1A 1QG2A 4B74A 2G77B 3PEUA 4M1SA 2PZGA 4JSYA 4BFUA 2VF8A 4JVNA 2ZPTX 2G1KA 4Q01A 2I1VB 621PA 1CJMA 5GJVC 4C0SA 4HDOB 4I81A 4IOMA 4CRWB 4X8HA 2QG6A 2VHJA 4QJ3A 4XWKA 4TLAA 3CX8A 1UFQA 5F3WB 2O8FA 4N3NA 4V0MA 2A5GA 2O0KA 2CEAA 3RC3A 3U3KA 1R7RA 1XD2A 1GRNA 1IY0A 4LHXA 3MAAC 3TSZA 4B3FX 3B6EA 3QI2A 4PC1A 5JEEA 3A36A 4QJ5A 2V7QA 5CB8A 4ZCIA 1TEVA 3OEEA 2WKQA 1SVSA 3LBHA 4G01B 2Q6TA 2W6JD 5KSPA 2HF8A 3M6AA 3OAAD 3T5GA 1JR6A 3O8CA 1Q1QA 1TAGA 4NBSA 2ZSFA 2YOLA 3OEHD 1QHNA 3BB1A 5C2JB 1VKJA 3L0PA 1N0WA 3ZD7A 1F2TA 4TYDA 4LSGA 1P9RA 3ZDQA 4F91B 1W36D 3QVVA 2MSEB 3OIVA 4NYJQ 1SZPA 4PPFA 2PLRA 1KMHB 5JMTA 2ZI9A 2GA8A 1YZTA 3WYFA 3A1UA 4D81A 2IL1A 3CH5A 4US2R 5KUTA 1P75A 2O52A 3KNXA 3U1JB 5HZKA 4MITA 1GP2A 4G0NA 5BXQC 4YMVA 2R65A 2Q3MA 4GL2A 3FMFA 5FOUA 4LC1A 3BE4A 1GAJA 1V43A 2IYWA 4BRUA 4V0ME 1ZNWA 1GKUB 1ZUIA 1CTQA 4LRWA 5J4HA 4DZZA 1TADA 1R5BA 1XF9A 1L8QA 2OCBA 1S2MA 3ONWA 4KFUA 4YQFA 1L7VC 2BKUA 1EK0A 4WAUA 5ANRB 3WP0A 4O25A 3I61A 2JIZA 3W5IA 1CJUC 4TYPA 1ZD1A 4G5OA 1MO5A 5J4LA 3CNLA 4CF7A 1OXXK 5HPYB 4C0HA 1E2KA 4FW9A 3VU9A 1DELA 1J7KA 4GSYA 1GVNB 2NOAA 2A2ZA 3UPUA 1NF3A 2PZEA 3H2YA 1CJKC 3ND9A 4UNNA 4IHQA 3WHKA 5JLJA 2AWOA 2AXNA 4PSVA 3NWJA 4O2RA 1IQPA 5CJ2A 2A4GA 4P4TA 2W6JA 1P3JA 3OAAA 1DAIA 4TL7A 3LX5A 3SJBA 3TVTA 2VL7A 4IXMA 2Z5FA 1BO6A 3OEHA 5CK5A 5HE8A 4DLYA 4PPQA 1XX6A 1ZNZA 2YJTD 4D26A 4P4SB 2ANBA 3A1WA 4LV8B 1COWD 1RW4A 4JVLA 1GUAA 1NKSA 1OPXA 3VQTA 1RYHA 2ERYA 3T15A 5C4MA 1FQKA 3IHLA 2NO0A 3K0FB 1NJFA 1QDEA 1KI4A 3K9GA 4M1WA 4DCNA 2NMVA 2VEDA 1TUEA 4D80A 3QG1A 2Z43A 3SFVA 1GNPA 2PJRA 1KSJA 4JLNA 2YOGA 1MH1A 5KYKA 2B21A 3TGPA 2ZJBA 1UEIA 3VHXA 4DC9A 1OH6A 4GDFA 4I31A 2JLQA 3KXKA 2BBOA 4QNMA 1ZC4A 3J81k 1E99A 2EFCB 1ZBDA 2WWXA 3QUSA 3QF4B 1C1YA 4UNRA 4TWZA 4K46A 4PTLA 3FTQA 4ZKDA 3EC1A 5TVKA 3SC3A 4LK2A 2PT7A 2NO1A 3DEFA 3EASA 1TMKA 4TMXA 5HCIA 2ZRMA 2DFTA 4JT2A 2OXRA 1OYYA 1G3QA 5A4JA 2J87A 4OBEA 2ZAMA 2CLDX 3K9HA 2YNMA 1GDDA 4IRUB 4K8BA 1NL3A 4LUCA 2RGCA 4YLGA 3U3OA 3IQXA 2GDJA 2O8MA 4J0QA 4URWR 4UXIA 1YVDA 2XSZD 4Q9LA 2RGDA 3SBDA 1E0JA 2CCJA 3PUVA 4BASA 1SVOA 4C30A 1UM8A 2H8KA 3RAPR 5JJKA 1I2DA 3CWZA 4CEHA 1Q12A 3B5JA 1P2SA 1R2QA 4OJKA 4C0LA 5KSOA 1P2VA 1G7SA 4DEXA 3TR5A 2IXEA 2WJVA 4B75A 3FMIA 4KAXA 4MGZR 4CT5A 2QGZA 4LJ9A 2R2AA 4B2IA 1QBKC 4A1TA 1G7CA 1T5LA 3AB3A 1YZNA 4NCHA 1P5ZB 4RFSA 5AJXA 4LWZA 1COWA 1KHTA 1XRJA 2GZDA 4MRRA 1SVIA 2ZU6A 2IX3A 1E2NA 2O8CB 1RRGA 5AWFC 2ODEA 1GILA 1WXRA 1E9SA 1ZC3A 2C2HA 5AUQA 2IS6A 2ZRIA 3AKEA 4B73A 3FKQA 1Z08A 3KKQA 1G3IA 1BMFA 3BH0A 4TZ0A 1W36B 1Z6YA 3KZ1E 3EZ6A 1YR7A 1WRBA 4LC0A 3I72A 4LJ7A 1UDWA 1E9FA 4DCSA 4JKIA 1E1RD 1NBMD 2D7DA 4YDSA 1G8FA 1W2HA 4M1YA 5FUVA 1OT3A 3SU4A 4QM7A 3GD7A 3SV8A 2FSHA 3VTKA 2XB4A 3KFVA 1G1MA 3QNUA 4Q1AA 3AVOA 2MSDB 2R6FA 4XVRA 5DLQC 3P27A 4OHXA 4HAZA 5KPDA 1N6IA 2W2TA 1FQJA 2WJGA 4DLUA 5P21A 5JRJA 3PEWA 5JEDA 2XSZA 3CPEA 2AXPA 4RZUA 3IQWA 2KE5A 2KI5A 4GMDA 2DHRA 4I33A 1JJ7A 4ACAA 1EXMA 1DOAA 3W34A 4YONB 2DYKA 4A6PA 1U90A 4RI0A 4IEEA 4LDJA 3B9PA 3IDQA 2GAAA 2WWWA 3KN2A 3ZIAD 2C8VA 1NN0A 2PX3A 4TYYA 1RIFA 3NIBA 3BOSA 1U0HC 3UXMA 5TMPA 4PHGA 1I4DD 4M0LA 2UZ3A 2CL7X 1KDRA 2HYDA 1XCPA 3SYJA 2DBYA 3BH6A 4KYUA 4MUAA 2WICA 2QM7A 4EIWA 1XD9A 1QVAA 4QBGB 3X1WA 1KSFX 3I5XA 2CCKA 4HAXA 4DDTA 2ZTSA 1M34E 3GEHA 2H1LA 3RYTC 1NVVR 3SR0A 1KO7A 4EJSA 2W00A 3Q7PA 1NN3A 4XJXA 3EA0A 1CS4C 3G0HA 1KKMA 4I1UA 4RSGA 5M04A 3OESA 1JI0A 1E9EA 2C03A 4MYHA 2DB3A 4FMCB 4OL0A 3BXZA 4MH0R 3WMEA 3WYAA 1GG2A 4G1UC 3AVWA 5BN3A 4W5JA 1BYUA 3BORA 4BLTA 1R4AA 2FV8A 1MABA 2QQEA 2OE2A 4R8TB 3QEJA 4ON9A 3OZXA 4Y0VA 4Z8XA 4E07A 4EQ6A 1JXOA 3SNHA 1DE0A 2IHYA 2WJYA 3AV0B 2Q3HA 4DCTA 2O8BB 1WE2A 3RLFA 1G3MA 1YE8A 4DRZA 4Q1EA 1RFLA 5FOTA 2VA8A 3QPUA 1NY5A 3GMTA 3MLEA 4B71A 4LGMA 3W6PA 1J90A 2BHRA 4PQFA 5H68A 3LBIA 1HURA 1FMJA 1XJCA 1KMQA 2BMFA 3I5YA 1HE8B 2OG2A 4AY2A 3T1TA 2WPDD 5DNYB 1G7RA 2NIPA 1KK3A 2BMEA 1N6KA 3ZJYA 3U6BA 3GLHE 3IO5A 1XXHB 5J4VA 1KIMA 4B47A 4A1XA 2Y8EA 4JLBA 1F2UB 4GP6A 1OLOA 3LKWA 1XEWY 3GLFB 2GXQA 3JVVA 4PPGA 3AVYA 3FMPB 2O0JA 5KOYA 5EQTA 1SXJD 1Z0FA 3ECCA 3GFTA 1TF7A 1J99A 2OZEA 4XH9B 1JXMA 3CNOA 5G40A 1GOTA 1W0JA 5AUOB 2VRWA 1DO2A 3L0IB 2FF7A 4URXR 2QNRA 2NPIA 2Z83A 3AP2A 1SHZA 2HCBA 2J0UA 3LA6A 4OQLA 4KXFB 3O8DA 4RZXA 4DXAA 3C14C 5JBQA 4TSFA 3N5CA 4A8JB 1PV4A 3W3AA 4GZLA 2F43A 3TAUA 3CB4A 4ZI2A 4DLWA 4PC3A 3S1AB 5EPNA 4TYWA 2B8TA 2F9LA 3QKTA 3Q9LA 1HT2E 4HUQB 1DS6A 1KAGA 3A1SA 4RCZA 1Q1ZA 4V0KA 2C99A 3SEAA 4FCWA 2QBYB 4W9MC 1JXPA 5JHGB 4FI3C 3B82A 1M2OB 2FFBA 2YINC 2NTYC 4DLTA 4M1TA 1AS3A 1OHHA 3CRVA 3UANA 1S9HA 4IVQA 4OKSA 5IK2A 5EE5B 1TTTA 1T8TA 1M7HA 2JGNA 4LJ8A 2NZJA 2J45A 2HJVA 3NHAA 2ZRGA 3C16C 3M4YA 5CM8B 4CEIB 2RHMA 3LW8A 1VG0B 1HT1E 4BFXA 3AP1A 1Q3HA 3GJ0A 1W48A 3P32A 4AIIA 1N5LA 1N5JA 1VIAA 3CX7A 4JLAA 1G8HA 2YC2C 2HJGA 3LONA 2ZR0A 4BGDA 2VP4A 4EUNA 3B1WA 1MR3F 2PZFA 1ZM7A 1GSIA 5F9FA 4RKFA 2VSFA 2QL6A 2QQ0A 1N6PA 1QHXA 3W6NA 1R0XA 3SUDA 3WNCA 1JEEA 2IS4A 1NLYA 5BYJA 1T9HA 1Z29A 4FD2A 4NDZA 4Q66C 1KSGA 2F7SA 2BEJA 2BJWA 2I3BA 2PEZA 4R9UC 4HLUC 1NVWQ 5G3ZA 2A3RA 1FFHA 1U0LA 1E4YA 1XCGB 5E7MA 5J40A 3EX7C 4BLOA 3SOPA 2ZEJA 1Z0IA 3JVUA 2FN4A 3AH8A 3P4XA 4DLZA 5FBLB 1VG8A 5FPHA 3THYB 2YZ2A 3BJIC 4KHZA 5TV2A 4IJMA 1IXSB 2KB0A 3K0AA 3QXJA 3DKVA 3U3JA 4YC7A 1WP9A 1W36C 1AA9A 2ATVA 4PZYA 4WA7A 4URUR 2ZI3A 1R8SA 3NHBA 4NCKA 3SU0A 3B9QA 2F4LA 4C0BA 4FCVA 2XOKD 4CW7A 3LW7A 2ZRAA 4A0HA 1KY3A 5EP4A 2J41A 4OJQA 1WQ1R 5AR1A 2GXSA 4XVUA 3QBTA 5F9HA 4ACBA 5FTJA 4EPRA 1JR3D 1R10A 1EGAA 3TRFA 2ORVA 4QHTA 1M1YE 1W0KD 4MKFA 1DAHA 5EP1A 2OC1A 1XMSA 1RRFA 2F9MA 4HZUA 4IDNA 3TSOA 1OFTA 2G0NA 3F3YA 3KXLA 3GJ4A 3PQCA 1W7AA 3GJXC 4FXPA 1WF3A 4FWIB 3EZ7A 1P60A 5GJ4B 3C15C 5DYIA 4AD8A 2XCNA 1XFAA 2IYTA 2P67A 4UQOA 2H7VA 1N0VC 4MKGA 1KI6B 1ESNA 3CR8A 3SE0A 1C9KA 2RGNA 2ZRNA 4HAYA 2IA5A 1KOFA 3Q8XB 1RVDA 3GJ5A 2XTMA 3MJRA 4O3MA 3NTUA 3SU8A 2VP5A 1SVLA 3GCGA 1F5NA 1IY1A 1DY8A 2VO1A 5CYPA 3WBKA 5CDFA 2A30A 4LPSA 5LB4A 3T1VA 2DY1A 1YRAA 3AGQA 3HR7A 2V6JA 2ZRBA 3F0TA 2RAPA 4RCYA 3PENA 3DMNA 2P65A 3KTAB 1G7TA 3PV5A 4LZZA 2IYRA 2EFDB 1S3GA 5JCZA 2D2FA 3SFZA 3SV6A 4TT3D 1E2QA 1R5OA 1RRPA 4JJZA 4Q9IA 1ZIOA 2GETA 3W9YA 1LV7A 3AVXA 1SXJB 4OK5A 3SS8A 2L0XA 3OFNA 3LDAA 2FFQA 2FEMA 3K0EA 2JLRA 3QENA 3UWKA 2KBEA 3OHMA 4P33A 5J4YA 1G5TA 3PITA 2JLWA 1UKYA 3SU1A 4DDUA 1T3LA 5AJWA 4C7OB 4KITB 2BC9A 3W3ZB 3HP1A 1EFHA 3GLIB 4I99A 3KKOA 4EPXA 1NJGA 2BVNA 5CIWA 2W0MA 3AVQA 4A0GA 1AQYA 2PEYA 2BKEA 2W6IA 3IGFA 5EE1A 1ZIPA 2EQBA 2AKYA 2HT6A 5K8LA 1ZW6A 5DI3B 4YMUA 4WOPA 3L2OB 4Q9KA 1G6HA 1WXQA 2OFOA 3B78A 5JWHA 4BQSA 3U4QB 2BMDA 3MUFA 2GVDC 4MYCA 1Z83A 4KV9A 1ZU5A 2OK5A 2F3TA 5CDFE 3AVTA 1DAMA 4U7DA 1HA3A 2J1LA 3HDTA 1PLJA 4QOSA 2R6GA 5GJBA 4XVQA 2OSBA 1KYIA 2VF7A 2GEUA 3CM0A 3RNLA 2EYQA 4A82A 3IHWA 4JT4A 5JSZB 4UXJA 1T0JB 4PFSA 2HXYA 1AM4D 4FMDF 1BKDR 2EFGA 4G5SA 2AK3A 2Z4SA 3EWAA 4JBYA 2CK3A 4MGYR 4DVGA 1XJ0A 3HJNA 1P7CA 3WHLA 5EUQB 2C9CA 2OBOA 4MYUA 2XB2A 5EUMA 1AJEA 3ASZA 4DT1B 4GI7A 3NBFA 4QHYA 2OAQ1 1ZCAA 4IDQA 2P2LA 5ETXA 1QHSA 3GQBA 3NDBB 3MJHA 1II0A 2ANCA 4OI4A 2FPKA 2E1RA 3U7HB 5ELXA 1XMVA 5FPTA 2V7QD 3PV2A 1XEXB 3K09C 3L8YA 3OEED 4JLMA 4Q7LA 4Q48A 5C18A 1FTSA 2H18A 3IUYA 2GZHA 2WTUA 4A8JC 1JR3E 1CXZA 3IO3A 2O8DB 1CR4A 2ZR7A 4K81B 4KFTA 1IN6A 1ESMA 4QGGA 3P8NA 3MGCA 4NWKA 1OH8A 2P5TB 2PMKA 3NVAA 4IW3B 4DEYA 5A5GA 4CVNA 4E03A 4EFMA 2PCLA 4NZYA 1PLLA 4QGAA 3EG5A 4U00A 2N46A 5FR2A 4EAQA 1N25A 3ZD6A 3AGPA 1DG1G 1A2KC 2J0QA 3ZVLA 2P6RA 3FWYA 4JZKA 5FBWB 2JDID 1OFUX 4NP6A 4JSTA 1J2JA 1VIYA 4ARZB 2IW3A 2ECKA 1E32A 1ZJ6A 1IHUA 3LNCA 3RANA 1N6NA 2RB4A 4QFMA 1OIXA 3EARA 4D25A 3QBVA 5EPYA 1SKYE 4LBVA 4LJ4A 4UXHA 1OFIA 4W5HA 5BN4A 2DR3A 2QY9A 4PSKA 4XTRA 3R8FA 1CR0A 2FM2A 3UG7A 1ODFA 1EX6A 2YWFA 3CX6A 3KUDA 2XAUA 1GRQA 3IKJA 1YJ5A 4HLCA 1QZXA 2X77A 4UNPA 4XWAA 3C5HA 4B3GA 1N5IA 3E5HA 2GK6A 5FOWA 2FX3A 2JIZD 2D62A 5HCNA 3SYKA 2WM9B 2J0SA 2PL3A 4BRWA 1HY3A 1EFTA 3FYHA 4DSOA 1MOZA 2V1XA 3L0SA 2D4HA 1NSTA 1X8LA 4HB3A 1ZNYA 2X8AA 3R7WB 3DMDA 4MDEA 1GRRA 1I2MA 4DUGD 3K53A 2H57A 2QT1A 2YOFA 2X2EA 2CE2X 1UAAA 2O8EB 1T91A 1ZCBA 1P9NA 5EZ6B 2G9NA 5F2EA 1R6BX 1II8B 2ZRJA 1KK2A 1EFRD 1X6VA 2OV2A 3VNVA 2E9SA 721PA 2J46A 1YZLA 4AKGA 3B13B 1E2DA 4KJZA 5GVRA 1P9WA 3KXIA 4DIDA 3EIEA 1NMXA 2XZLA 3THWB 1DXWA 4KVGA 5C4GB 5KTYA 3OF5A 1E9AA 5GPIB 1A7JA 2IHBA 4DDWA 2OC0A 1BYIA 2SHKA 3RDPA 4IFBA 2OINA 3WXMA 1TQ2A 2GEVA 4H9GA 4DSUA 1EX7A 2JDIA 4BECA 2XJ9A 4V02A 3ADKA 1DADA 5JWOA 1YRBA 1A5TA 4QC2A 3P20A 3SU3A 2OHFA 2YOHA 4HAUA 2QRZA 2VP9A 3C7KA 3TH5A 1Z8FA 1AS0A 2W2VA 2LKCA 1IN4A 1TPZA 1YZQA 4PAMA 3P1JA 2W2XA 2XXAA 4ERNA 1E0SA 1NMYA 4LV5B 1ETUA 4TQUS 4BZPA 4BFZA 5EP2A 5AUNB 1A1VA 3MD0A 4P31A 4QKQA 2BMJA 3QVUA 3QJYA 4M1KA 3QF4A 4ASUA 2CE7A 6Q21A 4BEJA 2Q21A 2JEOA 2YWHA 3BGWA 4JL8A 2FZ4A 2YYZA 1MO6A 1MRNA 2ZJ5A 2ZU0C 4YMSA 4BLRA 1VHLA 5L3RA 1ZINA 3QPVA 4LBYA 2RH5A 3REFA 2QA5A 4JL6A 4PC7A 5G53C 4V0LA 2V55B 4Q4HB 1VG1A 1SXJC 5EE9A 4DUGA 4OQXA 4CGZA 3MFYA 4MGIR 4UNQA 2FPLA 2O8FB 4XD7A 1XJQA 2VHCA 1GWNA 1NKTA 1XD2B 1EFRA 4LI0A 2CJWB 3QXSA 3W90A 1JQLB 5DHAA 4P32A 1W1WA 2A5FA 3KDSE 4TL6A 1AIPA 4FMDB 4YDHB 4XSGA 5EE0A 2QTHA 2JA1A 4BLPA 5KNBA 2XX3A 2OFWA 3KUCA 5C1BA 5JRZA 3K70D 1TU3A 1YZKA 2GESA 3V00A 3LVRE 4AC9A 4PANA 3ASYA 4HLUA 1CF4A 4DCUA 3SJAA 1J8MF 3KFXA 5HTKA 3R8CA 4C0KA 3LLMA 5B30A 2QMOA 3RC8A 1RC8A 1BMFD 4KVAA 5D3MB 3UMFA 3I3SR 3QPWA 3ZZ0A 1XTKA 4NYJR 1HE1C 2F1IA 1JNYA 4OYHA 3DL0A 4F4JA 2UZIR 1S96A 2J7PD 4NH0A 4RD6A 1CJTC 1Z6TA 2CL6X 2FJUA 2EFHB 1KZ7B 4CEJA 2CXXA 1KO5A 4OI2A 4YMTA 5JWRA 4POAA 4BEBA 5SZIA 2ZS9A 1GKYA 1QVRA 3QKRA 4IOJA 4HYYA 1XMJA 1K6MA 221PA 1VTKA 1ZMXA 2ZJAA 4Z1MA 3BK7A 5SZHB 5EQQA 3RRYA 1XB2A 4HEJA 1ZYUA 4TN1A 2V3CC 4DB4A 3IIKA 1SQ5A 1G4AE 2ZRDA 4S2EA 5GNDA 4PQRA 4C2UA 1LNZA 2W83A 1N2CE 3NBZC 4M53A 1GZSA 2A5JA 2YWGA 2ZAOA 5KNDA 4II7A 3QEOA 3UWOA 1CR1A 1AZSC 4AKHA 2OO7A 3RRNA 4M9SA 2GJAA 3EIHA 4NYMQ 1KO8A 4BWYA 2ZRHA 2X19A 5HE9A 3B8HA 4Q5IA 5G41A 4F38A 2AN9A 1DPFA 2XTZA 3CWQA 3VU9B 5HKKA 4JBXA 3MG9A 2REOA 2VLIA 3M1IA 2ODWA 2XITA 4HSEA 2ZJOA 1U94A 1NS3A 1VYVA 1D2MA 1NSFA 1XPUA 2C78A 2UVQA 4HB4A 2R44A 2IYYA 4EPYA 1D6JA 2ATXA 5CIQA 2IYQA 3VR5A 3GFOA 1Z6XA 2DFLA 3GP8A 1FNMA 2JLZA 2GBLC 2RMKA 1NIPA 4C0QC 1O87A 2FH5B 4O2LA 3SU5A 4KBGA 4XIGS 4DLVA 2O5VA 1X1SA 4L9WA 1Z3IX 4GNKA 2OC7A 1ZNXA 4Q4JA 2D06A 5FPSA 4QL3A 1G9XA 2OCAA 5JJLA 2H17A 2ZYUX 1DTSA 3THXA 4Q4AA 4YXWD 2WWYA 1UEJA 2J7PA 1G19A 3B1YA 2FU5C 5KSZA 3SYLA 4HDQB 2GILA 3FKSA 1XPOA 2C04A 3JZAA 3IIMA 4LJAA 2IWHA 3SUFA 3Q5DA 5E4FA 4KCGA 3N70A 3W8RA 1R8QA 3M5NA 1EG7A 3AQ4A 3A37A 4CT4B 1Z0KA 3KB2A 2BM0A 3VR4A 5BN5A 2MMCA 2AHOA 1W44A 1FP7A 4RD3A 3ZZTA 3LRPA 4L16A 5DIFA 3AF1A 1OYWA 2QE7A 4JLJA 3AKCA 4BUJA 2E87A 4AG6A 2CHQA 3VKHA 1S9DA 2DFNA 1G5RA 2F6RA 1KTVA 1U99A 3FE2A 3KJGA 3KF2A 3NXSA 4MKHA 4NYIR 3TVDA 1RRCA 1WBDA 1NI3A 1NG1A 5FBQB 4PR0A 2N1BA 2WKPA 5FOSA 1XXHA 4E5UA 2ODNA 2V6IA 3ZVNA 3FFBA 2JATA 1KJYA 5FI1B 2XTNA 821PA 4CEHB 4ESVA 3OYPA 1GNRA 4XOIA 1W0JD 5JI3E 2A5YB 2DWPA 1Q20A 4BZXA 2QSYA 3IIJA 2YKGA 4TLEA 1U9IA 1M7GA 1TX4B 4F7WA 4D4LA 4MGKR 4NHOA 4Q1DA 4TSFD 3T34A 3U61B 2ZREA 4RFSB 2G0TA 4E22A 1US8A 4DHEA 2V1UA 5EQRA 1IY2A 1XTJA 3K09A 5DN6A 4D4JA 4DLXA 1W5TA 4YXWA 3RWOA 4Y0AA 4DB2A 2QU8A 4MYTA 2IYSA 4B6EA 1Z0DA 3X1YA 1W4CA 1VDZA 2NO6A 2PT5A 4G5RA 4PC2A 1Z6GA 3R9WA 2F55A 3TE6A 4IXNA 2A4RA 1LVGA 1OHHD 2GKSA 5FOXA 2IC5A 4HAWA 1ZU4A 5IK2D 3CF2A 5F98A 3X2SA 3B1ZA 3SJZA 2XNDD 1UKVY 4BFSA 2FOLA 2EFEB 4HZIA 2QBYA 1G17A 1SVKA 2FGKA 2LCFA 2AFHE 3C8UA 1J8YF 3I62A 4KO8A 5K8IA 4MKIA 1OB2A 5AJVB 4M2LA 3N2EA 4HB0A 1D8TA 2VHTA 2IJOB 3WY9A 1XXHE 1JPJA 3U7FB 3KKPA 1YR9A 3AF2A 3L43A 4GT1A 4HI0E 3H09A 1H8HD 4L5BA 1E2MA 4LBWA 4DSTA 1EFUA 1IXRC 3PUYA 3K9NA 3U7GA 3I8XA 4OHVA 1MO4A 5B57C 1JBKA 3VHLB 1B0UA 4B2PA 1OB5A 1QHHB 4HDCA 1AQUA 4JL5A 1HTWA 4LHZA 5FUWA 4ABYA 4A0FA 4Q21A 4P4UA 1TF2A 1D9XA 1KI7A 2OLKA 2FNAA 4I32A 3K0CC 4ZDKA 3NC0C 2GXAA 2ZQ5A 5CLQA 1KDOA 2MSCB 3V4FA 1JALA 1XZPA 1RGQA 2PCJA 4WW0A 2ODBA 3MWLA 2QAGB 2ZI7A 4JS0A 2QZ4A 3CUEF 1A2BA 4Q9HA 4NCIA 2QUZA 4ZCMA 2FSIA 3GEIA 2N42A 3GLHB 4KU4A 1IOZA 2WJIA 4CYMA 1Z5ZA 2IUSA 4QNRA 1SHKA 2B6HA 3THYA 1YZGA 3EXAA 2CHGA 1XBTA 2GEDA 5EJEA 1ONBA 1DY9A 2IT1A 4PX9A 4TMZA 4OQFA 2Q9BA 4EJSB 4IEIA 4V03A 4CIDA 1KI9A 2GWHA 2ZRLA 2GCOB 3RS7A 3E2IA 1HUQA 1N5KA 4FIDA 3EYDA 1ZM9A 3HU2A 1S0UA 3D31A 4LV6A 2FG5A 3L6PA 5BQ5A 3FDIA 2JLSA 2XNDA 5H8WA 1S4QA 1UJ2A 4ZV4A 2D2EA 4BLSA 1ZP6A 3I32A 3SZEA 3SZRA 3CRQA 3FFAA 2J7KA 3LY5A 3A6PC 4EFNA 1ZD9A 1TF5A 2QTVB 4EQ6B 2ZSDA 4ZIRA 3O47A 1D2EA 5LPNA 2ZETA 1YU9A 3NEYA 1NMZA 1W46A 3KKMA 4A4DA 1H65A 2OCPA 3B85A 1H8HA 3A1TA 4UKDA 2CL0X 5BWMA 3AVPA 4AYXA 4BFVA 2RCNA 1Q1EA 4BZQA 3SDZA 2ZYVX 1QG4A 1LFDB 1KSHA 1G41A 3IEUA 2GNOA 3V4RA 2P6UA 1XPRA 1IM2A 4Q1BA 4HAVA 5CM9C 4UJ5A 4JIMA 1UADA 4MRVA 2YV5A 3Q5EA 4M8NE 2WV9A 4M9XA 3U60B 2OUKA 2QM8A 3ZQJA 4KYIB 1P62B 2ZYWX 3SU6A 4A6XA 4ILEA 2H92A 1Z2AA 5L3SA 2JJ2A 1ZM4A 3OFND 3PFIA 3OIYA 4WF8A 1PZNA 1MV5A 3WRXC 2ZJZA 4LYAA 5JCPA 3DOEA 1QHIA 3SJCA 3KJEA 3LQQA 1XMIA 1XU4A 5DO9A 3R20A 2J0UB 1MRSA 3DZDA 4PZLA 4UNSA 2OESA 5D3QA 3BFVA 1PUJA 3BIFA 1ZRHA 2IBMA 2F43B 2Q3FA 4PC6A 4XSHA 1F6BA 1RJ9A 3VAAA 4C7OA 2QP9X 2XCFA 1CRQA 1QHYA 2W6ID 1IONA 1E2EA 1B23P 2VHUA 4IDPA 4AURA 2QPOA 3GLIA 4ZDIA 4LYFA 1LF0A 3H86A 4ZKEA 3DO6A 5KDOA 1CBUA 2ZVQX 1UKZA 1RKBA 2ZSBA 3DKPA 1XNJA 3SHWA 3RS4A 2GAOA 1NY6A 3EA5A 5FI0B 5DI3A 1XTIA 521PA 2G83A 1OKKA 2GJ9A 5EZ5A 3QKSA 3A4NA 3WMFA 3A8TA 2GVZC 2Z6VA 4C4PA 5B64A 2WBLC 4Z8YA 1S8FA 1Q22A 2ZE7A 1VG9B 2QMUA 2ZUBA 2FE4A 4AI6A 3CLVA 2FDCA 5JS7A 1E3MA 3GPLA 1D5CA 2CK3D 4RJLA 1OH5A 1KDTA 1NIJA 4Z54A 1G16A 2BIFA 1BOFA 2QI9C 3TW8B 1RPZA 5FR1A 1TQ6A 4KODA 1HYQA 3KJHA 1DEKA 2FFAA 4LYHA 2CLCX 4NMMA 2IEZA 4MRPA 4WBSA 3NBYC 3NDPA 4HLDA 3BWDD 3CPHA 2IYZA 1SVWA 4DT1A 1P4SA 3CPJB 3TSWA 5E95A 2VH5R 3WP1B 5CITA 3BFKA 3GLIE 2PX0A 3X1ZA 3E90B 3P4YA 1FX0A 2PJZA 2QTFA 3HU1A 5CK4A 5L3QB 3CO5A 3U1IB 1EWQA 2BCGY 1NN1A 2AWNA 3VFDA 4W7SA 1M8PA 2ZRFA 3AKYA 2XJ4A 4ZPXA 5JFGA 3VKWA 2AL7A 4TL9A 1AKEA 3K0AB 1Y3AA 1AKYA 3QY0A 4OHYA 2BWJA 1S1CA 1GKIA 1P6XA 3HPQA 1OXTA 1RYFA 4L4UA 3WNDA 2Z4RA 4GFDA 4KTCA 1E2PA 3M0EA 3NG1A 5KHOC 4XWOA 3W8NA 1E6CA 4R71A 3OIUA 2ZE5A 2OT3B 1HQCA 2OBMA 3G5UA 2UKDA 4Q7MB 4X8MA 1G20E 1JB1A 2GBLA 2XZOA 2IK8A 4U01A 3H0KA 5JS8A 3I73A 3VR1A 4DWJA 1R5NA 5FTMA 3FVQA 3B1VA 1D9ZA 3EW9A 2OILA 4HZUB 2DCUA 4EPWA 3GLGB 3X1DA 3U44A 5DE3A 4OHZA 2ZRPA 4PZZA 1R0WA 3L82B 4D82A 3SV7A 3K9LA 4JBWA 2VIIA 2GCNA 3BB4A 1R0ZA 1G64A 1WB9A 1KO4A 3LD9A 4A9AA 2IJD1 3RRMA 2KSQA 3MRSA 1P72A 1W4RA 1K5GA 3KL4A 3QQ5A 4MA4A 4QBFA 4C0AC 2JLXA 2QPAA 1DBSA 2F1RA 2YVUA 2D74A 5K8UA 3SU2A 4FINA 3BH7A 1U2RA 4TTRA 2CNWD 3I4LA 2RHDA 3F5FA 2QAGC 1UBGA 4PAQA 4Q19A 4B3BA 2QP3A 5KPJA 4JLVA 2G3YA 2BBTA 3VNUA 4PXAA 5LDDC 3FHOA 5J5CA 1BH2A 3CONA 3AP3A 4TMWA 4Q7JB 4OI0A 1X8JA 1P2TA 3TAHA 2O8EA 421PA 3TW4A 5JJIA 2G88A 3B2EA 4JLOA 3AF0A 4IDHA 1S1MA 5IHPA 5FTLA 1GM5A 4EJSC 3KKNA 2QMHA 3LWNA 2R6AA 4C0JA 4D0NA 3MWYW 1LTQA 4TTPA 1MT0A 3TJZA 3CW2A 1J70A 3IBYA 1R0YA 4QJ4A 4GRAA 2QMEA 4B2LA 4TYQA 3BB3A 4F4IA 5GADl 2VQSA 5LD2B 1XEFA 4KFRA 3MWJA 4FN5A 4WXRA 1KMHA 2BEKA 2IF0A 1OJLA 3SI7A 5L3VA 3L0OA 1P2UA 1XDBA 1FMLA 5IRCD 4D0LB 3EC2A 3BAFA 3TUJC 3CZPA 1E9CA 3NH6A 4US0R 1GL6A 5TDHA 5E3HA 4WIAA 5DI9A 5GVSA 1NLZA 2GF0A 1NLFA 2CHVA 4ASUD 3MWKA 3SBEA 4ZCLA 1N6LA 1CULC 4B32A 5HR5A 2JLVA 2GF9A 4LPKA 2B8WA 4RD2A 3PUZA 1G21E 5FTKA 4BPBA 5SZKB 2R62A 1V5WA 5FUXA 1EFCA 2CNWA 5AUPB 1AK2A 1SKYB 2GK7A
chains in the Genus database with same CATH superfamily
3C5EA 4L6IA 2BPOA 2N9UA 4BP8A 5HM2A 3FPAA 4DWOA 1YIOA 2ZVPX 2OO3A 4JJAA 3VR5H 3C4QA 1OWEA 3RM0H 3V4PB 1IBSA 3B1JA 3RXJA 2OXSA 4H42U 1QHEA 3ZHYA 3KPWA 1R74A 3IXQA 1MDFA 3K0CA 5BMVB 2VC2B 3W5SA 4CLRB 3E8XA 1DT5A 2WJ4A 3MH4A 1MTNC 1CLEA 5COQA 3R9XA 3HP7A 2X4GA 4FFLA 3DJYA 1VC2A 1TUIA 3FRJA 2R7KA 3EFOB 5AK0A 1BCSB 2QVBA 1BROA 1O31A 3VH1A 2FP4B 3FB1A 3IDSA 1KZHA 2Q6FA 1O3NA 1J24A 1ACJA 4P80A 4HDSA 5HILA 2IPAB 4GBJA 1OW3B 4PLHA 4A2QA 4TRNA 3RC6A 2I6XA 2PV9B 1M2WA 1QK3A 1XDWA 3RBVA 4B3HA 1VQ1A 3PPYA 1FDOA 2X42A 1P5HA 2Q8QA 3L05A 4THNH 2Y3IA 4IDFA 5B2FA 4ZWNA 1ZAKA 3SV9A 3P9PA 2WSIA 5G0VA 2P4EA 3FKSD 3RS5A 4BNRA 3MMXA 4JENA 1LF5A 2WPKS 1QQBA 4DMUB 3VZSA 1SBWA 1C1XA 3E82A 4RHFA 2FYTA 5HF9A 2JK0A 3OOJA 4FYJA 3NUGA 3TBHA 5SYNA 1CB0A 1KK0A 5DOVA 3CUVA 3HKJB 4AXXA 1THRH 2PL5A 2CHEA 4ZVRA 2MSKA 2Q1UA 1WUHS 2GJSA 4AFQA 1R3UA 4XQEA 5LD2C 4BUZA 3NRBA 1N77A 4WNYA 4TVBA 1JMVA 1QNFA 4JLSA 4Q1CA 1UOOA 3W0LB 4EB6A 1TT7A 4BU1A 1DRVA 4R98A 1ABBA 2Q41A 3BZWA 1QH9A 1E2IA 3RH0A 1LPKB 4OY3A 1QHFA 4GP7A 4UU1A 3AM1A 3GRPA 3LT0A 3V4ZA 3PC2A 1PNRA 5J2TB 3U62A 1QF9A 2D1TA 2I2CA 2ZAYA 4XEHA 1NVXQ 4RZ2A 2DWQA 3BMCA 1OAKA 3GBPA 3RNOA 1O3JA 3BXOA 4AFSA 5DISB 3ETDA 3F4LA 2GCGA 5GZ6A 5A5DA 4TQAA 4D9CA 4OM9A 3T2NA 3D4LA 3I92A 2FZ5A 2YYSA 1NBIA 4A8JA 4IF6A 5MFZA 4BMVA 4DBLC 2AN3A 4HT3B 1AZWA 2VEOA 1V8PA 3UHJA 5IYZA 4WNIA 3W1VA 3SQMA 3ZLBA 3IE2A 3DZFA 3UK6A 5KNCA 1DWBH 2XECA 5G3YA 1DTEA 5K2MA 3OT1B 4R54A 3EZ9A 2DPXA 3IUMA 5T64A 3ND7A 3C7CB 3JQ7B 3R0FA 1BB0B 4J1YA 1GGVA 3LHSA 5ALMA 4AQ7A 1PNQA 1XVVA 3ZHXA 5LUBA 2ZYDA 5IT0A 1Q44A 5I9BA 4B2BA 5CFNA 4GYWA 2JHPA 1NUQA 3IEKA 4NA9H 2GPBA 1A8QA 1D1SA 4FHZA 2P79A 3J7TA 3HRKA 3GY7A 4KR7A 4GMXA 4EY4A 4GAWA 2V7BA 5FWNA 5BN3B 4M60A 2H7CA 5AF9H 4BN0A 1O2LA 1DFGA 5DX8A 3DV2A 2ST1A 3OFVA 4U2BA 4OLFA 1V2PT 2Y2VA 3PF9A 4HPXB 5JAOA 3M6XA 3VPGA 1T3HA 2EP7A 2ECQA 3GRCA 5SYMA 2SCUB 3B6MA 2L69A 1NUPA 2J6BA 3Q3JB 5ALKA 1UIMA 3ZX4A 2RBGA 3RYFA 1WZ2A 2XNSA 3EGOA 5EN4A 2GK3A 3PI6A 3PV4A 4CODB 1ANKA 4DA6A 2RIPA 1IZ0A 2GN0A 4NFEA 3U80A 3WGTA 2EY4C 4Q00A 1ISPA 3ICEA 4ZQCB 4IDDA 2BDAA 1R8XA 2FIRH 1UJ4A 4CMIB 4PYLA 1H0HA 2ZS8A 2X9VA 3RC5A 1UC5B 4REQB 2FE1A 2HT1A 1KRWA 2XI4A 3KQTA 1Q3TA 2P69A 4ABEA 3EIXA 2P9HA 3M70A 1HE2A 2TMYA 3Q6IA 4QAJA 1SOAA 1A4UA 2B34A 2ZUDA 3KCNA 1OY1A 1Q1BA 2VJ1A 4LDAA 4V0SA 2H2ZA 1SXJE 1ZUD1 1KY9A 3UIEA 1ZUNB 4Z7JA 4YR7A 2RC6A 4AUNA 1MUEB 1HLFA 1JLSA 3PNSA 3D81A 4KXUA 2FMXA 5CFOA 3I04A 5ARBA 2NQ8A 5CLIA 3TAXA 4HNUA 1T2FA 4F86A 4OIMA 1MKYA 3ZDCA 3I28A 3LQ4A 4N65A 4A92A 1U9CA 1FUYB 3DLTA 5JSKA 4WJZA 4KL8S 3A2LA 4NCJA 1P10A 3OPYA 4KGAA 2BGUA 4JI2B 1MQ9A 4TKVA 3UJCA 5KTOA 2F1HA 4EZEA 5AJYA 4AO8A 1YFKA 3WMWA 2E55A 3L33A 2O8TA 1P3Y1 4EEKA 4PSCA 1G8PA 3HN2A 4R9SA 2WHXA 1KEKA 1U9IC 4MQBA 3BAZA 3IL2A 3HDJA 4BNMA 2P59A 4D6PA 3DT6A 1B15A 4D8WA 1T5IA 1ABFA 3LAWA 2PMFA 4US1R 1ZVKA 5CJPA 3WLEA 5EGNA 2WMOB 1FC0A 5FI3A 1T5TA 3A6GA 1OFHA 4YWJA 2V98A 4HVAA 4E7PA 2ORYA 4RY9A 1FONA 5JXHA 3E53A 1FIZA 3V9AA 1BXRB 2MMGA 1ZI8A 2WKRA 2CMDA 2A0XA 1DPGA 3C74A 1UFOA 4S1TA 5REQB 3W2EA 4EFKA 1GADO 1IY0A 2CUNA 1FYEA 2TYSB 3QI2A 3NP9A 3M6AA 1VL6A 2FO9A 3ZH2A 2CFIA 5AXAA 2YOLA 4NR0A 1G3BA 2JD1A 4J0KA 2MOKA 4BO9A 4F21A 3VTAA 4QZVA 3BT7A 3T94A 3ZUPA 3H17A 3DPIA 2Z9GA 1P8AA 5FYQA 3T9BA 4G0NA 2RH9B 1F0RA 3DEAA 1QWSA 6GCHF 1RAAA 1VIVA 2UWOA 5BUQA 1EK5A 5FD8A 1K1JA 2FDRA 4KFUA 3VOAA 3INNA 5IJ9B 5K8CA 1Z17A 3C6XA 3U26A 1Y8ZA 3EY9A 1A5GH 4RV4A 1NF3A 2W6NA 1HBTH 1PL6A 3NWJA 1JLHA 3OM1A 2W6JA 1P3JA 3GMSA 1NVTA 4ITUA 2KLBA 4IEFB 4IXMA 4AZ0B 5HE8A 4D26A 3OLWA 2A94A 3A1WA 4AF6A 3QTLA 2BVRH 3UUWA 4FDUA 3KOYA 4EY6A 2QJFA 3A6FA 4E6EA 1U6QA 1LC0A 3B3FA 3R24A 2CLDX 5F1KA 4GPAA 4DCMA 1M3SA 1EJBA 4KTTE 3LC7O 1Y6FA 1V2UT 2SGDE 3JQ9C 5E6RB 4BASA 3RAPR 2COEA 5KQLA 1LQTA 3UJ7A 2O8WA 4ONEA 1G4HA 4B2IA 4BNYA 3KYCA 1SVIA 4ZO8A 1O3LA 3TINA 2IS6A 1DICA 3VPKA 1TUBA 3LCUA 1U11A 4TV9A 4FU9A 2OGUA 2ZIWB 1YE3A 5IUNC 3EXHA 1O9HA 3KQQA 4CL8A 4ES6A 8ADHA 1MNQA 3QNUA 4AJEA 2PZJA 1PTJC 1GMDF 1JV2B 3BUSA 1ELGA 2XDYA 1QQ4A 3SZOA 1FQJA 3LK6A 2SKEA 1VOTA 4RZUA 5IABA 1ZPZA 3HV2A 4YESB 1SXGA 3T3DA 1JJ7A 1XELA 4AJIA 2R66A 4PWZA 3B9PA 5FPQA 2CWDA 3ZIAD 3FZEA 2PX3A 2QN8A 5DSXA 3SYJA 3B6ZA 4LE0A 1CZUA 3COZA 1AVXA 5IDWA 1WBJB 3JS5A 3NFYA 3PFKA 4E05H 1H2EA 2QY0B 4OL0A 3WMEA 3P2KA 3NTLA 5JVDB 1NROH 3NEAA 4GICA 1R64A 2WJYA 2XUZA 4MUMA 1P17A 3U4MA 1YPHE 2BEVB 4Y2SA 2FPSA 8ATCA 3I5YA 1DFIA 3ZCXA 4TMFA 2X8BA 1TWXB 4CKBB 4HUJA 5BQOA 1NO9H 1FUEA 3GAZA 3FMPB 3ECCA 1MU0A 4MW6A 4AICA 5JC1A 1DTWA 3S69A 1NI4A 1C2TA 4PYJA 3M5DA 2Y76A 2ZW9A 5KWEA 4P84A 1PR6A 4RZXA 3PR3A 1NVMB 1PV4A 1SKUA 1F7UA 3RIHA 2J48A 4FILA 2W26A 3ZZBA 2X5NA 1Q1ZA 3U4CA 2FMKA 3RYIA 3B82A 2B8OH 1S9HA 4Z6AH 3U17A 2JG3A 1XO1A 3NT2A 3JZIA 1EPUA 2IIPA 2XIQA 2VOJA 3W77A 1M2VB 1FRVA 4Q39A 4BP9A 1GVHA 2ZR0A 3EWNA 2VP4A 3M3HA 2JPDA 4YREA 5FIUA 3WR5A 3T5FH 1T9HA 4R9UC 1O5CB 4HLUC 5G3ZA 3Q3KA 1XCGB 1VIDA 1NQAO 1C2FA 5KYWA 3P4XA 2QXYA 3NANA 2Q1XA 5AP9A 4DADA 2P9CA 4X6OA 1GTZA 3MHWU 1QQTA 3QBJA 4J3NA 2Z3CA 4NJEB 1C9YA 3S8EA 1L4DA 1YYY1 4DRYA 1GV1A 4D6XA 4NABA 1P9UA 3K6JA 4RM2A 2CFOA 1JR3D 2A2XH 4KPGA 5A4FS 2HWUA 1MAYA 2A9FA 5ETJA 4ALJA 1JU9A 4MUFA 4D0SA 1ZMRA 1IUOA 4M7GA 1Z25A 4GD3Q 1KIGH 1Z26A 3SE0A 5L6NH 3EZNA 3RREA 3TLAA 2NV2B 1PEAA 1F5NA 4G25A 3TOXA 1HRTH 4N18A 3DE4X 1TOCB 3PENA 2BTEA 2DOKA 4Y6LA 5C20A 2W3KA 4U0KA 1FSGA 4MV4A 3KUUA 3SAJA 4RAQA 4XYMA 1ZOIA 2OLGA 2PTGA 2AT1A 1PX0A 2CJPA 1OFGA 4RCVA 4OXYA 5EXNA 2ZFFH 4A10A 1UP6A 4D3YA 4IMIB 3HS3A 4W1RA 1HE5A 2H1HA 2COKA 3A7EA 3OZFA 4PCAA 4U7TB 3UOWA 5K0FA 3HFRA 4U2CA 1RBMA 2R8YA 3E15A 3ZXIA 4YAUA 1SH7A 2BGKA 2R6GA 2PA0A 4ZI7B 1NKVA 1IUNA 4HDKB 1RIIA 1BKDR 3O26A 3F2GA 3I64A 3ASZA 4DA9A 3MH5A 4NBWA 2CFTA 1GR1A 4Q48A 3OEED 2GZHA 3IRUA 4DW8A 3ETGA 3MGCA 1HG1A 5CVJA 2WT8A 2X8WA 4BLWA 1WLYA 1G2OA 4DDKA 4NP6A 4JSTA 4O02B 2VJBA 1OFIA 3PHIA 4E6PA 1ZJYA 4UHEA 3AXTA 3KYBA 2QN7A 2HDHA 1FY4A 3BIUH 2GK6A 3Q3EA 2C2YA 3UUFA 1W6UA 3SYKA 4BRWA 2VWQA 3PFWO 1I2MA 2I6FA 1T8NA 1P9NA 2R8ZA 1F9AA 1KK2A 3UWIA 2IYOA 3RF6A 1DJQA 3ZX5A 2PZLA 3KXIA 3AILA 3NJ4A 4NSNA 5C4GB 1Z0ZA 1ZPDA 3G0IA 1BYIA 1EDZA 4MV3A 2PLNA 1SQGA 3U31A 5H4HA 1IWPB 3F5DA 2C2OA 2OHFA 2YOHA 1HAYB 1IN4A 2A31A 3ESBA 3CTMA 3C5WP 3I2HA 4KE6A 3ZY2A 5A8ZA 1F4VA 2BMJA 1G9TA 1T9KA 2EL7A 3TF5A 2X4DA 2Q21A 2JEOA 4HFMA 2FZ4A 1EP6A 2YNMD 5EIEA 1PT9A 5IKEA 2YVKA 1XE3A 3RSQA 3V3KA 5G2OA 3T9EA 4QIHA 2XB6A 3LI2A 3SZMA 3A25A 3R23A 5JBIA 2DFPA 4MVWA 2GV7A 1KF0A 1NMEA 1RC8A 2J97A 3QJ5A 3HDHA 1MP0A 4UVGA 4FFWA 2DQKA 3H13A 4O4HF 4WTOA 1RWBA 4HFNA 1KZ7B 5ITWA 5JWRA 4K9QA 4IOJA 2H2IA 4DIUA 2GBCA 4YJGB 4Z1MA 5SY9A 1CUFA 4OEHA 1OJ7A 1N2CE 4HDRB 4K88A 4C2AA 1G3DA 2A5JA 2Q1YA 2Y1XA 1L8OA 2R4UA 2ZAOA 1EKXA 1N2SA 3OOEA 1J2TA 4M9SA 5HE9A 2H1UA 1AWFH 4BQIA 5FAHA 2RA3A 3M1IA 1GBLA 1DWPA 1JHMA 2RHRA 1NSFA 4AT1A 1D6JA 1PO7A 2PX6A 1XDDA 5EIBD 2J9NA 1RKUA 4XIGS 4IIFA 3RXHA 4W7IA 1BBRH 1UK7A 4ISNA 2JH5D 2V7VA 3HFGA 5KYYA 1G19A 3SEFA 5I4CA 3AR9A 3ROMA 3Q5DA 1LDBA 4YJ3F 3BEDA 2YV3A 4FT2A 1TIBA 2AHOA 2I2DA 1QJ1B 5AW0A 5H4GA 5GDSH 3RXSA 1PQYA 2X1MA 3NALA 3VKHA 3I5AA 2ZHDA 4LZOA 3K2QA 1E1NA 2F6RA 3BXGA 1M76A 1U99A 1EU1A 1NG1A 4MRMB 5JY1A 2W37A 5K51A 4QRDA 2JK1A 3BEOA 2GK4A 2JGRA 3GLVA 3H16A 2GN2A 4XQ0A 2QSYA 3DNMA 4TLEA 4DIOA 4MGKR 4TSFD 4WN9A 3GUCA 4WJG2 4LDZA 3U69H 5DN6A 4OSPA 4QPDA 2Y1CA 1ZOLA 3ZWBA 3RAFC 1NVEA 2J85A 4COKA 2OYSA 4IJ5A 1Y6GA 3R9WA 2WUFA 4GVPA 3MW8A 1YZVA 5C17A 3CUUA 4I1RA 2QY6A 1OB2A 1DAOA 1O96A 4ENTA 2IJOB 2VXOA 2DMRA 1QNLA 2EJTA 4L5BA 3NJ8A 4ZYTA 2DHEA 1EJNA 3DGFC 3V42A 1GI1A 1F5SA 5FUWA 3ODDA 1CPYA 4UFGH 3NC0C 2B8JA 2IDKA 5AXDA 1X15A 4RIIA 1QOPB 4BKPA 1CRZA 1Y42X 2R2GA 2TSYB 1Q15A 4O2BF 2PKAA 2AIPA 1VGRA 4PX9A 5B4TA 3NV7A 4NIVA 3PRBA 3OX4A 3E16B 3CG0A 4G23A 5JQWA 2NYVA 3AERA 2XWJI 3DT8A 5C8YB 4Z0PA 4IILA 1V26A 4ZIRA 3PXBA 3K0BA 5B12A 1Y8AA 2C82A 2TECE 4ARVA 1H65A 1H8HA 3A1TA 1BEEA 4BXOA 3SDZA 1G41A 3NYRA 4BNWA 1QFSA 1RYYA 4LKRA 4IDGA 3AUJB 3H9QA 2QG4A 3STXA 3DBRB 2V7EA 1YR1A 4ZMSA 1W0CA 3ROPA 1P01A 1KJ8A 2OCIA 4N5MA 1K98A 5GAJA 2FMIA 3QELA 5KDOA 1UKZA 1RKBA 1H05A 2W8BB 4R83A 1NY6A 4JGGA 4Q7XA 1FPHH 2XUJA 3EGEA 3A4NA 4OUDA 3A8TA 3CKMA 1ZGZA 2WBLC 5H3CA 2P8JA 4DQVA 3C1OA 4MMYB 4JAVC 1SQRA 4JB8A 5J9FA 1G20A 1NIJA 3C48A 3UT5A 1T25A 3SC4A 3O4JA 4NATA 2LNCA 1UO6A 3WP1B 4CKEB 2E6UX 4G4GA 2PJZA 3BG8A 3EOZA 3EUFA 3DB2A 2L17A 2C54A 3IAFA 3ZCQA 4Z9FA 1NZDA 3FN4A 5HFNA 1XVIA 3Q5GA 4OHMA 2BWJA 4OHYA 4K6OA 4UFDH 3NG1A 5FNVF 3VEQB 4LOKA 2GBLA 1O4VA 3Q0EA 4NICA 1HDRA 2BM9A 2BFDA 3A88A 2DCUA 2OK8A 2YXDA 2QQFA 1IQMA 4K3UA 4W6ZA 4RH1A 1VIMA 2VYVA 1OCEA 2JFGA 5DBFA 3N7OA 2PL1A 1K5GA 4MA4A 4RDCA 2VTBA 4ZVTA 2FN9A 4TS4A 5A03A 2ODTX 1S6LA 1NMSA 4WESB 4EBFA 5KNBH 4RQUA 5YASA 1SQ6A 1WMFA 5DBOA 1O3BA 3I83A 1Q0HA 1S1MA 3EVCA 5DCUA 1LTQA 2HQRA 1XZEA 5CVEA 1D0VA 4GRAA 1EJ2A 3BB3A 3O1LA 1M6HA 3MWJA 4FN5A 4D8UA 5K0CA 4TT8A 5EC8A 2D1SA 4R1TA 3K1AB 4GBGA 3V1NA 5DI9A 1NLZA 2O1WA 2PL9A 1FP4B 3VNRA 4TRMA 5KS2A 3IULA 5DJ7A 1G21E 1YRLA 1UXJA 5JMPA 2PAAA 2STBE 2QEQA 2GM5A 1G2MA 5KHAA 4F2WA 4I1OA 2W7TA 1K88A 1LI7A 1M8KA 4MAAA 2JLAA 4RD1A 1XV5A 2DTEA 1IXKA 1LDYA 2OOSA 1P73A 2B7DH 4CHGA 5EXXA 1FDPA 1CLUA 2VVCA 5HM9A 1MTSA 3QFFA 3G9XA 4CR8A 4ETNA 3G9QA 1UK6A 1L1GA 3U3RA 4E5NA 4LJYA 3MLAA 3A6HA 3ENQA 5A3VA 1C0PA 4FSHA 4U30A 3EW7A 3WLKX 4FETA 2QT9A 4XPIA 1ZTLA 1OXSC 2XTAA 5JECA 1XUJA 3JARB 2EJVA 3TM4A 1ESDA 1PHPA 1FUIA 4EMSA 5BSFA 2SBTA 4Y2YA 3LLSA 2CLHB 1JJIA 3QITA 1EHYA 2BKAA 3JCZA 5B58C 3VBEA 2XMBA 2ZPUA 4JVOA 4BNDA 4OA5A 4N7BA 1JEQA 1T3SA 5ALXA 3BPSA 4AJOA 1ZLXA 4DYDA 4EA9A 4X6NA 1C0LA 3HKCB 1TMUH 3OTHA 4IUBS 4ZU6X 3RVNA 1CS0A 1ESTA 3IBGA 3EDOA 5KOJB 2BD3A 3LH1A 3MLBA 3ELYA 3EA9A 2JFOA 2AX4A 2OAP1 2ONKA 1AVGH 3NATA 3JWIA 5HTOA 3CH4B 3BTWE 5E1MA 1NVGA 4GS5A 2LP4Y 4EUFA 2JARA 3HLKA 1P02A 4F0JA 4EABA 2PJUA 1TYEB 5IYZF 4GKAA 3BTSA 1GG5A 1GL7A 1I2CA 1NXWA 3SC6A 3DM5A 5TE9A 3MQ4A 1EPTA 3KK0A 2V4ZA 1O3CA 4MB0A 1WW3A 4XWGA 1ECFA 4YMWA 3QV2A 5DO4H 2GEBA 2I3ZA 3A9WA 3MD9A 3WGLA 2VUSA 4Y7BA 3VUFA 1KI1A 4LZAA 2WMNB 3DKIA 4ZAZA 3RQIA 4WECA 2XQIA 3R4CA 3T3MB 3KV1A 5D5QA 1ZOOA 2I29A 3RXTA 4TLCA 2KWIA 1DXPA 2L82A 2ZGXH 2TPIZ 3W7VA 4JC5A 2D5IA 4IQ0A 4KX5A 4MV6A 2VSYA 3DTVA 1L7XA 2K87A 4A2WA 5CXQA 1EP9A 5KVQA 3LBAA 1B3RA 1NUTA 2VDWA 3F74A 4B43A 2WIGA 4M21A 4JVMA 3Q41A 4RMIA 1G291 1X86B 5EZYB 3UNXA 2Q6LA 2NSYA 1WUTA 4Y8YA 1A5SB 1J25A 4MKZA 1XZLA 3UUZA 2E82A 2WJJA 1VYTA 5CDHA 1BHSA 2XVAA 2R48A 2O05A 1G42A 3I04M 1A8UA 1J7JA 3QOFA 4E70A 1XROA 1BHJA 5A3JA 1O89A 1V25A 4QU8A 3UGKA 1LD3A 3N8HA 2VYQA 1U5BB 1DC6A 4MVNA 4CQLA 4EW1A 2DWCA 4L28A 3U9TA 1IAVA 2GXUA 1QIFA 3U7RA 4OHPA 1D3PB 1Z82A 3RSOA 3KKKA 3H99A 1LDEA 4GF5A 3KC2A 8OHMA 1E0AA 3PJRA 3WY8A 2HIGA 3CY6A 6ESTA 4ABJA 5CPBA 1O36A 5ALPA 3NWUA 1AN0A 4WZBA 3EF1A 1W2WB 2EJBA 3K0KA 4G8CA 2I1QA 5AJUA 3TVYA 4EYGA 1AGRA 1VJ1A 4JUIA 4H3KB 3GS9A 3HFSA 1K6XA 3KZNA 5L3QA 4ZVNA 4I1PA 3ZZDA 3GT0A 3H2KA 1UJBA 4YRJA 2H4XA 1IQGA 3IUNA 4W5WA 4JB3A 2M1ZA 3OZIA 3D23A 3UKDA 1M2GA 4CIAA 3C39A 5KO2A 4DLRA 1SLXB 3LOXA 5ALVA 4RA9A 3QF7A 1PR2A 2HHAA 4RADA 4IJKA 5L3ZA 2P4SA 4RU1A 3HZRA 1YU6A 3V1KA 5BOSA 1F48A 3ZEIA 2H31A 4WH8A 1LQUA 5T6MA 4LGVA 1UFRA 2JIPA 4BE7B 3GGDA 3HJFA 1K7EB 1E2GA 3RS3A 4YI3A 4OFXA 4OYLA 2GAFA 2IPXA 2IU6A 1NC6A 4ABIA 4UZFA 3H2ZA 3D1JA 2BYTA 3GRZA 3EYAA 3LL7A 3QKSB 2H1SA 1N0UA 4GX0A 2BEWA 1SD1A 3LDHA 1GI4A 3EVAA 3ZD8A 4FB5A 2BBWA 5K3FA 2HRZA 2BHNA 1Y4ZA 4WEQA 1J9GA 5HIZA 2IZ6A 2F9BH 1H93A 4N12A 1LVBA 3LC2O 3WB9A 2NT3A 5EVJA 4FU0A 2X5KO 3KUXA 5U4QA 4K1TA 1CO7E 5DNEA 2W2NA 4HEQA 4MLDA 2H5IA 2C59A 1YQGA 2QTCA 1SUAA 2JJ8A 1PEKE 2VBGA 2JFPA 3PYXA 3KUKA 2FAXA 1Q57A 2C3UA 3EBLA 5HQ3A 3OZSA 3OO1A 4P34A 4BP3A 4LJ5A 5KX5B 1Y7HA 3JPWA 4OS4A 1PVDA 3U56A 5FL3A 3W6ZA 2GASA 2WYHA 4B74A 4BFUA 3TIUA 4XUCA 4HDAA 5CNJA 4XIIA 3JYNA 5CE1A 1GYQA 2HO4A 2Z8XA 1DINA 2YJNA 3EMKA 3A36A 4Y98A 2Q6TA 1QC5A 1Z4OA 5KSPA 4HNQA 4KR9A 1DCTA 4MJLA 1H69A 2B37A 1O77A 2BLQA 3QW4B 5A9SA 1P9RA 2ADOA 4ROTA 1YQXA 4AZ2B 3R3UA 4BYMA 5K0TA 3W9BA 4O8CA 2IL1A 1AKVA 3CH5A 1M6EX 4ABHA 3N0TA 1KJQA 3NU1A 4PIPA 3RVOA 2R1VA 4BRUA 4FR5A 2OCBA 4X94A 2UWLA 2GYVA 3PP8A 5C3MA 1WW8A 3JV7A 4MR9A 1F0UA 5JD3A 2I03A 4CF7A 3MUEA 5HPYB 4KRFA 2ANYA 4FW9A 2A2ZA 1BTZA 4XDGA 1QH1A 4R5MA 1C3OA 4EL5A 4EGSA 1GGNA 4DLYA 3OEHA 5M29A 4G65A 1SCAA 3H8SA 2ANBA 2GBGA 4ZVOA 4HXYA 3VQTA 3VB6A 4PYNA 1BD3A 4D9GA 4GPGA 3DMHA 5LLSA 2HOQA 2I1LA 4UHCA 3A80A 2YHAA 3HZOA 4J1QA 3RAGA 1TPPA 3KS9A 5F33A 2EEZA 3HYNA 1D2AA 4R84A 2EQNA 4JLWA 1VE9A 4IRUB 5KC9A 2CUZA 1NJ6A 4J0QA 4NNPA 4KHPB 1O2MA 5JIBA 1VLZA 3WRYA 1SIUA 4XWYA 1I2DA 1LV8A 1UANA 5LP6B 3EYWA 5FV4A 1X14A 1CG6A 1IHDA 4WFJA 3L79A 3PMJA 4I5IA 2IXEA 1YHYA 4AUEA 4LJ9A 4Q12A 1FMTA 3WICA 2ZU6A 1GZDA 4TN5A 3FR8A 1TBQH 3S4YA 2AHME 2RI6A 3BH0A 3LECA 4P8RA 2R68A 2WHEA 5AM4A 4GOMD 4OHFA 2QE6A 3QNWA 2F3CE 3DGEC 2UUKB 2EERA 5EGSA 2WV4A 1F51E 3TG2A 4OHXA 4HAZA 2XWBF 2WJGA 2UYHA 3TXAA 1GG8A 2KE5A 1RRKA 1JLKA 3UHPA 4ACAA 3GFQA 2GAAA 2IDZA 4KWTA 2C8VA 3BOSA 2FRDA 2J4IA 2H1CA 4M0LA 4REOA 4YTEA 4ALLA 1KSFX 1KO7A 4EJSA 1FU8A 4I1UA 3AEXA 1YCPK 4EO9A 1HDEA 2BFEA 1ID1A 3GU3A 1YPMH 4JYMA 5CA1A 3FDZA 3DE7X 2DECA 3K1ZA 5SICE 2FCAA 1WDMA 2PKXA 3RVMA 4XW2A 4BN4A 1DDOA 4PQFA 1FMJA 4EF6A 4AY2A 5DNYB 1XMOB 4UHJA 5E2IA 4YJ3A 4B47A 5LQUA 1KFEB 3M6WA 4WADA 2PHBA 4DTCA 3DE6X 1P7WA 5G40A 1U2ZA 2HI0A 2FF7A 4X0EA 1E37B 1YHZA 3UTCA 3TAUA 2IZ5A 3K5PA 4JYUH 2AS0A 4PC3A 3HXKA 3O0TA 2X7HA 2Z6BD 3I42A 1ZRMA 5EOKA 2QBYB 1CDEA 1OILA 1NAHA 3BE8A 1U7DA 2QRVB 5IJZA 3NCTA 2Z3EA 1EFLA 5DW3A 2HJVA 3NHAA 4P08A 3CVWA 4KO4S 1BMQA 4AX8A 4BFXA 1HT1E 4AIIA 1HGXA 5I4KA 1U5CA 2IXTA 2IS4A 4KMRA 3ZDFA 1N2JA 2BR4A 2HHLA 3AEQA 2FN4A 1XX9A 1EWVA 1K4KA 4WFKA 4KHZA 3Q3YA 5EJFA 1KYQA 4G2TA 4XJSA 3AW8A 3JAKA 2PU5A 3S28A 2I66A 3KJFA 4R01A 3SOSA 1A7UA 1D07A 1B0ZA 5AR1A 1IEXA 2Z8ZA 1TGTA 3TRFA 1RHJA 2H85A 1HDIA 4IDNA 4O2BA 3PQCA 2GM4A 1Z6ZA 4HBGA 3PSAA 4AD8A 3Q8MA 4MKGA 3ZWCA 2OZLA 4A5OA 5TJ9A 5F3DA 3JWJA 3NTUA 4Q3NA 1SVLA 5CYPA 5FULA 3NZIA 2W2KB 2PD3A 3KB8A 4G5HA 2IGBA 1RRPA 4R68A 3PITA 2HREA 3W5CA 1E35B 3K4PA 4WKBA 1LKAA 3PEEA 4OPMA 4X45A 2AKYA 1G6HA 4KIGA 4MYCA 1D4ZA 1SBCA 3V4SA 5TQVA 3FDXA 1CVIA 4C4ZA 2A5IA 1ECLA 2QPLA 5DULA 3G01A 3K31A 3IHWA 5JD4A 5FWDA 2B83A 2KHZA 1KXFA 1E7YA 3FOCA 3V55A 1C4V2 4RTKA 3UNQA 3SNBA 1EXDA 2IHVA 1B0EA 3AG6A 1AHNA 3CSDA 3ELDA 5BYBA 1D6NA 3DWEX 4TKLA 1ESMA 4CL0A 2YFKA 4KP0A 3T95A 1RAIA 1PPFE 2PMKA 4P3KA 2NUAA 1EUDA 1KXBA 4P93A 4B2AA 2J5QA 3DEZA 1GTMA 1HLTH 2XBMA 4FFVA 1OIXA 1EQUA 3D8SA 1C1MA 3AMVA 3R8FA 3W7AA 1ODFA 3ZHTA 3KUDA 1DV1A 1YJ5A 1UUFA 3ROXA 3K8QA 3UMCA 1QOQB 3GOHA 1MX1A 3T7SA 1SUFA 3FYHA 4YEDA 4MROA 2BD9A 3GHYA 4CCWA 4Z9YA 1MMJN 1GRRA 2GOYA 2O8EB 3JQAB 4UEWA 4AL4A 1LU9A 1YI8A 2MR6A 3DE5X 1GVLA 3N86A 1SWVA 3IT1A 5K3EA 2FN7A 2ZYAA 1EX7A 2WJ3A 3ZZ1A 4LZJA 1TYBE 4Y2GA 2AC4A 2ZI2H 5MN4A 4M8SA 5AUNB 1RE1A 3KZOA 1C1NA 3PC6A 4BEJA 2G09A 3U48A 1XQWA 4WXEA 5DMXA 2VBIA 1YZYA 3UA3A 2PH3A 4JL6A 3M4XA 2ANWA 4UAGA 4OFBA 4V1CB 1EDBA 2QS9A 5A7GA 3ZU2A 3QXSA 2F1OA 1JQLB 4R9NA 2J98B 5C1YA 3A4YA 1ZIDA 2JA1A 2OFWA 4E2FA 3ASYA 3AHEA 1EG2A 5F8ZA 5CHYA 1S2DA 4F9EA 4YRIA 1IDOA 4F04A 4GE3A 4CEJA 3Q7SA 5D1NA 3G7SA 3QKRA 1C5YB 1KE1A 1ZMXA 2C4MA 3RXRA 2V3CC 4AXBA 2XCOA 1RWOA 1YDFA 1YLCA 2ADMA 4GQAA 3TRHA 3L8EA 1H9HE 5C0TA 1CR1A 1VCHA 5A0AE 3A28A 4MVXA 4NYMQ 2X19A 1SOMA 4FUCA 1SCQA 4D9RA 4JI8B 2FK7A 4PYKA 3VR5A 2C92A 3S2UA 4JOQA 3QU9A 2HK8A 4GNKA 2FRVA 1WNFA 5JJLA 2ZFRH 3THXA 4Q4AA 3Q7RA 1ZIXA 3MGAA 1HYGA 4H6VA 4J7UA 5JAZA 1ZVVA 3ENWA 3N2GA 2C04A 5E4FA 1N2XA 3WWOA 4FHFA 1O97C 3HSKA 1OVGA 4PIVA 4M7PA 3JQ8B 3VNQA 2Q3CA 2IH4A 3SSNA 1A96A 2CHQA 3IERA 4HOYA 2DFDA 2ZUSA 3FIUA 3FYUC 1KZ4A 4QJIA 1VE5A 3L1HA 2FSUA 1CF2O 4XOIA 3H2BA 1CE8B 1Q20A 2ULLA 1U9IA 3IUPA 3MHTA 4NHOA 4IBLH 2O1XA 2VNJA 5DP4A 1YCHA 3K09A 5FWYB 1W5TA 2IIQA 3W5BA 4MYTA 3X1YA 3AASA 4K1SA 4EEZA 2F55A 4IXNA 1TTQB 4OJNA 4LWQA 1ZU4A 5F98A 1G17A 3V7TA 4K60A 2SNIE 3OOHA 4GWLA 1JPJA 2NU8A 3AF2A 4RYDA 3Q8KA 3TJMA 1E2MA 1IL0A 4DG5A 2GBFA 3PUYA 4DMCA 1C5WB 4QUDA 4BAZA 3FAOA 1T4MA 4CQMB 3VXKA 4EO4A 4Q21A 1VSBA 3X2FA 2XXBA 2QAGB 4NGAH 4NV3A 3FZQA 5EYPA 4Q9HA 3HM9A 3V13A 5EPOA 3QOWA 1F92A 1YZGA 1KQPA 1FV9A 1DY9A 4W1SA 2YN4A 4XWWA 4P5PA 5T5QA 4CIDA 3WFZA 1KI9A 1JQ5A 1HNXB 3O8NA 1VHQA 1QS0A 3PLKA 5C7OO 2ZXEA 3JQFC 2ZCVA 3NEYA 3EODA 2XCIA 3IUJA 1AHIA 3IAS1 5ENDA 3W4KA 4MRVA 4TYMA 4KDCA 3DFFA 1MTOA 4A6XA 1GAQA 4L07A 2JGJA 5JTTA 1U8TA 1QHIA 3V1UA 2H4JA 1DX4A 5CURA 3H9BA 3GY5A 2J0UB 3JYPA 3SGAE 1QGZA 3ATMA 1M6WA 1SGEE 4FJ2A 2ZSBA 1B8PA 1E9VA 4RA6B 2B36A 1Q31A 3GL9A 1IRIA 2HRDA 1H9BA 2O7NA 2CK3D 4DNOA 1QZUA 3DR5A 4QPJC 1RPZA 4XM2A 2V5AA 2PNFA 4BNUA 2IEZA 5CG1A 4B3MB 4DT1A 3EEQA 5DX0A 1Y6QA 1QJCA 3E90B 1FX0A 3CO5A 2Z1NA 2P4UA 2ZRFA 3QLVC 1JDVA 1C9JA 1F3LA 3AI1A 3HPQA 4Q82A 1Y3UA 1RJXB 4ZTBA 1FY1A 4QAQA 4NZNA 4X8MA 1M66A 1PGOA 4AIRA 4QDXA 3GLGB 1L1QA 3LY8A 3SLGA 1HRKA 4GUXA 4MWEA 3BH7A 3IE0A 1VJ5A 1ELDE 3I4LA 1EZXC 1TXGA 2AFIB 1IPEA 2I99A 1MC4A 3GVIA 4Y76A 1X8JA 1P04A 4LXYA 3O9ZA 2WV5A 1DRKA 2KYRA 4ZKOU 1MT0A 2CWWA 2PX8A 2Z5GA 1XQ6A