4FUDA

Crystal structure of the urokinase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 61
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fudA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fudA01
2J38A 3U8RH 4DG4A 1KLJH 1GBIA 3HATH 1FIWA 1SGIB 3ZZ7A 3HPTB 1GBTA 1RD3B 1LVBA 5C1XA 1KTSB 1WCZA 4HZHA 8KME2 1O2HA 1MBQA 2VVCA 5JDUB 3PWCA 1O34A 4UD9H 5DP8A 2HRVA 2ZU1A 5LPEA 8ESTE 2HOBA 1K1IA 1V2ST 1CQQA 4FUFA 3SGQE 3UQVA 5C20A 1SFQB 1V2WT 1B7XB 3ZYDA 1BUIA 3ATMA 1UK4A 4IBLH 4F4OC 1AVWA 1IQMA 3A81A 1ELBA 1C1VH 2VVVA 2BDHA 4ABEA 4JZDH 1BTPA 4I33A 4AGJA 1UTJA 1O3LA 2HWLB 3RDZA 1AO5A 3ODDA 1BB0B 1K1JA 1YM0A 2EI8A 5FX6A 1G36A 2EC9H 4OGXA 5EU8A 3MYWA 1XXDA 4CBNA 1ZGVA 3F1SB 1MZDA 1C5OH 1EB2A 2G4UA 2PSYA 1AVXA 2NU0E 1QB1A 3SJIA 3RMOH 3HKJB 3SQHE 1AUTC 1O3KA 1P57B 4Y0YE 3SN8A 1O2UA 4ABBA 1AGJA 2Y80A 3PTBA 1ARBA 1TMTH 4WVPE 1C1RA 1A5HA 4Y71A 1HAPH 1ABJH 1H8DH 1GI4A 5T6GA 2TGTA 2ZGJA 4HTCH 2FOAA 1TRNA 1Y3VA 4TY6A 3E0NB 3D23A 3PTNA 3T5FH 3ZZ3A 2PGQB 1QGFA 1NU9A 5DJ7A 3ELAH 4VGCC 3ESTA 4Y79A 3Q3KA 3V13A 3ATKA 3SJ8A 1O2MA 1BRUP 5JPMH 3LC5A 1D4PB 2V0BA 4CRCA 2G52A 1GGDB 3BTDE 1VGCB 1BCUH 1G3BA 1P9UA 1SVPA 3U8OH 4CHAB 1GPZA 2XC5A 5JYIA 1RIWB 5E8EH 3RXTA 2FOFA 5AHGH 4A1TA 5DO4H 3BIUH 3QZQA 2CN0H 4K8YA 4YLUA 3ITIA 2ZQ2A 3ZZ9A 4JYUH 1TPPA 3VB4A 3UQOA 7ESTE 1D3QB 3PMBB 4UFGH 1DFPA 1S5SA 1CBWC 1HXEH 2AMPA 1C5RA 1P2OA 1QBNA 1GCDA 3RXMA 2BD8A 2QY0B 1MQ6A 1E38B 1C2MA 2BYAX 3UY9A 3GY2A 1GI5A 3OTJE 2ZEBA 4K69A 1BMLA 1VR1H 2CHAC 2QGRA 1AB9B 4NFFA 3RXVA 1TRYA 1B5GH 3H5CB 4IS5A 4AX9H 3M3TA 4YT7H 2G81E 4OS2A 1GBMA 1GJ9B 3MNSA 1MU6B 2BVRH 1PQ7A 1VGCC 4O9VA 1B0FA 1P2NA 4FUBA 4NA9H 3PLPA 1ETSH 2ZCKP 1C5XB 1EQ9A 1L0ZA 4MPXA 3FANA 4DIHH 3JZ1B 3MNXA 4B2AA 2VIOA 1AFEH 3K6ZA 4IC6A 1AU8A 1AWHB 1P03A 3GDVA 4KKDA 2AIPA 5DK1A 1SQTA 3A8AA 3RXDA 1EX3A 3EA9A 1SGDE 2JETC 4OS4A 2AGIX 4XE4A 4Y6DA 2NU4E 3QLPH 1NO9H 3K2UA 3ZZAA 5IDKA 1NRPH 1YC0A 3V12A 3IG6B 1BRCE 1MQ5A 3S0NA 4ISOA 1YGCH 1QQUA 1SGYE 4NG9H 4FU7A 1SGQE 1YCPM 1FNIA 2ZO3H 2ZECA 5C5NA 3EDXB 3S69A 1O2VA 1PFXC 2AEIH 1TGSZ 3FVFB 1TQ7B 3NZIA 1SGTA 3KIDU 1FQ3A 1ZMLA 1BRAA 2WINI 3TGJE 2XXLA 2ZFRH 1PPHE 2J34A 1XKAC 3PYHA 1W12U 1SGNE 1O30A 3FP7E 2WYGA 1JRTA 2ZTYA 3FZZA 2WV4A 1LTOA 1QL7A 1O5CB 4WXVA 1PPCE 3ZZ8A 1GI8B 4JMYA 3TVJB 3LONA 2QXHA 1UVUH 1OSSA 1SBWA 1QCPA 2A2QH 1YLCA 1K21H 2OP9A 1ELAA 4X8VH 3SOSA 1QJ1B 1AHTH 1P2QA 2Q6DA 3SBKA 1HNEE 2FYRA 3LGTA 1O5EH 2OC0A 2SNWA 1SFIA 2OC7A 1HPGA 2H5DA 3L33A 3L3TA 1UK2A 1KIGH 3NUMA 1GJCB 1QB6A 1V2TT 2WPLS 4ISLA 2A2XH 3LJJA 4NZQA 4X1NU 2ZA5A 1FI8A 1EZXC 1HYLA 2FESH 6CHAC 2ZDKA 1LQEA 3KF2A 1EAUA 2WYJA 5L2ZH 3M5NA 2VIPA 5GPIB 2FI4E 1S82A 4KP0A 1W0ZU 4X6MA 1V2RT 1V6DA 3RC4A 1DWDH 1HCGA 4I8GA 1HIAA 2OD3B 2XW9A 3SU3A 1SOZA 2FO9A 9ESTA 1UHBA 2FXRA 3RXIA 2WPIS 1F0SA 2PSXA 3RU4T 5J4SA 1P0SH 5FX5A 2ZQ1A 1OYTH 1GJ4H 3SU6A 4DVAU 1TE0A 1TGNA 1TPSA 4WWYA 2ZP0H 3ATLA 1FY5A 2ZU4A 1CVWH 2ZHDA 5HMAA 1VCPA 4A7IB 2C8XB 1DITH 5LPFA 1IQIA 1VJ9U 1CE5A 1M9UA 1QRZA 4ZUHA 1F7ZA 1BIOA 1OKXA 2PUQH 1LPGB 1C5YB 3RXRA 4D9QA 4JK6A 3RXPA 1MTNB 1FAKH 2BY9X 4AN7A 1GBDA 3U98H 1GMCF 1UCYK 3FP8E 3W95A 1MTNC 1IQNA 1ZHPA 1Z8GA 1K2I1 3RXFA 4XDEA 2JH0D 1AY6H 4Y10E 1TQ0B 1YF4A 1TNJA 1WU1A 1KLIH 4AB9A 1WSSH 1QBOA 2HVXA 1ELGA 2RA3A 1Y8TA 4B74A 1N6YA 2DE8A 4X2WA 3ATIA 4O3UA 3OU0A 7LPRA 1WAYB 1SSXA 3CS0A 1OX1A 2P8OB 3MU5A 2NWNA 3F6UH 4GUXA 4I8KA 1T8MA 3GCTG 2BD4A 2OXSA 1AFQC 1BITA 3E0PB 4CR9A 4ZAEA 3SNCA 3D65E 7KMEH 1O5GH 4WY3A 2Z9KA 4K2YA 3BF6H 2UWOA 3Q77A 4I31A 1C1UH 1UK3A 2FOEA 2H9EH 5FXLA 2XBWA 1NY22 5C1YA 5FCKA 6ESTA 2PLXA 1ORFA 1L2EA 2FX6A 4CBOA 4F49A 4FUJA 4RSPA 4MPUA 1YYY1 2UUYA 1J17T 5E2OA 1V2JT 2DUCA 3A8DA 3VGCC 4YOJA 4B2CA 1GJ8B 1Y3XA 2ZI2H 2AS9A 4E06H 4WH8A 3CP7A 4HI3A 2BY8X 4X1SU 1LHGH 1QA7A 2BD5A 3PLKA 1KXCA 3D49H 2C93B 2BD7A 3SW2B 3EA8A 1ELFA 3UR9A 4NCYA 4Y8ZA 1YPHC 1GHYH 1GI1A 1ZTJA 4BAQB 1GG6B 3TNSA 4XOJA 2HNTE 3MHWU 2W3IA 1A2CH 3NK8A 4A5TS 1ZSLA 1G2MA 3QK1A 4A1VA 1GCTB 3PLBA 1C9PA 2ZFTA 1C1WH 8GCHF 1LO6A 2C8YB 3LIWA 2FS8A 4WJG2 1GVLA 1XKBC 3LU9B 4NFEA 1NRSH 2XBVA 2VWMA 2ZDVH 1O3PB 1HGTH 2K1QA 1MMJN 4Q7XA 5I46H 2FTLE 1O2NA 5C67A 2SGQE 1K1NA 3SUDA 1DX5M 1PPBH 2ZU5A 1G3EA 2R0KA 3BG8A 2XBYA 4RN6A 1DUEA 1V2NT 2EI7A 1ZRKA 4X2XA 3PO1B 2P16A 4Y11E 2I6QA 4MNWA 3T29A 1FXYA 3T27A 3UPEA 2STBE 1FDPA 1CT0E 1N6XA 3BTGE 1O2TA 1UTMA 1L1GA 3U8TH 1O36A 1PPFE 4FUCA 3TJNA 2C8WB 2ZDNA 4CHAC 1GL0E 1ANEA 3DD2H 3URCA 1LCYA 4YM9A 3M5OA 1YLDA 1C2GA 2BDBA 1RTFB 3ZZ4A 1Z7KA 4NIVA 1H9IE 3RXQA 1RRKA 1HAOH 2GGVB 3BTQE 1OP2A 2BY7X 4OS1A 3O8DA 4YESB 4NWKA 1V2VT 3TGKE 1GBJA 4XBCA 4B75A 3ENSB 5DKMA 5PTPA 2FWWA 3GCTF 1F0UA 1BHXF 2O8WA 5DPAA 1V2UT 5EQRA 1K1PA 2WUCA 3P92A 5F03A 2ZU3A 1RTKA 1NPMA 2GCTC 1GCTC 2GDDA 1T7CA 4NIXA 3ODFA 3S9BA 2O9QA 4K8BA 1GVKB 1O3CA 1YPHE 5K0HA 2SGAA 2AMDA 3BG4B 1QJ6B 1UMAH 3MNBA 1TB6H 2QXGA 2ALVA 5FPTA 2ZFQH 3MU8A 2ANWA 2BX4A 2FIRH 2VGCC 2P93A 1N1LA 1SL3A 3RXSA 4NIWA 1TNHA 2BZ6H 3SNAA 1CHOF 1VITF 8LPRA 1ARCA 3MFJA 2QA9E 1CU1A 2PWXA 3NWUA 2RA0A 2ZF0H 4ZHLU 3RP2A 1ZSKA 1HJ9A 2C4FH 1S85A 2F9NA 2ZWLH 1ZZZA 3V7TA 1GHBF 5GJ4B 3QTVH 2ZPQA 1HAHH 3NPSA 1SGCA 3V0XA 1FONA 2BDIA 2ZGCA 2ZTZA 1AQ7A 1KY9A 1ZJDA 2BXTH 4XFQA 1YPKH 1S83A 2BY6X 3OYPA 3GYLB 3BN9A 5EXLA 1C1MA 2VINA 1HAZB 2Q1JA 4MNXA 1UTOA 3SI3H 1AE8H 3ZZ5A 5GDSH 2XC4A 3SORA 3LGUA 4HGCA 1ZSJA 3RXJA 3K6YA 6CHAB 1FPHH 5A09A 1PYTC 1DSUA 2A4GA 1LHFH 4AGKA 2FLBH 1SGFA 1C4U2 4XBBA 1ZPCA 3I78A 4D8NA 1EPTA 1D6RA 4NIYA 3IITA 1EATA 2PKSC 5EXNA 2JKHA 1TOMH 3RU4D 1V3XA 2EEKA 3NCLA 3OSYA 3MU4A 1ZPZA 3MO6A 3VGCB 3KEEA 1THRH 3OY5U 1IQJA 1FMGA 2M5TA 2F9OA 4INHA 2PTNA 1DE7H 2GV6A 2XC0A 4FU9A 1T4UH 3ZYEA 2ZHQH 3T28A 4FUEA 2VIQA 3QUMP 4GCHG 3UOPA 1GI2A 2KAIB 3SJ9A 1SLVB 2ZDAH 2V3OH 2XCNA 1A0LA 2FP7B 1TRMA 4ISNA 5GCHG 3SQEE 4KTCA 4O97A 2YNBA 1O3GA 3UOUA 4WMEA 3EE0B 4DIIH 2D26C 1NU7B 1LMWB 2VGCB 3P8FA 1MD7A 1EP6A 2Z9JA 2UUFB 3P8GA 2QCYA 5FAHA 5G4BA 3T2NA 1OWJA 1P12E 1AMHA 1O5AB 2BB4A 4NSYA 3RXGA 1YCPH 1PPZA 3PM3A 1YPMH 4YO9A 2H5CA 4ESTE 1ELDE 1T31A 4TWYA 4ZKRU 2XRCA 2B8OH 2PFEA 5BPEA 1GGDC 1SOTA 1H9LB 3TNTA 4E05H 1JBUH 2Z3DA 2QIQA 1SPJA 2W7UA 2ZPSA 4DJZB 1E36B 1C2DA 3MWIU 3SJOA 2TBSA 3F9FA 2F3CE 2SFAA 2O8LA 1ZLRA 1ACBE 1PPGE 2ULLA 3ZVGA 3M5MA 4JYVH 1HAGE 5JBCS 2ILNA 2ZFSA 5L30H 2TRMA 1YBWA 4MPWA 2BLQA 1BTWA 3LT3A 1UJ1A 1PPEE 1GJBB 3FFGA 3RLWH 4FU8A 5DP9A 3AW1A 1NT1A 2P95A 3W94A 1DOJA 2VIVA 2G00A 3KCGH 1V2OT 1MTSA 1WYKA 1BBRK 3SNDA 3AASA 4IMZA 1GBLA 3MU0A 3QX5H 2UUKB 3LH3A 1W2KH 3SO3A 3KGPA 2Q6GA 1A0JA 2A0QB 3A7ZA 4AZ2B 2A5AA 1A61H 1PQ5A 2AYWA 3MH6A 4TYDA 1FY1A 1JIMA 1GDQA 1A3EH 1PYTD 1TX8A 1GHAF 2Y7ZA 2FDAA 3RC5A 4M7GA 1F5LA 1D9IA 2TGPZ 3D62A 3SZNA 1C5WB 1P3EA 5HYOA 1V2KT 2CV3A 3QZRA 2B5TB 2KAIA 4NSVA 1AZZA 3EAJA 5A8ZA 3BTHE 1C9TA 2EA3A 1UTNA 1SGRE 2VWLA 3PMJA 3BTFE 4MLFB 1O5BB 1OWKA 1PQ8A 2W7SA 4SGBE 1FN8A 4Q7YA 1OP8A 1C2HA 3GISB 1YPLH 3MOCA 1BTZA 1XUFA 2FM2A 2TIOA 2Z9LA 1NFUA 1MKXH 3T26A 1O3JA 2BHGA 4BAOB 1WTHD 1E37B 5T3HA 1LVYA 2IJOB 3P17H 4AYVB 3N7OA 2F9VA 2AIQA 1TFXA 1BJVA 1GMCG 5FPYA 2BQWB 1LVOA 1FLEE 1K9OE 2BXUH 1VJAU 3SUEA 1P8VC 2ZNKH 3MH4A 2OLGA 4LZ4B 1KTTB 2OCVB 4X2YA 1WQSA 2H1UA 4FUDA 2IOTA 3LGWA 2J9NA 5EQSA 2HNTF 3RXUA 4CR5A 2A7JA 2FMJA 1SGFG 1E35B 2Y5GA 3Q00A 3BTWE 2A31A 3F68H 3RUOA 2W3KA 1C1NA 4ZH8A 2BD9A 1NZQH 4X0WU 1O5FH 3F9EA 1BOQA 3M7UA 1TWXB 2D8WA 3SNBA 3DUXH 2VH0A 1O2GH 1N8OB 5FCRA 1EKBB 1O3NA 2TGAA 1FUJA 4AG2A 1DVAH 3ZVFA 1SR5C 2GZ9A 1JWTA 3ZVAA 4H42U 1SI5H 4LK4A 1YP9A 3VXEH 1BZXE 1GI3A 5AVDA 3KN2A 1FAXA 1UHBB 2G5VA 2FYQA 1DANH 1Z1IA 3SU0A 2ZCHP 1Y3UA 2ZG0H 4Y8YA 1HJ8A 3PWBA 3A7WA 4B71A 3PROA 1J14A 1HXFH 1IQHA 5GXPA 2CF9H 2GZ8A 2LNCA 1C1SA 2AERH 2BX3A 2F9UA 1EAWA 3SUGA 1C2EA 1HAVB 1G9IE 1S6HA 1TX7A 3OX7U 1TA2A 2PHBA 5EG4A 1GDNA 3ZZ6A 2Z6BD 1C5QA 4AFUA 5T6FA 2XTTB 3RXKA 5JB9S 1IHSH 3MH7A 4DCDA 2B7DH 2ZIQH 1UTPA 3TITA 2QN5T 1C5SA 2A45B 1QIXB 3A83A 1W3CA 5F8TA 1FJSA 3TJUA 4IC5A 4INKA 4MPVA 3SU4A 4BAKB 4Y76A 1O37A 1O2ZA 4A92A 3EYDA 1HB0B 1MAXA 1MU8B 1W7XH 2QC2A 1TIOA 1EXFA 2AGGX 3M5LA 2Y5FA 4X6OA 1NM6A 4X6PA 4NA8A 5F6MA 1W0YH 3BEUA 2NU2E 1TMBH 3KL6A 4XBDA 1GL1A 1GVZA 3ZVEA 4AYYB 2VNTA 3M35A 3UWJH 5A0CA 1NC6A 1HAIH 2FOHA 3CS7A 3AAVA 3VB6A 1TGBA 2HNTC 2OINA 2BD3A 2GDEH 3TJOA 2H9HA 1EJNA 3S7KB 3RXOA 1XUHA 4GAWA 5A0BA 2HPPH 2WV5A 4WMDA 2Y7XA 1UTQA 3EA7A 2G5NA 1P05A 1P01A 2ZGHA 3BTME 1DY8A 2GCHG 3TK9A 4B76A 2FEQH 2R2WU 1ESBA 1MBMA 4BAMB 2OQ5A 4DGJA 4LOYH 1ELTA 4DURA 1Z8IB 2G8TA 3RXHA 1F92A 1C5VA 2F83A 5C3NA 1OXGA 3ZZDA 1ZTKA 4JZEH 2NU3E 1O5DH 2SNVA 4GHTA 5F8XA 2CGAA 3QWCH 1HAVA 1L4ZA 5J4QA 4H6TA 2AH4X 2ODYB 1F5KU 2XYAA 3ZZCA 3LH1A 2VVUA 2AFQB 2UWLA 3C27B 1MAYA 3RXBA 1WQVH 1Z71A 1H1BA 3VPKA 1GJ7B 3URDA 3B9FH 1O2PA 1O3DA 4Z0KA 3SU5A 5BRRE 4KGAA 1O31A 1GHVH 4CH2B 3GCNA 2PTCE 4X8TH 1TMUH 1DLKB 2OBOA 5EXMA 1T8NA 3RMNH 1CT4E 1SB1H 1T8OA 1O3BA 3QDZB 2H2ZA 4ISIH 1V2PT 1EOLA 2ASUB 1XVOA 4Y7AA 4E7NA 1UTLM 1GMDG 2F91A 1AI8H 1IQEA 4UFEH 3RXAA 2GV7A 3NKKA 5DG6A 5ESBA 3GDUA 1P2KA 4ZXYH 4BTIB 3GY7A 4GPGA 1BTYA 2AGEX 2FODA 2J4IA 4Q2KA 2TPIZ 4HFPB 1GMDF 4GSOA 1L1JA 2P94A 5E2PA 3SU1A 2WPMS 3M7QA 5ABWA 1NFXA 3A84A 3UUZA 1GBHA 1KXEA 2PKSB 1GBEA 2R9PA 2B0FA 1C1TA 1S81A 1OPHB 2C3SA 2BVSH 3WY8A 1QRWA 2BLWA 3M3SA 4JZ1A 4WMFA 7GCHG 5DP3A 4BAHB 1SQOA 5CHAC 2R2MB 1O3IA 1LPKB 4CRBA 1W8BH 3PMHB 1IOEA 1O3HA 2RG3A 5EW2H 4GLYA 1ELCA 1LPZB 3TU7H 3Q3XA 2PV9B 5CMXH 5A8YA 1QFKH 2WPKS 1OOKB 3KHVA 1O2XA 1TPOA 1TNIA 8GCHG 4DW2U 3BG4C 2BTCE 3MMGA 1Y3WA 1Y3YA 2ZTXA 4NZLA 5HM2A 1KDQA 2H6MA 4ZMAH 2OBQA 4UDWH 5DP6A 1Z6JH 1KLTA 1TNGA 4ZKNU 1NFYA 3E16B 1MUEB 1ABIH 3RXCA 2P3FH 1S0RA 1BQYA 2NU1E 1QURH 2FS9A 2ZC9H 6GCHF 2QV1A 1CA0B 1C5LH 1THPB 3RXEA 1MKWH 2PGBB 1HAXB 3UIRA 4FVDA 4D7GA 3KNXA 2B9LA 2Z9IA 9LPRA 1XUGA 1MKXK 2A4QA 1LDTT 3M7TA 3MO9A 1GJ5H 3GCHB 4NWLA 3O8RA 1WUNH 2HLCA 1OS8A 1P09A 1GHXH 1HIAB 3TJVA 3BV9B 3S7HB 2W5EA 3LC3A 5E0HA 3F9GA 2ZPRA 1KXBA 1O2SA 2JH6D 4CREA 3GY4A 1GBBA 2Y82A 2PKAB 2Z9GA 1DPOA 1HV7A 3A86A 3SV7A 5ETXA 2PW8H 3R3GB 1C2IA 3I77A 1YPEH 2RDLA 3BTTE 1C2JA 1GI9B 2VH6A 4WH6A 3O8BA 4GCHF 1W14U 2ANYA 4JYTA 1UTKA 1H4WA 5I25A 2DE9A 3Q76A 1DWBH 4H6SB 4OS7A 3UTUH 1EPTC 1MZAA 2CMYA 5A8XA 5CE1A 1D3DB 2FOBA 1P10A 5AFYH 1ETRH 3P8OA 1F0TA 1XMNB 1K1MA 4MNYA 1GWAA 2HPQH 1BDAA 1T8LA 4K1TA 5JBBS 1FIZA 2XCFA 5LPRA 1C1QA 4IN1A 4JZIA 4VGCB 3SV9A 3UNRA 1K28D 2P3UB 1MD8A 2SGPE 1G37A 4TPYA 1SHYA 3U1JB 1O2KA 3HGPA 1TA6A 1AIXH 1ESTA 3U9AH 1O32A 1MTWA 1XVMA 1A3BH 2W26A 4IMQA 1GMHF 1ZRBA 2OTVA 3SV6A 1O2RA 2G51A 2F9BH 1BMNH 2Y6TA 1TGCA 4ABGA 1O39A 3AAUA 1FPCH 2FI3E 1ZHMA 4ABHA 1MCVA 4OGYA 2VU8E 1O35A 1L4DA 2BQ7B 1MKWK 1X7AC 1UVOA 1NFWA 2IPHA 5EQQA 5T6DA 5DP5A 1HDTH 2OC8A 1CA0C 2PR3A 2BOHB 2CF8H 2A1DB 3DHKH 1MCTA 4CH8B 1G2LA 3M3VA 4X2VA 3LGVA 2GZ7A 2V6NA 3M36A 1P02A 5C1UA 6GCHG 4Q80A 3LJOA 1XM1A 2THFB 3VB7A 3G01A 2QYIA 3CENA 2CJIA 3DA9B 3LOXA 3MTYA 1IAUA 1RGQA 2ALPA 1P2MA 3GICB 3UREA 1EJMA 2STAE 1JRSA 2UUJB 3E90B 5AF9H 1DM4B 4FVBA 1O33A 1HUTH 2BD2A 2OUAA 5JB8S 2ANKH 1GI0A 2G55A 1C1PA 3LPRA 2R3YA 4YT6H 2TGDA 1VZQH 1J8AA 2ESTE 4B1TA 3SV2H 3E8LA 3VXFH 3VB3A 4X8UH 1W7GH 2GVFA 1EAIA 2ODPA 4AFSA 2XWBI 1GBFA 4AOQA 4UFDH 4AFZA 2JETB 3O8CA 1O3AA 4ABIA 1SQAA 3PO1C 1LKBA 1K22H 1ZHRA 1IQGA 3T25A 2ODQA 2ZFPH 2BDCA 4K5ZA 3H7TA 2V3HH 1CGHA 3LGYA 2BM2A 3KQBA 1GJDB 4AORA 1Q31A 1RIWC 2SGDE 1O3EA 5FBEA 1BMMH 1O2JA 2BY5X 1LHDH 1TAWA 3A88A 5ESTE 4WXIA 1D6WA 1P04A 2J92A 1EUFA 3RM2H 3GY8A 1DLEA 1AFQB 5GCHF 1EAXA 3IWMA 1RS0A 1A5IA 1FZZA 3TH3H 5JBAS 3UNQA 3P6ZB 3ZV8A 1K1LA 2GT7A 1C2LA 4YOIA 1G30B 4CRGA 1J9CH 1MTVA 1VCWA 1GBAA 1OP0A 4J1YA 3K65B 2AMQA 1DT2A 1ZOMA 2WUBA 1TABE 1P2JA 3I29A 1UVTH 1Q3XA 5HM9A 1OWHA 3EQ0H 4Y8XA 1GI6A 5EW1H 3TLOA 1O2LA 4YOGA 3L6PA 1O3MA 1NTPA 3KQDA 4MVNA 1P06A 5A2MH 3SJKA 2QF3A 1XUKA 2P8OC 3PMAB 1TGTA 3VEQB 1FN6A 5EOKA 1NRQH 2BZAA 3P70B 1OWDA 3E91A 1HRTH 3STJA 4PROA 1OWIA 2ZFFH 1SGPE 2A5KA 1GJAB 1Z1JA 1THSH 3R0FA 3LDXH 1W10U 1TNKA 2OQUA 2XBXA 4ZHAA 4ZHMU 4B2BA 1A46H 3E3TA 3Q3YA 2BDGA 2YOLA 4TWWA 1QY6A 4DOQA 1IQFA 4BTTB 1SLWB 5FHTA 3SNEA 3GCHC 1CT2E 1DSTA 1HLTH 3MO3A 4UEHH 2C8ZB 5SGAE 3DT0H 4U01A 1BT7A 3A87A 1UCYE 2Y81A 5HXFA 1VITH 1GHBG 1EZQA 2ZGXH 2ZKSA 1F0RA 3GYMA 1AB9C 1QR3E 1GHWH 5DP7A 1JOUB 3KQCA 3A85A 1SLUB 5TCCA 2BOKA 1ZMJA 1CGIE 2GCTB 4ABAA 1ANBA 1HFDA 1W13U 2JH5D 1CO7E 1B0EA 4Y7BA 3TK5A 3H7OA 1NRNH 1Y5BT 4D7FA 1KSNA 2ZHEH 4E7RG 1LQDB 2BDYA 1GG6C 3P8NA 5EPNA 3QGJA 1BRBE 1E0FD 4YLQH 1DDJA 3PB1E 4TPIZ 2FI5E 1BA8B 1SG8B 1HJAB 3SI4H 2J95A 2A32A 1BTHH 1V2MT 3TH2H 3BSQA 1UO6A 1HAYB 1MTUA 1O3FA 3M61U 1Q2WA 1A1RA 1WTGH 3EGKH 4AFQA 4ISHH 1EP5A 3SGBE 1S6FA 4RKJB 1V2LT 3FAOA 5L6NH 1NESE 2O8MA 4Y0ZE 2XNIA 1GMHG 4AG1A 2BLVA 5AFZH 1YKTA 1Z8RA 2EI6A 2VJ1A 1A7SA 1J16A 1DS2E 1YPGH 5TCAA 4I32A 2SGEE 3TGIE 1FV9A 1HBTH 4K3JA 2LPRA 2O8UA 2J2UA 1QQ4A 3U69H 4BXWA 4B73A 5GWZA 1O2YA 4OS5A 3ZZBA 3V3MA 1NRRH 4ZKSU 1O0DH 2VB0A 1Y5AT 1QRXA 1W11U 3SV8A 1TOCB 1EASA 2FOGA 2VIWA 4UE7H 1C5PA 3A8BA 5A0AE 1FY3A 1BBRE 2BVXH 4GVUA 4LXBH 4BANB 4XSKU 4MTBA 1N8OC 4JZFH 4X1RU 1QB9A 2D2DA 3TH4H 1FY8E 2ANMH 1RTLA 3F9HA 3TPIZ 4ZROA 5JBTA 3RU4E 2F9PA 1D3PB 3LKWA 4CRAA 4R8TB 1QBVH 3DFLA 3QTOH 4Z6AH 1DY9A 4INLA 4ABDA 2CHAB 1AE5A 2HALA 1LHEH 3VFEA 3BTKE 5DGJA 1KYNA 1O2IA 3BEIB 2FX4A 4KTSA 4U30A 4MG3A 4GHQA 1OYQA 1DXPA 1DWCH 2XWAA 1GHAG 1AUJA 2GD4B 2VWNA 3FP6E 3GCOA 2R3UA 1WBGB 2PKAA 1NS3A 4KELA 1J15A 1GBCA 2ZU2A 1EZUC 3GY6A 5LH8A 1XX9A 2QXIA 1L1NA 2H9TH 1XUIA 4ABFA 1IQKA 1JXPA 4MDSA 1EJAA 2FOMB 5E0GA 5GIBA 3UFAA 3GDSA 1F2SE 1IHTH 2RCEA 1QNJA 4UFFH 1VITG 1ZR0A 1JIRA 4J2YB 4TY7A 3SHAH 3QGNB 1SC8U 1TBRH 4BNRA 1P11E 2R0LA 4IGDA 5L2YH 3U1IB 3SGAE 1A5GH 1EZSC 4DT7B 1TPAE 3BTEE 2GMTC 4ABJA 3S9CA 1O38A 1Y59T 1AZ8A 1CGJE 5H4IB 2QAAA 1DXWA 1BHXB 3MI4A 5E0JA 1SMFE 3QN7A 1CA8B 4THNH 1BBRH 1UCYH 6LPRA 3TIUA 3A8CA 1AKSB 2GTBA 4K1EA 3UNSA 1UVPA 3HGNA 3HKIB 3RM0H 1KXFA 2I6SA 2Z94A 4FUIA 1G3DA 1O2WA 4IN2A 2QXJA 4X1QU 1O2OA 1C5MD 4SGAE 3RXLA 3RC6A 4A1XA 5C5OA 4KTUA 2Y5HA 1TONA 2O8TA 1SGEE 2BMGB 2WPJS 1PJPA 1SLXB 1TYNA 1BMAA 1ZJKA 3HK3B 4ASHA 4IW4E 1VCQA 2FTMA 1T32A 3A7VA 1QL8A 4MNVA 1ZTLA 1CHOG 1GBKA 1SHHB 4YZUA 2GX4A 1TX6A 4FUHA 1EPTB 3SHCH 2GCHF 3MU1A 2GMTB 3ZVCA 1F5RA 1XUJA 1C2KA 1KXDA 1C5TA 2G4TA 3A7YA 1YPJH 2Z7FE 1TBZH 3ZVDA 1FY4A 5LGOA 1T4VH 2BQ6B 1NN6A 4OS6A 4ZXXH 3PV4A 3JZ2B 1BTXA 1YCPK 3HK6B 5F8ZA 4MQAA 2FOCA 2P59A 3ZVBA 1AKSA 2A4OA 4X6NA 1TBQH 1A0HB 1Y5UT 1ZGIA 1QHRB 1RJXB 1ETTH 1ID5H 2CXVA 4I8JA 2SGFE 2PUXB 2C90B 3SU2A 3BEFB 5FPSA 1LHCH 4Q7ZA 5K7RA 2WPHS 1MH0A 4AB8A 1DICA 4X8SH 3E6PH 4RKOB 2BDAA 1P9SA 4D76A 1CSOE 2FLRH 4NGAH 1AWFH 5B6OA 3RMLH 1RFNA 1E34B 7GCHF 1K1OA 3P95A 1ESAA 4H4FA 3OY6U 4JCNA 1AVGH 1LKAA 1U6QA 2VWOA 1PQAA 1S84A 2GKVE 1ZMNA 3A80A 1ELVA 1V2QT 2A5IA 4WF8A 2YNAA 3BIVH 2ZZUH 3FZDA 1WV7H 2ZGBH 1D3TB 1C1OA 1C5ZB 1XXFA 1BTUA 1BJUA 1GDUA 2BLOA 2UWPA 4O03A 1RXPA 2FPZA 3MNCA 3ZV9A 2QF0A 1ANCA 4R0IA 4BOHA 3AVZA 4I8HA 1JMOH 3GY3A 2GP9B 4FXGH 1G3CA 4K1SA 4CRDA 4NA7A 1DUAA 4BTUB 5EGMA 1EB1H 1AD8H 5IYTA 1ANDA 1LVMA 3B23B 4QT8C 2ZDMA 1H8IH 4I8LA 2A7HA 1C4V2 4O3TA 3UR6A 1QA0A 3A89A 1GHZA 5DP4A 1ZYOA 5C2ZA 1A4WH 3UWIA 3C1KA 3A7TA 1O3OA 1KXAA 2V35A 2HGTH 1TLDA 2OC1A 3RLYH 2IN2A 4ZKOU 1CHGA 5HGGA 5FBIA 1P2IA 1OWEA 1Z8JB 4D9RA 1AN1E 2P3TB 2Z3EA 5TJXA 3RMMH 2Z3CA 3QO6A 3STIA 4K60A 1CBWB 3DFJA 3NXPA 1ZPBA 4U2WA 1QL9A 3E1XB 4FUGA 1QJ7B 4CRFA 1TALA 4U32A 4LZ1H 1GI7B 2A4RA 1DWEH 1QTFA 4YTAA 1WOFA 2A7CA 3K9XB 3AW0A 2GT8A 1UVSH 3A82A 3KQEA 1C5NH 1EOJA 5EODA 1P3CA 2D1JA 2J94A 1INCA 4BXSA 1IQLA 2ZCLP 1Z6EA 3GOVB 1C2FA 2ZHWH 1TNLA 2Q6FA 5CHAB 4DY7B 3B8JA 3GY5A 3TK6A 1GJ6A 4JK5A 1NROH 2ZDLA 3MH5A 4I7YH 1H9HE 1C4Y2 1KDQB 1C5UA 3M37A 2VIDA 3VB5A 1HJAC 3LGIA 3A7XA 1G32B 4X1PU 3SUFA 2FZZA 1ELEE 1S0QA 4A6LA 4UONA 1O2QA 2ZHFH 3ATWA 5EPYA 3S9AA 3T62A
chains in the Genus database with same CATH superfamily
2J38A 3U8RH 4DG4A 1KLJH 3PRDA 1GBIA 3HATH 4OM9A 1FIWA 1SGIB 3ZZ7A 3HPTB 1GBTA 1RD3B 1LVBA 5C1XA 1KTSB 1WCZA 1SQRA 4HZHA 8KME2 1O2HA 1MBQA 2VVCA 5JDUB 3PWCA 1O34A 4UD9H 5DP8A 2HRVA 2ZU1A 5LPEA 8ESTE 2HOBA 1K1IA 1V2ST 1CQQA 4FUFA 3SGQE 3UQVA 5C20A 1BMFD 1SFQB 1V2WT 1B7XB 3ZYDA 1BUIA 3ATMA 1UK4A 4IBLH 4F4OC 1AVWA 1IQMA 3A81A 1ELBA 1C1VH 2VVVA 2BDHA 4ABEA 4JZDH 1BTPA 4I33A 4AGJA 1NBME 1UTJA 1O3LA 2HWLB 3RDZA 1AO5A 3ODDA 4F55A 1BB0B 1K1JA 4FOUC 1YM0A 2EI8A 5FX6A 1G36A 2EC9H 4OGXA 2K8IA 3MYWA 5EU8A 2J5UA 4RT1A 1XXDA 4CBNA 1ZGVA 3F1SB 1MZDA 1C5OH 1EB2A 4RT0A 2G4UA 2PSYA 1AVXA 2NU0E 1QB1A 3SJIA 3RMOH 3HKJB 3SQHE 1AUTC 1O3KA 1P57B 4Y0YE 3SN8A 1O2UA 4ABBA 1AGJA 2Y80A 3PTBA 1ARBA 1TMTH 4WVPE 1C1RA 1A5HA 4Y71A 1HAPH 1ABJH 5KGOA 2JJ1D 1H8DH 1GI4A 5T6GA 2TGTA 2ZGJA 4HTCH 2FOAA 1TRNA 1Y3VA 4TY6A 3E0NB 3D23A 3PTNA 3T5FH 3ZZ3A 2PGQB 1QGFA 1NU9A 5DJ7A 3ELAH 4VGCC 3ESTA 4Y79A 3Q3KA 3V13A 3ATKA 3SJ8A 1O2MA 1BRUP 5JPMH 3LC5A 1D4PB 2V0BA 4CRCA 2G52A 1GGDB 3BTDE 1VGCB 5C0UA 1BCUH 1G3BA 1P9UA 1SVPA 3U8OH 4CHAB 5KEDA 1GPZA 2XC5A 5JYIA 4TT3D 1RIWB 5E8EH 3RXTA 2FOFA 5AHGH 4A1TA 5DO4H 3BIUH 3QZQA 2CN0H 4K8YA 4YLUA 2JDID 1YY3A 3W1EA 3ITIA 2ZQ2A 3ZZ9A 4JYUH 1TPPA 3VB4A 3UQOA 7ESTE 1D3QB 3PMBB 4UFGH 3UAIC 1DFPA 1S5SA 1CBWC 1HXEH 2AMPA 1C5RA 1P2OA 1QBNA 1GCDA 3RXMA 2BD8A 2QY0B 5GNDA 1MQ6A 1E38B 1C2MA 2BYAX 3UY9A 3GY2A 1GI5A 3OTJE 2ZEBA 4K69A 1BMLA 1VR1H 2CHAC 2QGRA 1AB9B 4NFFA 3RXVA 1TRYA 1B5GH 3H5CB 4IS5A 4AX9H 3M3TA 4YT7H 2G81E 4OS2A 1GBMA 1GJ9B 2L6OA 3MNSA 1MU6B 2BVRH 1PQ7A 1VGCC 4O9VA 1B0FA 1P2NA 4FUBA 4NA9H 3PLPA 1ETSH 2ZCKP 1C5XB 1EQ9A 1L0ZA 4MPXA 3FANA 4DIHH 3JZ1B 3MNXA 4B2AA 2VIOA 1AFEH 3K6ZA 4IC6A 1AU8A 1AWHB 1P03A 3GDVA 4KKDA 2AIPA 5DK1A 1SQTA 3A8AA 3RXDA 1EX3A 3EA9A 1SGDE 2JETC 4OS4A 3MQKC 2AGIX 4XE4A 4Y6DA 2NU4E 3QLPH 1NO9H 3K2UA 3ZZAA 5IDKA 1NRPH 1H8ED 1YC0A 3V12A 3IG6B 1BRCE 1MQ5A 3S0NA 4ISOA 4DT4A 1YGCH 2K0QA 1QQUA 3F3BA 1SGYE 4NG9H 4FU7A 1SGQE 1YCPM 1FNIA 2ZO3H 2ZECA 5C5NA 3EDXB 3S69A 1O2VA 1PFXC 2AEIH 1TGSZ 3FVFB 1TQ7B 3NZIA 1SGTA 3KIDU 1FQ3A 2J98B 1ZMLA 1BRAA 2WINI 3TGJE 2XXLA 2ZFRH 1PPHE 2KX4A 2J34A 1XKAC 3PYHA 1W12U 1SGNE 1O30A 3FP7E 2WYGA 1JRTA 2ZTYA 3FZZA 2WV4A 1WXRA 1LTOA 1QL7A 1O5CB 4WXVA 3WWFA 1PPCE 3ZZ8A 1GI8B 2IJD1 4JMYA 3TVJB 3LONA 2QXHA 1UVUH 1OSSA 1SBWA 1QCPA 2A2QH 1YLCA 1K21H 2OP9A 1ELAA 4X8VH 3SOSA 1YWUA 1QJ1B 1AHTH 1P2QA 2Q6DA 3SBKA 1HNEE 2FYRA 3N7EA 3LGTA 3FKSD 1O5EH 2OC0A 2SNWA 1SFIA 2OC7A 1HPGA 2H5DA 3L33A 3L3TA 3DSPA 1UK2A 1KIGH 3NUMA 1GJCB 1QB6A 1V2TT 2WPLS 4ISLA 2A2XH 3LJJA 4NZQA 4X1NU 2ZA5A 1FI8A 1EZXC 1HYLA 2FESH 6CHAC 2ZDKA 1LQEA 3KF2A 1EAUA 2WYJA 5EJLA 3M5NA 5L2ZH 2VIPA 5GPIB 2FI4E 1S82A 2V3MA 4KP0A 1W0ZU 4X6MA 1V2RT 1V6DA 3RC4A 1DWDH 1HCGA 4I8GA 1HIAA 3CNRA 2OD3B 2XW9A 3SU3A 1SOZA 2FO9A 9ESTA 1UHBA 2FXRA 3RXIA 2WPIS 1F0SA 2PSXA 3RU4T 5J4SA 1P0SH 5FX5A 2ZQ1A 1OYTH 1GJ4H 3SU6A 4DVAU 1TE0A 1TGNA 1TPSA 4WWYA 2ZP0H 3ATLA 1FY5A 2ZU4A 1CVWH 2ZHDA 3PRBA 5HMAA 1VCPA 4A7IB 2C8XB 1DITH 5LPFA 1IQIA 1VJ9U 1CE5A 1M9UA 1QRZA 4ZUHA 1F7ZA 1BIOA 1OKXA 2PUQH 1LPGB 1C5YB 3RXRA 4D9QA 4JK6A 3RXPA 1MTNB 1FAKH 2BY9X 4AN7A 1GBDA 3U98H 1GMCF 1UCYK 3FP8E 3W95A 1MTNC 1IQNA 1ZHPA 1Z8GA 1K2I1 3RXFA 2KM0A 2KZ4A 4XDEA 2JH0D 1AY6H 4Y10E 1TQ0B 1YF4A 1TNJA 1WU1A 1KLIH 4AB9A 2HLDD 1WSSH 1QBOA 2HVXA 1ELGA 2RA3A 1Y8TA 4B74A 1N6YA 2DE8A 4X2WA 3ATIA 4O3UA 2M2AA 3GS9A 3OU0A 7LPRA 1WAYB 1SSXA 3CS0A 4Z1MD 1OX1A 2P8OB 3MU5A 2NWNA 3F6UH 4GUXA 4I8KA 1T8MA 3GCTG 3KYFA 2BD4A 2OXSA 1AFQC 1BITA 3E0PB 5EJZA 5FL7D 4CR9A 4ZAEA 3SNCA 3D65E 7KMEH 1O5GH 4WY3A 2Z9KA 4K2YA 3BF6H 2UWOA 3Q77A 4I31A 1C1UH 1UK3A 2FOEA 2H9EH 5FXLA 2XBWA 1NY22 5C1YA 5F53A 5FCKA 6ESTA 2PLXA 1ORFA 1L2EA 2FX6A 4CBOA 4F49A 4FUJA 4RSPA 4MPUA 1YYY1 2UUYA 1J17T 5E2OA 1V2JT 2DUCA 3A8DA 3VGCC 4YOJA 4B2CA 1GJ8B 1Y3XA 2ZI2H 2AS9A 4E06H 4WH8A 3CP7A 4HI3A 2BY8X 4X1SU 1LHGH 1QA7A 2BD5A 3PLKA 1KXCA 4M9FA 3D49H 2C93B 2BD7A 3SW2B 3EA8A 1ELFA 3UR9A 4NCYA 4Y8ZA 1YPHC 1GHYH 1GI1A 1ZTJA 4BAQB 1GG6B 3TNSA 4XOJA 2HNTE 3MHWU 2W3IA 1A2CH 3NK8A 4A5TS 1ZSLA 1G2MA 3QK1A 4A1VA 1GCTB 3PLBA 1C9PA 2ZFTA 1C1WH 8GCHF 1LO6A 2C8YB 3LIWA 2FS8A 4WJG2 1GVLA 1XKBC 3LU9B 4NFEA 1NRSH 2XBVA 2VWMA 2ZDVH 1O3PB 1HGTH 2K1QA 1MMJN 4Q7XA 5I46H 2FTLE 1O2NA 5C67A 2SGQE 1K1NA 3SUDA 1DX5M 1PPBH 2ZU5A 1G3EA 2R0KA 3BG8A 2XBYA 4RN6A 1OHHD 1DUEA 1V2NT 2EI7A 1ZRKA 4X2XA 3PO1B 2P16A 2LP6A 2QF5A 2I6QA 4MNWA 4Y11E 1FXYA 3T29A 3T27A 3UPEA 2STBE 1FDPA 1CT0E 1N6XA 3BTGE 4I86A 1O2TA 1UTMA 1L1GA 3U8TH 1O36A 1PPFE 4FUCA 3TJNA 2C8WB 2ZDNA 4CHAC 1GL0E 1ANEA 3DD2H 3URCA 1LCYA 4YM9A 3M5OA 1YLDA 1C2GA 2BDBA 2L74A 1RTFB 3ZZ4A 1Z7KA 4NIVA 1H9IE 2WSSD 1SKYE 3RXQA 1RRKA 1HAOH 2GGVB 3BTQE 1OP2A 2BY7X 4OS1A 3O8DA 4YESB 4NWKA 1V2VT 3TGKE 1GBJA 4XBCA 4B75A 3ENSB 5DKMA 5PTPA 2FWWA 3GCTF 1F0UA 1BHXF 2O8WA 5DPAA 1V2UT 5EQRA 1K1PA 2WUCA 3P92A 5F03A 2ZU3A 1RTKA 1NPMA 2GCTC 1GCTC 2GDDA 1T7CA 4NIXA 5EJ1A 3ODFA 3S9BA 2O9QA 4K8BA 1GVKB 1O3CA 1YPHE 5K0HA 2SGAA 2AMDA 3BG4B 1QJ6B 1UMAH 3MNBA 1TB6H 2QXGA 4F48B 2ALVA 5FPTA 2ZFQH 3MU8A 2ANWA 2BX4A 2FIRH 2VGCC 2P93A 4ACAA 1N1LA 1SL3A 3RXSA 4NIWA 1TNHA 2BZ6H 3SNAA 1CHOF 1VITF 8LPRA 1ARCA 3MFJA 2QA9E 5HKKD 1CU1A 2PWXA 3NWUA 2RA0A 2ZF0H 4ZHLU 3SYJA 3RP2A 1ZSKA 3OEHD 1HJ9A 2C4FH 1S85A 2F9NA 2ZWLH 1ZZZA 3V7TA 1GHBF 5GJ4B 3QTVH 2ZPQA 1HAHH 3NPSA 1SGCA 3V0XA 1FONA 2BDIA 2ZGCA 2ZTZA 1AQ7A 1KY9A 1ZJDA 3F0PA 2BXTH 4XFQA 1YPKH 1S83A 2HVYB 2BY6X 3OYPA 3GYLB 3BN9A 5EXLA 1C1MA 1HAZB 2Q1JA 2VINA 4MNXA 1UTOA 2KR7A 1AE8H 3SI3H 3ZZ5A 5GDSH 2XC4A 3SORA 3LGUA 4HGCA 1ZSJA 3RXJA 3K6YA 6CHAB 1FPHH 5A09A 1PYTC 1DSUA 2A4GA 1LHFH 4AGKA 2FLBH 1SGFA 1C4U2 4XBBA 1ZPCA 3I78A 4D8NA 1EPTA 1D6RA 4NIYA 3IITA 1EATA 2PKSC 5EXNA 2JKHA 1TOMH 3RU4D 4YXWD 1V3XA 2EEKA 3NCLA 3OSYA 5HIYA 3MU4A 1ZPZA 3MO6A 3VGCB 3KEEA 1THRH 3OY5U 1IQJA 1FMGA 2M5TA 2F9OA 4INHA 2PTNA 3OTPA 1DE7H 2GV6A 2XC0A 4FU9A 1T4UH 3ZYEA 2ZHQH 3T28A 3KYGA 4FUEA 2LELA 2VIQA 3QUMP 4GCHG 3UOPA 1GI2A 2KAIB 4TSFD 3SJ9A 1SLVB 2ZDAH 3N99A 2V3OH 2XCNA 1A0LA 2FP7B 1TRMA 4ISNA 5GCHG 3SQEE 4KTCA 4O97A 2YNBA 1O3GA 3UOUA 4WMEA 3EE0B 4DIIH 2D26C 1NU7B 1LMWB 2VGCB 3P8FA 1MD7A 1EP6A 2Z9JA 2UUFB 3P8GA 2QCYA 5FAHA 5G4BA 3T2NA 1OWJA 1P12E 2QF4A 1AMHA 1O5AB 2BB4A 5C94A 4NSYA 3RXGA 1YCPH 1PPZA 3PM3A 1YPMH 4YO9A 2H5CA 4ESTE 1ELDE 1T31A 4TWYA 4ZKRU 2XRCA 2B8OH 2PFEA 5BPEA 1GGDC 1SOTA 1H9LB 3TNTA 3VG8A 4E05H 1JBUH 2Z3DA 3FOAA 3FO8D 3OAAD 2QIQA 1SPJA 2W7UA 2ZPSA 4DJZB 1E36B 1C2DA 3MWIU 3SJOA 2TBSA 3F9FA 2F3CE 2SFAA 2O8LA 1ZLRA 1ACBE 1PPGE 2ULLA 3ZVGA 3M5MA 4JYVH 1HAGE 5JBCS 2ILNA 2J97A 2ZFSA 5L30H 2TRMA 1YBWA 4MPWA 2BLQA 1BTWA 3LT3A 1UJ1A 1PPEE 1GJBB 3FFGA 3RLWH 4FU8A 5DP9A 3AW1A 4B6EA 1NT1A 2P95A 3W94A 1DOJA 2VIVA 2G00A 3KCGH 1V2OT 1MTSA 1WYKA 4ASUD 1BBRK 3SNDA 3AASA 4IMZA 1GBLA 3MU0A 3QX5H 2UUKB 3LH3A 1W2KH 3SO3A 3KGPA 2Q6GA 1A0JA 2A0QB 3A7ZA 4AZ2B 2A5AA 1A61H 1PQ5A 2AYWA 3MH6A 4TYDA 1FY1A 1JIMA 1GDQA 1A3EH 1PYTD 1TX8A 1GHAF 2Y7ZA 2FDAA 3RC5A 4M7GA 1F5LA 1D9IA 2TGPZ 3D62A 3SZNA 1C5WB 1P3EA 5HYOA 1V2KT 2CV3A 3QZRA 2B5TB 2KAIA 4NSVA 1AZZA 3EAJA 5A8ZA 3BTHE 1C9TA 2EA3A 1UTNA 1SGRE 2VWLA 3PMJA 3BTFE 4MLFB 1O5BB 1OWKA 1PQ8A 2W7SA 4SGBE 1FN8A 4Q7YA 1OP8A 1C2HA 3GISB 3OFND 1YPLH 3MOCA 1BTZA 1XUFA 2FM2A 2TIOA 2Z9LA 1NFUA 1MKXH 3T26A 1O3JA 2BHGA 4BAOB 1WTHD 1E37B 5T3HA 1LVYA 2IJOB 3P17H 2WV9A 3N7OA 2F9VA 4AYVB 2AIQA 1TFXA 1BJVA 1GMCG 5FPYA 2BQWB 5KECA 1LVOA 1FLEE 1K9OE 2BXUH 1VJAU 3SUEA 1P8VC 2ZNKH 3MH4A 2OLGA 4LZ4B 1KTTB 2OCVB 4X2YA 1WQSA 2KCAA 2H1UA 4FUDA 2IOTA 3LGWA 2J9NA 5EQSA 2HNTF 4RI0A 3RXUA 2A7JA 2FMJA 4CR5A 1SGFG 1E35B 2Y5GA 3Q00A 3BTWE 2A31A 3F68H 3RUOA 2W3KA 1C1NA 4ZH8A 2BD9A 2KCOA 1NZQH 4X0WU 1O5FH 3F9EA 1BOQA 3M7UA 1TWXB 2D8WA 3SNBA 2J98A 3DUXH 1O2GH 2VH0A 1N8OB 5FCRA 1EKBB 1O3NA 2TGAA 1FUJA 4AG2A 1DVAH 3ZVFA 1SR5C 2GZ9A 1JWTA 3ZVAA 4H42U 1SI5H 2WZQA 4LK4A 1YP9A 3VXEH 1BZXE 1GI3A 5AVDA 3KN2A 1FAXA 1UHBB 3EE7A 2G5VA 2FYQA 1DANH 1Z1IA 3SU0A 2ZCHP 1Y3UA 2ZG0H 4Y8YA 1HJ8A 3PWBA 3A7WA 4B71A 3KQ5A 3PROA 1W0JD 1J14A 1HXFH 1IQHA 5GXPA 2CF9H 2GZ8A 2LNCA 1C1SA 2AERH 2BX3A 2F9UA 1EAWA 3SUGA 3SZEA 1C2EA 1HAVB 1G9IE 1S6HA 2F43B 1TX7A 3OX7U 1TA2A 2PHBA 5EG4A 1GDNA 3ZZ6A 2Z6BD 1C5QA 4AFUA 5T6FA 2XTTB 3RXKA 5JB9S 1IHSH 3MH7A 4DCDA 2B7DH 2ZIQH 1UTPA 3TITA 2QN5T 1C5SA 2A45B 1QIXB 3A83A 1W3CA 5F8TA 1FJSA 3TJUA 4IC5A 4INKA 4MPVA 3SU4A 4BAKB 4Y76A 1O37A 1O2ZA 4A92A 3EYDA 1HB0B 1MAXA 1MU8B 1W7XH 2QC2A 1TIOA 1EXFA 2AGGX 3PV2A 3M5LA 2Y5FA 4X6OA 1NM6A 4X6PA 4NA8A 5F6MA 2IPQX 1W0YH 3BEUA 2NU2E 1TMBH 3KL6A 5CDFE 4XBDA 1GL1A 1GVZA 3ZVEA 4AYYB 2VNTA 3M35A 3UWJH 5A0CA 1NC6A 1HAIH 1H8HD 2FOHA 3CS7A 3AAVA 1VKYA 3VB6A 1TGBA 2HNTC 2OINA 2BD3A 2GDEH 3TJOA 2H9HA 1EJNA 3S7KB 3RXOA 1XUHA 4GAWA 5A0BA 2HPPH 2WV5A 4WMDA 2Y7XA 1UTQA 3EA7A 2G5NA 1P05A 1P01A 2ZGHA 3BTME 1DY8A 2GCHG 3TK9A 4B76A 2FEQH 2R2WU 1ESBA 1MBMA 4BAMB 2OQ5A 4DGJA 4LOYH 1ELTA 4DURA 1Z8IB 2G8TA 3RXHA 1F92A 1C5VA 2F83A 5C3NA 1OXGA 2EQNA 3ZZDA 1ZTKA 2W6JD 4JZEH 3WWBA 2NU3E 1O5DH 2SNVA 4GHTA 5F8XA 2CGAA 3QWCH 1HAVA 1L4ZA 5J4QA 4H6TA 2AH4X 2ODYB 1F5KU 2XYAA 3ZZCA 3LH1A 2VVUA 2AFQB 2UWLA 3C27B 1MAYA 4XRNA 3RXBA 1WQVH 1Z71A 1H1BA 3VPKA 1GJ7B 3URDA 3B9FH 1O2PA 1O3DA 4Z0KA 3SU5A 5BRRE 4KGAA 1O31A 1GHVH 5T1VA 4CH2B 3GCNA 2PTCE 4X8TH 1TMUH 1DLKB 2OBOA 5EXMA 1T8NA 3RMNH 1CT4E 1SB1H 1T8OA 1O3BA 3QDZB 2H2ZA 4ISIH 1V2PT 1EOLA 2ASUB 1XVOA 4Y7AA 4E7NA 1UTLM 1GMDG 2PP6A 2F91A 1AI8H 1IQEA 4UFEH 3RXAA 2GV7A 3NKKA 5DG6A 5ESBA 3GDUA 1P2KA 4ZXYH 4BTIB 3GY7A 4GPGA 1BTYA 2AGEX 1E1RD 2FODA 2J4IA 4Q2KA 2TPIZ 4HFPB 1GMDF 4GSOA 1L1JA 2P94A 5E2PA 3SU1A 2WPMS 3M7QA 5ABWA 1NFXA 3A84A 3UUZA 1GBHA 1KXEA 2PKSB 2YMSB 1GBEA 2R9PA 2B0FA 1C1TA 1S81A 1OPHB 2C3SA 2BVSH 3WY8A 1QRWA 2BLWA 3M3SA 4JZ1A 4WMFA 7GCHG 3UB0A 5DP3A 4BAHB 1SQOA 2WPDD 5CHAC 2R2MB 1O3IA 1LPKB 4CRBA 1W8BH 3PMHB 1IOEA 1O3HA 2RG3A 1NBMD 5EW2H 4GLYA 1ELCA 1LPZB 3TU7H 3Q3XA 2PV9B 5CMXH 5A8YA 1QFKH 2WPKS 1OOKB 3KHVA 1O2XA 1TPOA 1TNIA 8GCHG 4DW2U 3BG4C 2BTCE 3MMGA 1Y3WA 1Y3YA 2ZTXA 4NZLA 5HM2A 1KDQA 2H6MA 3DCLA 4ZMAH 2OBQA 4UDWH 5DP6A 1Z6JH 1KLTA 1TNGA 4ZKNU 1NFYA 3E16B 1MUEB 1ABIH 3RXCA 2P3FH 1S0RA 1BQYA 2NU1E 1QURH 2FS9A 2ZC9H 6GCHF 2QV1A 1CA0B 1C5LH 1THPB 3RXEA 1MKWH 2PGBB 1HAXB 3UIRA 2OK5A 4FVDA 4D7GA 5C17A 3KNXA 2B9LA 2Z9IA 9LPRA 1XUGA 1MKXK 2A4QA 1LDTT 3M7TA 3MO9A 1GJ5H 3GCHB 4NWLA 3O8RA 1WUNH 2HLCA 1OS8A 1P09A 1GHXH 1HIAB 3TJVA 3BV9B 3S7HB 2W5EA 3LC3A 5E0HA 2YMSD 3F9GA 2ZPRA 1KXBA 1O2SA 2JH6D 4CREA 3GY4A 1GBBA 2Y82A 2PKAB 2Z9GA 1DPOA 1COWD 1HV7A 3A86A 3SV7A 5ETXA 2PW8H 3R3GB 1C2IA 3I77A 1YPEH 2RDLA 3BTTE 1C2JA 1GI9B 2VH6A 4WH6A 3O8BA 4GCHF 1W14U 1KMHB 2ANYA 4JYTA 2KCPA 1UTKA 1H4WA 5I25A 2DE9A 3Q76A 1DWBH 4H6SB 4OS7A 3UTUH 1EPTC 1MZAA 2KFWA 2CMYA 5A8XA 5CE1A 1D3DB 2FOBA 1P10A 3F2FA 5AFYH 1ETRH 3P8OA 1F0TA 1XMNB 1K1MA 4MNYA 3F0OA 1GWAA 2HPQH 1BDAA 1T8LA 4K1TA 2VBCA 5JBBS 1FIZA 2XCFA 5LPRA 1C1QA 4IN1A 4JZIA 4VGCB 3SV9A 3UNRA 1K28D 2P3UB 1MD8A 2SGPE 1G37A 4TPYA 1SHYA 3U1JB 1O2KA 3HGPA 1TA6A 1AIXH 1ESTA 3U9AH 1O32A 1MTWA 1XVMA 1A3BH 2W26A 2QE7D 4IMQA 1GMHF 1ZRBA 2OTVA 3SV6A 1O2RA 2G51A 2F9BH 1BMNH 2Y6TA 1TGCA 4ABGA 3F2GA 1O39A 3AAUA 1FPCH 2FI3E 1ZHMA 4ABHA 1MCVA 4OGYA 1O35A 2VU8E 1L4DA 2BQ7B 1MKWK 1X7AC 1UVOA 1NFWA 2IPHA 5EQQA 5T6DA 5DP5A 1HDTH 2OC8A 5C0TA 1CA0C 2PR3A 2BOHB 2CF8H 2A1DB 3DHKH 1MCTA 4CH8B 1G2LA 3M3VA 4X2VA 3LGVA 2GZ7A 2V6NA 3M36A 1P02A 5C1UA 6GCHG 4Q80A 3LJOA 1XM1A 2THFB 3VB7A 3G01A 2QYIA 3CENA 2CJIA 3DA9B 3LOXA 3MTYA 1IAUA 1RGQA 2ALPA 1P2MA 3GICB 3UREA 1EJMA 2STAE 1JRSA 2UUJB 3E90B 5AF9H 1DM4B 4FVBA 1O33A 2XOKD 1HUTH 2BD2A 2JJ2D 2OUAA 5JB8S 2ANKH 1GI0A 2G55A 1C1PA 3LPRA 2R3YA 4YT6H 2TGDA 1VZQH 1J8AA 2ESTE 4B1TA 3SV2H 3E8LA 3VXFH 3VB3A 1W0KD 4X8UH 2YMSC 1W7GH 2GVFA 2GJGA 1EAIA 2ODPA 4AFSA 2XWBI 1GBFA 4AOQA 4UFDH 4AFZA 4XD7D 2JETB 3O8CA 1O3AA 4ABIA 1SQAA 3PO1C 1LKBA 1K22H 1ZHRA 1IQGA 3T25A 2ODQA 2ZFPH 2BDCA 4K5ZA 3H7TA 2V3HH 1CGHA 3DSOA 3LGYA 2BM2A 3KQBA 1GJDB 4AORA 1Q31A 1RIWC 2SGDE 2V7QD 1O3EA 5FBEA 1BMMH 1O2JA 2BY5X 1LHDH 1TAWA 3A88A 5ESTE 3WW7A 4WXIA 5DN6D 1D6WA 1P04A 2J92A 1EUFA 3RM2H 3GY8A 1DLEA 5EIYA 1AFQB 1QZ8A 5GCHF 1EAXA 3IWMA 1RS0A 1A5IA 1FZZA 1YLNA 3TH3H 5JBAS 3UNQA 3P6ZB 3ZV8A 1K1LA 2GT7A 1C2LA 4YOIA 1G30B 4CRGA 1J9CH 1MTVA 1VCWA 1GBAA 1OP0A 4J1YA 4ACBA 3K65B 2AMQA 1DT2A 1ZOMA 2WUBA 1TABE 1P2JA 3I29A 1UVTH 1Q3XA 5HM9A 1OWHA 3EQ0H 4Y8XA 1GI6A 5EW1H 3TLOA 1O2LA 4YOGA 3L6PA 1O3MA 1NTPA 2CK3D 3KQDA 4MVNA 1P06A 5A2MH 3SJKA 2QF3A 1XUKA 2P8OC 3PMAB 1TGTA 3VEQB 1FN6A 1FX0B 5EOKA 1NRQH 2BZAA 3P70B 1OWDA 3E91A 1HRTH 3STJA 4PROA 2F4LA 1OWIA 2ZFFH 1SGPE 2A5KA 1GJAB 1Z1JA 1THSH 3R0FA 3LDXH 1W10U 3NRLA 1TNKA 2OQUA 2XBXA 3PV5A 4ZHAA 4ZHMU 2JIZD 4B2BA 1A46H 3E3TA 3Q3YA 2BDGA 2YOLA 4TWWA 1QY6A 4DOQA 1IQFA 4BTTB 1SLWB 5FHTA 3SNEA 3GCHC 1CT2E 1DSTA 1HLTH 3MO3A 1MABB 4UEHH 2C8ZB 5SGAE 3DT0H 4U01A 1BT7A 5CHBA 3A87A 1UCYE 2Y81A 5HXFA 1VITH 1GHBG 1EZQA 2ZGXH 2ZKSA 4AC9A 1F0RA 3GYMA 1AB9C 1QR3E 1GHWH 5DP7A 1JOUB 3KQCA 3A85A 1SLUB 5TCCA 4Q63A 2BOKA 2RDEA 1ZMJA 1CGIE 2GCTB 4ABAA 3ZIAD 1ANBA 2RFKC 1HFDA 1W13U 2JH5D 1CO7E 1B0EA 4Y7BA 3TK5A 3H7OA 1NRNH 1Y5BT 4D7FA 1KSNA 2ZHEH 4E7RG 1LQDB 2BDYA 1GG6C 3P8NA 5EPNA 3QGJA 1BRBE 1E0FD 4YLQH 1DDJA 3PB1E 4TPIZ 2FI5E 1BA8B 1SG8B 3OEED 1HJAB 3SI4H 2J95A 2A32A 1BTHH 1V2MT 3TH2H 3BSQA 1UO6A 1HAYB 1MTUA 1O3FA 3M61U 1Q2WA 1A1RA 1WTGH 3H09A 3EGKH 4AFQA 4ISHH 1EP5A 3SGBE 2KCYA 1S6FA 4RKJB 1V2LT 3FAOA 5L6NH 1NESE 2O8MA 4Y0ZE 2XNIA 1GMHG 4AG1A 1UW7A 2BLVA 5AFZH 1YKTA 1Z8RA 2EI6A 2VJ1A 1A7SA 1J16A 1DS2E 1YPGH 2XNDD 5TCAA 4I32A 2SGEE 3TGIE 1FV9A 1HBTH 4K3JA 2LPRA 2O8UA 2J2UA 1QQ4A 3U69H 4BXWA 4Q4LA 5DSFA 4B73A 5GWZA 1O2YA 4OS5A 3ZZBA 3V3MA 1NRRH 4ZKSU 1O0DH 1Y5AT 2VB0A 1QRXA 1W11U 3SV8A 1TOCB 1EASA 4P00A 2FOGA 2VIWA 3FN8A 4UE7H 1C5PA 2W6ID 3A8BA 5A0AE 1FY3A 1BBRE 2BVXH 4GVUA 4LXBH 4BANB 4XSKU 4MTBA 1N8OC 4JZFH 4X1RU 1E79D 1QB9A 2D2DA 2EY4C 1FY8E 2ANMH 3TH4H 1RTLA 3F9HA 3TPIZ 4ZROA 5JBTA 3RU4E 2F9PA 1D3PB 3LKWA 4CRAA 4R8TB 1QBVH 3DFLA 3QTOH 4Z6AH 1DY9A 4INLA 4ABDA 2CHAB 1AE5A 2HALA 1LHEH 3VFEA 3BTKE 5DGJA 4ZCNA 1KYNA 1O2IA 3BEIB 2FX4A 4KTSA 4U30A 4MG3A 4GHQA 1OYQA 1DXPA 1DWCH 2XWAA 1GHAG 1AUJA 2GD4B 2VWNA 3FP6E 3GCOA 2R3UA 1WBGB 2PKAA 1NS3A 4KELA 1J15A 1GBCA 2ZU2A 1EZUC 3GY6A 5LH8A 1XX9A 2QXIA 1L1NA 2H9TH 1XUIA 4ABFA 1IQKA 1JXPA 4MDSA 1EJAA 2FOMB 5E0GA 5GIBA 3UFAA 3GDSA 1F2SE 1IHTH 2RCEA 1QNJA 4UFFH 1VITG 1ZR0A 1JIRA 4J2YB 4HG6A 1WDIA 4TY7A 3SHAH 3QGNB 1SC8U 1TBRH 4BNRA 1P11E 2R0LA 4IGDA 5L2YH 3U1IB 3SGAE 1A5GH 1EZSC 4DT7B 1TPAE 3BTEE 2GMTC 4ABJA 4B6FA 3S9CA 1O38A 1Y59T 1AZ8A 1CGJE 5H4IB 2QAAA 1DXWA 1BHXB 5B6LA 3MI4A 5E0JA 1SMFE 3QN7A 1CA8B 4THNH 1BBRH 1UCYH 6LPRA 3TIUA 3A8CA 1AKSB 2GTBA 4K1EA 3UNSA 1UVPA 3HGNA 3HKIB 3RM0H 1KXFA 2I6SA 2Z94A 4FUIA 1G3DA 1O2WA 4IN2A 2QXJA 4X1QU 1O2OA 1C5MD 4SGAE 3RXLA 3RC6A 4A1XA 5C5OA 4KTUA 2Y5HA 1TONA 2O8TA 1SGEE 2BMGB 1PJPA 1SLXB 1TYNA 1BMAA 1ZJKA 2WPJS 3HK3B 4ASHA 4IW4E 1VCQA 2FTMA 1T32A 3A7VA 1QL8A 4MNVA 3DSGA 1ZTLA 1CHOG 1GBKA 1SHHB 3F2HA 4YZUA 2GX4A 1TX6A 4FUHA 1EPTB 3SHCH 2GCHF 3MU1A 2GMTB 3ZVCA 4P02A 1F5RA 1XUJA 1C2KA 1KXDA 1C5TA 2G4TA 1E1QD 3A7YA 1YPJH 2Z7FE 1TBZH 3ZVDA 1FY4A 5LGOA 1T4VH 2BQ6B 3U28C 1NN6A 4OS6A 4ZXXH 3PV4A 3JZ2B 3N7DA 1BTXA 1YCPK 3HK6B 5F8ZA 4MQAA 2FOCA 2P59A 3ZVBA 1AKSA 2A4OA 2AHME 4X6NA 1TBQH 1A0HB 1Y5UT 1ZGIA 1QHRB 1RJXB 1ETTH 1ID5H 2CXVA 4I8JA 2SGFE 2PUXB 2C90B 3SU2A 3BEFB 5FPSA 1LHCH 4Q7ZA 5K7RA 5HIZA 2WPHS 1MH0A 4AB8A 1DICA 4X8SH 1K0HA 3E6PH 1EFRD 4FETA 4RKOB 2BDAA 1P9SA 4D76A 1CSOE 2FLRH 4NGAH 1AWFH 5IK2D 5B6OA 3RMLH 1RFNA 1E34B 7GCHF 1K1OA 3P95A 1ESAA 4H4FA 3OY6U 4JCNA 1AVGH 1LKAA 1U6QA 2VWOA 1PQAA 1S84A 2GKVE 1ZMNA 3A80A 1ELVA 1V2QT 2A5IA 4WF8A 2YNAA 3BIVH 2ZZUH 3FZDA 1WV7H 2ZGBH 1D3TB 1C1OA 1C5ZB 1XXFA 1BTUA 1BJUA 1GDUA 2BLOA 2UWPA 4O03A 1RXPA 2FPZA 3MNCA 3ZV9A 2QF0A 1ANCA 4R0IA 4BOHA 3AVZA 4I8HA 1JMOH 3GY3A 2GP9B 4FXGH 1G3CA 4K1SA 4CRDA 4NA7A 1DUAA 4BTUB 5EGMA 1EB1H 1AD8H 5IYTA 1ANDA 1LVMA 3B23B 2WHXA 2ZDMA 4QT8C 1H8IH 4I8LA 2A7HA 1C4V2 4O3TA 3UR6A 1QA0A 3A89A 1GHZA 5DP4A 1ZYOA 5C2ZA 3OE7D 1A4WH 3UWIA 3C1KA 3A7TA 1O3OA 1KXAA 2V35A 2HGTH 1TLDA 1S6LA 2OC1A 3RLYH 2IN2A 4ZKOU 1CHGA 5HGGA 5FBIA 1P2IA 1OWEA 1Z8JB 4D9RA 3AK5A 1AN1E 2P3TB 2Z3EA 5TJXA 3RMMH 2Z3CA 3QO6A 3STIA 4K60A 1CBWB 3DFJA 3NXPA 1ZPBA 4U2WA 1QL9A 3E1XB 4FUGA 1QJ7B 4CRFA 1TALA 4U32A 4LZ1H 1GI7B 2A4RA 1DWEH 1QTFA 4YTAA 1WOFA 2A7CA 3K9XB 3AW0A 2GT8A 1UVSH 3A82A 3KQEA 1C5NH 1EOJA 5EODA 1P3CA 2D1JA 2J94A 1INCA 4BXSA 1IQLA 2ZCLP 1Z6EA 3GOVB 1C2FA 2ZHWH 1TNLA 2Q6FA 5CHAB 4DY7B 3B8JA 3GY5A 3TK6A 1GJ6A 4JK5A 1NROH 2ZDLA 3MH5A 4I7YH 1H9HE 1C4Y2 1KDQB 1C5UA 3M37A 2VIDA 3VB5A 1HJAC 3LGIA 3A7XA 1G32B 4X1PU 3SUFA 2FZZA 1ELEE 1S0QA 4A6LA 4UONA 1O2QA 2ZHFH 3ATWA 5EPYA 3S9AA 3T62A
chains in the Genus database with same CATH topology
2J38A 3U8RH 4DG4A 1KLJH 1GBIA 3HATH 1FIWA 1SGIB 3ZZ7A 3HPTB 1GBTA 1RD3B 1LVBA 5C1XA 1KTSB 1WCZA 4HZHA 8KME2 1O2HA 1MBQA 2VVCA 5JDUB 3PWCA 1O34A 4UD9H 5DP8A 2HRVA 2ZU1A 5LPEA 8ESTE 2HOBA 1K1IA 1V2ST 1CQQA 4FUFA 3SGQE 3UQVA 5C20A 1SFQB 1V2WT 1B7XB 3ZYDA 1BUIA 3ATMA 1UK4A 4IBLH 4F4OC 1AVWA 1IQMA 3A81A 1ELBA 1C1VH 2VVVA 2BDHA 4ABEA 4JZDH 1BTPA 4I33A 4AGJA 1UTJA 1O3LA 2HWLB 3RDZA 1AO5A 3ODDA 1BB0B 1K1JA 1YM0A 2EI8A 5FX6A 1G36A 2EC9H 4OGXA 5EU8A 3MYWA 1XXDA 4CBNA 1ZGVA 3F1SB 1MZDA 1C5OH 1EB2A 2G4UA 2PSYA 1AVXA 2NU0E 1QB1A 3SJIA 3RMOH 3HKJB 3SQHE 1AUTC 1O3KA 1P57B 4Y0YE 3SN8A 1O2UA 4ABBA 1AGJA 2Y80A 3PTBA 1ARBA 1TMTH 4WVPE 1C1RA 1A5HA 4Y71A 1HAPH 1ABJH 1H8DH 1GI4A 5T6GA 2TGTA 2ZGJA 4HTCH 2FOAA 1TRNA 1Y3VA 4TY6A 3E0NB 3D23A 3PTNA 3T5FH 3ZZ3A 2PGQB 1QGFA 1NU9A 5DJ7A 3ELAH 4VGCC 3ESTA 4Y79A 3Q3KA 3V13A 3ATKA 3SJ8A 1O2MA 1BRUP 5JPMH 3LC5A 1D4PB 2V0BA 4CRCA 2G52A 1GGDB 3BTDE 1VGCB 1BCUH 1G3BA 1P9UA 1SVPA 3U8OH 4CHAB 1GPZA 2XC5A 5JYIA 1RIWB 5E8EH 3RXTA 2FOFA 5AHGH 4A1TA 5DO4H 3BIUH 3QZQA 2CN0H 4K8YA 4YLUA 3ITIA 2ZQ2A 3ZZ9A 4JYUH 1TPPA 3VB4A 3UQOA 7ESTE 1D3QB 3PMBB 4UFGH 1DFPA 1S5SA 1CBWC 1HXEH 2AMPA 1C5RA 1P2OA 1QBNA 1GCDA 3RXMA 2BD8A 2QY0B 1MQ6A 1E38B 1C2MA 2BYAX 3UY9A 3GY2A 1GI5A 3OTJE 2ZEBA 4K69A 1BMLA 1VR1H 2CHAC 2QGRA 1AB9B 4NFFA 3RXVA 1TRYA 1B5GH 3H5CB 4IS5A 4AX9H 3M3TA 4YT7H 2G81E 4OS2A 1GBMA 1GJ9B 3MNSA 1MU6B 2BVRH 1PQ7A 1VGCC 4O9VA 1B0FA 1P2NA 4FUBA 4NA9H 3PLPA 1ETSH 2ZCKP 1C5XB 1EQ9A 1L0ZA 4MPXA 3FANA 4DIHH 3JZ1B 3MNXA 4B2AA 2VIOA 1AFEH 3K6ZA 4IC6A 1AU8A 1AWHB 1P03A 3GDVA 4KKDA 2AIPA 5DK1A 1SQTA 3A8AA 3RXDA 1EX3A 3EA9A 1SGDE 2JETC 4OS4A 2AGIX 4XE4A 4Y6DA 2NU4E 3QLPH 1NO9H 3K2UA 3ZZAA 5IDKA 1NRPH 1YC0A 3V12A 3IG6B 1BRCE 1MQ5A 3S0NA 4ISOA 1YGCH 1QQUA 1SGYE 4NG9H 4FU7A 1SGQE 1YCPM 1FNIA 2ZO3H 2ZECA 5C5NA 3EDXB 3S69A 1O2VA 1PFXC 2AEIH 1TGSZ 3FVFB 1TQ7B 3NZIA 1SGTA 3KIDU 1FQ3A 1ZMLA 1BRAA 2WINI 3TGJE 2XXLA 2ZFRH 1PPHE 2J34A 1XKAC 3PYHA 1W12U 1SGNE 1O30A 3FP7E 2WYGA 1JRTA 2ZTYA 3FZZA 2WV4A 1LTOA 1QL7A 1O5CB 4WXVA 1PPCE 3ZZ8A 1GI8B 4JMYA 3TVJB 3LONA 2QXHA 1UVUH 1OSSA 1SBWA 1QCPA 2A2QH 1YLCA 1K21H 2OP9A 1ELAA 4X8VH 3SOSA 1QJ1B 1AHTH 1P2QA 2Q6DA 3SBKA 1HNEE 2FYRA 3LGTA 1O5EH 2OC0A 2SNWA 1SFIA 2OC7A 1HPGA 2H5DA 3L33A 3L3TA 1UK2A 1KIGH 3NUMA 1GJCB 1QB6A 1V2TT 2WPLS 4ISLA 2A2XH 3LJJA 4NZQA 4X1NU 2ZA5A 1FI8A 1EZXC 1HYLA 2FESH 6CHAC 2ZDKA 1LQEA 3KF2A 1EAUA 2WYJA 5L2ZH 3M5NA 2VIPA 5GPIB 2FI4E 1S82A 4KP0A 1W0ZU 4X6MA 1V2RT 1V6DA 3RC4A 1DWDH 1HCGA 4I8GA 1HIAA 2OD3B 2XW9A 3SU3A 1SOZA 2FO9A 9ESTA 1UHBA 2FXRA 3RXIA 2WPIS 1F0SA 2PSXA 3RU4T 5J4SA 1P0SH 5FX5A 2ZQ1A 1OYTH 1GJ4H 3SU6A 4DVAU 1TE0A 1TGNA 1TPSA 4WWYA 2ZP0H 3ATLA 1FY5A 2ZU4A 1CVWH 2ZHDA 5HMAA 1VCPA 4A7IB 2C8XB 1DITH 5LPFA 1IQIA 1VJ9U 1CE5A 1M9UA 1QRZA 4ZUHA 1F7ZA 1BIOA 1OKXA 2PUQH 1LPGB 1C5YB 3RXRA 4D9QA 4JK6A 3RXPA 1MTNB 1FAKH 2BY9X 4AN7A 1GBDA 3U98H 1GMCF 1UCYK 3FP8E 3W95A 1MTNC 1IQNA 1ZHPA 1Z8GA 1K2I1 3RXFA 4XDEA 2JH0D 1AY6H 4Y10E 1TQ0B 1YF4A 1TNJA 1WU1A 1KLIH 4AB9A 1WSSH 1QBOA 2HVXA 1ELGA 2RA3A 1Y8TA 4B74A 1N6YA 2DE8A 4X2WA 3ATIA 4O3UA 3OU0A 7LPRA 1WAYB 1SSXA 3CS0A 1OX1A 2P8OB 3MU5A 2NWNA 3F6UH 4GUXA 4I8KA 1T8MA 3GCTG 2BD4A 2OXSA 1AFQC 1BITA 3E0PB 4CR9A 4ZAEA 3SNCA 3D65E 7KMEH 1O5GH 4WY3A 2Z9KA 4K2YA 3BF6H 2UWOA 3Q77A 4I31A 1C1UH 1UK3A 2FOEA 2H9EH 5FXLA 2XBWA 1NY22 5C1YA 5FCKA 6ESTA 2PLXA 1ORFA 1L2EA 2FX6A 4CBOA 4F49A 4FUJA 4RSPA 4MPUA 1YYY1 2UUYA 1J17T 5E2OA 1V2JT 2DUCA 3A8DA 3VGCC 4YOJA 4B2CA 1GJ8B 1Y3XA 2ZI2H 2AS9A 4E06H 4WH8A 3CP7A 4HI3A 2BY8X 4X1SU 1LHGH 1QA7A 2BD5A 3PLKA 1KXCA 3D49H 2C93B 2BD7A 3SW2B 3EA8A 1ELFA 3UR9A 4NCYA 4Y8ZA 1YPHC 1GHYH 1GI1A 1ZTJA 4BAQB 1GG6B 3TNSA 4XOJA 2HNTE 3MHWU 2W3IA 1A2CH 3NK8A 4A5TS 1ZSLA 1G2MA 3QK1A 4A1VA 1GCTB 3PLBA 1C9PA 2ZFTA 1C1WH 8GCHF 1LO6A 2C8YB 3LIWA 2FS8A 4WJG2 1GVLA 1XKBC 3LU9B 4NFEA 1NRSH 2XBVA 2VWMA 2ZDVH 1O3PB 1HGTH 2K1QA 1MMJN 4Q7XA 5I46H 2FTLE 1O2NA 5C67A 2SGQE 1K1NA 3SUDA 1DX5M 1PPBH 2ZU5A 1G3EA 2R0KA 3BG8A 2XBYA 4RN6A 1DUEA 1V2NT 2EI7A 1ZRKA 4X2XA 3PO1B 2P16A 4Y11E 2I6QA 4MNWA 3T29A 1FXYA 3T27A 3UPEA 2STBE 1FDPA 1CT0E 1N6XA 3BTGE 1O2TA 1UTMA 1L1GA 3U8TH 1O36A 1PPFE 4FUCA 3TJNA 2C8WB 2ZDNA 4CHAC 1GL0E 1ANEA 3DD2H 3URCA 1LCYA 4YM9A 3M5OA 1YLDA 1C2GA 2BDBA 1RTFB 3ZZ4A 1Z7KA 4NIVA 1H9IE 3RXQA 1RRKA 1HAOH 2GGVB 3BTQE 1OP2A 2BY7X 4OS1A 3O8DA 4YESB 4NWKA 1V2VT 3TGKE 1GBJA 4XBCA 4B75A 3ENSB 5DKMA 5PTPA 2FWWA 3GCTF 1F0UA 1BHXF 2O8WA 5DPAA 1V2UT 5EQRA 1K1PA 2WUCA 3P92A 5F03A 2ZU3A 1RTKA 1NPMA 2GCTC 1GCTC 2GDDA 1T7CA 4NIXA 3ODFA 3S9BA 2O9QA 4K8BA 1GVKB 1O3CA 1YPHE 5K0HA 2SGAA 2AMDA 3BG4B 1QJ6B 1UMAH 3MNBA 1TB6H 2QXGA 2ALVA 5FPTA 2ZFQH 3MU8A 2ANWA 2BX4A 2FIRH 2VGCC 2P93A 1N1LA 1SL3A 3RXSA 4NIWA 1TNHA 2BZ6H 3SNAA 1CHOF 1VITF 8LPRA 1ARCA 3MFJA 2QA9E 1CU1A 2PWXA 3NWUA 2RA0A 2ZF0H 4ZHLU 3RP2A 1ZSKA 1HJ9A 2C4FH 1S85A 2F9NA 2ZWLH 1ZZZA 3V7TA 1GHBF 5GJ4B 3QTVH 2ZPQA 1HAHH 3NPSA 1SGCA 3V0XA 1FONA 2BDIA 2ZGCA 2ZTZA 1AQ7A 1KY9A 1ZJDA 2BXTH 4XFQA 1YPKH 1S83A 2BY6X 3OYPA 3GYLB 3BN9A 5EXLA 1C1MA 2VINA 1HAZB 2Q1JA 4MNXA 1UTOA 3SI3H 1AE8H 3ZZ5A 5GDSH 2XC4A 3SORA 3LGUA 4HGCA 1ZSJA 3RXJA 3K6YA 6CHAB 1FPHH 5A09A 1PYTC 1DSUA 2A4GA 1LHFH 4AGKA 2FLBH 1SGFA 1C4U2 4XBBA 1ZPCA 3I78A 4D8NA 1EPTA 1D6RA 4NIYA 3IITA 1EATA 2PKSC 5EXNA 2JKHA 1TOMH 3RU4D 1V3XA 2EEKA 3NCLA 3OSYA 3MU4A 1ZPZA 3MO6A 3VGCB 3KEEA 1THRH 3OY5U 1IQJA 1FMGA 2M5TA 2F9OA 4INHA 2PTNA 1DE7H 2GV6A 2XC0A 4FU9A 1T4UH 3ZYEA 2ZHQH 3T28A 4FUEA 2VIQA 3QUMP 4GCHG 3UOPA 1GI2A 2KAIB 3SJ9A 1SLVB 2ZDAH 2V3OH 2XCNA 1A0LA 2FP7B 1TRMA 4ISNA 5GCHG 3SQEE 4KTCA 4O97A 2YNBA 1O3GA 3UOUA 4WMEA 3EE0B 4DIIH 2D26C 1NU7B 1LMWB 2VGCB 3P8FA 1MD7A 1EP6A 2Z9JA 2UUFB 3P8GA 2QCYA 5FAHA 5G4BA 3T2NA 1OWJA 1P12E 1AMHA 1O5AB 2BB4A 4NSYA 3RXGA 1YCPH 1PPZA 3PM3A 1YPMH 4YO9A 2H5CA 4ESTE 1ELDE 1T31A 4TWYA 4ZKRU 2XRCA 2B8OH 2PFEA 5BPEA 1GGDC 1SOTA 1H9LB 3TNTA 4E05H 1JBUH 2Z3DA 2QIQA 1SPJA 2W7UA 2ZPSA 4DJZB 1E36B 1C2DA 3MWIU 3SJOA 2TBSA 3F9FA 2F3CE 2SFAA 2O8LA 1ZLRA 1ACBE 1PPGE 2ULLA 3ZVGA 3M5MA 4JYVH 1HAGE 5JBCS 2ILNA 2ZFSA 5L30H 2TRMA 1YBWA 4MPWA 2BLQA 1BTWA 3LT3A 1UJ1A 1PPEE 1GJBB 3FFGA 3RLWH 4FU8A 5DP9A 3AW1A 1NT1A 2P95A 3W94A 1DOJA 2VIVA 2G00A 3KCGH 1V2OT 1MTSA 1WYKA 1BBRK 3SNDA 3AASA 4IMZA 1GBLA 3MU0A 3QX5H 2UUKB 3LH3A 1W2KH 3SO3A 3KGPA 2Q6GA 1A0JA 2A0QB 3A7ZA 4AZ2B 2A5AA 1A61H 1PQ5A 2AYWA 3MH6A 4TYDA 1FY1A 1JIMA 1GDQA 1A3EH 1PYTD 1TX8A 1GHAF 2Y7ZA 2FDAA 3RC5A 4M7GA 1F5LA 1D9IA 2TGPZ 3D62A 3SZNA 1C5WB 1P3EA 5HYOA 1V2KT 2CV3A 3QZRA 2B5TB 2KAIA 4NSVA 1AZZA 3EAJA 5A8ZA 3BTHE 1C9TA 2EA3A 1UTNA 1SGRE 2VWLA 3PMJA 3BTFE 4MLFB 1O5BB 1OWKA 1PQ8A 2W7SA 4SGBE 1FN8A 4Q7YA 1OP8A 1C2HA 3GISB 1YPLH 3MOCA 1BTZA 1XUFA 2FM2A 2TIOA 2Z9LA 1NFUA 1MKXH 3T26A 1O3JA 2BHGA 4BAOB 1WTHD 1E37B 5T3HA 1LVYA 2IJOB 3P17H 4AYVB 3N7OA 2F9VA 2AIQA 1TFXA 1BJVA 1GMCG 5FPYA 2BQWB 1LVOA 1FLEE 1K9OE 2BXUH 1VJAU 3SUEA 1P8VC 2ZNKH 3MH4A 2OLGA 4LZ4B 1KTTB 2OCVB 4X2YA 1WQSA 2H1UA 4FUDA 2IOTA 3LGWA 2J9NA 5EQSA 2HNTF 3RXUA 4CR5A 2A7JA 2FMJA 1SGFG 1E35B 2Y5GA 3Q00A 3BTWE 2A31A 3F68H 3RUOA 2W3KA 1C1NA 4ZH8A 2BD9A 1NZQH 4X0WU 1O5FH 3F9EA 1BOQA 3M7UA 1TWXB 2D8WA 3SNBA 3DUXH 2VH0A 1O2GH 1N8OB 5FCRA 1EKBB 1O3NA 2TGAA 1FUJA 4AG2A 1DVAH 3ZVFA 1SR5C 2GZ9A 1JWTA 3ZVAA 4H42U 1SI5H 4LK4A 1YP9A 3VXEH 1BZXE 1GI3A 5AVDA 3KN2A 1FAXA 1UHBB 2G5VA 2FYQA 1DANH 1Z1IA 3SU0A 2ZCHP 1Y3UA 2ZG0H 4Y8YA 1HJ8A 3PWBA 3A7WA 4B71A 3PROA 1J14A 1HXFH 1IQHA 5GXPA 2CF9H 2GZ8A 2LNCA 1C1SA 2AERH 2BX3A 2F9UA 1EAWA 3SUGA 1C2EA 1HAVB 1G9IE 1S6HA 1TX7A 3OX7U 1TA2A 2PHBA 5EG4A 1GDNA 3ZZ6A 2Z6BD 1C5QA 4AFUA 5T6FA 2XTTB 3RXKA 5JB9S 1IHSH 3MH7A 4DCDA 2B7DH 2ZIQH 1UTPA 3TITA 2QN5T 1C5SA 2A45B 1QIXB 3A83A 1W3CA 5F8TA 1FJSA 3TJUA 4IC5A 4INKA 4MPVA 3SU4A 4BAKB 4Y76A 1O37A 1O2ZA 4A92A 3EYDA 1HB0B 1MAXA 1MU8B 1W7XH 2QC2A 1TIOA 1EXFA 2AGGX 3M5LA 2Y5FA 4X6OA 1NM6A 4X6PA 4NA8A 5F6MA 1W0YH 3BEUA 2NU2E 1TMBH 3KL6A 4XBDA 1GL1A 1GVZA 3ZVEA 4AYYB 2VNTA 3M35A 3UWJH 5A0CA 1NC6A 1HAIH 2FOH<