4FUDA

Crystal structure of the urokinase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 61
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fudA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fudA01
1SQTA 2J4IA 4YOIA 3S7HB 1C5NH 1Y3YA 1NFUA 1UTPA 2J9NA 1BCUH 1BJUA 1YLDA 4I31A 1KIGH 3VGCB 1NPMA 2XWAA 5EPNA 1SFQB 2FODA 2G00A 1HFDA 1QQ4A 1EB2A 2FS8A 1G3DA 1QA7A 1P3CA 3SUEA 1Y5BT 2ZDKA 1KLIH 2HWLB 1GCTB 2WV5A 1GBCA 1GI4A 1AHTH 4D8NA 1D3DB 4KTUA 1C1QA 1P11E 2D1JA 3EQ0H 1F0RA 1ELGA 1SGIB 3TVJB 4FU9A 1O3HA 2C3SA 1HB0B 2Z9JA 2A0QB 1O5AB 1MTWA 4K1EA 1VR1H 2I6SA 2OP9A 2WPLS 1V2NT 2TIOA 9ESTA 3SV9A 2OD3B 1C2LA 4D9QA 1TABE 3V13A 1S6FA 1CT4E 3PTBA 1E38B 3BTKE 2EI6A 3QUMP 2F9BH 1GBJA 2XBWA 3P6ZB 2VH6A 2ZA5A 2V35A 2BDAA 3BTHE 1O2LA 1SGEE 2FX6A 2STAE 4YLUA 1O3JA 1ZHRA 4K69A 1BA8B 3SGQE 1A61H 2FOCA 1TOCB 3MYWA 1FY5A 2OBOA 4AX9H 2VVVA 4Y11E 1GJ4H 3LGUA 1LPGB 2D8WA 1BHXB 1CGJE 2PKAA 3O8DA 3UWIA 4X6PA 1ZRKA 2B8OH 3F1SB 2OLGA 1KLTA 4ISHH 2BLQA 3M7TA 1LVOA 6GCHG 2QY0B 4DURA 2BY9X 3GDUA 1NS3A 4I8GA 2FOAA 4Y0ZE 1GHWH 4H42U 5EU8A 5LPFA 1GVLA 1GI2A 3RXEA 4AB9A 3OU0A 2RG3A 1RS0A 2FS9A 1CHOG 1GDQA 3A85A 1DWEH 4AFSA 2Z3EA 3URDA 1O3OA 4NFEA 1TPAE 5J4QA 1HYLA 4MQAA 1GHBG 1IQIA 1TX7A 2FXRA 3N7OA 4BTTB 2PFEA 1L4ZA 3MU1A 4AYVB 2OQUA 5PTPA 2SGPE 2ZWLH 2I6QA 3HGNA 2AGIX 4NA7A 3NKKA 3FFGA 2PWXA 3K2UA 1BTZA 2FO9A 3UR9A 1AKSB 3MNXA 2TGAA 2F3CE 4IS5A 2ZDNA 4X2VA 3M3VA 3P8NA 2ZFRH 2ZGHA 5T6FA 6GCHF 1AFQC 1AO5A 1K28D 1EOJA 2G8TA 1G36A 1FXYA 4YOGA 3SU1A 3SU3A 1YPEH 1W0ZU 2P3FH 3ZZ4A 1KYNA 2VNTA 2ZU1A 1SC8U 3T5FH 4K3JA 5DP3A 2VB0A 1SI5H 2ZHWH 3FZDA 1DFPA 3ZVGA 3KEEA 4FVDA 4M7GA 3P70B 4ABEA 4NIVA 1L1JA 1Y3XA 4BAQB 4FUCA 4AZ2B 4AGKA 2ZHFH 3BIVH 1HJ9A 4DIIH 2O8MA 1FJSA 4YTAA 4NSVA 4HFPB 3RU4E 1C1OA 1QRXA 4AG2A 5FPYA 4FUDA 1NC6A 2XBVA 3HGPA 4XBDA 1C1WH 1QJ1B 1FLEE 1GBIA 1K1OA 4UFFH 3SQHE 1V2TT 3MU5A 4TYDA 2NU2E 2ODPA 1CGHA 3BV9B 1HXEH 1ZMLA 1FZZA 2BLVA 3TU7H 1AFQB 2FTLE 4I8JA 3VB7A 5I25A 2RCEA 3SO3A 3SUGA 1LMWB 1IHTH 4PROA 2WV4A 4FUHA 1PYTD 4X8SH 1G3CA 1SLUB 3A81A 3KCGH 1C2GA 1G37A 2FP7B 1ELAA 4TY7A 6CHAB 1PQ7A 2PTNA 5FX5A 4ZKSU 2BB4A 1A1RA 2ZEBA 1F5KU 4WVPE 2DE9A 1O2VA 5EXLA 3NPSA 4XBCA 3TJNA 3KL6A 1TMTH 1OP0A 2YNBA 4MLFB 3SZNA 1Q3XA 5FCKA 4A6LA 3B23B 3RM0H 2J95A 2OCVB 2GZ9A 5T3HA 2BX3A 5IDKA 1HJ8A 5FX6A 1FN6A 1GBHA 2ALVA 3BEUA 5J4SA 3RXAA 3U1JB 5FPTA 3M61U 3TK9A 1L0ZA 1TMUH 1GBEA 3A89A 3RXDA 2GGVB 1VJ9U 2H9HA 4OS7A 1SGCA 1QBVH 1GL1A 3MO6A 2C4FH 5HGGA 4BTUB 1FQ3A 1Z8GA 3L3TA 3SGAE 1EPTB 3FAOA 4NA8A 3LC5A 3B9FH 4OGXA 1GI1A 2YOLA 3UNSA 1SL3A 2HGTH 1RIWC 1DDJA 2P3UB 2BHGA 3MNCA 1D4PB 3GY6A 1O36A 1QTFA 1QY6A 3Q77A 4MDSA 1DWCH 1OPHB 3HATH 1FV9A 1GBBA 4NIWA 4K8BA 3M5LA 3QTOH 5E0HA 2HOBA 4IGDA 3RXBA 4ABDA 3BTGE 3EAJA 4NIXA 2VIQA 3VPKA 2BD2A 4ZHLU 1CGIE 4WXIA 3UPEA 1DANH 1LHFH 2PV9B 2FOBA 1TBQH 3BTEE 2CV3A 2A4RA 4GCHF 2BVSH 2HALA 2GCHG 1GG6C 1HGTH 4GUXA 1S85A 3A83A 1VCWA 1YCPM 5L30H 1TE0A 1V2OT 1VCQA 1DT2A 2QN5T 1ZPBA 1HAGE 2FYQA 2NWNA 2XC0A 1TPPA 4MPWA 1WV7H 3VB5A 2ZU5A 4WH8A 5C67A 3M3SA 4RSPA 1H4WA 1O34A 4LK4A 3MU8A 2GDEH 1N8OC 1FIZA 1YPGH 1OWEA 2A4OA 2BDHA 4MNWA 3F9FA 1H8DH 3D65E 3SUFA 1H9LB 3R3GB 3LGTA 1ZOMA 2P16A 1C1PA 3RLWH 4SGAE 3DUXH 5LPRA 1GMCG 1C1TA 2BXTH 3BG8A 4X1RU 8GCHG 1TGNA 2CHAB 3PWCA 4AG1A 2PUQH 4B2BA 1VGCB 2Z9LA 1C5YB 5FBEA 1CA0C 1AWFH 1P0SH 3A84A 1Z71A 4KGAA 3SU6A 1CBWC 4BAKB 5JBBS 3GDVA 3A80A 2R9PA 4A1XA 2RDLA 1XUFA 1K2I1 4R0IA 3SI3H 4ABJA 4JK6A 1AE8H 3QGNB 1B7XB 2O9QA 5E0GA 1YPKH 3QX5H 2PGBB 3QWCH 1Y59T 1CU1A 1QNJA 3SNBA 5BRRE 1V2KT 1S6HA 3SQEE 1ABJH 2ZCKP 1DXPA 1SPJA 2TRMA 5CHAC 1VCPA 1ESBA 2BY5X 2GCHF 3BTQE 2P59A 1BRCE 2XRCA 5IYTA 1KXAA 3L6PA 7ESTE 1N8OB 3GY8A 1PPBH 1SGFA 3ZV8A 2VVCA 1O2UA 3SBKA 4TPIZ 2ZI2H 3SJKA 1QRZA 5B6OA 2A1DB 2VINA 4INHA 4K2YA 1AWHB 3Q3XA 1VJAU 2FOEA 4ISIH 1CA0B 1FY3A 1RFNA 1CBWB 1O3NA 2BDIA 1C1NA 1P10A 3F9HA 2ZHDA 1DWDH 1GPZA 2IPHA 3LONA 3A88A 1THSH 4HZHA 2WUBA 1GI7B 1H8IH 2SGQE 3PM3A 4ABGA 8GCHF 2P8OC 4FUBA 3K65B 1O2MA 2IJOB 5C1XA 1IQNA 1WU1A 3P17H 1GHZA 2UUKB 1WYKA 5CHAB 1F92A 1PPZA 1FONA 1HIAA 1T7CA 1Z6JH 1DOJA 3RXIA 3K6YA 2FI3E 1AQ7A 1ESAA 4DIHH 2B0FA 3S7KB 1XUHA 1KDQA 1LHCH 1YM0A 1GJDB 2BLOA 3F6UH 1YPLH 1WCZA 3SN8A 1G2MA 3JZ1B 3M7UA 3DA9B 2ODYB 1EP5A 1S81A 1YBWA 3JZ2B 4HI3A 1C1SA 4K1SA 4BAHB 1JIRA 4E05H 1ESTA 3T27A 2PLXA 1ID5H 1GBLA 1D9IA 4Y8ZA 2GV7A 1D3PB 4MNYA 1VITH 1CT2E 1C5RA 4BAOB 2P8OB 2M5TA 1O2ZA 2GKVE 5E0JA 4AYYB 2WPKS 2Y6TA 4ABBA 5C20A 3CS0A 3PWBA 2XC5A 3HPTB 3KF2A 5F6MA 4Q2KA 1O3PB 1HAZB 5AF9H 1FY4A 5AFZH 1GMHG 4NGAH 1PYTC 5L6NH 1UHBA 4MPXA 1O5EH 1GL0E 4X2XA 2O8LA 3FVFB 4Y10E 3BN9A 2AIQA 1UVPA 1DE7H 1GHYH 4YO9A 1ZHMA 2XTTB 1DVAH 1GJCB 1K1JA 3UUZA 4O97A 1Z6EA 4O3UA 1J15A 3PMAB 1C5XB 1V2UT 2EC9H 1GJ6A 1SGDE 4ZXXH 2NU3E 1ANCA 1O37A 1ZTKA 1MQ6A 1QB6A 3I77A 4A1VA 1MBMA 1WTHD 1WUNH 3BTFE 5F8XA 4NZLA 2FESH 2FOHA 2CN0H 2Z94A 3RXVA 4FUEA 1NZQH 7KMEH 1MAYA 1NN6A 1SFIA 2Y7ZA 1ELCA 4RN6A 3UOPA 1OP8A 5H4IB 1EAWA 3E6PH 1PPFE 1V2ST 2V3HH 2QC2A 1T8LA 4GPGA 3A7VA 5DP9A 3GICB 2JH0D 2G5NA 1BMAA 2ZPQA 1ZLRA 3VGCC 1UK3A 2O8UA 4D7FA 2QXJA 5DP5A 2OTVA 2FOGA 2ZFQH 1ELFA 3UQVA 3ZVEA 1GI6A 5JBTA 1LQEA 1MKXK 4E7NA 1SGNE 2GVFA 2V6NA 3LIWA 3Q76A 3GCTF 1ZHPA 2GT8A 1GHXH 2XCNA 1HAHH 2Z3CA 1OYTH 1O2PA 3QLPH 1OOKB 1V2VT 3BIUH 4Y8XA 1QL7A 2Q6GA 1ZGIA 4AB8A 1MTUA 2FLRH 3OSYA 1MZAA 1TGSZ 2VIPA 4GSOA 1GI3A 1HPGA 1O3BA 2BDYA 4IN1A 4Y8YA 6LPRA 3E0NB 1F7ZA 1O3FA 1YPJH 4R8TB 3TJUA 3STJA 1X7AC 3W95A 1SGRE 1QJ6B 2TGTA 4MPVA 1CO7E 3KN2A 1E36B 2ZTZA 3QZRA 1ETRH 5AHGH 4FUJA 1TNGA 3MOCA 1TA2A 3NZIA 1SHHB 3PLKA 4CR5A 4E7RG 3MH4A 1JIMA 4X1NU 2HNTE 3QN7A 2IOTA 1DWBH 3AASA 2VWOA 1SR5C 3DT0H 3RLYH 4WMEA 1LO6A 4KKDA 4JZFH 1OWJA 2ZCLP 3ZZAA 1O3DA 4AORA 4ZMAH 4OS2A 3P8OA 3GOVB 3NXPA 1A5HA 1TX6A 4Y79A 5EGMA 3V0XA 4BXSA 3S9AA 2Z3DA 5FCRA 1A0LA 3A8CA 3RXHA 1MH0A 1TB6H 4A5TS 1GHVH 1IQMA 3GDSA 4BANB 1HUTH 2BZAA 5HYOA 1AU8A 1GHAG 3HKJB 4YOJA 2ZP0H 4ZH8A 3RXSA 3SU4A 3D62A 3SGBE 1T4UH 3PYHA 5ABWA 4Z0KA 1K1MA 3LPRA 3A7XA 1ZGVA 3I78A 1Y8TA 4UE7H 1EAUA 4IC6A 4XSKU 1G9IE 1Q2WA 4JZIA 1T4VH 1TYNA 5L2ZH 1C2FA 2TGDA 1E0FD 1AUTC 1UK4A 3A8BA 2CMYA 3PLBA 3LDXH 5FAHA 1BHXF 2FPZA 2B7DH 1BTYA 1ZYOA 3LC3A 1SHYA 2UWOA 2ASUB 2H9TH 5SGAE 3TH3H 2VGCC 1YF4A 1A5IA 1O2KA 3TNTA 4JCNA 1LHGH 1NRQH 3LH1A 2Y82A 3C1KA 2HPPH 3A7YA 4NIYA 1HV7A 4XBBA 3K6ZA 1UTQA 2C93B 3QO6A 3TGIE 2F91A 2AGEX 1BUIA 1W7XH 2OC7A 2HVXA 4B2CA 3ODDA 3EA9A 2Y5HA 2BYAX 3KQBA 3T29A 3DFLA 3PROA 3HK3B 1GMDG 1YPHE 4ZUHA 1D3TB 3EE0B 1O2RA 1CA8B 2CGAA 1V6DA 2H6MA 3OX7U 4ABAA 2F83A 1BBRK 4IMZA 1T8OA 4MVNA 4DT7B 2Z7FE 3G01A 3ZYEA 1QB9A 4XE4A 3ZZ6A 1K1IA 2ZFFH 2O8TA 4B2AA 1EAIA 3T2NA 1W14U 1BB0B 2BDCA 4OS6A 4I7YH 1IQKA 2VGCB 3ATLA 4Y7BA 3SJ9A 5DKMA 3U8TH 2ZFTA 3RU4D 3SOSA 1A4WH 1TMBH 3TPIZ 4OS4A 4NWLA 2NU0E 1UO6A 3ODFA 3D23A 4JYVH 2ZDLA 3S9BA 6ESTA 3LJJA 3M5MA 1HNEE 1QGFA 4O3TA 1TFXA 2VVUA 1J16A 4FUIA 2P93A 1QFKH 5DPAA 1QR3E 4NCYA 4MPUA 5JBCS 1IQGA 1EAXA 4J1YA 4X8VH 1CHOF 2XBXA 6CHAC 3KNXA 2CJIA 1P01A 3PB1E 1K21H 2XNIA 1Q31A 1G32B 2WPJS 5DP6A 1NRPH 1SMFE 1AIXH 1UVUH 1MKXH 4B76A 3H5CB 2QIQA 2FZZA 1JRTA 8ESTE 3A7ZA 4MTBA 1RXPA 3ATKA 5ESTE 1W11U 5JPMH 1DX5M 1GHBF 1ZSLA 3LJOA 1Y3UA 1AB9C 2Q6DA 3E91A 4CBOA 1O30A 4MNVA 4X1SU 3VEQB 1A5GH 1QB1A 2SFAA 2OC0A 1P02A 1QCPA 1W13U 3O8CA 1C2HA 1O2GH 4X6MA 5GWZA 5HXFA 4YT6H 1KY9A 1BQYA 2WYJA 1UTNA 3RXJA 1D3QB 3EDXB 3NWUA 2GZ8A 2H1UA 1DPOA 1XVMA 3TIUA 4Q80A 4INLA 5C1UA 1Z1IA 2P95A 2B5TB 3F9GA 1GBDA 5JDUB 3MU0A 2SGEE 1EPTC 2ZDMA 3URCA 3AAUA 4CRFA 1LDTT 3MO9A 1AVXA 2OC1A 4CRAA 3R0FA 2AYWA 4DVAU 4X8UH 1ZJDA 2QYIA 4X6NA 1FY1A 2PTCE 3FP6E 3MHWU 1SOTA 2PKAB 1QA0A 2Q1JA 4WMDA 2TGPZ 1AB9B 1O2QA 4GHQA 2BY7X 3U1IB 1XKBC 3RXQA 2HNTC 1JXPA 3UY9A 1TRMA 9LPRA 5A8YA 1UTOA 2QV1A 3LGIA 3ATMA 4FU7A 1P2IA 1C4V2 4HGCA 3RXPA 3GYLB 1EX3A 1RGQA 1SSXA 2KAIA 3ELAH 3A8AA 3DD2H 1KXCA 4BNRA 1O3LA 3AW0A 1WTGH 2FYRA 2C8XB 3ZZ3A 1TONA 2JKHA 2AMPA 4X0WU 5JB9S 3VFEA 1U6QA 3RXGA 1PQ8A 1ETTH 3EGKH 4ABFA 3SV2H 1YP9A 1BRAA 1Z1JA 1UTMA 3Q3YA 3RMNH 4XFQA 1YKTA 1DM4B 2FX4A 4JK5A 3MO3A 1IOEA 1W7GH 4D76A 2FOMB 1QL8A 2Y81A 1JRSA 3RXKA 2HNTF 2W7SA 2CHAC 2Y80A 1THRH 1VGCC 4THNH 3VXFH 2ZQ2A 3F9EA 2HPQH 1XUGA 4XDEA 2ZNKH 3CENA 4E06H 3OTJE 3W94A 1L2EA 3RXLA 5BPEA 4BOHA 1BOQA 2SNWA 2H2ZA 3TK5A 1DXWA 1BBRH 1TNKA 2FI5E 2ZQ1A 3ZVFA 1HRTH 4NA9H 2H5CA 4Q7ZA 2QXGA 3TLOA 5T6DA 3ZZ9A 1OWHA 1GJ7B 1SBWA 1TGCA 3LGWA 1O3EA 2ULLA 2OUAA 4A92A 4ISOA 1KSNA 4U2WA 5DJ7A 1A3BH 1W12U 3P8GA 4BAMB 4NSYA 1S84A 2G5VA 3DHKH 1LCYA 4CRDA 4K60A 1ARBA 2BD5A 1EJNA 1YPHC 3A7WA 2PSYA 1O39A 4GAWA 4Y0YE 3TITA 1HAXB 4H6TA 4ZHMU 1HXFH 5K7RA 1C2IA 1C5ZB 1GI5A 2A2XH 1F5LA 1UTLM 1MAXA 1HBTH 5C1YA 2DUCA 1ZR0A 4J2YB 1GJ5H 3MNSA 4ZAEA 2RA3A 3AAVA 2VWLA 1YYY1 1GVZA 3PTNA 1XX9A 2P3TB 2R0KA 1MTNC 5LPEA 1HCGA 3LH3A 3SNCA 1FUJA 3TGKE 3UQOA 1C2EA 1XXFA 4UFDH 1QJ7B 2ZGCA 1O5GH 2V3OH 3KQDA 4X2YA 3ZV9A 1H9IE 1UVSH 1AE5A 3V12A 5EOKA 1P2QA 3UREA 1QURH 4OS5A 1GBTA 1UVTH 4RKOB 3H7TA 2EA3A 8LPRA 1OYQA 5EQQA 4K1TA 5DG6A 2ZTYA 2THFB 4I8KA 1PQ5A 1O2SA 2ANWA 2A31A 1GBKA 1GMCF 3EA8A 3PO1C 3AW1A 1HAVA 1EZUC 3D49H 1W8BH 5TCCA 1TGBA 1YGCH 2OQ5A 2BVXH 3SW2B 2JETB 2P94A 1MTNB 1XUIA 2BX4A 3ITIA 2GT7A 2J92A 1JWTA 4WWYA 3RXRA 4D7GA 1WQSA 2XW9A 1F0SA 1IAUA 3EYDA 1MKWK 5EG4A 1YCPK 1K1PA 1AZZA 3RXOA 1GVKB 2YNAA 1AFEH 3L33A 5C5OA 3GY7A 2UUYA 2BQWB 5F03A 2PSXA 5DGJA 1MU8B 1O2NA 3BG4B 1NT1A 2FDAA 3SNDA 1DICA 3TGJE 3CP7A 1G30B 1P03A 1C5UA 1O5BB 1SGYE 1ACBE 1C2DA 1UMAH 3IWMA 4FUFA 7LPRA 2QAAA 1BTHH 2QXHA 4IC5A 3PO1B 2A7CA 2H5DA 4B73A 1LVBA 3MMGA 1T8MA 1O2XA 4O03A 1CQQA 1TPOA 1ELEE 1ZRBA 1UK2A 3PMBB 2QXIA 1SGFG 2VU8E 1J14A 4AN7A 1AZ8A 3OYPA 5DP4A 3EA7A 4DCDA 2NU4E 4K5ZA 2BLWA 4BTIB 1EZQA 1EJAA 3Q00A 3RXCA 5EXNA 1A3EH 2G81E 3RC5A 5ESBA 2ANKH 4MG3A 3SHCH 1O2IA 1B0FA 1ZSJA 3RU4T 3VB3A 2BMGB 1K1NA 1UCYH 5EODA 5G4BA 3ENSB 2J34A 4I8LA 4YLQH 1PPGE 1RD3B 3M5OA 3S69A 1MBQA 1S0QA 2UWLA 1BTUA 5TCAA 1OP2A 1GBMA 5JB8S 1O38A 1IQJA 1SLVB 4IN2A 1HDTH 5L2YH 1EQ9A 1LHEH 1SB1H 4B75A 1J17T 2AS9A 3E16B 1IQEA 5A8XA 4CRBA 1O3IA 2ODQA 3T28A 4AFZA 1UJ1A 2PKSB 3O8RA 1GBAA 1ABIH 1LPZB 1INCA 5A2MH 1O2OA 1SOZA 4DG4A 1EJMA 3K9XB 1DUEA 1BMLA 2FMJA 2RA0A 5FPSA 1W0YH 1C5WB 4FXGH 4Y7AA 3DFJA 1LVYA 4OGYA 4CH8B 1GMHF 3M7QA 1O3MA 5DP8A 5EW2H 4U01A 4X1QU 1V2MT 3SV7A 3ZZCA 1C5TA 2O8WA 2AGGX 2BXUH 1YPMH 5HM9A 4ABHA 1V2LT 1C2JA 1GJ9B 1ORFA 2UUJB 2VWNA 1KXEA 1O33A 4JZEH 2ZF0H 2XYAA 1NU9A 2EEKA 5E2PA 1QIXB 2WPMS 1BTWA 4KTCA 3E0PB 3ZZ5A 2BTCE 5DP7A 1DY8A 1PPHE 1IQHA 2IN2A 1TIOA 1BTXA 1C2KA 3A87A 2GMTC 8KME2 1JBUH 1HIAB 3STIA 1KTSB 1FPCH 2FM2A 1AKSA 2A7HA 1MZDA 3GCHC 4O9VA 1C4Y2 1LPKB 2F9UA 3MU4A 4YESB 1LTOA 2Q6FA 1O5DH 2FTMA 1KDQB 1BJVA 2GDDA 5FXLA 3TNSA 1A0JA 2CXVA 1XUJA 2ZC9H 2D26C 3LKWA 3ZZ8A 3ZVDA 3M3TA 1PQAA 1M9UA 1IQLA 1EP6A 5GCHG 1C4U2 1O35A 3RC6A 1HJAC 2EI8A 4FU8A 3SUDA 1GGDC 1EASA 4KP0A 2AERH 3HKIB 1XUKA 1MUEB 1K1LA 1O32A 5A8ZA 2BQ6B 1WQVH 4CR9A 1P05A 1O31A 3QZQA 5C3NA 3RMMH 1AMHA 1W10U 1O3GA 2VH0A 1UVOA 3RXFA 2GMTB 4BXWA 1MKWH 1MTVA 1YCPH 4D9RA 1FPHH 2WPIS 3KHVA 3GCHB 1UHBB 2BD4A 3C27B 1THPB 2SGAA 5CE1A 1QBOA 4KELA 3U8OH 1ZSKA 2BDGA 2FLBH 1L4DA 2OC8A 5K0HA 1ZTJA 1NESE 1QBNA 3S9CA 2C8YB 1OSSA 3UTUH 2Z9GA 1NO9H 1HJAB 1GGDB 1ZTLA 1SGTA 1JMOH 1XVOA 1BZXE 5EW1H 3E3TA 3RM2H 3RP2A 1MCVA 4JYTA 3ESTA 4B1TA 3TH2H 1TGTA 1SG8B 1P2JA 2A5IA 1P2OA 1PPEE 3V3MA 4Y6DA 1C5VA 4CRCA 1C1UH 1XKAC 1NRRH 2VIDA 5GCHF 2H9EH 1GDNA 1IHSH 1V3XA 4JMYA 1T32A 2JH6D 2ZG0H 4TY6A 5DO4H 4I8HA 1TBZH 1ZJKA 1LQDB 1S82A 3TJOA 2AFQB 1ANBA 3BEIB 4VGCC 1P06A 1AI8H 1FAKH 1NTPA 1GHAF 2G55A 1ELTA 2ZGJA 3ZZ7A 1NU7B 5A0AE 3VXEH 1BRBE 1NM6A 4Z6AH 2BY8X 1RJXB 3KGPA 5AVDA 1XM1A 3LOXA 1BMMH 2LNCA 3MH5A 1N1LA 2A5KA 3ZVAA 1A2CH 1EPTA 2BVRH 2ZCHP 4NZQA 1TWXB 3GY3A 5DK1A 2D2DA 1GI8B 1TNLA 4B71A 1TLDA 4CRGA 2FOFA 2C8WB 4DJZB 1IQFA 4FVBA 3BTWE 1T31A 4NG9H 1LKAA 2C90B 2OXSA 1YC0A 2PHBA 3UFAA 4HTCH 4ZHAA 2GCTC 1FDPA 1GDUA 1LKBA 4AOQA 2G4UA 1O5CB 4K8YA 3BTTE 5E8EH 1ARCA 4F4OC 4VGCB 2OBQA 4Q7XA 1C5SA 2G4TA 2SGDE 1DUAA 2AIPA 2FI4E 3A86A 4GLYA 1FMGA 2F9PA 1RTLA 2JH5D 4UD9H 5E2OA 1ZZZA 3U8RH 4RKJB 3A8DA 4LZ4B 4DW2U 1Y5AT 1EATA 3FP8E 2VIOA 1TALA 1QRWA 2GX4A 4X8TH 3SU2A 1QQUA 2WUCA 4ZXYH 1GMDF 3PV4A 2XBYA 4Y71A 1GBFA 3M37A 3WY8A 1MTSA 1TAWA 1W2KH 3BTME 1B5GH 4LZ1H 2PUXB 1VITG 2ZHEH 3H7OA 1BMNH 1DY9A 1OS8A 3TH4H 2WYGA 1DLKB 2GTBA 2BD9A 2VJ1A 4LOYH 1G3EA 1TBRH 2HRVA 3FP7E 3SORA 2J38A 2GCTB 2BD8A 4DY7B 2XXLA 3FZZA 1EKBB 1E34B 2A4GA 1GI0A 4TWYA 3SI4H 5ETXA 3SU5A 4B74A 2TPIZ 1TPSA 4UFEH 1C5OH 1BIOA 1C9PA 3MNBA 3IITA 1TQ0B 1HAIH 2C8ZB 1TNHA 4U30A 3VB4A 1F5RA 2DE8A 1B0EA 4H6SB 2K1QA 2ZPRA 2W3KA 1UTJA 3TK6A 3UWJH 2ANYA 5HMAA 3SJOA 3PMHB 5GDSH 1O3CA 1HLTH 3UR6A 2WINI 5C2ZA 1TRYA 1DSUA 2OINA 2QF0A 4UONA 1F2SE 2R3UA 1SQOA 3SJIA 5CMXH 3SNEA 4SGBE 2QCYA 3T26A 1C5QA 5GPIB 1J9CH 5A09A 1JOUB 2FIRH 2XCFA 1DS2E 2BZ6H 1BTPA 1P2MA 4GCHG 4JYUH 1VITF 2ZU4A 3ATIA 1EZXC 2BQ7B 1MQ5A 3RMOH 1N6YA 1XMNB 5EPYA 3O8BA 2QF3A 1V2PT 2W5EA 3P92A 1Z8RA 1DSTA 1AUJA 1AVWA 2ZGBH 4ASHA 4I33A 1DITH 3T25A 2Z9IA 1FIWA 1FAXA 2VWMA 3NK8A 1F0UA 1O3KA 7GCHG 1NY22 1KLJH 3RC4A 1O2WA 5JYIA 2TBSA 2PW8H 1F0TA 1GJBB 3QK1A 4ABIA 4UDWH 1FI8A 1S83A 3M35A 1TOMH 1K22H 2ZTXA 1NFXA 2AEIH 1UCYK 1NFYA 1RRKA 2W7UA 2Z6BD 1KXBA 1LVMA 2CF8H 2ZECA 1C9TA 1ELBA 1T8NA 1NRSH 2J94A 1Z7KA 1H9HE 4WF8A 3RUOA 1TNIA 2GD4B 5GJ4B 3SHAH 4NWKA 1CVWH 4QT8C 2Y5GA 4ZKOU 1L1GA 5LGOA 1ANEA 2QA9E 2R3YA 1WBGB 3V7TA 4GHTA 4WJG2 4INKA 2BDBA 4Y76A 4CH2B 1AN1E 1HAYB 1O2JA 3RDZA 1PFXC 1C1VH 3UOUA 5EQRA 3A7TA 2B9LA 5EQSA 2BY6X 2UWPA 1SGQE 3M5NA 2ZFPH 4WH6A 1CSOE 4JZ1A 1FY8E 2GV6A 3VB6A 4OS1A 3GY2A 1RIWB 1EXFA 4YM9A 2A45B 5HM2A 1SLWB 4AFQA 7GCHF 4TWWA 1L1NA 1O2YA 4CREA 5A0BA 1P57B 2AH4X 3E1XB 5F8ZA 2GP9B 1WAYB 4YT7H 4AGJA 1LHDH 3BTDE 2BD3A 2J2UA 3Q3KA 2Z9KA 4A7IB 3U98H 2ZU2A 2R2MB 1BITA 1GJ8B 1VZQH 3GY5A 4GVUA 5A0CA 3BSQA 1UTKA 4DOQA 4FUGA 1KXDA 3SNAA 2ALPA 2JETC 1W3CA 2SGFE 4CBNA 3ZYDA 3UNQA 1GJAB 1TA6A 2A2QH 3P95A 3GCNA 5T6GA 1Y3WA 1GG6B 1AD8H 4H4FA 1AY6H 1WOFA 4IMQA 3ZZDA 1C5PA 4WY3A 1Y3VA 1MMJN 2R2WU 1OWIA 2ZDVH 3BEFB 1P3EA 1EOLA 1ANDA 3BF6H 3I29A 5LH8A 2ZDAH 1G3BA 3BG4C 2BM2A 3P8FA 1K9OE 2XC4A 4AFUA 5JBAS 1ZMNA 1MD8A 3GY4A 1OKXA 5C5NA 2A5AA 1Y5UT 4XOJA 2FWWA 2XWBI 1BBRE 1ZMJA 2ANMH 1ELDE 2HLCA 4CHAC 3RXUA 1PJPA 3MFJA 3OY6U 2F9VA 1E37B 2KAIB 3ZZBA 1YLCA 2ESTE 1TNJA 2CF9H 1C5LH 3SV8A 1KTTB 3FANA 3UIRA 3T62A 4UFGH 3TJVA 1QHRB 3ATWA 1ZPZA 1N6XA 3B8JA 1FNIA 1BDAA 1S0RA 3GCOA 4ZKNU 1RTFB 3U9AH 2F9NA 1BT7A 3QGJA 1E35B 1MCTA 2W26A 4ESTE 3MH6A 3E90B 1GI9B 1ELVA 5EXMA 5I46H 2ZKSA 3MWIU 4KTSA 2G51A 1V2QT 3LGYA 4CHAB 1D6WA 1Z8IB 4IBLH 4ZROA 1O0DH 1J8AA 3LT3A 1EZSC 1O2HA 2STBE 3GYMA 3S0NA 1C1RA 1HAPH 2FEQH 3M36A 1P2NA 2A4QA 3KQEA 1TQ7B 4ISLA 4JZDH 4UEHH 1NFWA 1DLEA 1ZPCA 3SJ8A 1CT0E 3RMLH 2ZIQH 2R0LA 1P04A 2AMDA 2ZZUH 1H1BA 3LU9B 2V0BA 2AMQA 3QDZB 5TJXA 2PKSC 1P8VC 4WMFA 1A7SA 3OY5U 2EI7A 1A0HB 3MTYA 1OX1A 3IG6B 2LPRA 1TX8A 2W3IA 4F49A 3RXTA 4X2WA 1C5MD 1SGPE 2PR3A 2VIVA 2ZHQH 1ETSH 1V2JT 2BOHB 1P12E 3U69H 4DGJA 4NFFA 2ZO3H 1C2MA 1BRUP 3GCTG 2GZ7A 1HAOH 3SV6A 3KIDU 1S5SA 2ZU3A 4X6OA 3QTVH 4ZKRU 2SNVA 2BD7A 1CE5A 1QL9A 1O5FH 1OXGA 4LXBH 4TPYA 2A32A 1G2LA 4ISNA 3KQCA 1XXDA 3ZVBA 3RXMA 1NRNH 1PPCE 1OWKA 3E8LA 4WXVA 4YZUA 4I32A 1NROH 1SLXB 1C1MA 2F9OA 3LGVA 5GXPA 3AVZA 1AVGH 2QGRA 1AGJA 2A7JA 5GIBA 3SU0A 1EUFA 2UUFB 3MH7A 2ZFSA 3HK6B 3ZVCA 1EB1H 1MD7A 4U32A 1O3AA 1P9UA 1V2WT 1FN8A 2Y7XA 1P09A 1GWAA 4IW4E 1OWDA 4Q7YA 3NUMA 3UNRA 1D6RA 3PMJA 1Z8JB 1CHGA 2G52A 2PGQB 5AFYH 1RTKA 1A46H 1GCTC 2VIWA 4X1PU 4A1TA 1V2RT 1HAVB 3F68H 1SQAA 1O2TA 1SVPA 2WPHS 3MI4A 1WSSH 5FBIA 5F8TA 5FHTA 1GCDA 1KXFA 1TRNA 3PLPA 2NU1E 2ZPSA 3A82A 1P9SA 2ILNA 3GISB 3NCLA 1UCYE 2ZGXH 4MNXA 1MU6B 2BOKA 3CS7A 1P2KA 2Y5FA
chains in the Genus database with same CATH superfamily
1SQTA 2J4IA 4YOIA 3ZIAD 1C5NH 3DSGA 1Y3YA 3S7HB 1NFUA 1UTPA 2J9NA 1BCUH 1BJUA 1YLDA 4I31A 1KIGH 3VGCB 1NPMA 2XWAA 5EPNA 1SFQB 2FODA 2G00A 1HFDA 1QQ4A 1EB2A 2FS8A 1G3DA 1QA7A 1P3CA 3SUEA 1Y5BT 2ZDKA 1KLIH 2HWLB 1GCTB 2WV5A 1GBCA 1GI4A 1AHTH 4D8NA 1D3DB 3OEHD 4KTUA 1C1QA 1P11E 2D1JA 3EQ0H 1F0RA 1ELGA 1SGIB 3TVJB 4FU9A 1O3HA 2C3SA 1HB0B 2Z9JA 4Q4LA 2A0QB 3OE7D 1O5AB 1MTWA 4K1EA 1VR1H 2I6SA 3W1EA 2OP9A 2WPLS 1V2NT 2TIOA 2YMSB 9ESTA 3SV9A 2OD3B 1C2LA 4RT0A 4D9QA 1TABE 3V13A 1S6FA 1CT4E 3PTBA 1E38B 3BTKE 2EI6A 3QUMP 2F9BH 1GBJA 2XBWA 3P6ZB 2VH6A 2ZA5A 2V35A 2BDAA 1MABB 3BTHE 1O2LA 1SGEE 2FX6A 2STAE 4YLUA 1O3JA 1ZHRA 4TT3D 4K69A 1BA8B 3SGQE 1A61H 2FOCA 2XNDD 1TOCB 3MYWA 1FY5A 2OBOA 4AX9H 2VVVA 4TSFD 4Y11E 1GJ4H 3LGUA 1LPGB 4M9FA 2D8WA 1BHXB 1CGJE 2PKAA 3O8DA 3UWIA 4X6PA 1ZRKA 2B8OH 3F1SB 2OLGA 1KLTA 4ISHH 2BLQA 3M7TA 1LVOA 6GCHG 2QY0B 4DURA 2BY9X 3GDUA 1NS3A 4I8GA 2FOAA 4Y0ZE 1GHWH 4H42U 5EU8A 5LPFA 1GVLA 1GI2A 3RXEA 4AB9A 3OU0A 2RG3A 1RS0A 2FS9A 1CHOG 1GDQA 3A85A 1DWEH 4AFSA 2Z3EA 3URDA 1O3OA 4NFEA 1TPAE 5J4QA 1HYLA 4MQAA 1GHBG 1IQIA 1TX7A 2FXRA 3N7OA 4BTTB 2PFEA 1L4ZA 3MU1A 4AYVB 2OQUA 5PTPA 3SZEA 5EJLA 2SGPE 2ZWLH 2I6QA 3HGNA 2AGIX 4NA7A 3NKKA 3FFGA 2PWXA 3K2UA 1BTZA 2PP6A 2FO9A 3UR9A 1AKSB 3MNXA 2TGAA 2F3CE 4IS5A 2ZDNA 4X2VA 3M3VA 3P8NA 2ZFRH 2ZGHA 5T6FA 6GCHF 1AFQC 1AO5A 1K28D 1EOJA 2G8TA 1G36A 1FXYA 4YOGA 3SU1A 3SU3A 1YPEH 1W0ZU 2P3FH 3ZZ4A 1KYNA 2VNTA 2ZU1A 1SC8U 3T5FH 4K3JA 5DP3A 2VB0A 1SI5H 2ZHWH 3FZDA 1DFPA 3ZVGA 3KEEA 4FVDA 4M7GA 3P70B 5T1VA 4ABEA 4NIVA 1L1JA 1Y3XA 4BAQB 4FUCA 4AZ2B 4AGKA 2ZHFH 3BIVH 1HJ9A 4DIIH 2O8MA 1FJSA 4YTAA 4NSVA 4HFPB 3RU4E 1C1OA 1W0JD 1QRXA 4AG2A 5FPYA 2WZQA 4FUDA 1NC6A 2XBVA 3HGPA 4XBDA 1C1WH 1QJ1B 1FLEE 1GBIA 1K1OA 4UFFH 3SQHE 1V2TT 3MU5A 4TYDA 2NU2E 2ODPA 4Q63A 1CGHA 3F2HA 3BV9B 1HXEH 1ZMLA 1FZZA 2BLVA 3TU7H 2KFWA 1AFQB 2FTLE 4I8JA 3VB7A 5I25A 2RCEA 3SO3A 3SUGA 1LMWB 1IHTH 4PROA 2WV4A 4FUHA 1PYTD 4X8SH 1G3CA 1SLUB 3A81A 3KCGH 5C17A 1C2GA 1G37A 2FP7B 1ELAA 4TY7A 6CHAB 2KM0A 1PQ7A 2PTNA 5FX5A 4ZKSU 2BB4A 1A1RA 2ZEBA 1E79D 1F5KU 4WVPE 2DE9A 1O2VA 5EXLA 3NPSA 4XBCA 3TJNA 3KL6A 3KYGA 1TMTH 1OP0A 2YNBA 4MLFB 3SZNA 3KYFA 1Q3XA 5FCKA 4A6LA 2JIZD 3B23B 3RM0H 2J95A 2OCVB 2GZ9A 5T3HA 2BX3A 5IDKA 1HJ8A 5FX6A 1FN6A 1GBHA 2ALVA 3BEUA 5J4SA 3RXAA 3U1JB 5FPTA 3M61U 3TK9A 1L0ZA 1TMUH 1GBEA 3A89A 3RXDA 2GGVB 4B6EA 1VJ9U 2H9HA 4OS7A 1SGCA 1QBVH 1GL1A 3MO6A 2C4FH 5HGGA 4BTUB 1FQ3A 1Z8GA 3L3TA 3SGAE 1EPTB 3FAOA 4NA8A 3LC5A 3B9FH 4OGXA 1GI1A 2YOLA 3UNSA 1SL3A 2HGTH 1RIWC 1DDJA 2P3UB 2BHGA 3MNCA 5EJ1A 1D4PB 3GY6A 2LP6A 1YLNA 1O36A 1QTFA 1QY6A 3Q77A 4MDSA 1DWCH 1OPHB 3HATH 1FV9A 1GBBA 4NIWA 2J98A 4K8BA 3M5LA 3QTOH 5E0HA 2HOBA 4IGDA 2WV9A 3RXBA 3BTGE 3EAJA 4NIXA 4ABDA 2YMSD 2VIQA 3VPKA 2BD2A 4ZHLU 1CGIE 4WXIA 3UPEA 1DANH 1LHFH 2PV9B 2FOBA 1TBQH 3BTEE 2CV3A 2A4RA 4GCHF 2BVSH 4FETA 3WW7A 2HALA 2GCHG 1GG6C 1HGTH 4GUXA 1S85A 4Z1MD 3A83A 1VCWA 1YCPM 5L30H 1TE0A 1V2OT 1VCQA 1DT2A 2QN5T 1ZPBA 4RI0A 1HAGE 2FYQA 2NWNA 2XC0A 1TPPA 4MPWA 1WV7H 3VB5A 2ZU5A 4WH8A 5C67A 3M3SA 4RSPA 1H4WA 1O34A 4LK4A 3MU8A 2GDEH 1N8OC 1FIZA 1YPGH 1OWEA 2A4OA 2BDHA 4MNWA 3F9FA 3GS9A 1H8DH 3D65E 3SUFA 1H9LB 3R3GB 3LGTA 1ZOMA 2P16A 1C1PA 3RLWH 4SGAE 3DUXH 5LPRA 1GMCG 1C1TA 2BXTH 2W6ID 3BG8A 4X1RU 8GCHG 1TGNA 2CHAB 3PWCA 4AG1A 2PUQH 4B2BA 1VGCB 2Z9LA 1C5YB 5FBEA 1CA0C 1AWFH 1P0SH 3A84A 1Z71A 4KGAA 3SU6A 1CBWC 4BAKB 5JBBS 3GDVA 3A80A 2R9PA 4A1XA 2RDLA 1XUFA 1K2I1 4R0IA 3SI3H 4ABJA 4JK6A 1AE8H 2LELA 1B7XB 3QGNB 4F55A 2O9QA 5E0GA 1YPKH 3QX5H 2JJ2D 2PGBB 3QWCH 1Y59T 1CU1A 1QNJA 3SNBA 5BRRE 1V2KT 1S6HA 3SQEE 1ABJH 2ZCKP 1DXPA 1SPJA 2TRMA 5CHAC 3NRLA 1VCPA 1ESBA 2BY5X 2GCHF 3BTQE 2P59A 1BRCE 2XRCA 5IYTA 1KXAA 3L6PA 7ESTE 1N8OB 3GY8A 1PPBH 1SGFA 3ZV8A 2VVCA 1O2UA 3SBKA 4TPIZ 2ZI2H 3SJKA 1QRZA 5B6OA 2A1DB 2VINA 4INHA 4K2YA 1AWHB 3Q3XA 1VJAU 2FOEA 4ISIH 1CA0B 1FY3A 1RFNA 1CBWB 1O3NA 2BDIA 1C1NA 1P10A 3F9HA 2ZHDA 1DWDH 1GPZA 2IPHA 3LONA 2OK5A 3A88A 1THSH 4HZHA 2WUBA 1GI7B 1H8IH 2SGQE 3PM3A 4ABGA 8GCHF 2P8OC 4FUBA 3K65B 1O2MA 2IJOB 5C1XA 1IQNA 1WU1A 3P17H 1GHZA 2UUKB 1WYKA 5CHAB 1F92A 1PPZA 1FONA 1HIAA 1T7CA 2QF5A 1Z6JH 1DOJA 3RXIA 3K6YA 2FI3E 1AQ7A 1ESAA 4DIHH 1H8ED 2B0FA 3S7KB 1XUHA 1KDQA 1LHCH 1YM0A 1K0HA 1GJDB 2BLOA 3F6UH 1YPLH 1WCZA 3SN8A 2QF4A 1G2MA 3JZ1B 5DN6D 3M7UA 3DA9B 2ODYB 1EP5A 1S81A 1YBWA 3JZ2B 4HI3A 1C1SA 4K1SA 4BAHB 1JIRA 2M2AA 3F0PA 4E05H 1ESTA 3T27A 2PLXA 1ID5H 1GBLA 1D9IA 4Y8ZA 2GV7A 1D3PB 4MNYA 1VITH 1CT2E 1C5RA 4BAOB 2P8OB 5HIYA 2M5TA 1O2ZA 2GKVE 5E0JA 4AYYB 2WPKS 2Y6TA 4ABBA 5C20A 3CS0A 3PWBA 2XC5A 3HPTB 1QZ8A 3KF2A 5F6MA 2AHME 4Q2KA 1O3PB 1HAZB 5AF9H 1FY4A 5AFZH 1GMHG 4NGAH 1PYTC 5L6NH 1UHBA 4XD7D 2HVYB 4MPXA 1O5EH 1GL0E 4X2XA 2O8LA 3FVFB 4Y10E 3BN9A 2AIQA 1UVPA 1DE7H 1GHYH 4YO9A 1ZHMA 2XTTB 1DVAH 1GJCB 1K1JA 3UUZA 4O97A 1Z6EA 4O3UA 1J15A 3PMAB 1SKYE 1C5XB 1V2UT 2EC9H 1GJ6A 1SGDE 4ZXXH 2NU3E 1ANCA 2IPQX 1O37A 1ZTKA 1MQ6A 1QB6A 3I77A 5DSFA 4A1VA 1MBMA 1WTHD 1WUNH 3BTFE 5F8XA 4NZLA 2FESH 2FOHA 2CN0H 2Z94A 3RXVA 4FUEA 1NZQH 2IJD1 7KMEH 1MAYA 1NN6A 1SFIA 2Y7ZA 1ELCA 4RN6A 3UOPA 1OP8A 5H4IB 1EAWA 3E6PH 1PPFE 1V2ST 2V3HH 2QC2A 3OFND 1T8LA 4GPGA 3A7VA 5DP9A 3GICB 2JH0D 4YXWD 2G5NA 1BMAA 2ZPQA 1ZLRA 3VGCC 1UK3A 2O8UA 4D7FA 2QXJA 5DP5A 2OTVA 2FOGA 2ZFQH 1ELFA 3UQVA 3ZVEA 1GI6A 5JBTA 1LQEA 1MKXK 4E7NA 1SGNE 2GVFA 2V6NA 3LIWA 3Q76A 3GCTF 1ZHPA 2GT8A 1GHXH 2XCNA 1HAHH 2Z3CA 3KQ5A 1OYTH 1O2PA 3QLPH 1OOKB 1V2VT 3BIUH 3PRBA 4Y8XA 1QL7A 2Q6GA 1ZGIA 4AB8A 1MTUA 2FLRH 3OSYA 2YMSC 1E1QD 1MZAA 1TGSZ 2VIPA 4GSOA 1GI3A 1HPGA 1O3BA 2BDYA 4HG6A 2JJ1D 4IN1A 4Y8YA 6LPRA 3E0NB 1F7ZA 1O3FA 1YPJH 4R8TB 3TJUA 3STJA 1X7AC 3W95A 1SGRE 1QJ6B 2TGTA 4MPVA 1CO7E 3KN2A 1E36B 2ZTZA 3QZRA 1ETRH 5AHGH 4FUJA 1TNGA 3MOCA 1TA2A 3NZIA 1SHHB 3PLKA 4CR5A 4E7RG 3MH4A 1JIMA 4X1NU 2HNTE 3QN7A 2IOTA 1DWBH 3AASA 2VWOA 1SR5C 3DT0H 3RLYH 4WMEA 1COWD 1LO6A 4KKDA 4JZFH 1OWJA 2ZCLP 3ZZAA 3F3BA 1O3DA 4AORA 4ZMAH 4OS2A 3P8OA 3GOVB 3NXPA 1A5HA 1TX6A 4Y79A 5EGMA 3V0XA 4BXSA 3S9AA 2Z3DA 5FCRA 1A0LA 3A8CA 3RXHA 1MH0A 2KR7A 1TB6H 4A5TS 1GHVH 1IQMA 3GDSA 4BANB 1HUTH 2BZAA 5HYOA 1AU8A 1GHAG 3HKJB 4YOJA 2ZP0H 4ZH8A 3RXSA 3SU4A 3OEED 3D62A 5C0UA 3SGBE 1SQRA 1T4UH 3PYHA 5ABWA 4Z0KA 1K1MA 3LPRA 3A7XA 1ZGVA 3I78A 1Y8TA 4UE7H 1EAUA 4IC6A 4XSKU 1G9IE 1Q2WA 4JZIA 1T4VH 1TYNA 5L2ZH 1C2FA 2TGDA 1E0FD 1AUTC 1UK4A 3A8BA 2CMYA 3PLBA 3LDXH 5FAHA 1BHXF 2FPZA 2V3MA 2B7DH 1BTYA 1ZYOA 3LC3A 1SHYA 2UWOA 2ASUB 2H9TH 5SGAE 3TH3H 2VGCC 1YF4A 1A5IA 1O2KA 3TNTA 4JCNA 1LHGH 1NRQH 3LH1A 4P02A 2Y82A 3C1KA 2HPPH 3A7YA 4NIYA 1HV7A 4XBBA 3K6ZA 1UTQA 2QE7D 2C93B 3QO6A 3TGIE 2F91A 2AGEX 1BUIA 1W7XH 2OC7A 2HVXA 4B2CA 3ODDA 3EA9A 2Y5HA 2BYAX 3KQBA 3T29A 3DFLA 3PROA 3HK3B 1GMDG 1YPHE 4ZUHA 1D3TB 3EE0B 1O2RA 1CA8B 2CGAA 1V6DA 2H6MA 3OX7U 4ABAA 2F83A 1BBRK 1EFRD 4IMZA 1T8OA 4MVNA 4DT7B 2Z7FE 3G01A 3ZYEA 1QB9A 4XE4A 3ZZ6A 1K1IA 2ZFFH 2O8TA 4B2AA 1EAIA 3T2NA 1W14U 1BB0B 2BDCA 4OS6A 5FL7D 4I7YH 1IQKA 2VGCB 3ATLA 4Y7BA 3SJ9A 5DKMA 3U8TH 2ZFTA 3RU4D 3SOSA 1A4WH 1TMBH 3TPIZ 4OS4A 4NWLA 2NU0E 1UO6A 3ODFA 3D23A 4JYVH 2ZDLA 3S9BA 6ESTA 3LJJA 1H8HD 3M5MA 1HNEE 1QGFA 4O3TA 1TFXA 2VVUA 5C94A 1J16A 4FUIA 2P93A 1QFKH 5DPAA 1QR3E 4NCYA 4MPUA 5JBCS 1IQGA 1EAXA 4J1YA 4X8VH 1CHOF 2XBXA 6CHAC 3KNXA 2CJIA 1P01A 3PB1E 1K21H 2XNIA 1Q31A 1G32B 2WPJS 5DP6A 1NRPH 1SMFE 1AIXH 1UVUH 1MKXH 3FOAA 4B76A 3H5CB 2QIQA 2FZZA 1JRTA 8ESTE 3A7ZA 4MTBA 1RXPA 3ATKA 5ESTE 1W11U 5JPMH 1DX5M 1GHBF 1ZSLA 3LJOA 1Y3UA 1AB9C 2Q6DA 3E91A 4CBOA 1O30A 4MNVA 4X1SU 3VEQB 1A5GH 1QB1A 2SFAA 2OC0A 1P02A 1QCPA 1W13U 2WHXA 3O8CA 1C2HA 1O2GH 4X6MA 5GWZA 5HXFA 4YT6H 1KY9A 1BQYA 2WYJA 1UTNA 3RXJA 1D3QB 3EDXB 3NWUA 2GZ8A 2H1UA 4DT4A 1DPOA 1XVMA 3TIUA 4Q80A 4INLA 5C1UA 1Z1IA 2P95A 2B5TB 3F9GA 1GBDA 5JDUB 3MU0A 2SGEE 1EPTC 2ZDMA 3URCA 1WXRA 3AAUA 4CRFA 1LDTT 3MO9A 1AVXA 2OC1A 4CRAA 3R0FA 2AYWA 4DVAU 4X8UH 1ZJDA 2QYIA 4X6NA 1FY1A 2EQNA 2PTCE 3FP6E 2CK3D 2L6OA 2KCYA 3MHWU 1SOTA 2PKAB 1NBMD 1QA0A 2Q1JA 4WMDA 2TGPZ 1AB9B 1O2QA 4GHQA 2BY7X 3U1IB 1XKBC 3RXQA 2HNTC 1JXPA 3UY9A 1TRMA 9LPRA 5A8YA 1UTOA 2QV1A 3LGIA 3ATMA 4FU7A 1P2IA 1C4V2 4HGCA 3RXPA 3GYLB 1EX3A 1RGQA 1SSXA 2KAIA 3ELAH 3A8AA 3DD2H 1KXCA 4BNRA 1O3LA 3AW0A 1WTGH 2FYRA 2C8XB 3ZZ3A 1TONA 2JKHA 2AMPA 4X0WU 2WPDD 5JB9S 3VFEA 1U6QA 3RXGA 1PQ8A 1ETTH 1NBME 3EGKH 4ABFA 3SV2H 1YP9A 1BRAA 1Z1JA 1UTMA 3Q3YA 3RMNH 4XFQA 1YKTA 1DM4B 5B6LA 2FX4A 4JK5A 3MO3A 1IOEA 1W7GH 4D76A 2FOMB 1QL8A 2Y81A 1JRSA 3RXKA 2HNTF 2W7SA 2CHAC 2Y80A 1THRH 1VGCC 4THNH 3VXFH 2ZQ2A 3F9EA 2HPQH 1XUGA 4XDEA 2ZNKH 3CENA 4E06H 3OTJE 3W94A 1L2EA 3RXLA 5BPEA 4BOHA 1BOQA 2SNWA 2H2ZA 3TK5A 2KCOA 1DXWA 1BBRH 1TNKA 2FI5E 2ZQ1A 3ZVFA 1HRTH 4NA9H 2H5CA 4Q7ZA 5CHBA 2QXGA 3TLOA 5T6DA 3ZZ9A 1OWHA 1GJ7B 1SBWA 1TGCA 3LGWA 1O3EA 2ULLA 2OUAA 4A92A 4ISOA 1KSNA 4U2WA 5DJ7A 1A3BH 1W12U 3P8GA 4BAMB 4NSYA 1S84A 2G5VA 3DHKH 1LCYA 4CRDA 4K60A 1ARBA 2BD5A 1EJNA 1YPHC 3A7WA 2PSYA 1O39A 4GAWA 4Y0YE 3TITA 1HAXB 4H6TA 4ZHMU 1HXFH 5K7RA 1C2IA 1C5ZB 1GI5A 2A2XH 1F5LA 1UTLM 1MAXA 1HBTH 1OHHD 5C1YA 2DUCA 1ZR0A 2KX4A 4J2YB 1GJ5H 3MNSA 4ZAEA 2RA3A 3AAVA 2VWLA 1YYY1 1GVZA 3PTNA 1XX9A 2P3TB 3UAIC 2R0KA 1MTNC 5LPEA 1HCGA 3LH3A 3SNCA 1FUJA 3TGKE 3UQOA 1C2EA 1XXFA 4UFDH 1QJ7B 2ZGCA 1O5GH 2V3OH 3KQDA 4X2YA 3ZV9A 1H9IE 1UVSH 1AE5A 3V12A 5EOKA 1P2QA 3UREA 1QURH 4OS5A 1GBTA 1UVTH 4RKOB 3H7TA 2EA3A 8LPRA 1OYQA 5EQQA 4K1TA 5DG6A 2ZTYA 2THFB 4I8KA 1PQ5A 1O2SA 2ANWA 5HIZA 2A31A 1YWUA 1GBKA 1GMCF 3EA8A 3PO1C 3AW1A 1HAVA 1EZUC 3D49H 1W8BH 5TCCA 1TGBA 1YGCH 2OQ5A 2BVXH 3SW2B 2JETB 2P94A 1MTNB 1XUIA 2BX4A 3ITIA 2GT7A 2J92A 5KEDA 1JWTA 4WWYA 3RXRA 4D7GA 1WQSA 2XW9A 1F0SA 1IAUA 3EYDA 1MKWK 5EG4A 1YCPK 1K1PA 3F2FA 1AZZA 3RXOA 1GVKB 2YNAA 3N7DA 1AFEH 3L33A 5C5OA 2J98B 3GY7A 2UUYA 2BQWB 1KMHB 5F03A 2PSXA 5DGJA 1MU8B 1O2NA 3BG4B 1NT1A 2FDAA 3SNDA 1DICA 3TGJE 3CP7A 1G30B 1P03A 1C5UA 1O5BB 1SGYE 1ACBE 1C2DA 1UMAH 3IWMA 2F43B 4FUFA 7LPRA 2QAAA 1BTHH 2QXHA 4IC5A 3PO1B 2A7CA 2H5DA 4B73A 1LVBA 3MMGA 1T8MA 1O2XA 4O03A 1CQQA 1TPOA 1ELEE 1ZRBA 1UK2A 3PMBB 2QXIA 1SGFG 2VU8E 1J14A 4AN7A 1AZ8A 3OYPA 5DP4A 3EA7A 4DCDA 2NU4E 4K5ZA 2BLWA 4BTIB 1EZQA 1EJAA 3Q00A 3RXCA 5EXNA 1A3EH 2G81E 3RC5A 5ESBA 2ANKH 4MG3A 3SHCH 1O2IA 1B0FA 1ZSJA 3RU4T 3VB3A 2BMGB 1K1NA 1UCYH 5EODA 5G4BA 3ENSB 2J34A 4I8LA 4YLQH 1PPGE 1RD3B 3M5OA 3S69A 4B6FA 1MBQA 1S0QA 2UWLA 5GNDA 2KCAA 1BTUA 5TCAA 1OP2A 1GBMA 5JB8S 1O38A 1IQJA 1SLVB 3PV5A 4IN2A 3PRDA 1HDTH 5L2YH 1EQ9A 1LHEH 1SB1H 4B75A 4ASUD 1J17T 2AS9A 3E16B 1IQEA 5A8XA 4CRBA 1O3IA 2ODQA 3T28A 4AFZA 1UJ1A 2PKSB 3O8RA 1GBAA 1ABIH 1LPZB 1INCA 5A2MH 1O2OA 1SOZA 4DG4A 1EJMA 3K9XB 1DUEA 1BMLA 2RFKC 2FMJA 2RA0A 5FPSA 1W0YH 1C5WB 4FXGH 4Y7AA 3DFJA 1LVYA 4OGYA 4CH8B 1GMHF 3M7QA 1O3MA 5DP8A 5EW2H 4U01A 4X1QU 1V2MT 3SV7A 3ZZCA 1C5TA 2O8WA 2AGGX 2BXUH 1YPMH 5HM9A 4ABHA 1V2LT 1C2JA 1GJ9B 1ORFA 2UUJB 2VWNA 1KXEA 1O33A 4JZEH 1WDIA 2ZF0H 2XYAA 1NU9A 2EEKA 5E2PA 2WSSD 1QIXB 3CNRA 2WPMS 1BTWA 4KTCA 3FN8A 3E0PB 3ZZ5A 2BTCE 5DP7A 1DY8A 1PPHE 1IQHA 2IN2A 1TIOA 1BTXA 1C2KA 3A87A 2GMTC 8KME2 1JBUH 1HIAB 3STIA 1KTSB 1FPCH 2FM2A 3F2GA 1AKSA 2A7HA 1MZDA 3GCHC 4O9VA 1C4Y2 1LPKB 2F9UA 3MU4A 4YESB 1LTOA 2Q6FA 1O5DH 2FTMA 1KDQB 1BJVA 2GDDA 5FXLA 3TNSA 1A0JA 2CXVA 1XUJA 1W0KD 2ZC9H 2D26C 3LKWA 3ZZ8A 3ZVDA 3M3TA 1PQAA 1M9UA 1IQLA 1EP6A 5GCHG 1C4U2 1O35A 3RC6A 1HJAC 2EI8A 4FU8A 3SUDA 1GGDC 1EASA 4KP0A 2AERH 3HKIB 1XUKA 1MUEB 1K1LA 1O32A 5A8ZA 2BQ6B 1WQVH 4CR9A 1P05A 1O31A 2F4LA 3QZQA 5C3NA 3RMMH 1AMHA 1W10U 1O3GA 2VH0A 1UVOA 3RXFA 2GMTB 3FO8D 4BXWA 1MKWH 1MTVA 1YCPH 4D9RA 1FPHH 2WPIS 3KHVA 3GCHB 1UHBB 2BD4A 3C27B 5EJZA 1THPB 2SGAA 5CE1A 1QBOA 4KELA 2XOKD 1ZSKA 3U8OH 2BDGA 2FLBH 1L4DA 2OC8A 5K0HA 1ZTJA 1NESE 1QBNA 3S9CA 2C8YB 1OSSA 3UTUH 2Z9GA 1NO9H 1HJAB 1GGDB 1ZTLA 1SGTA 1JMOH 1XVOA 1BZXE 5EW1H 3E3TA 3RM2H 3RP2A 1MCVA 4JYTA 3ESTA 4B1TA 3TH2H 1TGTA 1SG8B 1P2JA 2A5IA 1P2OA 1PPEE 3VG8A 3V3MA 4Y6DA 1C5VA 4CRCA 1C1UH 1XKAC 1NRRH 2VIDA 5GCHF 2H9EH 1GDNA 1IHSH 1V3XA 4JMYA 1T32A 2JH6D 2ZG0H 4TY6A 5DO4H 4I8HA 1TBZH 1ZJKA 1LQDB 1S82A 3TJOA 2AFQB 1ANBA 3BEIB 4VGCC 1P06A 2J5UA 1AI8H 1FAKH 1NTPA 1GHAF 2G55A 1ELTA 2ZGJA 2V7QD 3ZZ7A 1NU7B 5A0AE 3DSPA 3VXEH 1BRBE 1NM6A 4Z6AH 2BY8X 1RJXB 3KGPA 5AVDA 1XM1A 3LOXA 1BMMH 2LNCA 3MH5A 1N1LA 2A5KA 3ZVAA 1A2CH 1EPTA 2BVRH 2ZCHP 4NZQA 1TWXB 2KZ4A 3GY3A 1S6LA 2RDEA 5DK1A 2D2DA 1GI8B 1TNLA 4B71A 1TLDA 4CRGA 2FOFA 2C8WB 4DJZB 1IQFA 4FVBA 3BTWE 1T31A 4NG9H 1LKAA 2C90B 2OXSA 1YC0A 2PHBA 3UFAA 4HTCH 4ZHAA 2GCTC 1FDPA 1GDUA 1LKBA 4AOQA 2G4UA 1O5CB 4K8YA 2JDID 3BTTE 1ARCA 5E8EH 4VGCB 4F4OC 2OBQA 4Q7XA 1C5SA 2G4TA 2SGDE 4P00A 1DUAA 2AIPA 2FI4E 3A86A 4GLYA 1FMGA 2F9PA 1RTLA 2JH5D 4UD9H 5E2OA 1ZZZA 3U8RH 5IK2D 4RKJB 3A8DA 4LZ4B 4DW2U 1Y5AT 1EATA 3FP8E 2VIOA 1TALA 1QRWA 2GX4A 4X8TH 3SU2A 1QQUA 2WUCA 4ZXYH 1GMDF 3PV4A 2XBYA 4Y71A 1GBFA 3M37A 3WY8A 1MTSA 1TAWA 1W2KH 3BTME 1B5GH 4LZ1H 2PUXB 1VITG 2ZHEH 3H7OA 1BMNH 1DY9A 1OS8A 3TH4H 2WYGA 3UB0A 1DLKB 2GTBA 4F48B 2BD9A 2VJ1A 4LOYH 1G3EA 1TBRH 2HRVA 3FP7E 3SORA 2J38A 2GCTB 2BD8A 4DY7B 2XXLA 3FZZA 1EKBB 1E34B 2A4GA 1GI0A 4TWYA 3SI4H 5ETXA 3SU5A 4B74A 2TPIZ 1TPSA 4UFEH 1C5OH 1BIOA 1C9PA 3MNBA 3IITA 1TQ0B 1HAIH 2C8ZB 1TNHA 4U30A 3VB4A 1F5RA 5CDFE 4ZCNA 2DE8A 1B0EA 4H6SB 2K1QA 5EIYA 2ZPRA 2W3KA 1UTJA 3TK6A 3U28C 2ANYA 3UWJH 5HMAA 3SJOA 3PMHB 3F0OA 5GDSH 1O3CA 1HLTH 3UR6A 2WINI 5C2ZA 1TRYA 1DSUA 2OINA 2QF0A 4UONA 1F2SE 2R3UA 1SQOA 3SJIA 5CMXH 3SNEA 4SGBE 2QCYA 3T26A 1C5QA 5GPIB 1J9CH 5A09A 3DSOA 1UW7A 1JOUB 2FIRH 2XCFA 1DS2E 2BZ6H 1BTPA 1P2MA 4GCHG 4JYUH 4FOUC 2J97A 1VITF 2ZU4A 3ATIA 1EZXC 2BQ7B 1MQ5A 3RMOH 1N6YA 1XMNB 5EPYA 4XRNA 3O8BA 2QF3A 1V2PT 2W5EA 3P92A 1Z8RA 1DSTA 1AUJA 1AVWA 2ZGBH 4ASHA 4I33A 1DITH 3T25A 2Z9IA 1FIWA 1FAXA 2VWMA 3NK8A 1F0UA 1O3KA 7GCHG 1NY22 1KLJH 3RC4A 1O2WA 5JYIA 2TBSA 5C0TA 2PW8H 3OAAD 1F0TA 1GJBB 3QK1A 4ABIA 2L74A 4UDWH 1FI8A 1S83A 3M35A 1TOMH 1K22H 2ZTXA 1NFXA 2AEIH 1UCYK 1NFYA 1RRKA 2W7UA 2Z6BD 1KXBA 1LVMA 2CF8H 2ZECA 1C9TA 1ELBA 1T8NA 1NRSH 2J94A 1Z7KA 1H9HE 4OM9A 4WF8A 1TNIA 3RUOA 2GD4B 5GJ4B 3SHAH 4NWKA 1CVWH 4QT8C 2HLDD 2Y5GA 4ZKOU 1L1GA 5LGOA 1ANEA 2QA9E 2R3YA 1WBGB 3V7TA 4GHTA 4WJG2 4INKA 2BDBA 4Y76A 4CH2B 1AN1E 1HAYB 1O2JA 3RDZA 1PFXC 1C1VH 3UOUA 5EQRA 3A7TA 2B9LA 5EQSA 2BY6X 2UWPA 1SGQE 3M5NA 2ZFPH 4WH6A 1CSOE 4JZ1A 1FY8E 2GV6A 3VB6A 2EY4C 4OS1A 4ACBA 3GY2A 1RIWB 1EXFA 3DCLA 4YM9A 2A45B 5HM2A 1VKYA 1SLWB 4AFQA 7GCHF 1E1RD 4TWWA 1L1NA 1O2YA 4CREA 5A0BA 1P57B 2AH4X 3E1XB 5F8ZA 2GP9B 3N7EA 1WAYB 4YT7H 2K0QA 1LHDH 3BTDE 4AGJA 2BD3A 2J2UA 3Q3KA 2Z9KA 4A7IB 3U98H 2ZU2A 2R2MB 1BITA 1GJ8B 1VZQH 3GY5A 4GVUA 5A0CA 3BSQA 1UTKA 3SYJA 4DOQA 4FUGA 1KXDA 3SNAA 2ALPA 2JETC 1W3CA 2SGFE 4CBNA 3ZYDA 3UNQA 1GJAB 1TA6A 2A2QH 3P95A 3GCNA 3EE7A 5T6GA 1Y3WA 1GG6B 1AD8H 4H4FA 1AY6H 1WOFA 4IMQA 3ZZDA 1C5PA 3WWBA 3OTPA 4WY3A 1Y3VA 1MMJN 2R2WU 1OWIA 2ZDVH 3BEFB 1P3EA 1EOLA 1ANDA 3BF6H 3I29A 5LH8A 2ZDAH 1G3BA 3BG4C 2BM2A 3P8FA 1K9OE 2XC4A 4AFUA 5JBAS 1ZMNA 1MD8A 3GY4A 1OKXA 3WWFA 5C5NA 2A5AA 1Y5UT 4XOJA 2FWWA 2XWBI 1BBRE 1ZMJA 2ANMH 1ELDE 2HLCA 4CHAC 3RXUA 1PJPA 3MFJA 3OY6U 2F9VA 1E37B 2KAIB 3ZZBA 1YLCA 2ESTE 1TNJA 2CF9H 5F53A 1C5LH 3SV8A 1KTTB 3FANA 3UIRA 3T62A 4UFGH 3TJVA 1QHRB 1BMFD 3ATWA 1ZPZA 1N6XA 3B8JA 2GJGA 1FNIA 1BDAA 1S0RA 3GCOA 4ZKNU 3N99A 1RTFB 3U9AH 5HKKD 2F9NA 1BT7A 3QGJA 1E35B 1MCTA 2W26A 4ESTE 3MH6A 3E90B 1GI9B 1ELVA 3H09A 5EXMA 5I46H 2ZKSA 3MWIU 4KTSA 2G51A 1V2QT 3LGYA 4CHAB 1D6WA 1Z8IB 4IBLH 4AC9A 4ZROA 1O0DH 1J8AA 3LT3A 1EZSC 1O2HA 2STBE 3GYMA 3S0NA 1C1RA 1HAPH 2FEQH 3M36A 1P2NA 2A4QA 3KQEA 1TQ7B 4ISLA 4JZDH 5KECA 4UEHH 1NFWA 1DLEA 1ZPCA 3SJ8A 1CT0E 3RMLH 2ZIQH 2R0LA 1P04A 2AMDA 2ZZUH 1H1BA 3LU9B 2V0BA 2AMQA 3QDZB 5TJXA 2PKSC 1P8VC 4WMFA 1A7SA 3OY5U 2EI7A 1A0HB 3MTYA 1OX1A 4I86A 3IG6B 2LPRA 1TX8A 2W3IA 4F49A 3RXTA 4X2WA 1C5MD 1SGPE 2PR3A 2VIVA 2ZHQH 1ETSH 1V2JT 2BOHB 1P12E 3U69H 4DGJA 4NFFA 2ZO3H 1C2MA 1BRUP 3GCTG 2GZ7A 1HAOH 3SV6A 3KIDU 1S5SA 2ZU3A 4X6OA 3QTVH 4ZKRU 2SNVA 2BD7A 3MQKC 1CE5A 1QL9A 1O5FH 1OXGA 4LXBH 4TPYA 2A32A 1G2LA 2W6JD 4ISNA 3KQCA 1XXDA 3ZVBA 3RXMA 1NRNH 1PPCE 1OWKA 3E8LA 4WXVA 4YZUA 4I32A 1NROH 1SLXB 1C1MA 2F9OA 3FKSD 3LGVA 5GXPA 2KCPA 3AVZA 1AVGH 2QGRA 1AGJA 2A7JA 5GIBA 3SU0A 1EUFA 2UUFB 3MH7A 2ZFSA 3HK6B 3ZVCA 1EB1H 1MD7A 4U32A 1O3AA 1FX0B 1P9UA 3PV2A 1V2WT 1FN8A 2Y7XA 1P09A 4RT1A 1GWAA 4IW4E 1OWDA 4Q7YA 3NUMA 3UNRA 1D6RA 3PMJA 5KGOA 1Z8JB 1CHGA 2G52A 2PGQB 5AFYH 3AK5A 1RTKA 2VBCA 4ACAA 1A46H 1GCTC 2VIWA 4X1PU 4A1TA 1V2RT 1HAVB 3F68H 1SQAA 1O2TA 1SVPA 2WPHS 3MI4A 1WSSH 1YY3A 5FBIA 5F8TA 5FHTA 1GCDA 1KXFA 1TRNA 3PLPA 2NU1E 2ZPSA 3A82A 1P9SA 2ILNA 3GISB 3NCLA 1UCYE 2ZGXH 4MNXA 2K8IA 1MU6B 2BOKA 3CS7A 1P2KA 2Y5FA
chains in the Genus database with same CATH topology
1SQTA 2J4IA 4YOIA 3S7HB 1C5NH 1Y3YA 1NFUA 1UTPA 2J9NA 1BCUH 1BJUA 1YLDA 4I31A 1KIGH 3VGCB 1NPMA 2XWAA 5EPNA 1SFQB 2FODA 2G00A 1HFDA 1QQ4A 1EB2A 2FS8A 1G3DA 1QA7A 1P3CA 3SUEA 1Y5BT 2ZDKA 1KLIH 2HWLB 1GCTB 2WV5A 1GBCA 1GI4A 1AHTH 4D8NA 1D3DB 4KTUA 1C1QA 1P11E 2D1JA 3EQ0H 1F0RA 1ELGA 1SGIB 3TVJB 4FU9A 1O3HA 2C3SA 1HB0B 2Z9JA 2A0QB 1O5AB 1MTWA 4K1EA 1VR1H 2I6SA 2OP9A 2WPLS 1V2NT 2TIOA 9ESTA 3SV9A 2OD3B 1C2LA 4D9QA 1TABE 3V13A 1S6FA 1CT4E 3PTBA 1E38B 3BTKE 2EI6A 3QUMP 2F9BH 1GBJA 2XBWA 3P6ZB 2VH6A 2ZA5A 2V35A 2BDAA 3BTHE 1O2LA 1SGEE 2FX6A 2STAE 4YLUA 1O3JA 1ZHRA 4K69A 1BA8B 3SGQE 1A61H 2FOCA 1TOCB 3MYWA 1FY5A 2OBOA 4AX9H 2VVVA 4Y11E 1GJ4H 3LGUA 1LPGB 2D8WA 1BHXB 1CGJE 2PKAA 3O8DA 3UWIA 4X6PA 1ZRKA 2B8OH 3F1SB 2OLGA 1KLTA 4ISHH 2BLQA 3M7TA 1LVOA 6GCHG 2QY0B 4DURA 2BY9X 3GDUA 1NS3A 4I8GA 2FOAA 4Y0ZE 1GHWH 4H42U 5EU8A 5LPFA 1GVLA 1GI2A 3RXEA 4AB9A 3OU0A 2RG3A 1RS0A 2FS9A 1CHOG 1GDQA 3A85A 1DWEH 4AFSA 2Z3EA 3URDA 1O3OA 4NFEA 1TPAE 5J4QA 1HYLA 4MQAA 1GHBG 1IQIA 1TX7A 2FXRA 3N7OA 4BTTB 2PFEA 1L4ZA 3MU1A 4AYVB 2OQUA 5PTPA 2SGPE 2ZWLH 2I6QA 3HGNA 2AGIX 4NA7A 3NKKA 3FFGA 2PWXA 3K2UA 1BTZA 2FO9A 3UR9A 1AKSB 3MNXA 2TGAA 2F3CE 4IS5A 2ZDNA 4X2VA 3M3VA 3P8NA 2ZFRH 2ZGHA 5T6FA 6GCHF 1AFQC 1AO5A 1K28D 1EOJA 2G8TA 1G36A 1FXYA 4YOGA 3SU1A 3SU3A 1YPEH 1W0ZU 2P3FH 3ZZ4A 1KYNA 2VNTA 2ZU1A 1SC8U 3T5FH 4K3JA 5DP3A 2VB0A 1SI5H 2ZHWH 3FZDA 1DFPA 3ZVGA 3KEEA 4FVDA 4M7GA 3P70B 4ABEA 4NIVA 1L1JA 1Y3XA 4BAQB 4FUCA 4AZ2B 4AGKA 2ZHFH 3BIVH 1HJ9A 4DIIH 2O8MA 1FJSA 4YTAA 4NSVA 4HFPB 3RU4E 1C1OA 1QRXA 4AG2A 5FPYA 4FUDA 1NC6A 2XBVA 3HGPA 4XBDA 1C1WH 1QJ1B 1FLEE 1GBIA 1K1OA 4UFFH 3SQHE 1V2TT 3MU5A 4TYDA 2NU2E 2ODPA 1CGHA 3BV9B 1HXEH 1ZMLA 1FZZA 2BLVA 3TU7H 1AFQB 2FTLE 4I8JA 3VB7A 5I25A 2RCEA 3SO3A 3SUGA 1LMWB 1IHTH 4PROA 2WV4A 4FUHA 1PYTD 4X8SH 1G3CA 1SLUB 3A81A 3KCGH 1C2GA 1G37A 2FP7B 1ELAA 4TY7A 6CHAB 1PQ7A 2PTNA 5FX5A 4ZKSU 2BB4A 1A1RA 2ZEBA 1F5KU 4WVPE 2DE9A 1O2VA 5EXLA 3NPSA 4XBCA 3TJNA 3KL6A 1TMTH 1OP0A 2YNBA 4MLFB 3SZNA 1Q3XA 5FCKA 4A6LA 3B23B 3RM0H 2J95A 2OCVB 2GZ9A 5T3HA 2BX3A 5IDKA 1HJ8A 5FX6A 1FN6A 1GBHA 2ALVA 3BEUA 5J4SA 3RXAA 3U1JB 5FPTA 3M61U 3TK9A 1L0ZA 1TMUH 1GBEA 3A89A 3RXDA 2GGVB 1VJ9U 2H9HA 4OS7A 1SGCA 1QBVH 1GL1A 3MO6A 2C4FH 5HGGA 4BTUB 1FQ3A 1Z8GA 3L3TA 3SGAE 1EPTB 3FAOA 4NA8A 3LC5A 3B9FH 4OGXA 1GI1A 2YOLA 3UNSA 1SL3A 2HGTH 1RIWC 1DDJA 2P3UB 2BHGA 3MNCA 1D4PB 3GY6A 1O36A 1QTFA 1QY6A 3Q77A 4MDSA 1DWCH 1OPHB 3HATH 1FV9A 1GBBA 4NIWA 4K8BA 3M5LA 3QTOH 5E0HA 2HOBA 4IGDA 3RXBA 4ABDA 3BTGE 3EAJA 4NIXA 2VIQA 3VPKA 2BD2A 4ZHLU 1CGIE 4WXIA 3UPEA 1DANH 1LHFH 2PV9B 2FOBA 1TBQH 3BTEE 2CV3A 2A4RA 4GCHF 2BVSH 2HALA 2GCHG 1GG6C 1HGTH 4GUXA 1S85A 3A83A 1VCWA 1YCPM 5L30H 1TE0A 1V2OT 1VCQA 1DT2A 2QN5T 1ZPBA 1HAGE 2FYQA 2NWNA 2XC0A 1TPPA 4MPWA 1WV7H 3VB5A 2ZU5A 4WH8A 5C67A 3M3SA 4RSPA 1H4WA 1O34A 4LK4A 3MU8A 2GDEH 1N8OC 1FIZA 1YPGH 1OWEA 2A4OA 2BDHA 4MNWA 3F9FA 1H8DH 3D65E 3SUFA 1H9LB 3R3GB 3LGTA 1ZOMA 2P16A 1C1PA 3RLWH 4SGAE 3DUXH 5LPRA 1GMCG 1C1TA 2BXTH 3BG8A 4X1RU 8GCHG 1TGNA 2CHAB 3PWCA 4AG1A 2PUQH 4B2BA 1VGCB 2Z9LA 1C5YB 5FBEA 1CA0C 1AWFH 1P0SH 3A84A 1Z71A 4KGAA 3SU6A 1CBWC 4BAKB 5JBBS 3GDVA 3A80A 2R9PA 4A1XA 2RDLA 1XUFA 1K2I1 4R0IA 3SI3H 4ABJA 4JK6A 1AE8H 3QGNB 1B7XB 2O9QA 5E0GA 1YPKH 3QX5H 2PGBB 3QWCH 1Y59T 1CU1A 1QNJA 3SNBA 5BRRE 1V2KT 1S6HA 3SQEE 1ABJH 2ZCKP 1DXPA 1SPJA 2TRMA 5CHAC 1VCPA 1ESBA 2BY5X 2GCHF 3BTQE 2P59A 1BRCE 2XRCA 5IYTA 1KXAA 3L6PA 7ESTE 1N8OB 3GY8A 1PPBH 1SGFA 3ZV8A 2VVCA 1O2UA 3SBKA 4TPIZ 2ZI2H 3SJKA 1QRZA 5B6OA 2A1DB 2VINA 4INHA 4K2YA 1AWHB 3Q3XA 1VJAU 2FOEA 4ISIH 1CA0B 1FY3A 1RFNA 1CBWB 1O3NA 2BDIA 1C1NA 1P10A 3F9HA 2ZHDA 1DWDH 1GPZA 2IPHA 3LONA 3A88A 1THSH 4HZHA 2WUBA 1GI7B 1H8IH 2SGQE 3PM3A 4ABGA 8GCHF 2P8OC 4FUBA 3K65B 1O2MA 2IJOB 5C1XA 1IQNA 1WU1A 3P17H 1GHZA 2UUKB 1WYKA 5CHAB 1F92A 1PPZA 1FONA 1HIAA 1T7CA 1Z6JH 1DOJA 3RXIA 3K6YA 2FI3E 1AQ7A 1ESAA 4DIHH 2B0FA 3S7KB 1XUHA 1KDQA 1LHCH 1YM0A 1GJDB 2BLOA 3F6UH 1YPLH 1WCZA 3SN8A 1G2MA 3JZ1B 3M7UA 3DA9B 2ODYB 1EP5A 1S81A 1YBWA 3JZ2B 4HI3A 1C1SA 4K1SA 4BAHB 1JIRA 4E05H 1ESTA 3T27A 2PLXA 1ID5H 1GBLA 1D9IA 4Y8ZA 2GV7A 1D3PB 4MNYA 1VITH 1CT2E 1C5RA 4BAOB 2P8OB 2M5TA 1O2ZA 2GKVE 5E0JA 4AYYB 2WPKS 2Y6TA 4ABBA 5C20A 3CS0A 3PWBA 2XC5A 3HPTB 3KF2A 5F6MA 4Q2KA 1O3PB 1HAZB 5AF9H 1FY4A 5AFZH 1GMHG 4NGAH 1PYTC 5L6NH 1UHBA 4MPXA 1O5EH 1GL0E 4X2XA 2O8LA 3FVFB 4Y10E 3BN9A 2AIQA 1UVPA 1DE7H 1GHYH 4YO9A 1ZHMA 2XTTB 1DVAH 1GJCB 1K1JA 3UUZA 4O97A 1Z6EA 4O3UA 1J15A 3PMAB 1C5XB 1V2UT 2EC9H 1GJ6A 1SGDE 4ZXXH 2NU3E 1ANCA 1O37A 1ZTKA 1MQ6A 1QB6A 3I77A 4A1VA 1MBMA 1WTHD 1WUNH 3BTFE 5F8XA 4NZLA 2FESH 2FOHA 2CN0H 2Z94A 3RXVA 4FUEA 1NZQH 7KMEH 1MAYA 1NN6A 1SFIA 2Y7ZA 1ELCA 4RN6A 3UOPA 1OP8A 5H4IB 1EAWA 3E6PH 1PPFE 1V2ST 2V3HH 2QC2A 1T8LA 4GPGA 3A7VA 5DP9A 3GICB 2JH0D 2G5NA 1BMAA 2ZPQA 1ZLRA 3VGCC 1UK3A 2O8UA 4D7FA 2QXJA 5DP5A 2OTVA 2FOGA 2ZFQH 1ELFA 3UQVA 3ZVEA 1GI6A 5JBTA 1LQEA 1MKXK 4E7NA 1SGNE 2GVFA 2V6NA 3LIWA 3Q76A 3GCTF 1ZHPA 2GT8A 1GHXH 2XCNA 1HAHH 2Z3CA 1OYTH 1O2PA 3QLPH 1OOKB 1V2VT 3BIUH 4Y8XA 1QL7A 2Q6GA 1ZGIA 4AB8A 1MTUA 2FLRH 3OSYA 1MZAA 1TGSZ 2VIPA 4GSOA 1GI3A 1HPGA 1O3BA 2BDYA 4IN1A 4Y8YA 6LPRA 3E0NB 1F7ZA 1O3FA 1YPJH 4R8TB 3TJUA 3STJA 1X7AC 3W95A 1SGRE 1QJ6B 2TGTA 4MPVA 1CO7E 3KN2A 1E36B 2ZTZA 3QZRA 1ETRH 5AHGH 4FUJA 1TNGA 3MOCA 1TA2A 3NZIA 1SHHB 3PLKA 4CR5A 4E7RG 3MH4A 1JIMA 4X1NU 2HNTE 3QN7A 2IOTA 1DWBH 3AASA 2VWOA 1SR5C 3DT0H 3RLYH 4WMEA 1LO6A 4KKDA 4JZFH 1OWJA 2ZCLP 3ZZAA 1O3DA 4AORA 4ZMAH 4OS2A 3P8OA 3GOVB 3NXPA 1A5HA 1TX6A 4Y79A 5EGMA 3V0XA 4BXSA 3S9AA 2Z3DA 5FCRA 1A0LA 3A8CA 3RXHA 1MH0A 1TB6H 4A5TS 1GHVH 1IQMA 3GDSA 4BANB 1HUTH 2BZAA 5HYOA 1AU8A 1GHAG 3HKJB 4YOJA 2ZP0H 4ZH8A 3RXSA 3SU4A 3D62A 3SGBE 1T4UH 3PYHA 5ABWA 4Z0KA 1K1MA 3LPRA 3A7XA 1ZGVA 3I78A 1Y8TA 4UE7H 1EAUA 4IC6A 4XSKU 1G9IE 1Q2WA 4JZIA 1T4VH 1TYNA 5L2ZH 1C2FA 2TGDA 1E0FD 1AUTC 1UK4A 3A8BA 2CMYA 3PLBA 3LDXH 5FAHA 1BHXF 2FPZA 2B7DH 1BTYA 1ZYOA 3LC3A 1SHYA 2UWOA 2ASUB 2H9TH 5SGAE 3TH3H 2VGCC 1YF4A 1A5IA 1O2KA 3TNTA 4JCNA 1LHGH 1NRQH 3LH1A 2Y82A 3C1KA 2HPPH 3A7YA 4NIYA 1HV7A 4XBBA 3K6ZA 1UTQA 2C93B 3QO6A 3TGIE 2F91A 2AGEX 1BUIA 1W7XH 2OC7A 2HVXA 4B2CA 3ODDA 3EA9A 2Y5HA 2BYAX 3KQBA 3T29A 3DFLA 3PROA 3HK3B 1GMDG 1YPHE 4ZUHA 1D3TB 3EE0B 1O2RA 1CA8B 2CGAA 1V6DA 2H6MA 3OX7U 4ABAA 2F83A 1BBRK 4IMZA 1T8OA 4MVNA 4DT7B 2Z7FE 3G01A 3ZYEA 1QB9A 4XE4A 3ZZ6A 1K1IA 2ZFFH 2O8TA 4B2AA 1EAIA 3T2NA 1W14U 1BB0B 2BDCA 4OS6A 4I7YH 1IQKA 2VGCB 3ATLA 4Y7BA 3SJ9A 5DKMA 3U8TH 2ZFTA 3RU4D 3SOSA 1A4WH 1TMBH 3TPIZ 4OS4A 4NWLA 2NU0E 1UO6A 3ODFA 3D23A 4JYVH 2ZDLA 3S9BA 6ESTA 3LJJA 3M5MA 1HNEE 1QGFA 4O3TA 1TFXA 2VVUA 1J16A 4FUIA 2P93A 1QFKH 5DPAA 1QR3E 4NCYA 4MPUA 5JBCS 1IQGA 1EAXA 4J1YA 4X8VH 1CHOF 2XBXA 6CHAC 3KNXA 2CJIA 1P01A 3PB1E 1K21H 2XNIA 1Q31A 1G32B 2WPJS 5DP6A 1NRPH 1SMFE 1AIXH 1UVUH 1MKXH 4B76A 3H5CB 2QIQA 2FZZA 1JRTA 8ESTE 3A7ZA 4MTBA 1RXPA 3ATKA 5ESTE 1W11U 5JPMH 1DX5M 1GHBF 1ZSLA 3LJOA 1Y3UA 1AB9C 2Q6DA 3E91A 4CBOA 1O30A 4MNVA 4X1SU 3VEQB 1A5GH 1QB1A 2SFAA 2OC0A 1P02A 1QCPA 1W13U 3O8CA 1C2HA 1O2GH 4X6MA 5GWZA 5HXFA 4YT6H 1KY9A 1BQYA 2WYJA 1UTNA 3RXJA 1D3QB 3EDXB 3NWUA 2GZ8A 2H1UA 1DPOA 1XVMA 3TIUA 4Q80A 4INLA 5C1UA 1Z1IA 2P95A 2B5TB 3F9GA 1GBDA 5JDUB 3MU0A 2SGEE 1EPTC 2ZDMA 3URCA 3AAUA 4CRFA 1LDTT 3MO9A 1AVXA 2OC1A 4CRAA 3R0FA 2AYWA 4DVAU 4X8UH 1ZJDA 2QYIA 4X6NA 1FY1A 2PTCE 3FP6E 3MHWU 1SOTA 2PKAB 1QA0A 2Q1JA 4WMDA 2TGPZ 1AB9B 1O2QA 4GHQA 2BY7X 3U1IB 1XKBC 3RXQA 2HNTC 1JXPA 3UY9A 1TRMA 9LPRA 5A8YA 1UTOA 2QV1A 3LGIA 3ATMA 4FU7A 1P2IA 1C4V2 4HGCA 3RXPA 3GYLB 1EX3A 1RGQA 1SSXA 2KAIA 3ELAH 3A8AA 3DD2H 1KXCA 4BNRA 1O3LA 3AW0A 1WTGH 2FYRA 2C8XB 3ZZ3A 1TONA 2JKHA 2AMPA 4X0WU 5JB9S 3VFEA 1U6QA 3RXGA 1PQ8A 1ETTH 3EGKH 4ABFA 3SV2H 1YP9A 1BRAA 1Z1JA 1UTMA 3Q3YA 3RMNH 4XFQA 1YKTA 1DM4B 2FX4A 4JK5A 3MO3A 1IOEA 1W7GH 4D76A 2FOMB 1QL8A 2Y81A 1JRSA 3RXKA 2HNTF 2W7SA 2CHAC 2Y80A 1THRH 1VGCC 4THNH 3VXFH 2ZQ2A