4FUDA

Crystal structure of the urokinase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
total genus 61
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fudA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fudA01
1T32A 3S7KB 1O3IA 1ESTA 4CRAA 2W26A 1MBMA 2C90B 4ZKOU 3K6ZA 1O36A 2PSYA 2UWLA 2ZU3A 1D3DB 1EOLA 1ELFA 1BMMH 1NROH 1P04A 2PKSB 4Q7XA 1O5CB 3A88A 4GCHF 2OINA 4TY6A 1A46H 3KEEA 5HM2A 4CRCA 1HJAB 4B73A 2A5AA 1C9PA 3A7YA 1NZQH 2STAE 4DG4A 1QHRB 1MAYA 2FS8A 2OD3B 1LVOA 1C4U2 1EX3A 1S0QA 4FUBA 2B0FA 1E0FD 1ZSJA 2IN2A 1MTUA 4I8LA 2TBSA 1GG6B 4D9RA 2CHAB 1WQSA 1JRTA 3N7OA 1O2TA 2AFQB 1GBLA 3GCTF 1TE0A 2QXHA 2WINI 4Z6AH 1GI3A 1K22H 1ZTKA 1O3OA 3E3TA 1P11E 2R9PA 3ATIA 3A85A 2LPRA 3KQDA 4H6TA 2NU4E 1UJ1A 1GGDB 2J94A 1DE7H 2FOHA 3HATH 3LGVA 2HPPH 3RXBA 2GVFA 1OYTH 3NCLA 1C1MA 1GBKA 2ANMH 2Z9IA 4H6SB 1BTPA 4U2WA 1G2MA 1N1LA 2F9OA 4UONA 3B9FH 4I32A 1C2EA 1F0RA 2BDBA 3UNQA 1JOUB 3P8NA 2VINA 1AKSA 2PSXA 3O8DA 2F9BH 2O9QA 2CN0H 4FU9A 3E0NB 1DT2A 3LT3A 1BITA 2RDLA 3QZRA 2PLXA 1PQ8A 2Y80A 2GZ7A 1QL7A 2XYAA 3M7UA 1V2KT 3M35A 3BTDE 1K1NA 1O5BB 2RA0A 5T6DA 3RM2H 2FX4A 3GDSA 1SGYE 5FX6A 1TBRH 1XVMA 1TRNA 5E2PA 1HUTH 3SNBA 2FM2A 4ZHLU 2J92A 2ZQ2A 4JK6A 1UTMA 3A82A 2ZCKP 1GPZA 2Z9JA 3DA9B 3W95A 1WCZA 2O8TA 4WH8A 4XDEA 4Y8XA 1AO5A 4R0IA 3CENA 2G51A 3GICB 1MQ6A 3CS7A 4IBLH 2ZGBH 1IQJA 3GYLB 4VGCB 5C67A 3RMLH 1D6RA 3BTME 3IWMA 2FS9A 4UEHH 3TGKE 4WXIA 1MTNB 2ZPSA 4KTCA 4D9QA 1GMDG 4LOYH 5A8XA 3I78A 1NT1A 3RU4T 2OXSA 1MKXK 3ZVFA 1UTQA 1IQMA 3EA8A 3OTJE 1MD7A 1DY8A 5FXLA 1GI5A 3TITA 1O2WA 4Y76A 4K69A 1FLEE 2HNTC 2A31A 2P94A 2PR3A 2PUQH 2JKHA 1ELBA 2CF9H 1S85A 2ZA5A 4ZROA 4ESTE 1C4Y2 1TNKA 1P57B 1TNLA 1W7XH 2FESH 1QA0A 3LH1A 2W3IA 3SUDA 4M7GA 2HLCA 2BDHA 2BM2A 1GBJA 3NKKA 2ZU2A 4ISOA 2OCVB 2KAIB 4A1TA 1LQEA 6GCHG 5ABWA 1IQLA 5DPAA 1SGEE 1TQ7B 4D76A 5TCAA 2AS9A 1LQDB 5AHGH 1HDTH 1LHFH 4CH8B 2PWXA 4ZKRU 5C5OA 1J16A 4BTIB 2G5VA 1LVYA 1GJ6A 2F9UA 4FUGA 1P3CA 2XCFA 3MNBA 1WSSH 3S9BA 3LPRA 1S82A 5A8ZA 1JXPA 2H5DA 1O2YA 3TU7H 1C1QA 1E38B 3S0NA 1W3CA 1NS3A 1Z7KA 1YPLH 5A2MH 1QNJA 2GX4A 3GY5A 1P06A 3MU8A 2UUJB 3URDA 1JIMA 3SU4A 3T5FH 1AFQB 1QRZA 1UTNA 2Q1JA 2XRCA 1FQ3A 4ABIA 2Q6GA 1GI0A 1GBFA 3RXTA 1DWEH 1ZHPA 3GCHC 4LK4A 3HKJB 5L30H 1UO6A 2UWPA 1C2FA 1C1UH 1EZXC 1XUKA 3PO1C 3UFAA 1DANH 1BDAA 1TX6A 1SGIB 3RXQA 4X2XA 1Z6EA 3UQOA 2AMPA 1JRSA 3SU6A 4Y8ZA 4FUCA 1CHGA 2C8YB 2BDIA 1TGTA 3H7TA 4Y7BA 1O3PB 1BBRH 1BTYA 1GJ7B 2ALPA 1UTOA 3L3TA 2R3YA 5F8XA 1EXFA 2HVXA 1W13U 2OC0A 1BTUA 4FUDA 1W0YH 1LVBA 4GSOA 1HJ9A 4D8NA 3SUEA 5BRRE 1GBCA 4AG1A 1K1IA 1G36A 3TH2H 3A80A 3SJ8A 5DKMA 3P6ZB 4Q80A 1MD8A 4GVUA 3A7TA 4IMZA 3LU9B 1JWTA 2J2UA 3QUMP 5A8YA 1BRBE 3BTTE 4XBDA 1C5LH 1OP2A 2ANYA 3MH5A 4X2VA 2A0QB 1GBAA 1FN8A 3M7QA 2BQ6B 2PKSC 2PFEA 3FP7E 1CE5A 2A1DB 1O39A 1UK3A 1UHBA 1V2PT 4NA7A 4X6MA 4AB8A 1KYNA 2EC9H 1HJAC 2BXUH 2OC7A 1AVGH 2VB0A 3D23A 4INHA 1S84A 3P8FA 2ZFSA 4CREA 1D6WA 1KLTA 1XMNB 3D49H 5C20A 3STJA 1OP0A 3LGYA 4WXVA 3F6UH 1AI8H 1D9IA 1NFYA 3FZDA 1S6FA 2CHAC 8ESTE 4NIYA 2EI6A 8KME2 1W2KH 3K9XB 3RXIA 2ZU1A 3A7WA 1ANCA 5I46H 4BXWA 3CP7A 4JYVH 1BHXB 2XC4A 3OYPA 1CA0B 2ZECA 3MYWA 3PLBA 4WJG2 4FUHA 1UVPA 1GGDC 3ESTA 4KP0A 1O33A 3QN7A 1PYTD 2NU2E 3V7TA 2FPZA 4XSKU 1IOEA 1AUTC 3RP2A 4HTCH 3U9AH 1ID5H 1LPZB 1MMJN 2PHBA 4JZDH 5E0HA 2FLRH 2BX4A 4JZFH 1XXFA 2OTVA 4THNH 3KCGH 1S0RA 1HXFH 1Z1JA 1AE5A 3MH6A 3ATLA 1SLWB 2XTTB 1KLIH 1SLUB 4IS5A 4RKOB 1AUJA 2ZPQA 2BD3A 1LHEH 3EDXB 1THRH 2WPIS 3TJOA 1ZSLA 1A5GH 1TNHA 2ZFTA 1OOKB 1E36B 1EPTA 1GHWH 2J34A 1ELDE 1SBWA 4MPWA 5C1XA 1LO6A 4ABAA 2BDYA 5L6NH 2A2XH 1CGIE 4Y7AA 1G32B 1BCUH 1Y59T 3FP6E 5EPYA 1ZLRA 1ZMJA 5DP4A 1EOJA 1HAHH 3T62A 1VR1H 1SGCA 5G4BA 4OGYA 3FZZA 1TBQH 3NPSA 1SGTA 4NIVA 3SJKA 1ELGA 1YPHE 2ZIQH 4IN1A 4Y8YA 4FUIA 1F0UA 4VGCC 4DOQA 4Q7YA 3E8LA 3OY6U 1G2LA 1C4V2 2ZFQH 4PROA 4I8KA 3SGBE 1ELAA 4K1TA 1P09A 4YOGA 4CBNA 3KF2A 2Z3DA 1DXPA 1ZYOA 4A5TS 3PWBA 1CHOF 1ZPZA 5F8TA 2EA3A 1VCWA 1C2HA 4DW2U 3D62A 4I8JA 2FTMA 1W12U 2SGPE 3SU1A 1QRWA 4UFDH 4ZXYH 2TIOA 2ZDVH 3P70B 4AFQA 3M37A 1O5AB 2BDCA 1AQ7A 4OS1A 5LPEA 4OS2A 1S83A 1B5GH 2BZ6H 2VIWA 2XNIA 2B8OH 3BG8A 1DY9A 1H9LB 1GMCG 3RXAA 1HAVA 1F5RA 1A2CH 5HM9A 3LJOA 1VITF 1Y3UA 4K1SA 1XKBC 2WPKS 1BRAA 5DO4H 1SC8U 4I33A 1EAUA 2H6MA 2ODPA 2AIQA 2NWNA 3BEFB 4AG2A 2WPHS 1JMOH 1TABE 2BXTH 2NU0E 3MNSA 3K6YA 3MTYA 1AFQC 4A7IB 2ANWA 3Q00A 3RMOH 2YOLA 1HAOH 2P3TB 1AY6H 3LC3A 1K1JA 3QX5H 1HFDA 3AASA 3V0XA 1QY6A 4UFEH 5A09A 2Q6FA 1ZPCA 3CS0A 3RXGA 1GJ9B 3C27B 1LDTT 1P2IA 4X0WU 2BLVA 3VFEA 5FPTA 3SV6A 1SQOA 1PYTC 2P3UB 1PPZA 2QC2A 2WYJA 1HIAB 4AFSA 4FVDA 3VB7A 2SGEE 1DS2E 4NCYA 4K1EA 1LHDH 1YPMH 1EJMA 3BIVH 1ZMNA 2FYRA 3Q77A 5DP3A 4HFPB 4AZ2B 3TH4H 3TJNA 5J4SA 1YYY1 2C93B 4AFUA 1ABJH 3SO3A 4CBOA 4BNRA 5DP8A 3UIRA 2FP7B 1GCTB 1C5XB 2BD5A 2G4UA 3UWIA 1VZQH 1ZTLA 5L2YH 3EQ0H 1O0DH 1MH0A 4CRFA 2BVSH 4A92A 2BLOA 2QN5T 3SNCA 2CGAA 4MLFB 3RU4D 4ZMAH 5AF9H 4TWYA 1UVUH 1BMNH 4FXGH 1SGFA 2O8MA 1GBEA 3DUXH 2VVCA 1V6DA 1CSOE 4MPXA 4JZEH 2R0LA 4K8YA 1GL0E 4YOJA 1GHXH 2ZGHA 4QT8C 1B0FA 2ZHEH 3DFJA 4NG9H 1Q2WA 3E0PB 3PTBA 3GOVB 4AYVB 4KKDA 1Y5AT 2Z94A 2ZTZA 3SJIA 3GDVA 2DE8A 3MFJA 1CT4E 2FTLE 2ZKSA 4K2YA 3RMNH 2ZHDA 1RD3B 5EXMA 2GGVB 3ATKA 2WUCA 2C4FH 4D7GA 3KGPA 2QA9E 2WPLS 3FFGA 1O2NA 3ZVEA 3HPTB 1O2MA 3A87A 3T25A 9LPRA 3VB6A 1T8LA 2GTBA 5A0BA 2F9VA 1B0EA 3AVZA 4B2BA 4O03A 3PTNA 2FX6A 3TGJE 4WVPE 1UTJA 2OBOA 1CA0C 2H9EH 1CGHA 1D3TB 1G3CA 5DK1A 1FAKH 3Q3KA 3MU5A 3GY7A 1FY5A 1VCQA 3TJVA 1DXWA 1XUGA 3GYMA 1GHBG 2BY5X 3EA7A 5TJXA 2VIQA 1O3HA 3E90B 1SB1H 3UWJH 3JZ2B 2FOMB 2GCHG 3HK6B 1OWEA 1P10A 3MNCA 1RGQA 2ZHFH 1AZ8A 1GMDF 2O8LA 1BA8B 1EAXA 1G3EA 1LVMA 2FOFA 1NFUA 2R2MB 2VNTA 1C5QA 2BDAA 3OX7U 4ISIH 4U01A 3LIWA 1H9IE 4UD9H 1L1JA 2ZU4A 4U32A 2HALA 3KQEA 4ABFA 3KN2A 5EG4A 1TNJA 2BX3A 4ZAEA 1O2KA 2Y82A 5AFYH 1NRSH 2PKAA 1EP6A 1MU8B 5EXLA 4XE4A 2BHGA 1GVZA 4Y6DA 1TOMH 1INCA 3U8TH 5GDSH 3ZZ6A 1P2NA 1T4UH 1YPEH 3PROA 2ODQA 3I77A 5EQSA 1JBUH 3I29A 1KTTB 6GCHF 1ZPBA 2BB4A 3VGCB 2EI7A 1YLDA 2ZFRH 2ZTXA 3T26A 1TPPA 2ZO3H 1C2MA 1L1GA 3MH7A 3UPEA 1UMAH 4H42U 1QR3E 1HJ8A 1A0JA 1CVWH 1J8AA 4WMDA 1O2RA 2FMJA 1O3CA 1YCPK 2BLWA 1GJ8B 3A7VA 2PTCE 2F83A 1BRCE 3PYHA 1V2OT 5JYIA 1TQ0B 4NSVA 1FI8A 4CR5A 4ISNA 5L2ZH 1CO7E 3V13A 1GI8B 1GI7B 4GHTA 1EAIA 4YOIA 4MVNA 1UVSH 1UTKA 1Y5BT 1WYKA 1BTWA 2K1QA 3O8RA 1C1NA 4TY7A 4YO9A 2AGIX 3KHVA 2W5EA 3GISB 4A6LA 3A8DA 1MKWK 2FI4E 3MU0A 1SGQE 4Y71A 4NFEA 3TNTA 5C3NA 2ANKH 3MO3A 1SGDE 2Z6BD 1ARBA 1V2LT 2FZZA 3RLYH 5GIBA 4GPGA 2R2WU 3BIUH 5TCCA 4NA9H 1FAXA 3LC5A 2QF3A 1ARCA 2ESTE 4X1PU 5E8EH 5T3HA 2XBVA 1NO9H 1GJ5H 4ZH8A 1O2GH 2A4QA 4WMEA 5H4IB 3S69A 1BHXF 1ZSKA 1PJPA 1TLDA 3ENSB 1TMBH 1DFPA 2HRVA 1CQQA 2FODA 1H8DH 3GY4A 4MQAA 1PPCE 4NSYA 1KTSB 1F5KU 4BAOB 1OS8A 4AYYB 3D65E 3SUGA 5LPRA 4CRGA 4X6PA 1EJAA 1VJ9U 1C5RA 1O2SA 4FVBA 1O2OA 1O31A 1P9SA 1RRKA 1PPBH 1BIOA 2ZWLH 3M5OA 3SV8A 1ZR0A 1Q3XA 1ZTJA 1TMUH 2BOKA 1ABIH 2JH6D 3SJOA 2NU3E 2W3KA 2QAAA 3TJUA 1OSSA 1GCTC 1TGCA 1XUHA 1O30A 1UCYH 2I6SA 3M3SA 4BAHB 1GJCB 4AORA 1KY9A 1X7AC 1AWFH 1NFWA 1CT2E 1P2KA 4Q7ZA 2WPMS 1G9IE 5EQQA 4O3TA 3RC4A 3H7OA 1D4PB 5PTPA 1O5EH 1DUEA 3RXEA 1QA7A 1WBGB 1O2JA 1ELVA 2FDAA 2Q6DA 2F91A 2UUKB 3SJ9A 1XVOA 1CGJE 2ZP0H 3GDUA 1LPKB 1P2MA 3E1XB 3DFLA 4BAKB 1C5NH 3K65B 1WU1A 3JZ1B 1IHTH 5F8ZA 4AB9A 1P01A 2Y6TA 3BG4B 3RXKA 2A7CA 4X8UH 1PPGE 6CHAB 2W7SA 1K1PA 4WF8A 5JB8S 2TGPZ 1TGSZ 1GHAG 1DM4B 1XM1A 1E37B 4A1VA 3B23B 4DCDA 1ZZZA 2BD2A 1BOQA 3A84A 1EZUC 1MQ5A 1RTLA 3E16B 1RS0A 2ZDAH 1BZXE 1AWHB 1O3GA 5HMAA 3ZZ3A 7GCHG 3FP8E 4Z0KA 2ZGJA 3M5MA 2F9NA 2P95A 1BTZA 1YP9A 1A5HA 3QLPH 3BTGE 3V12A 1YLCA 1F2SE 1AZZA 3LGTA 4TWWA 1DSUA 3PMJA 2QY0B 3UUZA 4AOQA 3DD2H 3PM3A 1T4VH 1DWCH 4MNVA 1WTGH 1KSNA 3P17H 1FIZA 5CHAB 4RN6A 3MU1A 3HGPA 1UK2A 3RXRA 5B6OA 1SPJA 1SOZA 3TK9A 1OPHB 2FI3E 1IQIA 2XC5A 1HV7A 3PLKA 4JZIA 1CBWB 2ZHWH 4MPUA 5JPMH 5CE1A 4AFZA 4TPIZ 4TPYA 3UQVA 1V2QT 4XFQA 2GZ8A 3RMMH 1A4WH 1MUEB 1PPFE 2OC8A 2SGQE 1NC6A 2BY6X 3ZZ7A 1BQYA 1EUFA 1Q31A 4JK5A 4UDWH 2VH6A 1KXAA 2ZG0H 1M9UA 3RLWH 1ZMLA 1SMFE 1TA6A 1VJAU 2CJIA 1C5VA 3SGQE 3OSYA 2RCEA 5C1YA 3UREA 3ZZ9A 3V3MA 2VU8E 2P16A 1TPSA 2HNTF 3SHCH 1SL3A 5T6FA 2W7UA 1S6HA 4Y79A 1AGJA 1ETTH 2A2QH 4X2WA 3ZZCA 1G30B 1NU7B 2P93A 3RXCA 4MNXA 4X6OA 5E0JA 3U8RH 3U1JB 1VCPA 2Z3EA 3A83A 2ZF0H 4E05H 2J38A 4MDSA 1HAPH 1P03A 2KAIA 3VB4A 1YF4A 1HYLA 3G01A 3VGCC 4I8GA 1MTWA 1RFNA 1HXEH 2ZGXH 3SV2H 2ODYB 3TH3H 1UTLM 2GMTB 5JDUB 1W0ZU 1FONA 6LPRA 2XWAA 1GMCF 3RXJA 1XXDA 2VWLA 1Z1IA 1GHZA 1TRYA 2BDGA 1A0HB 3RU4E 4BXSA 3DT0H 4NZLA 3SNDA 2TGTA 4B2CA 2Y5FA 2THFB 3UY9A 3RXOA 2ALVA 3GCNA 1O3FA 2GKVE 1C5UA 4BAMB 1TGNA 3M3TA 1T8OA 3LKWA 1DVAH 3A81A 3RC5A 2R0KA 3SW2B 3LH3A 1C2KA 1GJAB 1ZGIA 1AU8A 4ABEA 4O3UA 3SU2A 2Y5HA 1P02A 1FIWA 2HPQH 2BTCE 1O2QA 1A61H 4NZQA 3U69H 1IQEA 1GHVH 2TPIZ 1SFIA 2HNTE 1GBDA 4XBCA 1PFXC 2V0BA 4YM9A 2B5TB 4WWYA 2QGRA 2PGQB 1U6QA 1RIWB 2Z3CA 4H4FA 1HAYB 1MTVA 2FOBA 1GI6A 2SGFE 4J2YB 1KDQB 1YPKH 1ETSH 4FU8A 1TPOA 1BBRE 2ZNKH 1DLEA 1LMWB 4O97A 7ESTE 3MOCA 4D7FA 2Z7FE 2O8WA 1EJNA 2ZFFH 2JH0D 3VB5A 3TLOA 3MO6A 2CMYA 2PTNA 1A3EH 1F5LA 1OXGA 2A7HA 4F49A 1P3EA 3A86A 1F7ZA 3SQEE 1QB6A 2NU1E 2SGAA 2G81E 1NY22 2TGDA 1ELCA 3ZZBA 2QYIA 1C1TA 1S5SA 1W7GH 1GBBA 4X1RU 1AE8H 1DUAA 1QBNA 3R0FA 3UNRA 1C5SA 1UTPA 1KXDA 1HBTH 1RTFB 3SU5A 5GXPA 2ULLA 1LCYA 3FVFB 5EOKA 1E35B 1GMHG 4CRBA 1C1SA 1Z8JB 4DT7B 4SGAE 1V2VT 4YT7H 4I8HA 1NU9A 2Z9GA 1SG8B 4X8SH 1P2OA 2FOAA 2V3OH 1HB0B 2BLQA 1SLXB 4CHAB 1BTXA 3ZVBA 1BBRK 7KMEH 4KTSA 3TK5A 3MU4A 2ZEBA 1HNEE 3RXPA 1N8OB 2XBWA 1O3KA 3SU3A 1FZZA 3A8BA 4ZUHA 2XXLA 1C1PA 1B7XB 2G8TA 4BOHA 2D26C 3NZIA 2QXJA 2VVUA 1YM0A 3LJJA 2JETB 5FBEA 4AGKA 1V2TT 1TBZH 1CT0E 4OS5A 3F1SB 4ABGA 1GHBF 3BG4C 3RXFA 3QGJA 1OP8A 3ZZAA 6CHAC 1RTKA 2SFAA 1FMGA 1OWKA 3T27A 2XBXA 2GCHF 3SV9A 3VXEH 3MHWU 1TWXB 2VIDA 3B8JA 1O3MA 2CV3A 2QXGA 1BMLA 1P12E 3URCA 1TPAE 3RM0H 1DDJA 5EU8A 3UNSA 3ELAH 3LGUA 1G37A 1ANBA 4NWKA 1BB0B 4JCNA 1MKXH 1AKSB 4X6NA 3UTUH 1A3BH 1ESAA 1NFXA 3TGIE 1DWBH 1NRNH 1P9UA 1YC0A 3U1IB 4SGBE 3PMHB 1D3QB 1IQNA 3F68H 5GJ4B 5C1UA 1O5GH 2Y7XA 2AGEX 2HGTH 3QK1A 2VH0A 3KQCA 3SV7A 5CHAC 2ZI2H 2OUAA 3ZV8A 1L2EA 1QB1A 1GHYH 1MZDA 3BEUA 4UE7H 3ITIA 1TOCB 1KIGH 3TIUA 5C5NA 4X2YA 1CBWC 2Z9KA 1GI2A 3STIA 2BD9A 3LDXH 1FJSA 1Y5UT 2AERH 2BYAX 4IN2A 3U98H 2F3CE 1YKTA 3EE0B 3T28A 1TYNA 8LPRA 5FCRA 4KTUA 4OS4A 4B71A 1LTOA 1A5IA 4KGAA 1SGPE 1K9OE 1GBMA 5LGOA 1KXFA 2D1JA 2TGAA 1FY8E 4MNYA 1RJXB 1QL9A 1GDUA 1ZHRA 2UUYA 3VXFH 1MBQA 1PPEE 4E7NA 1IQGA 4YT6H 3Q3XA 5GPIB 1T8MA 3AW1A 3SUFA 2VWOA 1TONA 1P0SH 1W10U 4DJZB 4X1SU 3M7TA 2ZZUH 3R3GB 1O2HA 5DG6A 2GV6A 1TA2A 2GDDA 1GJDB 1O37A 1QFKH 5ESTE 4I7YH 1HAIH 1ANDA 1OWJA 1C5WB 2GMTC 3F9EA 1WAYB 3P8GA 3QTVH 3BSQA 1OX1A 1NESE 1C2IA 4ABJA 3UOUA 1C2DA 2GD4B 5JBTA 3ZZ5A 4JYTA 8GCHG 1GVKB 2GDEH 1BJUA 1LKAA 2F9PA 1V2NT 1O38A 1OWHA 1EASA 1AVXA 3UOPA 1QQ4A 1PQ7A 4E7RG 2J4IA 1O3JA 3H5CB 1C5OH 1QL8A 3PMBB 4CR9A 1HLTH 1O3DA 2Y81A 1YGCH 2P8OB 1AFEH 2VGCB 2A4OA 5FCKA 1Z8GA 1GCDA 1ZOMA 1K1LA 1O2ZA 4IMQA 4IC6A 4J1YA 1XKAC 1XUFA 5A0CA 4WH6A 1BTHH 4O9VA 4ZHAA 1RIWC 1LPGB 1K1OA 2LNCA 1O34A 2D2DA 1G3DA 3BTEE 1XUIA 4DGJA 1IQFA 3FAOA 3RXHA 2D8WA 2Z9LA 4KELA 2IJOB 1W8BH 2FO9A 4BAQB 2ASUB 2AIPA 3LOXA 1NTPA 1AN1E 1TNGA 5E2OA 2STBE 4AX9H 1GWAA 1HIAA 2XBYA 1J9CH 3MI4A 2FOGA 2BY7X 4RSPA 4YZUA 1EZSC 2HWLB 1O5DH 5K0HA 1NRPH 2OLGA 2A5KA 1L0ZA 2WPJS 1D3PB 1ANEA 1P8VC 2OQ5A 2VWNA 1BJVA 4Y10E 1H4WA 1NRRH 4NGAH 3A8CA 1Y3XA 3PV4A 4K5ZA 1FN6A 2C8XB 2YNBA 2VIPA 5GCHG 5ESBA 2BY8X 4AN7A 1NPMA 3A8AA 1QJ1B 1HAZB 4JZ1A 2FI5E 1Y3WA 4LXBH 1DSTA 1C1WH 1C1RA 4OS7A 1O2LA 3IITA 1LHGH 1VGCB 5DJ7A 1TNIA 2AMQA 2QF0A 2PW8H 4JMYA 5EGMA 1EAWA 1O2VA 3E91A 3A89A 4ZXXH 1GHAF 3Q76A 1TX8A 1QJ6B 1ZRKA 4CRDA 2WUBA 5FX5A 4LZ1H 3AAVA 1MAXA 5BPEA 1FPCH 2ZQ1A 4CHAC 1C2JA 4B2AA 1ELEE 1UHBB 4NIXA 1QGFA 4GCHG 1N6YA 2BQ7B 2PUXB 7GCHF 1N8OC 2CF8H 5DP7A 1GL1A 1GVLA 1SR5C 1WQVH 2VJ1A 1MCTA 1ELTA 1O3LA 2JETC 1O5FH 2FWWA 1TGBA 1SGRE 1C1VH 2ZGCA 1ZJDA 4YLQH 1DITH 3PB1E 3K2UA 5FBIA 3RXLA 2V6NA 1YPJH 3BN9A 2OC1A 1YPHC 4B1TA 1FY1A 3SNAA 1FDPA 1FV9A 1QIXB 4DIHH 3GCTG 3ZZ8A 5EXNA 2IPHA 3A7ZA 3SU0A 4HI3A 1Z6JH 1GBTA 2V35A 1C5TA 3E6PH 1V3XA 1C5PA 3IG6B 3L33A 1ZRBA 1BUIA 2JH5D 4CH2B 1G3BA 3NUMA 5DGJA 3MMGA 3O8CA 1O32A 1J15A 2C8WB 1C5ZB 2G52A 4Y11E 2ZFPH 2YNAA 1O35A 2GT8A 3BTFE 1T31A 1YBWA 1YCPM 1KXCA 2BOHB 3S9AA 3ZVCA 2Y7ZA 2DUCA 5J4QA 2BD8A 1O3AA 2R3UA 1EPTB 4UFFH 4TYDA 3SHAH 1QBVH 4IGDA 1H9HE 4ISHH 1NRQH 1Y3VA 2GZ9A 1BT7A 1C2GA 3F9GA 1MZAA 1O3EA 1PPHE 3EA9A 1O3NA 1UVTH 4FU7A 1GJBB 1BMAA 4Q2KA 4FUJA 2ZTYA 2WV4A 2XW9A 4OS6A 3RXVA 1FY3A 2V3HH 2A32A 3RUOA 2ZHQH 1DX5M 5FAHA 4JYUH 2GV7A 4K8BA 3LGIA 4LZ4B 5DP6A 3BV9B 2BY9X 1Y3YA 3T29A 1GBHA 4IC5A 3SOSA 5JBCS 4GHQA 5CMXH 1NN6A 4XBBA 1EKBB 3PMAB 4ZHMU 5JBAS 3KQBA 1GI9B 4GAWA 5E0GA 2BVXH 1QQUA 2I6QA 4INLA 3W94A 4B75A 1AB9B 1KLJH 2IOTA 2PGBB 2ZPRA 1V2MT 1H1BA 4AGJA 4R8TB 5LPFA 5ETXA 4DY7B 4UFGH 3ZYDA 5FPYA 1ORFA 2SGDE 3U8OH 1A7SA 1F0SA 1UVOA 3LONA 3QDZB 1BRUP 1EB2A 2P8OC 4XOJA 2P3FH 2PV9B 3WY8A 1HAVB 2VGCC 1TX7A 1SQAA 2VIOA 2ZDKA 5A0AE 4INKA 1HPGA 4MG3A 1XX9A 3VB3A 2G4TA 3P95A 2ZC9H 2FYQA 1AIXH 2FEQH 4MNWA 2CXVA 2HOBA 3P8OA 2AYWA 4BANB 1Z71A 1ESBA 1P2JA 1FXYA 3GY3A 7LPRA 4FUEA 3ZV9A 1GG6C 3MH4A 1P05A 1QTFA 1TIOA 1GMHF 1THPB 1K1MA 4F4OC 2ZDNA 3F9HA 1K2I1 1GI1A 5FPSA 1H8IH 2GCTB 3SBKA 1ZGVA 1CA8B 1SI5H 1SGFG 3QTOH 4IW4E 4BTUB 2BD4A 3AAUA 3UR6A 5I25A 3NXPA 1TMTH 2H1UA 5DP9A 2VIVA 3KIDU 1HAGE 4X8VH 2TRMA 3ZZDA 1RXPA 3QO6A 1UCYE 3BTWE 4I31A 2AEIH 1A1RA 1ZJKA 2G55A 3SQHE 2A45B 2C8ZB 5LH8A 3TK6A 3AW0A 1T8NA 1C5YB 3NWUA 1AMHA 1W14U 3EAJA 4ZKNU 1SQTA 1GJ4H 2A7JA 4Y0ZE 2J95A 4K60A 1SFQB 1DICA 3VPKA 2SNWA 1FNIA 1IHSH 2OQUA 3TVJB 3QZQA 1SGNE 2ILNA 1QJ7B 4U30A 1LHCH 1K21H 3BEIB 5HGGA 1O2PA 1VGCC 3ODDA 5SGAE 3FANA 1VITH 1GDQA 2B9LA 4ABBA 4Y0YE 5C2ZA 2ZCLP 1IQKA 3LGWA 1AVWA 2QCYA 5IYTA 1GDNA 5JB9S 4HZHA 3KNXA 3S9CA 4YTAA 1EZQA 2BVRH 1EATA 1K28D 2VVVA 4WMFA 1OWDA 4RKJB 4DVAU 1TALA 1EP5A 3GY2A 3HK3B 3ZVDA 2A4RA 1Z8IB 1O3BA 2QV1A 5DP5A 4ABHA 1OYQA 3P92A 5JBBS 3Q3YA 1MTNC 3DHKH 1SHYA 3TPIZ 4NA8A 2H5CA 5EODA 1LKBA 3RXSA 1J14A 1UCYK 3ZVAA 3BTKE 3MO9A 3RXDA 3SZNA 2XCNA 1ZHMA 3OU0A 3ATMA 1SOTA 1FY4A 2ZU5A 2QIQA 4ABDA 3RXMA 3RC6A 1TB6H 1C5MD 4YLUA 2AMDA 5F03A 1TRMA 2ZCHP 3MNXA 1MTSA 3ZZ4A 1O2UA 5F6MA 3ZYEA 1DOJA 4X1NU 2P59A 4DIIH 1PQ5A 1QB9A 4NIWA 2RA3A 2BMGB 1J17T 2WV5A 3M3VA 4GLYA 4K3JA 5EQRA 3VEQB 3EYDA 3SN8A 1W11U 1EQ9A 3F9FA 3RXUA 5T6GA 3L6PA 1PQAA 3EGKH 4BTTB 1CU1A 2FLBH 4X1QU 1L4ZA 2C3SA 9ESTA 5FHTA 1WOFA 2J9NA 1SSXA 1XUJA 1C1OA 4OGXA 1AHTH 1QBOA 1YCPH 1EPTC 1V2WT 2A4GA 2VWMA 3M36A 2OBQA 3C1KA 3GCOA 1S81A 1OKXA 4WY3A 2AH4X 2BZAA 4ISLA 3GY6A 1C9TA 1SLVB 3MWIU 2WYGA 2PKAB 1IAUA 4YESB 1MU6B 1KXBA 1HAXB 2EEKA 2GT7A 2Y5GA 2M5TA 4GUXA 5EPNA 4MPVA 2FOEA 3HGNA 4NFFA 1TFXA 1DWDH 1P2QA 2H2ZA 2H9HA 2FXRA 1GI4A 3TNSA 4ASHA 1DPOA 8GCHF 5IDKA 1FPHH 1WUNH 1A0LA 1SHHB 1SVPA 1WV7H 1NM6A 1L4DA 1UK4A 4ZKSU 3GY8A 1MCVA 1AD8H 3SNEA 1MKWH 3BF6H 1WTHD 2GP9B 1QRXA 3PWCA 1HRTH 4A1XA 2H9TH 1QURH 3M5NA 2DE9A 2A5IA 2ZDMA 3QWCH 4NWLA 3SORA 1EB1H 1OWIA 3T2NA 3S7HB 3OY5U 2BQWB 2B7DH 2XWBI 1C2LA 3RDZA 1CHOG 4HGCA 1AB9C 2XC0A 5EW2H 2G00A 3NK8A 2UWOA 3SI3H 2EI8A 3QGNB 2FIRH 1L1NA 1N6XA 1KDQA 2QXIA 5HYOA 5GWZA 1O2XA 3GCHB 1T7CA 1E34B 3A7XA 3HKIB 3BTHE 4E06H 1TAWA 1ACBE 2BD7A 3PO1B 1JIRA 4FUFA 2RG3A 1YPGH 2O8UA 2SNVA 5AVDA 5EW1H 2FOCA 3M61U 1VITG 1IQHA 1HGTH 1HCGA 1V2ST 3SI4H 1Z8RA 5GCHF 3ATWA 4DURA 4B74A 2AGGX 5K7RA 3SGAE 1DLKB 5HXFA 3PLPA 3UR9A 1V2JT 3BTQE 1QCPA 3M5LA 1GBIA 1THSH 4X8TH 1Y8TA 4B76A 4MTBA 1ETRH 3ZVGA 3KL6A 1O2IA 2GCTC 1F0TA 6ESTA 5AFZH 1V2UT 1V2RT 2ZDLA 1F92A 1KXEA 3O8BA 1FUJA 2G5NA 2OP9A 2UUFB 3ODFA
chains in the Genus database with same CATH superfamily
1T32A 3S7KB 1O3IA 1ESTA 4CRAA 1MABB 2W26A 1MBMA 2C90B 4ZKOU 3K6ZA 1O36A 2PSYA 2UWLA 2ZU3A 1D3DB 5EIYA 1EOLA 1ELFA 1BMMH 1NROH 1P04A 2PKSB 4Q7XA 1O5CB 3A88A 4GCHF 3U28C 2OINA 4TY6A 1A46H 3KEEA 5HM2A 4CRCA 1HJAB 4B73A 2A5AA 1C9PA 3A7YA 1NZQH 2STAE 4DG4A 1QHRB 1MAYA 2FS8A 2OD3B 1LVOA 1C4U2 1EX3A 1S0QA 4FUBA 2B0FA 1E0FD 1ZSJA 2IN2A 1MTUA 4I8LA 3PRBA 2TBSA 1GG6B 4D9RA 2CHAB 1WQSA 1JRTA 3N7OA 2QF5A 1O2TA 2AFQB 1GBLA 3GCTF 1TE0A 2QXHA 2WINI 4Z6AH 1GI3A 1K22H 1ZTKA 1O3OA 1EFRD 3E3TA 2V3MA 1P11E 2R9PA 3ATIA 3A85A 2LPRA 3KQDA 4H6TA 2NU4E 1UJ1A 1GGDB 2J94A 1DE7H 2FOHA 3HATH 3LGVA 2HPPH 3RXBA 2GVFA 1OYTH 3NCLA 1C1MA 1GBKA 2ANMH 2Z9IA 4H6SB 1BTPA 4U2WA 1G2MA 1N1LA 2F9OA 4UONA 1S6LA 3B9FH 4I32A 1C2EA 1F0RA 2BDBA 3UNQA 1JOUB 3P8NA 2VINA 1AKSA 2PSXA 3O8DA 2F9BH 2O9QA 2CN0H 4FU9A 3E0NB 1DT2A 3LT3A 1BITA 2RDLA 3QZRA 2PLXA 1PQ8A 2Y80A 2GZ7A 1QL7A 2QF4A 2XYAA 3M7UA 1V2KT 5KEDA 3M35A 3BTDE 1K1NA 1O5BB 2RA0A 5T6DA 3RM2H 2FX4A 3GDSA 3WWFA 1SGYE 5FX6A 1TBRH 1XVMA 1TRNA 5E2PA 1HUTH 3SNBA 2FM2A 4ZHLU 2J92A 2ZQ2A 4JK6A 1UTMA 3A82A 2ZCKP 1GPZA 2Z9JA 3DA9B 3W95A 1WCZA 2O8TA 4WH8A 4XDEA 4Y8XA 1AO5A 4R0IA 3CENA 2WPDD 2G51A 3GICB 1MQ6A 2J97A 3CS7A 4IBLH 2ZGBH 1IQJA 3GYLB 4F55A 5B6LA 4ACBA 4VGCB 5C67A 3RMLH 1D6RA 2KM0A 3BTME 3IWMA 2FS9A 4UEHH 3TGKE 4WXIA 1MTNB 2ZPSA 4KTCA 4D9QA 1GMDG 4LOYH 5A8XA 3I78A 1NT1A 3RU4T 2OXSA 1MKXK 3ZVFA 1UTQA 1IQMA 3EA8A 3OTJE 1MD7A 1DY8A 5FXLA 1GI5A 3TITA 1O2WA 4Y76A 4K69A 1FLEE 2HNTC 2A31A 2P94A 2PR3A 2PUQH 2JKHA 1ELBA 2CF9H 1S85A 2ZA5A 4ZROA 4ESTE 1BMFD 1C4Y2 1TNKA 1P57B 1TNLA 1W7XH 2FESH 1QA0A 3LH1A 2W3IA 3SUDA 4M7GA 2HLCA 2BDHA 2BM2A 1GBJA 3F3BA 3NKKA 2ZU2A 4ISOA 2OCVB 2KAIB 4A1TA 1LQEA 6GCHG 5ABWA 1IQLA 5DPAA 1SGEE 1TQ7B 4D76A 5TCAA 2AS9A 1LQDB 5AHGH 1HDTH 1LHFH 4CH8B 2PWXA 5EJZA 4ZKRU 3DSOA 5C5OA 1J16A 4BTIB 2G5VA 1LVYA 1GJ6A 2F9UA 4FUGA 1P3CA 2HVYB 2XCFA 3MNBA 1WSSH 4FOUC 3S9BA 3LPRA 1S82A 5A8ZA 1JXPA 2H5DA 1O2YA 3TU7H 1C1QA 1E38B 3S0NA 1W3CA 1NS3A 1Z7KA 1YPLH 5A2MH 1QNJA 2GX4A 3GY5A 1P06A 3MU8A 2UUJB 3URDA 1JIMA 3SU4A 3T5FH 1AFQB 1QRZA 1UTNA 1KMHB 2Q1JA 2XRCA 1FQ3A 3NRLA 4TSFD 4ABIA 2Q6GA 1GI0A 1GBFA 3F0OA 3RXTA 1DWEH 1ZHPA 3GCHC 4LK4A 3HKJB 5L30H 1UO6A 2UWPA 1C2FA 1C1UH 1EZXC 1XUKA 3PO1C 3UFAA 5KECA 1DANH 3OE7D 1BDAA 1TX6A 1SGIB 3RXQA 4X2XA 1Z6EA 3UQOA 2AMPA 1JRSA 3SU6A 4Y8ZA 4FUCA 1CHGA 2C8YB 2BDIA 1TGTA 3H7TA 4Y7BA 5C0UA 1O3PB 1BBRH 1BTYA 1GJ7B 2ALPA 1UTOA 3L3TA 2R3YA 5F8XA 1EXFA 2HVXA 1W13U 2OC0A 1BTUA 4FUDA 1W0YH 1LVBA 4GSOA 1HJ9A 4D8NA 3SUEA 5BRRE 1GBCA 4AG1A 1K1IA 1G36A 3TH2H 3A80A 3SJ8A 5DKMA 3P6ZB 4Q80A 1MD8A 4GVUA 3A7TA 4IMZA 3LU9B 1JWTA 2J2UA 2WSSD 2F4LA 3QUMP 5A8YA 1BRBE 3BTTE 4XBDA 1C5LH 1OP2A 2ANYA 3MH5A 4X2VA 2A0QB 1GBAA 1FN8A 3M7QA 2BQ6B 2PKSC 2PFEA 3FP7E 1CE5A 2A1DB 1O39A 1UK3A 1UHBA 1V2PT 4NA7A 4X6MA 4AB8A 1KYNA 2EC9H 1HJAC 2BXUH 2OC7A 1AVGH 5DN6D 2RDEA 2VB0A 3D23A 4INHA 1S84A 3P8FA 2ZFSA 4CREA 3FKSD 1D6WA 1KLTA 1XMNB 3D49H 5FL7D 5C20A 3STJA 3DSGA 1OP0A 3LGYA 4WXVA 3F6UH 1AI8H 1D9IA 1NFYA 3FZDA 1S6FA 2CHAC 1NBME 8ESTE 4NIYA 2EI6A 8KME2 1W2KH 3K9XB 2EY4C 2ZU1A 3RXIA 3A7WA 1ANCA 5I46H 4BXWA 2KX4A 3CP7A 4JYVH 1BHXB 2XC4A 3OYPA 1CA0B 2ZECA 3MYWA 3PLBA 4WJG2 4FUHA 1UVPA 1GGDC 3ESTA 4KP0A 1O33A 3QN7A 1PYTD 2NU2E 3V7TA 2FPZA 4XSKU 1IOEA 1AUTC 3RP2A 4HTCH 3U9AH 1ID5H 1LPZB 1MMJN 2PHBA 4JZDH 5E0HA 2FLRH 2BX4A 4JZFH 1XXFA 2OTVA 4THNH 3KCGH 1S0RA 1HXFH 1Z1JA 1AE5A 3H09A 3ATLA 3MH6A 3ZIAD 1SLWB 2XTTB 1KLIH 1SLUB 4IS5A 4RKOB 1AUJA 2ZPQA 4P02A 2BD3A 1LHEH 3EDXB 4F48B 1THRH 2WPIS 3TJOA 1ZSLA 1A5GH 1TNHA 2ZFTA 1OOKB 1E36B 1EPTA 1GHWH 2J34A 1ELDE 1SBWA 4MPWA 5C1XA 1LO6A 2K0QA 2BDYA 4ABAA 5L6NH 2A2XH 1CGIE 4Y7AA 1G32B 1BCUH 1Y59T 3FP6E 5EPYA 1ZLRA 1ZMJA 5DP4A 1EOJA 2JJ1D 1HAHH 3T62A 1VR1H 1SGCA 5G4BA 4OGYA 3FZZA 1TBQH 3NPSA 1SGTA 4NIVA 3SJKA 1ELGA 1YPHE 2ZIQH 4IN1A 4Y8YA 4FUIA 1F0UA 4VGCC 4DOQA 4Q7YA 3E8LA 3OY6U 1G2LA 1C4V2 2ZFQH 4PROA 4I8KA 3SGBE 1ELAA 4K1TA 1YLNA 1P09A 5DSFA 4YOGA 4CBNA 3KF2A 2Z3DA 1DXPA 1ZYOA 4A5TS 3PWBA 1CHOF 1ZPZA 5F8TA 2EA3A 1VCWA 1C2HA 4DW2U 3D62A 2YMSB 4I8JA 2FTMA 4XD7D 1W12U 2SGPE 2VBCA 3SU1A 3FOAA 1QRWA 4UFDH 4ZXYH 2TIOA 2ZDVH 3P70B 4AFQA 3M37A 3PV5A 1O5AB 2BDCA 1AQ7A 4OS1A 5LPEA 4OS2A 1S83A 1B5GH 2BZ6H 2VIWA 2XNIA 2B8OH 3BG8A 1DY9A 1H9LB 1GMCG 3RXAA 1HAVA 4B6EA 1F5RA 1A2CH 5HM9A 3LJOA 1VITF 1Y3UA 4K1SA 1XKBC 2WPKS 1BRAA 3WW7A 1SC8U 5DO4H 4I33A 1EAUA 3F2FA 2H6MA 4XRNA 2KFWA 2ODPA 2AIQA 2NWNA 3BEFB 4AG2A 2WPHS 1JMOH 1TABE 1W0JD 5CDFE 2BXTH 2NU0E 3MNSA 3K6YA 3MTYA 1AFQC 4A7IB 2ANWA 3Q00A 3RMOH 2YOLA 1HAOH 2P3TB 1AY6H 3LC3A 1K1JA 3QX5H 1HFDA 3AASA 3V0XA 1QY6A 4UFEH 5A09A 2RFKC 2Q6FA 1ZPCA 3CS0A 3RXGA 1GJ9B 3C27B 1LDTT 1P2IA 4X0WU 2BLVA 3VFEA 5FPTA 3SV6A 1SQOA 4AC9A 1PYTC 2P3UB 1PPZA 2QC2A 2WYJA 1HIAB 4AFSA 4FVDA 3VB7A 2SGEE 1DS2E 4NCYA 4K1EA 1LHDH 1YPMH 1EJMA 3BIVH 1ZMNA 2FYRA 2PP6A 3Q77A 5DP3A 4HFPB 4AZ2B 3TH4H 3TJNA 5J4SA 1YYY1 2C93B 4AFUA 1ABJH 3SO3A 4CBOA 4BNRA 5DP8A 3UIRA 2FP7B 1GCTB 1C5XB 2BD5A 2OK5A 2G4UA 3UWIA 1VZQH 1ZTLA 5L2YH 3EQ0H 1O0DH 2F43B 1MH0A 4CRFA 2BVSH 4A92A 2BLOA 2QN5T 3SNCA 2CGAA 4MLFB 3RU4D 4ZMAH 5AF9H 4TWYA 1UVUH 1BMNH 4FXGH 4I86A 1SGFA 2O8MA 1GBEA 3DUXH 2VVCA 5IK2D 1V6DA 1CSOE 4MPXA 2K8IA 4JZEH 2R0LA 4K8YA 1GL0E 4YOJA 1GHXH 2ZGHA 4QT8C 1B0FA 2ZHEH 3DFJA 4NG9H 1Q2WA 3E0PB 3PTBA 3GOVB 4AYVB 4KKDA 1Y5AT 2Z94A 2ZTZA 3SJIA 3GDVA 2DE8A 3MFJA 2KCAA 1CT4E 2FTLE 2ZKSA 4K2YA 3RMNH 2ZHDA 1RD3B 5EXMA 2GGVB 3ATKA 2WUCA 2C4FH 4D7GA 3KGPA 2QA9E 2WPLS 3FFGA 1O2NA 3ZVEA 3HPTB 5C0TA 1O2MA 3A87A 3T25A 9LPRA 3VB6A 1T8LA 2GTBA 5A0BA 2F9VA 3SZEA 1B0EA 3AVZA 3F2GA 4B2BA 4O03A 3PTNA 2FX6A 3TGJE 4WVPE 5GNDA 1UTJA 2OBOA 1CA0C 2H9EH 1CGHA 1D3TB 1G3CA 5DK1A 1FAKH 3Q3KA 3MU5A 3GY7A 1FY5A 1VCQA 3TJVA 1DXWA 1XUGA 3GYMA 1GHBG 2BY5X 3EA7A 5TJXA 2VIQA 1O3HA 3E90B 1SB1H 3UWJH 3JZ2B 5EJ1A 5HIZA 2FOMB 2GCHG 3HK6B 1OWEA 1P10A 3MNCA 1RGQA 2ZHFH 1AZ8A 1GMDF 2O8LA 1BA8B 1EAXA 1G3EA 1LVMA 2FOFA 1NFUA 2R2MB 2VNTA 1C5QA 2BDAA 3OX7U 4ISIH 4U01A 3LIWA 1H9IE 4UD9H 5F53A 1L1JA 2ZU4A 4U32A 2HALA 3KQEA 4ABFA 3KN2A 5EG4A 1TNJA 2BX3A 4ZAEA 1O2KA 2Y82A 5AFYH 1NRSH 2PKAA 1EP6A 1MU8B 5EXLA 4XE4A 2BHGA 1GVZA 2LELA 4Y6DA 1TOMH 1INCA 2J98B 3U8TH 5GDSH 1W0KD 3ZZ6A 1P2NA 1T4UH 1YPEH 3PROA 2ODQA 3I77A 5EQSA 1JBUH 3I29A 1KTTB 6GCHF 1ZPBA 2BB4A 3VGCB 2EI7A 1YLDA 2ZFRH 2ZTXA 3T26A 1TPPA 2ZO3H 1C2MA 1L1GA 3MH7A 3UPEA 1UMAH 4H42U 1QR3E 1HJ8A 1A0JA 2IPQX 1CVWH 1J8AA 4WMDA 1O2RA 2FMJA 1O3CA 1YCPK 2BLWA 1GJ8B 2YMSC 3A7VA 2PTCE 4FETA 2F83A 1BRCE 3PYHA 1V2OT 5JYIA 1TQ0B 4NSVA 1FI8A 4CR5A 4ISNA 5L2ZH 1CO7E 3V13A 1GI8B 1GI7B 5HKKD 4GHTA 1EAIA 4YOIA 4MVNA 1UVSH 1UTKA 1Y5BT 1WYKA 1BTWA 2M2AA 2K1QA 3O8RA 3PV2A 1C1NA 4TY7A 4YO9A 2XNDD 2AGIX 3KHVA 2W5EA 3GISB 4A6LA 3A8DA 1MKWK 2FI4E 3MU0A 1SGQE 4Y71A 4NFEA 3TNTA 5C3NA 2ANKH 3MO3A 1SGDE 2Z6BD 1ARBA 1V2LT 2FZZA 3RLYH 5GIBA 4GPGA 2R2WU 3BIUH 4OM9A 5TCCA 4NA9H 1FAXA 3LC5A 2QF3A 1ARCA 2ESTE 4X1PU 5E8EH 5T3HA 2XBVA 1NO9H 1GJ5H 4ZH8A 1O2GH 2A4QA 4WMEA 5H4IB 3S69A 1BHXF 1ZSKA 1PJPA 1TLDA 3ENSB 1TMBH 1DFPA 1QZ8A 2HRVA 1CQQA 2FODA 1H8DH 3GY4A 4MQAA 1PPCE 4NSYA 1KTSB 1F5KU 4BAOB 1OS8A 4AYYB 3D65E 2WZQA 3SUGA 1E1RD 5LPRA 4CRGA 4X6PA 1EJAA 1VJ9U 1C5RA 1O2SA 4FVBA 1O2OA 1O31A 1P9SA 3N99A 1RRKA 1PPBH 1BIOA 2ZWLH 3M5OA 3SV8A 1ZR0A 1Q3XA 1COWD 1ZTJA 1TMUH 2BOKA 1ABIH 2JH6D 3SJOA 2NU3E 2W3KA 2QAAA 3TJUA 1OSSA 1GCTC 1TGCA 1XUHA 1O30A 1UCYH 2I6SA 3M3SA 4BAHB 1GJCB 4AORA 1KY9A 1H8ED 1X7AC 1AWFH 1NFWA 1CT2E 1P2KA 4Q63A 4Q7ZA 2WPMS 1G9IE 5EQQA 4O3TA 3RC4A 3H7OA 1D4PB 5PTPA 1O5EH 1DUEA 3RXEA 1QA7A 1WBGB 1O2JA 1ELVA 2FDAA 2Q6DA 2F91A 2UUKB 3SJ9A 1XVOA 1CGJE 2ZP0H 3GDUA 1LPKB 1P2MA 3E1XB 3DFLA 4BAKB 1C5NH 3K65B 1WU1A 1OHHD 3JZ1B 1IHTH 5F8ZA 4AB9A 1P01A 2Y6TA 3BG4B 3RXKA 2A7CA 4X8UH 1PPGE 6CHAB 2W7SA 3AK5A 1K1PA 4WF8A 5JB8S 2TGPZ 1TGSZ 1GHAG 1DM4B 1XM1A 1E37B 4A1VA 3B23B 4DCDA 1ZZZA 2BD2A 1BOQA 3A84A 1EZUC 1MQ5A 1RTLA 3E16B 1RS0A 2ZDAH 3KYFA 1BZXE 1AWHB 2KCOA 1O3GA 5HMAA 3ZZ3A 7GCHG 3FP8E 4Z0KA 2ZGJA 3M5MA 2F9NA 2P95A 1BTZA 3N7EA 1YP9A 1A5HA 3QLPH 3BTGE 3V12A 1YLCA 1F2SE 1AZZA 3LGTA 4TWWA 1DSUA 3PMJA 2QY0B 3UUZA 4AOQA 3DD2H 3PM3A 1T4VH 1DWCH 4MNVA 1WTGH 1KSNA 3P17H 1FIZA 4P00A 5CHAB 4RN6A 3MU1A 3HGPA 1WDIA 1UK2A 3RXRA 4RT0A 5B6OA 1SPJA 1SOZA 3TK9A 1OPHB 2FI3E 1IQIA 2XC5A 1HV7A 3PLKA 4JZIA 1CBWB 2ZHWH 4MPUA 5JPMH 5CE1A 4AFZA 4TPIZ 4TPYA 3UQVA 1V2QT 4XFQA 2GZ8A 3RMMH 1A4WH 1MUEB 1PPFE 2OC8A 2SGQE 4RI0A 1NC6A 2BY6X 3OFND 3ZZ7A 1BQYA 1EUFA 1Q31A 4JK5A 4UDWH 2VH6A 1KXAA 2ZG0H 1M9UA 3RLWH 1ZMLA 5T1VA 1SMFE 1TA6A 1VJAU 2CJIA 1C5VA 3SGQE 3OSYA 2RCEA 5C1YA 3UREA 3ZZ9A 3V3MA 2VU8E 2P16A 1TPSA 2HNTF 3SHCH 1SL3A 5T6FA 2W7UA 1S6HA 4Y79A 2KR7A 1AGJA 1ETTH 2A2QH 4X2WA 3ZZCA 1G30B 1NU7B 2P93A 3RXCA 4MNXA 4X6OA 5E0JA 3U8RH 3U1JB 1VCPA 2Z3EA 3A83A 2ZF0H 4E05H 2J38A 4MDSA 1HAPH 1P03A 2KAIA 3VB4A 1YF4A 1HYLA 3G01A 3VGCC 4I8GA 1MTWA 1RFNA 1HXEH 2ZGXH 3SV2H 2ODYB 3TH3H 1UTLM 2GMTB 5JDUB 1W0ZU 1FONA 6LPRA 2XWAA 1GMCF 3RXJA 1XXDA 2VWLA 1Z1IA 1GHZA 1TRYA 2BDGA 1A0HB 3RU4E 4BXSA 3DT0H 4NZLA 3SNDA 2TGTA 4B2CA 2Y5FA 2THFB 3UY9A 3RXOA 4HG6A 2ALVA 3GCNA 1O3FA 2GKVE 1C5UA 4BAMB 1TGNA 3M3TA 1T8OA 2W6JD 3LKWA 1DVAH 3A81A 3RC5A 2R0KA 3SW2B 3LH3A 1C2KA 1GJAB 1ZGIA 1AU8A 4ABEA 4O3UA 3SU2A 2Y5HA 1P02A 1FIWA 2HPQH 2BTCE 4RT1A 1O2QA 1A61H 4NZQA 3U69H 1IQEA 1GHVH 2TPIZ 1SFIA 2HNTE 1GBDA 4XBCA 1PFXC 2V0BA 4YM9A 2B5TB 4WWYA 2QGRA 2PGQB 1U6QA 1RIWB 2Z3CA 3DSPA 4H4FA 1HAYB 1MTVA 2FOBA 1GI6A 2SGFE 4J2YB 1KDQB 1YPKH 1ETSH 4FU8A 1TPOA 1BBRE 2ZNKH 1DLEA 1LMWB 4O97A 7ESTE 3MOCA 4D7FA 2Z7FE 2O8WA 1EJNA 2ZFFH 5C94A 2JH0D 3VB5A 3TLOA 3MO6A 2CMYA 2PTNA 1A3EH 1F5LA 1OXGA 2A7HA 4F49A 1P3EA 3A86A 1F7ZA 3SQEE 1QB6A 2NU1E 2SGAA 2G81E 1NY22 2TGDA 1ELCA 3ZZBA 2QYIA 1C1TA 1S5SA 1W7GH 1GBBA 4X1RU 1AE8H 1DUAA 1QBNA 3R0FA 3UNRA 1C5SA 1UTPA 1KXDA 1HBTH 1RTFB 3SU5A 5GXPA 2ULLA 1LCYA 2WV9A 3FVFB 2KCYA 5EOKA 1E35B 1GMHG 4CRBA 1C1SA 1Z8JB 4DT7B 2CK3D 4SGAE 1V2VT 4YT7H 4I8HA 1NU9A 2Z9GA 1SG8B 4X8SH 1P2OA 2FOAA 2V3OH 1HB0B 2BLQA 1SLXB 4CHAB 1BTXA 3ZVBA 1BBRK 7KMEH 4KTSA 3TK5A 3MU4A 2ZEBA 1HNEE 3DCLA 3RXPA 1N8OB 2XBWA 1O3KA 3SU3A 1FX0B 1FZZA 3A8BA 4ZUHA 2XXLA 1C1PA 1B7XB 2G8TA 4BOHA 2D26C 3NZIA 2QXJA 2VVUA 1YM0A 3LJJA 1UW7A 2JETB 5FBEA 4AGKA 1V2TT 1TBZH 1CT0E 4OS5A 3F1SB 1SQRA 4ABGA 1GHBF 3BG4C 3RXFA 3QGJA 1OP8A 3ZZAA 6CHAC 1YY3A 1RTKA 3FO8D 2SFAA 1FMGA 1OWKA 3T27A 2XBXA 2GCHF 3SV9A 3VXEH 3MHWU 1TWXB 2VIDA 3B8JA 1O3MA 2CV3A 2QXGA 1BMLA 1P12E 3URCA 1TPAE 3RM0H 1DDJA 5EU8A 3UNSA 3ELAH 3LGUA 2YMSD 1G37A 1ANBA 5HIYA 4NWKA 1BB0B 4JCNA 1MKXH 1AKSB 4X6NA 3UTUH 1A3BH 1ESAA 1NFXA 3TGIE 1DWBH 1NRNH 1P9UA 1YC0A 3U1IB 4SGBE 3PMHB 1D3QB 1IQNA 3F68H 5GJ4B 1SKYE 5C1UA 1O5GH 2Y7XA 1E1QD 2AGEX 2HGTH 3QK1A 2VH0A 3KQCA 3SV7A 5CHAC 2ZI2H 2OUAA 3ZV8A 3MQKC 1L2EA 1QB1A 1GHYH 1MZDA 3BEUA 4UE7H 3ITIA 1TOCB 1KIGH 3TIUA 5C5NA 4X2YA 1CBWC 2Z9KA 1GI2A 3STIA 2BD9A 3LDXH 1FJSA 1Y5UT 2AERH 2BYAX 4IN2A 3U98H 2F3CE 1YKTA 3EE0B 3T28A 1TYNA 8LPRA 5FCRA 4KTUA 4OS4A 4B71A 1LTOA 1A5IA 4KGAA 1SGPE 1K9OE 1GBMA 5LGOA 1KXFA 2D1JA 2TGAA 3F0PA 1FY8E 4MNYA 1RJXB 1QL9A 1GDUA 1ZHRA 2UUYA 3VXFH 1MBQA 1PPEE 4E7NA 1IQGA 4YT6H 3SYJA 3Q3XA 5GPIB 1T8MA 3AW1A 3SUFA 2VWOA 1TONA 1P0SH 1W10U 4DJZB 4X1SU 3M7TA 2ZZUH 3R3GB 1O2HA 5DG6A 2GV6A 1TA2A 2GDDA 1GJDB 1O37A 1QFKH 5ESTE 4I7YH 1HAIH 1ANDA 1OWJA 1C5WB 2GMTC 3F9EA 1WAYB 3P8GA 3QTVH 3BSQA 1OX1A 1NESE 1C2IA 4ABJA 3UOUA 1C2DA 2GD4B 5JBTA 3ZZ5A 4JYTA 8GCHG 1GVKB 2GDEH 1BJUA 1LKAA 2F9PA 1V2NT 1O38A 1OWHA 1EASA 1AVXA 3UOPA 1QQ4A 1PQ7A 4E7RG 2J4IA 1O3JA 3H5CB 1C5OH 1QL8A 3PMBB 4CR9A 1HLTH 1O3DA 2Y81A 2L74A 1YGCH 2P8OB 1AFEH 2VGCB 2A4OA 5FCKA 1Z8GA 1GCDA 1ZOMA 1K1LA 1O2ZA 4IMQA 4IC6A 4J1YA 1XKAC 1XUFA 5A0CA 4WH6A 1BTHH 4O9VA 3UB0A 4ZHAA 1RIWC 1LPGB 1K1OA 2LNCA 1O34A 2D2DA 1G3DA 3BTEE 1XUIA 4DGJA 1IQFA 3FAOA 3RXHA 2D8WA 2Z9LA 4KELA 2IJOB 1W8BH 2FO9A 4BAQB 2ASUB 2AIPA 3LOXA 1NTPA 1AN1E 1TNGA 5E2OA 2STBE 4AX9H 1GWAA 1HIAA 2XBYA 1J9CH 3MI4A 3PRDA 2FOGA 2BY7X 4RSPA 4YZUA 1EZSC 2HWLB 1O5DH 5K0HA 1NRPH 2OLGA 2A5KA 1L0ZA 2WPJS 1D3PB 1ANEA 1P8VC 2OQ5A 2VWNA 1BJVA 3CNRA 4Y10E 5C17A 1H4WA 1NRRH 4NGAH 3A8CA 1Y3XA 3PV4A 4K5ZA 2JJ2D 1FN6A 2C8XB 2YNBA 2VIPA 5GCHG 3GS9A 5ESBA 2BY8X 4AN7A 1NPMA 3A8AA 2JIZD 1QJ1B 1HAZB 4JZ1A 2FI5E 1Y3WA 4LXBH 1DSTA 1C1WH 1C1RA 4OS7A 1O2LA 3IITA 1LHGH 1VGCB 5DJ7A 1TNIA 2AMQA 2QF0A 1VKYA 2PW8H 4JMYA 5EGMA 1EAWA 1O2VA 3E91A 3A89A 4ZXXH 1GHAF 3Q76A 1TX8A 1QJ6B 1ZRKA 4CRDA 2WUBA 5FX5A 4LZ1H 3AAVA 1MAXA 5BPEA 1FPCH 2ZQ1A 1H8HD 4CHAC 1C2JA 4B2AA 3VG8A 1ELEE 1UHBB 4NIXA 1QGFA 4GCHG 1N6YA 2BQ7B 2PUXB 7GCHF 1N8OC 2CF8H 5DP7A 3OAAD 1GL1A 1GVLA 1SR5C 1WQVH 2VJ1A 1MCTA 1ELTA 1O3LA 2JETC 1O5FH 2FWWA 1TGBA 1SGRE 1C1VH 2ZGCA 1ZJDA 4YLQH 1DITH 3PB1E 3K2UA 5FBIA 3RXLA 2XOKD 5KGOA 3UAIC 2V6NA 1YPJH 3BN9A 2OC1A 1YPHC 4B1TA 1FY1A 3SNAA 1FDPA 1FV9A 1QIXB 2IJD1 4DIHH 3GCTG 3ZZ8A 5EXNA 2IPHA 3A7ZA 3SU0A 4HI3A 1Z6JH 1GBTA 2V35A 1C5TA 3E6PH 1V3XA 1C5PA 3IG6B 3L33A 1ZRBA 1BUIA 2JH5D 4CH2B 1G3BA 3NUMA 5DGJA 3MMGA 3O8CA 1O32A 1J15A 2C8WB 1C5ZB 2G52A 4Y11E 2ZFPH 2YNAA 1O35A 2GT8A 3BTFE 1T31A 1YBWA 1YCPM 1KXCA 2BOHB 3S9AA 3ZVCA 2Y7ZA 2DUCA 5J4QA 2BD8A 1O3AA 2R3UA 4Q4LA 4Z1MD 2J98A 1EPTB 4UFFH 4YXWD 4TYDA 3SHAH 1QBVH 4IGDA 1H9HE 4TT3D 4ISHH 1NRQH 1Y3VA 2GZ9A 1BT7A 1C2GA 3F9GA 1MZAA 1O3EA 1PPHE 3EA9A 1O3NA 1UVTH 1YWUA 4FU7A 2GJGA 1GJBB 1BMAA 4M9FA 4Q2KA 4FUJA 2ZTYA 2WV4A 3KQ5A 2XW9A 4OS6A 3RXVA 1FY3A 2V3HH 2A32A 3RUOA 2ZHQH 1DX5M 5FAHA 4JYUH 2GV7A 2L6OA 4K8BA 3LGIA 4LZ4B 5DP6A 3BV9B 2BY9X 4ASUD 1Y3YA 3T29A 1GBHA 4IC5A 3SOSA 5JBCS 3FN8A 4GHQA 5CMXH 1NN6A 4XBBA 1EKBB 3PMAB 4ZHMU 4ACAA 5JBAS 3OEHD 3KQBA 1GI9B 4GAWA 5E0GA 2BVXH 1QQUA 2I6QA 4INLA 3W94A 4B75A 1AB9B 1KLJH 2IOTA 2PGBB 2ZPRA 1V2MT 1H1BA 4AGJA 4B6FA 4R8TB 5LPFA 5ETXA 4DY7B 4UFGH 3ZYDA 5FPYA 1ORFA 2SGDE 3U8OH 1A7SA 1F0SA 1UVOA 3LONA 3QDZB 1BRUP 1EB2A 2KCPA 2P8OC 4XOJA 2P3FH 2PV9B 3WY8A 1HAVB 2VGCC 2W6ID 5EJLA 1TX7A 1SQAA 2VIOA 2ZDKA 5A0AE 4INKA 1HPGA 4MG3A 1XX9A 3VB3A 2G4TA 3P95A 2ZC9H 2FYQA 1AIXH 2FEQH 4MNWA 2CXVA 2HOBA 2LP6A 3P8OA 2AYWA 4BANB 1Z71A 1ESBA 1P2JA 1FXYA 3GY3A 2JDID 7LPRA 4FUEA 3ZV9A 1GG6C 3MH4A 1P05A 1QTFA 1TIOA 1GMHF 1THPB 1K1MA 4ZCNA 4F4OC 2ZDNA 3F9HA 1K2I1 1GI1A 5FPSA 1H8IH 2J5UA 2GCTB 3SBKA 1ZGVA 1CA8B 1SI5H 1SGFG 3QTOH 4IW4E 4BTUB 2KZ4A 2BD4A 3AAUA 3UR6A 5I25A 1K0HA 3NXPA 1TMTH 2H1UA 5DP9A 3OTPA 2VIVA 3KIDU 1HAGE 4X8VH 2TRMA 3ZZDA 1RXPA 3QO6A 1UCYE 3WWBA 2AHME 3BTWE 4I31A 2AEIH 1A1RA 1ZJKA 2G55A 3SQHE 2A45B 2C8ZB 5LH8A 3TK6A 3AW0A 1T8NA 1C5YB 3NWUA 1AMHA 1W14U 3EAJA 4ZKNU 1SQTA 1GJ4H 2A7JA 4Y0ZE 2J95A 4K60A 1SFQB 1DICA 3VPKA 3W1EA 2SNWA 1FNIA 1IHSH 2OQUA 3EE7A 3TVJB 3QZQA 1SGNE 2ILNA 1QJ7B 4U30A 1LHCH 1K21H 3BEIB 5HGGA 1O2PA 1VGCC 3ODDA 5SGAE 3FANA 1VITH 1GDQA 2B9LA 4ABBA 4Y0YE 5C2ZA 2ZCLP 1IQKA 3LGWA 1AVWA 2QCYA 5IYTA 1GDNA 5JB9S 4HZHA 3KNXA 3S9CA 2EQNA 4YTAA 1EZQA 2BVRH 1EATA 1K28D 2VVVA 4WMFA 1OWDA 2V7QD 4RKJB 4DVAU 1TALA 5CHBA 1EP5A 3GY2A 3HK3B 3ZVDA 2A4RA 1Z8IB 1O3BA 2QV1A 5DP5A 4ABHA 1OYQA 3P92A 5JBBS 3Q3YA 1MTNC 3DHKH 1SHYA 3TPIZ 4NA8A 2H5CA 5EODA 1LKBA 3RXSA 1J14A 1UCYK 3ZVAA 3BTKE 3MO9A 3RXDA 3SZNA 2XCNA 1ZHMA 3OU0A 3ATMA 1SOTA 1FY4A 2ZU5A 2QIQA 4ABDA 3RXMA 1E79D 3RC6A 1TB6H 1C5MD 4YLUA 2AMDA 2WHXA 5F03A 1TRMA 2ZCHP 3MNXA 1MTSA 3ZZ4A 1O2UA 5F6MA 3ZYEA 1DOJA 1WXRA 4X1NU 2P59A 3KYGA 4DIIH 1PQ5A 1QB9A 4NIWA 2RA3A 2BMGB 1J17T 2WV5A 3M3VA 4GLYA 4K3JA 5EQRA 3VEQB 3EYDA 3SN8A 1W11U 1EQ9A 3F9FA 3RXUA 5T6GA 3L6PA 1PQAA 3EGKH 4BTTB 1CU1A 2FLBH 4X1QU 1L4ZA 2C3SA 9ESTA 5FHTA 1WOFA 2J9NA 1SSXA 3N7DA 1XUJA 1C1OA 4OGXA 1AHTH 1QBOA 1YCPH 3F2HA 1EPTC 2HLDD 1V2WT 2A4GA 2VWMA 3M36A 2OBQA 3C1KA 3GCOA 1S81A 1OKXA 4WY3A 2AH4X 2BZAA 4ISLA 3GY6A 1C9TA 1SLVB 3MWIU 2WYGA 1IAUA 2PKAB 4YESB 1MU6B 1KXBA 1HAXB 2EEKA 2GT7A 2Y5GA 2M5TA 4GUXA 5EPNA 4MPVA 2FOEA 3HGNA 4NFFA 1TFXA 1DWDH 1P2QA 2H2ZA 2H9HA 2FXRA 1GI4A 3TNSA 4ASHA 1DPOA 8GCHF 5IDKA 1FPHH 1WUNH 1A0LA 1SHHB 1SVPA 1WV7H 1NM6A 1L4DA 1UK4A 4ZKSU 3GY8A 1MCVA 1AD8H 3SNEA 1MKWH 3BF6H 1WTHD 2GP9B 1QRXA 1NBMD 3PWCA 1HRTH 4A1XA 2H9TH 1QURH 3M5NA 2DE9A 2A5IA 2ZDMA 3QWCH 4NWLA 3SORA 1EB1H 1OWIA 3T2NA 3S7HB 3OY5U 2BQWB 2B7DH 2XWBI 1C2LA 3RDZA 1CHOG 4HGCA 1AB9C 2XC0A 2QE7D 5EW2H 2G00A 3NK8A 2UWOA 3SI3H 2EI8A 3QGNB 2FIRH 1L1NA 1N6XA 1KDQA 2QXIA 5HYOA 5GWZA 1O2XA 3GCHB 1T7CA 1E34B 3A7XA 3HKIB 3BTHE 4E06H 1TAWA 1ACBE 2BD7A 3PO1B 1JIRA 4FUFA 2RG3A 1YPGH 2O8UA 2SNVA 5AVDA 5EW1H 2FOCA 3M61U 4DT4A 1VITG 1IQHA 1HGTH 1HCGA 1V2ST 3SI4H 1Z8RA 5GCHF 3ATWA 4DURA 4B74A 2AGGX 5K7RA 3SGAE 1DLKB 5HXFA 3PLPA 3UR9A 1V2JT 3BTQE 1QCPA 3M5LA 1GBIA 1THSH 3OEED 4X8TH 1Y8TA 4B76A 4MTBA 1ETRH 3ZVGA 3KL6A 1O2IA 2GCTC 1F0TA 6ESTA 5AFZH 1V2UT 1V2RT 2ZDLA 1F92A 1KXEA 3O8BA 1FUJA 2G5NA 2OP9A 2UUFB 3ODFA
chains in the Genus database with same CATH topology
1T32A 3S7KB 1O3IA 1ESTA 4CRAA 2W26A 1MBMA 2C90B 4ZKOU 3K6ZA 1O36A 2PSYA 2UWLA 2ZU3A 1D3DB 1EOLA 1ELFA 1BMMH 1NROH 1P04A 2PKSB 4Q7XA 1O5CB 3A88A 4GCHF 2OINA 4TY6A 1A46H 3KEEA 5HM2A 4CRCA 1HJAB 4B73A 2A5AA 1C9PA 3A7YA 1NZQH 2STAE 4DG4A 1QHRB 1MAYA 2FS8A 2OD3B 1LVOA 1C4U2 1EX3A 1S0QA 4FUBA 2B0FA 1E0FD 1ZSJA 2IN2A 1MTUA 4I8LA 2TBSA 1GG6B 4D9RA 2CHAB 1WQSA 1JRTA 3N7OA 1O2TA 2AFQB 1GBLA 3GCTF 1TE0A 2QXHA 2WINI 4Z6AH 1GI3A 1K22H 1ZTKA 1O3OA 3E3TA 1P11E 2R9PA 3ATIA 3A85A 2LPRA 3KQDA 4H6TA 2NU4E 1UJ1A 1GGDB 2J94A 1DE7H 2FOHA 3HATH 3LGVA 2HPPH 3RXBA 2GVFA 1OYTH 3NCLA 1C1MA 1GBKA 2ANMH 2Z9IA 4H6SB 1BTPA 4U2WA 1G2MA 1N1LA 2F9OA 4UONA 3B9FH 4I32A 1C2EA 1F0RA 2BDBA 3UNQA 1JOUB 3P8NA 2VINA 1AKSA 2PSXA 3O8DA 2F9BH 2O9QA 2CN0H 4FU9A 3E0NB 1DT2A 3LT3A 1BITA 2RDLA 3QZRA 2PLXA 1PQ8A 2Y80A 2GZ7A 1QL7A 2XYAA 3M7UA 1V2KT 3M35A 3BTDE 1K1NA 1O5BB 2RA0A 5T6DA 3RM2H 2FX4A 3GDSA 1SGYE 5FX6A 1TBRH 1XVMA 1TRNA 5E2PA 1HUTH 3SNBA 2FM2A 4ZHLU 2J92A 2ZQ2A 4JK6A 1UTMA 3A82A 2ZCKP 1GPZA 2Z9JA 3DA9B 3W95A 1WCZA 2O8TA 4WH8A 4XDEA 4Y8XA 1AO5A 4R0IA 3CENA 2G51A 3GICB 1MQ6A 3CS7A 4IBLH 2ZGBH 1IQJA 3GYLB 4VGCB 5C67A 3RMLH 1D6RA 3BTME 3IWMA 2FS9A 4UEHH 3TGKE 4WXIA 1MTNB 2ZPSA 4KTCA 4D9QA 1GMDG 4LOYH 5A8XA 3I78A 1NT1A 3RU4T 2OXSA 1MKXK 3ZVFA 1UTQA 1IQMA 3EA8A 3OTJE 1MD7A 1DY8A 5FXLA 1GI5A 3TITA 1O2WA 4Y76A 4K69A 1FLEE 2HNTC 2A31A 2P94A 2PR3A 2PUQH 2JKHA 1ELBA 2CF9H 1S85A 2ZA5A 4ZROA 4ESTE 1C4Y2 1TNKA 1P57B 1TNLA 1W7XH 2FESH 1QA0A 3LH1A 2W3IA 3SUDA 4M7GA 2HLCA 2BDHA 2BM2A 1GBJA 3NKKA 2ZU2A 4ISOA 2OCVB 2KAIB 4A1TA 1LQEA 6GCHG 5ABWA 1IQLA 5DPAA 1SGEE 1TQ7B 4D76A 5TCAA 2AS9A 1LQDB 5AHGH 1HDTH 1LHFH 4CH8B 2PWXA 4ZKRU 5C5OA 1J16A 4BTIB 2G5VA 1LVYA 1GJ6A 2F9UA 4FUGA 1P3CA 2XCFA 3MNBA 1WSSH 3S9BA 3LPRA 1S82A 5A8ZA 1JXPA 2H5DA 1O2YA 3TU7H 1C1QA 1E38B 3S0NA 1W3CA 1NS3A 1Z7KA 1YPLH 5A2MH 1QNJA 2GX4A 3GY5A 1P06A 3MU8A 2UUJB 3URDA 1JIMA 3SU4A 3T5FH 1AFQB 1QRZA 1UTNA 2Q1JA 2XRCA 1FQ3A 4ABIA 2Q6GA 1GI0A 1GBFA 3RXTA 1DWEH 1ZHPA 3GCHC 4LK4A 3HKJB 5L30H 1UO6A 2UWPA 1C2FA 1C1UH 1EZXC 1XUKA 3PO1C 3UFAA 1DANH 1BDAA 1TX6A 1SGIB 3RXQA 4X2XA 1Z6EA 3UQOA 2AMPA 1JRSA 3SU6A 4Y8ZA 4FUCA 1CHGA 2C8YB 2BDIA 1TGTA 3H7TA 4Y7BA 1O3PB 1BBRH 1BTYA 1GJ7B 2ALPA 1UTOA 3L3TA 2R3YA 5F8XA 1EXFA 2HVXA 1W13U 2OC0A 1BTUA 4FUDA 1W0YH 1LVBA 4GSOA 1HJ9A 4D8NA 3SUEA 5BRRE 1GBCA 4AG1A 1K1IA 1G36A 3TH2H 3A80A 3SJ8A 5DKMA 3P6ZB 4Q80A 1MD8A 4GVUA 3A7TA 4IMZA 3LU9B 1JWTA 2J2UA 3QUMP 5A8YA 1BRBE 3BTTE 4XBDA 1C5LH 1OP2A 2ANYA 3MH5A 4X2VA 2A0QB 1GBAA 1FN8A 3M7QA 2BQ6B 2PKSC 2PFEA 3FP7E 1CE5A 2A1DB 1O39A 1UK3A 1UHBA 1V2PT 4NA7A 4X6MA 4AB8A 1KYNA 2EC9H 1HJAC 2BXUH 2OC7A 1AVGH 2VB0A 3D23A 4INHA 1S84A 3P8FA 2ZFSA 4CREA 1D6WA 1KLTA 1XMNB 3D49H 5C20A 3STJA 1OP0A 3LGYA 4WXVA 3F6UH 1AI8H 1D9IA 1NFYA 3FZDA 1S6FA 2CHAC 8ESTE 4NIYA 2EI6A 8KME2 1W2KH 3K9XB 3RXIA 2ZU1A 3A7WA 1ANCA 5I46H 4BXWA 3CP7A 4JYVH 1BHXB 2XC4A 3OYPA 1CA0B 2ZECA 3MYWA 3PLBA 4WJG2 4FUHA 1UVPA 1GGDC 3ESTA 4KP0A 1O33A 3QN7A 1PYTD 2NU2E 3V7TA 2FPZA 4XSKU 1IOEA 1AUTC 3RP2A 4HTCH 3U9AH 1ID5H 1LPZB 1MMJN 2PHBA 4JZDH 5E0HA 2FLRH 2BX4A 4JZFH 1XXFA 2OTVA 4THNH 3KCGH 1S0RA 1HXFH 1Z1JA 1AE5A 3MH6A 3ATLA 1SLWB 2XTTB 1KLIH 1SLUB 4IS5A 4RKOB 1AUJA 2ZPQA 2BD3A 1LHEH 3EDXB 1THRH 2WPIS 3TJOA 1ZSLA 1A5GH 1TNHA 2ZFTA 1OOKB 1E36B 1EPTA 1GHWH 2J34A 1ELDE 1SBWA 4MPWA 5C1XA 1LO6A 4ABAA 2BDYA 5L6NH 2A2XH 1CGIE 4Y7AA 1G32B 1BCUH 1Y59T 3FP6E 5EPYA 1ZLRA 1ZMJA 5DP4A 1EOJA 1HAHH 3T62A 1VR1H 1SGCA 5G4BA 4OGYA 3FZZA 1TBQH 3NPSA 1SGTA 4NIVA 3SJKA 1ELGA 1YPHE 2ZIQH 4IN1A 4Y8YA 4FUIA 1F0UA 4VGCC 4DOQA 4Q7YA 3E8LA 3OY6U 1G2LA 1C4V2 2ZFQH 4PROA 4I8KA 3SGBE 1ELAA 4K1TA 1P09A 4YOGA 4CBNA 3KF2A 2Z3DA 1DXPA 1ZYOA 4A5TS 3PWBA 1CHOF 1ZPZA 5F8TA 2EA3A 1VCWA 1C2HA 4DW2U 3D62A 4I8JA 2FTMA 1W12U 2SGPE 3SU1A 1QRWA 4UFDH 4ZXYH 2TIOA 2ZDVH 3P70B 4AFQA 3M37A 1O5AB 2BDCA 1AQ7A 4OS1A 5LPEA 4OS2A 1S83A 1B5GH 2BZ6H 2VIWA 2XNIA 2B8OH 3BG8A 1DY9A 1H9LB 1GMCG 3RXAA 1HAVA 1F5RA 1A2CH 5HM9A 3LJOA 1VITF 1Y3UA 4K1SA 1XKBC 2WPKS 1BRAA 5DO4H 1SC8U 4I33A 1EAUA 2H6MA 2ODPA 2AIQA 2NWNA 3BEFB 4AG2A 2WPHS 1JMOH 1TABE 2BXTH 2NU0E 3MNSA 3K6YA 3MTYA 1AFQC 4A7IB 2ANWA 3Q00A 3RMOH 2YOLA 1HAOH 2P3TB 1AY6H 3LC3A 1K1JA 3QX5H 1HFDA 3AASA 3V0XA 1QY6A 4UFEH 5A09A 2Q6FA 1ZPCA 3CS0A 3RXGA 1GJ9B 3C27B 1LDTT 1P2IA 4X0WU 2BLVA 3VFEA 5FPTA 3SV6A 1SQOA 1PYTC 2P3UB 1PPZA 2QC2A 2WYJA 1HIAB 4AFSA 4FVDA 3VB7A 2SGEE 1DS2E 4NCYA 4K1EA 1LHDH 1YPMH 1EJMA 3BIVH 1ZMNA 2FYRA 3Q77A 5DP3A 4HFPB 4AZ2B 3TH4H 3TJNA 5J4SA 1YYY1 2C93B 4AFUA 1ABJH 3SO3A 4CBOA 4BNRA 5DP8A 3UIRA 2FP7B 1GCTB 1C5XB 2BD5A 2G4UA 3UWIA 1VZQH 1ZTLA 5L2YH 3EQ0H 1O0DH 1MH0A 4CRFA 2BVSH 4A92A 2BLOA 2QN5T 3SNCA 2CGAA 4MLFB 3RU4D 4ZMAH 5AF9H 4TWYA 1UVUH 1BMNH 4FXGH 1SGFA 2O8MA 1GBEA 3DUXH 2VVCA 1V6DA 1CSOE 4MPXA 4JZEH 2R0LA 4K8YA 1GL0E 4YOJA 1GHXH 2ZGHA 4QT8C 1B0FA 2ZHEH 3DFJA 4NG9H 1Q2WA 3E0PB 3PTBA 3GOVB 4AYVB 4KKDA 1Y5AT 2Z94A 2ZTZA 3SJIA 3GDVA 2DE8A 3MFJA 1CT4E 2FTLE 2ZKSA 4K2YA 3RMNH 2ZHDA 1RD3B 5EXMA 2GGVB 3ATKA 2WUCA 2C4FH 4D7GA 3KGPA 2QA9E 2WPLS 3FFGA 1O2NA 3ZVEA 3HPTB 1O2MA 3A87A 3T25A 9LPRA 3VB6A 1T8LA 2GTBA 5A0BA 2F9VA 1B0EA 3AVZA 4B2BA 4O03A 3PTNA 2FX6A 3TGJE 4WVPE 1UTJA 2OBOA 1CA0C 2H9EH 1CGHA 1D3TB 1G3CA 5DK1A 1FAKH 3Q3KA 3MU5A 3GY7A 1FY5A 1VCQA 3TJVA 1DXWA 1XUGA 3GYMA 1GHBG 2BY5X 3EA7A 5TJXA 2VIQA 1O3HA 3E90B 1SB1H 3UWJH 3JZ2B 2FOMB 2GCHG 3HK6B 1OWEA 1P10A 3MNCA 1RGQA 2ZHFH 1AZ8A 1GMDF 2O8LA 1BA8B 1EAXA 1G3EA 1LVMA 2FOFA 1NFUA 2R2MB 2VNTA 1C5QA 2BDAA 3OX7U 4ISIH 4U01A 3LIWA 1H9IE 4UD9H 1L1JA 2ZU4A 4U32A 2HALA 3KQEA 4ABFA 3KN2A 5EG4A 1TNJA 2BX3A 4ZAEA 1O2KA 2Y82A 5AFYH 1NRSH 2PKAA 1EP6A 1MU8B 5EXLA 4XE4A 2BHGA 1GVZA 4Y6DA 1TOMH 1INCA 3U8TH 5GDSH 3ZZ6A 1P2NA 1T4UH 1YPEH 3PROA 2ODQA 3I77A 5EQSA 1JBUH 3I29A 1KTTB 6GCHF 1ZPBA 2BB4A 3VGCB 2EI7A 1YLDA 2ZFRH 2ZTXA 3T26A 1TPPA 2ZO3H 1C2MA 1L1GA 3MH7A 3UPEA 1UMAH 4H42U 1QR3E 1HJ8A 1A0JA 1CVWH 1J8AA 4WMDA 1O2RA 2FMJA 1O3CA 1YCPK 2BLWA 1GJ8B 3A7VA 2PTCE 2F83A 1BRCE 3PYHA 1V2OT 5JYIA 1TQ0B 4NSVA 1FI8A 4CR5A 4ISNA 5L2ZH 1CO7E 3V13A 1GI8B 1GI7B 4GHTA 1EAIA 4YOIA 4MVNA 1UVSH 1UTKA 1Y5BT 1WYKA 1BTWA 2K1QA 3O8RA 1C1NA 4TY7A 4YO9A 2AGIX 3KHVA 2W5EA 3GISB 4A6LA 3A8DA 1MKWK 2FI4E 3MU0A 1SGQE 4Y71A 4NFEA 3TNTA 5C3NA 2ANKH 3MO3A 1SGDE 2Z6BD 1ARBA 1V2LT 2FZZA 3RLYH 5GIBA 4GPGA 2R2WU 3BIUH 5TCCA 4NA9H 1FAXA 3LC5A 2QF3A 1ARCA 2ESTE 4X1PU 5E8EH 5T3HA 2XBVA 1NO9H 1GJ5H 4ZH8A 1O2GH 2A4QA 4WMEA 5H4IB 3S69A 1BHXF 1ZSKA 1PJPA 1TLDA 3ENSB 1TMBH 1DFPA 2HRVA 1CQQA 2FODA 1H8DH 3GY4A 4MQAA 1PPCE 4NSYA 1KTSB 1F5KU 4BAOB 1OS8A 4AYYB 3D65E 3SUGA 5LPRA 4CRGA 4X6PA 1EJAA 1VJ9U 1C5RA 1O2SA 4FVBA 1O2OA 1O31A 1P9SA 1RRKA 1PPBH 1BIOA 2ZWLH 3M5OA 3SV8A 1ZR0A 1Q3XA 1ZTJA 1TMUH 2BOKA 1ABIH 2JH6D 3SJOA 2NU3E 2W3KA 2QAAA 3TJUA 1OSSA 1GCTC 1TGCA 1XUHA 1O30A 1UCYH 2I6SA 3M3SA 4BAHB 1GJCB 4AORA 1KY9A 1X7AC 1AWFH 1NFWA 1CT2E 1P2KA 4Q7ZA 2WPMS 1G9IE 5EQQA 4O3TA 3RC4A 3H7OA 1D4PB 5PTPA 1O5EH 1DUEA 3RXEA 1QA7A 1WBGB 1O2JA 1ELVA 2FDAA 2Q6DA 2F91A 2UUKB 3SJ9A 1XVOA 1CGJE 2ZP0H 3GDUA 1LPKB 1P2MA 3E1XB 3DFLA 4BAKB 1C5NH 3K65B 1WU1A 3JZ1B 1IHTH 5F8ZA 4AB9A 1P01A 2Y6TA 3BG4B 3RXKA 2A7CA 4X8UH 1PPGE 6CHAB 2W7SA 1K1PA 4WF8A 5JB8S 2TGPZ 1TGSZ 1GHAG 1DM4B 1XM1A 1E37B 4A1VA 3B23B 4DCDA 1ZZZA 2BD2A 1BOQA 3A84A 1EZUC 1MQ5A 1RTLA 3E16B 1RS0A 2ZDAH 1BZXE 1AWHB 1O3GA 5HMAA 3ZZ3A 7GCHG 3FP8E 4Z0KA 2ZGJA 3M5MA 2F9NA 2P95A 1BTZA 1YP9A 1A5HA 3QLPH 3BTGE 3V12A 1YLCA 1F2SE 1AZZA 3LGTA 4TWWA 1DSUA 3PMJA 2QY0B 3UUZA 4AOQA 3DD2H 3PM3A 1T4VH 1DWCH 4MNVA 1WTGH 1KSNA 3P17H 1FIZA 5CHAB 4RN6A 3MU1A 3HGPA 1UK2A 3RXRA 5B6OA 1SPJA 1SOZA 3TK9A 1OPHB 2FI3E 1IQIA 2XC5A 1HV7A 3PLKA 4JZIA 1CBWB 2ZHWH 4MPUA 5JPMH 5CE1A 4AFZA 4TPIZ 4TPYA 3UQVA 1V2QT 4XFQA 2GZ8A 3RMMH 1A4WH 1MUEB 1PPFE 2OC8A 2SGQE 1NC6A 2BY6X 3ZZ7A 1BQYA 1EUFA 1Q31A 4JK5A 4UDWH 2VH6A 1KXAA 2ZG0H 1M9UA 3RLWH 1ZMLA 1SMFE 1TA6A 1VJAU 2CJIA 1C5VA 3SGQE 3OSYA 2RCEA 5C1YA 3UREA 3ZZ9A 3V3MA 2VU8E 2P16A 1TPSA