4FUDA

Crystal structure of the urokinase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 61
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fudA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fudA01
4AZ2B 3GISB 1QTFA 2CJIA 2FLBH 4VGCC 5PTPA 2ZCLP 5A8ZA 3SJOA 3MU8A 4BNRA 4GCHF 1WAYB 1UO6A 1UTLM 4CBOA 1QIXB 2EI6A 4KGAA 1Y3XA 1L4DA 3GY4A 1IQJA 1E38B 3UIRA 3PTBA 1SGFA 2FI4E 1K21H 3BTHE 1C2FA 2B7DH 1C5YB 1THPB 1TYNA 1O2QA 1FUJA 1CGHA 2H9EH 2AGGX 1TA6A 3BEUA 1EATA 3SGAE 3VB3A 1QGFA 2D8WA 2F9NA 2PGBB 3NZIA 3ATKA 2RDLA 1WTHD 2EEKA 1UVOA 2B9LA 2A5AA 3GYMA 4FVDA 2FXRA 1SGRE 5DPAA 2OTVA 1NPMA 1GI0A 2FOAA 1ZGIA 4I8KA 3ZZ6A 5C3NA 3SGQE 2UWPA 2ZTXA 3RXMA 2H5DA 1YPHC 2CXVA 3NKKA 4B75A 4DY7B 1GHXH 1NESE 1FXYA 1UVUH 3SI4H 2B0FA 5FPSA 3SO3A 3CS7A 1GMDG 1Y3UA 3SBKA 2VNTA 4ZKNU 1XX9A 5FBEA 1O2KA 3RXIA 3P95A 2ILNA 2QAAA 1VJ9U 1RIWC 3PMJA 2ANYA 1GJCB 1AZZA 1UMAH 4Q7YA 3LH1A 1HAVA 5E0JA 3A8DA 2H5CA 1SG8B 1AB9C 4I32A 1DLEA 5EW1H 1O2ZA 2OBQA 1NM6A 4HGCA 3MH7A 4X2XA 1H8IH 1WOFA 2J2UA 2A4RA 1XM1A 3MO9A 5HYOA 2FTMA 4WMFA 3TGKE 1HGTH 4JZIA 4O3UA 4OS4A 2AS9A 1TIOA 1C5LH 1SGIB 2A7HA 1EAIA 4CRFA 2O8TA 2ZHDA 1MZAA 3OY5U 3V13A 3BTTE 1VITF 1MMJN 2OBOA 1NTPA 1EP6A 2Z9JA 1O2SA 3BTWE 3URCA 4J2YB 1WQVH 2WPLS 3QTVH 3A87A 1MQ5A 2ZDMA 2UUKB 1LPGB 1UCYK 4IGDA 1O38A 2ZZUH 2VWNA 2GZ7A 4X6PA 4WH8A 1V2WT 2JH6D 4GHTA 1NRSH 3GCHB 2HLCA 3SGBE 2ZECA 2CN0H 1C5XB 2ZWLH 1C5WB 5CE1A 2PUQH 1HYLA 1EAUA 4O03A 4SGBE 3SV8A 3M5OA 3MU5A 1DM4B 2BTCE 1AVGH 2Z9IA 3LT3A 5GPIB 3PO1C 1EKBB 1C5SA 5AVDA 5BRRE 4BTIB 2BDIA 3L3TA 1TFXA 2WV5A 1SGFG 3KQEA 4XBBA 1TMTH 1ZTJA 2QF3A 1C5TA 3A84A 2ZU4A 4JK5A 3RU4T 1Q3XA 1LKBA 1CHOF 1TNJA 1GMDF 1G9IE 3EGKH 1AVWA 1CT4E 1TAWA 3PWCA 1HNEE 1AWFH 1OPHB 4X1SU 2G81E 4E06H 5EU8A 2PKSB 2ZGJA 1CU1A 3GDUA 1DWCH 1HJ8A 1LKAA 2FOMB 3LGTA 4JYTA 1KXCA 1O2OA 1O5AB 1SGQE 5TJXA 1FY8E 4XBCA 1FY1A 1GI2A 2BDGA 2LPRA 4BTUB 3BTME 5FHTA 1G3DA 1KSNA 1AWHB 1NFUA 2ZHEH 1SGCA 3DFLA 1GJ4H 2TPIZ 1J17T 2AIPA 3F1SB 4FUIA 1WBGB 2ZCHP 1P8VC 4WMEA 1HJ9A 1NU7B 3T25A 4I33A 3VB5A 3BEFB 4OS2A 4GPGA 1GHBF 2J95A 3UPEA 1RS0A 1FAKH 4NA8A 4ZXXH 3RXPA 3SV7A 1GL1A 4ABGA 4IN2A 4ABEA 2ZTZA 1MKWK 2PKAB 3BG4B 4FUFA 4BXWA 1TNGA 1UJ1A 3STJA 3HKJB 3RXVA 1DT2A 3UUZA 1A7SA 3NCLA 5GJ4B 1Z8RA 1YPHE 1CSOE 3BTQE 1XKAC 1THRH 1HJAB 1V2ST 1GI1A 5ESTE 1HAIH 4D9RA 4YOJA 1PPCE 3MNXA 1PPGE 2ZA5A 4H6SB 1FQ3A 1O39A 1P06A 1VZQH 1WCZA 1F2SE 1G3CA 2SFAA 1XXDA 2ZDNA 1K1PA 1Y5BT 1O3JA 2G51A 7ESTE 1O2MA 1V6DA 3O8RA 3LPRA 1DY9A 3TJOA 4IS5A 5HM2A 1TPOA 2JETB 4OGXA 1MD8A 1ZHRA 4K60A 2G52A 3RXEA 4FU9A 1UCYE 1ESBA 1UTNA 4X1RU 1DLKB 2BHGA 3D65E 3W95A 6ESTA 4O3TA 1TLDA 1GPZA 1W14U 1YLCA 4A5TS 2TGPZ 1HLTH 1A2CH 1DFPA 1G3EA 4IN1A 3U98H 2CV3A 1O2VA 2C90B 1OYTH 1P2MA 4ASHA 1AE8H 1AB9B 1INCA 3RXBA 4DVAU 3RXAA 1ETSH 2PKAA 4Y76A 4AFZA 2AGIX 3ZYDA 4A7IB 1UTOA 1S0RA 1LHGH 1ZJDA 1O2RA 3ATLA 1N8OB 3IWMA 1RTKA 2OCVB 1CT2E 4ISIH 3OU0A 2Z6BD 3GCNA 2P3FH 9ESTA 1AFQB 4INHA 3WY8A 2GMTB 1OWJA 3UWIA 1TGBA 2YOLA 3A8BA 4X2YA 2FX6A 1TMBH 1YKTA 3SJ8A 1W0YH 2GV7A 2VIVA 2AERH 1CA0B 3RLYH 1TNKA 2DE8A 5JBAS 3AW1A 1W8BH 3SQHE 1HBTH 3V7TA 2Z3CA 5A8YA 1S5SA 4I8HA 1QBNA 2FYRA 2BVXH 3LIWA 2OC8A 4D8NA 1O34A 2BB4A 1C1SA 3MU4A 2W5EA 5K7RA 3TJNA 2PR3A 1YYY1 1ZHMA 3SU2A 1O2TA 1P2NA 3SN8A 3IG6B 2CMYA 1QHRB 2P59A 4CR5A 2ZEBA 1YLDA 2H1UA 1O3GA 5EG4A 2O9QA 4Y8ZA 2HNTE 4YOIA 5DO4H 2XWBI 1K9OE 3S9CA 2WV4A 4HI3A 1HXEH 4MTBA 3TLOA 2R0KA 3K6ZA 4YLQH 3EE0B 4RKOB 1W7GH 3HK3B 1X7AC 3MH4A 1RGQA 3S7HB 3SNDA 1GHBG 5IYTA 1W7XH 3LGUA 1SOZA 3QDZB 1DDJA 1C1MA 2OD3B 3RM2H 1S83A 3DD2H 2OC7A 2ZDAH 1KLTA 6LPRA 1UTPA 1A5GH 1THSH 4FU7A 1P9SA 1O2NA 2O8LA 5EODA 2QXIA 2F91A 1O2PA 2ZU2A 1EZSC 3LDXH 2CHAC 3JZ2B 1C2EA 1EUFA 1GMHG 5JBBS 1TX6A 1DANH 5DP9A 4B74A 2STBE 1SLUB 3ESTA 3VGCB 3S9BA 3E3TA 1DSTA 2BY8X 2PSYA 4ESTE 4Q80A 3MI4A 1AZ8A 1GHZA 2ESTE 1NFXA 3A7XA 4UFFH 4NCYA 3RXTA 4BAKB 5L2ZH 2QXHA 3PMAB 3MHWU 1H8DH 1OS8A 1K1NA 1T8MA 1C1UH 1E0FD 1BTUA 5A2MH 4I8JA 2VVCA 2P95A 4UFGH 4ZMAH 3GICB 4DGJA 3TGIE 1IQMA 1A4WH 1C1VH 1SLVB 3F6UH 5FXLA 1ETRH 2FI5E 4CH2B 1RXPA 2BX3A 2XC5A 1DXPA 2BD5A 4E7NA 1IQEA 1O37A 3M7QA 1TQ0B 5EXLA 2FOCA 3KGPA 1BRAA 2CGAA 1BRCE 1Z7KA 1JRSA 1CVWH 1O33A 4Y8YA 2QGRA 3UOPA 4Z0KA 2YNBA 1GBTA 1GHWH 2FESH 1UVTH 1V2PT 2UUYA 4GVUA 5C67A 2XBXA 2BDYA 3RMOH 1MTNB 3VB7A 4KTCA 1SLXB 3A7WA 1GI9B 3UNRA 2ZFQH 1DVAH 1QURH 1EOLA 1GDNA 1WSSH 4Q7ZA 3VXFH 4ABBA 3EDXB 4FU8A 2DE9A 1DY8A 2VINA 2C8ZB 1FN6A 3QK1A 1W11U 2ZGCA 1NO9H 3MNCA 1ZR0A 1EZUC 1N1LA 1WTGH 3M7UA 1T31A 1EAXA 1WQSA 5T6FA 1O3FA 1SQTA 1SGEE 1C2HA 5HMAA 5DP8A 4I31A 3ATIA 2WUCA 4AFUA 1P12E 3DA9B 2BQWB 1Z1JA 1GHYH 1O3BA 4TPIZ 2FX4A 1HJAC 2JKHA 4Y0YE 3ZVEA 3P17H 2P94A 5F03A 3PWBA 3KL6A 3RXDA 1O2GH 3UTUH 2BM2A 2ZDKA 5C1UA 1XKBC 3ODDA 3M5MA 2V0BA 1AU8A 5JB8S 2GVFA 1LPKB 4D7FA 2QC2A 1Z6EA 4MPXA 5JPMH 1FNIA 2VIOA 3FFGA 4RSPA 3U1JB 1Y5UT 4JZ1A 1HIAB 5SGAE 2AH4X 4TPYA 2PWXA 1GDUA 2W3IA 1GVZA 1T7CA 1JRTA 1NZQH 4DJZB 4MG3A 2ZU3A 2ODPA 3PLPA 1TB6H 1WUNH 2GCTB 1MTSA 1BDAA 3C1KA 3I78A 4IMQA 5F8ZA 5DK1A 2VB0A 2OINA 3U8TH 1NFWA 2H6MA 5GCHF 1CO7E 3A85A 1YPMH 1YF4A 1Z71A 1CA0C 3T62A 1VGCC 3SV6A 1XVOA 1ELGA 1L2EA 2J34A 1E35B 1EPTA 1GBCA 3A80A 1QJ6B 2PKSC 5DP3A 1TBRH 1GJAB 5E0HA 1BMAA 3MFJA 3RXOA 1GHAF 2AFQB 1P03A 3EQ0H 4ZHMU 3S9AA 2ZPRA 3AAVA 2O8UA 2Y5GA 3VEQB 2BXUH 3KQCA 4KELA 3OX7U 1Y3WA 3K6YA 1BMLA 1JXPA 3UNQA 2GV6A 4RN6A 4ZKOU 8LPRA 1LCYA 3U9AH 2P93A 1AVXA 1UVSH 2A4GA 4XBDA 1O2UA 3LGWA 3SUGA 1YC0A 4R0IA 4MNYA 3PMBB 4UD9H 3ZVDA 2PGQB 2NU2E 1KIGH 3E6PH 1FY4A 2F9VA 4CREA 3Q76A 1GBIA 2BLWA 4FUJA 4IMZA 3MO6A 4DIIH 1IQNA 3KQBA 1W12U 2ZF0H 1GGDB 3E90B 1P3EA 1FAXA 6CHAC 1NFYA 1W3CA 2ZFSA 5C1YA 2PLXA 4DCDA 2FP7B 5C2ZA 2CF9H 4ZHAA 4CRAA 5GWZA 2XBYA 3LC3A 3MTYA 3BTDE 1V2RT 3GYLB 1BIOA 4HTCH 3KF2A 4YM9A 4Y6DA 2J94A 3FANA 3SU6A 4TY6A 4NIWA 5DP5A 5GXPA 4OS5A 1B7XB 1BBRH 2XC0A 1VCQA 3QGJA 4WMDA 1K1IA 3M3TA 3FP7E 4HZHA 1C5QA 3AAUA 1GBHA 3P92A 4LZ4B 2C3SA 5F8XA 2ZIQH 1GBMA 1BRBE 2A2QH 3UOUA 4GHQA 1FY5A 3B8JA 5I25A 3RXHA 1P2IA 2ANWA 3OSYA 5E2PA 3RXQA 4BAQB 1A0HB 4NWLA 1P2KA 1YCPM 3B23B 1QBOA 4OS1A 3GY3A 2W3KA 1LHDH 1TNIA 3MH6A 2IOTA 1TPPA 2ZHFH 1EJAA 1UK4A 1GI8B 2A7CA 1SGPE 3SHCH 2HWLB 2SNWA 2NU0E 2Q6GA 2R9PA 1QJ1B 5A0BA 3QWCH 1E34B 1BHXF 3SJIA 4B76A 1C5NH 4WXIA 2A31A 1NROH 1YPLH 1QB1A 1VCWA 4XFQA 1D3PB 3RXSA 1BQYA 1U6QA 1NRPH 1A0JA 3URDA 4KKDA 3V3MA 1F0SA 3LGIA 2XC4A 2VU8E 5DG6A 3ZVCA 1BTZA 5HGGA 1ELDE 1YGCH 2A0QB 5K0HA 2J38A 3PV4A 2H9HA 1P01A 2BX4A 5EQSA 3TPIZ 2FODA 1D3DB 1Z8GA 3FZDA 4ZUHA 1ESAA 1LO6A 2VIPA 1XUKA 4U30A 2GCHF 3ZZBA 3BN9A 3GCTG 3RXKA 1GBJA 3FP8E 2BLQA 4TY7A 5A8XA 3LGVA 2VWMA 1C1OA 3I29A 2GZ9A 5DGJA 5C5OA 3ZZ8A 2Y81A 2JH5D 1ZZZA 1MCVA 4X6OA 1EASA 1QY6A 1ZTKA 1BITA 1CHOG 4Q7XA 4TWWA 1F0UA 3SUEA 4FUHA 3PROA 1SI5H 1GDQA 1O5DH 1AN1E 3SUFA 1GMCG 3SQEE 1HAPH 2A7JA 3BIVH 5DP7A 3ATWA 3T29A 1L4ZA 2TIOA 4IC5A 1TMUH 2V3HH 4CRBA 1C2KA 4LOYH 1ZSLA 1GJ5H 3E0NB 2IJOB 2F9UA 2ZG0H 2GDEH 4NIVA 5EW2H 4CHAB 2HVXA 1ANCA 1ZLRA 2M5TA 3GY5A 4NWKA 5LH8A 1T8LA 3SU5A 1JMOH 1ZMJA 2ANMH 1EZQA 1P11E 3SORA 1AUJA 1P0SH 1PPEE 3M36A 1HAHH 1C2MA 3S0NA 1ZPBA 3QZQA 1QL7A 3SV2H 3D49H 3MNSA 1Y8TA 1HAXB 1TRYA 1MU6B 1J15A 4H4FA 2EI7A 3W94A 5LPRA 1AHTH 2AGEX 2AMDA 2BY5X 4AG2A 2FOEA 4X2WA 1CBWC 1NC6A 1OP2A 3OY6U 2ZHWH 2A32A 3Q00A 1QBVH 1O3LA 1DWDH 3SV9A 1S6HA 1BTXA 3SUDA 1YPJH 2NWNA 4LXBH 1LVMA 1BBRK 1UTQA 2XRCA 2VIQA 4AX9H 4GAWA 1P05A 2IPHA 1D6WA 2F3CE 1J8AA 3U8OH 3VB6A 1C5MD 4K8YA 4ISOA 2F9PA 3LH3A 2VIDA 4RKJB 1C2LA 3ZVFA 1IHTH 1AKSA 3PO1B 3E8LA 1L1JA 3NUMA 2C4FH 2I6SA 4YT6H 1V2NT 2WPMS 1UK3A 1SSXA 1YM0A 1P57B 1H4WA 2P8OB 4K1TA 4FUCA 2HOBA 3KHVA 4FUBA 1F7ZA 2QXGA 2GMTC 3K65B 4WWYA 2GD4B 3RU4D 2A4OA 3H7OA 1H9IE 2J4IA 3CP7A 1CGIE 1O3DA 3U1IB 1T4UH 1O2IA 1O3OA 4X6NA 3UR6A 2W7UA 5J4SA 1IAUA 4VGCB 3VXEH 5T3HA 4F4OC 2YNAA 1UCYH 3A81A 3GY6A 3S69A 1P2OA 3GDVA 4XDEA 4OGYA 1G3BA 2JH0D 3QLPH 1V2KT 1ELAA 2HPPH 5A0AE 3GY2A 1AE5A 3KEEA 3LJOA 2R2MB 4ABFA 4ZKSU 3AVZA 1SPJA 1A1RA 1DS2E 1BZXE 1FY3A 7KMEH 4BAOB 1P2JA 2Q1JA 2ZGXH 4WH6A 4BANB 1UTKA 2OQUA 3BSQA 2QY0B 2V3OH 3TJVA 4X0WU 4ABHA 4CRDA 1GVLA 4UFEH 4YTAA 1BA8B 2ALVA 3BIUH 3HK6B 4IBLH 5HXFA 1MTWA 3P8GA 2EA3A 4I8GA 1G37A 4J1YA 4YLUA 1YPKH 3Q3KA 1P02A 2V6NA 3SU4A 3M3SA 5F8TA 1ZSKA 1PYTD 1SVPA 1BB0B 1DICA 1NT1A 4DW2U 1SQAA 1UHBB 5EQQA 1ID5H 1V2JT 3SI3H 1TPSA 3TK6A 1TABE 3DFJA 4DIHH 1GG6C 1TOCB 1C5RA 1CBWB 3RXUA 1AY6H 1HV7A 1XMNB 3UNSA 1PPHE 1DITH 1GBEA 9LPRA 2QXJA 1E37B 2FOHA 1ZPZA 4I7YH 1GBLA 1TALA 1V2VT 1NS3A 1ACBE 1TGCA 4CRCA 3RP2A 1TGNA 3UR9A 1DSUA 1GJDB 1ZOMA 1GG6B 2PFEA 2ZFRH 3F9EA 1BBRE 1IQLA 1SGTA 3TH4H 2D1JA 3P6ZB 4Y7BA 2BD4A 1OSSA 1TBQH 1FLEE 1P09A 2QN5T 5L2YH 1OWEA 1GJBB 1VGCB 3RUOA 1LHFH 1AD8H 1LVOA 2ZP0H 1Y3VA 3EAJA 4KP0A 4YESB 1HIAA 3F9FA 1Z8JB 1O2YA 2ALPA 2D2DA 2Q6DA 3O8BA 1KLJH 2WPHS 6GCHF 1Q2WA 1IQFA 1ABJH 1FIZA 1KY9A 3LJJA 5DP4A 1S81A 1KTTB 1S82A 1A5HA 4AG1A 1C2GA 2ZU1A 1KYNA 3LOXA 2B5TB 1WV7H 3M5LA 1C1WH 4ZAEA 5T6GA 2SGQE 2SGPE 1SFQB 3A7ZA 2H2ZA 5DJ7A 2ANKH 1V2LT 2GP9B 1K22H 3PLBA 1DPOA 1MTNC 4CRGA 4ISHH 3SU0A 1PQ5A 1EPTB 2R3UA 5A0CA 4SGAE 2XCFA 1LHEH 2R0LA 1TNHA 4M7GA 1IOEA 4B2CA 2PTNA 5JB9S 3SNCA 5C20A 1CA8B 3H7TA 4D76A 1CGJE 1OOKB 1AQ7A 7GCHF 2BQ6B 2G4UA 1FN8A 2JETC 3OTJE 2F9BH 1C9PA 1QRWA 4A1VA 2ZPQA 3RXLA 3P70B 3TNTA 2B8OH 4XOJA 1ABIH 1T8OA 4DURA 3MNBA 1QRXA 5DP6A 3FP6E 4INLA 1C5UA 2VJ1A 3VFEA 2UUFB 1NRRH 1HAOH 1F92A 3B9FH 2XYAA 1IHSH 3SJKA 2FM2A 1FMGA 1XUFA 1GHAG 4WXVA 1TQ7B 5C5NA 1O0DH 3MO3A 4X6MA 3T5FH 3RDZA 4JZFH 2BZAA 2FEQH 4DOQA 1QB6A 2VWOA 1VITG 1CE5A 4NSYA 2A2XH 1MUEB 1D6RA 1O3NA 4U2WA 2V35A 1V2TT 2XTTB 3GCOA 1GBAA 2C8YB 3F9GA 3FVFB 3D62A 5GCHG 2FDAA 2UWOA 1G32B 3F68H 1W10U 4XE4A 2GGVB 1XUHA 2GCHG 1EJNA 1GBDA 4GSOA 4U01A 1NU9A 2C8XB 1V2QT 1TRNA 2ZU5A 3LKWA 1SGDE 2BZ6H 3SNAA 3KCGH 3UFAA 4AOQA 3SU3A 1IQHA 8GCHF 1BUIA 1D3QB 4GUXA 4FUDA 1V3XA 3D23A 4B73A 3TIUA 1TPAE 2FYQA 1O3MA 5AHGH 2UWLA 2PSXA 1UK2A 2WINI 5LPFA 1ARBA 1MCTA 3RC4A 1JWTA 1AFQC 2TRMA 3PYHA 1Q31A 3SW2B 2UUJB 5CMXH 1L1NA 1QJ7B 2BD7A 4NA7A 4DG4A 3AW0A 1KXBA 1GBBA 3N7OA 3BEIB 1TGSZ 1G36A 1RFNA 1AMHA 4ZKRU 4Y7AA 7GCHG 3G01A 2ODYB 4A92A 1BTWA 4CBNA 2RG3A 6GCHG 1C1QA 1KXDA 4K1SA 1LTOA 4X8TH 2VH0A 1XVMA 3DT0H 1BJUA 3RMLH 1RTLA 1S0QA 3SNBA 1ZPCA 4AFSA 4K2YA 1H1BA 2ZC9H 4MNXA 1QA0A 1WU1A 3ENSB 1ZMLA 4Q2KA 3ZZAA 3RC5A 4A1TA 2WUBA 1LHCH 3GY8A 1QCPA 3TVJB 3TK5A 4D7GA 2QCYA 1QR3E 3IITA 4INKA 1LPZB 2G5VA 1NN6A 5B6OA 1GJ7B 1YBWA 4KTSA 2ZDVH 1QA7A 1N6XA 1OWDA 4WVPE 2J92A 5LPEA 2WPJS 4ABDA 1ELVA 1ZMNA 2ZCKP 1O5GH 3QN7A 3QX5H 3VGCC 2Z94A 1M9UA 3U8RH 4AFQA 1S84A 2GX4A 3DHKH 5CHAC 2W7SA 1BTHH 1ETTH 1Z8IB 1P3CA 2QV1A 1SOTA 2XWAA 1A0LA 4JCNA 3ZZCA 4JYUH 1C4V2 2TGAA 3C27B 2A5KA 3LC5A 3A89A 3RMNH 2Z3DA 2ZNKH 1Y59T 1B5GH 2D26C 3ZVAA 4X1QU 1C4Y2 2C8WB 1TBZH 1ANBA 1MTUA 2A45B 2BVRH 3P8OA 1K2I1 2ZKSA 1IQIA 4K8BA 4Y10E 4TWYA 2GTBA 4O97A 4BAMB 1W2KH 4AYYB 2J9NA 4OS7A 3SHAH 2QIQA 3JZ1B 4TYDA 1O3AA 2RCEA 1NRNH 1SGNE 3TNSA 3PLKA 2Z9KA 3RM0H 4ABAA 2BVSH 2SGFE 4O9VA 4B1TA 1FZZA 2VH6A 2HPQH 1SMFE 3U69H 2GZ8A 4GCHG 1ZHPA 1TE0A 3E0PB 1AGJA 4YZUA 3LGYA 1DUAA 1LQEA 3GCHC 5J4QA 5GIBA 3GCTF 1FV9A 1BOQA 1P10A 3SZNA 3ZVBA 8KME2 2P3TB 3EYDA 2SGAA 4MLFB 4AB9A 3L33A 4FXGH 3E16B 3O8CA 1HDTH 3HATH 5AFYH 2RA0A 1ESTA 2P8OC 1G2MA 1LQDB 1F5KU 1OWHA 4Y11E 1PPZA 5FBIA 1V2UT 3M3VA 3MOCA 3TU7H 3M61U 2FTLE 5DKMA 4B2BA 2GT7A 1EZXC 1QNJA 1PPBH 2Y5HA 1O32A 1GBKA 1MQ6A 1HAVB 2GT8A 1XUGA 1DWBH 2G55A 1DX5M 1GMCF 4AORA 1K1JA 1C5OH 4JZDH 1HRTH 2PV9B 2Y7XA 1HAZB 1C2IA 1RIWB 3BV9B 3DUXH 2NU1E 2GDDA 1SHHB 2OP9A 3R3GB 5FPYA 3TK9A 3M5NA 1A61H 2FOFA 4CR9A 1OXGA 1GCTB 2BD9A 2BXTH 1GI4A 1TNLA 2ZFFH 3SU1A 2BDHA 3K2UA 1HCGA 1MD7A 1GBFA 4WJG2 1VITH 4U32A 5ABWA 1Y3YA 5G4BA 1SR5C 4AYVB 2BDBA 4WY3A 1OYQA 2STAE 2ZFPH 3EA8A 1O3HA 1SQOA 1SL3A 2AIQA 2G4TA 1BTPA 1GCDA 5TCCA 1D3TB 1O2XA 1PPFE 2OXSA 3ODFA 1MBQA 5ETXA 1VCPA 1SB1H 3BG4C 1XUJA 3PB1E 2I6QA 1ZRKA 3A88A 3QO6A 3RXRA 2ASUB 4JK6A 1AUTC 2AYWA 1GJ9B 2IN2A 1IQKA 2EC9H 1MH0A 2FO9A 2NU4E 1TONA 2A4QA 1LMWB 1HFDA 1H9HE 2HNTC 1N8OC 3OYPA 4E05H 4LZ1H 2H9TH 2O8MA 2AEIH 1XXFA 2BOHB 2SGEE 3M35A 5EXNA 3E91A 3GDSA 1BCUH 1ANEA 2ZGHA 3BTKE 5FCKA 2XBWA 1O2JA 3V0XA 2TGTA 1V2MT 4B71A 3Q3YA 1UHBA 2VWLA 1TX8A 4X1NU 3TITA 1DUEA 3NK8A 2ZTYA 5JYIA 1GJ6A 4H6TA 1S6FA 6CHAB 1V2OT 1QL8A 2AMPA 1EOJA 1FPCH 4GLYA 1O3PB 1A3EH 4Y8XA 1ZTLA 5ESBA 3BTFE 1OP0A 4F49A 3MYWA 1DE7H 5IDKA 1DOJA 2BLOA 3SJ9A 1FI8A 1P04A 3MU1A 1VJAU 3A8CA 1K1LA 1F0TA 2WYJA 1BT7A 2FLRH 4WF8A 2AMQA 5E8EH 4B2AA 1GHVH 4UEHH 5EXMA 3PMHB 3QUMP 3MWIU 3ZZ7A 1DWEH 8GCHG 1BMMH 4UONA 1C2JA 3TGJE 1WYKA 1TGTA 1O2WA 3ZYEA 1GGDC 2WPKS 3UREA 1NRQH 2CF8H 4NIYA 1LVYA 4MVNA 2ZDLA 3A7YA 1QFKH 1HB0B 3FAOA 1P9UA 1C5ZB 1Y5AT 1C5PA 2VIWA 3BF6H 4NFEA 1SBWA 2BD2A 1G2LA 4K5ZA 1ARCA 3QZRA 1KTSB 2QF0A 1OWIA 1E36B 3LONA 2FI3E 1HUTH 1AKSB 2P16A 4BTTB 1O5BB 1TRMA 1BMNH 4X8SH 2BY7X 5CHAB 1O3CA 5E2OA 3VPKA 3A86A 1QQ4A 3RXFA 3ZZDA 2Z9GA 2W26A 2VVUA 2Q6FA 1MKXK 4MPUA 3ELAH 2ZFTA 4JYVH 3T2NA 2BLVA 4Z6AH 1EP5A 4IC6A 2OC0A 3ZZ3A 2ODQA 1P2QA 1GI6A 1L0ZA 1JBUH 2HALA 3I77A 1C2DA 1C4U2 2GCTC 4UDWH 3BTEE 2XW9A 1PJPA 1HPGA 2FMJA 1ZJKA 2FPZA 3ATMA 1FONA 1K1MA 1T4VH 2ZQ1A 1QB9A 3ZZ4A 2ZO3H 4NA9H 7LPRA 1OWKA 2Y80A 1C5VA 4OS6A 4PROA 1F5LA 5FX5A 1H9LB 1MKWH 2G5NA 3ZV8A 4ISLA 1RRKA 1O3IA 2PTCE 4ZHLU 4A6LA 4X8VH 1XUIA 3KNXA 3HPTB 2BY6X 3RXJA 1EJMA 4NZQA 2EI8A 3L6PA 3F9HA 4D9QA 1MKXH 2OC1A 3NXPA 3GY7A 4MQAA 1A5IA 2WYGA 3KQDA 1W13U 1S85A 1B0FA 1EB1H 1ANDA 1C1RA 1C9TA 3STIA 8ESTE 1TOMH 1JOUB 2A5IA 3FZZA 1SLWB 3E1XB 2PHBA 2Y82A 4Y79A 1LDTT 5L6NH 3KN2A 2F9OA 3H5CB 1ELBA 1VR1H 4CH8B 2BYAX 4YOGA 2BDCA 1GI7B 1MAYA 1B0EA 3Q3XA 4ZROA 1NY22 3ZVGA 1PFXC 3Q77A 1HAYB 4ZXYH 5AFZH 1UTJA 4HFPB 4MNVA 4FVBA 3RC6A 1KXEA 4KTUA 2KAIB 1BTYA 1JIMA 4FUEA 2THFB 1AIXH 1KDQA 1MU8B 1PQ7A 2ZPSA 1RTFB 1BJVA 3PTNA 1EXFA 3M7TA 1CQQA 3TJUA 3A8AA 2Y7ZA 3ZZ9A 2FZZA 1HAGE 5TCAA 3M37A 1YCPH 1MTVA 5F6MA 1GCTC 2PUXB 1T8NA 2Y5FA 4X2VA 3QGNB 5E0GA 3KIDU 3SOSA 5AF9H 1C1TA 3A82A 4FUGA 4X8UH 1DXWA 4NGAH 4IW4E 3A7VA 4Y71A 5FX6A 2FWWA 1CHGA 3NPSA 3RU4E 2QYIA 2KAIA 2A1DB 2P3UB 2HGTH 1EX3A 5EOKA 4NG9H 1J14A 4BAHB 4ABIA 2SGDE 2G8TA 1OX1A 1KDQB 1RJXB 2R3YA 2GKVE 4NFFA 3UY9A 3BTGE 1G30B 4NSVA 4AGJA 2Y6TA 1OKXA 1SGYE 1TA2A 2FOGA 2OQ5A 5JBTA 4K69A 1ZSJA 4QT8C 1A3BH 1O35A 1ELCA 4ISNA 1YPGH 4NIXA 3TH2H 1KXAA 4MPWA 4A1XA 3SNEA 3O8DA 1UTMA 3PM3A 1O30A 1FIWA 4LK4A 1O3KA 1KLIH 3QTOH 2BOKA 3T28A 1Z6JH 2BMGB 2VGCB 2ZI2H 1ZYOA 2BD8A 5H4IB 1GI3A 2BQ7B 3A83A 3BG8A 1YCPK 1K28D 4UE7H 4BOHA 3TH3H 4X1PU 1O2LA 1J16A 2XBVA 1ORFA 3A7TA 1LVBA 1GJ8B 2BY9X 3EA9A 2VGCC 1PQ8A 2PW8H 1OP8A 3GOVB 5C1XA 2FS9A 1F5RA 3RXGA 2ZHQH 1N6YA 1L1GA 1RD3B 5EPNA 3HGPA 3K9XB 3HGNA 4K1EA 2HRVA 4ABJA 5EGMA 4Y0ZE 3ITIA 2R2WU 3VB4A 3ZV9A 5JBCS 1YPEH 4MNWA 1O5FH 3UQOA 2FIRH 4DT7B 1SFIA 4THNH 1SC8U 5GDSH 1KXFA 5LGOA 1GL0E 1K1OA 2XCNA 1D9IA 2VVVA 1FPHH 3CS0A 1BRUP 3MU0A 3P8NA 1O3EA 1ZGVA 1ELTA 1W0ZU 3HKIB 3T26A 2LNCA 3AASA 2NU3E 3MMGA 1F0RA 5HM9A 1JIRA 4AB8A 5JDUB 4BXSA 4YO9A 1AI8H 1PYTC 1MAXA 4NZLA 2QA9E 4JMYA 4MDSA 5EPYA 1UVPA 3EA7A 2HNTF 2FOBA 2Z9LA 1QL9A 1O31A 1GMHF 5EQRA 5BPEA 1T32A 1QQUA 1QRZA 3CENA 3T27A 3V12A 3S7KB 1FDPA 2C93B 2XXLA 4ZH8A 3MH5A 1TX7A 1O5CB 2SNVA 1TWXB 1ZRBA 4CHAC 1YP9A 3R0FA 1O36A 1GVKB 2TGDA 1EPTC 1J9CH 3UQVA 2DUCA 3ZZ5A 2OUAA 2XNIA 2RA3A 4K3JA 2O8WA 1FJSA 4H42U 3RXCA 4UFDH 3LU9B 2FS8A 1O2HA 1EQ9A 1GI5A 1O5EH 5L30H 5FCRA 1AFEH 3RLWH 1Z1IA 2G00A 2F83A 1BHXB 3NWUA 2CHAB 2Z3EA 4E7RG 5FAHA 1MBMA 1EB2A 4AGKA 3P8FA 1ELFA 1AO5A 2ULLA 2ZGBH 1PQAA 1MZDA 2OLGA 2TBSA 2BDAA 4I8LA 2K1QA 5I46H 1D4PB 4JZEH 3RMMH 5FPTA 4AN7A 4MPVA 2Z7FE 4R8TB 1C1NA 1A46H 4YT7H 2ZQ2A 5T6DA 1GWAA 1ELEE 2WPIS 1IQGA 4XSKU 1HXFH 1CT0E 1C1PA 1EAWA 2BD3A 5A09A 3UWJH 1SHYA
chains in the Genus database with same CATH superfamily
4AZ2B 3GISB 1H8HD 1QTFA 5IK2D 2CJIA 2FLBH 4VGCC 5PTPA 2ZCLP 5A8ZA 3SJOA 3MU8A 4BNRA 4GCHF 1WAYB 1UO6A 1UTLM 4CBOA 1QIXB 2EI6A 4KGAA 1Y3XA 1L4DA 3GY4A 1IQJA 1E38B 3UIRA 3PTBA 1SGFA 2FI4E 1K21H 3BTHE 1C2FA 2B7DH 1C5YB 3FKSD 1THPB 1TYNA 1O2QA 1FUJA 1CGHA 2H9EH 2AGGX 1TA6A 3BEUA 1EATA 3SGAE 4OM9A 3VB3A 1QGFA 2D8WA 2F9NA 2PGBB 3NZIA 3ATKA 5EJZA 2RDLA 1WTHD 2EEKA 5C0TA 1UVOA 2B9LA 2A5AA 3GYMA 4FVDA 2FXRA 1SGRE 5DPAA 2OTVA 1NPMA 1GI0A 2FOAA 1ZGIA 4I8KA 3ZZ6A 3OAAD 5C3NA 3SGQE 2UWPA 2ZTXA 3RXMA 2H5DA 1YPHC 2CXVA 3NKKA 4B75A 2GJGA 4DY7B 1GHXH 1NESE 1FXYA 1UVUH 3SI4H 2B0FA 4RI0A 5FPSA 3SO3A 3CS7A 1GMDG 1Y3UA 3SBKA 3FN8A 2VNTA 4ZKNU 1XX9A 5FBEA 4FETA 1O2KA 3RXIA 3P95A 2ILNA 2QAAA 1VJ9U 3VG8A 1RIWC 3PMJA 2ANYA 1GJCB 1AZZA 1UMAH 4Q7YA 3LH1A 1HAVA 5E0JA 3A8DA 2H5CA 1SG8B 1AB9C 4I32A 1DLEA 5EW1H 1O2ZA 2OBQA 1NM6A 4HGCA 3MH7A 4X2XA 1H8IH 1WOFA 2J2UA 2WSSD 2A4RA 1XM1A 3MO9A 5HYOA 2FTMA 4WMFA 3TGKE 1HGTH 4JZIA 4O3UA 5DN6D 1W0KD 4OS4A 2AS9A 1TIOA 1C5LH 1SGIB 2A7HA 1EAIA 4CRFA 2O8TA 2ZHDA 1MZAA 1FX0B 2RDEA 3OY5U 3V13A 3BTTE 1VITF 1MMJN 2OBOA 3PRDA 1NTPA 1EP6A 2Z9JA 3OE7D 1O2SA 3BTWE 3URCA 4J2YB 1WQVH 2WPLS 3QTVH 3A87A 1MQ5A 2ZDMA 2UUKB 1LPGB 1UCYK 4IGDA 1O38A 2ZZUH 2VWNA 2GZ7A 3OTPA 4X6PA 4ACAA 4WH8A 1V2WT 2JH6D 4GHTA 1NRSH 3GCHB 2KFWA 2HLCA 3SGBE 2ZECA 2CN0H 1C5XB 2ZWLH 1C5WB 3WWBA 2PUQH 5CE1A 1HYLA 1EAUA 4O03A 4SGBE 3SV8A 3M5OA 3MU5A 1DM4B 2BTCE 1AVGH 2Z9IA 3LT3A 5GPIB 3PO1C 1EKBB 1C5SA 5AVDA 5BRRE 4BTIB 2BDIA 3L3TA 1TFXA 2WV5A 3DSOA 1SGFG 3KQEA 4XBBA 1TMTH 1ZTJA 2QF3A 1C5TA 3A84A 2ZU4A 4JK5A 3RU4T 2KX4A 1Q3XA 1LKBA 1CHOF 2QE7D 1TNJA 1GMDF 1G9IE 3EGKH 1AVWA 1CT4E 1TAWA 3PWCA 1HNEE 1AWFH 1OPHB 4X1SU 2G81E 4E06H 5EU8A 2PKSB 2ZGJA 1CU1A 3GDUA 1DWCH 1HJ8A 1LKAA 2FOMB 3LGTA 4JYTA 4B6FA 1KXCA 1O2OA 1O5AB 1SGQE 5TJXA 1FY8E 4XBCA 3PRBA 3UAIC 1FY1A 1GI2A 2BDGA 2LPRA 4BTUB 3BTME 5FHTA 1G3DA 1KSNA 1AWHB 1NFUA 2ZHEH 1SGCA 3DFLA 5DSFA 1GJ4H 2TPIZ 1J17T 2AIPA 3F1SB 4FUIA 1WBGB 2ZCHP 1P8VC 4WMEA 1HJ9A 1NU7B 3T25A 4I33A 3VB5A 3BEFB 2W6ID 4OS2A 1NBME 4GPGA 1GHBF 2J95A 3UPEA 1RS0A 1FAKH 4NA8A 4ZXXH 3RXPA 3SV7A 1GL1A 4ABGA 4IN2A 4ABEA 2ZTZA 1MKWK 2PKAB 3BG4B 4FUFA 4BXWA 1TNGA 1UJ1A 3STJA 3HKJB 3RXVA 1DT2A 3UUZA 1A7SA 3NCLA 5GJ4B 1Z8RA 1YPHE 1CSOE 3BTQE 1XKAC 1THRH 1HJAB 1V2ST 1GI1A 5ESTE 1HAIH 4XD7D 4D9RA 4YOJA 1PPCE 3MNXA 1PPGE 2ZA5A 4H6SB 1FQ3A 1O39A 1P06A 1VZQH 1WCZA 1F2SE 1G3CA 2SFAA 3DCLA 1XXDA 2ZDNA 1K1PA 1Y5BT 1O3JA 2G51A 7ESTE 1O2MA 1V6DA 3O8RA 3LPRA 1DY9A 3TJOA 4IS5A 5HM2A 1TPOA 2JETB 4XRNA 4OGXA 1MD8A 1ZHRA 4K60A 2G52A 3RXEA 4FU9A 1UCYE 1UW7A 1ESBA 1UTNA 4X1RU 1DLKB 2BHGA 3D65E 3W95A 6ESTA 4O3TA 1TLDA 1GPZA 1W14U 1YLCA 4A5TS 2TGPZ 1HLTH 1A2CH 1DFPA 1G3EA 4IN1A 3U98H 2CV3A 1O2VA 2C90B 1OYTH 1P2MA 4ASHA 1AE8H 1AB9B 1INCA 3RXBA 4DVAU 3RXAA 1ETSH 2PKAA 4Y76A 4AFZA 2AGIX 3ZYDA 4A7IB 1UTOA 1S0RA 1LHGH 1ZJDA 1O2RA 3ATLA 1N8OB 3IWMA 1RTKA 2OCVB 1CT2E 4ISIH 3OU0A 2Z6BD 3GCNA 2P3FH 9ESTA 1AFQB 4INHA 3WY8A 2YMSC 2GMTB 1OWJA 3UWIA 1TGBA 2YOLA 3A8BA 4X2YA 2FX6A 1TMBH 1YKTA 3SJ8A 1EFRD 1W0YH 2GV7A 2VIVA 2AERH 1CA0B 3RLYH 1TNKA 2DE8A 5JBAS 3AW1A 1W8BH 3FOAA 3SQHE 1HBTH 3V7TA 2Z3CA 5A8YA 1S5SA 4I8HA 1QBNA 2FYRA 2BVXH 1YWUA 3LIWA 2OC8A 4D8NA 4ACBA 1O34A 2BB4A 1C1SA 3MU4A 2W5EA 5K7RA 3TJNA 2PR3A 1YYY1 1ZHMA 3SU2A 1O2TA 1P2NA 3SN8A 3IG6B 2CMYA 1QHRB 2P59A 5T1VA 2ZEBA 4CR5A 1YLDA 2H1UA 1O3GA 5EG4A 2O9QA 4Y8ZA 2HNTE 4YOIA 5DO4H 2XWBI 1K9OE 3S9CA 2WV4A 4HI3A 1HXEH 4MTBA 3TLOA 2R0KA 3K6ZA 4YLQH 3EE0B 4RKOB 1W7GH 3HK3B 1X7AC 3MH4A 1RGQA 2YMSB 3S7HB 3SNDA 1GHBG 5IYTA 1W7XH 3LGUA 1SOZA 3QDZB 1DDJA 1C1MA 2OD3B 3RM2H 1S83A 3DD2H 2OC7A 2ZDAH 1KLTA 6LPRA 1UTPA 1A5GH 1THSH 4FU7A 1P9SA 1O2NA 2O8LA 5EODA 2QXIA 2F91A 1O2PA 2ZU2A 1EZSC 3LDXH 2CHAC 3JZ2B 1C2EA 1EUFA 1GMHG 5JBBS 1TX6A 1DANH 5DP9A 4B74A 2STBE 1SLUB 3ESTA 2WHXA 3VGCB 3S9BA 3E3TA 2F4LA 1DSTA 2BY8X 2PSYA 4ESTE 4Q80A 3MI4A 1AZ8A 1GHZA 2ESTE 1NFXA 3A7XA 4UFFH 4NCYA 3RXTA 4BAKB 5L2ZH 2QXHA 3PMAB 3MHWU 1H8DH 1OS8A 1K1NA 1MABB 1T8MA 1C1UH 1E0FD 1BTUA 5A2MH 4I8JA 2VVCA 2P95A 4UFGH 4ZMAH 5C94A 3GICB 4DGJA 3TGIE 1IQMA 1A4WH 1C1VH 1SLVB 3F6UH 5FXLA 1ETRH 2FI5E 4CH2B 1RXPA 2BX3A 2XC5A 1DXPA 2BD5A 4E7NA 1IQEA 1O37A 3M7QA 1WDIA 1TQ0B 5EXLA 2FOCA 3KGPA 1BRAA 2CGAA 1BRCE 1Z7KA 2L6OA 1JRSA 1CVWH 1O33A 4Y8YA 2QGRA 3UOPA 4Z0KA 2YNBA 1GBTA 1GHWH 2FESH 1UVTH 1V2PT 2UUYA 4GVUA 5C67A 2XBXA 2BDYA 3RMOH 1MTNB 3VB7A 4KTCA 1SLXB 3A7WA 1GI9B 3UNRA 2VBCA 2ZFQH 1DVAH 1QURH 1EOLA 1GDNA 1WSSH 4Q4LA 4Q7ZA 4HG6A 3VXFH 3CNRA 3EDXB 2V7QD 3H09A 2DE9A 1DY8A 2VINA 2C8ZB 4FU8A 4ABBA 1FN6A 3QK1A 1W11U 2ZGCA 1NO9H 3MNCA 1ZR0A 1EZUC 1N1LA 2KM0A 1WTGH 3M7UA 1T31A 1EAXA 1WQSA 5T6FA 1O3FA 1SQTA 1SGEE 1C2HA 3WW7A 5HMAA 5DP8A 4I31A 3ATIA 2WUCA 2CK3D 4AFUA 1P12E 3DA9B 2BQWB 1Z1JA 1GHYH 1O3BA 4TPIZ 2FX4A 1HJAC 2JKHA 4Y0YE 3ZVEA 3P17H 2P94A 5F03A 3PWBA 3KL6A 4DT4A 3RXDA 1O2GH 3UTUH 2BM2A 2ZDKA 4P00A 5C1UA 1XKBC 3ODDA 3M5MA 2V0BA 1AU8A 5JB8S 2GVFA 1LPKB 4D7FA 2QC2A 1Z6EA 4MPXA 5JPMH 1FNIA 2VIOA 3FFGA 4RSPA 3U1JB 1Y5UT 4JZ1A 1HIAB 5SGAE 3WWFA 2AH4X 4TPYA 2PWXA 1GDUA 2W3IA 1GVZA 5FL7D 1T7CA 1JRTA 1NZQH 4DJZB 4MG3A 3ZIAD 2ZU3A 2ODPA 3PLPA 1TB6H 1WUNH 2GCTB 1MTSA 1BDAA 3C1KA 3I78A 4IMQA 5F8ZA 5DK1A 2VB0A 2OINA 3U8TH 1NFWA 2H6MA 5GCHF 1CO7E 3A85A 1YPMH 1YF4A 1Z71A 1CA0C 3T62A 1VGCC 3SV6A 1XVOA 1ELGA 1L2EA 5EJ1A 2J34A 1E35B 1EPTA 1GBCA 3A80A 1QJ6B 2PKSC 5DP3A 3F3BA 1TBRH 1GJAB 5E0HA 1BMAA 3MFJA 3RXOA 1GHAF 2AFQB 1P03A 3EQ0H 4ZHMU 3S9AA 2ZPRA 3AAVA 2O8UA 2Y5GA 3VEQB 2BXUH 3KQCA 4KELA 3U28C 3OX7U 3KQ5A 1Y3WA 3K6YA 1BMLA 1JXPA 3UNQA 2GV6A 2RFKC 4RN6A 4ZKOU 2EY4C 8LPRA 1LCYA 3U9AH 2P93A 1AVXA 1UVSH 2A4GA 4XBDA 1O2UA 3LGWA 3SUGA 1YC0A 2XNDD 4Q63A 4R0IA 4MNYA 3PMBB 4UD9H 3ZVDA 2PGQB 2NU2E 1KIGH 3E6PH 1FY4A 2F9VA 4CREA 3Q76A 1GBIA 2BLWA 4FUJA 4IMZA 3MO6A 4DIIH 1IQNA 3KQBA 1W12U 2ZF0H 1GGDB 3E90B 1P3EA 1KMHB 1FAXA 6CHAC 1NFYA 1W3CA 2ZFSA 5C1YA 2PLXA 4DCDA 2FP7B 5C2ZA 2CF9H 4ZHAA 2KCYA 4CRAA 5GWZA 2XBYA 3LC3A 3MTYA 3BTDE 1V2RT 3GYLB 1BIOA 1E1QD 4HTCH 3KF2A 4YM9A 4Y6DA 2J94A 3FANA 3SU6A 4TY6A 4NIWA 5DP5A 5GXPA 4OS5A 1B7XB 1BBRH 2XC0A 1VCQA 3QGJA 4WMDA 1K1IA 3M3TA 3FP7E 4HZHA 1C5QA 3AAUA 1GBHA 3P92A 4LZ4B 2C3SA 5F8XA 2ZIQH 3N7DA 1GBMA 1BRBE 2A2QH 2WPDD 3UOUA 4GHQA 1FY5A 3B8JA 5I25A 3RXHA 1P2IA 2ANWA 3OSYA 2J97A 5E2PA 3RXQA 4BAQB 5C17A 1A0HB 4NWLA 1P2KA 1YCPM 3B23B 1QBOA 4OS1A 3GY3A 2W3KA 1LHDH 1TNIA 3MH6A 2IOTA 1TPPA 2ZHFH 1EJAA 1UK4A 1GI8B 2A7CA 1SGPE 3SHCH 2HWLB 2SNWA 2NU0E 2Q6GA 5HIYA 2R9PA 1QJ1B 2EQNA 5A0BA 3QWCH 1E34B 1BHXF 3SJIA 4B76A 1C5NH 4WXIA 2A31A 1NROH 1YPLH 1QB1A 1VCWA 4XFQA 1D3PB 3RXSA 3MQKC 1BQYA 1U6QA 1NRPH 1A0JA 3URDA 4KKDA 3V3MA 1F0SA 3LGIA 2XC4A 2VU8E 5DG6A 3ZVCA 1BTZA 5HGGA 1BMFD 1ELDE 1YGCH 2A0QB 5K0HA 2J38A 3PV4A 2WV9A 2H9HA 1P01A 2BX4A 5EQSA 3TPIZ 2FODA 1D3DB 1Z8GA 3FZDA 4ZUHA 1ESAA 1LO6A 2VIPA 1XUKA 4U30A 2GCHF 3ZZBA 3BN9A 3GCTG 3RXKA 1GBJA 3FP8E 2BLQA 4TY7A 5A8XA 3LGVA 2VWMA 1C1OA 3I29A 2GZ9A 5DGJA 2QF5A 5C5OA 3ZZ8A 2Y81A 2JH5D 1ZZZA 1MCVA 4X6OA 1EASA 1QY6A 1ZTKA 1BITA 1CHOG 4Q7XA 4TWWA 1F0UA 3KYFA 3SUEA 4FUHA 3PROA 1SI5H 1GDQA 1O5DH 1AN1E 3SUFA 1GMCG 3SQEE 1HAPH 2A7JA 3BIVH 5DP7A 2W6JD 3ATWA 2JDID 3T29A 1L4ZA 5KEDA 2TIOA 4IC5A 1TMUH 2V3HH 4CRBA 1C2KA 4LOYH 1ZSLA 1GJ5H 3E0NB 2IJOB 2F9UA 2ZG0H 2GDEH 4NIVA 5EW2H 4CHAB 2HVXA 1ANCA 1ZLRA 2M5TA 3GY5A 4NWKA 5LH8A 1T8LA 3SU5A 1JMOH 1ZMJA 2ANMH 1EZQA 1P11E 3SORA 1AUJA 1P0SH 1PPEE 3PV5A 3M36A 1HAHH 1C2MA 3S0NA 1ZPBA 3QZQA 3F2HA 1QL7A 3SV2H 3D49H 3MNSA 4B6EA 1Y8TA 1HAXB 1TRYA 1MU6B 1J15A 4H4FA 2EI7A 3W94A 5LPRA 2LP6A 1AHTH 2AGEX 2AMDA 2BY5X 4AG2A 2FOEA 4X2WA 1CBWC 2KCPA 1NC6A 1OP2A 3OY6U 2ZHWH 2A32A 3Q00A 1QBVH 1W0JD 1SKYE 1O3LA 1DWDH 3SV9A 2KR7A 1S6HA 1BTXA 3SUDA 1YPJH 2NWNA 4LXBH 1LVMA 1BBRK 1UTQA 2XRCA 2VIQA 4AX9H 4GAWA 1P05A 2HLDD 2IPHA 1D6WA 2F3CE 1J8AA 2K8IA 3U8OH 3VB6A 1C5MD 4K8YA 4ISOA 2F9PA 3LH3A 2VIDA 4RKJB 1C2LA 3ZVFA 1IHTH 1AKSA 3PO1B 3E8LA 1L1JA 3NUMA 2C4FH 2I6SA 4YT6H 1V2NT 2WPMS 1UK3A 1SSXA 1YM0A 1P57B 1H4WA 2P8OB 4K1TA 4FUCA 2HOBA 3KHVA 4FUBA 1F7ZA 2QXGA 2GMTC 3K65B 4WWYA 2GD4B 3RU4D 2A4OA 3H7OA 1H9IE 2J4IA 3CP7A 1CGIE 1O3DA 3U1IB 1T4UH 1O2IA 1O3OA 4X6NA 3UR6A 2W7UA 5J4SA 1IAUA 4VGCB 3VXEH 5T3HA 4F4OC 2YNAA 1UCYH 3A81A 3GY6A 3S69A 2L74A 5C0UA 1P2OA 3GDVA 4XDEA 4OGYA 1G3BA 2JH0D 3QLPH 1V2KT 1ELAA 2HPPH 5A0AE 3GY2A 1AE5A 3KEEA 3LJOA 2R2MB 4ABFA 4ZKSU 3AVZA 1SPJA 1A1RA 1DS2E 1BZXE 1FY3A 7KMEH 4BAOB 1P2JA 2Q1JA 3AK5A 2ZGXH 4WH6A 4BANB 1UTKA 2OQUA 3BSQA 2QY0B 2V3OH 3FO8D 3TJVA 4X0WU 4ABHA 4CRDA 1GVLA 4UFEH 4YTAA 1BA8B 2ALVA 3BIUH 3HK6B 4IBLH 5HXFA 1MTWA 3P8GA 2EA3A 4I8GA 1G37A 4J1YA 4YLUA 1YPKH 3Q3KA 3OEED 1P02A 2V6NA 3SU4A 3M3SA 5F8TA 1ZSKA 1PYTD 1SVPA 1BB0B 1DICA 1NT1A 4DW2U 1SQAA 1UHBB 5EQQA 1ID5H 1V2JT 3SI3H 1TPSA 3TK6A 1TABE 3DFJA 4DIHH 1GG6C 1TOCB 1C5RA 1CBWB 3RXUA 1AY6H 1HV7A 1XMNB 3UNSA 1PPHE 1DITH 1GBEA 9LPRA 2QXJA 1E37B 2FOHA 1ZPZA 4I7YH 1GBLA 1TALA 1V2VT 1NS3A 1ACBE 1TGCA 4CRCA 3RP2A 1WXRA 1TGNA 3UR9A 1DSUA 1GJDB 1ZOMA 1GG6B 2PFEA 2ZFRH 3F9EA 1BBRE 1IQLA 1SGTA 3TH4H 2D1JA 3P6ZB 2V3MA 4Y7BA 2BD4A 1OSSA 1TBQH 1FLEE 1P09A 2QN5T 5L2YH 1OWEA 1GJBB 1VGCB 2XOKD 3RUOA 1LHFH 1AD8H 1LVOA 2ZP0H 1Y3VA 3EAJA 4KP0A 4YESB 1HIAA 3F0PA 1Z8JB 3F9FA 1O2YA 2ALPA 2D2DA 2Q6DA 3O8BA 1KLJH 3PV2A 2WPHS 6GCHF 1Q2WA 1IQFA 1ABJH 1FIZA 1KY9A 3LJJA 5DP4A 1S81A 1KTTB 1S82A 1A5HA 4AG1A 1C2GA 2ZU1A 1KYNA 3LOXA 2B5TB 1E79D 1WV7H 3M5LA 1C1WH 5F53A 4ZAEA 5T6GA 2SGQE 2KCAA 2SGPE 1SFQB 3A7ZA 5HIZA 2H2ZA 5DJ7A 2ANKH 1V2LT 2GP9B 1K22H 3PLBA 1DPOA 1MTNC 4CRGA 4ISHH 3SU0A 1PQ5A 1EPTB 2R3UA 5A0CA 4SGAE 2XCFA 1LHEH 2R0LA 1TNHA 4M7GA 1IOEA 4B2CA 2PTNA 5JB9S 3SNCA 5C20A 1CA8B 3H7TA 4D76A 1CGJE 1OOKB 1AQ7A 7GCHF 2BQ6B 2G4UA 1FN8A 2JETC 3OTJE 2F9BH 1C9PA 1QRWA 4A1VA 2ZPQA 3RXLA 3P70B 3TNTA 2B8OH 4XOJA 1ABIH 1T8OA 4DURA 3MNBA 1QRXA 5DP6A 3FP6E 4INLA 1C5UA 4AC9A 2VJ1A 3VFEA 2UUFB 1NRRH 1HAOH 1F92A 3B9FH 5EIYA 2XYAA 1IHSH 3SJKA 2FM2A 1FMGA 1XUFA 1GHAG 4WXVA 1TQ7B 5C5NA 1O0DH 3MO3A 4X6MA 3T5FH 3RDZA 4JZFH 2BZAA 2FEQH 4DOQA 1QB6A 2VWOA 1VITG 1CE5A 4NSYA 2A2XH 1MUEB 1D6RA 1O3NA 4U2WA 2V35A 1V2TT 2XTTB 3GCOA 1GBAA 2C8YB 3F9GA 3FVFB 3D62A 5GCHG 2FDAA 2UWOA 1G32B 3F68H 1W10U 4XE4A 2GGVB 1XUHA 2GCHG 1EJNA 1GBDA 4GSOA 4U01A 1NU9A 2C8XB 1V2QT 1TRNA 2ZU5A 3LKWA 1SGDE 2BZ6H 3SNAA 3KCGH 3UFAA 4AOQA 5B6LA 3SU3A 1IQHA 8GCHF 1BUIA 1D3QB 4GUXA 4FUDA 3SYJA 1V3XA 3D23A 4B73A 3TIUA 1TPAE 2FYQA 4RT0A 1O3MA 5AHGH 2UWLA 2PSXA 1UK2A 2WINI 5LPFA 3OEHD 1ARBA 1MCTA 3RC4A 1JWTA 1AFQC 2TRMA 3PYHA 1Q31A 3SW2B 2UUJB 5CMXH 1L1NA 1QJ7B 2BD7A 4NA7A 4DG4A 3AW0A 1KXBA 1GBBA 3N7OA 3BEIB 1TGSZ 1G36A 2F43B 5KECA 1RFNA 1AMHA 4ZKRU 4Y7AA 2KZ4A 4ZCNA 7GCHG 2K0QA 3G01A 2ODYB 4A92A 1BTWA 4CBNA 2RG3A 6GCHG 1C1QA 1KXDA 4K1SA 4RT1A 1LTOA 4X8TH 2VH0A 1XVMA 3DT0H 1BJUA 3RMLH 1RTLA 1S0QA 3SNBA 1ZPCA 4AFSA 4K2YA 1H1BA 5GNDA 2ZC9H 4MNXA 1QA0A 1WU1A 3ENSB 1ZMLA 4Q2KA 3ZZAA 3RC5A 4A1TA 2WUBA 1LHCH 3GY8A 1QCPA 3TVJB 3TK5A 4D7GA 2QCYA 1QR3E 3IITA 4INKA 1LPZB 2G5VA 1NN6A 5B6OA 1GJ7B 1YBWA 4KTSA 2ZDVH 1QA7A 1N6XA 1OWDA 4WVPE 2J92A 2J5UA 5LPEA 2WPJS 4ABDA 1ELVA 3EE7A 1ZMNA 2ZCKP 1O5GH 3QN7A 3QX5H 3VGCC 2Z94A 1M9UA 4M9FA 3U8RH 4AFQA 1S84A 2GX4A 3DHKH 5CHAC 2W7SA 1BTHH 3N7EA 1ETTH 1Z8IB 1P3CA 2QV1A 1SOTA 1A0LA 2XWAA 4JCNA 3ZZCA 4JYUH 1C4V2 2TGAA 3C27B 2JJ2D 2A5KA 3LC5A 3A89A 3RMNH 2Z3DA 2ZNKH 1Y59T 1B5GH 2D26C 3ZVAA 4X1QU 1C4Y2 2C8WB 1TBZH 2OK5A 1ANBA 1MTUA 2A45B 2BVRH 3P8OA 1K2I1 2ZKSA 1IQIA 4K8BA 4Y10E 4TWYA 2GTBA 4O97A 4BAMB 1W2KH 3SZEA 4AYYB 2J9NA 4OS7A 3SHAH 2QIQA 3JZ1B 4TYDA 1O3AA 2RCEA 1NRNH 1SGNE 3TNSA 3PLKA 5KGOA 2Z9KA 3NRLA 3RM0H 4ABAA 2BVSH 2SGFE 4O9VA 4B1TA 1FZZA 2VH6A 2HPQH 1SMFE 3U69H 2GZ8A 4GCHG 1ZHPA 1TE0A 3E0PB 1AGJA 2PP6A 3LGYA 4YZUA 1DUAA 1LQEA 3GCHC 5HKKD 5J4QA 5GIBA 3GCTF 1FV9A 3UB0A 3KYGA 1BOQA 1P10A 3SZNA 3ZVBA 8KME2 3F2FA 3F0OA 2P3TB 3EYDA 2SGAA 4MLFB 4AB9A 3L33A 4FXGH 3E16B 3O8CA 1HDTH 3HATH 5AFYH 2RA0A 1ESTA 2P8OC 1G2MA 1LQDB 1F5KU 1OWHA 4Y11E 1PPZA 5FBIA 1V2UT 3M3VA 3MOCA 3TU7H 3M61U 2FTLE 5DKMA 4B2BA 2GT7A 1EZXC 1QNJA 1PPBH 2Y5HA 1O32A 4TT3D 1GBKA 1MQ6A 1HAVB 2GT8A 1XUGA 1DWBH 2G55A 1DX5M 1GMCF 4AORA 1K1JA 1H8ED 1C5OH 4JZDH 1HRTH 2PV9B 2Y7XA 1HAZB 1C2IA 1RIWB 3BV9B 3DUXH 2NU1E 2GDDA 4YXWD 1SHHB 2OP9A 3R3GB 5FPYA 3TK9A 3M5NA 1A61H 2FOFA 4CR9A 1OXGA 1GCTB 2BD9A 2BXTH 1GI4A 1TNLA 2ZFFH 3SU1A 2BDHA 3K2UA 1HCGA 1MD7A 1GBFA 4WJG2 1VITH 4U32A 5ABWA 1Y3YA 5G4BA 1SR5C 4AYVB 2BDBA 4WY3A 1OYQA 2STAE 2ZFPH 3EA8A 1O3HA 1SQOA 1SL3A 2AIQA 2G4TA 1BTPA 1GCDA 5TCCA 1D3TB 1O2XA 1PPFE 2OXSA 3ODFA 1MBQA 5ETXA 1VCPA 1SB1H 3BG4C 1XUJA 3PB1E 2I6QA 1ZRKA 3A88A 3QO6A 3RXRA 2ASUB 4JK6A 1AUTC 2AYWA 1GJ9B 2IN2A 1IQKA 2EC9H 1MH0A 2FO9A 2NU4E 1TONA 2A4QA 1LMWB 1HFDA 1H9HE 2HNTC 1N8OC 3OYPA 4E05H 4LZ1H 2H9TH 2O8MA 2AEIH 1XXFA 2BOHB 2SGEE 3M35A 5EXNA 3E91A 3GDSA 1BCUH 1ANEA 2ZGHA 3BTKE 5FCKA 2XBWA 1O2JA 1VKYA 2TGTA 3V0XA 1V2MT 4B71A 3Q3YA 1UHBA 2VWLA 1TX8A 4X1NU 3TITA 1DUEA 3NK8A 2ZTYA 5JYIA 1GJ6A 4H6TA 1S6FA 6CHAB 4TSFD 1V2OT 1QL8A 2AMPA 2IPQX 1EOJA 1FPCH 4GLYA 1O3PB 2KCOA 1A3EH 4Y8XA 1ZTLA 5ESBA 3BTFE 1OP0A 4F49A 3MYWA 1DE7H 5IDKA 1DOJA 2BLOA 2IJD1 2LELA 3SJ9A 1FI8A 1P04A 3MU1A 1VJAU 3A8CA 1K1LA 1F0TA 5EJLA 2WYJA 1BT7A 2FLRH 4WF8A 2AMQA 5E8EH 3DSPA 4B2AA 1GHVH 4UEHH 5EXMA 3PMHB 3QUMP 3MWIU 1COWD 3ZZ7A 1DWEH 8GCHG 3OFND 1BMMH 4UONA 1C2JA 3TGJE 1WYKA 2HVYB 1TGTA 2YMSD 1O2WA 3ZYEA 1GGDC 2WPKS 3N99A 3UREA 1NRQH 2CF8H 4NIYA 1LVYA 4MVNA 2ZDLA 3A7YA 1QFKH 1HB0B 3FAOA 1P9UA 1C5ZB 1Y5AT 1C5PA 2VIWA 3BF6H 4NFEA 1SBWA 2BD2A 1G2LA 4K5ZA 1ARCA 3QZRA 1KTSB 2QF0A 1OWIA 1E36B 3LONA 2FI3E 1HUTH 1AKSB 2P16A 4BTTB 1O5BB 1TRMA 1BMNH 4X8SH 2BY7X 5CHAB 1O3CA 5E2OA 3VPKA 3A86A 1QQ4A 3RXFA 3ZZDA 2Z9GA 2W26A 2VVUA 2Q6FA 1MKXK 4MPUA 3ELAH 2ZFTA 4JYVH 3T2NA 2BLVA 4Z6AH 1EP5A 4IC6A 2OC0A 3ZZ3A 2ODQA 1P2QA 1GI6A 1L0ZA 1JBUH 2HALA 3I77A 1C2DA 1C4U2 1SQRA 2GCTC 4UDWH 3BTEE 2XW9A 1PJPA 1HPGA 2FMJA 1ZJKA 2FPZA 3ATMA 1FONA 1K1MA 1T4VH 2ZQ1A 1QB9A 3ZZ4A 2ZO3H 4NA9H 7LPRA 1OWKA 1NBMD 2Y80A 1C5VA 4OS6A 4PROA 1F5LA 5FX5A 1H9LB 1MKWH 2G5NA 3ZV8A 4ISLA 1RRKA 1O3IA 2PTCE 4ZHLU 4A6LA 4X8VH 1XUIA 3KNXA 3HPTB 2BY6X 3RXJA 1EJMA 4NZQA 2EI8A 3L6PA 3F9HA 4D9QA 1MKXH 2OC1A 3NXPA 3GY7A 3DSGA 4MQAA 1A5IA 2WYGA 3KQDA 1W13U 1S85A 1B0FA 1EB1H 1ANDA 1C1RA 1C9TA 3STIA 2QF4A 8ESTE 1TOMH 1JOUB 2A5IA 3FZZA 1SLWB 3E1XB 2PHBA 2Y82A 4Y79A 1LDTT 5L6NH 3KN2A 2F9OA 3H5CB 1ELBA 1VR1H 4CH8B 2BYAX 4YOGA 2BDCA 1GI7B 1MAYA 1B0EA 3Q3XA 4ZROA 1NY22 3ZVGA 2WZQA 1PFXC 3Q77A 1HAYB 4ZXYH 5AFZH 1UTJA 4HFPB 4MNVA 4FVBA 3RC6A 1KXEA 4I86A 4KTUA 2KAIB 1BTYA 1JIMA 4FUEA 2THFB 1AIXH 1KDQA 1MU8B 1PQ7A 2ZPSA 1RTFB 1BJVA 3PTNA 1EXFA 3M7TA 1CQQA 3TJUA 3A8AA 2Y7ZA 3ZZ9A 2FZZA 1HAGE 5TCAA 3M37A 1YCPH 1MTVA 5F6MA 3W1EA 1GCTC 2PUXB 1T8NA 2Y5FA 4X2VA 3QGNB 5E0GA 3KIDU 3SOSA 5AF9H 1C1TA 2JJ1D 3A82A 4FUGA 4X8UH 1QZ8A 4NGAH 1DXWA 4IW4E 4Z1MD 3A7VA 4Y71A 5FX6A 2FWWA 1CHGA 3NPSA 3RU4E 2QYIA 2KAIA 2A1DB 2P3UB 1S6LA 4ASUD 2HGTH 1EX3A 5EOKA 4NG9H 1J14A 4BAHB 4ABIA 2SGDE 2G8TA 1OX1A 1KDQB 1RJXB 2R3YA 2GKVE 4NFFA 3UY9A 3BTGE 1G30B 4NSVA 4AGJA 2AHME 2Y6TA 1OKXA 1SGYE 1TA2A 2FOGA 2OQ5A 5JBTA 4K69A 1ZSJA 4QT8C 1OHHD 1A3BH 1O35A 1ELCA 4ISNA 1YPGH 4NIXA 3TH2H 1KXAA 4MPWA 4A1XA 3SNEA 3O8DA 1UTMA 3PM3A 1O30A 1FIWA 4LK4A 1O3KA 1KLIH 3QTOH 2BOKA 3T28A 1Z6JH 2BMGB 2VGCB 2ZI2H 1ZYOA 2BD8A 5H4IB 1GI3A 2BQ7B 3A83A 3BG8A 1YCPK 1K28D 4UE7H 4BOHA 3TH3H 4X1PU 1O2LA 1J16A 2XBVA 1ORFA 3A7TA 1LVBA 1GJ8B 2BY9X 3EA9A 2VGCC 1PQ8A 2PW8H 1OP8A 3GOVB 5C1XA 2FS9A 1F5RA 3RXGA 2ZHQH 1N6YA 5CHBA 1L1GA 4FOUC 1RD3B 5EPNA 3HGPA 3K9XB 3HGNA 4K1EA 2HRVA 4ABJA 5EGMA 4F55A 4Y0ZE 3ITIA 2R2WU 3VB4A 3ZV9A 5JBCS 4F48B 1YPEH 4MNWA 1O5FH 3UQOA 2FIRH 4DT7B 5CDFE 1SFIA 4THNH 1SC8U 5GDSH 1YLNA 1KXFA 5LGOA 1GL0E 1K1OA 1D9IA 1FPHH 2VVVA 2XCNA 3CS0A 1BRUP 3MU0A 3P8NA 1O3EA 1ZGVA 1ELTA 1W0ZU 3HKIB 3T26A 2LNCA 3AASA 2NU3E 3MMGA 1F0RA 2J98A 5HM9A 1JIRA 4AB8A 3GS9A 5JDUB 4BXSA 4YO9A 1AI8H 1PYTC 1MAXA 4NZLA 2QA9E 4JMYA 4MDSA 5EPYA 1UVPA 3EA7A 2HNTF 2FOBA 2Z9LA 1QL9A 1O31A 1GMHF 5EQRA 5BPEA 1T32A 1QQUA 1QRZA 3CENA 3T27A 3V12A 3S7KB 1FDPA 2C93B 2XXLA 4ZH8A 3MH5A 1TX7A 1O5CB 2SNVA 1TWXB 1ZRBA 4CHAC 1YP9A 3R0FA 1O36A 1GVKB 2TGDA 1EPTC 1J9CH 3UQVA 1K0HA 2DUCA 3ZZ5A 2OUAA 2XNIA 1E1RD 2RA3A 3F2GA 4K3JA 2O8WA 1FJSA 4H42U 3RXCA 4UFDH 3LU9B 2FS8A 1O2HA 1EQ9A 1GI5A 1O5EH 5L30H 5FCRA 1AFEH 3RLWH 1Z1IA 2G00A 2F83A 1BHXB 3NWUA 2M2AA 2CHAB 2Z3EA 4E7RG 5FAHA 4P02A 1MBMA 1EB2A 4AGKA 3P8FA 1ELFA 1AO5A 2ULLA 2ZGBH 1PQAA 1MZDA 2OLGA 2TBSA 2BDAA 2J98B 4I8LA 2K1QA 5I46H 1D4PB 4JZEH 3RMMH 5FPTA 4AN7A 4MPVA 2JIZD 2Z7FE 4R8TB 1C1NA 1A46H 4YT7H 2ZQ2A 5T6DA 1GWAA 1ELEE 2WPIS 1IQGA 4XSKU 1HXFH 1CT0E 1C1PA 1EAWA 1YY3A 2BD3A 5A09A 3UWJH 1SHYA
chains in the Genus database with same CATH topology
4AZ2B 3GISB 1QTFA 2CJIA 2FLBH 4VGCC 5PTPA 2ZCLP 5A8ZA 3SJOA 3MU8A 4BNRA 4GCHF 1WAYB 1UO6A 1UTLM 4CBOA 1QIXB 2EI6A 4KGAA 1Y3XA 1L4DA 3GY4A 1IQJA 1E38B 3UIRA 3PTBA 1SGFA 2FI4E 1K21H 3BTHE 1C2FA 2B7DH 1C5YB 1THPB 1TYNA 1O2QA 1FUJA 1CGHA 2H9EH 2AGGX 1TA6A 3BEUA 1EATA 3SGAE 3VB3A 1QGFA 2D8WA 2F9NA 2PGBB 3NZIA 3ATKA 2RDLA 1WTHD 2EEKA 1UVOA 2B9LA 2A5AA 3GYMA 4FVDA 2FXRA 1SGRE 5DPAA 2OTVA 1NPMA 1GI0A 2FOAA 1ZGIA 4I8KA 3ZZ6A 5C3NA 3SGQE 2UWPA 2ZTXA 3RXMA 2H5DA 1YPHC 2CXVA 3NKKA 4B75A 4DY7B 1GHXH 1NESE 1FXYA 1UVUH 3SI4H 2B0FA 5FPSA 3SO3A 3CS7A 1GMDG 1Y3UA 3SBKA 2VNTA 4ZKNU 1XX9A 5FBEA 1O2KA 3RXIA 3P95A 2ILNA 2QAAA 1VJ9U 1RIWC 3PMJA 2ANYA 1GJCB 1AZZA 1UMAH 4Q7YA 3LH1A 1HAVA 5E0JA 3A8DA 2H5CA 1SG8B 1AB9C 4I32A 1DLEA 5EW1H 1O2ZA 2OBQA 1NM6A 4HGCA 3MH7A 4X2XA 1H8IH 1WOFA 2J2UA 2A4RA 1XM1A 3MO9A 5HYOA 2FTMA 4WMFA 3TGKE 1HGTH 4JZIA 4O3UA 4OS4A 2AS9A 1TIOA 1C5LH 1SGIB 2A7HA 1EAIA 4CRFA 2O8TA 2ZHDA 1MZAA 3OY5U 3V13A 3BTTE 1VITF 1MMJN 2OBOA 1NTPA 1EP6A 2Z9JA 1O2SA 3BTWE 3URCA 4J2YB 1WQVH 2WPLS 3QTVH 3A87A 1MQ5A 2ZDMA 2UUKB 1LPGB 1UCYK 4IGDA 1O38A 2ZZUH 2VWNA 2GZ7A 4X6PA 4WH8A 1V2WT 2JH6D 4GHTA 1NRSH 3GCHB 2HLCA 3SGBE 2ZECA 2CN0H 1C5XB 2ZWLH 1C5WB 5CE1A 2PUQH 1HYLA 1EAUA 4O03A 4SGBE 3SV8A 3M5OA 3MU5A 1DM4B 2BTCE 1AVGH 2Z9IA 3LT3A 5GPIB 3PO1C 1EKBB 1C5SA 5AVDA 5BRRE 4BTIB 2BDIA 3L3TA 1TFXA 2WV5A 1SGFG 3KQEA 4XBBA 1TMTH 1ZTJA 2QF3A 1C5TA 3A84A 2ZU4A 4JK5A 3RU4T 1Q3XA 1LKBA 1CHOF 1TNJA 1GMDF 1G9IE 3EGKH 1AVWA 1CT4E 1TAWA 3PWCA 1HNEE 1AWFH 1OPHB 4X1SU 2G81E 4E06H 5EU8A 2PKSB 2ZGJA 1CU1A 3GDUA 1DWCH 1HJ8A 1LKAA 2FOMB 3LGTA 4JYTA 1KXCA 1O2OA 1O5AB 1SGQE 5TJXA 1FY8E 4XBCA 1FY1A 1GI2A 2BDGA 2LPRA 4BTUB 3BTME 5FHTA 1G3DA 1KSNA 1AWHB 1NFUA 2ZHEH 1SGCA 3DFLA 1GJ4H 2TPIZ 1J17T 2AIPA 3F1SB 4FUIA 1WBGB 2ZCHP 1P8VC 4WMEA 1HJ9A 1NU7B 3T25A 4I33A 3VB5A 3BEFB 4OS2A 4GPGA 1GHBF 2J95A 3UPEA 1RS0A 1FAKH 4NA8A 4ZXXH 3RXPA 3SV7A 1GL1A 4ABGA 4IN2A 4ABEA 2ZTZA 1MKWK 2PKAB 3BG4B 4FUFA 4BXWA 1TNGA 1UJ1A 3STJA 3HKJB 3RXVA 1DT2A 3UUZA 1A7SA 3NCLA 5GJ4B 1Z8RA 1YPHE 1CSOE 3BTQE 1XKAC 1THRH 1HJAB 1V2ST 1GI1A 5ESTE 1HAIH 4D9RA 4YOJA 1PPCE 3MNXA 1PPGE 2ZA5A 4H6SB 1FQ3A 1O39A 1P06A 1VZQH 1WCZA 1F2SE 1G3CA 2SFAA 1XXDA 2ZDNA 1K1PA 1Y5BT 1O3JA 2G51A 7ESTE 1O2MA 1V6DA 3O8RA 3LPRA 1DY9A 3TJOA 4IS5A 5HM2A 1TPOA 2JETB 4OGXA 1MD8A 1ZHRA 4K60A 2G52A 3RXEA 4FU9A 1UCYE 1ESBA 1UTNA 4X1RU 1DLKB 2BHGA 3D65E 3W95A 6ESTA 4O3TA 1TLDA 1GPZA 1W14U 1YLCA 4A5TS 2TGPZ 1HLTH 1A2CH 1DFPA 1G3EA 4IN1A 3U98H 2CV3A 1O2VA 2C90B 1OYTH 1P2MA 4ASHA 1AE8H 1AB9B 1INCA 3RXBA 4DVAU 3RXAA 1ETSH 2PKAA 4Y76A 4AFZA 2AGIX 3ZYDA 4A7IB 1UTOA 1S0RA 1LHGH 1ZJDA 1O2RA 3ATLA 1N8OB 3IWMA 1RTKA 2OCVB 1CT2E 4ISIH 3OU0A 2Z6BD 3GCNA 2P3FH 9ESTA 1AFQB 4INHA 3WY8A 2GMTB 1OWJA 3UWIA 1TGBA 2YOLA 3A8BA 4X2YA 2FX6A 1TMBH 1YKTA 3SJ8A 1W0YH 2GV7A 2VIVA 2AERH 1CA0B 3RLYH 1TNKA 2DE8A 5JBAS 3AW1A 1W8BH 3SQHE 1HBTH 3V7TA 2Z3CA 5A8YA 1S5SA 4I8HA 1QBNA 2FYRA 2BVXH 3LIWA 2OC8A 4D8NA 1O34A 2BB4A 1C1SA 3MU4A 2W5EA 5K7RA 3TJNA 2PR3A 1YYY1 1ZHMA 3SU2A 1O2TA 1P2NA 3SN8A 3IG6B 2CMYA 1QHRB 2P59A 4CR5A 2ZEBA 1YLDA 2H1UA 1O3GA 5EG4A 2O9QA 4Y8ZA 2HNTE 4YOIA 5DO4H 2XWBI 1K9OE 3S9CA 2WV4A 4HI3A 1HXEH 4MTBA 3TLOA 2R0KA 3K6ZA 4YLQH 3EE0B 4RKOB 1W7GH 3HK3B 1X7AC 3MH4A 1RGQA 3S7HB 3SNDA 1GHBG 5IYTA 1W7XH 3LGUA 1SOZA 3QDZB 1DDJA 1C1MA 2OD3B 3RM2H 1S83A 3DD2H 2OC7A 2ZDAH 1KLTA 6LPRA 1UTPA 1A5GH 1THSH 4FU7A 1P9SA 1O2NA 2O8LA 5EODA 2QXIA 2F91A 1O2PA 2ZU2A 1EZSC 3LDXH 2CHAC 3JZ2B 1C2EA 1EUFA 1GMHG 5JBBS 1TX6A 1DANH 5DP9A 4B74A 2STBE 1SLUB 3ESTA 3VGCB 3S9BA 3E3TA 1DSTA 2BY8X 2PSYA 4ESTE 4Q80A 3MI4A 1AZ8A 1GHZA 2ESTE 1NFXA 3A7XA 4UFFH 4NCYA 3RXTA 4BAKB 5L2ZH 2QXHA 3PMAB 3MHWU 1H8DH 1OS8A 1K1NA 1T8MA 1C1UH 1E0FD 1BTUA 5A2MH 4I8JA 2VVCA 2P95A 4UFGH 4ZMAH 3GICB 4DGJA 3TGIE 1IQMA 1A4WH 1C1VH 1SLVB 3F6UH 5FXLA 1ETRH 2FI5E 4CH2B 1RXPA 2BX3A 2XC5A 1DXPA 2BD5A 4E7NA 1IQEA 1O37A 3M7QA 1TQ0B 5EXLA 2FOCA 3KGPA 1BRAA 2CGAA 1BRCE 1Z7KA 1JRSA 1CVWH 1O33A 4Y8YA 2QGRA 3UOPA 4Z0KA 2YNBA 1GBTA 1GHWH 2FESH 1UVTH 1V2PT 2UUYA 4GVUA 5C67A 2XBXA 2BDYA 3RMOH 1MTNB 3VB7A 4KTCA 1SLXB 3A7WA 1GI9B 3UNRA 2ZFQH 1DVAH 1QURH 1EOLA 1GDNA 1WSSH 4Q7ZA 3VXFH 4ABBA 3EDXB 4FU8A 2DE9A 1DY8A 2VINA 2C8ZB 1FN6A 3QK1A 1W11U 2ZGCA 1NO9H 3MNCA 1ZR0A 1EZUC 1N1LA 1WTGH 3M7UA 1T31A 1EAXA 1WQSA 5T6FA 1O3FA 1SQTA 1SGEE 1C2HA 5HMAA 5DP8A 4I31A 3ATIA 2WUCA 4AFUA 1P12E 3DA9B 2BQWB 1Z1JA 1GHYH 1O3BA 4TPIZ 2FX4A 1HJAC 2JKHA 4Y0YE 3ZVEA 3P17H 2P94A 5F03A 3PWBA 3KL6A 3RXDA 1O2GH 3UTUH 2BM2A 2ZDKA 5C1UA 1XKBC 3ODDA 3M5MA 2V0BA 1AU8A 5JB8S 2GVFA 1LPKB 4D7FA 2QC2A 1Z6EA 4MPXA 5JPMH 1FNIA 2VIOA 3FFGA 4RSPA 3U1JB 1Y5UT 4JZ1A 1HIAB 5SGAE 2AH4X 4TPYA 2PWXA 1GDUA 2W3IA 1GVZA 1T7CA 1JRTA 1NZQH 4DJZB 4MG3A 2ZU3A 2ODPA 3PLPA 1TB6H 1WUNH 2GCTB 1MTSA 1BDAA 3C1KA 3I78A 4IMQA 5F8ZA 5DK1A 2VB0A 2OINA 3U8TH 1NFWA 2H6MA 5GCHF 1CO7E 3A85A 1YPMH 1YF4A 1Z71A 1CA0C 3T62A 1VGCC 3SV6A 1XVOA 1ELGA 1L2EA 2J34A 1E35B 1EPTA 1GBCA 3A80A 1QJ6B 2PKSC 5DP3A 1TBRH 1GJAB 5E0HA 1BMAA 3MFJA 3RXOA 1GHAF 2AFQB 1P03A 3EQ0H 4ZHMU 3S9AA 2ZPRA 3AAVA 2O8UA 2Y5GA 3VEQB 2BXUH 3KQCA 4KELA 3OX7U 1Y3WA 3K6YA 1BMLA 1JXPA 3UNQA 2GV6A 4RN6A 4ZKOU 8LPRA 1LCYA 3U9AH 2P93A 1AVXA 1UVSH 2A4GA 4XBDA 1O2UA 3LGWA 3SUGA 1YC0A 4R0IA 4MNYA 3PMBB 4UD9H 3ZVDA 2PGQB 2NU2E 1KIGH 3E6PH 1FY4A 2F9VA 4CREA 3Q76A 1GBIA 2BLWA 4FUJA 4IMZA 3MO6A 4DIIH 1IQNA 3KQBA 1W12U 2ZF0H 1GGDB 3E90B 1P3EA 1FAXA 6CHAC 1NFYA 1W3CA 2ZFSA 5C1YA 2PLXA 4DCDA 2FP7B 5C2ZA 2CF9H 4ZHAA 4CRAA 5GWZA 2XBYA 3LC3A 3MTYA 3BTDE 1V2RT 3GYLB 1BIOA 4HTCH 3KF2A 4YM9A 4Y6DA 2J94A 3FANA 3SU6A 4TY6A 4NIWA 5DP5A 5GXPA 4OS5A 1B7XB 1BBRH 2XC0A 1VCQA 3QGJA 4WMDA 1K1IA 3M3TA 3FP7E 4HZHA 1C5QA 3AAUA 1GBHA 3P92A 4LZ4B 2C3SA 5F8XA 2ZIQH 1GBMA 1BRBE 2A2QH 3UOUA 4GHQA 1FY5A 3B8JA 5I25A 3RXHA 1P2IA 2ANWA 3OSYA 5E2PA 3RXQA 4BAQB 1A0HB 4NWLA 1P2KA 1YCPM 3B23B 1QBOA 4OS1A 3GY3A 2W3KA 1LHDH 1TNIA 3MH6A 2IOTA 1TPPA 2ZHFH 1EJAA 1UK4A 1GI8B 2A7CA 1SGPE 3SHCH 2HWLB 2SNWA 2NU0E 2Q6GA 2R9PA 1QJ1B 5A0BA 3QWCH 1E34B 1BHXF 3SJIA 4B76A 1C5NH 4WXIA 2A31A 1NROH 1YPLH 1QB1A 1VCWA 4XFQA 1D3PB 3RXSA 1BQYA 1U6QA 1NRPH 1A0JA 3URDA 4KKDA 3V3MA 1F0SA 3LGIA 2XC4A 2VU8E 5DG6A 3ZVCA 1BTZA 5HGGA 1ELDE 1YGCH 2A0QB 5K0HA 2J38A 3PV4A 2H9HA 1P01A 2BX4A 5EQSA 3TPIZ 2FODA 1D3DB 1Z8GA 3FZDA 4ZUHA 1ESAA 1LO6A 2VIPA 1XUKA 4U30A 2GCHF 3ZZBA 3BN9A 3GCTG 3RXKA 1GBJA 3FP8E 2BLQA 4TY7A 5A8XA 3LGVA 2VWMA 1C1OA 3I29A 2GZ9A 5DGJA 5C5OA 3ZZ8A 2Y81A 2JH5D 1ZZZA 1MCVA 4X6OA 1EASA 1QY6A 1ZTKA 1BITA 1CHOG 4Q7XA 4TWWA 1F0UA 3SUEA 4FUHA 3PROA 1SI5H 1GDQA 1O5DH 1AN1E 3SUFA 1GMCG 3SQEE 1HAPH 2A7JA 3BIVH 5DP7A 3ATWA 3T29A 1L4ZA 2TIOA 4IC5A 1TMUH 2V3HH 4CRBA 1C2KA 4LOYH 1ZSLA 1GJ5H 3E0NB 2IJOB 2F9UA 2ZG0H 2GDEH 4NIVA 5EW2H 4CHAB 2HVXA 1ANCA 1ZLRA 2M5TA 3GY5A 4NWKA 5LH8A 1T8LA 3SU5A 1JMOH 1ZMJA 2ANMH 1EZQA 1P11E 3SORA 1AUJA 1P0SH 1PPEE 3M36A 1HAHH 1C2MA 3S0NA 1ZPBA 3QZQA 1QL7A 3SV2H 3D49H 3MNSA 1Y8TA 1HAXB 1TRYA 1MU6B 1J15A 4H4FA 2EI7A 3W94A 5LPRA 1AHTH 2AGEX 2AMDA 2BY5X 4AG2A 2FOEA 4X2WA 1CBWC 1NC6A 1OP2A 3OY6U 2ZHWH 2A32A 3Q00A 1QBVH 1O3LA 1DWDH 3SV9A 1S6HA 1BTXA 3SUDA 1YPJH 2NWNA 4LXBH 1LVMA 1BBRK 1UTQA 2XRCA 2VIQA 4AX9H 4GAWA 1P05A 2IPHA 1D6WA 2F3CE 1J8AA 3U8OH 3VB6A 1C5MD 4K8YA 4ISOA 2F9PA 3LH3A 2VIDA 4RKJB 1C2LA 3ZVFA 1IHTH 1AKSA 3PO1B 3E8LA 1L1JA 3NUMA 2C4FH 2I6SA 4YT6H 1V2NT 2WPMS 1UK3A 1SSXA 1YM0A 1P57B 1H4WA 2P8OB 4K1TA 4FUCA 2HOBA 3KHVA 4FUBA 1F7ZA 2QXGA 2GMTC 3K65B 4WWYA 2GD4B 3RU4D 2A4OA 3H7OA 1H9IE 2J4IA 3CP7A 1CGIE 1O3DA 3U1IB 1T4UH 1O2IA 1O3OA 4X6NA 3UR6A 2W7UA 5J4SA 1IAUA 4VGCB 3VXEH 5T3HA 4F4OC 2YNAA 1UCYH 3A81A 3GY6A 3S69A 1P2OA 3GDVA 4XDEA 4OGYA 1G3BA 2JH0D 3QLPH 1V2KT 1ELAA 2HPPH 5A0AE 3GY2A 1AE5A 3KEEA 3LJOA 2R2MB 4ABFA 4ZKSU 3AVZA 1SPJA 1A1RA 1DS2E 1BZXE 1FY3A 7KMEH 4BAOB 1P2JA 2Q1JA 2ZGXH 4WH6A 4BANB 1UTKA 2OQUA 3BSQA 2QY0B 2V3OH 3TJVA 4X0WU 4ABHA 4CRDA 1GVLA 4UFEH 4YTAA 1BA8B 2ALVA 3BIUH 3HK6B 4IBLH 5HXFA 1MTWA 3P8G<