2K0QA

Solution structure of copk, a periplasmic protein involved in copper resistance in cupriavidus metallidurans ch34
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
74
structure length
74
Chain Sequence
VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEALRKGHSEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Putative uncharacterized protein copK
publication title Molecular structure and metal-binding properties of the periplasmic CopK protein expressed in Cupriavidus metallidurans CH34 during copper challenge.
pubmed doi rcsb
source organism Cupriavidus metallidurans
total genus 16
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2008-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2k0qA00
2LELA 3N7DA 2KM0A 3N7EA 3DSOA 2K0QA 3DSPA
chains in the Genus database with same CATH superfamily
1AIXH 2H1UA 1PQ5A 3BIUH 3GY5A 2J4IA 4NIWA 3CS7A 2EI8A 1VITH 3QLPH 3DHKH 5DPAA 2VBCA 4INLA 2ZC9H 3UR9A 3A87A 3KYGA 2RG3A 3VB3A 4NG9H 1THSH 2CJIA 1KTSB 2LNCA 1Z1IA 1GHWH 4I33A 2PFEA 1K28D 1XUKA 1Q31A 2AGIX 4RSPA 2A5KA 4D7FA 3Q3KA 5F6MA 1SGYE 1ANBA 2WUBA 2Z9JA 2BVXH 3FP8E 1SSXA 5DSFA 4JMYA 3SUEA 1E1RD 2BY6X 1MBMA 3SQEE 4CRGA 3KQDA 1GI4A 1MKXK 2J5UA 1BRAA 3M35A 1ETSH 4BTUB 3MO3A 2ZDAH 4UDWH 1HLTH 1NRQH 4HTCH 2AEIH 2ZO3H 1O5CB 1TOMH 2G52A 3RLWH 4GUXA 2KR7A 4NSYA 1OSSA 3KGPA 3T62A 1AFEH 1A5HA 2XC0A 4D7GA 4X2YA 5HIYA 1FDPA 5DO4H 1NESE 4CH2B 3N7EA 2P3FH 2JH0D 1ZMJA 2BTCE 1MH0A 1BIOA 1IQHA 1O0DH 3A82A 1HAYB 2FS9A 2L6OA 2RDEA 2F9VA 2BD7A 2TGDA 4I32A 4XSKU 3F0OA 1GBLA 1UVOA 2ZHEH 3EA7A 3M5OA 2BVRH 1GBAA 4WY3A 4Q7XA 3GYMA 1AZZA 1NC6A 3VB4A 4IN1A 1W2KH 1MTVA 4M9FA 3O8BA 3PROA 1KLTA 5EXNA 3SHAH 4JZFH 1YY3A 4DJZB 4OGXA 1OOKB 5FPTA 1OWJA 3P8OA 1HIAB 3DSPA 1EZXC 1SHHB 3V0XA 1C1SA 1O2ZA 2AH4X 4O9VA 2XNIA 3A7YA 3FAOA 5BRRE 3GY2A 4Z6AH 4ASHA 5DKMA 2PKSB 2F9OA 4DIIH 1FX0B 2AS9A 4DW2U 1KXDA 1JMOH 4FXGH 4JK5A 3ZZ3A 1XXDA 1LKBA 1SGTA 2PKSC 4K69A 1VJ9U 2ZDNA 1ORFA 4MNYA 1D4PB 1XX9A 3SV8A 2YOLA 2ZGXH 3LIWA 1P2NA 5GXPA 1PPFE 3SZNA 1XM1A 3TIUA 1P2MA 2PKAB 2J95A 4O03A 1UK3A 2GMTB 4OS1A 3M5NA 2VJ1A 1MAYA 1PQAA 1NT1A 3DSOA 2J2UA 4X8UH 2AGGX 1ABJH 5IDKA 1AUJA 5FL7D 3FANA 4RT0A 3RMLH 4A1TA 2SGAA 4YTAA 1C5LH 4IBLH 3GCHC 1GMDG 4KGAA 1TLDA 3QO6A 4X8SH 4B76A 2THFB 1OPHB 4YZUA 2QXHA 1B0EA 3ZZ9A 1WSSH 3BTDE 3TK6A 3UFAA 1QJ7B 1QQUA 3NKKA 3RXRA 3SQHE 1ANEA 1C5SA 1O2HA 2A4OA 1Y5BT 1DXPA 1XUHA 2W26A 3HGNA 2CF9H 1TNHA 2Y81A 4OM9A 2PHBA 1QNJA 3UIRA 1Z8GA 1ZRBA 1DVAH 2PGQB 3V3MA 1O38A 2XWBI 3MFJA 1YWUA 5GCHF 4B74A 4JZDH 1A61H 1GBFA 1BBRE 2ZFFH 1YPHE 2CN0H 2R2MB 4WH8A 2Y5FA 1C2JA 1F0TA 1FUJA 3N7OA 2ZDMA 3S7HB 2SGPE 5BPEA 4X1QU 1S83A 1GBJA 2ZI2H 1O31A 7KMEH 3V7TA 3STJA 4AG2A 4FU7A 3RMNH 2H9HA 2ZU5A 4TY6A 3GDVA 1Y59T 4MTBA 1A5IA 1KY9A 2V0BA 3F9GA 4YLUA 5AVDA 3QTOH 3BTME 3BTWE 2XC5A 4YLQH 1GHXH 3GY4A 3TJVA 2BDYA 5DP8A 3PV5A 5HM2A 1VGCB 2BD9A 1TRNA 2ZWLH 3ZZ8A 3P70B 5DJ7A 4AFZA 2D8WA 4YT6H 2G5NA 1YF4A 5EXLA 5GDSH 2L74A 1XUIA 1O2XA 4R8TB 1GI9B 3MO9A 3VB6A 2FZZA 4X2WA 1TX8A 1YLNA 2QGRA 1GBCA 1GMCF 2ZHFH 4ISOA 1TA6A 1PFXC 3RXEA 1O5EH 1GHYH 3SV9A 1O2OA 2RDLA 1SC8U 1SI5H 2GT7A 1BQYA 2J98B 3TLOA 1PYTD 1SFQB 3DSGA 2C4FH 1V2UT 1UK4A 1BTWA 1TBZH 1WCZA 4IN2A 1B0FA 5J4QA 1FQ3A 2FTMA 3A7TA 2J38A 3EE7A 1P8VC 1QHRB 1NTPA 1NROH 2TGAA 3FO8D 3GISB 3D49H 1AVWA 1DOJA 1WTHD 3DUXH 3TVJB 1O2VA 3B9FH 4RN6A 1C2FA 2XTTB 2W6ID 1IQIA 1V2QT 1ELCA 2TGPZ 2ZP0H 5E8EH 5C1YA 1OP8A 2HWLB 2UUYA 2ZGJA 1COWD 1DWCH 5FX6A 1P2KA 4RKOB 1OYTH 2ZHWH 1UO6A 1QB9A 3MQKC 4YT7H 1SGNE 3P8GA 3ATKA 5EPYA 3U8RH 3UWIA 1C5MD 4X0WU 2QE7D 1HPGA 1KTTB 1UTKA 3PO1C 2G81E 1NFYA 3M7TA 3M3VA 5E0JA 6CHAB 3RP2A 4SGAE 3ESTA 3EAJA 2ZPQA 5C17A 3GY8A 3Q77A 5AF9H 1Q2WA 2ANYA 3EA8A 1T32A 2WPJS 1AUTC 1QA7A 3P6ZB 1T31A 1GHAG 3F6UH 1MU6B 5FPSA 1EB2A 5CDFE 1UVSH 1TNIA 1V2PT 3ZVEA 4GLYA 2HPQH 2YMSD 1T8LA 2HRVA 2OC1A 3UNRA 3RXHA 4E06H 1O3KA 1EZQA 1QJ6B 2NU4E 5LPFA 3SYJA 5C20A 1KDQB 4HGCA 1GBDA 2D2DA 4YESB 3TU7H 4CREA 4AFUA 1LVOA 2H9EH 2OTVA 5HXFA 1GI0A 2J92A 1MABB 3AVZA 1DM4B 4UD9H 1QB6A 3P8FA 4UONA 4CHAB 3BSQA 1GI2A 4J1YA 2CHAB 1O30A 2WSSD 4IC5A 2ZZUH 5JB8S 3P92A 4D9RA 4CHAC 3MNSA 2CHAC 2PWXA 3GY6A 4NIXA 1C1RA 3OY5U 3RXMA 2BX3A 3SU4A 3S9CA 2Z3DA 4DURA 3STIA 1IQNA 3LH3A 3ODDA 1ARBA 3PB1E 5HYOA 3E16B 1KXBA 1O3AA 1BJUA 5JBTA 1NU9A 1NFUA 2ZKSA 2OQ5A 3SUFA 2Y80A 3H7OA 3M5LA 2AMQA 3PMBB 1ZHRA 2EEKA 2EY4C 3NRLA 3A85A 2A7HA 1PPEE 4TWWA 4ACAA 4ABHA 3E8LA 1FI8A 2J97A 1RS0A 1YPMH 4BXWA 1DY8A 1DT2A 2LELA 1OWDA 3OEHD 5DP7A 2VIPA 1C2IA 1HAGE 2GDDA 1UHBA 4B73A 5T6FA 5ABWA 1EAUA 1G2LA 4ABBA 3PLKA 2KCOA 3M61U 4HZHA 4BTTB 1EFRD 3K9XB 3SJIA 1BTZA 1NU7B 4ZAEA 1HAZB 3PWCA 2P8OB 4FUHA 2IJD1 3BV9B 1SGFG 4ZMAH 2SNVA 2WPKS 2YNBA 1Y3YA 1ZPZA 3SU6A 1S6FA 5GWZA 1Z8IB 3DCLA 2P8OC 1PPBH 1DWBH 4NWKA 1BMFD 1YPGH 1DUEA 1C5WB 2G8TA 4Y7BA 3BTGE 2QF0A 5HM9A 3F3BA 4CRFA 1CGJE 2P93A 3Q00A 5F53A 3RXIA 1FMGA 2XXLA 1OHHD 4Y8XA 3PMJA 1LQEA 2KFWA 1H1BA 4WMFA 3BEUA 3F2HA 1BITA 2WHXA 3OYPA 5T3HA 5HIZA 3KEEA 2WUCA 4UE7H 1O2RA 3RXTA 1J9CH 2A4RA 1N6YA 1TYNA 1G3EA 1L4ZA 3TJOA 3WWFA 1C5UA 1CQQA 1BCUH 1Z7KA 1GHBG 4MPUA 4X2VA 1O3JA 2WINI 3H5CB 3RXJA 1JIRA 1AKSA 1O36A 2DE8A 4AX9H 3LGWA 6GCHG 2PSYA 1PPGE 4INKA 1Z8RA 1ARCA 4TWYA 2PW8H 1HJAC 1HAPH 2FOAA 1BBRK 1H4WA 3BG4B 3VFEA 1UCYE 2A31A 7GCHG 2PV9B 2F9NA 5KEDA 3IITA 3FZZA 2WPHS 1K22H 1SB1H 3EA9A 2TGTA 5A0CA 1BHXB 2YNAA 5DP3A 4F48B 4K1EA 1TNLA 1Y3VA 2AIPA 2UUKB 4XDEA 3SW2B 2RA3A 2OQUA 1G36A 1NBMD 4TPIZ 5KGOA 1U6QA 3KYFA 1ANDA 1G2MA 4X6NA 1ELEE 3KHVA 5J4SA 4AGKA 2BY5X 5LPEA 1J16A 2Y5HA 4FUIA 1KXEA 5C67A 3ZZBA 1MKXH 2ZHDA 1PJPA 2H9TH 4I8KA 3V13A 2V3MA 5DN6D 1GHBF 1D3TB 1OWHA 3AASA 3H7TA 1C5TA 4KTUA 3RXSA 1SQAA 3SGBE 1CA0B 2FOCA 1SQOA 1CU1A 4ABEA 4CRAA 4FVBA 4MLFB 4ZKOU 1TGSZ 2Q6GA 4KKDA 3E0NB 2G51A 1RIWB 1OS8A 3KL6A 1QFKH 2SFAA 1ZYOA 4YOGA 4I7YH 1SLUB 2HNTE 3TK9A 4DT4A 1EZSC 2GP9B 1OKXA 1KXAA 5F8ZA 1ZJDA 2KCAA 2NU2E 4NIVA 1T8OA 2ZU1A 3K6YA 2ZFRH 3SJ8A 1NRSH 2WV5A 2ZGCA 1SOZA 1TX6A 4TSFD 1C1PA 2BD4A 4F4OC 1AU8A 1SLVB 3T2NA 3FOAA 2FYRA 4DIHH 3A86A 3DT0H 4X6PA 3ITIA 5H4IB 3TITA 2ZDLA 3BTHE 2A1DB 5C0UA 4BTIB 5IYTA 1QIXB 2BLOA 1NFXA 1VCPA 2QC2A 3PMHB 3HKIB 2ODPA 5A8XA 1C2KA 4Y11E 1EB1H 4IGDA 3HKJB 2FESH 1WUNH 1SLWB 4P00A 4ASUD 1TB6H 4FOUC 3R3GB 2A2XH 1F5KU 1UTPA 1AFQC 3NK8A 3SNDA 2R9PA 4THNH 1GJ8B 3U9AH 4ZHMU 1TNJA 1F5RA 2GZ7A 5F8XA 2BQWB 3LGTA 3F9HA 1S81A 1THRH 4GCHG 2JETB 3BEFB 1QR3E 2OK5A 1TMTH 1GMHF 1QJ1B 3TH3H 1XUJA 1EPTC 2G55A 2JETC 4Y8ZA 1ESBA 5FAHA 3TGIE 3NWUA 1AQ7A 3OEED 5F03A 4A6LA 1H8IH 1AI8H 4JYVH 5DGJA 4CH8B 1O2IA 2IOTA 2SGQE 3UNSA 1O2KA 5HGGA 1P11E 1XUFA 1SLXB 2DE9A 1BT7A 1C9PA 2O8UA 1K1LA 1G30B 1K1PA 1Y3XA 4D76A 3I77A 1GJDB 3VXFH 1DFPA 1LVMA 2VB0A 1C1NA 2UWLA 2ZA5A 2SGFE 3OY6U 1MKWH 2XWAA 5C1XA 1Z1JA 1HFDA 1W7XH 4XFQA 1MD7A 3JZ2B 1BOQA 3A89A 4RI0A 3LGYA 1P10A 4LK4A 4Y10E 8GCHG 1BTYA 2BLWA 3UQVA 1AHTH 4LZ1H 1A0HB 1DDJA 1TNKA 3OU0A 1HAHH 2ZECA 3D23A 4GAWA 3ZIAD 2Z3CA 3Q76A 4BAKB 2HLDD 5EXMA 3MO6A 2H6MA 2ANMH 1FY3A 1YPJH 4MG3A 3S69A 3ZZ7A 1C1MA 3H09A 4TPYA 2PTCE 4AFQA 2C93B 5JYIA 2FOMB 1EAIA 3AW0A 1P09A 3A7XA 2OCVB 4TYDA 3U8OH 8LPRA 3LGIA 1YKTA 3BIVH 1ELGA 1A7SA 1XXFA 3SNAA 2K0QA 2ZCLP 1TGNA 1QQ4A 3OAAD 1RGQA 2BZ6H 1QBNA 3A7ZA 5JPMH 5CHBA 3F0PA 3QX5H 3S0NA 1C1VH 4LZ4B 3MNXA 3TH4H 1O2YA 2PLXA 1INCA 2QXGA 3ZV9A 4FUJA 3BTQE 1GGDB 3D65E 4MPVA 2BZAA 1CHOG 1MQ6A 1YLCA 1GGDC 1S85A 4Q2KA 3U98H 2JH6D 3M7QA 2A7JA 2VIWA 4WJG2 4ZXYH 3RMOH 4KELA 3A81A 4CBOA 1A1RA 2G4TA 2LP6A 2JDID 1IQMA 1YC0A 3QGJA 5LPRA 1IQKA 1Y8TA 1YPEH 2Z9IA 2IPQX 5EIYA 2FIRH 5KECA 3RXAA 3A88A 4AB9A 3E3TA 2VVUA 1DWDH 1SMFE 1BRUP 1KXCA 4K8YA 4Q7YA 1XUGA 2GCHG 2O8WA 1MQ5A 2W5EA 1SL3A 4JYUH 3SJOA 1YCPH 3UQOA 4BAQB 1CSOE 1V6DA 2OINA 1ZSKA 2A45B 4MPWA 3KN2A 1E37B 4Y0YE 4FETA 4J2YB 1IQJA 1SQTA 4Q80A 4UFFH 1IHTH 1AVXA 1H8ED 3Q3XA 1C2GA 4XD7D 1V2ST 5E0HA 2KCPA 1WQVH 1GVZA 2PUQH 1DS2E 2GMTC 2HLCA 2FX6A 1SKYE 1H8DH 1W3CA 1CHGA 1UCYK 1IQGA 3MH7A 2Y82A 2STAE 4GHQA 5ESBA 3QN7A 2OC7A 1O2WA 3TPIZ 2BQ7B 1A3BH 2P16A 1S6LA 4XRNA 1O2SA 1VKYA 1BDAA 1F92A 1TRMA 1N8OB 4CRCA 3GCNA 1MCTA 1G37A 3UTUH 3FP7E 1C1TA 1L2EA 3QZQA 2ZQ2A 1DX5M 1GBEA 3RMMH 1MTSA 4MVNA 4D9QA 1WBGB 1NO9H 4Y71A 2FYQA 8ESTE 2Y6TA 1P12E 5K7RA 1FIWA 2QXJA 3I29A 1EOLA 1JWTA 2WPMS 1TPSA 3LH1A 5G4BA 1F0UA 1TFXA 1O3NA 1FY4A 1EJAA 1GG6B 1HAVA 1P04A 1RTKA 3MI4A 4HG6A 4E7NA 3WY8A 2R2WU 2GZ9A 1EOJA 1GBIA 1RD3B 2PUXB 2W3KA 1C5VA 5EQSA 2C3SA 7ESTE 3MH4A 3PTNA 2BLVA 2QY0B 3FP6E 1AZ8A 4M7GA 2TBSA 1O34A 3QK1A 4Y8YA 3T25A 1ZZZA 2FM2A 1TIOA 4NWLA 3DFJA 2XYAA 3GY7A 2BX4A 1GMDF 1P57B 3VXEH 1VGCC 2XCFA 4LOYH 3TNTA 1EAXA 4NZQA 4JK6A 1BHXF 5CHAB 1GWAA 9ESTA 3M7UA 1W13U 1AWHB 1EPTA 3P95A 1RFNA 5E2OA 2Z9KA 2ZG0H 1ELAA 1SBWA 3A83A 5L2YH 2V3OH 5CHAC 1K1JA 2ALVA 2FS8A 2OP9A 1DUAA 2W7UA 3RXQA 1NPMA 2A2QH 2ZU4A 3SU0A 1P3EA 4U2WA 1AE5A 4A5TS 1O3DA 4WH6A 3TJUA 3GICB 3ZZAA 4Q4LA 3HGPA 2BM2A 4U30A 1UK2A 5EODA 1GI7B 3K65B 2KM0A 2ODYB 5FXLA 1TQ0B 3RXVA 2DUCA 1O3FA 2QAAA 3BTKE 3P17H 1A46H 3HPTB 1O3OA 2GV7A 3A80A 1CE5A 2CF8H 3SGQE 3SU5A 1W0JD 1FPHH 2BYAX 1NRNH 1TMUH 1VITG 4D8NA 3LJJA 2UWOA 1GL0E 1E36B 4B2BA 5LGOA 3FZDA 2VIDA 4H4FA 2PSXA 3B8JA 3M3SA 1O35A 1O2MA 4MPXA 1K21H 1QL7A 4INHA 1AVGH 4ABJA 4AORA 2ILNA 1GHZA 2ZFTA 3EE0B 3GDUA 3SNEA 3UR6A 5EGMA 1YPHC 1LHEH 3ZYEA 1O3CA 6CHAC 1YP9A 1O3EA 1C4U2 1DWEH 3RM0H 2XBVA 4ABGA 1O2QA 1QCPA 1MZDA 4ESTE 4QT8C 1OWEA 1SHYA 1SGPE 2CMYA 1GJBB 5A8ZA 3FN8A 5C5NA 1EUFA 1H9HE 3QZRA 3TH2H 1BTXA 4BXSA 2XBXA 3ZZ4A 3PLBA 3TNSA 1BMLA 2AERH 1MAXA 2JJ1D 1DXWA 3F68H 5EJZA 3W1EA 4R0IA 6LPRA 1IAUA 1QRXA 1MZAA 1NBME 3GY3A 1YPLH 2LPRA 1O39A 1W10U 4BAHB 1HIAA 1F7ZA 1F0RA 2A4GA 4XBCA 3SHCH 1A0JA 4XOJA 1OWKA 1SPJA 2WYJA 4Y79A 5TJXA 3S9BA 2R0KA 1MD8A 4H6TA 4Y7AA 4ZKRU 4ZROA 3VB7A 2H5DA 1HDTH 1Y5AT 1O3GA 1OYQA 1ABIH 3UOPA 2GCTB 2XCNA 2G5VA 1OP0A 5DP5A 1P9UA 3LDXH 2FOGA 4BAOB 2UWPA 2BDIA 1W14U 2GCTC 1XMNB 1C1UH 2B7DH 5C94A 1L0ZA 2PP6A 1D3PB 2C8ZB 1NRRH 5FBIA 2Z3EA 2C8XB 2PKAA 1ANCA 2ZPRA 4WXVA 1GHAF 2EI6A 2R3UA 4OS5A 4B1TA 1O2TA 4KTSA 3FFGA 1C1WH 1O2JA 2ZTYA 4IS5A 3HK3B 3RXLA 3E6PH 1TAWA 4GSOA 1ZRKA 3A8CA 5T6DA 1C2MA 1WTGH 1GL1A 3S9AA 1HRTH 4BAMB 1QB1A 3A7WA 1LTOA 3EGKH 1LPZB 1LKAA 1O2GH 2FTLE 3PYHA 3ZZ5A 4ZCNA 1AY6H 3SO3A 1UTQA 1UTOA 1GCDA 2ANWA 1K1MA 2ZQ1A 4B2AA 4ISLA 1O3LA 2P94A 1B7XB 4K8BA 1H9LB 1GVKB 1ZPCA 5B6OA 1S0QA 1GJCB 1O2NA 1S0RA 1SFIA 4HI3A 3MWIU 5FX5A 3NZIA 2FDAA 1HYLA 1TABE 3CNRA 4ABFA 5AFZH 2WV9A 4FUBA 3SI4H 5FCKA 2V3HH 3ZYDA 1SGIB 5EJ1A 3JZ1B 3BEIB 4K2YA 2A5IA 3SUDA 1F5LA 1EP6A 3QWCH 1AWFH 1ZHMA 3PLPA 5ETXA 5L2ZH 1ZMNA 4YOJA 4K1TA 2ZCHP 1YM0A 1P2QA 1FZZA 2KAIB 1HAOH 4NCYA 2D26C 2K1QA 1LMWB 3GYLB 5B6LA 1TALA 2FI3E 1WOFA 5JDUB 3SOSA 2PGBB 1G32B 4TT3D 4Q63A 2RFKC 1B5GH 2A0QB 3SGAE 4AN7A 1ELBA 4NGAH 4Y0ZE 4YO9A 3RLYH 5C3NA 4ZXXH 3MHWU 2P59A 1HXFH 3KNXA 3KQEA 3RM2H 5HMAA 5A09A 3ZVFA 1E34B 1YCPM 3A8DA 3BG4C 1L1GA 2F9BH 1DLEA 2AHME 2TPIZ 3E91A 4X8TH 3UB0A 3ATMA 1EAWA 3ATLA 2J98A 2FWWA 2OC0A 1A5GH 3PV4A 4DCDA 2HALA 1GHVH 1ZGVA 1LCYA 3LC5A 3HK6B 4B6FA 3T26A 1ZGIA 2QCYA 1K1NA 2FI4E 4A92A 1ESTA 2GT8A 1O5FH 3MU0A 5L6NH 2BQ6B 2W3IA 2BLQA 1UTMA 2FOEA 1L4DA 2FXRA 3OTPA 3G01A 4TY7A 8KME2 3PM3A 1XKBC 2F9UA 3LU9B 3SZEA 4AZ2B 1V2RT 1A4WH 3RXKA 1FIZA 1GJ4H 2AIQA 4I86A 1Z71A 2EQNA 3I78A 2G00A 6GCHF 5A0AE 2ZGBH 2F83A 3ZZCA 5L30H 1CA0C 1D6WA 1C2DA 3QTVH 3RU4D 1IQLA 4FVDA 4ZH8A 1RIWC 1HUTH 1XVMA 2VINA 1KLIH 3PTBA 2VH6A 1BTUA 1O5BB 3E90B 4X1RU 3RU4T 1V2OT 2R3YA 2Z7FE 1PPZA 5IK2D 2GVFA 2Y7ZA 4I8HA 7GCHF 1QL9A 2M2AA 1LHDH 4OS6A 2VWMA 2GDEH 3WW7A 3Q3YA 5C2ZA 1ELVA 1AB9B 1HGTH 1TPOA 1EJNA 3U1JB 1O2LA 4UFDH 2QV1A 1GJ5H 1BMAA 1W0ZU 1DANH 5EW1H 1BA8B 3IWMA 4JZ1A 1KDQA 1LPKB 1ZSLA 2JKHA 3B23B 5EQRA 2IJOB 1HAIH 2A32A 1ZHPA 5EU8A 2Z9LA 1HB0B 3SV7A 2VIQA 4AOQA 2BD8A 4MDSA 3IG6B 1TGCA 1P3CA 3N7DA 4ABIA 3UY9A 1EASA 2CGAA 1C9TA 5FCRA 3LGVA 1C5RA 1C4Y2 1CBWB 2GV6A 1DLKB 1NZQH 1C5ZB 1K1OA 3MTYA 2QF4A 5LH8A 1XVOA 2ZEBA 2BDBA 3AAVA 1GDUA 1CT2E 3ZVCA 2BY7X 1CBWC 2VVVA 1CVWH 4X1NU 1UTNA 1WU1A 1P2IA 3M37A 4NSVA 1V2NT 1RXPA 2FODA 2XBWA 3U8TH 2ZPSA 3AAUA 1WAYB 2OBOA 3D62A 1E79D 1EP5A 3WWBA 1OP2A 2HOBA 1MTWA 1UCYH 4B75A 1K0HA 1DSUA 1W0YH 4FUEA 3VEQB 1SG8B 2O8LA 1MUEB 3ZVGA 4MNXA 4NA7A 4RT1A 1GJ6A 3RXDA 3AW1A 5FBEA 4AYYB 1UTLM 3QGNB 3UWJH 1WXRA 2FP7B 2WPIS 3R0FA 2ODQA 3UOUA 5SGAE 1O3PB 2SGDE 1QL8A 4Y6DA 2HNTC 4AGJA 1ZJKA 2GZ8A 5E2PA 3RXPA 3T28A 1JRSA 4IW4E 1UVPA 2BDAA 3L33A 4O3TA 3RXGA 5EW2H 1AMHA 2WYGA 1O5AB 5F8TA 1PQ7A 2IN2A 2WPDD 1QBVH 3GCOA 1E0FD 2O8TA 4GCHF 3F9FA 1SVPA 2F4LA 1DY9A 1E1QD 1EQ9A 3SNBA 4ABAA 1QURH 2QYIA 2VH0A 2WZQA 3ZVBA 3KIDU 1UW7A 4NFEA 2H2ZA 2KAIA 3ENSB 1AD8H 1TBRH 4PROA 4U32A 1CO7E 4A1XA 1NN6A 1Z8JB 3BTEE 1PPCE 1A2CH 1HBTH 1G3DA 1TMBH 4UFGH 2KCYA 1S82A 3RXCA 5A2MH 5PTPA 2ASUB 2GD4B 1C1QA 2ZNKH 1P2JA 3RC4A 4FUFA 1GDQA 3KQCA 1UVTH 4ZHAA 4K60A 2ZTZA 4XBBA 1FONA 5E0GA 1VR1H 4IC6A 1ELTA 1C5YB 2WV4A 2F43B 2A7CA 4K5ZA 3DFLA 1UVUH 2O9QA 3MU5A 8GCHF 3SJKA 4DT7B 1F0SA 2FOHA 1EXFA 2M5TA 1QBOA 4GHTA 1D3DB 3LT3A 4ISNA 1ZOMA 1J17T 1TBQH 4O97A 1V2MT 5EQQA 3MU4A 2FOBA 1GCTB 3MOCA 2BXUH 1LVYA 1D3QB 5I25A 4IMZA 1C2LA 1P2OA 5GCHG 1TONA 1GCTC 1K2I1 2ZDVH 2UUJB 1N6XA 1V3XA 4X8VH 1FNIA 1C4V2 2VWLA 2ZFSA 1GBHA 4IMQA 5C5OA 2ZU2A 4F49A 4YOIA 5CMXH 2GTBA 2EI7A 2ZFQH 5JBCS 2J94A 3ZV8A 3V12A 2BDGA 4ISIH 1PQ8A 4CR9A 3FKSD 2HGTH 4ZUHA 1TA2A 1FY5A 1G3BA 2QA9E 2QXIA 3NXPA 3URDA 3SU2A 4A7IB 4E7RG 2CV3A 3FVFB 1A0LA 3GCHB 1LDTT 3NPSA 3MU8A 1UHBB 1PPHE 2FEQH 1BTHH 1T8MA 2OC8A 2VNTA 2Z9GA 2P95A 1CHOF 1QRZA 1SGEE 1TRYA 4ISHH 1N8OC 4DGJA 4FU8A 1MMJN 1NM6A 3SV6A 3F9EA 1S5SA 1O2UA 4Z0KA 3SJ9A 5TCAA 1FY1A 3N99A 1HNEE 2OBQA 1GMCG 4H42U 4I8JA 1OXGA 5DP6A 3OX7U 3A7VA 2C8YB 1WDIA 1PYTC 3DD2H 2ZGHA 1IQFA 3W94A 4AYVB 1MKWK 2GCHF 4CRDA 1A3EH 4ZKSU 5A8YA 4ABDA 2F91A 3RUOA 1LVBA 2R0LA 3O8DA 2K8IA 2OLGA 1HJ9A 1RTFB 1GBMA 2BOKA 1T4VH 1BTPA 4GVUA 1GG6C 2AMPA 3LJOA 1C2HA 1F2SE 1CT4E 1H8HD 1MTUA 1ELDE 2TIOA 2XW9A 1ETTH 1BMNH 1VCQA 2BOHB 5JBBS 2UUFB 5K0HA 1GI1A 4I8LA 2VVCA 1K9OE 1T7CA 1CGHA 2Z6BD 1GI5A 1RRKA 3TK5A 1V2JT 3EQ0H 3F2GA 1AKSB 4X1SU 1ZSJA 4K3JA 2Q1JA 3T27A 2OUAA 3SU3A 1MU8B 3VG8A 1FPCH 2V7QD 1J15A 4JCNA 1WQSA 5HKKD 2Y5GA 3BTTE 1W11U 1WYKA 1Y3WA 3LGUA 2F9PA 2YMSB 2BHGA 3P8NA 1SQRA 1LHCH 3ZZ6A 3ATWA 1W12U 2V6NA 2STBE 4JZIA 3OE7D 1W0KD 2YMSC 1BRBE 2RA0A 1CA8B 3A8AA 4SGBE 1P9SA 2FLRH 1MTNB 4DY7B 4X2XA 4A1VA 2C90B 4JZEH 4FU9A 1FV9A 1ZR0A 1YGCH 4F55A 3GCTG 1MTNC 4ZHLU 1AO5A 2EC9H 2QIQA 2ZHQH 2HPPH 4AC9A 1NRPH 3ZVDA 2A5AA 4WWYA 1OWIA 1ZTJA 5JB9S 1P02A 1IQEA 2OXSA 4KTCA 4X6MA 1C1OA 3U28C 2CK3D 1TNGA 2P3UB 2KX4A 3TGKE 1YCPK 1NS3A 1QZ8A 1DITH 3HATH 1FAKH 2ULLA 4OS7A 2H5CA 5TCCA 1BZXE 4NA9H 3PO1B 1QY6A 4YM9A 1YYY1 2BDHA 2JJ2D 4KP0A 3RC5A 3K6ZA 1C5XB 1O32A 2B5TB 4Y76A 3T5FH 5EJLA 1YBWA 3ATIA 1JXPA 1DSTA 4XBDA 4HFPB 1TWXB 1D6RA 1ZPBA 5DP4A 1E38B 1BBRH 2XRCA 3K2UA 2I6QA 1LQDB 2ZF0H 1C5PA 3QDZB 4MNVA 3SNCA 3O8RA 3EYDA 5I46H 1ZTKA 2ESTE 1O3MA 2XBYA 3BG8A 3W95A 1TGBA 3A84A 1YPKH 3DA9B 1RTLA 1VITF 2I6SA 4JYTA 1P03A 5EOKA 1W8BH 3GCTF 3OSYA 1GJAB 4WMEA 1Q3XA 2FOFA 1GDNA 1Z6EA 5GIBA 4B2CA 1QA0A 1Y3UA 5FHTA 3MH6A 1HCGA 2ANKH 3PV2A 3PMAB 3GDSA 1UJ1A 3ELAH 2VWNA 1D9IA 1UTJA 2XOKD 3SUGA 1P01A 2BD2A 1JBUH 4B6EA 1DICA 1L1NA 2SNWA 3KF2A 4WXIA 2OD3B 1SGFA 1BUIA 1FAXA 4FUCA 3RXFA 1HXEH 2F3CE 3BTFE 3OTJE 4FUGA 5DG6A 3MNCA 2ZFPH 5EG4A 3VPKA 3RU4E 3M5MA 4OS2A 1L1JA 3UAIC 2CXVA 2HNTF 3CENA 1OX1A 1M9UA 1C5NH 3VGCB 4AFSA 1CGIE 1GI3A 2W6JD 3TGJE 1FN8A 3SI3H 1E35B 5ESTE 1HV7A 3VB5A 1J8AA 1GBBA 5FPYA 3VGCC 1C2EA 1KIGH 2QF3A 4LXBH 3RXOA 2O8MA 2KZ4A 5T6GA 1X7AC 2FMJA 2JIZD 3URCA 1FLEE 3NUMA 4BNRA 3CP7A 1ETRH 1EZUC 2HVYB 4K1SA 2TRMA 4O3UA 2Q6DA 2W7SA 1BMMH 1W7GH 1H9IE 1TQ7B 3LONA 2P3TB 3L3TA 1QGFA 3A8BA 1G3CA 1T4UH 2BDCA 4XE4A 4H6SB 4ZKNU 3LPRA 2B8OH 3MNBA 1C5QA 2WPLS 1THPB 4I31A 1IOEA 3ZVAA 2BXTH 2J9NA 3BN9A 1AE8H 2PTNA 1LHGH 2BVSH 1GBTA 3MU1A 5C0TA 2VIOA 4NFFA 3SBKA 3C27B 3CS0A 1ELFA 4MQAA 5AFYH 1SR5C 3M36A 7LPRA 1BB0B 1P06A 2QN5T 2XC4A 3SORA 3MMGA 1N1LA 4ACBA 5DP9A 2GX4A 1O5DH 1O33A 1LO6A 3F1SB 3OFND 4WF8A 5EPNA 4Z1MD 1V2KT 4X1PU 5GNDA 4I8GA 3L6PA 2C8WB 1DPOA 1GI8B 2Y7XA 4BOHA 1ZTLA 1TPPA 2VWOA 1VCWA 5GPIB 3NCLA 3RC6A 4NZLA 3UNQA 3U1IB 4RKJB 1JIMA 2EA3A 3F2FA 2AFQB 4UEHH 1NY22 4MNWA 3T29A 1JRTA 4OS4A 1Y5UT 1SGDE 1AN1E 4Q7ZA 3QUMP 1HJAB 2A4QA 1HJ8A 3LC3A 4DG4A 2ZCKP 1RJXB 1GVLA 1V2WT 1O3BA 1O3IA 1SGQE 1J14A 1EKBB 1O37A 5JBAS 2VGCB 1AGJA 4DOQA 3TJNA 5A0BA 1BRCE 1IHSH 1GJ7B 3RXUA 1SGCA 1FXYA 1TGTA 2VGCC 4GPGA 3RXBA 4AG1A 1QTFA 4VGCB 1O2PA 2FLBH 1KSNA 9LPRA 3BF6H 1MBQA 4WVPE 2BB4A 3KQBA 1TE0A 4VGCC 2AGEX 4BANB 2BD3A 2Z94A 2ZU3A 1LPGB 3PWBA 1TPAE 2NWNA 1DE7H 2AMDA 4OGYA 2ZDKA 3PRBA 3UPEA 1XKAC 1LHFH 1JOUB 1KLJH 1YLDA 1GJ9B 3EDXB 1V2TT 2BY8X 2FO9A 5GJ4B 1ACBE 1Z6JH 1S84A 5AHGH 1BJVA 4WMDA 1FJSA 3U69H 2QF5A 2PR3A 2BD5A 4P02A 4E05H 1CT0E 1GMHG 1P0SH 4DVAU 1G9IE 2FPZA 1FY8E 4X6OA 3UREA 1AB9C 6ESTA 1NFWA 2ZTXA 1KYNA 1KMHB 2SGEE 3GS9A 1UMAH 2ALPA 1TX7A 3LKWA 3MYWA 2GGVB 1GPZA 1ID5H 2J34A 1HAXB 2NU3E 1SGRE 3ODFA 3SU1A 2IPHA 2JH5D 2RCEA 2AYWA 2XNDD 3E0PB 1P05A 3UUZA 2VIVA 1MCVA 4UFEH 1GBKA 1K1IA 1KXFA 1C5OH 4CRBA 3E1XB 2B9LA 1EX3A 4U01A 2GKVE 3ZZDA 1HAVB 1GI6A 1QRWA 1ZLRA 4CBNA 4CR5A 5C1UA 1O3HA 4AB8A 1FN6A 2B0FA 1AFQB 1VJAU 3C1KA 1T8NA 1ESAA 3AK5A 2VU8E 3MH5A 2HVXA 3GOVB 3KQ5A 2GJGA 1VZQH 2BMGB 2BY9X 5CE1A 4YXWD 3PRDA 2Q6FA 2ZIQH 3LOXA 3S7KB 3SV2H 1V2VT 3M3TA 2D1JA 2G4UA 2NU0E 1O5GH 2NU1E 3SN8A 1EATA 1EPTB 2V35A 4B71A 2FX4A 1TOCB 1S6HA 1ZMLA 5DK1A 5T1VA 4FUDA 4NIYA 3O8CA 1EJMA 4NA8A 1V2LT 3KCGH 3RDZA 2FI5E 1WV7H 1SOTA
chains in the Genus database with same CATH topology
3OAAD 2OC8A 1RGQA 5ETXA 3FN8A 2M2AA 4KTCA 5CHBA 3F0PA 2F4LA 1DY9A 3SU4A 3WW7A 5EQSA 2CK3D 3SV9A 3U1JB 3SV6A 3SV8A 1E1QD 2QV1A 2YOLA 4I31A 3PRBA 2K1QA 2VBCA 1NS3A 5B6LA 2WZQA 3N99A 1DXWA 2JJ1D 2OBQA 3W1EA 2FM2A 4NWLA 3SUFA 5C0TA 1NBME 2JJ2D 4TT3D 3M5LA 5GJ4B 2OK5A 2XCFA 4Q63A 5EQRA 3RC5A 2IJOB 3M5NA 4A1XA 3NRLA 4I33A 3FO8D 1A1RA 3DSOA 2JDID 2A4GA 5IDKA 5FL7D 3SV7A 4A1TA 1DY8A 2KCYA 2LELA 1NBMD 3OEHD 1JXPA 2QF5A 3O8DA 2K8IA 2P59A 2W6ID 3OEED 3KNXA 1N1LA 4B76A 5DSFA 3N7DA 4JMYA 3RC4A 3SUEA 1E1RD 4B73A 1H8HD 2XCNA 3SU0A 1COWD 3OFND 4WF8A 5EPNA 4Z1MD 2J5UA 3O8RA 4WH6A 5GNDA 2KCOA 2OINA 3EYDA 1KMHB 4Q4LA 3GS9A 1EFRD 3L6PA 2QF4A 3KN2A 3LKWA 3UB0A 2AHME 2GGVB 4FETA 2F43B 1BT7A 1RTLA 5EPYA 5DN6D 1DXPA 2IJD1 1H8ED 2KM0A 2OC0A 2QE7D 5GPIB 3SU1A 4XD7D 3RC6A 2XNDD 4OM9A 2KCPA 1CU1A 4B6FA 3SU6A 4A92A 2KR7A 3DCLA 3U1IB 3F2FA 5C17A 1SKYE 3F2GA 4NWKA 4B74A 1W3CA 1BMFD 2OBOA 1W0JD 3SU5A 1E79D 3SU3A 3PV2A 3N7EA 4U01A 3WWBA 3VG8A 5ESBA 5EQQA 2V7QD 4DT4A 5HKKD 2OC7A 2L6OA 2XOKD 3F3BA 4WH8A 3SUGA 4B6EA 4RI0A 3OTPA 4B75A 5FPSA 2F9VA 5CDFE 1S6LA 2KCAA 5F53A 3KF2A 4I32A 2A4QA 1OHHD 2YMSD 3F0OA 2F9UA 2OC1A 3SZEA 4ZCNA 2KFWA 2YMSB 3P8NA 3AK5A 4TSFD 3M5OA 3F2HA 2WHXA 3OYPA 3M5MA 3KEEA 3FOAA 3SYJA 3ZIAD 4YXWD 4M9FA 3O8BA 3OE7D 4K8BA 2HLDD 3PRDA 1W0KD 1WXRA 3LOXA 2FP7B 2A4RA 2YMSC 2W6JD 5H4IB 5FPTA 3PV5A 3WWFA 4A1VA 1MABB 5C0UA 5FPYA 3P8OA 3FKSD 3DSPA 3H09A 4B71A 2FOMB 2O8MA 2WSSD 4F55A 2KZ4A 4TYDA 3SU2A 2JIZD 5T1VA 2XNIA 3O8CA 2WV9A 2WPDD 3E90B 4R8TB 4ASUD 1FX0B 2K0QA 5IK2D 3SUDA 2GVFA 3LONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LEL A;  3N7D A;  2KM0 A;  3N7E A;  3DSO A;  2K0Q A;  3DSP A; 
#chains in the Genus database with same CATH topology
 1AIX H;  2H1U A;  1PQ5 A;  3BIU H;  3GY5 A;  2J4I A;  4NIW A;  3CS7 A;  2EI8 A;  1VIT H;  3QLP H;  3DHK H;  5DPA A;  2VBC A;  4INL A;  2ZC9 H;  3UR9 A;  3A87 A;  3KYG A;  2RG3 A;  3VB3 A;  4NG9 H;  1THS H;  2CJI A;  1KTS B;  2LNC A;  1Z1I A;  1GHW H;  4I33 A;  2PFE A;  1K28 D;  1XUK A;  1Q31 A;  2AGI X;  4RSP A;  2A5K A;  4D7F A;  3Q3K A;  5F6M A;  1SGY E;  1ANB A;  2WUB A;  2Z9J A;  2BVX H;  3FP8 E;  1SSX A;  5DSF A;  4JMY A;  3SUE A;  1E1R D;  2BY6 X;  1MBM A;  3SQE E;  4CRG A;  3KQD A;  1GI4 A;  1MKX K;  2J5U A;  1BRA A;  3M35 A;  1ETS H;  4BTU B;  3MO3 A;  2ZDA H;  4UDW H;  1HLT H;  1NRQ H;  4HTC H;  2AEI H;  2ZO3 H;  1O5C B;  1TOM H;  2G52 A;  3RLW H;  4GUX A;  2KR7 A;  4NSY A;  1OSS A;  3KGP A;  3T62 A;  1AFE H;  1A5H A;  2XC0 A;  4D7G A;  4X2Y A;  5HIY A;  1FDP A;  5DO4 H;  1NES E;  4CH2 B;  3N7E A;  2P3F H;  2JH0 D;  1ZMJ A;  2BTC E;  1MH0 A;  1BIO A;  1IQH A;  1O0D H;  3A82 A;  1HAY B;  2FS9 A;  2L6O A;  2RDE A;  2F9V A;  2BD7 A;  2TGD A;  4I32 A;  4XSK U;  3F0O A;  1GBL A;  1UVO A;  2ZHE H;  3EA7 A;  3M5O A;  2BVR H;  1GBA A;  4WY3 A;  4Q7X A;  3GYM A;  1AZZ A;  1NC6 A;  3VB4 A;  4IN1 A;  1W2K H;  1MTV A;  4M9F A;  3O8B A;  3PRO A;  1KLT A;  5EXN A;  3SHA H;  4JZF H;  1YY3 A;  4DJZ B;  4OGX A;  1OOK B;  5FPT A;  1OWJ A;  3P8O A;  1HIA B;  3DSP A;  1EZX C;  1SHH B;  3V0X A;  1C1S A;  1O2Z A;  2AH4 X;  4O9V A;  2XNI A;  3A7Y A;  3FAO A;  5BRR E;  3GY2 A;  4Z6A H;  4ASH A;  5DKM A;  2PKS B;  2F9O A;  4DII H;  1FX0 B;  2AS9 A;  4DW2 U;  1KXD A;  1JMO H;  4FXG H;  4JK5 A;  3ZZ3 A;  1XXD A;  1LKB A;  1SGT A;  2PKS C;  4K69 A;  1VJ9 U;  2ZDN A;  1ORF A;  4MNY A;  1D4P B;  1XX9 A;  3SV8 A;  2YOL A;  2ZGX H;  3LIW A;  1P2N A;  5GXP A;  1PPF E;  3SZN A;  1XM1 A;  3TIU A;  1P2M A;  2PKA B;  2J95 A;  4O03 A;  1UK3 A;  2GMT B;  4OS1 A;  3M5N A;  2VJ1 A;  1MAY A;  1PQA A;  1NT1 A;  3DSO A;  2J2U A;  4X8U H;  2AGG X;  1ABJ H;  5IDK A;  1AUJ A;  5FL7 D;  3FAN A;  4RT0 A;  3RML H;  4A1T A;  2SGA A;  4YTA A;  1C5L H;  4IBL H;  3GCH C;  1GMD G;  4KGA A;  1TLD A;  3QO6 A;  4X8S H;  4B76 A;  2THF B;  1OPH B;  4YZU A;  2QXH A;  1B0E A;  3ZZ9 A;  1WSS H;  3BTD E;  3TK6 A;  3UFA A;  1QJ7 B;  1QQU A;  3NKK A;  3RXR A;  3SQH E;  1ANE A;  1C5S A;  1O2H A;  2A4O A;  1Y5B T;  1DXP A;  1XUH A;  2W26 A;  3HGN A;  2CF9 H;  1TNH A;  2Y81 A;  4OM9 A;  2PHB A;  1QNJ A;  3UIR A;  1Z8G A;  1ZRB A;  1DVA H;  2PGQ B;  3V3M A;  1O38 A;  2XWB I;  3MFJ A;  1YWU A;  5GCH F;  4B74 A;  4JZD H;  1A61 H;  1GBF A;  1BBR E;  2ZFF H;  1YPH E;  2CN0 H;  2R2M B;  4WH8 A;  2Y5F A;  1C2J A;  1F0T A;  1FUJ A;  3N7O A;  2ZDM A;  3S7H B;  2SGP E;  5BPE A;  4X1Q U;  1S83 A;  1GBJ A;  2ZI2 H;  1O31 A;  7KME H;  3V7T A;  3STJ A;  4AG2 A;  4FU7 A;  3RMN H;  2H9H A;  2ZU5 A;  4TY6 A;  3GDV A;  1Y59 T;  4MTB A;  1A5I A;  1KY9 A;  2V0B A;  3F9G A;  4YLU A;  5AVD A;  3QTO H;  3BTM E;  3BTW E;  2XC5 A;  4YLQ H;  1GHX H;  3GY4 A;  3TJV A;  2BDY A;  5DP8 A;  3PV5 A;  5HM2 A;  1VGC B;  2BD9 A;  1TRN A;  2ZWL H;  3ZZ8 A;  3P70 B;  5DJ7 A;  4AFZ A;  2D8W A;  4YT6 H;  2G5N A;  1YF4 A;  5EXL A;  5GDS H;  2L74 A;  1XUI A;  1O2X A;  4R8T B;  1GI9 B;  3MO9 A;  3VB6 A;  2FZZ A;  4X2W A;  1TX8 A;  1YLN A;  2QGR A;  1GBC A;  1GMC F;  2ZHF H;  4ISO A;  1TA6 A;  1PFX C;  3RXE A;  1O5E H;  1GHY H;  3SV9 A;  1O2O A;  2RDL A;  1SC8 U;  1SI5 H;  2GT7 A;  1BQY A;  2J98 B;  3TLO A;  1PYT D;  1SFQ B;  3DSG A;  2C4F H;  1V2U T;  1UK4 A;  1BTW A;  1TBZ H;  1WCZ A;  4IN2 A;  1B0F A;  5J4Q A;  1FQ3 A;  2FTM A;  3A7T A;  2J38 A;  3EE7 A;  1P8V C;  1QHR B;  1NTP A;  1NRO H;  2TGA A;  3FO8 D;  3GIS B;  3D49 H;  1AVW A;  1DOJ A;  1WTH D;  3DUX H;  3TVJ B;  1O2V A;  3B9F H;  4RN6 A;  1C2F A;  2XTT B;  2W6I D;  1IQI A;  1V2Q T;  1ELC A;  2TGP Z;  2ZP0 H;  5E8E H;  5C1Y A;  1OP8 A;  2HWL B;  2UUY A;  2ZGJ A;  1COW D;  1DWC H;  5FX6 A;  1P2K A;  4RKO B;  1OYT H;  2ZHW H;  1UO6 A;  1QB9 A;  3MQK C;  4YT7 H;  1SGN E;  3P8G A;  3ATK A;  5EPY A;  3U8R H;  3UWI A;  1C5M D;  4X0W U;  2QE7 D;  1HPG A;  1KTT B;  1UTK A;  3PO1 C;  2G81 E;  1NFY A;  3M7T A;  3M3V A;  5E0J A;  6CHA B;  3RP2 A;  4SGA E;  3EST A;  3EAJ A;  2ZPQ A;  5C17 A;  3GY8 A;  3Q77 A;  5AF9 H;  1Q2W A;  2ANY A;  3EA8 A;  1T32 A;  2WPJ S;  1AUT C;  1QA7 A;  3P6Z B;  1T31 A;  1GHA G;  3F6U H;  1MU6 B;  5FPS A;  1EB2 A;  5CDF E;  1UVS H;  1TNI A;  1V2P T;  3ZVE A;  4GLY A;  2HPQ H;  2YMS D;  1T8L A;  2HRV A;  2OC1 A;  3UNR A;  3RXH A;  4E06 H;  1O3K A;  1EZQ A;  1QJ6 B;  2NU4 E;  5LPF A;  3SYJ A;  5C20 A;  1KDQ B;  4HGC A;  1GBD A;  2D2D A;  4YES B;  3TU7 H;  4CRE A;  4AFU A;  1LVO A;  2H9E H;  2OTV A;  5HXF A;  1GI0 A;  2J92 A;  1MAB B;  3AVZ A;  1DM4 B;  4UD9 H;  1QB6 A;  3P8F A;  4UON A;  4CHA B;  3BSQ A;  1GI2 A;  4J1Y A;  2CHA B;  1O30 A;  2WSS D;  4IC5 A;  2ZZU H;  5JB8 S;  3P92 A;  4D9R A;  4CHA C;  3MNS A;  2CHA C;  2PWX A;  3GY6 A;  4NIX A;  1C1R A;  3OY5 U;  3RXM A;  2BX3 A;  3SU4 A;  3S9C A;  2Z3D A;  4DUR A;  3STI A;  1IQN A;  3LH3 A;  3ODD A;  1ARB A;  3PB1 E;  5HYO A;  3E16 B;  1KXB A;  1O3A A;  1BJU A;  5JBT A;  1NU9 A;  1NFU A;  2ZKS A;  2OQ5 A;  3SUF A;  2Y80 A;  3H7O A;  3M5L A;  2AMQ A;  3PMB B;  1ZHR A;  2EEK A;  2EY4 C;  3NRL A;  3A85 A;  2A7H A;  1PPE E;  4TWW A;  4ACA A;  4ABH A;  3E8L A;  1FI8 A;  2J97 A;  1RS0 A;  1YPM H;  4BXW A;  1DY8 A;  1DT2 A;  2LEL A;  1OWD A;  3OEH D;  5DP7 A;  2VIP A;  1C2I A;  1HAG E;  2GDD A;  1UHB A;  4B73 A;  5T6F A;  5ABW A;  1EAU A;  1G2L A;  4ABB A;  3PLK A;  2KCO A;  3M61 U;  4HZH A;  4BTT B;  1EFR D;  3K9X B;  3SJI A;  1BTZ A;  1NU7 B;  4ZAE A;  1HAZ B;  3PWC A;  2P8O B;  4FUH A;  2IJD 1;  3BV9 B;  1SGF G;  4ZMA H;  2SNV A;  2WPK S;  2YNB A;  1Y3Y A;  1ZPZ A;  3SU6 A;  1S6F A;  5GWZ A;  1Z8I B;  3DCL A;  2P8O C;  1PPB H;  1DWB H;  4NWK A;  1BMF D;  1YPG H;  1DUE A;  1C5W B;  2G8T A;  4Y7B A;  3BTG E;  2QF0 A;  5HM9 A;  3F3B A;  4CRF A;  1CGJ E;  2P93 A;  3Q00 A;  5F53 A;  3RXI A;  1FMG A;  2XXL A;  1OHH D;  4Y8X A;  3PMJ A;  1LQE A;  2KFW A;  1H1B A;  4WMF A;  3BEU A;  3F2H A;  1BIT A;  2WHX A;  3OYP A;  5T3H A;  5HIZ A;  3KEE A;  2WUC A;  4UE7 H;  1O2R A;  3RXT A;  1J9C H;  2A4R A;  1N6Y A;  1TYN A;  1G3E A;  1L4Z A;  3TJO A;  3WWF A;  1C5U A;  1CQQ A;  1BCU H;  1Z7K A;  1GHB G;  4MPU A;  4X2V A;  1O3J A;  2WIN I;  3H5C B;  3RXJ A;  1JIR A;  1AKS A;  1O36 A;  2DE8 A;  4AX9 H;  3LGW A;  6GCH G;  2PSY A;  1PPG E;  4INK A;  1Z8R A;  1ARC A;  4TWY A;  2PW8 H;  1HJA C;  1HAP H;  2FOA A;  1BBR K;  1H4W A;  3BG4 B;  3VFE A;  1UCY E;  2A31 A;  7GCH G;  2PV9 B;  2F9N A;  5KED A;  3IIT A;  3FZZ A;  2WPH S;  1K22 H;  1SB1 H;  3EA9 A;  2TGT A;  5A0C A;  1BHX B;  2YNA A;  5DP3 A;  4F48 B;  4K1E A;  1TNL A;  1Y3V A;  2AIP A;  2UUK B;  4XDE A;  3SW2 B;  2RA3 A;  2OQU A;  1G36 A;  1NBM D;  4TPI Z;  5KGO A;  1U6Q A;  3KYF A;  1AND A;  1G2M A;  4X6N A;  1ELE E;  3KHV A;  5J4S A;  4AGK A;  2BY5 X;  5LPE A;  1J16 A;  2Y5H A;  4FUI A;  1KXE A;  5C67 A;  3ZZB A;  1MKX H;  2ZHD A;  1PJP A;  2H9T H;  4I8K A;  3V13 A;  2V3M A;  5DN6 D;  1GHB F;  1D3T B;  1OWH A;  3AAS A;  3H7T A;  1C5T A;  4KTU A;  3RXS A;  1SQA A;  3SGB E;  1CA0 B;  2FOC A;  1SQO A;  1CU1 A;  4ABE A;  4CRA A;  4FVB A;  4MLF B;  4ZKO U;  1TGS Z;  2Q6G A;  4KKD A;  3E0N B;  2G51 A;  1RIW B;  1OS8 A;  3KL6 A;  1QFK H;  2SFA A;  1ZYO A;  4YOG A;  4I7Y H;  1SLU B;  2HNT E;  3TK9 A;  4DT4 A;  1EZS C;  2GP9 B;  1OKX A;  1KXA A;  5F8Z A;  1ZJD A;  2KCA A;  2NU2 E;  4NIV A;  1T8O A;  2ZU1 A;  3K6Y A;  2ZFR H;  3SJ8 A;  1NRS H;  2WV5 A;  2ZGC A;  1SOZ A;  1TX6 A;  4TSF D;  1C1P A;  2BD4 A;  4F4O C;  1AU8 A;  1SLV B;  3T2N A;  3FOA A;  2FYR A;  4DIH H;  3A86 A;  3DT0 H;  4X6P A;  3ITI A;  5H4I B;  3TIT A;  2ZDL A;  3BTH E;  2A1D B;  5C0U A;  4BTI B;  5IYT A;  1QIX B;  2BLO A;  1NFX A;  1VCP A;  2QC2 A;  3PMH B;  3HKI B;  2ODP A;  5A8X A;  1C2K A;  4Y11 E;  1EB1 H;  4IGD A;  3HKJ B;  2FES H;  1WUN H;  1SLW B;  4P00 A;  4ASU D;  1TB6 H;  4FOU C;  3R3G B;  2A2X H;  1F5K U;  1UTP A;  1AFQ C;  3NK8 A;  3SND A;  2R9P A;  4THN H;  1GJ8 B;  3U9A H;  4ZHM U;  1TNJ A;  1F5R A;  2GZ7 A;  5F8X A;  2BQW B;  3LGT A;  3F9H A;  1S81 A;  1THR H;  4GCH G;  2JET B;  3BEF B;  1QR3 E;  2OK5 A;  1TMT H;  1GMH F;  1QJ1 B;  3TH3 H;  1XUJ A;  1EPT C;  2G55 A;  2JET C;  4Y8Z A;  1ESB A;  5FAH A;  3TGI E;  3NWU A;  1AQ7 A;  3OEE D;  5F03 A;  4A6L A;  1H8I H;  1AI8 H;  4JYV H;  5DGJ A;  4CH8 B;  1O2I A;  2IOT A;  2SGQ E;  3UNS A;  1O2K A;  5HGG A;  1P11 E;  1XUF A;  1SLX B;  2DE9 A;  1BT7 A;  1C9P A;  2O8U A;  1K1L A;  1G30 B;  1K1P A;  1Y3X A;  4D76 A;  3I77 A;  1GJD B;  3VXF H;  1DFP A;  1LVM A;  2VB0 A;  1C1N A;  2UWL A;  2ZA5 A;  2SGF E;  3OY6 U;  1MKW H;  2XWA A;  5C1X A;  1Z1J A;  1HFD A;  1W7X H;  4XFQ A;  1MD7 A;  3JZ2 B;  1BOQ A;  3A89 A;  4RI0 A;  3LGY A;  1P10 A;  4LK4 A;  4Y10 E;  8GCH G;  1BTY A;  2BLW A;  3UQV A;  1AHT H;  4LZ1 H;  1A0H B;  1DDJ A;  1TNK A;  3OU0 A;  1HAH H;  2ZEC A;  3D23 A;  4GAW A;  3ZIA D;  2Z3C A;  3Q76 A;  4BAK B;  2HLD D;  5EXM A;  3MO6 A;  2H6M A;  2ANM H;  1FY3 A;  1YPJ H;  4MG3 A;  3S69 A;  3ZZ7 A;  1C1M A;  3H09 A;  4TPY A;  2PTC E;  4AFQ A;  2C93 B;  5JYI A;  2FOM B;  1EAI A;  3AW0 A;  1P09 A;  3A7X A;  2OCV B;  4TYD A;  3U8O H;  8LPR A;  3LGI A;  1YKT A;  3BIV H;  1ELG A;  1A7S A;  1XXF A;  3SNA A;  2K0Q A;  2ZCL P;  1TGN A;  1QQ4 A;  3OAA D;  1RGQ A;  2BZ6 H;  1QBN A;  3A7Z A;  5JPM H;  5CHB A;  3F0P A;  3QX5 H;  3S0N A;  1C1V H;  4LZ4 B;  3MNX A;  3TH4 H;  1O2Y A;  2PLX A;  1INC A;  2QXG A;  3ZV9 A;  4FUJ A;  3BTQ E;  1GGD B;  3D65 E;  4MPV A;  2BZA A;  1CHO G;  1MQ6 A;  1YLC A;  1GGD C;  1S85 A;  4Q2K A;  3U98 H;  2JH6 D;  3M7Q A;  2A7J A;  2VIW A;  4WJG 2;  4ZXY H;  3RMO H;  4KEL A;  3A81 A;  4CBO A;  1A1R A;  2G4T A;  2LP6 A;  2JDI D;  1IQM A;  1YC0 A;  3QGJ A;  5LPR A;  1IQK A;  1Y8T A;  1YPE H;  2Z9I A;  2IPQ X;  5EIY A;  2FIR H;  5KEC A;  3RXA A;  3A88 A;  4AB9 A;  3E3T A;  2VVU A;  1DWD H;  1SMF E;  1BRU P;  1KXC A;  4K8Y A;  4Q7Y A;  1XUG A;  2GCH G;  2O8W A;  1MQ5 A;  2W5E A;  1SL3 A;  4JYU H;  3SJO A;  1YCP H;  3UQO A;  4BAQ B;  1CSO E;  1V6D A;  2OIN A;  1ZSK A;  2A45 B;  4MPW A;  3KN2 A;  1E37 B;  4Y0Y E;  4FET A;  4J2Y B;  1IQJ A;  1SQT A;  4Q80 A;  4UFF H;  1IHT H;  1AVX A;  1H8E D;  3Q3X A;  1C2G A;  4XD7 D;  1V2S T;  5E0H A;  2KCP A;  1WQV H;  1GVZ A;  2PUQ H;  1DS2 E;  2GMT C;  2HLC A;  2FX6 A;  1SKY E;  1H8D H;  1W3C A;  1CHG A;  1UCY K;  1IQG A;  3MH7 A;  2Y82 A;  2STA E;  4GHQ A;  5ESB A;  3QN7 A;  2OC7 A;  1O2W A;  3TPI Z;  2BQ7 B;  1A3B H;  2P16 A;  1S6L A;  4XRN A;  1O2S A;  1VKY A;  1BDA A;  1F92 A;  1TRM A;  1N8O B;  4CRC A;  3GCN A;  1MCT A;  1G37 A;  3UTU H;  3FP7 E;  1C1T A;  1L2E A;  3QZQ A;  2ZQ2 A;  1DX5 M;  1GBE A;  3RMM H;  1MTS A;  4MVN A;  4D9Q A;  1WBG B;  1NO9 H;  4Y71 A;  2FYQ A;  8EST E;  2Y6T A;  1P12 E;  5K7R A;  1FIW A;  2QXJ A;  3I29 A;  1EOL A;  1JWT A;  2WPM S;  1TPS A;  3LH1 A;  5G4B A;  1F0U A;  1TFX A;  1O3N A;  1FY4 A;  1EJA A;  1GG6 B;  1HAV A;  1P04 A;  1RTK A;  3MI4 A;  4HG6 A;  4E7N A;  3WY8 A;  2R2W U;  2GZ9 A;  1EOJ A;  1GBI A;  1RD3 B;  2PUX B;  2W3K A;  1C5V A;  5EQS A;  2C3S A;  7EST E;  3MH4 A;  3PTN A;  2BLV A;  2QY0 B;  3FP6 E;  1AZ8 A;  4M7G A;  2TBS A;  1O34 A;  3QK1 A;  4Y8Y A;  3T25 A;  1ZZZ A;  2FM2 A;  1TIO A;  4NWL A;  3DFJ A;  2XYA A;  3GY7 A;  2BX4 A;  1GMD F;  1P57 B;  3VXE H;  1VGC C;  2XCF A;  4LOY H;  3TNT A;  1EAX A;  4NZQ A;  4JK6 A;  1BHX F;  5CHA B;  1GWA A;  9EST A;  3M7U A;  1W13 U;  1AWH B;  1EPT A;  3P95 A;  1RFN A;  5E2O A;  2Z9K A;  2ZG0 H;  1ELA A;  1SBW A;  3A83 A;  5L2Y H;  2V3O H;  5CHA C;  1K1J A;  2ALV A;  2FS8 A;  2OP9 A;  1DUA A;  2W7U A;  3RXQ A;  1NPM A;  2A2Q H;  2ZU4 A;  3SU0 A;  1P3E A;  4U2W A;  1AE5 A;  4A5T S;  1O3D A;  4WH6 A;  3TJU A;  3GIC B;  3ZZA A;  4Q4L A;  3HGP A;  2BM2 A;  4U30 A;  1UK2 A;  5EOD A;  1GI7 B;  3K65 B;  2KM0 A;  2ODY B;  5FXL A;  1TQ0 B;  3RXV A;  2DUC A;  1O3F A;  2QAA A;  3BTK E;  3P17 H;  1A46 H;  3HPT B;  1O3O A;  2GV7 A;  3A80 A;  1CE5 A;  2CF8 H;  3SGQ E;  3SU5 A;  1W0J D;  1FPH H;  2BYA X;  1NRN H;  1TMU H;  1VIT G;  4D8N A;  3LJJ A;  2UWO A;  1GL0 E;  1E36 B;  4B2B A;  5LGO A;  3FZD A;  2VID A;  4H4F A;  2PSX A;  3B8J A;  3M3S A;  1O35 A;  1O2M A;  4MPX A;  1K21 H;  1QL7 A;  4INH A;  1AVG H;  4ABJ A;  4AOR A;  2ILN A;  1GHZ A;  2ZFT A;  3EE0 B;  3GDU A;  3SNE A;  3UR6 A;  5EGM A;  1YPH C;  1LHE H;  3ZYE A;  1O3C A;  6CHA C;  1YP9 A;  1O3E A;  1C4U 2;  1DWE H;  3RM0 H;  2XBV A;  4ABG A;  1O2Q A;  1QCP A;  1MZD A;  4EST E;  4QT8 C;  1OWE A;  1SHY A;  1SGP E;  2CMY A;  1GJB B;  5A8Z A;  3FN8 A;  5C5N A;  1EUF A;  1H9H E;  3QZR A;  3TH2 H;  1BTX A;  4BXS A;  2XBX A;  3ZZ4 A;  3PLB A;  3TNS A;  1BML A;  2AER H;  1MAX A;  2JJ1 D;  1DXW A;  3F68 H;  5EJZ A;  3W1E A;  4R0I A;  6LPR A;  1IAU A;  1QRX A;  1MZA A;  1NBM E;  3GY3 A;  1YPL H;  2LPR A;  1O39 A;  1W10 U;  4BAH B;  1HIA A;  1F7Z A;  1F0R A;  2A4G A;  4XBC A;  3SHC H;  1A0J A;  4XOJ A;  1OWK A;  1SPJ A;  2WYJ A;  4Y79 A;  5TJX A;  3S9B A;  2R0K A;  1MD8 A;  4H6T A;  4Y7A A;  4ZKR U;  4ZRO A;  3VB7 A;  2H5D A;  1HDT H;  1Y5A T;  1O3G A;  1OYQ A;  1ABI H;  3UOP A;  2GCT B;  2XCN A;  2G5V A;  1OP0 A;  5DP5 A;  1P9U A;  3LDX H;  2FOG A;  4BAO B;  2UWP A;  2BDI A;  1W14 U;  2GCT C;  1XMN B;  1C1U H;  2B7D H;  5C94 A;  1L0Z A;  2PP6 A;  1D3P B;  2C8Z B;  1NRR H;  5FBI A;  2Z3E A;  2C8X B;  2PKA A;  1ANC A;  2ZPR A;  4WXV A;  1GHA F;  2EI6 A;  2R3U A;  4OS5 A;  4B1T A;  1O2T A;  4KTS A;  3FFG A;  1C1W H;  1O2J A;  2ZTY A;  4IS5 A;  3HK3 B;  3RXL A;  3E6P H;  1TAW A;  4GSO A;  1ZRK A;  3A8C A;  5T6D A;  1C2M A;  1WTG H;  1GL1 A;  3S9A A;  1HRT H;  4BAM B;  1QB1 A;  3A7W A;  1LTO A;  3EGK H;  1LPZ B;  1LKA A;  1O2G H;  2FTL E;  3PYH A;  3ZZ5 A;  4ZCN A;  1AY6 H;  3SO3 A;  1UTQ A;  1UTO A;  1GCD A;  2ANW A;  1K1M A;  2ZQ1 A;  4B2A A;  4ISL A;  1O3L A;  2P94 A;  1B7X B;  4K8B A;  1H9L B;  1GVK B;  1ZPC A;  5B6O A;  1S0Q A;  1GJC B;  1O2N A;  1S0R A;  1SFI A;  4HI3 A;  3MWI U;  5FX5 A;  3NZI A;  2FDA A;  1HYL A;  1TAB E;  3CNR A;  4ABF A;  5AFZ H;  2WV9 A;  4FUB A;  3SI4 H;  5FCK A;  2V3H H;  3ZYD A;  1SGI B;  5EJ1 A;  3JZ1 B;  3BEI B;  4K2Y A;  2A5I A;  3SUD A;  1F5L A;  1EP6 A;  3QWC H;  1AWF H;  1ZHM A;  3PLP A;  5ETX A;  5L2Z H;  1ZMN A;  4YOJ A;  4K1T A;  2ZCH P;  1YM0 A;  1P2Q A;  1FZZ A;  2KAI B;  1HAO H;  4NCY A;  2D26 C;  2K1Q A;  1LMW B;  3GYL B;  5B6L A;  1TAL A;  2FI3 E;  1WOF A;  5JDU B;  3SOS A;  2PGB B;  1G32 B;  4TT3 D;  4Q63 A;  2RFK C;  1B5G H;  2A0Q B;  3SGA E;  4AN7 A;  1ELB A;  4NGA H;  4Y0Z E;  4YO9 A;  3RLY H;  5C3N A;  4ZXX H;  3MHW U;  2P59 A;  1HXF H;  3KNX A;  3KQE A;  3RM2 H;  5HMA A;  5A09 A;  3ZVF A;  1E34 B;  1YCP M;  3A8D A;  3BG4 C;  1L1G A;  2F9B H;  1DLE A;  2AHM E;  2TPI Z;  3E91 A;  4X8T H;  3UB0 A;  3ATM A;  1EAW A;  3ATL A;  2J98 A;  2FWW A;  2OC0 A;  1A5G H;  3PV4 A;  4DCD A;  2HAL A;  1GHV H;  1ZGV A;  1LCY A;  3LC5 A;  3HK6 B;  4B6F A;  3T26 A;  1ZGI A;  2QCY A;  1K1N A;  2FI4 E;  4A92 A;  1EST A;  2GT8 A;  1O5F H;  3MU0 A;  5L6N H;  2BQ6 B;  2W3I A;  2BLQ A;  1UTM A;  2FOE A;  1L4D A;  2FXR A;  3OTP A;  3G01 A;  4TY7 A;  8KME 2;  3PM3 A;  1XKB C;  2F9U A;  3LU9 B;  3SZE A;  4AZ2 B;  1V2R T;  1A4W H;  3RXK A;  1FIZ A;  1GJ4 H;  2AIQ A;  4I86 A;  1Z71 A;  2EQN A;  3I78 A;  2G00 A;  6GCH F;  5A0A E;  2ZGB H;  2F83 A;  3ZZC A;  5L30 H;  1CA0 C;  1D6W A;  1C2D A;  3QTV H;  3RU4 D;  1IQL A;  4FVD A;  4ZH8 A;  1RIW C;  1HUT H;  1XVM A;  2VIN A;  1KLI H;  3PTB A;  2VH6 A;  1BTU A;  1O5B B;  3E90 B;  4X1R U;  3RU4 T;  1V2O T;  2R3Y A;  2Z7F E;  1PPZ A;  5IK2 D;  2GVF A;  2Y7Z A;  4I8H A;  7GCH F;  1QL9 A;  2M2A A;  1LHD H;  4OS6 A;  2VWM A;  2GDE H;  3WW7 A;  3Q3Y A;  5C2Z A;  1ELV A;  1AB9 B;  1HGT H;  1TPO A;  1EJN A;  3U1J B;  1O2L A;  4UFD H;  2QV1 A;  1GJ5 H;  1BMA A;  1W0Z U;  1DAN H;  5EW1 H;  1BA8 B;  3IWM A;  4JZ1 A;  1KDQ A;  1LPK B;  1ZSL A;  2JKH A;  3B23 B;  5EQR A;  2IJO B;  1HAI H;  2A32 A;  1ZHP A;  5EU8 A;  2Z9L A;  1HB0 B;  3SV7 A;  2VIQ A;  4AOQ A;  2BD8 A;  4MDS A;  3IG6 B;  1TGC A;  1P3C A;  3N7D A;  4ABI A;  3UY9 A;  1EAS A;  2CGA A;  1C9T A;  5FCR A;  3LGV A;  1C5R A;  1C4Y 2;  1CBW B;  2GV6 A;  1DLK B;  1NZQ H;  1C5Z B;  1K1O A;  3MTY A;  2QF4 A;  5LH8 A;  1XVO A;  2ZEB A;  2BDB A;  3AAV A;  1GDU A;  1CT2 E;  3ZVC A;  2BY7 X;  1CBW C;  2VVV A;  1CVW H;  4X1N U;  1UTN A;  1WU1 A;  1P2I A;  3M37 A;  4NSV A;  1V2N T;  1RXP A;  2FOD A;  2XBW A;  3U8T H;  2ZPS A;  3AAU A;  1WAY B;  2OBO A;  3D62 A;  1E79 D;  1EP5 A;  3WWB A;  1OP2 A;  2HOB A;  1MTW A;  1UCY H;  4B75 A;  1K0H A;  1DSU A;  1W0Y H;  4FUE A;  3VEQ B;  1SG8 B;  2O8L A;  1MUE B;  3ZVG A;  4MNX A;  4NA7 A;  4RT1 A;  1GJ6 A;  3RXD A;  3AW1 A;  5FBE A;  4AYY B;  1UTL M;  3QGN B;  3UWJ H;  1WXR A;  2FP7 B;  2WPI S;  3R0F A;  2ODQ A;  3UOU A;  5SGA E;  1O3P B;  2SGD E;  1QL8 A;  4Y6D A;  2HNT C;  4AGJ A;  1ZJK A;  2GZ8 A;  5E2P A;  3RXP A;  3T28 A;  1JRS A;  4IW4 E;  1UVP A;  2BDA A;  3L33 A;  4O3T A;  3RXG A;  5EW2 H;  1AMH A;  2WYG A;  1O5A B;  5F8T A;  1PQ7 A;  2IN2 A;  2WPD D;  1QBV H;  3GCO A;  1E0F D;  2O8T A;  4GCH F;  3F9F A;  1SVP A;  2F4L A;  1DY9 A;  1E1Q D;  1EQ9 A;  3SNB A;  4ABA A;  1QUR H;  2QYI A;  2VH0 A;  2WZQ A;  3ZVB A;  3KID U;  1UW7 A;  4NFE A;  2H2Z A;  2KAI A;  3ENS B;  1AD8 H;  1TBR H;  4PRO A;  4U32 A;  1CO7 E;  4A1X A;  1NN6 A;  1Z8J B;  3BTE E;  1PPC E;  1A2C H;  1HBT H;  1G3D A;  1TMB H;  4UFG H;  2KCY A;  1S82 A;  3RXC A;  5A2M H;  5PTP A;  2ASU B;  2GD4 B;  1C1Q A;  2ZNK H;  1P2J A;  3RC4 A;  4FUF A;  1GDQ A;  3KQC A;  1UVT H;  4ZHA A;  4K60 A;  2ZTZ A;  4XBB A;  1FON A;  5E0G A;  1VR1 H;  4IC6 A;  1ELT A;  1C5Y B;  2WV4 A;  2F43 B;  2A7C A;  4K5Z A;  3DFL A;  1UVU H;  2O9Q A;  3MU5 A;  8GCH F;  3SJK A;  4DT7 B;  1F0S A;  2FOH A;  1EXF A;  2M5T A;  1QBO A;  4GHT A;  1D3D B;  3LT3 A;  4ISN A;  1ZOM A;  1J17 T;  1TBQ H;  4O97 A;  1V2M T;  5EQQ A;  3MU4 A;  2FOB A;  1GCT B;  3MOC A;  2BXU H;  1LVY A;  1D3Q B;  5I25 A;  4IMZ A;  1C2L A;  1P2O A;  5GCH G;  1TON A;  1GCT C;  1K2I 1;  2ZDV H;  2UUJ B;  1N6X A;  1V3X A;  4X8V H;  1FNI A;  1C4V 2;  2VWL A;  2ZFS A;  1GBH A;  4IMQ A;  5C5O A;  2ZU2 A;  4F49 A;  4YOI A;  5CMX H;  2GTB A;  2EI7 A;  2ZFQ H;  5JBC S;  2J94 A;  3ZV8 A;  3V12 A;  2BDG A;  4ISI H;  1PQ8 A;  4CR9 A;  3FKS D;  2HGT H;  4ZUH A;  1TA2 A;  1FY5 A;  1G3B A;  2QA9 E;  2QXI A;  3NXP A;  3URD A;  3SU2 A;  4A7I B;  4E7R G;  2CV3 A;  3FVF B;  1A0L A;  3GCH B;  1LDT T;  3NPS A;  3MU8 A;  1UHB B;  1PPH E;  2FEQ H;  1BTH H;  1T8M A;  2OC8 A;  2VNT A;  2Z9G A;  2P95 A;  1CHO F;  1QRZ A;  1SGE E;  1TRY A;  4ISH H;  1N8O C;  4DGJ A;  4FU8 A;  1MMJ N;  1NM6 A;  3SV6 A;  3F9E A;  1S5S A;  1O2U A;  4Z0K A;  3SJ9 A;  5TCA A;  1FY1 A;  3N99 A;  1HNE E;  2OBQ A;  1GMC G;  4H42 U;  4I8J A;  1OXG A;  5DP6 A;  3OX7 U;  3A7V A;  2C8Y B;  1WDI A;  1PYT C;  3DD2 H;  2ZGH A;  1IQF A;  3W94 A;  4AYV B;  1MKW K;  2GCH F;  4CRD A;  1A3E H;  4ZKS U;  5A8Y A;  4ABD A;  2F91 A;  3RUO A;  1LVB A;  2R0L A;  3O8D A;  2K8I A;  2OLG A;  1HJ9 A;  1RTF B;  1GBM A;  2BOK A;  1T4V H;  1BTP A;  4GVU A;  1GG6 C;  2AMP A;  3LJO A;  1C2H A;  1F2S E;  1CT4 E;  1H8H D;  1MTU A;  1ELD E;  2TIO A;  2XW9 A;  1ETT H;  1BMN H;  1VCQ A;  2BOH B;  5JBB S;  2UUF B;  5K0H A;  1GI1 A;  4I8L A;  2VVC A;  1K9O E;  1T7C A;  1CGH A;  2Z6B D;  1GI5 A;  1RRK A;  3TK5 A;  1V2J T;  3EQ0 H;  3F2G A;  1AKS B;  4X1S U;  1ZSJ A;  4K3J A;  2Q1J A;  3T27 A;  2OUA A;  3SU3 A;  1MU8 B;  3VG8 A;  1FPC H;  2V7Q D;  1J15 A;  4JCN A;  1WQS A;  5HKK D;  2Y5G A;  3BTT E;  1W11 U;  1WYK A;  1Y3W A;  3LGU A;  2F9P A;  2YMS B;  2BHG A;  3P8N A;  1SQR A;  1LHC H;  3ZZ6 A;  3ATW A;  1W12 U;  2V6N A;  2STB E;  4JZI A;  3OE7 D;  1W0K D;  2YMS C;  1BRB E;  2RA0 A;  1CA8 B;  3A8A A;  4SGB E;  1P9S A;  2FLR H;  1MTN B;  4DY7 B;  4X2X A;  4A1V A;  2C90 B;  4JZE H;  4FU9 A;  1FV9 A;  1ZR0 A;  1YGC H;  4F55 A;  3GCT G;  1MTN C;  4ZHL U;  1AO5 A;  2EC9 H;  2QIQ A;  2ZHQ H;  2HPP H;  4AC9 A;  1NRP H;  3ZVD A;  2A5A A;  4WWY A;  1OWI A;  1ZTJ A;  5JB9 S;  1P02 A;  1IQE A;  2OXS A;  4KTC A;  4X6M A;  1C1O A;  3U28 C;  2CK3 D;  1TNG A;  2P3U B;  2KX4 A;  3TGK E;  1YCP K;  1NS3 A;  1QZ8 A;  1DIT H;  3HAT H;  1FAK H;  2ULL A;  4OS7 A;  2H5C A;  5TCC A;  1BZX E;  4NA9 H;  3PO1 B;  1QY6 A;  4YM9 A;  1YYY 1;  2BDH A;  2JJ2 D;  4KP0 A;  3RC5 A;  3K6Z A;  1C5X B;  1O32 A;  2B5T B;  4Y76 A;  3T5F H;  5EJL A;  1YBW A;  3ATI A;  1JXP A;  1DST A;  4XBD A;  4HFP B;  1TWX B;  1D6R A;  1ZPB A;  5DP4 A;  1E38 B;  1BBR H;  2XRC A;  3K2U A;  2I6Q A;  1LQD B;  2ZF0 H;  1C5P A;  3QDZ B;  4MNV A;  3SNC A;  3O8R A;  3EYD A;  5I46 H;  1ZTK A;  2EST E;  1O3M A;  2XBY A;  3BG8 A;  3W95 A;  1TGB A;  3A84 A;  1YPK H;  3DA9 B;  1RTL A;  1VIT F;  2I6S A;  4JYT A;  1P03 A;  5EOK A;  1W8B H;  3GCT F;  3OSY A;  1GJA B;  4WME A;  1Q3X A;  2FOF A;  1GDN A;  1Z6E A;  5GIB A;  4B2C A;  1QA0 A;  1Y3U A;  5FHT A;  3MH6 A;  1HCG A;  2ANK H;  3PV2 A;  3PMA B;  3GDS A;  1UJ1 A;  3ELA H;  2VWN A;  1D9I A;  1UTJ A;  2XOK D;  3SUG A;  1P01 A;  2BD2 A;  1JBU H;  4B6E A;  1DIC A;  1L1N A;  2SNW A;  3KF2 A;  4WXI A;  2OD3 B;  1SGF A;  1BUI A;  1FAX A;  4FUC A;  3RXF A;  1HXE H;  2F3C E;  3BTF E;  3OTJ E;  4FUG A;  5DG6 A;  3MNC A;  2ZFP H;  5EG4 A;  3VPK A;  3RU4 E;  3M5M A;  4OS2 A;  1L1J A;  3UAI C;  2CXV A;  2HNT F;  3CEN A;  1OX1 A;  1M9U A;  1C5N H;  3VGC B;  4AFS A;  1CGI E;  1GI3 A;  2W6J D;  3TGJ E;  1FN8 A;  3SI3 H;  1E35 B;  5EST E;  1HV7 A;  3VB5 A;  1J8A A;  1GBB A;  5FPY A;  3VGC C;  1C2E A;  1KIG H;  2QF3 A;  4LXB H;  3RXO A;  2O8M A;  2KZ4 A;  5T6G A;  1X7A C;  2FMJ A;  2JIZ D;  3URC A;  1FLE E;  3NUM A;  4BNR A;  3CP7 A;  1ETR H;  1EZU C;  2HVY B;  4K1S A;  2TRM A;  4O3U A;  2Q6D A;  2W7S A;  1BMM H;  1W7G H;  1H9I E;  1TQ7 B;  3LON A;  2P3T B;  3L3T A;  1QGF A;  3A8B A;  1G3C A;  1T4U H;  2BDC A;  4XE4 A;  4H6S B;  4ZKN U;  3LPR A;  2B8O H;  3MNB A;  1C5Q A;  2WPL S;  1THP B;  4I31 A;  1IOE A;  3ZVA A;  2BXT H;  2J9N A;  3BN9 A;  1AE8 H;  2PTN A;  1LHG H;  2BVS H;  1GBT A;  3MU1 A;  5C0T A;  2VIO A;  4NFF A;  3SBK A;  3C27 B;  3CS0 A;  1ELF A;  4MQA A;  5AFY H;  1SR5 C;  3M36 A;  7LPR A;  1BB0 B;  1P06 A;  2QN5 T;  2XC4 A;  3SOR A;  3MMG A;  1N1L A;  4ACB A;  5DP9 A;  2GX4 A;  1O5D H;  1O33 A;  1LO6 A;  3F1S B;  3OFN D;  4WF8 A;  5EPN A;  4Z1M D;  1V2K T;  4X1P U;  5GND A;  4I8G A;  3L6P A;  2C8W B;  1DPO A;  1GI8 B;  2Y7X A;  4BOH A;  1ZTL A;  1TPP A;  2VWO A;  1VCW A;  5GPI B;  3NCL A;  3RC6 A;  4NZL A;  3UNQ A;  3U1I B;  4RKJ B;  1JIM A;  2EA3 A;  3F2F A;  2AFQ B;  4UEH H;  1NY2 2;  4MNW A;  3T29 A;  1JRT A;  4OS4 A;  1Y5U T;  1SGD E;  1AN1 E;  4Q7Z A;  3QUM P;  1HJA B;  2A4Q A;  1HJ8 A;  3LC3 A;  4DG4 A;  2ZCK P;  1RJX B;  1GVL A;  1V2W T;  1O3B A;  1O3I A;  1SGQ E;  1J14 A;  1EKB B;  1O37 A;  5JBA S;  2VGC B;  1AGJ A;  4DOQ A;  3TJN A;  5A0B A;  1BRC E;  1IHS H;  1GJ7 B;  3RXU A;  1SGC A;  1FXY A;  1TGT A;  2VGC C;  4GPG A;  3RXB A;  4AG1 A;  1QTF A;  4VGC B;  1O2P A;  2FLB H;  1KSN A;  9LPR A;  3BF6 H;  1MBQ A;  4WVP E;  2BB4 A;  3KQB A;  1TE0 A;  4VGC C;  2AGE X;  4BAN B;  2BD3 A;  2Z94 A;  2ZU3 A;  1LPG B;  3PWB A;  1TPA E;  2NWN A;  1DE7 H;  2AMD A;  4OGY A;  2ZDK A;  3PRB A;  3UPE A;  1XKA C;  1LHF H;  1JOU B;  1KLJ H;  1YLD A;  1GJ9 B;  3EDX B;  1V2T T;  2BY8 X;  2FO9 A;  5GJ4 B;  1ACB E;  1Z6J H;  1S84 A;  5AHG H;  1BJV A;  4WMD A;  1FJS A;  3U69 H;  2QF5 A;  2PR3 A;  2BD5 A;  4P02 A;  4E05 H;  1CT0 E;  1GMH G;  1P0S H;  4DVA U;  1G9I E;  2FPZ A;  1FY8 E;  4X6O A;  3URE A;  1AB9 C;  6EST A;  1NFW A;  2ZTX A;  1KYN A;  1KMH B;  2SGE E;  3GS9 A;  1UMA H;  2ALP A;  1TX7 A;  3LKW A;  3MYW A;  2GGV B;  1GPZ A;  1ID5 H;  2J34 A;  1HAX B;  2NU3 E;  1SGR E;  3ODF A;  3SU1 A;  2IPH A;  2JH5 D;  2RCE A;  2AYW A;  2XND D;  3E0P B;  1P05 A;  3UUZ A;  2VIV A;  1MCV A;  4UFE H;  1GBK A;  1K1I A;  1KXF A;  1C5O H;  4CRB A;  3E1X B;  2B9L A;  1EX3 A;  4U01 A;  2GKV E;  3ZZD A;  1HAV B;  1GI6 A;  1QRW A;  1ZLR A;  4CBN A;  4CR5 A;  5C1U A;  1O3H A;  4AB8 A;  1FN6 A;  2B0F A;  1AFQ B;  1VJA U;  3C1K A;  1T8N A;  1ESA A;  3AK5 A;  2VU8 E;  3MH5 A;  2HVX A;  3GOV B;  3KQ5 A;  2GJG A;  1VZQ H;  2BMG B;  2BY9 X;  5CE1 A;  4YXW D;  3PRD A;  2Q6F A;  2ZIQ H;  3LOX A;  3S7K B;  3SV2 H;  1V2V T;  3M3T A;  2D1J A;  2G4U A;  2NU0 E;  1O5G H;  2NU1 E;  3SN8 A;  1EAT A;  1EPT B;  2V35 A;  4B71 A;  2FX4 A;  1TOC B;  1S6H A;  1ZML A;  5DK1 A;  5T1V A;  4FUD A;  4NIY A;  3O8C A;  1EJM A;  4NA8 A;  1V2L T;  3KCG H;  3RDZ A;  2FI5 E;  1WV7 H;  1SOT A; 
#chains in the Genus database with same CATH homology
 3OAA D;  2OC8 A;  1RGQ A;  5ETX A;  3FN8 A;  2M2A A;  4KTC A;  5CHB A;  3F0P A;  2F4L A;  1DY9 A;  3SU4 A;  3WW7 A;  5EQS A;  2CK3 D;  3SV9 A;  3U1J B;  3SV6 A;  3SV8 A;  1E1Q D;  2QV1 A;  2YOL A;  4I31 A;  3PRB A;  2K1Q A;  2VBC A;  1NS3 A;  5B6L A;  2WZQ A;  3N99 A;  1DXW A;  2JJ1 D;  2OBQ A;  3W1E A;  2FM2 A;  4NWL A;  3SUF A;  5C0T A;  1NBM E;  2JJ2 D;  4TT3 D;  3M5L A;  5GJ4 B;  2OK5 A;  2XCF A;  4Q63 A;  5EQR A;  3RC5 A;  2IJO B;  3M5N A;  4A1X A;  3NRL A;  4I33 A;  3FO8 D;  1A1R A;  3DSO A;  2JDI D;  2A4G A;  5IDK A;  5FL7 D;  3SV7 A;  4A1T A;  1DY8 A;  2KCY A;  2LEL A;  1NBM D;  3OEH D;  1JXP A;  2QF5 A;  3O8D A;  2K8I A;  2P59 A;  2W6I D;  3OEE D;  3KNX A;  1N1L A;  4B76 A;  5DSF A;  3N7D A;  4JMY A;  3RC4 A;  3SUE A;  1E1R D;  4B73 A;  1H8H D;  2XCN A;  3SU0 A;  1COW D;  3OFN D;  4WF8 A;  5EPN A;  4Z1M D;  2J5U A;  3O8R A;  4WH6 A;  5GND A;  2KCO A;  2OIN A;  3EYD A;  1KMH B;  4Q4L A;  3GS9 A;  1EFR D;  3L6P A;  2QF4 A;  3KN2 A;  3LKW A;  3UB0 A;  2AHM E;  2GGV B;  4FET A;  2F43 B;  1BT7 A;  1RTL A;  5EPY A;  5DN6 D;  1DXP A;  2IJD 1;  1H8E D;  2KM0 A;  2OC0 A;  2QE7 D;  5GPI B;  3SU1 A;  4XD7 D;  3RC6 A;  2XND D;  4OM9 A;  2KCP A;  1CU1 A;  4B6F A;  3SU6 A;  4A92 A;  2KR7 A;  3DCL A;  3U1I B;  3F2F A;  5C17 A;  1SKY E;  3F2G A;  4NWK A;  4B74 A;  1W3C A;  1BMF D;  2OBO A;  1W0J D;  3SU5 A;  1E79 D;  3SU3 A;  3PV2 A;  3N7E A;  4U01 A;  3WWB A;  3VG8 A;  5ESB A;  5EQQ A;  2V7Q D;  4DT4 A;  5HKK D;  2OC7 A;  2L6O A;  2XOK D;  3F3B A;  4WH8 A;  3SUG A;  4B6E A;  4RI0 A;  3OTP A;  4B75 A;  5FPS A;  2F9V A;  5CDF E;  1S6L A;  2KCA A;  5F53 A;  3KF2 A;  4I32 A;  2A4Q A;  1OHH D;  2YMS D;  3F0O A;  2F9U A;  2OC1 A;  3SZE A;  4ZCN A;  2KFW A;  2YMS B;  3P8N A;  3AK5 A;  4TSF D;  3M5O A;  3F2H A;  2WHX A;  3OYP A;  3M5M A;  3KEE A;  3FOA A;  3SYJ A;  3ZIA D;  4YXW D;  4M9F A;  3O8B A;  3OE7 D;  4K8B A;  2HLD D;  3PRD A;  1W0K D;  1WXR A;  3LOX A;  2FP7 B;  2A4R A;  2YMS C;  2W6J D;  5H4I B;  5FPT A;  3PV5 A;  3WWF A;  4A1V A;  1MAB B;  5C0U A;  5FPY A;  3P8O A;  3FKS D;  3DSP A;  3H09 A;  4B71 A;  2FOM B;  2O8M A;  2WSS D;  4F55 A;  2KZ4 A;  4TYD A;  3SU2 A;  2JIZ D;  5T1V A;  2XNI A;  3O8C A;  2WV9 A;  2WPD D;  3E90 B;  4R8T B;  4ASU D;  1FX0 B;  2K0Q A;  5IK2 D;  3SUD A;  2GVF A;  3LON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...