2K0QA

Solution structure of copk, a periplasmic protein involved in copper resistance in cupriavidus metallidurans ch34
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
74
structure length
74
Chain Sequence
VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEALRKGHSEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structure and metal-binding properties of the periplasmic CopK protein expressed in Cupriavidus metallidurans CH34 during copper challenge.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Metal binding protein
molecule keywords Putative uncharacterized protein copK
total genus 16
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2008-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2k0qA00
3N7EA 3N7DA 2LELA 3DSOA 2KM0A 2K0QA 3DSPA
chains in the Genus database with same CATH superfamily
3KQEA 1GHAG 1SR5C 4FUGA 3AASA 5E0GA 1HNEE 3KYFA 5CHAC 1HAXB 1O31A 2KCYA 1SGEE 3AW0A 1YPKH 1VCQA 2PFEA 4CBNA 1YPEH 2YNAA 3FFGA 1V2QT 1EAIA 1TPSA 4NWKA 1W0KD 1MMJN 4MPVA 1ELBA 2VIWA 3P95A 1QBOA 1FI8A 1LPGB 4KGAA 1SGRE 3ZZ9A 3UQVA 2ZPSA 3LH1A 2ZHWH 4ISIH 1T4VH 4Y0ZE 1QL9A 1FN8A 5CHBA 1GGDC 1DY8A 3D62A 1EZXC 3HATH 1DLEA 2Y5FA 1ZSKA 1UVTH 4AC9A 3TPIZ 3KQCA 3FP7E 4NZLA 4JZEH 4K2YA 3T27A 1UO6A 1ZOMA 4YESB 2Z3EA 3TJVA 2BM2A 1BRAA 1TYNA 5EXLA 2Q6FA 4R8TB 1G3DA 5C67A 2G81E 1P03A 2PKSB 1YPMH 1T7CA 5E0HA 2GP9B 1CA0C 5GCHG 1AIXH 1JXPA 1LHEH 1QRZA 1XUGA 1XUIA 1TBZH 2GT8A 3QGJA 3UB0A 1AWFH 4OM9A 5FX5A 4ABHA 1ZJKA 1DICA 3JZ1B 8GCHF 2ZGBH 4MPUA 3FAOA 2AHME 1RIWB 1O2UA 1P0SH 3A7TA 2D8WA 1WXRA 1NFYA 1BTZA 1QIXB 3VFEA 3IITA 4A92A 3SUGA 2P95A 2FWWA 1JOUB 3A81A 4ABIA 1E34B 1SHYA 1TX7A 5FX6A 4THNH 1VJAU 5AHGH 1SBWA 5IK2D 2EI8A 3QZRA 2O8UA 1OWDA 1XXFA 3ATIA 4TY7A 5JB8S 3PO1C 4AB8A 1ABIH 1ZRBA 1MTNC 1FPHH 5C5OA 2HRVA 3U8TH 3FO8D 4SGAE 3QDZB 5T3HA 3T2NA 1C1OA 4H4FA 1A2CH 1YLCA 3ZVBA 3BIVH 2PR3A 4U32A 3M5MA 5LGOA 3EE0B 2C90B 1K21H 2J38A 1O3IA 2FEQH 1KTTB 1GJDB 2ZDAH 3D49H 1SSXA 2QY0B 7GCHF 4ZHMU 3BN9A 3PV5A 4AORA 1KYNA 2ZHDA 5DJ7A 5BRRE 2AGGX 3ATMA 1ETRH 2PLXA 1QA7A 3PWBA 3U8OH 1BCUH 1P57B 2P8OC 1TPAE 2A4OA 1W11U 1B0FA 2K8IA 3NRLA 5TCAA 2PGBB 1MU8B 1S6LA 2F43B 3STJA 1MCTA 3FP8E 1BTUA 1UTMA 1EUFA 3D23A 2OXSA 2TGAA 1EZUC 5EGMA 2EEKA 2OP9A 1FY3A 1FX0B 1IHSH 4MQAA 1GI3A 3BTWE 4B1TA 1JRTA 2ZKSA 2OTVA 2BZAA 2SGEE 5LPEA 1KXEA 4WY3A 3ESTA 4RI0A 2GGVB 4ACBA 4J1YA 2R3UA 2ZO3H 4LXBH 3S9CA 1NY22 4AYYB 4DURA 1UK2A 2PV9B 3S7KB 4WJG2 3SZEA 5C3NA 2DUCA 1YM0A 1SGFG 1HAIH 3SUFA 3U28C 4MPWA 1O2OA 2JH5D 1GVKB 4O03A 4FUFA 4Y7BA 2ZGHA 5DP7A 1HAZB 4X8UH 1DSUA 4YT6H 4YT7H 1GBDA 1O5BB 2PSYA 3W1EA 2WPKS 1A3BH 3F68H 3V13A 2Z9KA 1GG6C 5DGJA 1MAXA 4YOGA 5EU8A 1XVOA 5F8ZA 3CS7A 1ACBE 4NIWA 1ARCA 1AHTH 4K5ZA 4I32A 3O8CA 4OGYA 3Q3KA 2A7JA 2V3MA 1GI6A 4JZ1A 5FXLA 2Y81A 1D3TB 3NK8A 1ESAA 4IGDA 3MTYA 1IQJA 5L2YH 1AU8A 1PQ7A 1TX6A 3BTHE 4YOJA 3BTGE 4UFGH 2J2UA 2Z9IA 1QL7A 3M3TA 1O3GA 4FUBA 1C2HA 1BRUP 1FY5A 2ZCKP 1MD7A 4I33A 1PPGE 2ZCHP 4BTTB 4TYDA 2ZDVH 1GJAB 2ZHQH 2M2AA 1AZZA 3SO3A 2XBXA 1ELCA 1UTNA 1O3MA 3VB6A 1JMOH 3RXHA 1DY9A 2XC5A 1HV7A 1VITH 1AGJA 2XCNA 4Q63A 4AX9H 3EA9A 2G5VA 1QJ6B 3PLPA 3ZZCA 1OWHA 3A89A 1QURH 1OWKA 1SOZA 3LH3A 1GI8B 1GI7B 1Z6JH 2ZFFH 4BAQB 1ELDE 2A4GA 4Y8ZA 2HLCA 4A1TA 2FP7B 4K1SA 1QCPA 1S5SA 3MO9A 1BMLA 4X6MA 4FUDA 2KCAA 5TJXA 1TRYA 5JBTA 2L6OA 4AZ2B 1GBLA 1QL8A 1GHVH 1ELGA 2J98B 3M7TA 2KM0A 2BDIA 2QAAA 1IQEA 2K0QA 4Z1MD 1O2QA 1X7AC 5A8YA 1UTKA 4ZUHA 2XCFA 4FU9A 1P3EA 3P70B 3TJOA 2ANKH 1J14A 6LPRA 4X6NA 3EQ0H 3E6PH 2AS9A 2VBCA 1TOCB 2HNTE 4HGCA 4MVNA 1ZPZA 2J97A 4NZQA 1CT0E 4Q80A 1XUJA 5I46H 3PMAB 1IQNA 1P09A 1VR1H 1RS0A 1IQHA 1TGNA 1WUNH 2BY7X 3MHWU 3UPEA 7LPRA 1C1MA 5FCRA 5AVDA 3T26A 4ISHH 2AIQA 1C2MA 4IC6A 2DE9A 3O8BA 1IQFA 1TMTH 4Y10E 2BLVA 3LGIA 2UUYA 3VG8A 4B76A 3TK6A 4ZHLU 2P3FH 3K2UA 1KLTA 4Q2KA 1EPTA 1PFXC 2WV5A 2GZ9A 1P2JA 5DP5A 3CS0A 2ZHFH 4WF8A 1K28D 2XWAA 2ZECA 5BPEA 1EKBB 1B5GH 1F0SA 4F49A 1BITA 2ASUB 5DP3A 1O3CA 2FOEA 1HAVA 5T6GA 1YBWA 1UVOA 2NWNA 1P3CA 1G2LA 1ID5H 5L2ZH 5C1YA 1RTKA 2JETB 5C0TA 2F9UA 3FKSD 1CGJE 3UIRA 2YMSB 2ILNA 5DN6D 1TQ0B 2ZU4A 1O32A 1L0ZA 1JBUH 4D7FA 1NU9A 2Z7FE 3SZNA 3L6PA 1GBJA 1F5RA 2QN5T 3GCTG 2VVUA 3KF2A 1BA8B 1O3AA 2FOCA 2XBYA 2FODA 3PTNA 1TONA 4XOJA 4ZKRU 1CA0B 2PHBA 3MNSA 5CE1A 2VIOA 5EG4A 1NFXA 3VB3A 2P3TB 4D8NA 1F0RA 1MKWH 1ZHMA 3MU5A 1A1RA 2I6SA 1MD8A 2Y5HA 5T6DA 1L4DA 1BBRE 1FUJA 1SQAA 1DPOA 5SGAE 3RMLH 3SYJA 1G32B 1YC0A 4BNRA 4D76A 2PTNA 2VWNA 3SORA 2LP6A 3WWFA 4IMZA 5C1XA 2OD3B 3DT0H 1O3BA 2ANWA 1VCPA 1MU6B 4DIIH 1RJXB 5KGOA 1EPTC 3GY6A 4CRDA 2P16A 2CHAB 4ABAA 4NFEA 4ABDA 3BG8A 2R9PA 5EQSA 3F9EA 3A8DA 4HTCH 1Z8JB 4E06H 2ZDLA 3RXPA 3SJKA 3UR6A 1C5LH 2Z3CA 3OTPA 3F2HA 3RXJA 2O8MA 5C0UA 3L33A 1SFIA 1O39A 5EPYA 4K8YA 1HJ8A 5F6MA 4LK4A 3LT3A 3GY7A 2AEIH 3RUOA 4XBCA 1CBWC 3NPSA 1TMUH 7KMEH 1RXPA 1UMAH 1TAWA 1T32A 4MG3A 1O2XA 4E7NA 2OQUA 4VGCB 3IG6B 3A85A 3SGBE 3LGTA 8KME2 1ZMLA 4ISLA 4NSYA 5T6FA 3VGCC 1O3EA 3M5OA 4XE4A 3ZVDA 2EI7A 1FY4A 1HGTH 2GJGA 2Q1JA 2G51A 3HKJB 1GI5A 1MUEB 1SI5H 3GOVB 3H7OA 1V2LT 2HNTC 1KLJH 3LJOA 1Z71A 1C1PA 2BLWA 1C2KA 2K1QA 3VB7A 3GY8A 2A5IA 1DITH 1AUTC 5EW1H 2R0KA 1O2KA 1J9CH 4GVUA 1HDTH 2ANMH 4I8GA 1EASA 4HZHA 4OS2A 4IW4E 1N8OC 2ZDNA 1W0JD 1EZSC 3OEED 5EJLA 2UWPA 1SHHB 1G3EA 3SW2B 1O2MA 1PPEE 4B71A 3F6UH 2Z9GA 2BY5X 3E16B 1C5WB 2FTMA 1LHFH 1WQVH 4DG4A 1XKAC 1P8VC 3S0NA 1GHZA 2KAIA 1MTWA 3NXPA 4K69A 3SOSA 1W7GH 2BY9X 3TK5A 1GJ6A 4ABFA 1AKSA 1SLUB 2C8WB 1FXYA 1C5VA 2Y5GA 3A83A 4M9FA 4OS7A 3ZZDA 5F8TA 5I25A 1BTYA 1UTLM 3SV2H 3ZVGA 4Z6AH 3LGVA 4UE7H 1EAWA 1QR3E 4Y0YE 3SJIA 1O2ZA 3M3SA 4DW2U 1HJAB 1PYTC 1ANEA 1UHBB 5TCCA 1OP0A 3GYMA 1SKYE 1TGTA 1V2NT 1VZQH 5C1UA 2FPZA 1NN6A 3M7UA 3E3TA 3DSGA 3E0NB 5DSFA 3GCTF 1C2EA 1SGTA 1RTFB 1MKWK 3VPKA 1GMHF 2BD4A 4ZH8A 1RFNA 1PQ8A 2G52A 2H2ZA 5DP9A 1O2NA 4F55A 1Y5UT 1MCVA 1V2JT 3GISB 3RXVA 3U69H 1IQLA 1E35B 2GMTC 2VWOA 3MU8A 5EXNA 2VWMA 2SGPE 1GBHA 1GCTC 1O2GH 1D6RA 4B74A 3SNEA 4AB9A 1O3HA 1GJ4H 2Z6BD 3SU4A 1O5EH 3TJUA 7GCHG 1ORFA 4B2CA 4DOQA 3WW7A 2ZU5A 3SNAA 2KX4A 4CH8B 1Y3XA 1DSTA 2ZTZA 1SQTA 2VINA 2IPQX 2ZQ1A 2JIZD 1OYQA 1A5IA 3PMBB 3ZV9A 3SGAE 2VGCB 4E05H 2NU3E 5AFZH 1FQ3A 2ZG0H 1ZSJA 5FBEA 2P93A 3GY4A 2R2MB 4YO9A 3LGYA 5B6OA 1LPZB 2BD8A 3MOCA 5FAHA 4Y8YA 1C2FA 1WOFA 2JJ2D 3EGKH 1E36B 1CGHA 3GCOA 3N7EA 1QA0A 1GJ5H 2JH6D 3QO6A 2KCPA 1GMDF 1TFXA 4FUCA 3B9FH 1PPZA 2NU2E 3W94A 1YP9A 1C2JA 3BTFE 2BD7A 3SN8A 3SV6A 1C5RA 3M37A 2FX6A 1CU1A 2HOBA 2EC9H 4FOUC 3ZYDA 2B7DH 3U1JB 3V12A 1GDUA 5FPTA 3RU4D 1HCGA 1O3FA 1PYTD 1D9IA 2QXGA 2Z3DA 3SI3H 1GHBF 4ASUD 3JZ2B 4XD7D 5ESTE 3M61U 3GCHB 1O2SA 2CXVA 2HVYB 5LPFA 4F4OC 2ZNKH 1AB9C 1UW7A 2PWXA 1TALA 1W14U 3QGNB 1L1NA 2ZPQA 3RU4E 2KR7A 1DM4B 1EFRD 2ZFSA 1MZDA 2BDGA 1C2GA 5GJ4B 4FXGH 2Q6DA 1PPFE 3FZDA 1Y5AT 3TK9A 3PROA 2ALPA 2QF3A 3RP2A 2ZGJA 2FZZA 1TA6A 5ESBA 4KKDA 2F9NA 3VXFH 3MU1A 1BZXE 1RGQA 1GMHG 2ZGXH 2WPLS 3ZVAA 1LHCH 2TGPZ 4K3JA 2PKAA 2RA3A 2XNDD 2Y7XA 2FTLE 4ZHAA 1P2NA 4ZXXH 3WWBA 3DUXH 2R3YA 1GBEA 3M7QA 3LGWA 4WMFA 5LH8A 3SJ9A 2ODQA 2H6MA 1W3CA 2GVFA 1N1LA 1GHWH 1EPTB 3Q77A 2W7UA 4Y76A 3K65B 2CF9H 1BT7A 4KP0A 3QTOH 1MQ6A 3RC5A 4TY6A 1XX9A 2BDYA 1MAYA 1KY9A 3ELAH 1MABB 3KL6A 2FO9A 2VGCC 2XOKD 4E7RG 1GMCF 3ZYEA 1C5PA 1TGSZ 4X1QU 1ZJDA 3VXEH 1GHAF 2HPPH 1O2IA 3FN8A 1C5TA 1AQ7A 1BBRK 2O9QA 1EQ9A 1GI4A 3TJNA 3AW1A 2ZCLP 4AOQA 1NBMD 1O3OA 4AG2A 2EI6A 1ESBA 2CJIA 1G37A 3O8DA 2ZFRH 2WYJA 1AWHB 4UD9H 1L4ZA 1KXAA 4CRBA 1GCDA 2B5TB 5PTPA 1S6HA 2CHAC 2R0LA 3RC6A 2BVSH 1V2KT 1WAYB 3RXKA 3M5LA 1WTHD 1YCPK 4K1TA 2VB0A 1V2MT 1P04A 1V2RT 4ESTE 1AO5A 1SB1H 3W95A 2A32A 3SNCA 1BIOA 2HVXA 1SG8B 1TOMH 1FNIA 2C93B 4CRFA 1MKXK 2VIDA 3OY6U 1E38B 2WPDD 4JCNA 2ZGCA 4RN6A 2V6NA 1MTVA 3RXSA 1HAYB 2QC2A 2BVRH 2XC0A 4B2BA 1TNKA 4MNYA 1C2LA 1C4U2 3AAVA 3MH6A 4TWWA 1VITG 1DT2A 2M5TA 1KSNA 2PUQH 1DANH 1BMNH 1S82A 1F92A 1O3LA 5FL7D 1AVWA 5HIYA 4WMEA 2J5UA 1O2JA 4CHAC 3PO1B 1EATA 1QB9A 5L6NH 1QBNA 5AF9H 1AUJA 5C2ZA 1AY6H 1C5MD 1WV7H 1BMFD 3MNXA 1O5DH 2NU4E 3BF6H 1SPJA 3OSYA 4O3UA 1Y3UA 1XMNB 3ZZAA 5F8XA 2FOBA 1PPCE 4DVAU 3SHCH 1LMWB 3MNCA 4H6TA 8ESTE 4BAHB 1GJ9B 1H8ED 2Y7ZA 1YWUA 3FZZA 3ZZ4A 5C17A 1C5ZB 1FJSA 2D1JA 4A1XA 1TABE 2D2DA 1CT4E 2BX3A 3TLOA 1O2YA 1CO7E 4U2WA 1O2WA 3SQHE 5A2MH 2QA9E 1YGCH 2XRCA 4AFQA 1W0ZU 3PLBA 5C20A 1TQ7B 3TH4H 2STBE 1IQKA 1YLDA 5EIYA 1YPHE 3SHAH 1NT1A 2A4RA 5EW2H 1THPB 2AMPA 4WXVA 2RDLA 4PROA 1OP8A 1VCWA 2C8XB 3Q3XA 4FUEA 2XNIA 2XTTB 2WPJS 2ZQ2A 3QLPH 1BMMH 3K6ZA 1J8AA 5DKMA 1C1VH 3T29A 2OBOA 2VH0A 4CRAA 3M5NA 2Q6GA 1O34A 3QN7A 2A4QA 5HMAA 2QYIA 1SFQB 2O8LA 4TWYA 4DY7B 5LPRA 3KQ5A 1LO6A 4O97A 4ZKNU 1MBQA 3S9AA 1GMCG 3A7VA 4O9VA 4X1PU 4GUXA 2QF4A 5T1VA 3BTKE 1HIAB 2ZA5A 1O5FH 4GCHG 2BY6X 3CP7A 2ZWLH 1GVLA 1W8BH 1EZQA 4JMYA 1PJPA 4ASHA 1ELAA 3MMGA 1KMHB 3TIUA 4A6LA 1ZZZA 4AFZA 3SV7A 1DUAA 1IOEA 3OFND 1SLVB 7ESTE 1O36A 1SMFE 1KXBA 1TMBH 2GV6A 2OC1A 2ZU2A 1DWBH 3V0XA 5JYIA 1W10U 2VU8E 3RXDA 1GPZA 5GDSH 1BHXB 1DWEH 1SGIB 1W0YH 5A8XA 1EJNA 1O3KA 1FV9A 3I29A 1A61H 1THRH 4FETA 2YMSC 2ZIQH 3NWUA 4Q7XA 1O2PA 1OPHB 1G3BA 3AAUA 3H7TA 4YLQH 4K60A 4NA8A 4D9RA 1NPMA 1QRWA 1QNJA 3GYLB 1V6DA 1DS2E 2Z94A 2HLDD 3BTME 2VWLA 1A5HA 4LOYH 1N6YA 3UY9A 1GDNA 4ZKOU 1Y3VA 2OUAA 1AMHA 1GI1A 5G4BA 4B6EA 3B8JA 2AFQB 3DSPA 2AIPA 1AVGH 1RRKA 1TPPA 2G5NA 1ZSLA 3T5FH 2ZU1A 1XUKA 5KECA 4JYTA 3OE7D 3UNQA 1WQSA 2BVXH 1P02A 1ZPCA 1E37B 4ABJA 3EDXB 1WCZA 1CA8B 1GL1A 3SNBA 1O3JA 4ACAA 2GKVE 3LGUA 4FVBA 2IJD1 5HGGA 3UR9A 1LHDH 1ELFA 2FS8A 5FPYA 4ZMAH 3QWCH 4B75A 2PUXB 4XBDA 5B6LA 2UUKB 1Q3XA 1SQRA 1QFKH 3F1SB 4O3TA 3PYHA 4Q7ZA 1TRMA 1LVOA 4B73A 5A0BA 4WH6A 1O2RA 1SGDE 2G00A 1ESTA 3FP6E 2PP6A 1C4Y2 3OX7U 4QT8C 1FDPA 3O8RA 3BG4C 3PM3A 4TPYA 1P2OA 1NRRH 2ALVA 3DCLA 1O35A 2W7SA 1ELEE 2C4FH 4NG9H 3GCNA 5GWZA 1L2EA 2FOAA 4FVDA 1F7ZA 4GCHF 1HRTH 1TGBA 3C27B 3C1KA 2BY8X 4GSOA 1WYKA 4DT4A 4CRCA 2A7HA 3A7XA 2ZDMA 1Z7KA 3T28A 1SGYE 4TSFD 5CMXH 1O3DA 1AD8H 1JWTA 4X1RU 1LPKB 2WV4A 1NO9H 2YOLA 1LCYA 1OOKB 3ENSB 2QXHA 4XBBA 2IOTA 4CBOA 1NESE 1OWEA 2YMSD 1LTOA 1TE0A 4YTAA 3SV9A 1C5OH 2AGEX 1K9OE 1YYY1 4KTCA 1EOLA 4X8VH 2IJOB 5A0AE 1K22H 1NS3A 2ESTE 2W26A 1J17T 4MNWA 3N7DA 2C8ZB 1A4WH 5IYTA 4B2AA 4OS6A 2VH6A 3F9GA 1EJMA 1O3PB 4IC5A 3HGPA 2FOGA 3KCGH 2BZ6H 2XC4A 4Y79A 2HWLB 4AGJA 1FPCH 3UOUA 4D9QA 2H9HA 1VITF 2BLOA 2GCTC 4INKA 4NIVA 4IN1A 3TGJE 4WH8A 3P17H 4X2YA 1Z6EA 2W3KA 1H4WA 3SU1A 1D3QB 1UK4A 1Z8RA 1Y3YA 3A7YA 1QB6A 1ETSH 4TT3D 1UVSH 3NZIA 1DX5M 4X6OA 3SV8A 3TH2H 1INCA 1DE7H 4ZKSU 1BHXF 1PPHE 1JRSA 1DDJA 3SBKA 2WHXA 9LPRA 1G3CA 1OSSA 1TBQH 2ODPA 2P3UB 2ZF0H 3LPRA 3LOXA 3TH3H 4CR9A 1SC8U 1WDIA 3MWIU 2ZFPH 3TU7H 2HPQH 4CRGA 2VIQA 3LDXH 3EE7A 3HK6B 2F3CE 3SQEE 3Q3YA 2SGFE 2GCHF 2J34A 2R2WU 3ITIA 2LNCA 1O2HA 1Y3WA 5JBAS 3S7HB 1KTSB 1DWCH 1ELTA 3RU4T 3TNTA 1XM1A 3VB4A 1DVAH 4BXWA 3RXCA 2ZFQH 1GBTA 2BXUH 3SNDA 4GLYA 1RIWC 1MQ5A 2QE7D 3VGCB 1KDQB 1V2TT 1NBME 1UJ1A 1MBMA 2BMGB 5DO4H 1SGPE 3UNSA 3ZZ8A 1TGCA 1T31A 2CMYA 5AFYH 2ZPRA 2KZ4A 1F2SE 3MO6A 5FCKA 2J92A 1KLIH 1T8MA 2G8TA 2CK3D 4IBLH 3SU6A 1LHGH 4BXSA 1VKYA 4ISOA 4JK5A 2ZEBA 2NU0E 4LZ4B 2SGDE 2QXIA 1GBAA 4JZDH 1T8LA 4XRNA 1MZAA 2UWOA 1E1QD 3F9HA 3LJJA 3PRBA 2JH0D 1ZTJA 1EP5A 1W13U 1CBWB 1K1JA 2FI3E 1KDQA 4HFPB 1TRNA 2F9BH 1S84A 2FYQA 1V2ST 2WZQA 1C1NA 4K8BA 1H9HE 3TGKE 3BG4B 3EAJA 1YLNA 5CHAB 2BDBA 4MNVA 4X6PA 4X8SH 3TVJB 2P94A 2H9TH 3SU0A 2XBVA 5DP4A 2NU1E 3RXFA 5HKKD 2BD5A 2SNWA 5A09A 9ESTA 2WV9A 2A0QB 2KAIB 3BTTE 2CF8H 1S6FA 2FX4A 1FLEE 1VJ9U 2AMDA 4MTBA 4X1NU 1GBBA 2BHGA 1YPGH 3UWIA 3RMMH 4AYVB 3UFAA 1SGNE 3RXQA 1AE5A 1EXFA 1O2TA 3SUDA 6GCHF 3HK3B 2QXJA 2GZ8A 1TBRH 2FMJA 1HYLA 3MNBA 5C94A 1LKAA 2F9VA 3NKKA 3N99A 3RXMA 3MYWA 4MLFB 2Y82A 1S85A 3UWJH 2O8TA 5E0JA 2EY4C 2XW9A 1QHRB 3TNSA 3RXGA 1DLKB 1OWJA 2BB4A 3KHVA 4AGKA 4JK6A 1P11E 5DK1A 3IWMA 2JJ1D 4H6SB 2TPIZ 3ZV8A 1QB1A 1UTQA 4Z0KA 3FANA 1IQIA 1BTWA 1BB0B 1JIMA 1P2IA 3ZZ5A 2UUFB 1AN1E 4MPXA 3UNRA 1LVYA 3NCLA 4IMQA 5J4SA 3K6YA 2FS9A 1C5UA 3A80A 4BAKB 3EYDA 4YLUA 1OWIA 3E91A 1ZLRA 4NIXA 1G36A 1P9UA 4X2WA 2OK5A 1J16A 1AI8H 4JYUH 2F9PA 2A2XH 2XWBI 2DE8A 1GGDB 2Z9LA 1TNGA 2SGQE 4CREA 1C1WH 2BYAX 2A7CA 2V3HH 5JBCS 3RLWH 1HUTH 1FMGA 1DXWA 1CHGA 1MTUA 5EPNA 2WINI 3RXEA 3PV4A 2A5AA 4OS4A 2V7QD 4INLA 3RM0H 2TGDA 3S69A 3PMHB 1A0JA 2ODYB 3TGIE 1SGQE 4K1EA 2BTCE 1GI2A 1THSH 1ARBA 1HJ9A 1IHTH 4ZROA 2PTCE 1P10A 1E79D 2RCEA 2FXRA 4JZFH 3L3TA 2BQ6B 2SFAA 3A82A 2W6ID 1EAXA 3A8BA 1ZTKA 5GIBA 3M3VA 2AH4X 1G2MA 3E1XB 4YXWD 1P2MA 3OEHD 1H8DH 4I86A 5H4IB 4NCYA 1C4V2 3UUZA 3PWCA 1WSSH 3QZQA 2G55A 4FUHA 2J95A 1PPBH 3QK1A 3S9BA 1UCYH 1YPJH 5J4QA 3MH5A 2FOFA 1P2QA 5EOKA 1PQAA 1QY6A 2W3IA 2ZI2H 3BTDE 1SL3A 5A8ZA 3SUEA 3ZIAD 3B23B 1NFUA 1K1IA 1GDQA 2GDDA 4RSPA 4UEHH 2CN0H 3SGQE 3P92A 1QQ4A 2KCOA 4JZIA 1NM6A 4AN7A 2PGQB 2FOHA 3PLKA 1MTNB 1P05A 2TGTA 4X1SU 2JDID 3GCHC 2JKHA 1S83A 3A7ZA 4AG1A 2WPHS 1O2LA 1K2I1 3GY5A 2BDCA 3LC3A 4KTUA 1T8OA 2VVCA 4Y11E 3Q00A 1H9LB 4I8JA 1O38A 3QTVH 3KNXA 3RMNH 1IAUA 2PKAB 1D3PB 3UREA 1Y5BT 4NIYA 1A0LA 3RM2H 1AB9B 1UVPA 2A1DB 1SLXB 5K0HA 1EB2A 1GBCA 2ZTYA 1C2DA 5HIZA 3SU5A 2FI5E 3KQDA 4DJZB 1QBVH 2F4LA 1KIGH 2GT7A 5HYOA 1G9IE 1ZGIA 3VB5A 4NA9H 2BDAA 1NRPH 3MU4A 3U1IB 4RT0A 1Z1JA 1XXDA 3I77A 1WBGB 1SLWB 4DGJA 2V0BA 1O5GH 3GDUA 1GI9B 1FONA 1Q2WA 1TNHA 2FDAA 3AVZA 1XUFA 2SGAA 2H9EH 2WPMS 3U9AH 3SU2A 3P8FA 2Z9JA 2WYGA 1S81A 4XFQA 1ABJH 2A31A 4GAWA 1BTXA 3M35A 3MO3A 4XSKU 3UAIC 2WSSD 1C1SA 1LKBA 3PRDA 4NSVA 1A0HB 2ZU3A 3F0OA 3OTJE 5DG6A 1OYTH 2PSXA 1H8IH 3A84A 2QF0A 1K1MA 1F5LA 2BD2A 5EQQA 1C5YB 2FI4E 3RXTA 4AFUA 1QGFA 3R0FA 4B6FA 2BXTH 2A2QH 4TPIZ 5ETXA 4HG6A 3V7TA 2BD9A 3AK5A 1P2KA 1QRXA 1S0RA 1BJVA 1KXCA 4Y8XA 5CDFE 3N7OA 1ZRKA 2QV1A 2BDHA 3MU0A 2OQ5A 1QTFA 4FUJA 4BANB 1AFQC 5HM9A 2YNBA 2P59A 3FOAA 3ZVFA 1NRQH 2F83A 2FM2A 4BAOB 2GX4A 3KEEA 3F2FA 1TWXB 1ZTLA 1AE8H 2CGAA 4P00A 3F2GA 1CGIE 3E90B 1PQ5A 1P01A 4OS1A 2TBSA 1C5NH 5L30H 4BAMB 1BOQA 1UCYK 1O0DH 2BQ7B 5HXFA 3BSQA 2GMTB 1F0UA 2H5CA 4INHA 1AVXA 1L1JA 3BIUH 4XDEA 1C5SA 1UTPA 4ZAEA 4YM9A 3URDA 4I31A 4A7IB 2AGIX 2FESH 1K1OA 1W2KH 2C3SA 1TA2A 2JETC 1Z8GA 1XVMA 2Y80A 1QZ8A 1GJCB 1GBIA 1XKBC 3HKIB 2B0FA 5EJ1A 1C5QA 1C1QA 1W7XH 4CH2B 1COWD 1Z8IB 2VVVA 3WY8A 6GCHG 1NRSH 4LZ1H 4WMDA 3DD2H 3LONA 5HM2A 1ZGVA 1QQUA 2ANYA 3ZVCA 4RKOB 4HI3A 1SGFA 1ANDA 3SU3A 4UFDH 1NROH 1GWAA 1GBMA 2BOKA 1GHBG 5GPIB 1DXPA 2AERH 1O30A 1D3DB 2STAE 1KXFA 3SJOA 3VEQB 5F53A 2OLGA 1N8OB 4AFSA 1BRBE 1E0FD 1TB6H 2FIRH 3OY5U 4GHQA 3SI4H 2OINA 3U8RH 5A0CA 1YCPH 3HGNA 1CE5A 2WUCA 1TLDA 4A1VA 1CVWH 3E0PB 1UK3A 3T25A 5FHTA 1EP6A 2IN2A 2QIQA 3P8GA 1V3XA 4Q4LA 5IDKA 2ZDKA 2EQNA 1GBKA 1N6XA 3MH4A 3RXIA 3UTUH 1HIAA 3OAAD 3OU0A 1BQYA 1FAXA 3KIDU 2VJ1A 1GI0A 2RFKC 2QGRA 2KFWA 1G30B 2F9OA 2GCHG 3STIA 5FPSA 3E8LA 1HAPH 1KXDA 1GVZA 3PV2A 4A5TS 1TIOA 4VGCC 1F5KU 2V3OH 2J98A 2FYRA 1FY8E 3QX5H 3ZZBA 1HPGA 3G01A 1ETTH 1NU7B 1ANCA 4RKJB 1T8NA 1RD3B 5GNDA 2WPIS 2ULLA 3FVFB 2BQWB 1GHYH 1GCTB 1NC6A 2FOMB 4Y6DA 2A45B 3RDZA 3P8OA 1B7XB 1H9IE 1SVPA 3UOPA 1DWDH 1O2VA 3LKWA 3MI4A 1GHXH 3I78A 4H42U 4MNXA 1UVUH 1NZQH 1SOTA 3F3BA 4R0IA 1CSOE 1DOJA 4FU7A 5DP6A 5FBIA 3DFJA 4U01A 3GDSA 1TNIA 4NWLA 2UWLA 3BEFB 4NGAH 3KYGA 2THFB 2UUJB 3GY2A 1YF4A 5GXPA 3V3MA 3BTQE 3M36A 4WWYA 3ODDA 1QJ7B 3PTBA 2BLQA 1EAUA 4UFEH 1E1RD 2EA3A 1OP2A 2LELA 2VIPA 3URCA 1HFDA 3EA8A 1ZYOA 1JIRA 1IQMA 2ZHEH 1ZMJA 3ATKA 3A8CA 1ZHRA 2TRMA 1HAOH 4OS5A 2ZP0H 3GDVA 5EQRA 3LIWA 1ZHPA 1AZ8A 1U6QA 1K0HA 3DSOA 4ISNA 5GCHF 5DP8A 5JBBS 4I7YH 1UTJA 1QJ1B 3A87A 4NA7A 1AFEH 1C1RA 2XBWA 4Y71A 1A3EH 1YPLH 3ZZ3A 3K9XB 1V2VT 4FUIA 1CHOG 2L74A 1NFWA 4ZXYH 4CR5A 3RXBA 5K7RA 3RC4A 1O5CB 3U98H 1OHHD 2CV3A 1CT2E 4YOIA 3UQOA 3HPTB 1FIZA 4NFFA 5E2OA 1BRCE 3OYPA 1HJAC 4Y7AA 1GG6B 4ABEA 2HGTH 3Q76A 2RDEA 2FLBH 2V35A 1BTHH 1GJ7B 1DUEA 1FY1A 2H5DA 4YZUA 4WVPE 1S0QA 1O37A 1Q31A 1VGCB 1BBRH 2Y6TA 3QUMP 5JPMH 1TPOA 4Q7YA 4SGBE 1UCYE 3CNRA 5KEDA 2P8OB 2W5EA 2LPRA 1D4PB 1YCPM 3GICB 1TNLA 3D65E 2HNTF 1Y59T 1C5XB 3SJ8A 1MH0A 3ODFA 1LVMA 1SQOA 1O5AB 3PMJA 3T62A 1MKXH 2GTBA 4GPGA 1DFPA 3GY3A 4BTIB 1EB1H 1B0EA 1CQQA 1A5GH 2H1UA 4GHTA 1FIWA 1K1NA 3KQBA 6ESTA 1FZZA 3RXAA 2OC0A 1NTPA 4ABBA 2SNVA 1H1BA 1LQEA 2OC8A 4MDSA 3ATLA 1HXEH 1YY3A 2J94A 4FU8A 3EA7A 3KGPA 2BX4A 1BJUA 1AKSB 2G4TA 2RA0A 1K1PA 3ATWA 3RXLA 3RXUA 1V2OT 2ZC9H 4M7GA 3RMOH 3F9FA 2GV7A 2PKSC 1HXFH 1C2IA 3A8AA 1HLTH 1EX3A 1V2PT 3H09A 1HBTH 4RT1A 2OCVB 1OX1A 4X2XA 1A46H 2QCYA 1MTSA 2A5KA 2G4UA 2O8WA 1BTPA 4KELA 1AFQB 3RLYH 3P6ZB 4ZCNA 1WTGH 6CHAC 3GS9A 1EOJA 2RG3A 3KN2A 3LC5A 3DFLA 2PW8H 3PB1E 5JB9S 3ZZ7A 1O33A 2VNTA 1OKXA 1HB0B 1RTLA 2B9LA 1GJBB 1K1LA 3DA9B 1BMAA 1BDAA 1M9UA 1LQDB 3RXOA 4X2VA 4OGXA 4P02A 1HAVB 4JYVH 1GMDG 3A86A 1IQGA 3A88A 2BD3A 1ZPBA 2GZ7A 2VIVA 2GCTB 4BTUB 3ZVEA 4I8LA 5C5NA 4DIHH 8LPRA 1XUHA 1BUIA 1T4UH 1YKTA 2XXLA 1P9SA 1TX8A 2I6QA 1YPHC 1D6WA 1UTOA 1F0TA 1V2UT 1C1UH 3A7WA 4DT7B 2B8OH 1P12E 3NUMA 1FAKH 1OS8A 2QF5A 4I8HA 4IS5A 4F48B 3LU9B 1Z1IA 2J9NA 1NRNH 1C9PA 3BEIB 3CENA 4X0WU 2GDEH 4DCDA 1GJ8B 1V2WT 4D7GA 2WUBA 1H8HD 4X8TH 3H5CB 1VGCC 1CHOF 3BEUA 2IPHA 2D26C 1LVBA 4IN2A 4BOHA 8GCHG 1W12U 1UHBA 1LDTT 1WU1A 2TIOA 2OBQA 1ANBA 4CHAB 1ZR0A 3P8NA 5E8EH 1FN6A 1HAHH 1C9TA 1OXGA 1TNJA 1P06A 2AMQA 2C8YB 4WXIA 1ELVA 3TITA 2ZTXA 5DPAA 4U30A 6CHAB 2W6JD 1GL0E 3F0PA 3MQKC 2AYWA 4ABGA 2ZZUH 2XYAA 1A7SA 3ZZ6A 3MFJA 3BTEE 3RXRA 1GBFA 2BOHB 1Y8TA 5JDUB 4UFFH 5EXMA 1L1GA 2HALA 1ZMNA 4UDWH 4KTSA 3BV9B 5ABWA 2F91A 2GD4B 1SGCA 5E2PA 5EODA 4UONA 1HAGE 3DHKH 3R3GB 5EJZA 1EJAA 1J15A 2J4IA 4J2YB 2ZFTA 2FLRH 1C1TA 1O3NA 3MH7A 5F03A 2OC7A 4I8KA
chains in the Genus database with same CATH topology
3O8CA 4FETA 1E1QD 2YMSC 3PRBA 5EQRA 3VG8A 4B76A 4KTCA 1W3CA 1E79D 2GVFA 1N1LA 2IJOB 3DSOA 3FO8D 5F53A 1RTLA 3WW7A 1NS3A 2WZQA 2WSSD 2KCYA 2W6ID 1H8ED 3N7DA 4K8BA 3M5OA 2JIZD 3PRDA 1BT7A 2OINA 3F0OA 5C17A 4A1XA 4WF8A 3M5MA 3RC5A 2HLDD 4NWKA 4YXWD 1W0KD 3OEHD 5EQQA 3SU0A 3RC4A 1MABB 5H4IB 5HKKD 1OHHD 4A1VA 2WV9A 4B6FA 4I33A 2XOKD 4B6EA 3OYPA 2K1QA 4TYDA 2JJ2D 5ETXA 3PV5A 3DSPA 3N7EA 2M2AA 3AK5A 2KCPA 5C0TA 4Q4LA 2F9UA 5IDKA 4WH8A 3FN8A 3FKSD 5CDFE 3SUDA 3OE7D 2A4RA 2YMSB 5DN6D 5CHBA 3SU1A 1DY8A 1DY9A 2QV1A 2XCNA 1W0JD 3OAAD 4Q63A 3SUEA 3ZIAD 3SV6A 2XNIA 2F9VA 4TT3D 3OEED 2QF5A 1NBMD 3N99A 2KFWA 2K8IA 2P59A 3L6PA 3NRLA 4B71A 2IJD1 3FOAA 1CU1A 3O8DA 3SV8A 2FM2A 2F43B 1S6LA 2KCOA 5FPSA 2OBOA 2A4GA 3KF2A 1H8HD 3KEEA 3M5NA 3F2FA 2A4QA 5FPYA 2WHXA 3U1JB 4A1TA 3PV2A 4B75A 3RC6A 3F2GA 3LOXA 2FP7B 5B6LA 3E90B 5FPTA 2JJ1D 4R8TB 2JDID 3M5LA 2OBQA 1FX0B 4M9FA 2KCAA 4B73A 4ASUD 4XD7D 1JXPA 4WH6A 3P8NA 1A1RA 2QF4A 5T1VA 3UB0A 2L6OA 4OM9A 3WWBA 5GNDA 4RI0A 3SYJA 2GGVB 3O8RA 2FOMB 3KNXA 2KM0A 3P8OA 2WPDD 2AHME 3DCLA 4I31A 2W6JD 2K0QA 3F0PA 4Z1MD 2OC0A 3EYDA 3WWFA 1WXRA 2KR7A 3LKWA 1SKYE 2XCFA 3SZEA 4JMYA 1EFRD 2OC8A 2OK5A 5DSFA 4A92A 3F3BA 5GJ4B 3SUFA 1KMHB 3SUGA 4U01A 3SU5A 2VBCA 2QE7D 4NWLA 1NBME 5EQSA 2F4LA 4DT4A 3SV7A 1COWD 3OFND 4F55A 5FL7D 5ESBA 3H09A 2J5UA 2KZ4A 5IK2D 3LONA 4TSFD 3W1EA 1DXWA 3U1IB 1RGQA 3OTPA 3F2HA 5EPNA 2O8MA 2OC1A 5C0UA 2V7QD 1E1RD 2YOLA 2CK3D 2LELA 5EPYA 3SU6A 1BMFD 2XNDD 3SU3A 2YMSD 4ZCNA 4B74A 2OC7A 5GPIB 1DXPA 3GS9A 3O8BA 3SV9A 3KN2A 3SU2A 3SU4A 4I32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7E A;  3N7D A;  2LEL A;  3DSO A;  2KM0 A;  2K0Q A;  3DSP A; 
#chains in the Genus database with same CATH topology
 3KQE A;  1GHA G;  1SR5 C;  4FUG A;  3AAS A;  5E0G A;  1HNE E;  3KYF A;  5CHA C;  1HAX B;  1O31 A;  2KCY A;  1SGE E;  3AW0 A;  1YPK H;  1VCQ A;  2PFE A;  4CBN A;  1YPE H;  2YNA A;  3FFG A;  1V2Q T;  1EAI A;  1TPS A;  4NWK A;  1W0K D;  1MMJ N;  4MPV A;  1ELB A;  2VIW A;  3P95 A;  1QBO A;  1FI8 A;  1LPG B;  4KGA A;  1SGR E;  3ZZ9 A;  3UQV A;  2ZPS A;  3LH1 A;  2ZHW H;  4ISI H;  1T4V H;  4Y0Z E;  1QL9 A;  1FN8 A;  5CHB A;  1GGD C;  1DY8 A;  3D62 A;  1EZX C;  3HAT H;  1DLE A;  2Y5F A;  1ZSK A;  1UVT H;  4AC9 A;  3TPI Z;  3KQC A;  3FP7 E;  4NZL A;  4JZE H;  4K2Y A;  3T27 A;  1UO6 A;  1ZOM A;  4YES B;  2Z3E A;  3TJV A;  2BM2 A;  1BRA A;  1TYN A;  5EXL A;  2Q6F A;  4R8T B;  1G3D A;  5C67 A;  2G81 E;  1P03 A;  2PKS B;  1YPM H;  1T7C A;  5E0H A;  2GP9 B;  1CA0 C;  5GCH G;  1AIX H;  1JXP A;  1LHE H;  1QRZ A;  1XUG A;  1XUI A;  1TBZ H;  2GT8 A;  3QGJ A;  3UB0 A;  1AWF H;  4OM9 A;  5FX5 A;  4ABH A;  1ZJK A;  1DIC A;  3JZ1 B;  8GCH F;  2ZGB H;  4MPU A;  3FAO A;  2AHM E;  1RIW B;  1O2U A;  1P0S H;  3A7T A;  2D8W A;  1WXR A;  1NFY A;  1BTZ A;  1QIX B;  3VFE A;  3IIT A;  4A92 A;  3SUG A;  2P95 A;  2FWW A;  1JOU B;  3A81 A;  4ABI A;  1E34 B;  1SHY A;  1TX7 A;  5FX6 A;  4THN H;  1VJA U;  5AHG H;  1SBW A;  5IK2 D;  2EI8 A;  3QZR A;  2O8U A;  1OWD A;  1XXF A;  3ATI A;  4TY7 A;  5JB8 S;  3PO1 C;  4AB8 A;  1ABI H;  1ZRB A;  1MTN C;  1FPH H;  5C5O A;  2HRV A;  3U8T H;  3FO8 D;  4SGA E;  3QDZ B;  5T3H A;  3T2N A;  1C1O A;  4H4F A;  1A2C H;  1YLC A;  3ZVB A;  3BIV H;  2PR3 A;  4U32 A;  3M5M A;  5LGO A;  3EE0 B;  2C90 B;  1K21 H;  2J38 A;  1O3I A;  2FEQ H;  1KTT B;  1GJD B;  2ZDA H;  3D49 H;  1SSX A;  2QY0 B;  7GCH F;  4ZHM U;  3BN9 A;  3PV5 A;  4AOR A;  1KYN A;  2ZHD A;  5DJ7 A;  5BRR E;  2AGG X;  3ATM A;  1ETR H;  2PLX A;  1QA7 A;  3PWB A;  3U8O H;  1BCU H;  1P57 B;  2P8O C;  1TPA E;  2A4O A;  1W11 U;  1B0F A;  2K8I A;  3NRL A;  5TCA A;  2PGB B;  1MU8 B;  1S6L A;  2F43 B;  3STJ A;  1MCT A;  3FP8 E;  1BTU A;  1UTM A;  1EUF A;  3D23 A;  2OXS A;  2TGA A;  1EZU C;  5EGM A;  2EEK A;  2OP9 A;  1FY3 A;  1FX0 B;  1IHS H;  4MQA A;  1GI3 A;  3BTW E;  4B1T A;  1JRT A;  2ZKS A;  2OTV A;  2BZA A;  2SGE E;  5LPE A;  1KXE A;  4WY3 A;  3EST A;  4RI0 A;  2GGV B;  4ACB A;  4J1Y A;  2R3U A;  2ZO3 H;  4LXB H;  3S9C A;  1NY2 2;  4AYY B;  4DUR A;  1UK2 A;  2PV9 B;  3S7K B;  4WJG 2;  3SZE A;  5C3N A;  2DUC A;  1YM0 A;  1SGF G;  1HAI H;  3SUF A;  3U28 C;  4MPW A;  1O2O A;  2JH5 D;  1GVK B;  4O03 A;  4FUF A;  4Y7B A;  2ZGH A;  5DP7 A;  1HAZ B;  4X8U H;  1DSU A;  4YT6 H;  4YT7 H;  1GBD A;  1O5B B;  2PSY A;  3W1E A;  2WPK S;  1A3B H;  3F68 H;  3V13 A;  2Z9K A;  1GG6 C;  5DGJ A;  1MAX A;  4YOG A;  5EU8 A;  1XVO A;  5F8Z A;  3CS7 A;  1ACB E;  4NIW A;  1ARC A;  1AHT H;  4K5Z A;  4I32 A;  3O8C A;  4OGY A;  3Q3K A;  2A7J A;  2V3M A;  1GI6 A;  4JZ1 A;  5FXL A;  2Y81 A;  1D3T B;  3NK8 A;  1ESA A;  4IGD A;  3MTY A;  1IQJ A;  5L2Y H;  1AU8 A;  1PQ7 A;  1TX6 A;  3BTH E;  4YOJ A;  3BTG E;  4UFG H;  2J2U A;  2Z9I A;  1QL7 A;  3M3T A;  1O3G A;  4FUB A;  1C2H A;  1BRU P;  1FY5 A;  2ZCK P;  1MD7 A;  4I33 A;  1PPG E;  2ZCH P;  4BTT B;  4TYD A;  2ZDV H;  1GJA B;  2ZHQ H;  2M2A A;  1AZZ A;  3SO3 A;  2XBX A;  1ELC A;  1UTN A;  1O3M A;  3VB6 A;  1JMO H;  3RXH A;  1DY9 A;  2XC5 A;  1HV7 A;  1VIT H;  1AGJ A;  2XCN A;  4Q63 A;  4AX9 H;  3EA9 A;  2G5V A;  1QJ6 B;  3PLP A;  3ZZC A;  1OWH A;  3A89 A;  1QUR H;  1OWK A;  1SOZ A;  3LH3 A;  1GI8 B;  1GI7 B;  1Z6J H;  2ZFF H;  4BAQ B;  1ELD E;  2A4G A;  4Y8Z A;  2HLC A;  4A1T A;  2FP7 B;  4K1S A;  1QCP A;  1S5S A;  3MO9 A;  1BML A;  4X6M A;  4FUD A;  2KCA A;  5TJX A;  1TRY A;  5JBT A;  2L6O A;  4AZ2 B;  1GBL A;  1QL8 A;  1GHV H;  1ELG A;  2J98 B;  3M7T A;  2KM0 A;  2BDI A;  2QAA A;  1IQE A;  2K0Q A;  4Z1M D;  1O2Q A;  1X7A C;  5A8Y A;  1UTK A;  4ZUH A;  2XCF A;  4FU9 A;  1P3E A;  3P70 B;  3TJO A;  2ANK H;  1J14 A;  6LPR A;  4X6N A;  3EQ0 H;  3E6P H;  2AS9 A;  2VBC A;  1TOC B;  2HNT E;  4HGC A;  4MVN A;  1ZPZ A;  2J97 A;  4NZQ A;  1CT0 E;  4Q80 A;  1XUJ A;  5I46 H;  3PMA B;  1IQN A;  1P09 A;  1VR1 H;  1RS0 A;  1IQH A;  1TGN A;  1WUN H;  2BY7 X;  3MHW U;  3UPE A;  7LPR A;  1C1M A;  5FCR A;  5AVD A;  3T26 A;  4ISH H;  2AIQ A;  1C2M A;  4IC6 A;  2DE9 A;  3O8B A;  1IQF A;  1TMT H;  4Y10 E;  2BLV A;  3LGI A;  2UUY A;  3VG8 A;  4B76 A;  3TK6 A;  4ZHL U;  2P3F H;  3K2U A;  1KLT A;  4Q2K A;  1EPT A;  1PFX C;  2WV5 A;  2GZ9 A;  1P2J A;  5DP5 A;  3CS0 A;  2ZHF H;  4WF8 A;  1K28 D;  2XWA A;  2ZEC A;  5BPE A;  1EKB B;  1B5G H;  1F0S A;  4F49 A;  1BIT A;  2ASU B;  5DP3 A;  1O3C A;  2FOE A;  1HAV A;  5T6G A;  1YBW A;  1UVO A;  2NWN A;  1P3C A;  1G2L A;  1ID5 H;  5L2Z H;  5C1Y A;  1RTK A;  2JET B;  5C0T A;  2F9U A;  3FKS D;  1CGJ E;  3UIR A;  2YMS B;  2ILN A;  5DN6 D;  1TQ0 B;  2ZU4 A;  1O32 A;  1L0Z A;  1JBU H;  4D7F A;  1NU9 A;  2Z7F E;  3SZN A;  3L6P A;  1GBJ A;  1F5R A;  2QN5 T;  3GCT G;  2VVU A;  3KF2 A;  1BA8 B;  1O3A A;  2FOC A;  2XBY A;  2FOD A;  3PTN A;  1TON A;  4XOJ A;  4ZKR U;  1CA0 B;  2PHB A;  3MNS A;  5CE1 A;  2VIO A;  5EG4 A;  1NFX A;  3VB3 A;  2P3T B;  4D8N A;  1F0R A;  1MKW H;  1ZHM A;  3MU5 A;  1A1R A;  2I6S A;  1MD8 A;  2Y5H A;  5T6D A;  1L4D A;  1BBR E;  1FUJ A;  1SQA A;  1DPO A;  5SGA E;  3RML H;  3SYJ A;  1G32 B;  1YC0 A;  4BNR A;  4D76 A;  2PTN A;  2VWN A;  3SOR A;  2LP6 A;  3WWF A;  4IMZ A;  5C1X A;  2OD3 B;  3DT0 H;  1O3B A;  2ANW A;  1VCP A;  1MU6 B;  4DII H;  1RJX B;  5KGO A;  1EPT C;  3GY6 A;  4CRD A;  2P16 A;  2CHA B;  4ABA A;  4NFE A;  4ABD A;  3BG8 A;  2R9P A;  5EQS A;  3F9E A;  3A8D A;  4HTC H;  1Z8J B;  4E06 H;  2ZDL A;  3RXP A;  3SJK A;  3UR6 A;  1C5L H;  2Z3C A;  3OTP A;  3F2H A;  3RXJ A;  2O8M A;  5C0U A;  3L33 A;  1SFI A;  1O39 A;  5EPY A;  4K8Y A;  1HJ8 A;  5F6M A;  4LK4 A;  3LT3 A;  3GY7 A;  2AEI H;  3RUO A;  4XBC A;  1CBW C;  3NPS A;  1TMU H;  7KME H;  1RXP A;  1UMA H;  1TAW A;  1T32 A;  4MG3 A;  1O2X A;  4E7N A;  2OQU A;  4VGC B;  3IG6 B;  3A85 A;  3SGB E;  3LGT A;  8KME 2;  1ZML A;  4ISL A;  4NSY A;  5T6F A;  3VGC C;  1O3E A;  3M5O A;  4XE4 A;  3ZVD A;  2EI7 A;  1FY4 A;  1HGT H;  2GJG A;  2Q1J A;  2G51 A;  3HKJ B;  1GI5 A;  1MUE B;  1SI5 H;  3GOV B;  3H7O A;  1V2L T;  2HNT C;  1KLJ H;  3LJO A;  1Z71 A;  1C1P A;  2BLW A;  1C2K A;  2K1Q A;  3VB7 A;  3GY8 A;  2A5I A;  1DIT H;  1AUT C;  5EW1 H;  2R0K A;  1O2K A;  1J9C H;  4GVU A;  1HDT H;  2ANM H;  4I8G A;  1EAS A;  4HZH A;  4OS2 A;  4IW4 E;  1N8O C;  2ZDN A;  1W0J D;  1EZS C;  3OEE D;  5EJL A;  2UWP A;  1SHH B;  1G3E A;  3SW2 B;  1O2M A;  1PPE E;  4B71 A;  3F6U H;  2Z9G A;  2BY5 X;  3E16 B;  1C5W B;  2FTM A;  1LHF H;  1WQV H;  4DG4 A;  1XKA C;  1P8V C;  3S0N A;  1GHZ A;  2KAI A;  1MTW A;  3NXP A;  4K69 A;  3SOS A;  1W7G H;  2BY9 X;  3TK5 A;  1GJ6 A;  4ABF A;  1AKS A;  1SLU B;  2C8W B;  1FXY A;  1C5V A;  2Y5G A;  3A83 A;  4M9F A;  4OS7 A;  3ZZD A;  5F8T A;  5I25 A;  1BTY A;  1UTL M;  3SV2 H;  3ZVG A;  4Z6A H;  3LGV A;  4UE7 H;  1EAW A;  1QR3 E;  4Y0Y E;  3SJI A;  1O2Z A;  3M3S A;  4DW2 U;  1HJA B;  1PYT C;  1ANE A;  1UHB B;  5TCC A;  1OP0 A;  3GYM A;  1SKY E;  1TGT A;  1V2N T;  1VZQ H;  5C1U A;  2FPZ A;  1NN6 A;  3M7U A;  3E3T A;  3DSG A;  3E0N B;  5DSF A;  3GCT F;  1C2E A;  1SGT A;  1RTF B;  1MKW K;  3VPK A;  1GMH F;  2BD4 A;  4ZH8 A;  1RFN A;  1PQ8 A;  2G52 A;  2H2Z A;  5DP9 A;  1O2N A;  4F55 A;  1Y5U T;  1MCV A;  1V2J T;  3GIS B;  3RXV A;  3U69 H;  1IQL A;  1E35 B;  2GMT C;  2VWO A;  3MU8 A;  5EXN A;  2VWM A;  2SGP E;  1GBH A;  1GCT C;  1O2G H;  1D6R A;  4B74 A;  3SNE A;  4AB9 A;  1O3H A;  1GJ4 H;  2Z6B D;  3SU4 A;  1O5E H;  3TJU A;  7GCH G;  1ORF A;  4B2C A;  4DOQ A;  3WW7 A;  2ZU5 A;  3SNA A;  2KX4 A;  4CH8 B;  1Y3X A;  1DST A;  2ZTZ A;  1SQT A;  2VIN A;  2IPQ X;  2ZQ1 A;  2JIZ D;  1OYQ A;  1A5I A;  3PMB B;  3ZV9 A;  3SGA E;  2VGC B;  4E05 H;  2NU3 E;  5AFZ H;  1FQ3 A;  2ZG0 H;  1ZSJ A;  5FBE A;  2P93 A;  3GY4 A;  2R2M B;  4YO9 A;  3LGY A;  5B6O A;  1LPZ B;  2BD8 A;  3MOC A;  5FAH A;  4Y8Y A;  1C2F A;  1WOF A;  2JJ2 D;  3EGK H;  1E36 B;  1CGH A;  3GCO A;  3N7E A;  1QA0 A;  1GJ5 H;  2JH6 D;  3QO6 A;  2KCP A;  1GMD F;  1TFX A;  4FUC A;  3B9F H;  1PPZ A;  2NU2 E;  3W94 A;  1YP9 A;  1C2J A;  3BTF E;  2BD7 A;  3SN8 A;  3SV6 A;  1C5R A;  3M37 A;  2FX6 A;  1CU1 A;  2HOB A;  2EC9 H;  4FOU C;  3ZYD A;  2B7D H;  3U1J B;  3V12 A;  1GDU A;  5FPT A;  3RU4 D;  1HCG A;  1O3F A;  1PYT D;  1D9I A;  2QXG A;  2Z3D A;  3SI3 H;  1GHB F;  4ASU D;  3JZ2 B;  4XD7 D;  5EST E;  3M61 U;  3GCH B;  1O2S A;  2CXV A;  2HVY B;  5LPF A;  4F4O C;  2ZNK H;  1AB9 C;  1UW7 A;  2PWX A;  1TAL A;  1W14 U;  3QGN B;  1L1N A;  2ZPQ A;  3RU4 E;  2KR7 A;  1DM4 B;  1EFR D;  2ZFS A;  1MZD A;  2BDG A;  1C2G A;  5GJ4 B;  4FXG H;  2Q6D A;  1PPF E;  3FZD A;  1Y5A T;  3TK9 A;  3PRO A;  2ALP A;  2QF3 A;  3RP2 A;  2ZGJ A;  2FZZ A;  1TA6 A;  5ESB A;  4KKD A;  2F9N A;  3VXF H;  3MU1 A;  1BZX E;  1RGQ A;  1GMH G;  2ZGX H;  2WPL S;  3ZVA A;  1LHC H;  2TGP Z;  4K3J A;  2PKA A;  2RA3 A;  2XND D;  2Y7X A;  2FTL E;  4ZHA A;  1P2N A;  4ZXX H;  3WWB A;  3DUX H;  2R3Y A;  1GBE A;  3M7Q A;  3LGW A;  4WMF A;  5LH8 A;  3SJ9 A;  2ODQ A;  2H6M A;  1W3C A;  2GVF A;  1N1L A;  1GHW H;  1EPT B;  3Q77 A;  2W7U A;  4Y76 A;  3K65 B;  2CF9 H;  1BT7 A;  4KP0 A;  3QTO H;  1MQ6 A;  3RC5 A;  4TY6 A;  1XX9 A;  2BDY A;  1MAY A;  1KY9 A;  3ELA H;  1MAB B;  3KL6 A;  2FO9 A;  2VGC C;  2XOK D;  4E7R G;  1GMC F;  3ZYE A;  1C5P A;  1TGS Z;  4X1Q U;  1ZJD A;  3VXE H;  1GHA F;  2HPP H;  1O2I A;  3FN8 A;  1C5T A;  1AQ7 A;  1BBR K;  2O9Q A;  1EQ9 A;  1GI4 A;  3TJN A;  3AW1 A;  2ZCL P;  4AOQ A;  1NBM D;  1O3O A;  4AG2 A;  2EI6 A;  1ESB A;  2CJI A;  1G37 A;  3O8D A;  2ZFR H;  2WYJ A;  1AWH B;  4UD9 H;  1L4Z A;  1KXA A;  4CRB A;  1GCD A;  2B5T B;  5PTP A;  1S6H A;  2CHA C;  2R0L A;  3RC6 A;  2BVS H;  1V2K T;  1WAY B;  3RXK A;  3M5L A;  1WTH D;  1YCP K;  4K1T A;  2VB0 A;  1V2M T;  1P04 A;  1V2R T;  4EST E;  1AO5 A;  1SB1 H;  3W95 A;  2A32 A;  3SNC A;  1BIO A;  2HVX A;  1SG8 B;  1TOM H;  1FNI A;  2C93 B;  4CRF A;  1MKX K;  2VID A;  3OY6 U;  1E38 B;  2WPD D;  4JCN A;  2ZGC A;  4RN6 A;  2V6N A;  1MTV A;  3RXS A;  1HAY B;  2QC2 A;  2BVR H;  2XC0 A;  4B2B A;  1TNK A;  4MNY A;  1C2L A;  1C4U 2;  3AAV A;  3MH6 A;  4TWW A;  1VIT G;  1DT2 A;  2M5T A;  1KSN A;  2PUQ H;  1DAN H;  1BMN H;  1S82 A;  1F92 A;  1O3L A;  5FL7 D;  1AVW A;  5HIY A;  4WME A;  2J5U A;  1O2J A;  4CHA C;  3PO1 B;  1EAT A;  1QB9 A;  5L6N H;  1QBN A;  5AF9 H;  1AUJ A;  5C2Z A;  1AY6 H;  1C5M D;  1WV7 H;  1BMF D;  3MNX A;  1O5D H;  2NU4 E;  3BF6 H;  1SPJ A;  3OSY A;  4O3U A;  1Y3U A;  1XMN B;  3ZZA A;  5F8X A;  2FOB A;  1PPC E;  4DVA U;  3SHC H;  1LMW B;  3MNC A;  4H6T A;  8EST E;  4BAH B;  1GJ9 B;  1H8E D;  2Y7Z A;  1YWU A;  3FZZ A;  3ZZ4 A;  5C17 A;  1C5Z B;  1FJS A;  2D1J A;  4A1X A;  1TAB E;  2D2D A;  1CT4 E;  2BX3 A;  3TLO A;  1O2Y A;  1CO7 E;  4U2W A;  1O2W A;  3SQH E;  5A2M H;  2QA9 E;  1YGC H;  2XRC A;  4AFQ A;  1W0Z U;  3PLB A;  5C20 A;  1TQ7 B;  3TH4 H;  2STB E;  1IQK A;  1YLD A;  5EIY A;  1YPH E;  3SHA H;  1NT1 A;  2A4R A;  5EW2 H;  1THP B;  2AMP A;  4WXV A;  2RDL A;  4PRO A;  1OP8 A;  1VCW A;  2C8X B;  3Q3X A;  4FUE A;  2XNI A;  2XTT B;  2WPJ S;  2ZQ2 A;  3QLP H;  1BMM H;  3K6Z A;  1J8A A;  5DKM A;  1C1V H;  3T29 A;  2OBO A;  2VH0 A;  4CRA A;  3M5N A;  2Q6G A;  1O34 A;  3QN7 A;  2A4Q A;  5HMA A;  2QYI A;  1SFQ B;  2O8L A;  4TWY A;  4DY7 B;  5LPR A;  3KQ5 A;  1LO6 A;  4O97 A;  4ZKN U;  1MBQ A;  3S9A A;  1GMC G;  3A7V A;  4O9V A;  4X1P U;  4GUX A;  2QF4 A;  5T1V A;  3BTK E;  1HIA B;  2ZA5 A;  1O5F H;  4GCH G;  2BY6 X;  3CP7 A;  2ZWL H;  1GVL A;  1W8B H;  1EZQ A;  4JMY A;  1PJP A;  4ASH A;  1ELA A;  3MMG A;  1KMH B;  3TIU A;  4A6L A;  1ZZZ A;  4AFZ A;  3SV7 A;  1DUA A;  1IOE A;  3OFN D;  1SLV B;  7EST E;  1O36 A;  1SMF E;  1KXB A;  1TMB H;  2GV6 A;  2OC1 A;  2ZU2 A;  1DWB H;  3V0X A;  5JYI A;  1W10 U;  2VU8 E;  3RXD A;  1GPZ A;  5GDS H;  1BHX B;  1DWE H;  1SGI B;  1W0Y H;  5A8X A;  1EJN A;  1O3K A;  1FV9 A;  3I29 A;  1A61 H;  1THR H;  4FET A;  2YMS C;  2ZIQ H;  3NWU A;  4Q7X A;  1O2P A;  1OPH B;  1G3B A;  3AAU A;  3H7T A;  4YLQ H;  4K60 A;  4NA8 A;  4D9R A;  1NPM A;  1QRW A;  1QNJ A;  3GYL B;  1V6D A;  1DS2 E;  2Z94 A;  2HLD D;  3BTM E;  2VWL A;  1A5H A;  4LOY H;  1N6Y A;  3UY9 A;  1GDN A;  4ZKO U;  1Y3V A;  2OUA A;  1AMH A;  1GI1 A;  5G4B A;  4B6E A;  3B8J A;  2AFQ B;  3DSP A;  2AIP A;  1AVG H;  1RRK A;  1TPP A;  2G5N A;  1ZSL A;  3T5F H;  2ZU1 A;  1XUK A;  5KEC A;  4JYT A;  3OE7 D;  3UNQ A;  1WQS A;  2BVX H;  1P02 A;  1ZPC A;  1E37 B;  4ABJ A;  3EDX B;  1WCZ A;  1CA8 B;  1GL1 A;  3SNB A;  1O3J A;  4ACA A;  2GKV E;  3LGU A;  4FVB A;  2IJD 1;  5HGG A;  3UR9 A;  1LHD H;  1ELF A;  2FS8 A;  5FPY A;  4ZMA H;  3QWC H;  4B75 A;  2PUX B;  4XBD A;  5B6L A;  2UUK B;  1Q3X A;  1SQR A;  1QFK H;  3F1S B;  4O3T A;  3PYH A;  4Q7Z A;  1TRM A;  1LVO A;  4B73 A;  5A0B A;  4WH6 A;  1O2R A;  1SGD E;  2G00 A;  1EST A;  3FP6 E;  2PP6 A;  1C4Y 2;  3OX7 U;  4QT8 C;  1FDP A;  3O8R A;  3BG4 C;  3PM3 A;  4TPY A;  1P2O A;  1NRR H;  2ALV A;  3DCL A;  1O35 A;  2W7S A;  1ELE E;  2C4F H;  4NG9 H;  3GCN A;  5GWZ A;  1L2E A;  2FOA A;  4FVD A;  1F7Z A;  4GCH F;  1HRT H;  1TGB A;  3C27 B;  3C1K A;  2BY8 X;  4GSO A;  1WYK A;  4DT4 A;  4CRC A;  2A7H A;  3A7X A;  2ZDM A;  1Z7K A;  3T28 A;  1SGY E;  4TSF D;  5CMX H;  1O3D A;  1AD8 H;  1JWT A;  4X1R U;  1LPK B;  2WV4 A;  1NO9 H;  2YOL A;  1LCY A;  1OOK B;  3ENS B;  2QXH A;  4XBB A;  2IOT A;  4CBO A;  1NES E;  1OWE A;  2YMS D;  1LTO A;  1TE0 A;  4YTA A;  3SV9 A;  1C5O H;  2AGE X;  1K9O E;  1YYY 1;  4KTC A;  1EOL A;  4X8V H;  2IJO B;  5A0A E;  1K22 H;  1NS3 A;  2EST E;  2W26 A;  1J17 T;  4MNW A;  3N7D A;  2C8Z B;  1A4W H;  5IYT A;  4B2A A;  4OS6 A;  2VH6 A;  3F9G A;  1EJM A;  1O3P B;  4IC5 A;  3HGP A;  2FOG A;  3KCG H;  2BZ6 H;  2XC4 A;  4Y79 A;  2HWL B;  4AGJ A;  1FPC H;  3UOU A;  4D9Q A;  2H9H A;  1VIT F;  2BLO A;  2GCT C;  4INK A;  4NIV A;  4IN1 A;  3TGJ E;  4WH8 A;  3P17 H;  4X2Y A;  1Z6E A;  2W3K A;  1H4W A;  3SU1 A;  1D3Q B;  1UK4 A;  1Z8R A;  1Y3Y A;  3A7Y A;  1QB6 A;  1ETS H;  4TT3 D;  1UVS H;  3NZI A;  1DX5 M;  4X6O A;  3SV8 A;  3TH2 H;  1INC A;  1DE7 H;  4ZKS U;  1BHX F;  1PPH E;  1JRS A;  1DDJ A;  3SBK A;  2WHX A;  9LPR A;  1G3C A;  1OSS A;  1TBQ H;  2ODP A;  2P3U B;  2ZF0 H;  3LPR A;  3LOX A;  3TH3 H;  4CR9 A;  1SC8 U;  1WDI A;  3MWI U;  2ZFP H;  3TU7 H;  2HPQ H;  4CRG A;  2VIQ A;  3LDX H;  3EE7 A;  3HK6 B;  2F3C E;  3SQE E;  3Q3Y A;  2SGF E;  2GCH F;  2J34 A;  2R2W U;  3ITI A;  2LNC A;  1O2H A;  1Y3W A;  5JBA S;  3S7H B;  1KTS B;  1DWC H;  1ELT A;  3RU4 T;  3TNT A;  1XM1 A;  3VB4 A;  1DVA H;  4BXW A;  3RXC A;  2ZFQ H;  1GBT A;  2BXU H;  3SND A;  4GLY A;  1RIW C;  1MQ5 A;  2QE7 D;  3VGC B;  1KDQ B;  1V2T T;  1NBM E;  1UJ1 A;  1MBM A;  2BMG B;  5DO4 H;  1SGP E;  3UNS A;  3ZZ8 A;  1TGC A;  1T31 A;  2CMY A;  5AFY H;  2ZPR A;  2KZ4 A;  1F2S E;  3MO6 A;  5FCK A;  2J92 A;  1KLI H;  1T8M A;  2G8T A;  2CK3 D;  4IBL H;  3SU6 A;  1LHG H;  4BXS A;  1VKY A;  4ISO A;  4JK5 A;  2ZEB A;  2NU0 E;  4LZ4 B;  2SGD E;  2QXI A;  1GBA A;  4JZD H;  1T8L A;  4XRN A;  1MZA A;  2UWO A;  1E1Q D;  3F9H A;  3LJJ A;  3PRB A;  2JH0 D;  1ZTJ A;  1EP5 A;  1W13 U;  1CBW B;  1K1J A;  2FI3 E;  1KDQ A;  4HFP B;  1TRN A;  2F9B H;  1S84 A;  2FYQ A;  1V2S T;  2WZQ A;  1C1N A;  4K8B A;  1H9H E;  3TGK E;  3BG4 B;  3EAJ A;  1YLN A;  5CHA B;  2BDB A;  4MNV A;  4X6P A;  4X8S H;  3TVJ B;  2P94 A;  2H9T H;  3SU0 A;  2XBV A;  5DP4 A;  2NU1 E;  3RXF A;  5HKK D;  2BD5 A;  2SNW A;  5A09 A;  9EST A;  2WV9 A;  2A0Q B;  2KAI B;  3BTT E;  2CF8 H;  1S6F A;  2FX4 A;  1FLE E;  1VJ9 U;  2AMD A;  4MTB A;  4X1N U;  1GBB A;  2BHG A;  1YPG H;  3UWI A;  3RMM H;  4AYV B;  3UFA A;  1SGN E;  3RXQ A;  1AE5 A;  1EXF A;  1O2T A;  3SUD A;  6GCH F;  3HK3 B;  2QXJ A;  2GZ8 A;  1TBR H;  2FMJ A;  1HYL A;  3MNB A;  5C94 A;  1LKA A;  2F9V A;  3NKK A;  3N99 A;  3RXM A;  3MYW A;  4MLF B;  2Y82 A;  1S85 A;  3UWJ H;  2O8T A;  5E0J A;  2EY4 C;  2XW9 A;  1QHR B;  3TNS A;  3RXG A;  1DLK B;  1OWJ A;  2BB4 A;  3KHV A;  4AGK A;  4JK6 A;  1P11 E;  5DK1 A;  3IWM A;  2JJ1 D;  4H6S B;  2TPI Z;  3ZV8 A;  1QB1 A;  1UTQ A;  4Z0K A;  3FAN A;  1IQI A;  1BTW A;  1BB0 B;  1JIM A;  1P2I A;  3ZZ5 A;  2UUF B;  1AN1 E;  4MPX A;  3UNR A;  1LVY A;  3NCL A;  4IMQ A;  5J4S A;  3K6Y A;  2FS9 A;  1C5U A;  3A80 A;  4BAK B;  3EYD A;  4YLU A;  1OWI A;  3E91 A;  1ZLR A;  4NIX A;  1G36 A;  1P9U A;  4X2W A;  2OK5 A;  1J16 A;  1AI8 H;  4JYU H;  2F9P A;  2A2X H;  2XWB I;  2DE8 A;  1GGD B;  2Z9L A;  1TNG A;  2SGQ E;  4CRE A;  1C1W H;  2BYA X;  2A7C A;  2V3H H;  5JBC S;  3RLW H;  1HUT H;  1FMG A;  1DXW A;  1CHG A;  1MTU A;  5EPN A;  2WIN I;  3RXE A;  3PV4 A;  2A5A A;  4OS4 A;  2V7Q D;  4INL A;  3RM0 H;  2TGD A;  3S69 A;  3PMH B;  1A0J A;  2ODY B;  3TGI E;  1SGQ E;  4K1E A;  2BTC E;  1GI2 A;  1THS H;  1ARB A;  1HJ9 A;  1IHT H;  4ZRO A;  2PTC E;  1P10 A;  1E79 D;  2RCE A;  2FXR A;  4JZF H;  3L3T A;  2BQ6 B;  2SFA A;  3A82 A;  2W6I D;  1EAX A;  3A8B A;  1ZTK A;  5GIB A;  3M3V A;  2AH4 X;  1G2M A;  3E1X B;  4YXW D;  1P2M A;  3OEH D;  1H8D H;  4I86 A;  5H4I B;  4NCY A;  1C4V 2;  3UUZ A;  3PWC A;  1WSS H;  3QZQ A;  2G55 A;  4FUH A;  2J95 A;  1PPB H;  3QK1 A;  3S9B A;  1UCY H;  1YPJ H;  5J4Q A;  3MH5 A;  2FOF A;  1P2Q A;  5EOK A;  1PQA A;  1QY6 A;  2W3I A;  2ZI2 H;  3BTD E;  1SL3 A;  5A8Z A;  3SUE A;  3ZIA D;  3B23 B;  1NFU A;  1K1I A;  1GDQ A;  2GDD A;  4RSP A;  4UEH H;  2CN0 H;  3SGQ E;  3P92 A;  1QQ4 A;  2KCO A;  4JZI A;  1NM6 A;  4AN7 A;  2PGQ B;  2FOH A;  3PLK A;  1MTN B;  1P05 A;  2TGT A;  4X1S U;  2JDI D;  3GCH C;  2JKH A;  1S83 A;  3A7Z A;  4AG1 A;  2WPH S;  1O2L A;  1K2I 1;  3GY5 A;  2BDC A;  3LC3 A;  4KTU A;  1T8O A;  2VVC A;  4Y11 E;  3Q00 A;  1H9L B;  4I8J A;  1O38 A;  3QTV H;  3KNX A;  3RMN H;  1IAU A;  2PKA B;  1D3P B;  3URE A;  1Y5B T;  4NIY A;  1A0L A;  3RM2 H;  1AB9 B;  1UVP A;  2A1D B;  1SLX B;  5K0H A;  1EB2 A;  1GBC A;  2ZTY A;  1C2D A;  5HIZ A;  3SU5 A;  2FI5 E;  3KQD A;  4DJZ B;  1QBV H;  2F4L A;  1KIG H;  2GT7 A;  5HYO A;  1G9I E;  1ZGI A;  3VB5 A;  4NA9 H;  2BDA A;  1NRP H;  3MU4 A;  3U1I B;  4RT0 A;  1Z1J A;  1XXD A;  3I77 A;  1WBG B;  1SLW B;  4DGJ A;  2V0B A;  1O5G H;  3GDU A;  1GI9 B;  1FON A;  1Q2W A;  1TNH A;  2FDA A;  3AVZ A;  1XUF A;  2SGA A;  2H9E H;  2WPM S;  3U9A H;  3SU2 A;  3P8F A;  2Z9J A;  2WYG A;  1S81 A;  4XFQ A;  1ABJ H;  2A31 A;  4GAW A;  1BTX A;  3M35 A;  3MO3 A;  4XSK U;  3UAI C;  2WSS D;  1C1S A;  1LKB A;  3PRD A;  4NSV A;  1A0H B;  2ZU3 A;  3F0O A;  3OTJ E;  5DG6 A;  1OYT H;  2PSX A;  1H8I H;  3A84 A;  2QF0 A;  1K1M A;  1F5L A;  2BD2 A;  5EQQ A;  1C5Y B;  2FI4 E;  3RXT A;  4AFU A;  1QGF A;  3R0F A;  4B6F A;  2BXT H;  2A2Q H;  4TPI Z;  5ETX A;  4HG6 A;  3V7T A;  2BD9 A;  3AK5 A;  1P2K A;  1QRX A;  1S0R A;  1BJV A;  1KXC A;  4Y8X A;  5CDF E;  3N7O A;  1ZRK A;  2QV1 A;  2BDH A;  3MU0 A;  2OQ5 A;  1QTF A;  4FUJ A;  4BAN B;  1AFQ C;  5HM9 A;  2YNB A;  2P59 A;  3FOA A;  3ZVF A;  1NRQ H;  2F83 A;  2FM2 A;  4BAO B;  2GX4 A;  3KEE A;  3F2F A;  1TWX B;  1ZTL A;  1AE8 H;  2CGA A;  4P00 A;  3F2G A;  1CGI E;  3E90 B;  1PQ5 A;  1P01 A;  4OS1 A;  2TBS A;  1C5N H;  5L30 H;  4BAM B;  1BOQ A;  1UCY K;  1O0D H;  2BQ7 B;  5HXF A;  3BSQ A;  2GMT B;  1F0U A;  2H5C A;  4INH A;  1AVX A;  1L1J A;  3BIU H;  4XDE A;  1C5S A;  1UTP A;  4ZAE A;  4YM9 A;  3URD A;  4I31 A;  4A7I B;  2AGI X;  2FES H;  1K1O A;  1W2K H;  2C3S A;  1TA2 A;  2JET C;  1Z8G A;  1XVM A;  2Y80 A;  1QZ8 A;  1GJC B;  1GBI A;  1XKB C;  3HKI B;  2B0F A;  5EJ1 A;  1C5Q A;  1C1Q A;  1W7X H;  4CH2 B;  1COW D;  1Z8I B;  2VVV A;  3WY8 A;  6GCH G;  1NRS H;  4LZ1 H;  4WMD A;  3DD2 H;  3LON A;  5HM2 A;  1ZGV A;  1QQU A;  2ANY A;  3ZVC A;  4RKO B;  4HI3 A;  1SGF A;  1AND A;  3SU3 A;  4UFD H;  1NRO H;  1GWA A;  1GBM A;  2BOK A;  1GHB G;  5GPI B;  1DXP A;  2AER H;  1O30 A;  1D3D B;  2STA E;  1KXF A;  3SJO A;  3VEQ B;  5F53 A;  2OLG A;  1N8O B;  4AFS A;  1BRB E;  1E0F D;  1TB6 H;  2FIR H;  3OY5 U;  4GHQ A;  3SI4 H;  2OIN A;  3U8R H;  5A0C A;  1YCP H;  3HGN A;  1CE5 A;  2WUC A;  1TLD A;  4A1V A;  1CVW H;  3E0P B;  1UK3 A;  3T25 A;  5FHT A;  1EP6 A;  2IN2 A;  2QIQ A;  3P8G A;  1V3X A;  4Q4L A;  5IDK A;  2ZDK A;  2EQN A;  1GBK A;  1N6X A;  3MH4 A;  3RXI A;  3UTU H;  1HIA A;  3OAA D;  3OU0 A;  1BQY A;  1FAX A;  3KID U;  2VJ1 A;  1GI0 A;  2RFK C;  2QGR A;  2KFW A;  1G30 B;  2F9O A;  2GCH G;  3STI A;  5FPS A;  3E8L A;  1HAP H;  1KXD A;  1GVZ A;  3PV2 A;  4A5T S;  1TIO A;  4VGC C;  1F5K U;  2V3O H;  2J98 A;  2FYR A;  1FY8 E;  3QX5 H;  3ZZB A;  1HPG A;  3G01 A;  1ETT H;  1NU7 B;  1ANC A;  4RKJ B;  1T8N A;  1RD3 B;  5GND A;  2WPI S;  2ULL A;  3FVF B;  2BQW B;  1GHY H;  1GCT B;  1NC6 A;  2FOM B;  4Y6D A;  2A45 B;  3RDZ A;  3P8O A;  1B7X B;  1H9I E;  1SVP A;  3UOP A;  1DWD H;  1O2V A;  3LKW A;  3MI4 A;  1GHX H;  3I78 A;  4H42 U;  4MNX A;  1UVU H;  1NZQ H;  1SOT A;  3F3B A;  4R0I A;  1CSO E;  1DOJ A;  4FU7 A;  5DP6 A;  5FBI A;  3DFJ A;  4U01 A;  3GDS A;  1TNI A;  4NWL A;  2UWL A;  3BEF B;  4NGA H;  3KYG A;  2THF B;  2UUJ B;  3GY2 A;  1YF4 A;  5GXP A;  3V3M A;  3BTQ E;  3M36 A;  4WWY A;  3ODD A;  1QJ7 B;  3PTB A;  2BLQ A;  1EAU A;  4UFE H;  1E1R D;  2EA3 A;  1OP2 A;  2LEL A;  2VIP A;  3URC A;  1HFD A;  3EA8 A;  1ZYO A;  1JIR A;  1IQM A;  2ZHE H;  1ZMJ A;  3ATK A;  3A8C A;  1ZHR A;  2TRM A;  1HAO H;  4OS5 A;  2ZP0 H;  3GDV A;  5EQR A;  3LIW A;  1ZHP A;  1AZ8 A;  1U6Q A;  1K0H A;  3DSO A;  4ISN A;  5GCH F;  5DP8 A;  5JBB S;  4I7Y H;  1UTJ A;  1QJ1 B;  3A87 A;  4NA7 A;  1AFE H;  1C1R A;  2XBW A;  4Y71 A;  1A3E H;  1YPL H;  3ZZ3 A;  3K9X B;  1V2V T;  4FUI A;  1CHO G;  2L74 A;  1NFW A;  4ZXY H;  4CR5 A;  3RXB A;  5K7R A;  3RC4 A;  1O5C B;  3U98 H;  1OHH D;  2CV3 A;  1CT2 E;  4YOI A;  3UQO A;  3HPT B;  1FIZ A;  4NFF A;  5E2O A;  1BRC E;  3OYP A;  1HJA C;  4Y7A A;  1GG6 B;  4ABE A;  2HGT H;  3Q76 A;  2RDE A;  2FLB H;  2V35 A;  1BTH H;  1GJ7 B;  1DUE A;  1FY1 A;  2H5D A;  4YZU A;  4WVP E;  1S0Q A;  1O37 A;  1Q31 A;  1VGC B;  1BBR H;  2Y6T A;  3QUM P;  5JPM H;  1TPO A;  4Q7Y A;  4SGB E;  1UCY E;  3CNR A;  5KED A;  2P8O B;  2W5E A;  2LPR A;  1D4P B;  1YCP M;  3GIC B;  1TNL A;  3D65 E;  2HNT F;  1Y59 T;  1C5X B;  3SJ8 A;  1MH0 A;  3ODF A;  1LVM A;  1SQO A;  1O5A B;  3PMJ A;  3T62 A;  1MKX H;  2GTB A;  4GPG A;  1DFP A;  3GY3 A;  4BTI B;  1EB1 H;  1B0E A;  1CQQ A;  1A5G H;  2H1U A;  4GHT A;  1FIW A;  1K1N A;  3KQB A;  6EST A;  1FZZ A;  3RXA A;  2OC0 A;  1NTP A;  4ABB A;  2SNV A;  1H1B A;  1LQE A;  2OC8 A;  4MDS A;  3ATL A;  1HXE H;  1YY3 A;  2J94 A;  4FU8 A;  3EA7 A;  3KGP A;  2BX4 A;  1BJU A;  1AKS B;  2G4T A;  2RA0 A;  1K1P A;  3ATW A;  3RXL A;  3RXU A;  1V2O T;  2ZC9 H;  4M7G A;  3RMO H;  3F9F A;  2GV7 A;  2PKS C;  1HXF H;  1C2I A;  3A8A A;  1HLT H;  1EX3 A;  1V2P T;  3H09 A;  1HBT H;  4RT1 A;  2OCV B;  1OX1 A;  4X2X A;  1A46 H;  2QCY A;  1MTS A;  2A5K A;  2G4U A;  2O8W A;  1BTP A;  4KEL A;  1AFQ B;  3RLY H;  3P6Z B;  4ZCN A;  1WTG H;  6CHA C;  3GS9 A;  1EOJ A;  2RG3 A;  3KN2 A;  3LC5 A;  3DFL A;  2PW8 H;  3PB1 E;  5JB9 S;  3ZZ7 A;  1O33 A;  2VNT A;  1OKX A;  1HB0 B;  1RTL A;  2B9L A;  1GJB B;  1K1L A;  3DA9 B;  1BMA A;  1BDA A;  1M9U A;  1LQD B;  3RXO A;  4X2V A;  4OGX A;  4P02 A;  1HAV B;  4JYV H;  1GMD G;  3A86 A;  1IQG A;  3A88 A;  2BD3 A;  1ZPB A;  2GZ7 A;  2VIV A;  2GCT B;  4BTU B;  3ZVE A;  4I8L A;  5C5N A;  4DIH H;  8LPR A;  1XUH A;  1BUI A;  1T4U H;  1YKT A;  2XXL A;  1P9S A;  1TX8 A;  2I6Q A;  1YPH C;  1D6W A;  1UTO A;  1F0T A;  1V2U T;  1C1U H;  3A7W A;  4DT7 B;  2B8O H;  1P12 E;  3NUM A;  1FAK H;  1OS8 A;  2QF5 A;  4I8H A;  4IS5 A;  4F48 B;  3LU9 B;  1Z1I A;  2J9N A;  1NRN H;  1C9P A;  3BEI B;  3CEN A;  4X0W U;  2GDE H;  4DCD A;  1GJ8 B;  1V2W T;  4D7G A;  2WUB A;  1H8H D;  4X8T H;  3H5C B;  1VGC C;  1CHO F;  3BEU A;  2IPH A;  2D26 C;  1LVB A;  4IN2 A;  4BOH A;  8GCH G;  1W12 U;  1UHB A;  1LDT T;  1WU1 A;  2TIO A;  2OBQ A;  1ANB A;  4CHA B;  1ZR0 A;  3P8N A;  5E8E H;  1FN6 A;  1HAH H;  1C9T A;  1OXG A;  1TNJ A;  1P06 A;  2AMQ A;  2C8Y B;  4WXI A;  1ELV A;  3TIT A;  2ZTX A;  5DPA A;  4U30 A;  6CHA B;  2W6J D;  1GL0 E;  3F0P A;  3MQK C;  2AYW A;  4ABG A;  2ZZU H;  2XYA A;  1A7S A;  3ZZ6 A;  3MFJ A;  3BTE E;  3RXR A;  1GBF A;  2BOH B;  1Y8T A;  5JDU B;  4UFF H;  5EXM A;  1L1G A;  2HAL A;  1ZMN A;  4UDW H;  4KTS A;  3BV9 B;  5ABW A;  2F91 A;  2GD4 B;  1SGC A;  5E2P A;  5EOD A;  4UON A;  1HAG E;  3DHK H;  3R3G B;  5EJZ A;  1EJA A;  1J15 A;  2J4I A;  4J2Y B;  2ZFT A;  2FLR H;  1C1T A;  1O3N A;  3MH7 A;  5F03 A;  2OC7 A;  4I8K A; 
#chains in the Genus database with same CATH homology
 3O8C A;  4FET A;  1E1Q D;  2YMS C;  3PRB A;  5EQR A;  3VG8 A;  4B76 A;  4KTC A;  1W3C A;  1E79 D;  2GVF A;  1N1L A;  2IJO B;  3DSO A;  3FO8 D;  5F53 A;  1RTL A;  3WW7 A;  1NS3 A;  2WZQ A;  2WSS D;  2KCY A;  2W6I D;  1H8E D;  3N7D A;  4K8B A;  3M5O A;  2JIZ D;  3PRD A;  1BT7 A;  2OIN A;  3F0O A;  5C17 A;  4A1X A;  4WF8 A;  3M5M A;  3RC5 A;  2HLD D;  4NWK A;  4YXW D;  1W0K D;  3OEH D;  5EQQ A;  3SU0 A;  3RC4 A;  1MAB B;  5H4I B;  5HKK D;  1OHH D;  4A1V A;  2WV9 A;  4B6F A;  4I33 A;  2XOK D;  4B6E A;  3OYP A;  2K1Q A;  4TYD A;  2JJ2 D;  5ETX A;  3PV5 A;  3DSP A;  3N7E A;  2M2A A;  3AK5 A;  2KCP A;  5C0T A;  4Q4L A;  2F9U A;  5IDK A;  4WH8 A;  3FN8 A;  3FKS D;  5CDF E;  3SUD A;  3OE7 D;  2A4R A;  2YMS B;  5DN6 D;  5CHB A;  3SU1 A;  1DY8 A;  1DY9 A;  2QV1 A;  2XCN A;  1W0J D;  3OAA D;  4Q63 A;  3SUE A;  3ZIA D;  3SV6 A;  2XNI A;  2F9V A;  4TT3 D;  3OEE D;  2QF5 A;  1NBM D;  3N99 A;  2KFW A;  2K8I A;  2P59 A;  3L6P A;  3NRL A;  4B71 A;  2IJD 1;  3FOA A;  1CU1 A;  3O8D A;  3SV8 A;  2FM2 A;  2F43 B;  1S6L A;  2KCO A;  5FPS A;  2OBO A;  2A4G A;  3KF2 A;  1H8H D;  3KEE A;  3M5N A;  3F2F A;  2A4Q A;  5FPY A;  2WHX A;  3U1J B;  4A1T A;  3PV2 A;  4B75 A;  3RC6 A;  3F2G A;  3LOX A;  2FP7 B;  5B6L A;  3E90 B;  5FPT A;  2JJ1 D;  4R8T B;  2JDI D;  3M5L A;  2OBQ A;  1FX0 B;  4M9F A;  2KCA A;  4B73 A;  4ASU D;  4XD7 D;  1JXP A;  4WH6 A;  3P8N A;  1A1R A;  2QF4 A;  5T1V A;  3UB0 A;  2L6O A;  4OM9 A;  3WWB A;  5GND A;  4RI0 A;  3SYJ A;  2GGV B;  3O8R A;  2FOM B;  3KNX A;  2KM0 A;  3P8O A;  2WPD D;  2AHM E;  3DCL A;  4I31 A;  2W6J D;  2K0Q A;  3F0P A;  4Z1M D;  2OC0 A;  3EYD A;  3WWF A;  1WXR A;  2KR7 A;  3LKW A;  1SKY E;  2XCF A;  3SZE A;  4JMY A;  1EFR D;  2OC8 A;  2OK5 A;  5DSF A;  4A92 A;  3F3B A;  5GJ4 B;  3SUF A;  1KMH B;  3SUG A;  4U01 A;  3SU5 A;  2VBC A;  2QE7 D;  4NWL A;  1NBM E;  5EQS A;  2F4L A;  4DT4 A;  3SV7 A;  1COW D;  3OFN D;  4F55 A;  5FL7 D;  5ESB A;  3H09 A;  2J5U A;  2KZ4 A;  5IK2 D;  3LON A;  4TSF D;  3W1E A;  1DXW A;  3U1I B;  1RGQ A;  3OTP A;  3F2H A;  5EPN A;  2O8M A;  2OC1 A;  5C0U A;  2V7Q D;  1E1R D;  2YOL A;  2CK3 D;  2LEL A;  5EPY A;  3SU6 A;  1BMF D;  2XND D;  3SU3 A;  2YMS D;  4ZCN A;  4B74 A;  2OC7 A;  5GPI B;  1DXP A;  3GS9 A;  3O8B A;  3SV9 A;  3KN2 A;  3SU2 A;  3SU4 A;  4I32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...