2K0QA

Solution structure of copk, a periplasmic protein involved in copper resistance in cupriavidus metallidurans ch34
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
74
structure length
74
Chain Sequence
VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEALRKGHSEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein copK
publication title Molecular structure and metal-binding properties of the periplasmic CopK protein expressed in Cupriavidus metallidurans CH34 during copper challenge.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Metal binding protein
total genus 16
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2008-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2k0qA00
2LELA 3N7EA 2KM0A 3DSOA 3N7DA 2K0QA 3DSPA
chains in the Genus database with same CATH superfamily
1PPCE 1YPGH 2BM2A 1O2RA 1HJAC 1GDQA 3RXKA 3NXPA 3A8BA 1IQMA 3GOVB 1AGJA 2IPHA 2Y6TA 5JB9S 3LGIA 2XYAA 1EATA 4B6FA 1F7ZA 2G5VA 2UWLA 2ANWA 3BTKE 1EOLA 1QJ7B 4Y0YE 3LC5A 1G30B 1GCDA 1P9UA 4UDWH 1KTTB 1NY22 2ZI2H 2BD3A 2O8TA 2ALVA 1MQ5A 2A32A 2IOTA 1SGTA 3SI3H 3UB0A 4FUIA 1ELDE 4E7NA 1BRAA 4CH2B 1EB1H 3RXTA 4NZLA 2P16A 4AZ2B 1YGCH 1UHBA 1C5QA 3HGPA 5C5NA 5LPFA 1F92A 1O2QA 2WUBA 4CRFA 2LP6A 2AYWA 1XUIA 4CRAA 1AI8H 1DXWA 3SHAH 1O2TA 1SOTA 4Q63A 1YYY1 4AFZA 2PP6A 2Z6BD 2AGGX 1V2KT 2C8WB 3I78A 3SGQE 2GZ9A 3NPSA 2G81E 2BOHB 3M5LA 3V7TA 4DT7B 1S82A 3S7HB 4LK4A 1W8BH 2VVCA 2K1QA 1DUAA 1NRNH 1T4UH 8ESTE 5GCHG 2ZGHA 2H2ZA 1CBWC 1DFPA 1GHYH 2EA3A 4XE4A 2VJ1A 1P2MA 2FDAA 4DIHH 2R3UA 1IQLA 4WH8A 2ZU3A 2R2WU 4AORA 1K1IA 2OQ5A 2FM2A 1ZPCA 3KYGA 1WCZA 3N99A 1V2QT 3SV9A 1YF4A 1NFXA 1XX9A 2GP9B 1C5UA 1BBRH 2BD9A 2ZTXA 1CA0C 1KLIH 5K7RA 3GYMA 1G9IE 3UOPA 1LVYA 1GL0E 2FMJA 4JZFH 5BRRE 1TNJA 3M35A 1TX8A 4NIYA 3UY9A 3STJA 2OP9A 3SU2A 2RG3A 5GJ4B 5LGOA 4FVBA 2Z9IA 2XCFA 1LHEH 2FXRA 1N1LA 2DUCA 1IQIA 1NO9H 3BTTE 3ZZBA 1TPSA 2VGCB 1V2TT 2XRCA 1MTUA 1PYTD 1S0RA 3A8CA 1DE7H 1G3CA 3MYWA 1NM6A 1SSXA 2FOHA 2JJ1D 4ABGA 1DM4B 3R0FA 1H9IE 2ODYB 5C5OA 4I33A 3UAIC 5CDFE 1JWTA 1OS8A 2Q6GA 8GCHF 4NCYA 1MABB 5EIYA 1AQ7A 3TITA 5JYIA 2BY9X 4IMQA 4ABDA 1EAIA 4X6NA 1GBHA 1PPBH 3VEQB 5CMXH 1S5SA 1SQAA 3UR6A 4FUEA 4HTCH 3VB5A 3SGAE 2UWPA 5DGJA 1DXPA 3M5OA 2GD4B 3ZVFA 5GXPA 1PPEE 3S69A 2EQNA 5EJLA 1T8MA 2VIPA 2P3UB 5J4QA 1E35B 1EJAA 1N6YA 3ATIA 4DGJA 1D3TB 7GCHG 3TK6A 1WYKA 1NTPA 3MI4A 5FX5A 3A83A 3A87A 1E36B 3MH5A 1QB9A 4RKJB 3RMNH 4KKDA 3D49H 3O8CA 1GI1A 1LHCH 4K5ZA 1Y3UA 1EP6A 4I8LA 4DURA 3U28C 1BJVA 4A92A 1P57B 1TMTH 2TGPZ 3ZZ5A 8LPRA 1ZOMA 2FESH 2VINA 3G01A 2VVVA 3SORA 2FOFA 3MNXA 4IC6A 5F53A 3K6ZA 4ZROA 1XM1A 3OYPA 1S6HA 3T5FH 1B7XB 4Q7YA 1W3CA 1W0YH 3ZZ6A 1W2KH 3HKJB 3L6PA 5F8ZA 1T31A 3ODFA 1B0FA 3TGIE 1TA6A 2BD5A 1TA2A 8KME2 4RSPA 4X1PU 1GG6B 2HOBA 5EJZA 3PTBA 2O9QA 3SV6A 1MTWA 3FP6E 3PMHB 1G2MA 1GI9B 4I8HA 1CSOE 4GAWA 1KTSB 2W7SA 2A4QA 3BTFE 3U69H 2W6JD 1GCTB 3P92A 1ZMLA 3EE0B 3K65B 1G36A 1E79D 1GJ6A 3M3SA 3LPRA 2ZGBH 1O2HA 2OBOA 1A4WH 1BHXF 5C94A 2KAIA 4J1YA 2G8TA 3TK5A 3UWIA 1AZZA 3CNRA 1DDJA 2CK3D 1XUJA 3OEED 4R8TB 4HFPB 1CT0E 1K28D 1C1SA 2A0QB 5ABWA 1A3EH 2ODQA 1YWUA 1O32A 3F9GA 4M9FA 1RD3B 1FZZA 2BQ7B 1E38B 1T4VH 2WV5A 1ELEE 1PPZA 3N7DA 3TJUA 3DUXH 4FUFA 4O3TA 1C2GA 3OE7D 1K1NA 1FJSA 2J38A 2GV6A 3OAAD 3F9FA 1HIAA 2AIPA 3QO6A 3M5MA 4K1SA 2IJOB 1C2IA 3KCGH 4X1NU 1O33A 2QXGA 1GBCA 2PKSB 2BQWB 1KXBA 5E0JA 4IC5A 2FS9A 1C5SA 1XVMA 5C0TA 4LZ1H 3BG4C 1C2FA 1CHOG 4TPIZ 3PMAB 2G52A 2W7UA 1OX1A 2ZFPH 4IMZA 4AX9H 1O2ZA 1DICA 2H6MA 3PV4A 2EI7A 1CT4E 4AN7A 1BJUA 3AK5A 1V2MT 2OTVA 1IHTH 3SU6A 2SGAA 1GJ8B 3RLWH 3KQEA 5EXMA 5EU8A 1HAVA 3QDZB 2J95A 1Q3XA 3MTYA 1C2JA 3FKSD 1UK2A 3RU4E 2W26A 1MAXA 2BYAX 1IQGA 1TBRH 5FCRA 1TWXB 1TRYA 3RC6A 1RRKA 3ZV9A 1W0ZU 1MKWH 4TYDA 2BDGA 4BAOB 3QTVH 1YPEH 1ACBE 1S6FA 2KCAA 4GPGA 4INHA 2J2UA 1G3EA 1KXCA 1MBQA 1F5KU 2FI4E 3OX7U 1XUFA 5CHAB 5E0GA 3A84A 4NA8A 2QYIA 3MU0A 1ZGIA 1VITH 1OYTH 2YNBA 1BTYA 3L3TA 3BTHE 1D6WA 3M3TA 1J8AA 1IQEA 3A7WA 4INLA 2V0BA 4MPXA 1Z8RA 2ZPRA 3P8GA 1RIWB 3GYLB 3ZIAD 1SGIB 2QC2A 3M7UA 4O03A 4ZH8A 3SBKA 1W14U 4X1SU 3GDUA 1YLCA 1RXPA 5DO4H 1O2YA 4Y8XA 4ZMAH 2TRMA 3E90B 1E1QD 1U6QA 2G00A 2FTMA 1O2LA 1SGFA 1ZR0A 1AMHA 2FI5E 2ZFSA 3RUOA 4B2CA 1P02A 1SLXB 4UFFH 2ZCLP 1OOKB 2WPMS 4HGCA 1BDAA 3QX5H 3MNSA 3T2NA 4WH6A 1L1JA 2HLCA 4Y71A 2QXJA 3RXVA 2BXUH 1C5MD 1V2OT 2OC0A 2HPPH 1MTSA 5L2YH 1ZHPA 1SGCA 5FBEA 3M36A 4AYVB 5GIBA 1A0HB 4DY7B 1TGCA 3ZZ4A 1BZXE 1Z1JA 1GMDF 1MBMA 1V2UT 1QRWA 1ZYOA 2ZPSA 4NFEA 4X2XA 5EPYA 4AG1A 1O5BB 3KN2A 1C2MA 1L4ZA 3RC4A 3GDSA 3K6YA 2A5AA 2RDLA 2DE9A 1DY8A 4X6OA 4ZCNA 5JDUB 3HK3B 1PPGE 2NU1E 4Y79A 1O3MA 2CHAC 1EPTA 2ZZUH 4F4OC 4GVUA 4Z0KA 3ZZAA 4KELA 2QIQA 3SOSA 2J98B 3P6ZB 1OHHD 5C17A 1AFEH 4IGDA 1EOJA 4Q4LA 2ZDAH 1SPJA 5ESTE 4XBCA 2ULLA 3DT0H 1TRMA 1ARBA 1LHFH 1SQTA 3KIDU 3TK9A 1QGFA 1C2LA 2Y80A 1BMAA 1OWIA 1ZTKA 6ESTA 1TX7A 1TPOA 4XOJA 2P94A 1GGDC 1CHOF 2RA0A 3MU1A 1DS2E 3BIVH 3V13A 2Z9GA 1W10U 4FUGA 1DLEA 5FXLA 3GCNA 1GHXH 5T6DA 4Z6AH 5A8XA 3BEUA 3E91A 3GY8A 4ACBA 1MUEB 2OC7A 2XNDD 4X0WU 1AY6H 3S7KB 1GBFA 4Q80A 3TNTA 3A7VA 1C2DA 2VH6A 3A86A 5AVDA 3A8DA 1TRNA 1TAWA 4P00A 1LHDH 2XWAA 1LPZB 4MLFB 2ZDVH 3O8BA 1Z7KA 1SKYE 3DSOA 5HIZA 1AB9B 5FL7D 2Q6FA 4YO9A 2CHAB 1IOEA 4XDEA 4WXVA 4I31A 1BA8B 1ZSKA 1Y5BT 3CS0A 1K0HA 1SI5H 1PQ5A 1CT2E 2ANMH 2GT8A 2Z3DA 1C1QA 3OY6U 3F3BA 2GTBA 4UONA 1CGJE 2C4FH 2JETC 3PYHA 5E2OA 2ZA5A 5A0BA 3VXFH 1P2KA 4X2YA 2FWWA 5DPAA 2BLQA 3SYJA 5HXFA 3OTJE 4O3UA 4MPUA 5L30H 3HATH 3F9HA 1NT1A 3QN7A 1QJ1B 1H4WA 2GT7A 1TMBH 1PFXC 1SL3A 4NGAH 3MU4A 1ANDA 2FOCA 2R3YA 4JZEH 1ORFA 2XC4A 1G2LA 4SGAE 1SC8U 1TGSZ 2XCNA 2FS8A 2AHME 2B7DH 1V2JT 3MWIU 3UPEA 3AW0A 5A0CA 1D3DB 4FUHA 1LPKB 1ELAA 4DOQA 4X8VH 2H1UA 2YMSC 2YMSD 3HKIB 1QA0A 4OM9A 2LNCA 2GJGA 2ZKSA 3LGWA 1LDTT 1GHVH 1P12E 2FOMB 1TQ0B 4D9QA 1P04A 4ZKRU 2ZQ2A 4THNH 5FPYA 2ASUB 1UK4A 3O8RA 2WYJA 4X2VA 3M5NA 1GJ5H 4XSKU 3I29A 2BOKA 5EXLA 3ZVEA 2V3OH 3MNBA 1XXDA 4BXWA 1MQ6A 2ZFFH 3EQ0H 4FXGH 1TNLA 2TGDA 3LH3A 1C1WH 4NIXA 4I8KA 4XBDA 3ATMA 5HGGA 4NSYA 1DWCH 1Y3WA 1PQAA 2KZ4A 3DA9B 4GSOA 2A4OA 1SFIA 1ABIH 3FP8E 2SNVA 3TJVA 2VWOA 1VKYA 3ZVAA 3BG8A 4GUXA 4ISIH 1NC6A 4GLYA 4YXWD 5FCKA 5EODA 2FOEA 5C1UA 1A5IA 1KXFA 4KTSA 4DIIH 1GI3A 4P02A 3LKWA 3EE7A 4RT1A 1T8LA 2F83A 4OGYA 1GJ9B 5AHGH 1O2NA 4TWWA 3RLYH 1A7SA 2G5NA 3EYDA 1TALA 5C3NA 3ATWA 5A8ZA 4CHAB 4BNRA 3C1KA 3M7QA 4B6EA 1BRCE 1A0LA 1J17T 2GMTB 3AAVA 4MG3A 2ZPQA 1O2XA 5DJ7A 4X6MA 2K8IA 4CRBA 1TX6A 3F0PA 1MU6B 2AIQA 1Y59T 1D6RA 1RTFB 3U9AH 2P95A 3GY2A 3SZEA 1S6LA 4AOQA 3PTNA 1FN6A 4KTUA 1TNKA 1W7XH 5AFYH 5HM9A 4X8SH 1P9SA 3ZZ9A 5DP8A 3F68H 3W95A 1G37A 1MU8B 1P11E 5GPIB 1FI8A 4Y7BA 4CR9A 1OWEA 1AE8H 2OC8A 2OXSA 1HUTH 1ZRBA 4TT3D 2AFQB 3ITIA 4WJG2 3FAOA 1P2QA 4M7GA 1A0JA 1XXFA 1ZHRA 1HFDA 2ZGXH 2FI3E 2QGRA 1WTHD 5CHBA 4RI0A 4BTTB 3HK6B 2Z7FE 2BY7X 4X8TH 1ZMNA 1SB1H 1BBRK 2ZTZA 4AGJA 1HPGA 3MNCA 1XKAC 3FZDA 1HJAB 2VNTA 3A81A 1SMFE 4X6PA 3RXPA 4ISOA 1O2VA 5DP9A 4UFEH 1JBUH 2BD7A 2PV9B 3K2UA 2W5EA 4ABJA 1FV9A 5JBBS 1FX0B 2OD3B 2BHGA 3SJ9A 3WWFA 1O3JA 1OWHA 3RM2H 3GDVA 3BF6H 3QZQA 1OP8A 2JKHA 1QBVH 1VCWA 1BOQA 5L6NH 1O2WA 5B6OA 4NA7A 1MTNC 3Q3YA 1KXDA 1L0ZA 4IBLH 3RXGA 1Z6EA 2D8WA 1CVWH 1TLDA 1KYNA 4JYVH 1MH0A 2CGAA 5IDKA 2AGIX 1DVAH 2D1JA 1VR1H 3EA9A 4UEHH 2CXVA 5I25A 1MZDA 1PYTC 5A8YA 1G3DA 2I6QA 2W3KA 2ZIQH 1P09A 1YPJH 1P0SH 3GY6A 1AU8A 2PW8H 2WV9A 3A88A 1F0SA 3GCHC 3LJJA 4FU7A 1P03A 1TNGA 2O8MA 1WTGH 1DWBH 2A7JA 5JBAS 2ZFTA 1FIZA 4ZKNU 2ZP0H 2CMYA 1HCGA 2GV7A 1KXAA 1JXPA 2BDCA 3TVJB 1GI5A 4AC9A 1DITH 2C8XB 1CBWB 1Z71A 1T7CA 3U1JB 4XRNA 3RXFA 1D3PB 1KDQB 2A2XH 2SGPE 3LJOA 4FU8A 1FN8A 2ALPA 1G32B 1Q2WA 4I8GA 2ZGCA 1MZAA 2ZU5A 3AAUA 2EY4C 1LKAA 3UOUA 3BTEE 4UE7H 2TIOA 1F2SE 3Q77A 1N6XA 2GKVE 2XTTB 2ZDLA 3BEIB 4TWYA 1QY6A 1CA0B 3S9BA 1GWAA 2P3FH 2ESTE 1V6DA 2GX4A 4Q7ZA 2O8WA 3TH2H 1PQ7A 3A7XA 1NRQH 2ZGJA 3BTWE 1TMUH 2P3TB 1TOCB 5AF9H 2ZQ1A 2A7HA 3DHKH 3SW2B 1AVWA 5F6MA 1IAUA 1CQQA 1Z8GA 3LIWA 3VG8A 2C8ZB 5DKMA 4TSFD 1V2ST 2BY5X 4DVAU 1L1NA 5T3HA 1JRTA 1EPTC 6CHAC 4K60A 3BTME 2PLXA 1O2SA 2R9PA 1SOZA 3BV9B 2AGEX 5C67A 1KIGH 2Z9KA 1SLUB 4R0IA 1EJMA 3ZVCA 2FIRH 3CENA 1GMCG 2FX6A 1OWJA 3T26A 4U30A 1RFNA 1QQUA 4NWKA 1SFQB 1M9UA 1O0DH 2ZFQH 5EQRA 3U8TH 1ELFA 3SO3A 1S85A 1TB6H 1ESTA 1AUJA 2PUXB 3TGJE 3E16B 1FONA 4NIVA 2PR3A 2VWLA 2O8UA 1K1JA 1P3EA 1HXEH 4Y7AA 3ZZ7A 2WHXA 4O97A 5HMAA 2CV3A 3RXEA 3LONA 1C5PA 1O3KA 5TCCA 3LGYA 3M3VA 5GCHF 1AFQC 3QLPH 1J14A 1K22H 3PO1C 4ISHH 4X1RU 2G51A 4VGCC 3ZVBA 4FOUC 5SGAE 2PUQH 2BDIA 2Z3CA 1AD8H 1UTPA 5DP5A 3U98H 1AHTH 4F55A 1GJDB 2YOLA 5FPTA 1B5GH 1LCYA 1KMHB 4K2YA 4YLUA 1C1RA 2R0LA 2PFEA 4CH8B 1E1RD 1FY5A 5E8EH 3FANA 5KGOA 5A2MH 2FOBA 1GHBG 3S9CA 1ESBA 1GJ4H 1YBWA 1WU1A 2Y5FA 4MQAA 5F8TA 1BUIA 5K0HA 3PLPA 1AWFH 2SGEE 2QA9E 1TBQH 1JMOH 4UFGH 4DW2U 1EASA 1GBIA 4Y11E 3IWMA 3T29A 3M61U 1TE0A 1Z6JH 1V2RT 4MNYA 1QBNA 1X7AC 2AERH 4BAHB 5DSFA 3MU5A 4JZ1A 1TNIA 2F9VA 3SNEA 3FZZA 3WWBA 1C9PA 2WPIS 2ZHDA 1GHZA 1ZZZA 1MKWK 5L2ZH 1QL8A 2HWLB 3GCOA 1XUHA 3PWCA 2FEQH 2OC1A 4FUJA 4X2WA 1TABE 3A7TA 2FP7B 1C5OH 3MH4A 1A61H 2F43B 3A7YA 4AG2A 1UMAH 1HYLA 3RXOA 1F0RA 3WY8A 4ISLA 1OYQA 1YLDA 3P8OA 2XBVA 1BTUA 1H8IH 1TONA 1O3BA 2VH0A 1GBEA 5JPMH 2Z3EA 3KNXA 3KL6A 7GCHF 4H42U 1NFUA 1W0JD 3TU7H 1GHWH 2V3MA 2A31A 3QUMP 4CBNA 1DANH 1HJ8A 1INCA 1YCPK 1N8OC 1AWHB 1J9CH 3PB1E 3T28A 5T6GA 4XD7D 5FPSA 3RXMA 1BMMH 2FLRH 2A2QH 4GHTA 1SGEE 1COWD 2FOAA 1SGDE 3HGNA 5T1VA 3OFND 1ELCA 1C5YB 4OGXA 5DN6D 1C1PA 1O5DH 3BG4B 2EI6A 3BIUH 1NFWA 2KFWA 4OS7A 3T27A 1DUEA 1EKBB 1P05A 1YCPH 1HAIH 1HRTH 1QR3E 3TJOA 2JH0D 1O5GH 2AEIH 2IJD1 1ARCA 4Y6DA 3RXBA 3LGTA 1DSUA 4GHQA 4QT8C 4BTUB 2SGFE 4MPVA 1YPKH 4NIWA 3DFLA 3NK8A 2XBXA 1H1BA 3LU9B 4K69A 1K1PA 4J2YB 3TH3H 1YY3A 1O30A 2W3IA 4FUBA 2FO9A 1T32A 1MCVA 2H9HA 2VBCA 2BY8X 1O3EA 4LXBH 1ETTH 1NN6A 1DPOA 1SGRE 4E7RG 2A5KA 1JIRA 1UJ1A 1VITG 1W0KD 2UWOA 4FVDA 5DP7A 3E8LA 3Q3KA 3MO3A 2M2AA 1QFKH 4D8NA 1KLTA 4I32A 3GY7A 2PHBA 1K1MA 1VGCC 2IPQX 2G55A 1S84A 2HALA 1LPGB 1O2PA 1PPHE 4FUDA 3UQOA 2VB0A 3F0OA 3GCTG 4LOYH 2H5CA 2ZHWH 2SGDE 1L1GA 1GBKA 1P06A 1GHBF 2CN0H 1GJCB 3FP7E 5DP4A 3VB7A 4TY6A 2G4UA 3W94A 2A7CA 1BITA 1O34A 1O3HA 1C1OA 2VIWA 2QN5T 1ELTA 4MDSA 3NCLA 1C1TA 1LQEA 1QBOA 3VGCC 2ODPA 1HAHH 3UFAA 1O5EH 1QRZA 4ZUHA 1SR5C 1GBTA 3NRLA 1C1MA 2WINI 1TIOA 2FZZA 2GZ8A 1O3GA 4BAQB 3A82A 3H5CB 2C3SA 2ZNKH 4OS1A 1XUGA 1C2KA 3NZIA 1UCYE 3P70B 2QF5A 3BN9A 3H09A 1BMLA 4U32A 3MO9A 4K8YA 2AS9A 1HDTH 2FTLE 1HAPH 2C93B 5H4IB 1HB0B 1GMHG 1HXFH 1E0FD 1OXGA 4HZHA 1UVPA 2B0FA 1T8NA 1Z8JB 1K9OE 2PWXA 1C1NA 3PV5A 4BOHA 2ZG0H 1D3QB 2AMPA 1HAOH 1D4PB 1P01A 1FPCH 1MTVA 2BVSH 1ABJH 1K1OA 2J5UA 3LGUA 1FPHH 2Y7ZA 4Y76A 1UHBB 1Y5UT 3SJIA 1ETRH 1GI7B 5DG6A 3UUZA 2XBYA 4LZ4B 2THFB 1SGYE 4WY3A 1C5XB 1YPHE 2ZHQH 3SNCA 4IS5A 2A4GA 1ZPBA 1PJPA 1YP9A 2ZCKP 4Y10E 4BAKB 2Y7XA 1UTKA 2GZ7A 2VWMA 2RFKC 3OTPA 1GL1A 3UNRA 3PLKA 3P95A 4JZIA 3N7OA 1C5ZB 1ZLRA 2OUAA 4ABFA 2B5TB 1KLJH 2RA3A 1GI4A 2L74A 3B8JA 3SN8A 5LPEA 2WPLS 5TCAA 1GGDB 1IQHA 1EXFA 1E37B 1C2HA 4Y8ZA 3RMLH 1ZTJA 4E06H 2WPJS 1IQJA 4RT0A 4F48B 2P8OC 2F9NA 2L6OA 3TH4H 1GBDA 5IK2D 2GCTC 2QF0A 4NSVA 4YESB 1ZRKA 3TJNA 2BDYA 2QV1A 5C1YA 3H7OA 1SVPA 1WQVH 3DFJA 1NRPH 2WSSD 1IQFA 4YOIA 3B23B 1F0TA 4MNWA 1HNEE 2RCEA 4ABAA 3D62A 2A4RA 2PTNA 5DP6A 3E0PB 3U1IB 3F2FA 1O3IA 1BHXB 1UVUH 3QWCH 4ZXYH 3SNBA 1YPHC 1PQ8A 1C5TA 1GBJA 3SU1A 4JK6A 4YM9A 1BCUH 1GPZA 3PLBA 1NZQH 1O2UA 3P8NA 2JETB 4XFQA 4AGKA 2PKAA 2J4IA 1QIXB 1FAKH 3RXQA 4MNXA 1NRSH 2YNAA 5EXNA 1QJ6B 1SLWB 3GCTF 3UNQA 2BLVA 2EI8A 2TBSA 3URDA 1EJNA 1QRXA 1O31A 3TGKE 3EGKH 1VJAU 1ZMJA 1DX5M 1A3BH 1HAYB 3SQHE 3OY5U 2BDHA 1F0UA 3GY3A 1BRBE 4FU9A 3D65E 1TPAE 4CRCA 1L2EA 5KEDA 3R3GB 2F91A 3JZ1B 3RDZA 2GDDA 1JRSA 4YOGA 1P8VC 4DG4A 5FAHA 1K21H 1FY4A 3ZZ3A 1UTNA 1CHGA 2YMSB 1QURH 4IN2A 1JIMA 1SG8B 1VZQH 5EQQA 1SQRA 1UVTH 2VWNA 4U2WA 1EQ9A 4CRDA 5A0AE 3ODDA 3NWUA 2W6ID 4RKOB 1GMHF 1P2NA 1QB1A 2STBE 1P2JA 4IW4E 3ATKA 4A1XA 1BMFD 2CF8H 1AKSA 3EA8A 1NBMD 1W12U 1TQ7B 3SQEE 2V6NA 3UREA 2Q1JA 2EC9H 1QHRB 3BSQA 1ID5H 3FOAA 3RXJA 1QA7A 2I6SA 1O3AA 2ZCHP 2XNIA 4B2BA 1UCYK 3A80A 4FETA 4OS5A 1O3OA 4BXSA 1UTQA 1EUFA 2NU0E 2JDID 2TGTA 1ZHMA 2SFAA 4YLQH 3KQCA 1O2KA 4IN1A 2C90B 3CP7A 1S81A 2VIVA 1O5CB 3SV8A 3NKKA 2J94A 3RU4T 2BZ6H 2PSYA 5FHTA 3T62A 3ENSB 2XBWA 1TOMH 1UCYH 2VGCC 1TPPA 1FIWA 2BX3A 2F9PA 4WMFA 1C4Y2 5JBCS 1VCPA 1F5RA 2KAIB 4I86A 2D26C 3OSYA 1DLKB 1BTPA 3OU0A 2ZECA 2KCYA 1FAXA 1C5LH 3EDXB 3SJOA 1ESAA 1EZXC 2ZEBA 2NWNA 5DK1A 2P93A 1P2OA 1W7GH 2F3CE 4E05H 5GNDA 1MCTA 2ZC9H 1UK3A 2ANKH 1ETSH 3KHVA 3RXSA 4Q7XA 2PGBB 1C2EA 2H5DA 2OK5A 3FVFB 3MMGA 3MOCA 4MPWA 1OWDA 1D9IA 1HIAB 1NROH 1EAXA 1KSNA 1EB2A 4H6TA 2PTCE 1SGPE 3SV7A 1NPMA 4YTAA 3MFJA 2WZQA 3F6UH 4BANB 1EFRD 2XC5A 5C0UA 3Q3XA 1GI0A 1C4V2 1HLTH 5F03A 1CGIE 4A7IB 1ANBA 4AB9A 2BZAA 2WV4A 1NS3A 1C1UH 2HRVA 1AE5A 3A8AA 4Z1MD 2LELA 4FUCA 1BTWA 1HAVB 3K9XB 1Y8TA 2CF9H 3RMOH 2FYRA 3GICB 3RXCA 3SNDA 1YCPM 5HIYA 3BTGE 4AFUA 1MKXK 1K2I1 2BXTH 5EW1H 4UFDH 1Q31A 1YM0A 5IYTA 1THPB 1MD7A 3SI4H 3ELAH 2UUKB 3V0XA 1GJ7B 2AMDA 2WPDD 1TYNA 1FY3A 4ACAA 2ZTYA 4CREA 2OQUA 1AVXA 1ZJDA 4D7GA 1MTNB 1AVGH 3VB3A 2QE7D 2FPZA 1GG6C 1V2LT 3SU0A 3VB4A 4AFQA 3ZVDA 3WW7A 2BD8A 3FO8D 1AUTC 1EAWA 3LH1A 3MH7A 1UTOA 1MKXH 3GS9A 4KTCA 4KGAA 3VFEA 1H8HD 1GI6A 3AW1A 1G3BA 1GJAB 2BDAA 4PROA 1B0EA 2BB4A 3E6PH 4A1TA 1GCTC 2V7QD 3SZNA 3PRBA 1SBWA 4ZHMU 1RJXB 2KM0A 1AIXH 1V2VT 1ZSLA 1MD8A 3UQVA 4I7YH 3Q00A 3GCHB 4UD9H 2V3HH 3SJKA 1UW7A 2QF3A 3UNSA 5C2ZA 3LC3A 1W11U 3MQKC 1FUJA 3SJ8A 1NFYA 1O2JA 4O9VA 4XBBA 1O2MA 1OSSA 2R0KA 2K0QA 1NRRH 1C5VA 1OWKA 2RDEA 3C27B 1QTFA 2BLWA 2UUYA 3V3MA 1BTZA 5EGMA 4D7FA 1RTLA 1HBTH 2WUCA 2ZFRH 1A5HA 1ELGA 2QXHA 1EP5A 4I8JA 4HI3A 1DOJA 3ZZCA 9LPRA 1JOUB 1LQDB 4K3JA 4JK5A 3PV2A 3U8RH 2A45B 1LKBA 1OP2A 1LVOA 2BQ6B 4H6SB 2PKSC 1MMJN 2JH6D 2XC0A 5HM2A 1BMNH 2V35A 2KX4A 2NU2E 3S0NA 3QGJA 2OBQA 5ETXA 3ZZDA 4CR5A 1BT7A 2BLOA 1GBAA 2PSXA 1ELBA 2WYGA 1KXEA 1WV7H 1OKXA 3BTDE 3Q76A 4D76A 3SNAA 4B76A 2Y5GA 1E34B 2F9BH 2AMQA 3UR9A 4JCNA 3IITA 1DSTA 3M7TA 2QY0B 4TY7A 1H8ED 3VPKA 5JB8S 2ZDKA 2VIDA 1Z8IB 2XOKD 2CJIA 3RXIA 1EPTB 1O5AB 2Q6DA 2ZU2A 5FX6A 6CHAB 5BPEA 1GMDG 1FLEE 3DSPA 1CE5A 5JBTA 4AB8A 2GDEH 5T6FA 1C5RA 1VCQA 2SNWA 3LT3A 4WMEA 4B71A 1ANEA 3TLOA 4YOJA 2EEKA 2HNTF 2OLGA 4F49A 3T25A 1GVLA 1GVZA 4JMYA 1GVKB 1GBMA 1O5FH 3QK1A 3GISB 4NZQA 1WXRA 1LO6A 1BRUP 1EZSC 3S9AA 3F2GA 3URCA 5CHAC 2O8LA 2BVRH 2VIQA 5TJXA 5LPRA 3U8OH 4CRGA 4A6LA 2JH5D 4NWLA 1WOFA 4GCHG 1O37A 3GY5A 4ZKSU 2B8OH 1V2NT 1UTJA 2VVUA 4B75A 3P17H 3RM0H 3RXUA 1CA8B 2BVXH 1RIWC 4WVPE 1O3NA 1C5WB 2Z9JA 2SGQE 4K8BA 1PPFE 1DWDH 1AFQB 1FQ3A 3MHWU 4WWYA 1IHSH 4ZAEA 3PO1B 3VXEH 4SGBE 2HPQH 3E3TA 3KQ5A 1O2IA 4VGCB 3OEHD 1LVBA 1J16A 4B73A 1WDIA 2F4LA 1SGNE 2BTCE 2Y5HA 5CE1A 5C1XA 1QL9A 4YT6H 3N7EA 3SGBE 1EAUA 2FODA 4H4FA 1T8OA 3IG6B 4ASUD 3UTUH 1THRH 2ZHFH 3PRDA 1KDQA 3MO6A 3PMJA 6GCHG 2XWBI 5G4BA 3L33A 4OS2A 1SQOA 1YC0A 4JZDH 1A2CH 7KMEH 3ATLA 2ZU1A 3SUGA 1WUNH 2UUFB 2GGVB 2LPRA 1SGFG 2H9TH 3BTQE 4NG9H 1C9TA 5ESBA 1SHHB 3VB6A 1HAGE 2GCHG 5FBIA 1DT2A 3M37A 1A1RA 1GMCF 1AZ8A 2J34A 3ZYDA 4ZKOU 3ZVGA 3KQDA 1FMGA 5C20A 4D9RA 1OPHB 3CS7A 1H9HE 1QL7A 2D2DA 5EG4A 1O3PB 1EX3A 4B1TA 2VIOA 4INKA 1QB6A 3TIUA 3V12A 3SUFA 3AASA 4HG6A 1CU1A 2A1DB 4U01A 3RXAA 2J97A 3FFGA 1TFXA 3I77A 3RU4D 3PM3A 5HKKD 4BAMB 2ZWLH 4DT4A 3A85A 3DD2H 1O3DA 2A5IA 1N8OB 5EQSA 1O3LA 3RC5A 3SUEA 1BB0B 1UTMA 3BEFB 2ILNA 1ANCA 5EJ1A 1C5NH 3B9FH 2TPIZ 1TBZH 1XKBC 5KECA 1O2GH 2PKAB 2HGTH 4DJZB 3RXDA 2ZDMA 1FY1A 2H9EH 5EOKA 3ZV8A 3KQBA 1FNIA 4Y8YA 1S0QA 5EPNA 2DE8A 1GBLA 3RXRA 1V3XA 2WPKS 1BQYA 1O38A 3SU4A 1V2WT 4ABIA 1K1LA 4ESTE 3QTOH 1THSH 1XUKA 4ZHAA 1YLNA 1TGTA 1AB9C 1ZGVA 1RTKA 3GY4A 3HPTB 2UUJB 4RN6A 1A46H 4JYUH 3ZZ8A 1UTLM 1O35A 1HV7A 4MVNA 1XVOA 4K1EA 3KGPA 1BTXA 1P3CA 2HNTE 1YPLH 4MTBA 4Q2KA 4NFFA 2J92A 4GCHF 4Y0ZE 1J15A 2Z94A 2F9UA 3F1SB 2GVFA 1O3FA 2Z9LA 1GHAG 1GI2A 3KYFA 1O2OA 4CBOA 1H9LB 1F5LA 1UVOA 4KP0A 1SHYA 3DSGA 3PROA 2P59A 4MNVA 1QQ4A 3MU8A 1AKSB 2WPHS 3ESTA 3P8FA 3RP2A 3W1EA 5F8XA 1VGCB 1CO7E 2OINA 2AH4X 4ISNA 3JZ2B 2B9LA 2BMGB 1Y3XA 1TGNA 1FDPA 1NESE 5E2PA 1L4DA 4ZXXH 1O36A 1A5GH 4DCDA 1C4U2 5J4SA 3QZRA 5PTPA 1YKTA 1EZUC 4A1VA 2Y82A 4ABHA 2ZO3H 1QNJA 2JIZD 1NU9A 3O8DA 1WAYB 1O3CA 1NU7B 1BBRE 1DWEH 1HGTH 2QXIA 3UIRA 6GCHF 1ZJKA 3ZYEA 2HLDD 5DP3A 1LMWB 3E0NB 3VGCB 3RXHA 2QAAA 4OS4A 4BTIB 1GI8B 1SGQE 2PGQB 2FOGA 3EAJA 3TPIZ 2ANYA 1V2PT 7ESTE 3A89A 1LTOA 2HNTC 2F9OA 2NU3E 4AYYB 4ABEA 3F2HA 2IN2A 4B74A 3FN8A 4X8UH 1W13U 2HVYB 3UWJH 2GCHF 2ZDNA 2BD2A 1BTHH 2QCYA 1SLVB 1WBGB 2JJ2D 1KY9A 3MH6A 5AFZH 1IQNA 4YT7H 1FY8E 1Y3YA 1HAZB 1TGBA 1Y5AT 1CGHA 2ZU4A 1QZ8A 4ZHLU 1QCPA 1GBBA 1ZPZA 3SU5A 3QGNB 2VU8E 1XMNB 5GWZA 1RGQA 1WQSA 1WSSH 2XW9A 4B2AA 3SHCH 2FLBH 5B6LA 1H8DH 3LGVA 3E1XB 1VITF 2HVXA 3EA7A 1RS0A 1HAXB 3LDXH 1ELVA 2FX4A 1AN1E 2TGAA 1IQKA 1EZQA 1Y3VA 4WF8A 4CHAC 1TNHA 1LVMA 2ZHEH 3A7ZA 3SV2H 3RXLA 3PMBB 2GMTC 2OCVB 1Z1IA 4OS6A 1NBME 3NUMA 2KCPA 1YPMH 1P2IA 2STAE 3TNSA 1BIOA 2BDBA 3SUDA 2KR7A 6LPRA 2QF4A 2NU4E 3SU3A 4AFSA 1AO5A 2Y81A 4K1TA 4A5TS 1OP0A 2BY6X 2BD4A 1P10A 2BX4A 5HYOA 5I46H 3KEEA 3STIA 7LPRA 1FXYA 4TPYA 5E0HA 2KCOA 3PWBA 8GCHG 2P8OB 3RMMH 1LHGH 2FYQA 2GCTB 1GJBB 1GDUA 1VJ9U 3H7TA 1HJ9A 4ASHA 2XXLA 4WMDA 2J98A 5GDSH 4X1QU 2ZF0H 2G4TA 2R2MB 3D23A 1O39A 1MAYA 1UO6A 1C1VH 1ZSJA 1ZTLA 3AVZA 3KF2A 5A09A 3DCLA 4YZUA 5EW2H 1GDNA 4NA9H 1S83A 5LH8A 2M5TA 2C8YB 3F9EA 2J9NA 3LOXA 4WXIA 4ABBA 4JYTA 1GHAF 9ESTA 1UVSH 1DY9A
chains in the Genus database with same CATH topology
3RC5A 3SUEA 1E79D 3WWFA 3WW7A 2A4RA 3FO8D 3U1IB 2JJ1D 2OBOA 3F2FA 3F2HA 3KNXA 3SV8A 4NWLA 3GS9A 3FN8A 4B74A 1W0JD 2OC7A 2XNDD 1H8HD 4KTCA 4NWKA 4I33A 5EQRA 4YXWD 5CDFE 4B75A 3SU1A 3E90B 1E1QD 2CK3D 3OEED 4A1TA 4R8TB 2V7QD 1MABB 3NRLA 3PRBA 4B6FA 2JJ2D 2KM0A 3O8BA 4K8BA 1SKYE 3DSOA 3LKWA 3P8NA 4XD7D 4M9FA 5EPNA 5FL7D 5FPSA 5IDKA 2QF5A 3H09A 2WHXA 4I31A 3N7DA 1COWD 3OEHD 3OE7D 3LONA 4WH6A 3EYDA 3SU4A 4B73A 5T1VA 1DXPA 3M5OA 2KCYA 3OFND 3SU5A 5H4IB 5DN6D 3OAAD 2F4LA 3F3BA 3UB0A 1RGQA 3M5MA 2KFWA 2WV9A 2K0QA 2IJOB 4B6EA 5GNDA 3N7EA 2OC0A 5B6LA 2O8MA 2IJD1 3SU0A 2K8IA 4ASUD 3PV5A 1RTLA 3F0PA 3SYJA 4F55A 3PRDA 2OK5A 4WF8A 5C0TA 2YOLA 5FPTA 1DXWA 1KMHB 4Q63A 5EPYA 2J5UA 1JXPA 1E1RD 3O8CA 3KN2A 3SV7A 1NBME 3PV2A 3RC4A 3SZEA 1S6LA 2KCPA 3AK5A 3SUDA 3U1JB 2F9UA 3M5LA 2KR7A 1DY8A 2GVFA 2QF4A 2WZQA 3SU3A 3SUGA 4A92A 4ZCNA 2A4GA 3SU6A 2YMSB 2OBQA 1EFRD 5ETXA 5C0UA 2GGVB 2XCNA 2AHME 2K1QA 1BT7A 2VBCA 3OTPA 5EQQA 2P59A 3FKSD 5ESBA 5F53A 5GPIB 4B76A 3KEEA 3OYPA 2OC8A 5DSFA 3W1EA 1NS3A 2KCOA 4TT3D 1W0KD 1A1RA 1OHHD 4WH8A 2OINA 2YMSC 1W3CA 2YMSD 2LELA 4OM9A 1H8ED 3RC6A 4Z1MD 2W6ID 5C17A 2M2AA 2F9VA 2XOKD 4TYDA 4Q4LA 3L6PA 3WWBA 2FM2A 4A1XA 2FOMB 1BMFD 3DSPA 3N99A 1NBMD 4I32A 4RI0A 5CHBA 3SV9A 2KCAA 5FPYA 4A1VA 3SUFA 3O8RA 2OC1A 2L6OA 3O8DA 2JIZD 3VG8A 3FOAA 4B71A 5IK2D 1CU1A 4TSFD 4U01A 2QV1A 3KF2A 3M5NA 2FP7B 4JMYA 3DCLA 3SU2A 3F0OA 2XNIA 5GJ4B 2WSSD 3SV6A 2HLDD 4FETA 2F43B 5HKKD 2XCFA 2WPDD 4DT4A 3LOXA 2A4QA 1N1LA 1WXRA 3P8OA 2JDID 2W6JD 3F2GA 1DY9A 2QE7D 3ZIAD 2KZ4A 5EQSA 1FX0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LEL A;  3N7E A;  2KM0 A;  3DSO A;  3N7D A;  2K0Q A;  3DSP A; 
#chains in the Genus database with same CATH topology
 1PPC E;  1YPG H;  2BM2 A;  1O2R A;  1HJA C;  1GDQ A;  3RXK A;  3NXP A;  3A8B A;  1IQM A;  3GOV B;  1AGJ A;  2IPH A;  2Y6T A;  5JB9 S;  3LGI A;  2XYA A;  1EAT A;  4B6F A;  1F7Z A;  2G5V A;  2UWL A;  2ANW A;  3BTK E;  1EOL A;  1QJ7 B;  4Y0Y E;  3LC5 A;  1G30 B;  1GCD A;  1P9U A;  4UDW H;  1KTT B;  1NY2 2;  2ZI2 H;  2BD3 A;  2O8T A;  2ALV A;  1MQ5 A;  2A32 A;  2IOT A;  1SGT A;  3SI3 H;  3UB0 A;  4FUI A;  1ELD E;  4E7N A;  1BRA A;  4CH2 B;  1EB1 H;  3RXT A;  4NZL A;  2P16 A;  4AZ2 B;  1YGC H;  1UHB A;  1C5Q A;  3HGP A;  5C5N A;  5LPF A;  1F92 A;  1O2Q A;  2WUB A;  4CRF A;  2LP6 A;  2AYW A;  1XUI A;  4CRA A;  1AI8 H;  1DXW A;  3SHA H;  1O2T A;  1SOT A;  4Q63 A;  1YYY 1;  4AFZ A;  2PP6 A;  2Z6B D;  2AGG X;  1V2K T;  2C8W B;  3I78 A;  3SGQ E;  2GZ9 A;  3NPS A;  2G81 E;  2BOH B;  3M5L A;  3V7T A;  4DT7 B;  1S82 A;  3S7H B;  4LK4 A;  1W8B H;  2VVC A;  2K1Q A;  1DUA A;  1NRN H;  1T4U H;  8EST E;  5GCH G;  2ZGH A;  2H2Z A;  1CBW C;  1DFP A;  1GHY H;  2EA3 A;  4XE4 A;  2VJ1 A;  1P2M A;  2FDA A;  4DIH H;  2R3U A;  1IQL A;  4WH8 A;  2ZU3 A;  2R2W U;  4AOR A;  1K1I A;  2OQ5 A;  2FM2 A;  1ZPC A;  3KYG A;  1WCZ A;  3N99 A;  1V2Q T;  3SV9 A;  1YF4 A;  1NFX A;  1XX9 A;  2GP9 B;  1C5U A;  1BBR H;  2BD9 A;  2ZTX A;  1CA0 C;  1KLI H;  5K7R A;  3GYM A;  1G9I E;  3UOP A;  1LVY A;  1GL0 E;  2FMJ A;  4JZF H;  5BRR E;  1TNJ A;  3M35 A;  1TX8 A;  4NIY A;  3UY9 A;  3STJ A;  2OP9 A;  3SU2 A;  2RG3 A;  5GJ4 B;  5LGO A;  4FVB A;  2Z9I A;  2XCF A;  1LHE H;  2FXR A;  1N1L A;  2DUC A;  1IQI A;  1NO9 H;  3BTT E;  3ZZB A;  1TPS A;  2VGC B;  1V2T T;  2XRC A;  1MTU A;  1PYT D;  1S0R A;  3A8C A;  1DE7 H;  1G3C A;  3MYW A;  1NM6 A;  1SSX A;  2FOH A;  2JJ1 D;  4ABG A;  1DM4 B;  3R0F A;  1H9I E;  2ODY B;  5C5O A;  4I33 A;  3UAI C;  5CDF E;  1JWT A;  1OS8 A;  2Q6G A;  8GCH F;  4NCY A;  1MAB B;  5EIY A;  1AQ7 A;  3TIT A;  5JYI A;  2BY9 X;  4IMQ A;  4ABD A;  1EAI A;  4X6N A;  1GBH A;  1PPB H;  3VEQ B;  5CMX H;  1S5S A;  1SQA A;  3UR6 A;  4FUE A;  4HTC H;  3VB5 A;  3SGA E;  2UWP A;  5DGJ A;  1DXP A;  3M5O A;  2GD4 B;  3ZVF A;  5GXP A;  1PPE E;  3S69 A;  2EQN A;  5EJL A;  1T8M A;  2VIP A;  2P3U B;  5J4Q A;  1E35 B;  1EJA A;  1N6Y A;  3ATI A;  4DGJ A;  1D3T B;  7GCH G;  3TK6 A;  1WYK A;  1NTP A;  3MI4 A;  5FX5 A;  3A83 A;  3A87 A;  1E36 B;  3MH5 A;  1QB9 A;  4RKJ B;  3RMN H;  4KKD A;  3D49 H;  3O8C A;  1GI1 A;  1LHC H;  4K5Z A;  1Y3U A;  1EP6 A;  4I8L A;  4DUR A;  3U28 C;  1BJV A;  4A92 A;  1P57 B;  1TMT H;  2TGP Z;  3ZZ5 A;  8LPR A;  1ZOM A;  2FES H;  2VIN A;  3G01 A;  2VVV A;  3SOR A;  2FOF A;  3MNX A;  4IC6 A;  5F53 A;  3K6Z A;  4ZRO A;  1XM1 A;  3OYP A;  1S6H A;  3T5F H;  1B7X B;  4Q7Y A;  1W3C A;  1W0Y H;  3ZZ6 A;  1W2K H;  3HKJ B;  3L6P A;  5F8Z A;  1T31 A;  3ODF A;  1B0F A;  3TGI E;  1TA6 A;  2BD5 A;  1TA2 A;  8KME 2;  4RSP A;  4X1P U;  1GG6 B;  2HOB A;  5EJZ A;  3PTB A;  2O9Q A;  3SV6 A;  1MTW A;  3FP6 E;  3PMH B;  1G2M A;  1GI9 B;  4I8H A;  1CSO E;  4GAW A;  1KTS B;  2W7S A;  2A4Q A;  3BTF E;  3U69 H;  2W6J D;  1GCT B;  3P92 A;  1ZML A;  3EE0 B;  3K65 B;  1G36 A;  1E79 D;  1GJ6 A;  3M3S A;  3LPR A;  2ZGB H;  1O2H A;  2OBO A;  1A4W H;  1BHX F;  5C94 A;  2KAI A;  4J1Y A;  2G8T A;  3TK5 A;  3UWI A;  1AZZ A;  3CNR A;  1DDJ A;  2CK3 D;  1XUJ A;  3OEE D;  4R8T B;  4HFP B;  1CT0 E;  1K28 D;  1C1S A;  2A0Q B;  5ABW A;  1A3E H;  2ODQ A;  1YWU A;  1O32 A;  3F9G A;  4M9F A;  1RD3 B;  1FZZ A;  2BQ7 B;  1E38 B;  1T4V H;  2WV5 A;  1ELE E;  1PPZ A;  3N7D A;  3TJU A;  3DUX H;  4FUF A;  4O3T A;  1C2G A;  3OE7 D;  1K1N A;  1FJS A;  2J38 A;  2GV6 A;  3OAA D;  3F9F A;  1HIA A;  2AIP A;  3QO6 A;  3M5M A;  4K1S A;  2IJO B;  1C2I A;  3KCG H;  4X1N U;  1O33 A;  2QXG A;  1GBC A;  2PKS B;  2BQW B;  1KXB A;  5E0J A;  4IC5 A;  2FS9 A;  1C5S A;  1XVM A;  5C0T A;  4LZ1 H;  3BG4 C;  1C2F A;  1CHO G;  4TPI Z;  3PMA B;  2G52 A;  2W7U A;  1OX1 A;  2ZFP H;  4IMZ A;  4AX9 H;  1O2Z A;  1DIC A;  2H6M A;  3PV4 A;  2EI7 A;  1CT4 E;  4AN7 A;  1BJU A;  3AK5 A;  1V2M T;  2OTV A;  1IHT H;  3SU6 A;  2SGA A;  1GJ8 B;  3RLW H;  3KQE A;  5EXM A;  5EU8 A;  1HAV A;  3QDZ B;  2J95 A;  1Q3X A;  3MTY A;  1C2J A;  3FKS D;  1UK2 A;  3RU4 E;  2W26 A;  1MAX A;  2BYA X;  1IQG A;  1TBR H;  5FCR A;  1TWX B;  1TRY A;  3RC6 A;  1RRK A;  3ZV9 A;  1W0Z U;  1MKW H;  4TYD A;  2BDG A;  4BAO B;  3QTV H;  1YPE H;  1ACB E;  1S6F A;  2KCA A;  4GPG A;  4INH A;  2J2U A;  1G3E A;  1KXC A;  1MBQ A;  1F5K U;  2FI4 E;  3OX7 U;  1XUF A;  5CHA B;  5E0G A;  3A84 A;  4NA8 A;  2QYI A;  3MU0 A;  1ZGI A;  1VIT H;  1OYT H;  2YNB A;  1BTY A;  3L3T A;  3BTH E;  1D6W A;  3M3T A;  1J8A A;  1IQE A;  3A7W A;  4INL A;  2V0B A;  4MPX A;  1Z8R A;  2ZPR A;  3P8G A;  1RIW B;  3GYL B;  3ZIA D;  1SGI B;  2QC2 A;  3M7U A;  4O03 A;  4ZH8 A;  3SBK A;  1W14 U;  4X1S U;  3GDU A;  1YLC A;  1RXP A;  5DO4 H;  1O2Y A;  4Y8X A;  4ZMA H;  2TRM A;  3E90 B;  1E1Q D;  1U6Q A;  2G00 A;  2FTM A;  1O2L A;  1SGF A;  1ZR0 A;  1AMH A;  2FI5 E;  2ZFS A;  3RUO A;  4B2C A;  1P02 A;  1SLX B;  4UFF H;  2ZCL P;  1OOK B;  2WPM S;  4HGC A;  1BDA A;  3QX5 H;  3MNS A;  3T2N A;  4WH6 A;  1L1J A;  2HLC A;  4Y71 A;  2QXJ A;  3RXV A;  2BXU H;  1C5M D;  1V2O T;  2OC0 A;  2HPP H;  1MTS A;  5L2Y H;  1ZHP A;  1SGC A;  5FBE A;  3M36 A;  4AYV B;  5GIB A;  1A0H B;  4DY7 B;  1TGC A;  3ZZ4 A;  1BZX E;  1Z1J A;  1GMD F;  1MBM A;  1V2U T;  1QRW A;  1ZYO A;  2ZPS A;  4NFE A;  4X2X A;  5EPY A;  4AG1 A;  1O5B B;  3KN2 A;  1C2M A;  1L4Z A;  3RC4 A;  3GDS A;  3K6Y A;  2A5A A;  2RDL A;  2DE9 A;  1DY8 A;  4X6O A;  4ZCN A;  5JDU B;  3HK3 B;  1PPG E;  2NU1 E;  4Y79 A;  1O3M A;  2CHA C;  1EPT A;  2ZZU H;  4F4O C;  4GVU A;  4Z0K A;  3ZZA A;  4KEL A;  2QIQ A;  3SOS A;  2J98 B;  3P6Z B;  1OHH D;  5C17 A;  1AFE H;  4IGD A;  1EOJ A;  4Q4L A;  2ZDA H;  1SPJ A;  5EST E;  4XBC A;  2ULL A;  3DT0 H;  1TRM A;  1ARB A;  1LHF H;  1SQT A;  3KID U;  3TK9 A;  1QGF A;  1C2L A;  2Y80 A;  1BMA A;  1OWI A;  1ZTK A;  6EST A;  1TX7 A;  1TPO A;  4XOJ A;  2P94 A;  1GGD C;  1CHO F;  2RA0 A;  3MU1 A;  1DS2 E;  3BIV H;  3V13 A;  2Z9G A;  1W10 U;  4FUG A;  1DLE A;  5FXL A;  3GCN A;  1GHX H;  5T6D A;  4Z6A H;  5A8X A;  3BEU A;  3E91 A;  3GY8 A;  4ACB A;  1MUE B;  2OC7 A;  2XND D;  4X0W U;  1AY6 H;  3S7K B;  1GBF A;  4Q80 A;  3TNT A;  3A7V A;  1C2D A;  2VH6 A;  3A86 A;  5AVD A;  3A8D A;  1TRN A;  1TAW A;  4P00 A;  1LHD H;  2XWA A;  1LPZ B;  4MLF B;  2ZDV H;  3O8B A;  1Z7K A;  1SKY E;  3DSO A;  5HIZ A;  1AB9 B;  5FL7 D;  2Q6F A;  4YO9 A;  2CHA B;  1IOE A;  4XDE A;  4WXV A;  4I31 A;  1BA8 B;  1ZSK A;  1Y5B T;  3CS0 A;  1K0H A;  1SI5 H;  1PQ5 A;  1CT2 E;  2ANM H;  2GT8 A;  2Z3D A;  1C1Q A;  3OY6 U;  3F3B A;  2GTB A;  4UON A;  1CGJ E;  2C4F H;  2JET C;  3PYH A;  5E2O A;  2ZA5 A;  5A0B A;  3VXF H;  1P2K A;  4X2Y A;  2FWW A;  5DPA A;  2BLQ A;  3SYJ A;  5HXF A;  3OTJ E;  4O3U A;  4MPU A;  5L30 H;  3HAT H;  3F9H A;  1NT1 A;  3QN7 A;  1QJ1 B;  1H4W A;  2GT7 A;  1TMB H;  1PFX C;  1SL3 A;  4NGA H;  3MU4 A;  1AND A;  2FOC A;  2R3Y A;  4JZE H;  1ORF A;  2XC4 A;  1G2L A;  4SGA E;  1SC8 U;  1TGS Z;  2XCN A;  2FS8 A;  2AHM E;  2B7D H;  1V2J T;  3MWI U;  3UPE A;  3AW0 A;  5A0C A;  1D3D B;  4FUH A;  1LPK B;  1ELA A;  4DOQ A;  4X8V H;  2H1U A;  2YMS C;  2YMS D;  3HKI B;  1QA0 A;  4OM9 A;  2LNC A;  2GJG A;  2ZKS A;  3LGW A;  1LDT T;  1GHV H;  1P12 E;  2FOM B;  1TQ0 B;  4D9Q A;  1P04 A;  4ZKR U;  2ZQ2 A;  4THN H;  5FPY A;  2ASU B;  1UK4 A;  3O8R A;  2WYJ A;  4X2V A;  3M5N A;  1GJ5 H;  4XSK U;  3I29 A;  2BOK A;  5EXL A;  3ZVE A;  2V3O H;  3MNB A;  1XXD A;  4BXW A;  1MQ6 A;  2ZFF H;  3EQ0 H;  4FXG H;  1TNL A;  2TGD A;  3LH3 A;  1C1W H;  4NIX A;  4I8K A;  4XBD A;  3ATM A;  5HGG A;  4NSY A;  1DWC H;  1Y3W A;  1PQA A;  2KZ4 A;  3DA9 B;  4GSO A;  2A4O A;  1SFI A;  1ABI H;  3FP8 E;  2SNV A;  3TJV A;  2VWO A;  1VKY A;  3ZVA A;  3BG8 A;  4GUX A;  4ISI H;  1NC6 A;  4GLY A;  4YXW D;  5FCK A;  5EOD A;  2FOE A;  5C1U A;  1A5I A;  1KXF A;  4KTS A;  4DII H;  1GI3 A;  4P02 A;  3LKW A;  3EE7 A;  4RT1 A;  1T8L A;  2F83 A;  4OGY A;  1GJ9 B;  5AHG H;  1O2N A;  4TWW A;  3RLY H;  1A7S A;  2G5N A;  3EYD A;  1TAL A;  5C3N A;  3ATW A;  5A8Z A;  4CHA B;  4BNR A;  3C1K A;  3M7Q A;  4B6E A;  1BRC E;  1A0L A;  1J17 T;  2GMT B;  3AAV A;  4MG3 A;  2ZPQ A;  1O2X A;  5DJ7 A;  4X6M A;  2K8I A;  4CRB A;  1TX6 A;  3F0P A;  1MU6 B;  2AIQ A;  1Y59 T;  1D6R A;  1RTF B;  3U9A H;  2P95 A;  3GY2 A;  3SZE A;  1S6L A;  4AOQ A;  3PTN A;  1FN6 A;  4KTU A;  1TNK A;  1W7X H;  5AFY H;  5HM9 A;  4X8S H;  1P9S A;  3ZZ9 A;  5DP8 A;  3F68 H;  3W95 A;  1G37 A;  1MU8 B;  1P11 E;  5GPI B;  1FI8 A;  4Y7B A;  4CR9 A;  1OWE A;  1AE8 H;  2OC8 A;  2OXS A;  1HUT H;  1ZRB A;  4TT3 D;  2AFQ B;  3ITI A;  4WJG 2;  3FAO A;  1P2Q A;  4M7G A;  1A0J A;  1XXF A;  1ZHR A;  1HFD A;  2ZGX H;  2FI3 E;  2QGR A;  1WTH D;  5CHB A;  4RI0 A;  4BTT B;  3HK6 B;  2Z7F E;  2BY7 X;  4X8T H;  1ZMN A;  1SB1 H;  1BBR K;  2ZTZ A;  4AGJ A;  1HPG A;  3MNC A;  1XKA C;  3FZD A;  1HJA B;  2VNT A;  3A81 A;  1SMF E;  4X6P A;  3RXP A;  4ISO A;  1O2V A;  5DP9 A;  4UFE H;  1JBU H;  2BD7 A;  2PV9 B;  3K2U A;  2W5E A;  4ABJ A;  1FV9 A;  5JBB S;  1FX0 B;  2OD3 B;  2BHG A;  3SJ9 A;  3WWF A;  1O3J A;  1OWH A;  3RM2 H;  3GDV A;  3BF6 H;  3QZQ A;  1OP8 A;  2JKH A;  1QBV H;  1VCW A;  1BOQ A;  5L6N H;  1O2W A;  5B6O A;  4NA7 A;  1MTN C;  3Q3Y A;  1KXD A;  1L0Z A;  4IBL H;  3RXG A;  1Z6E A;  2D8W A;  1CVW H;  1TLD A;  1KYN A;  4JYV H;  1MH0 A;  2CGA A;  5IDK A;  2AGI X;  1DVA H;  2D1J A;  1VR1 H;  3EA9 A;  4UEH H;  2CXV A;  5I25 A;  1MZD A;  1PYT C;  5A8Y A;  1G3D A;  2I6Q A;  2W3K A;  2ZIQ H;  1P09 A;  1YPJ H;  1P0S H;  3GY6 A;  1AU8 A;  2PW8 H;  2WV9 A;  3A88 A;  1F0S A;  3GCH C;  3LJJ A;  4FU7 A;  1P03 A;  1TNG A;  2O8M A;  1WTG H;  1DWB H;  2A7J A;  5JBA S;  2ZFT A;  1FIZ A;  4ZKN U;  2ZP0 H;  2CMY A;  1HCG A;  2GV7 A;  1KXA A;  1JXP A;  2BDC A;  3TVJ B;  1GI5 A;  4AC9 A;  1DIT H;  2C8X B;  1CBW B;  1Z71 A;  1T7C A;  3U1J B;  4XRN A;  3RXF A;  1D3P B;  1KDQ B;  2A2X H;  2SGP E;  3LJO A;  4FU8 A;  1FN8 A;  2ALP A;  1G32 B;  1Q2W A;  4I8G A;  2ZGC A;  1MZA A;  2ZU5 A;  3AAU A;  2EY4 C;  1LKA A;  3UOU A;  3BTE E;  4UE7 H;  2TIO A;  1F2S E;  3Q77 A;  1N6X A;  2GKV E;  2XTT B;  2ZDL A;  3BEI B;  4TWY A;  1QY6 A;  1CA0 B;  3S9B A;  1GWA A;  2P3F H;  2EST E;  1V6D A;  2GX4 A;  4Q7Z A;  2O8W A;  3TH2 H;  1PQ7 A;  3A7X A;  1NRQ H;  2ZGJ A;  3BTW E;  1TMU H;  2P3T B;  1TOC B;  5AF9 H;  2ZQ1 A;  2A7H A;  3DHK H;  3SW2 B;  1AVW A;  5F6M A;  1IAU A;  1CQQ A;  1Z8G A;  3LIW A;  3VG8 A;  2C8Z B;  5DKM A;  4TSF D;  1V2S T;  2BY5 X;  4DVA U;  1L1N A;  5T3H A;  1JRT A;  1EPT C;  6CHA C;  4K60 A;  3BTM E;  2PLX A;  1O2S A;  2R9P A;  1SOZ A;  3BV9 B;  2AGE X;  5C67 A;  1KIG H;  2Z9K A;  1SLU B;  4R0I A;  1EJM A;  3ZVC A;  2FIR H;  3CEN A;  1GMC G;  2FX6 A;  1OWJ A;  3T26 A;  4U30 A;  1RFN A;  1QQU A;  4NWK A;  1SFQ B;  1M9U A;  1O0D H;  2ZFQ H;  5EQR A;  3U8T H;  1ELF A;  3SO3 A;  1S85 A;  1TB6 H;  1EST A;  1AUJ A;  2PUX B;  3TGJ E;  3E16 B;  1FON A;  4NIV A;  2PR3 A;  2VWL A;  2O8U A;  1K1J A;  1P3E A;  1HXE H;  4Y7A A;  3ZZ7 A;  2WHX A;  4O97 A;  5HMA A;  2CV3 A;  3RXE A;  3LON A;  1C5P A;  1O3K A;  5TCC A;  3LGY A;  3M3V A;  5GCH F;  1AFQ C;  3QLP H;  1J14 A;  1K22 H;  3PO1 C;  4ISH H;  4X1R U;  2G51 A;  4VGC C;  3ZVB A;  4FOU C;  5SGA E;  2PUQ H;  2BDI A;  2Z3C A;  1AD8 H;  1UTP A;  5DP5 A;  3U98 H;  1AHT H;  4F55 A;  1GJD B;  2YOL A;  5FPT A;  1B5G H;  1LCY A;  1KMH B;  4K2Y A;  4YLU A;  1C1R A;  2R0L A;  2PFE A;  4CH8 B;  1E1R D;  1FY5 A;  5E8E H;  3FAN A;  5KGO A;  5A2M H;  2FOB A;  1GHB G;  3S9C A;  1ESB A;  1GJ4 H;  1YBW A;  1WU1 A;  2Y5F A;  4MQA A;  5F8T A;  1BUI A;  5K0H A;  3PLP A;  1AWF H;  2SGE E;  2QA9 E;  1TBQ H;  1JMO H;  4UFG H;  4DW2 U;  1EAS A;  1GBI A;  4Y11 E;  3IWM A;  3T29 A;  3M61 U;  1TE0 A;  1Z6J H;  1V2R T;  4MNY A;  1QBN A;  1X7A C;  2AER H;  4BAH B;  5DSF A;  3MU5 A;  4JZ1 A;  1TNI A;  2F9V A;  3SNE A;  3FZZ A;  3WWB A;  1C9P A;  2WPI S;  2ZHD A;  1GHZ A;  1ZZZ A;  1MKW K;  5L2Z H;  1QL8 A;  2HWL B;  3GCO A;  1XUH A;  3PWC A;  2FEQ H;  2OC1 A;  4FUJ A;  4X2W A;  1TAB E;  3A7T A;  2FP7 B;  1C5O H;  3MH4 A;  1A61 H;  2F43 B;  3A7Y A;  4AG2 A;  1UMA H;  1HYL A;  3RXO A;  1F0R A;  3WY8 A;  4ISL A;  1OYQ A;  1YLD A;  3P8O A;  2XBV A;  1BTU A;  1H8I H;  1TON A;  1O3B A;  2VH0 A;  1GBE A;  5JPM H;  2Z3E A;  3KNX A;  3KL6 A;  7GCH F;  4H42 U;  1NFU A;  1W0J D;  3TU7 H;  1GHW H;  2V3M A;  2A31 A;  3QUM P;  4CBN A;  1DAN H;  1HJ8 A;  1INC A;  1YCP K;  1N8O C;  1AWH B;  1J9C H;  3PB1 E;  3T28 A;  5T6G A;  4XD7 D;  5FPS A;  3RXM A;  1BMM H;  2FLR H;  2A2Q H;  4GHT A;  1SGE E;  1COW D;  2FOA A;  1SGD E;  3HGN A;  5T1V A;  3OFN D;  1ELC A;  1C5Y B;  4OGX A;  5DN6 D;  1C1P A;  1O5D H;  3BG4 B;  2EI6 A;  3BIU H;  1NFW A;  2KFW A;  4OS7 A;  3T27 A;  1DUE A;  1EKB B;  1P05 A;  1YCP H;  1HAI H;  1HRT H;  1QR3 E;  3TJO A;  2JH0 D;  1O5G H;  2AEI H;  2IJD 1;  1ARC A;  4Y6D A;  3RXB A;  3LGT A;  1DSU A;  4GHQ A;  4QT8 C;  4BTU B;  2SGF E;  4MPV A;  1YPK H;  4NIW A;  3DFL A;  3NK8 A;  2XBX A;  1H1B A;  3LU9 B;  4K69 A;  1K1P A;  4J2Y B;  3TH3 H;  1YY3 A;  1O30 A;  2W3I A;  4FUB A;  2FO9 A;  1T32 A;  1MCV A;  2H9H A;  2VBC A;  2BY8 X;  1O3E A;  4LXB H;  1ETT H;  1NN6 A;  1DPO A;  1SGR E;  4E7R G;  2A5K A;  1JIR A;  1UJ1 A;  1VIT G;  1W0K D;  2UWO A;  4FVD A;  5DP7 A;  3E8L A;  3Q3K A;  3MO3 A;  2M2A A;  1QFK H;  4D8N A;  1KLT A;  4I32 A;  3GY7 A;  2PHB A;  1K1M A;  1VGC C;  2IPQ X;  2G55 A;  1S84 A;  2HAL A;  1LPG B;  1O2P A;  1PPH E;  4FUD A;  3UQO A;  2VB0 A;  3F0O A;  3GCT G;  4LOY H;  2H5C A;  2ZHW H;  2SGD E;  1L1G A;  1GBK A;  1P06 A;  1GHB F;  2CN0 H;  1GJC B;  3FP7 E;  5DP4 A;  3VB7 A;  4TY6 A;  2G4U A;  3W94 A;  2A7C A;  1BIT A;  1O34 A;  1O3H A;  1C1O A;  2VIW A;  2QN5 T;  1ELT A;  4MDS A;  3NCL A;  1C1T A;  1LQE A;  1QBO A;  3VGC C;  2ODP A;  1HAH H;  3UFA A;  1O5E H;  1QRZ A;  4ZUH A;  1SR5 C;  1GBT A;  3NRL A;  1C1M A;  2WIN I;  1TIO A;  2FZZ A;  2GZ8 A;  1O3G A;  4BAQ B;  3A82 A;  3H5C B;  2C3S A;  2ZNK H;  4OS1 A;  1XUG A;  1C2K A;  3NZI A;  1UCY E;  3P70 B;  2QF5 A;  3BN9 A;  3H09 A;  1BML A;  4U32 A;  3MO9 A;  4K8Y A;  2AS9 A;  1HDT H;  2FTL E;  1HAP H;  2C93 B;  5H4I B;  1HB0 B;  1GMH G;  1HXF H;  1E0F D;  1OXG A;  4HZH A;  1UVP A;  2B0F A;  1T8N A;  1Z8J B;  1K9O E;  2PWX A;  1C1N A;  3PV5 A;  4BOH A;  2ZG0 H;  1D3Q B;  2AMP A;  1HAO H;  1D4P B;  1P01 A;  1FPC H;  1MTV A;  2BVS H;  1ABJ H;  1K1O A;  2J5U A;  3LGU A;  1FPH H;  2Y7Z A;  4Y76 A;  1UHB B;  1Y5U T;  3SJI A;  1ETR H;  1GI7 B;  5DG6 A;  3UUZ A;  2XBY A;  4LZ4 B;  2THF B;  1SGY E;  4WY3 A;  1C5X B;  1YPH E;  2ZHQ H;  3SNC A;  4IS5 A;  2A4G A;  1ZPB A;  1PJP A;  1YP9 A;  2ZCK P;  4Y10 E;  4BAK B;  2Y7X A;  1UTK A;  2GZ7 A;  2VWM A;  2RFK C;  3OTP A;  1GL1 A;  3UNR A;  3PLK A;  3P95 A;  4JZI A;  3N7O A;  1C5Z B;  1ZLR A;  2OUA A;  4ABF A;  2B5T B;  1KLJ H;  2RA3 A;  1GI4 A;  2L74 A;  3B8J A;  3SN8 A;  5LPE A;  2WPL S;  5TCA A;  1GGD B;  1IQH A;  1EXF A;  1E37 B;  1C2H A;  4Y8Z A;  3RML H;  1ZTJ A;  4E06 H;  2WPJ S;  1IQJ A;  4RT0 A;  4F48 B;  2P8O C;  2F9N A;  2L6O A;  3TH4 H;  1GBD A;  5IK2 D;  2GCT C;  2QF0 A;  4NSV A;  4YES B;  1ZRK A;  3TJN A;  2BDY A;  2QV1 A;  5C1Y A;  3H7O A;  1SVP A;  1WQV H;  3DFJ A;  1NRP H;  2WSS D;  1IQF A;  4YOI A;  3B23 B;  1F0T A;  4MNW A;  1HNE E;  2RCE A;  4ABA A;  3D62 A;  2A4R A;  2PTN A;  5DP6 A;  3E0P B;  3U1I B;  3F2F A;  1O3I A;  1BHX B;  1UVU H;  3QWC H;  4ZXY H;  3SNB A;  1YPH C;  1PQ8 A;  1C5T A;  1GBJ A;  3SU1 A;  4JK6 A;  4YM9 A;  1BCU H;  1GPZ A;  3PLB A;  1NZQ H;  1O2U A;  3P8N A;  2JET B;  4XFQ A;  4AGK A;  2PKA A;  2J4I A;  1QIX B;  1FAK H;  3RXQ A;  4MNX A;  1NRS H;  2YNA A;  5EXN A;  1QJ6 B;  1SLW B;  3GCT F;  3UNQ A;  2BLV A;  2EI8 A;  2TBS A;  3URD A;  1EJN A;  1QRX A;  1O31 A;  3TGK E;  3EGK H;  1VJA U;  1ZMJ A;  1DX5 M;  1A3B H;  1HAY B;  3SQH E;  3OY5 U;  2BDH A;  1F0U A;  3GY3 A;  1BRB E;  4FU9 A;  3D65 E;  1TPA E;  4CRC A;  1L2E A;  5KED A;  3R3G B;  2F91 A;  3JZ1 B;  3RDZ A;  2GDD A;  1JRS A;  4YOG A;  1P8V C;  4DG4 A;  5FAH A;  1K21 H;  1FY4 A;  3ZZ3 A;  1UTN A;  1CHG A;  2YMS B;  1QUR H;  4IN2 A;  1JIM A;  1SG8 B;  1VZQ H;  5EQQ A;  1SQR A;  1UVT H;  2VWN A;  4U2W A;  1EQ9 A;  4CRD A;  5A0A E;  3ODD A;  3NWU A;  2W6I D;  4RKO B;  1GMH F;  1P2N A;  1QB1 A;  2STB E;  1P2J A;  4IW4 E;  3ATK A;  4A1X A;  1BMF D;  2CF8 H;  1AKS A;  3EA8 A;  1NBM D;  1W12 U;  1TQ7 B;  3SQE E;  2V6N A;  3URE A;  2Q1J A;  2EC9 H;  1QHR B;  3BSQ A;  1ID5 H;  3FOA A;  3RXJ A;  1QA7 A;  2I6S A;  1O3A A;  2ZCH P;  2XNI A;  4B2B A;  1UCY K;  3A80 A;  4FET A;  4OS5 A;  1O3O A;  4BXS A;  1UTQ A;  1EUF A;  2NU0 E;  2JDI D;  2TGT A;  1ZHM A;  2SFA A;  4YLQ H;  3KQC A;  1O2K A;  4IN1 A;  2C90 B;  3CP7 A;  1S81 A;  2VIV A;  1O5C B;  3SV8 A;  3NKK A;  2J94 A;  3RU4 T;  2BZ6 H;  2PSY A;  5FHT A;  3T62 A;  3ENS B;  2XBW A;  1TOM H;  1UCY H;  2VGC C;  1TPP A;  1FIW A;  2BX3 A;  2F9P A;  4WMF A;  1C4Y 2;  5JBC S;  1VCP A;  1F5R A;  2KAI B;  4I86 A;  2D26 C;  3OSY A;  1DLK B;  1BTP A;  3OU0 A;  2ZEC A;  2KCY A;  1FAX A;  1C5L H;  3EDX B;  3SJO A;  1ESA A;  1EZX C;  2ZEB A;  2NWN A;  5DK1 A;  2P93 A;  1P2O A;  1W7G H;  2F3C E;  4E05 H;  5GND A;  1MCT A;  2ZC9 H;  1UK3 A;  2ANK H;  1ETS H;  3KHV A;  3RXS A;  4Q7X A;  2PGB B;  1C2E A;  2H5D A;  2OK5 A;  3FVF B;  3MMG A;  3MOC A;  4MPW A;  1OWD A;  1D9I A;  1HIA B;  1NRO H;  1EAX A;  1KSN A;  1EB2 A;  4H6T A;  2PTC E;  1SGP E;  3SV7 A;  1NPM A;  4YTA A;  3MFJ A;  2WZQ A;  3F6U H;  4BAN B;  1EFR D;  2XC5 A;  5C0U A;  3Q3X A;  1GI0 A;  1C4V 2;  1HLT H;  5F03 A;  1CGI E;  4A7I B;  1ANB A;  4AB9 A;  2BZA A;  2WV4 A;  1NS3 A;  1C1U H;  2HRV A;  1AE5 A;  3A8A A;  4Z1M D;  2LEL A;  4FUC A;  1BTW A;  1HAV B;  3K9X B;  1Y8T A;  2CF9 H;  3RMO H;  2FYR A;  3GIC B;  3RXC A;  3SND A;  1YCP M;  5HIY A;  3BTG E;  4AFU A;  1MKX K;  1K2I 1;  2BXT H;  5EW1 H;  4UFD H;  1Q31 A;  1YM0 A;  5IYT A;  1THP B;  1MD7 A;  3SI4 H;  3ELA H;  2UUK B;  3V0X A;  1GJ7 B;  2AMD A;  2WPD D;  1TYN A;  1FY3 A;  4ACA A;  2ZTY A;  4CRE A;  2OQU A;  1AVX A;  1ZJD A;  4D7G A;  1MTN B;  1AVG H;  3VB3 A;  2QE7 D;  2FPZ A;  1GG6 C;  1V2L T;  3SU0 A;  3VB4 A;  4AFQ A;  3ZVD A;  3WW7 A;  2BD8 A;  3FO8 D;  1AUT C;  1EAW A;  3LH1 A;  3MH7 A;  1UTO A;  1MKX H;  3GS9 A;  4KTC A;  4KGA A;  3VFE A;  1H8H D;  1GI6 A;  3AW1 A;  1G3B A;  1GJA B;  2BDA A;  4PRO A;  1B0E A;  2BB4 A;  3E6P H;  4A1T A;  1GCT C;  2V7Q D;  3SZN A;  3PRB A;  1SBW A;  4ZHM U;  1RJX B;  2KM0 A;  1AIX H;  1V2V T;  1ZSL A;  1MD8 A;  3UQV A;  4I7Y H;  3Q00 A;  3GCH B;  4UD9 H;  2V3H H;  3SJK A;  1UW7 A;  2QF3 A;  3UNS A;  5C2Z A;  3LC3 A;  1W11 U;  3MQK C;  1FUJ A;  3SJ8 A;  1NFY A;  1O2J A;  4O9V A;  4XBB A;  1O2M A;  1OSS A;  2R0K A;  2K0Q A;  1NRR H;  1C5V A;  1OWK A;  2RDE A;  3C27 B;  1QTF A;  2BLW A;  2UUY A;  3V3M A;  1BTZ A;  5EGM A;  4D7F A;  1RTL A;  1HBT H;  2WUC A;  2ZFR H;  1A5H A;  1ELG A;  2QXH A;  1EP5 A;  4I8J A;  4HI3 A;  1DOJ A;  3ZZC A;  9LPR A;  1JOU B;  1LQD B;  4K3J A;  4JK5 A;  3PV2 A;  3U8R H;  2A45 B;  1LKB A;  1OP2 A;  1LVO A;  2BQ6 B;  4H6S B;  2PKS C;  1MMJ N;  2JH6 D;  2XC0 A;  5HM2 A;  1BMN H;  2V35 A;  2KX4 A;  2NU2 E;  3S0N A;  3QGJ A;  2OBQ A;  5ETX A;  3ZZD A;  4CR5 A;  1BT7 A;  2BLO A;  1GBA A;  2PSX A;  1ELB A;  2WYG A;  1KXE A;  1WV7 H;  1OKX A;  3BTD E;  3Q76 A;  4D76 A;  3SNA A;  4B76 A;  2Y5G A;  1E34 B;  2F9B H;  2AMQ A;  3UR9 A;  4JCN A;  3IIT A;  1DST A;  3M7T A;  2QY0 B;  4TY7 A;  1H8E D;  3VPK A;  5JB8 S;  2ZDK A;  2VID A;  1Z8I B;  2XOK D;  2CJI A;  3RXI A;  1EPT B;  1O5A B;  2Q6D A;  2ZU2 A;  5FX6 A;  6CHA B;  5BPE A;  1GMD G;  1FLE E;  3DSP A;  1CE5 A;  5JBT A;  4AB8 A;  2GDE H;  5T6F A;  1C5R A;  1VCQ A;  2SNW A;  3LT3 A;  4WME A;  4B71 A;  1ANE A;  3TLO A;  4YOJ A;  2EEK A;  2HNT F;  2OLG A;  4F49 A;  3T25 A;  1GVL A;  1GVZ A;  4JMY A;  1GVK B;  1GBM A;  1O5F H;  3QK1 A;  3GIS B;  4NZQ A;  1WXR A;  1LO6 A;  1BRU P;  1EZS C;  3S9A A;  3F2G A;  3URC A;  5CHA C;  2O8L A;  2BVR H;  2VIQ A;  5TJX A;  5LPR A;  3U8O H;  4CRG A;  4A6L A;  2JH5 D;  4NWL A;  1WOF A;  4GCH G;  1O37 A;  3GY5 A;  4ZKS U;  2B8O H;  1V2N T;  1UTJ A;  2VVU A;  4B75 A;  3P17 H;  3RM0 H;  3RXU A;  1CA8 B;  2BVX H;  1RIW C;  4WVP E;  1O3N A;  1C5W B;  2Z9J A;  2SGQ E;  4K8B A;  1PPF E;  1DWD H;  1AFQ B;  1FQ3 A;  3MHW U;  4WWY A;  1IHS H;  4ZAE A;  3PO1 B;  3VXE H;  4SGB E;  2HPQ H;  3E3T A;  3KQ5 A;  1O2I A;  4VGC B;  3OEH D;  1LVB A;  1J16 A;  4B73 A;  1WDI A;  2F4L A;  1SGN E;  2BTC E;  2Y5H A;  5CE1 A;  5C1X A;  1QL9 A;  4YT6 H;  3N7E A;  3SGB E;  1EAU A;  2FOD A;  4H4F A;  1T8O A;  3IG6 B;  4ASU D;  3UTU H;  1THR H;  2ZHF H;  3PRD A;  1KDQ A;  3MO6 A;  3PMJ A;  6GCH G;  2XWB I;  5G4B A;  3L33 A;  4OS2 A;  1SQO A;  1YC0 A;  4JZD H;  1A2C H;  7KME H;  3ATL A;  2ZU1 A;  3SUG A;  1WUN H;  2UUF B;  2GGV B;  2LPR A;  1SGF G;  2H9T H;  3BTQ E;  4NG9 H;  1C9T A;  5ESB A;  1SHH B;  3VB6 A;  1HAG E;  2GCH G;  5FBI A;  1DT2 A;  3M37 A;  1A1R A;  1GMC F;  1AZ8 A;  2J34 A;  3ZYD A;  4ZKO U;  3ZVG A;  3KQD A;  1FMG A;  5C20 A;  4D9R A;  1OPH B;  3CS7 A;  1H9H E;  1QL7 A;  2D2D A;  5EG4 A;  1O3P B;  1EX3 A;  4B1T A;  2VIO A;  4INK A;  1QB6 A;  3TIU A;  3V12 A;  3SUF A;  3AAS A;  4HG6 A;  1CU1 A;  2A1D B;  4U01 A;  3RXA A;  2J97 A;  3FFG A;  1TFX A;  3I77 A;  3RU4 D;  3PM3 A;  5HKK D;  4BAM B;  2ZWL H;  4DT4 A;  3A85 A;  3DD2 H;  1O3D A;  2A5I A;  1N8O B;  5EQS A;  1O3L A;  3RC5 A;  3SUE A;  1BB0 B;  1UTM A;  3BEF B;  2ILN A;  1ANC A;  5EJ1 A;  1C5N H;  3B9F H;  2TPI Z;  1TBZ H;  1XKB C;  5KEC A;  1O2G H;  2PKA B;  2HGT H;  4DJZ B;  3RXD A;  2ZDM A;  1FY1 A;  2H9E H;  5EOK A;  3ZV8 A;  3KQB A;  1FNI A;  4Y8Y A;  1S0Q A;  5EPN A;  2DE8 A;  1GBL A;  3RXR A;  1V3X A;  2WPK S;  1BQY A;  1O38 A;  3SU4 A;  1V2W T;  4ABI A;  1K1L A;  4EST E;  3QTO H;  1THS H;  1XUK A;  4ZHA A;  1YLN A;  1TGT A;  1AB9 C;  1ZGV A;  1RTK A;  3GY4 A;  3HPT B;  2UUJ B;  4RN6 A;  1A46 H;  4JYU H;  3ZZ8 A;  1UTL M;  1O35 A;  1HV7 A;  4MVN A;  1XVO A;  4K1E A;  3KGP A;  1BTX A;  1P3C A;  2HNT E;  1YPL H;  4MTB A;  4Q2K A;  4NFF A;  2J92 A;  4GCH F;  4Y0Z E;  1J15 A;  2Z94 A;  2F9U A;  3F1S B;  2GVF A;  1O3F A;  2Z9L A;  1GHA G;  1GI2 A;  3KYF A;  1O2O A;  4CBO A;  1H9L B;  1F5L A;  1UVO A;  4KP0 A;  1SHY A;  3DSG A;  3PRO A;  2P59 A;  4MNV A;  1QQ4 A;  3MU8 A;  1AKS B;  2WPH S;  3EST A;  3P8F A;  3RP2 A;  3W1E A;  5F8X A;  1VGC B;  1CO7 E;  2OIN A;  2AH4 X;  4ISN A;  3JZ2 B;  2B9L A;  2BMG B;  1Y3X A;  1TGN A;  1FDP A;  1NES E;  5E2P A;  1L4D A;  4ZXX H;  1O36 A;  1A5G H;  4DCD A;  1C4U 2;  5J4S A;  3QZR A;  5PTP A;  1YKT A;  1EZU C;  4A1V A;  2Y82 A;  4ABH A;  2ZO3 H;  1QNJ A;  2JIZ D;  1NU9 A;  3O8D A;  1WAY B;  1O3C A;  1NU7 B;  1BBR E;  1DWE H;  1HGT H;  2QXI A;  3UIR A;  6GCH F;  1ZJK A;  3ZYE A;  2HLD D;  5DP3 A;  1LMW B;  3E0N B;  3VGC B;  3RXH A;  2QAA A;  4OS4 A;  4BTI B;  1GI8 B;  1SGQ E;  2PGQ B;  2FOG A;  3EAJ A;  3TPI Z;  2ANY A;  1V2P T;  7EST E;  3A89 A;  1LTO A;  2HNT C;  2F9O A;  2NU3 E;  4AYY B;  4ABE A;  3F2H A;  2IN2 A;  4B74 A;  3FN8 A;  4X8U H;  1W13 U;  2HVY B;  3UWJ H;  2GCH F;  2ZDN A;  2BD2 A;  1BTH H;  2QCY A;  1SLV B;  1WBG B;  2JJ2 D;  1KY9 A;  3MH6 A;  5AFZ H;  1IQN A;  4YT7 H;  1FY8 E;  1Y3Y A;  1HAZ B;  1TGB A;  1Y5A T;  1CGH A;  2ZU4 A;  1QZ8 A;  4ZHL U;  1QCP A;  1GBB A;  1ZPZ A;  3SU5 A;  3QGN B;  2VU8 E;  1XMN B;  5GWZ A;  1RGQ A;  1WQS A;  1WSS H;  2XW9 A;  4B2A A;  3SHC H;  2FLB H;  5B6L A;  1H8D H;  3LGV A;  3E1X B;  1VIT F;  2HVX A;  3EA7 A;  1RS0 A;  1HAX B;  3LDX H;  1ELV A;  2FX4 A;  1AN1 E;  2TGA A;  1IQK A;  1EZQ A;  1Y3V A;  4WF8 A;  4CHA C;  1TNH A;  1LVM A;  2ZHE H;  3A7Z A;  3SV2 H;  3RXL A;  3PMB B;  2GMT C;  2OCV B;  1Z1I A;  4OS6 A;  1NBM E;  3NUM A;  2KCP A;  1YPM H;  1P2I A;  2STA E;  3TNS A;  1BIO A;  2BDB A;  3SUD A;  2KR7 A;  6LPR A;  2QF4 A;  2NU4 E;  3SU3 A;  4AFS A;  1AO5 A;  2Y81 A;  4K1T A;  4A5T S;  1OP0 A;  2BY6 X;  2BD4 A;  1P10 A;  2BX4 A;  5HYO A;  5I46 H;  3KEE A;  3STI A;  7LPR A;  1FXY A;  4TPY A;  5E0H A;  2KCO A;  3PWB A;  8GCH G;  2P8O B;  3RMM H;  1LHG H;  2FYQ A;  2GCT B;  1GJB B;  1GDU A;  1VJ9 U;  3H7T A;  1HJ9 A;  4ASH A;  2XXL A;  4WMD A;  2J98 A;  5GDS H;  4X1Q U;  2ZF0 H;  2G4T A;  2R2M B;  3D23 A;  1O39 A;  1MAY A;  1UO6 A;  1C1V H;  1ZSJ A;  1ZTL A;  3AVZ A;  3KF2 A;  5A09 A;  3DCL A;  4YZU A;  5EW2 H;  1GDN A;  4NA9 H;  1S83 A;  5LH8 A;  2M5T A;  2C8Y B;  3F9E A;  2J9N A;  3LOX A;  4WXI A;  4ABB A;  4JYT A;  1GHA F;  9EST A;  1UVS H;  1DY9 A; 
#chains in the Genus database with same CATH homology
 3RC5 A;  3SUE A;  1E79 D;  3WWF A;  3WW7 A;  2A4R A;  3FO8 D;  3U1I B;  2JJ1 D;  2OBO A;  3F2F A;  3F2H A;  3KNX A;  3SV8 A;  4NWL A;  3GS9 A;  3FN8 A;  4B74 A;  1W0J D;  2OC7 A;  2XND D;  1H8H D;  4KTC A;  4NWK A;  4I33 A;  5EQR A;  4YXW D;  5CDF E;  4B75 A;  3SU1 A;  3E90 B;  1E1Q D;  2CK3 D;  3OEE D;  4A1T A;  4R8T B;  2V7Q D;  1MAB B;  3NRL A;  3PRB A;  4B6F A;  2JJ2 D;  2KM0 A;  3O8B A;  4K8B A;  1SKY E;  3DSO A;  3LKW A;  3P8N A;  4XD7 D;  4M9F A;  5EPN A;  5FL7 D;  5FPS A;  5IDK A;  2QF5 A;  3H09 A;  2WHX A;  4I31 A;  3N7D A;  1COW D;  3OEH D;  3OE7 D;  3LON A;  4WH6 A;  3EYD A;  3SU4 A;  4B73 A;  5T1V A;  1DXP A;  3M5O A;  2KCY A;  3OFN D;  3SU5 A;  5H4I B;  5DN6 D;  3OAA D;  2F4L A;  3F3B A;  3UB0 A;  1RGQ A;  3M5M A;  2KFW A;  2WV9 A;  2K0Q A;  2IJO B;  4B6E A;  5GND A;  3N7E A;  2OC0 A;  5B6L A;  2O8M A;  2IJD 1;  3SU0 A;  2K8I A;  4ASU D;  3PV5 A;  1RTL A;  3F0P A;  3SYJ A;  4F55 A;  3PRD A;  2OK5 A;  4WF8 A;  5C0T A;  2YOL A;  5FPT A;  1DXW A;  1KMH B;  4Q63 A;  5EPY A;  2J5U A;  1JXP A;  1E1R D;  3O8C A;  3KN2 A;  3SV7 A;  1NBM E;  3PV2 A;  3RC4 A;  3SZE A;  1S6L A;  2KCP A;  3AK5 A;  3SUD A;  3U1J B;  2F9U A;  3M5L A;  2KR7 A;  1DY8 A;  2GVF A;  2QF4 A;  2WZQ A;  3SU3 A;  3SUG A;  4A92 A;  4ZCN A;  2A4G A;  3SU6 A;  2YMS B;  2OBQ A;  1EFR D;  5ETX A;  5C0U A;  2GGV B;  2XCN A;  2AHM E;  2K1Q A;  1BT7 A;  2VBC A;  3OTP A;  5EQQ A;  2P59 A;  3FKS D;  5ESB A;  5F53 A;  5GPI B;  4B76 A;  3KEE A;  3OYP A;  2OC8 A;  5DSF A;  3W1E A;  1NS3 A;  2KCO A;  4TT3 D;  1W0K D;  1A1R A;  1OHH D;  4WH8 A;  2OIN A;  2YMS C;  1W3C A;  2YMS D;  2LEL A;  4OM9 A;  1H8E D;  3RC6 A;  4Z1M D;  2W6I D;  5C17 A;  2M2A A;  2F9V A;  2XOK D;  4TYD A;  4Q4L A;  3L6P A;  3WWB A;  2FM2 A;  4A1X A;  2FOM B;  1BMF D;  3DSP A;  3N99 A;  1NBM D;  4I32 A;  4RI0 A;  5CHB A;  3SV9 A;  2KCA A;  5FPY A;  4A1V A;  3SUF A;  3O8R A;  2OC1 A;  2L6O A;  3O8D A;  2JIZ D;  3VG8 A;  3FOA A;  4B71 A;  5IK2 D;  1CU1 A;  4TSF D;  4U01 A;  2QV1 A;  3KF2 A;  3M5N A;  2FP7 B;  4JMY A;  3DCL A;  3SU2 A;  3F0O A;  2XNI A;  5GJ4 B;  2WSS D;  3SV6 A;  2HLD D;  4FET A;  2F43 B;  5HKK D;  2XCF A;  2WPD D;  4DT4 A;  3LOX A;  2A4Q A;  1N1L A;  1WXR A;  3P8O A;  2JDI D;  2W6J D;  3F2G A;  1DY9 A;  2QE7 D;  3ZIA D;  2KZ4 A;  5EQS A;  1FX0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...