2K0QA

Solution structure of copk, a periplasmic protein involved in copper resistance in cupriavidus metallidurans ch34
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
74
structure length
74
Chain Sequence
VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEALRKGHSEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structure and metal-binding properties of the periplasmic CopK protein expressed in Cupriavidus metallidurans CH34 during copper challenge.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Metal binding protein
molecule keywords Putative uncharacterized protein copK
total genus 16
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2008-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2k0qA00
3N7DA 2KM0A 3DSOA 2K0QA 3N7EA 2LELA 3DSPA
chains in the Genus database with same CATH superfamily
3WWBA 2Y5GA 1MKWK 4GUXA 3ATLA 3AAVA 5EOKA 1F2SE 3A8AA 3QWCH 3RC5A 2IOTA 1ORFA 1AKSA 1BRUP 4I33A 1H4WA 1A46H 1CT0E 4X0WU 5F53A 2WPLS 1EKBB 1BBRE 3E16B 1S85A 3Q3YA 2FYQA 1GBKA 1JMOH 2XC5A 4ZROA 3MH5A 3RXMA 2XC0A 4IC6A 5DG6A 1DY8A 4VGCC 2F91A 3TJNA 3RXVA 1NFWA 2VB0A 2J97A 4X1PU 3SORA 2W3KA 5EJLA 4O03A 2HVXA 3SHCH 2NU3E 2A4GA 2ZDMA 5J4QA 1C2MA 1C5UA 1QB6A 2BHGA 2HOBA 1H8HD 2WV4A 3ZZDA 4X1SU 1FDPA 2ZDKA 4Y79A 4ABBA 1UMAH 4ZAEA 1GHBG 1GI9B 2XBVA 2Y81A 1TGNA 2GCHG 3LT3A 1O3PB 3KQEA 2VIVA 3QUMP 1LHFH 3VB4A 1XXFA 1GJ7B 4H6SB 1GVZA 1O3NA 1B7XB 3RXPA 2QF4A 1T4UH 1YC0A 1D4PB 1QL7A 3TNSA 3ZZ3A 1GJAB 1JBUH 2VIPA 1C2EA 4IGDA 2QE7D 1DY9A 4TY6A 4GHTA 2KCPA 1VGCB 2BDGA 4NG9H 1HAZB 4DURA 2IJD1 2JH0D 1EJAA 2QCYA 2WPMS 2A2QH 1YM0A 1KXAA 3GY7A 5BRRE 2KAIB 1A0LA 9ESTA 1K1LA 1C9TA 1LTOA 2D26C 3E1XB 3ZVBA 1YPHC 4MNVA 3GDUA 3UREA 2CMYA 3ZV8A 4YZUA 2YNAA 3GDVA 3SV9A 3NPSA 1HYLA 1P10A 3KYGA 1ZSJA 3OY6U 1C5WB 2Q6FA 1NPMA 2A5AA 1ZPBA 3H09A 1NTPA 3SOSA 1CA0C 1DVAH 1GL0E 3FP7E 3K9XB 4KTCA 2W7SA 3SU5A 3ZV9A 5A8YA 4Q7YA 1GCTB 2Z9KA 3V13A 2ZGJA 3SU4A 3M5MA 1BITA 2ZFSA 1AN1E 2OC7A 2C8YB 4X2VA 2H9EH 3RXLA 1OX1A 1QGFA 1LVOA 2A32A 5FBEA 3SJIA 1Z71A 3KIDU 3SNAA 1QJ6B 1EJNA 4O3UA 1C5TA 1NRQH 2OQUA 1A7SA 1BTUA 5DP9A 1S5SA 1GCDA 2GTBA 1F0UA 1XUKA 1TA6A 1MTSA 6ESTA 3TK9A 1EPTB 5FX5A 2L6OA 2G4UA 1WTHD 1MMJN 1DDJA 3NZIA 1O3FA 2VVUA 1O3JA 2P94A 5C17A 2CHAC 1EB2A 3A85A 2UUKB 1HXFH 4BNRA 2YOLA 5GNDA 1GI7B 1LPZB 4E7NA 3SJOA 1CT4E 4ZXYH 1SLWB 4GVUA 5JDUB 3KEEA 4TT3D 2OBOA 2TGPZ 1ZPCA 4K5ZA 1KXFA 1TQ0B 1IAUA 2FI4E 1TGBA 2OTVA 1P03A 4D9RA 3K6YA 1MD8A 1TWXB 1AHTH 3E90B 4ACBA 4FVDA 1QCPA 4Y71A 3N7EA 3VXEH 4XBCA 2GZ9A 4O9VA 2BVXH 2W6ID 3KN2A 1V2NT 1J17T 4I8JA 1O38A 1A0JA 1O30A 3SV6A 2F9PA 2W3IA 3SZNA 1AQ7A 3LH3A 5C5NA 3VXFH 1D3TB 1DXPA 2Y5FA 3HATH 4NFFA 2AFQB 1GDUA 3RXGA 2DE9A 3TJOA 1GJ8B 5DP6A 2FXRA 1FN8A 1W7XH 2WPJS 1C5SA 1CBWB 1ZHMA 2HRVA 1ELCA 2AS9A 5GDSH 5EXLA 3A87A 1SG8B 1C2JA 3LGTA 3GCHB 1F0TA 3ODDA 1G2MA 4Y10E 1IQFA 1BIOA 3U9AH 3UWJH 2HPPH 3ZZ5A 2ZO3H 6CHAB 1Y5BT 1NRSH 1RTKA 1YBWA 3FANA 3MO9A 2BDHA 1AO5A 1AWFH 1T7CA 7LPRA 3EA9A 4FU7A 3MHWU 3NRLA 4XRNA 4Y0ZE 1L2EA 1SQTA 2BX3A 3GS9A 1L1GA 1EZSC 1X7AC 1P0SH 1HAPH 3N99A 4ZMAH 2CF8H 2FS9A 5FXLA 2ZU4A 1DLEA 4I31A 1TNJA 3ZYDA 3A81A 1WQSA 1ZYOA 2RA0A 1SL3A 3BTEE 2HNTE 2A7CA 3RP2A 3LGYA 1HCGA 5FCRA 1TMTH 3Q00A 4XSKU 1NM6A 3V0XA 1O2PA 1FI8A 1XMNB 1OWKA 2PUXB 1NO9H 4FUDA 2I6SA 3RXCA 4BTUB 2AERH 2ZCLP 1C9PA 1VITF 2OQ5A 2H5CA 2LELA 1CA0B 1AFQB 2F83A 1XUGA 2B0FA 4IW4E 1MH0A 1YYY1 1GGDC 1P9UA 1OWHA 3SU0A 5IK2D 3M7TA 4Y7BA 1QJ1B 4CRBA 1DXWA 1TLDA 1G3CA 3GCTF 1KXCA 5EQSA 3PRBA 1DPOA 1A5GH 1RD3B 1T32A 4B73A 2WV9A 2ZCKP 2K1QA 3EA8A 4AZ2B 3SV2H 1HAOH 1EOJA 1QRZA 2WPHS 1TBQH 1ABJH 2WPKS 5F8ZA 3BIVH 4Y6DA 2TPIZ 4DIHH 1EAUA 1ZJKA 1E37B 4DJZB 5FL7D 4XBDA 2SGPE 2ZDVH 1O2OA 1UO6A 3TK5A 4ABHA 1GBCA 1H8ED 2FOAA 1C5XB 3VEQB 4F4OC 1HXEH 2GMTC 6LPRA 1D3PB 3U1JB 1W7GH 4MQAA 2UWLA 4ISLA 2OP9A 5ETXA 4AX9H 5EXMA 3A8DA 1UCYH 5AF9H 2ZTZA 3SQEE 2CF9H 1PPGE 3K6ZA 1O0DH 3BTGE 4INKA 2ANYA 4AB9A 1GI3A 1RIWB 1EAWA 2BD4A 2GJGA 3UUZA 1C5VA 1AY6H 2CN0H 3L6PA 4A1TA 4YLUA 3TU7H 2PSXA 2F9UA 1C2KA 1LVMA 4K1SA 5AVDA 2GVFA 2CJIA 1A61H 2WSSD 2EEKA 2ALPA 2D8WA 1GJBB 2RA3A 1CGJE 1WAYB 1YLDA 1NFUA 1DLKB 4WVPE 3VGCC 4WF8A 2BDCA 3E0NB 2OC0A 2XCNA 3WY8A 2ZDLA 1TA2A 1GDQA 1Y3VA 2GP9B 2XBWA 1B0EA 3QX5H 4AYYB 4FU9A 1MTNC 1XUIA 1S83A 1UTQA 2SNVA 2WZQA 1NT1A 1ZJDA 3F0OA 4UDWH 1EOLA 1ZOMA 1GBIA 3DFLA 1INCA 1IOEA 1QA0A 4Y11E 2J34A 3SGQE 2VH6A 2G52A 1PPCE 3P8OA 3VGCB 1HGTH 3GY6A 4BXSA 1TRMA 1O5EH 1BT7A 3CNRA 1O36A 1VITH 2AGGX 2IPHA 4AG1A 2J38A 3HK6B 1WBGB 5I46H 1ZHPA 2ZHQH 1EPTC 2J4IA 5HGGA 1QB9A 4OS1A 4TPIZ 5CMXH 2ZU2A 3MH6A 5DP5A 3PWBA 3SHAH 1ZGIA 1DWBH 4BANB 2ZFFH 4AYVB 1O5GH 4CBNA 3ZVCA 2FESH 1QQ4A 1C2HA 3IWMA 3A7ZA 2A2XH 2F3CE 1B5GH 1OKXA 4JK5A 3FAOA 1UCYK 5E0HA 2HWLB 1AUJA 3EAJA 1F0RA 5A0BA 1NS3A 1F92A 2UWPA 1T4VH 3OAAD 3PLPA 4ISOA 5HYOA 1YKTA 2YNBA 3A80A 1ZTLA 5T1VA 1O3HA 3A8CA 2TGTA 5JYIA 1O33A 2C90B 1V2QT 4UONA 3EGKH 1K1MA 1O2ZA 1UK3A 1DWDH 1K1JA 1YPMH 3ZZ6A 3BV9B 3PLKA 3S9AA 2BQWB 4FU8A 1TNLA 1WU1A 1H1BA 1C4Y2 2BD5A 3T29A 1ANDA 4F55A 2JH5D 5FPSA 1NBME 1C1TA 1XXDA 1OWDA 3EA7A 3FN8A 4JZ1A 2P16A 2TGAA 3MNSA 1EZUC 1O3KA 5EIYA 3E3TA 1E1QD 1H9LB 1GMDF 1O5AB 1P09A 1GJ9B 3P8NA 1SQAA 2ZECA 5JPMH 3OSYA 3CS0A 1QURH 3RXOA 1BTXA 1G36A 2ANKH 4ZKOU 2UUYA 1J9CH 4OS2A 3M61U 5T6DA 2A7JA 5T6GA 1O37A 1S6HA 2ALVA 4MG3A 1UK4A 2BM2A 4UE7H 3SU2A 1QNJA 2F9OA 2BXTH 2ZU5A 4ZH8A 2VH0A 2BLQA 1BRBE 4U01A 4Q7XA 2FLRH 6GCHG 3S7HB 2DE8A 1JXPA 3GY4A 3OYPA 3JZ2B 4ZHAA 3LPRA 3A7YA 2LP6A 1HAYB 3LOXA 1YPJH 3KCGH 4GHQA 5FPYA 2PTNA 3D62A 1W0KD 1C1NA 1WQVH 2V0BA 3MO6A 1TMBH 1KLIH 2PKSC 4NCYA 1S6LA 1Y5UT 1VJAU 4NA8A 1Y8TA 2BB4A 2BY9X 3MNCA 1O3GA 1TABE 1YLNA 4FUCA 1YF4A 4K60A 4NSVA 1YP9A 1WYKA 1TB6H 1P12E 4Y8XA 4B76A 1ZLRA 1O2MA 5LH8A 1TMUH 3MWIU 1VITG 1TX8A 5AFZH 2BDAA 2W6JD 2WYJA 3BF6H 4CH8B 2Z9JA 5JBCS 3DSGA 3RXRA 2FZZA 4X6MA 2JIZD 1GHAG 1S0QA 4ISHH 2ZA5A 4Q7ZA 1O3LA 3M35A 4DT4A 4HTCH 3AK5A 3URDA 1S6FA 3ZZ8A 2A4RA 1MBQA 1WTGH 5DKMA 3L33A 3UQOA 2ODPA 4JYVH 1EUFA 1EPTA 1O3OA 5EG4A 3LJOA 3DCLA 1EX3A 4FETA 1NRPH 3F9EA 3BIUH 3QK1A 3F9GA 4OM9A 3BTTE 2O9QA 3LGVA 2C8XB 3UY9A 1TPPA 1HDTH 2VNTA 1LPKB 3TITA 3TIUA 1N1LA 4KTSA 1ID5H 3D49H 3T27A 2OC8A 4UFGH 3RXFA 1XVOA 1DICA 2G5NA 2G51A 3BG4C 2FIRH 1BOQA 3UOPA 3T2NA 2ZFRH 2BD9A 4P02A 1TNKA 3N7OA 3EE0B 2BVRH 3TLOA 3T5FH 3O8BA 2GT7A 3BTKE 5LPEA 1AFEH 2KM0A 3GDSA 2ANMH 5E0GA 5K7RA 3MU0A 4X1QU 2F9BH 1Y3XA 4YT7H 5TJXA 4IBLH 4AC9A 1TNGA 4DIIH 2ILNA 1IQKA 1GI5A 2NU4E 2UWOA 2QA9E 2CHAB 1YPLH 1SOZA 5HIYA 4CH2B 5IDKA 1NROH 1CA8B 3B23B 4I8KA 3TJVA 3W95A 3SN8A 5C94A 2KX4A 3RXJA 3UNRA 4OGYA 1SLXB 2ODYB 3MNXA 3ATKA 3SU1A 1G37A 2V3HH 2XWAA 3PRDA 1NZQH 1OWEA 2IJOB 2Z9GA 2FPZA 1JRSA 1GHXH 2QAAA 1TYNA 3ATMA 3E8LA 3QN7A 4LOYH 4RT0A 2R9PA 5HKKD 2ZWLH 3U8RH 3RU4E 5F6MA 4A7IB 1DITH 1FUJA 3SUDA 3DHKH 1GVKB 3VB3A 3MMGA 4DOQA 1NU9A 1JOUB 1SGRE 3PM3A 3TGIE 4BXWA 3KQ5A 2FTLE 4LXBH 3FO8D 3UFAA 1SQRA 1A0HB 2AGEX 4I7YH 2BDIA 2VIWA 1C1OA 3M3TA 1AE5A 1FLEE 1C5MD 2CV3A 1V2VT 1XUHA 3B8JA 4RKJB 1HV7A 3BTFE 2A5KA 4NIXA 3SJ9A 2J98A 1HFDA 3AASA 3C1KA 1G3EA 2ZFTA 1FV9A 1P3CA 2C3SA 1EZQA 1SGPE 5KGOA 5C3NA 4F49A 2OLGA 3GCNA 3DT0H 1OP2A 1PQ8A 2K0QA 4B2CA 3SNDA 3W1EA 1CGHA 2ZU3A 2PLXA 4X1NU 3NKKA 1O2IA 3E6PH 4UFFH 4X8VH 1ZR0A 5AHGH 4NZLA 5DK1A 3RLYH 3VFEA 3SU6A 1C5NH 1NN6A 2KCOA 4X8UH 1HAIH 5EXNA 1IQMA 1YPKH 3BEUA 4UD9H 4I8LA 3QTVH 2VGCC 2J9NA 1TBRH 3Q76A 4AFSA 2EI6A 1O3CA 1UTMA 2ZHEH 4FUJA 3AAUA 5DGJA 1WXRA 1IHSH 1W12U 2ZFPH 2HGTH 3R3GB 2PV9B 3UWIA 3OE7D 1GI4A 1MU6B 1C1WH 1C5YB 1CU1A 1O3DA 1W2KH 3KYFA 3SO3A 1O3BA 1LQEA 1SPJA 3DSPA 2ZC9H 2R0LA 1W11U 4QT8C 5FPTA 4CR5A 2XXLA 3U69H 3QO6A 2PKAA 2B9LA 1RJXB 4B2AA 2D1JA 3LONA 4OS6A 3A86A 4XD7D 3H7OA 3ODFA 4GPGA 1S84A 2R0KA 2V6NA 1HLTH 2AYWA 3P8GA 1U6QA 1V6DA 1W10U 1GJ6A 4AOQA 1Z7KA 4VGCB 1AGJA 2ZF0H 3RXUA 4K1EA 2GV7A 2TGDA 4Y76A 1NFYA 3L3TA 1H8DH 1ARBA 1QQUA 3V7TA 1SB1H 4BAKB 5K0HA 1RFNA 5GJ4B 3UNQA 3VB7A 1FAKH 4J1YA 1DE7H 1EZXC 3DFJA 3AW0A 1LPGB 2O8UA 2ZTXA 4ZHMU 2W5EA 1C1MA 3E0PB 2XRCA 1BTWA 4AG2A 3Q3XA 1VR1H 2KR7A 1CO7E 2SGDE 3BG8A 1L1JA 1V2UT 2TBSA 1MUEB 1AVXA 3BTME 2ZHFH 1NFXA 4UEHH 4FVBA 1K0HA 3ENSB 1SGTA 3P70B 1E36B 1FPHH 2VINA 2Z7FE 4DCDA 2H9HA 1BTPA 4Y8ZA 4CRAA 3DUXH 2XW9A 1TE0A 1Z8GA 4X6OA 1XUFA 3UIRA 2PWXA 1OP8A 3GY8A 1ZPZA 1IQJA 2OUAA 1FY1A 1LHEH 4CBOA 2BLOA 3B9FH 1D3QB 2IN2A 4B6EA 1T8LA 3GCHC 1MTWA 1IQIA 2STBE 1PPFE 5EJZA 1HIAB 4NIVA 1HBTH 4X2XA 3OFND 4AFUA 1A2CH 1V2OT 1BQYA 1QJ7B 4ABGA 2ZGHA 1AD8H 1JIMA 3A8BA 1F0SA 1S81A 1K1PA 4NZQA 1IQHA 1P2KA 5DN6D 4WMFA 1OYTH 1O2YA 1TAWA 2GKVE 5FAHA 4ABEA 1BMLA 3D23A 1Q31A 1N6YA 5C1YA 2SFAA 2G55A 1GHYH 1C5OH 1GMCG 2LNCA 3SUGA 4D7FA 1SI5H 2EQNA 3H7TA 2BD7A 2NU2E 2ZPQA 3UAIC 1QB1A 4JZFH 1XUJA 1K21H 5EU8A 4XDEA 8ESTE 2HALA 2ZU1A 1A4WH 1G9IE 1UVPA 2Q1JA 5ESBA 1H9IE 1P2MA 1D6WA 2G81E 2BZ6H 3PTBA 3KL6A 3M5NA 2ZPRA 3F3BA 5KEDA 1V2ST 2A31A 1H8IH 1ZHRA 1QTFA 1BDAA 4K8YA 4K2YA 1K2I1 1NC6A 4B75A 3S69A 1BTYA 1ZGVA 3KGPA 1XKAC 2NU0E 1ELGA 2J92A 1KMHB 1A3EH 1HAVB 2OINA 2AH4X 1TGCA 4KKDA 1HAXB 1K22H 4D9QA 3BEIB 4X2WA 4M7GA 3F2HA 1MCVA 4FUFA 3RLWH 1TIOA 1FY3A 2BVSH 2XOKD 1FY8E 1MKXK 1OPHB 3F0PA 1EASA 1RRKA 5SGAE 1NRNH 2PUQH 2GD4B 4X6NA 1ANEA 4DW2U 1WOFA 1TRYA 3GY5A 2A45B 1HJ8A 3S0NA 4XOJA 1GI8B 2O8TA 1W13U 5C20A 4AB8A 1GI0A 2SGAA 3GYMA 1GBHA 2BQ7B 5F8TA 1GHWH 1SKYE 1WCZA 4IN2A 2Z3DA 1O2GH 1P3EA 1J14A 3U28C 5FCKA 7KMEH 2ZQ1A 2EI7A 1C5RA 3N7DA 3RMLH 1K1OA 1KSNA 1E35B 2H5DA 1YCPH 1Z1IA 4XFQA 2FOMB 2QF3A 1P2JA 1UHBB 4BAHB 1BTZA 3O8RA 4CRFA 3UR6A 1OS8A 1GI6A 3F9HA 3LJJA 2OC1A 4WMDA 4X1RU 1PPHE 2FOFA 3MOCA 2PGBB 2JETC 1AVGH 2ZI2H 1G32B 2IPQX 2V7QD 3RXAA 2G00A 2GZ8A 5G4BA 1C5QA 1GBJA 2NU1E 1XKBC 3EE7A 1O2LA 1DS2E 4FUGA 4HGCA 3D65E 5CHAC 1DX5M 1C4V2 2XYAA 2KCAA 3ZVAA 2ULLA 1T8OA 2RG3A 3M7UA 3P95A 2PP6A 5IYTA 2ZNKH 4I86A 1Z8RA 2FOEA 1T31A 2ESTE 1RS0A 4E05H 2Y5HA 1GBDA 3NXPA 4A6LA 4NIWA 4X8TH 1AE8H 1DOJA 5I25A 3MO3A 4JZIA 3RU4D 1ZMLA 1NESE 1WUNH 3FKSD 3PYHA 1KXDA 3U98H 4HG6A 4DT7B 2ZFQH 1MQ5A 2O8MA 2R2MB 5T6FA 1CVWH 5JBTA 4RKOB 4RT1A 1BTHH 3P8FA 3CP7A 2SGFE 4E7RG 1GGDB 4P00A 2V3OH 3TNTA 2F9VA 4YESB 3TH2H 2ZZUH 2BY5X 2PGQB 3RU4T 3OEHD 1WV7H 5L30H 4WWYA 1EP5A 2AGIX 2BY6X 2A4QA 2FTMA 1W14U 3HGNA 2WUBA 2FI5E 1C4U2 1EXFA 3SGBE 1V2PT 3LKWA 4CRCA 4YTAA 1IQGA 1FQ3A 5CDFE 1SHYA 3FP8E 1BB0B 4ZKSU 5GCHF 1LO6A 1B0FA 1GBLA 1HB0B 1CHOF 3KQCA 1F5LA 1TPAE 1V2RT 4NWKA 4DG4A 1AU8A 1QRWA 2BYAX 5FHTA 3TJUA 5DO4H 4WMEA 4LK4A 1Y5AT 2EC9H 3FVFB 2ZHDA 2H2ZA 1KTSB 4YXWD 3EDXB 4MPXA 5A8ZA 5L2ZH 5GWZA 3BSQA 2AMDA 3UNSA 1BRCE 2XBXA 1SHHB 4MNXA 3RUOA 1GMDG 2FP7B 2C8ZB 2W26A 2SGEE 3DSOA 3PMBB 8LPRA 5DP8A 3TVJB 8GCHF 4FOUC 3VG8A 5B6LA 2GGVB 4KP0A 3ZVDA 1ESAA 5DPAA 1SGQE 1UW7A 5C67A 2BY7X 1KY9A 2XNDD 5T3HA 2WUCA 2VJ1A 1THRH 5GIBA 1GBEA 2RFKC 3F6UH 1Z1JA 1G30B 5LGOA 1LHCH 4ACAA 1HAGE 3ATIA 1BMAA 4TYDA 4DVAU 1IQLA 1AUTC 2XWBI 4ZKRU 1VKYA 4MLFB 1FIWA 3T62A 4AORA 2XTTB 4YM9A 4WJG2 1WDIA 1P11E 4TWYA 4ABJA 2M5TA 3FZDA 2VWOA 2FOCA 1V2LT 1SMFE 1DUAA 5GXPA 4PROA 1F5KU 2LPRA 1LKAA 3ZYEA 1OOKB 1P2NA 2VU8E 2J2UA 3DA9B 2YMSD 4AN7A 2JH6D 1PQAA 3MFJA 4ZCNA 2Y6TA 1ZMNA 1L1NA 3A82A 3LGWA 1C5PA 1O2KA 5L2YH 3OEED 4FUEA 1GBFA 2B5TB 3TH3H 3GY2A 5B6OA 5JB9S 1C2FA 1SQOA 1ELFA 1D3DB 1ELAA 3NUMA 5DJ7A 5HM2A 3C27B 1ZSLA 2P3TB 1O5DH 1C1VH 1MBMA 2AMPA 1FXYA 1ETTH 1OWIA 3BG4B 3MU4A 2A1DB 1C2DA 1O2TA 3BN9A 4H42U 3FZZA 1O2VA 2Z6BD 2Y82A 1SSXA 7ESTE 3SJ8A 1UTJA 1OWJA 4TPYA 3RMMH 4ZUHA 3ZZ4A 1SGYE 2CK3D 1XVMA 1E0FD 2OK5A 3M5OA 2F4LA 2WV5A 1YLCA 1YCPM 1W0ZU 1GG6C 2J5UA 1EAXA 3IITA 1LVBA 4TY7A 1GPZA 4WXIA 1AVWA 3EQ0H 1KXEA 1D6RA 3MH4A 1FN6A 1FONA 2FLBH 1VCWA 3OX7U 3DD2H 3GY3A 3M36A 3RXEA 1SVPA 1RIWC 5FBIA 2VVCA 1YGCH 3LDXH 1O2QA 4I8GA 9LPRA 2JJ2D 2GMTB 3HGPA 2XC4A 1Z8JB 1SGFG 1DFPA 1KDQA 1T8NA 1GJCB 1ZMJA 4IMZA 4KTUA 2FMJA 6GCHF 5A0AE 1RTFB 1LHDH 1N8OC 1LKBA 1A5HA 4GCHF 3SYJA 3T26A 3SI4H 2HPQH 3VB5A 2C4FH 1UVTH 4O97A 3RDZA 4FUBA 3FP6E 1TX6A 4CREA 3UTUH 3NWUA 4U2WA 2Z9IA 1L0ZA 3SV7A 1Y59T 3RXSA 3SU3A 2VWLA 5H4IB 1EJMA 2GCHF 3E91A 1VCPA 2A4OA 2R2WU 3SI3H 4OS4A 4ZXXH 5AFYH 3BTQE 2GV6A 1RTLA 4YOIA 2BMGB 3U8OH 2QYIA 4A92A 1EQ9A 1VZQH 4BAMB 5GCHG 5KECA 1P02A 2Y7XA 3I29A 2QY0B 5HIZA 4DY7B 2FOBA 3ZZ7A 1MKWH 1O2SA 1BMFD 1SGNE 3RXKA 1FY5A 4IMQA 3HK3B 1OP0A 4CRGA 1Y3YA 1FZZA 1RXPA 1F5RA 1LQDB 3SW2B 2H6MA 4H4FA 5HXFA 2BY8X 2GDDA 1E34B 1FMGA 1UTNA 4IC5A 3RXTA 1ELBA 1PQ5A 1GHAF 1AB9C 5TCAA 7GCHF 1TX7A 1PQ7A 5FX6A 1AKSB 1CQQA 1GJ4H 5DP4A 2YMSC 1MD7A 2OCVB 1CHGA 2VIQA 2ZIQH 4CHAC 1O2JA 1O5CB 1ZRBA 3QDZB 2QXIA 2FOHA 1BCUH 2XNIA 1QHRB 3MQKC 1Y3UA 1GJ5H 4MTBA 2RDEA 4ABDA 4SGAE 1FJSA 1O35A 1K1NA 3H5CB 2RDLA 4CHAB 4Y0YE 4H6TA 3PMHB 5PTPA 1V2TT 3VB6A 1TALA 1OSSA 3A83A 3A7VA 2FS8A 3LIWA 5JBBS 3UR9A 1EP6A 4XBBA 5HMAA 2KFWA 3S7KB 1C1QA 2ODQA 1O3AA 1TOMH 4THNH 4X6PA 2ASUB 1QBNA 2BLVA 3S9BA 1GMCF 2ZTYA 1SBWA 2EY4C 2XBYA 4ASUD 3SNBA 1YPGH 1O3MA 1SLUB 3OU0A 2OXSA 2EI8A 2QXHA 2R3YA 4WH8A 4K8BA 3NCLA 2Z3CA 2Q6DA 1GHBF 4BTTB 3RC6A 2QIQA 1M9UA 1TONA 3ZZCA 1MTUA 4J2YB 2FODA 1BHXB 1EAIA 2ZEBA 1C1UH 4ISNA 3HKJB 1SFIA 4Z0KA 1P2OA 1N6XA 2WPDD 4F48B 1IQEA 1NU7B 5DSFA 5C1XA 3ZVFA 3TGJE 1A5IA 1AI8H 1T8MA 1UCYE 2H1UA 2ZCHP 4Q4LA 4ASHA 1TNIA 3PO1C 4MDSA 1ARCA 4TWWA 4MPVA 4Q80A 2WPIS 3HPTB 2BOHB 2K8IA 3F68H 3M5LA 1P01A 1O2HA 1EB1H 4Z1MD 4UFDH 4D7GA 5CE1A 2RCEA 1TNHA 1NY22 1V2MT 5A09A 1JWTA 5E0JA 3OY5U 2EA3A 3UQVA 4UFEH 1TGSZ 4BAQB 1ETRH 1HJAB 3OTPA 1L4DA 2PSYA 3FOAA 2BQ6B 2KCYA 3GISB 5EPNA 1GBBA 2PTCE 2QF0A 5C0UA 3QTOH 3ZZAA 1J16A 1UHBA 3ZZ9A 1DT2A 2ZDAH 1XM1A 5LPFA 1MABB 3NK8A 4A1XA 1O3IA 1LMWB 4GSOA 4ISIH 1SR5C 1G2LA 3STJA 3SZEA 1BA8B 1THSH 1TFXA 5EW2H 4B2BA 2AIPA 1C1RA 1PYTD 1CHOG 3A7TA 1ELDE 3TH4H 3RM0H 1QZ8A 1DSTA 2KAIA 3KQDA 2WYGA 3T28A 2BD8A 1COWD 2B7DH 3ESTA 3QLPH 3PROA 2A0QB 3MNBA 2P8OC 3A88A 4NSYA 1AWHB 1RGQA 5F03A 2AHME 3KHVA 4CR9A 4B71A 2F43B 4SGBE 1SGEE 3F9FA 1V2WT 2R3UA 3UB0A 4KGAA 2W7UA 2VIDA 3QGNB 2FX6A 1ANCA 1ELTA 3KNXA 5HM9A 3R0FA 1JIRA 4HFPB 4R0IA 3U8TH 1ZSKA 4INLA 4YOJA 2HNTC 8KME2 4WXVA 1SOTA 3Q3KA 5ABWA 1HUTH 2P95A 4TSFD 1E79D 3BTDE 1E1RD 1O2XA 1P2QA 2F9NA 4D76A 3GICB 1N8OB 2ZP0H 2J98B 1YWUA 1O32A 1HRTH 2HNTF 1QBOA 4AGJA 1GG6B 1C5LH 2GDEH 5C1UA 2Z3EA 3MTYA 3MYWA 3Q77A 1SGCA 1BMMH 4CRDA 3ATWA 4NA7A 1LDTT 4XE4A 1BBRK 2FDAA 4OGXA 3PWCA 2WHXA 1SLVB 3BTWE 1CBWC 5JB8S 3SJKA 3M3VA 3ZZBA 3FFGA 1PPEE 4K3JA 2G4TA 1P57B 7GCHG 1SGFA 2VWMA 4AFZA 2BD3A 2QV1A 1KDQB 4O3TA 2P59A 5CHAB 2XCFA 1MQ6A 2PKSB 1QL8A 4DGJA 1D9IA 3RXDA 1VJ9U 3O8CA 1K28D 3K65B 3V12A 3RMNH 3QZQA 1P05A 1YPEH 1XX9A 1TPSA 4I32A 1J15A 3S9CA 2UUJB 3WWFA 4BOHA 1TPOA 4Y7AA 2Z9LA 1FX0B 2PW8H 4YO9A 3V3MA 4KELA 2PR3A 3A84A 1BUIA 3A7WA 4JYTA 4MNYA 3IG6B 4U32A 2PHBA 1CGIE 1QR3E 1PJPA 2VWNA 4ZHLU 2JETB 3MU5A 1PYTC 5EODA 1K9OE 4X8SH 1HPGA 1HAHH 3UOUA 4ESTE 1L4ZA 2CXVA 4AGKA 4OS5A 1CT2E 5EQQA 2P8OB 1UTLM 3O8DA 1K1IA 2GT8A 1C5ZB 1TOCB 1P9SA 4X2YA 4B74A 1OXGA 3JZ1B 1A1RA 1UK2A 1AMHA 1SGDE 4ABFA 3PV2A 3BTHE 1UVUH 3ITIA 3AW1A 3TK6A 1FIZA 2QF5A 1QY6A 5E2PA 1LHGH 1W8BH 3MU1A 2VGCB 3M3SA 1GCTC 3PMJA 5E8EH 1OYQA 1BMNH 1KIGH 4AFQA 1VCQA 2HVYB 5EJ1A 2QC2A 2I6QA 4FUHA 3P6ZB 4YOGA 1DM4B 1H9HE 2UUFB 1BHXF 1KYNA 2SNWA 4A1VA 1MAXA 1ELEE 2C8WB 4D8NA 1GBAA 1CE5A 2G8TA 1Z6JH 1QIXB 2CGAA 1AFQC 1QBVH 2PKAB 4FUIA 1S82A 2O8LA 1YPHE 2QN5T 1O5FH 1P04A 4M9FA 3P17H 4E06H 3RXBA 1J8AA 1BZXE 3LC5A 4RSPA 3SGAE 3T25A 1YCPK 4ABIA 5DP7A 2V3MA 3MH7A 2Z94A 1GVLA 2VBCA 2Y80A 1C1PA 3LGUA 2BD2A 1GHVH 4NWLA 1SC8U 5EQRA 2VVVA 1V2KT 1MZAA 2Q6GA 2SGQE 1F7ZA 3K2UA 2P93A 1ANBA 3RC4A 4WH6A 1NRRH 1TRNA 3SUFA 3PV4A 3SV8A 3TGKE 1C1SA 1AZZA 2ZKSA 5C0TA 2ZPSA 1AZ8A 3EYDA 1A3BH 3F2GA 6CHAC 4MNWA 4A5TS 1MTNB 1MCTA 3URCA 1DWCH 1Z8IB 1P06A 3A7XA 1FPCH 2J95A 3STIA 1O2UA 1O39A 2WINI 5L6NH 1WSSH 2B8OH 1CSOE 2QXGA 5C2ZA 2OD3B 1GJDB 1FY4A 4HI3A 3PTNA 3BEFB 3MI4A 1SGIB 4JYUH 3SBKA 4NIYA 4Q2KA 5EGMA 2BDYA 1DWEH 1O2NA 1FAXA 1UVSH 2FEQH 2JKHA 1KTTB 2VIOA 4INHA 1O34A 1ZZZA 3GCOA 2ZDNA 5EW1H 2A7HA 5J4SA 1MTVA 1ACBE 2J94A 1W3CA 2H9TH 4BAOB 1HJ9A 3GCTG 1ESTA 5DP3A 5GPIB 2D2DA 3ZVEA 1E38B 4RI0A 4B1TA 2BZAA 1BBRH 2GCTB 5A8XA 3M37A 4JCNA 1C2LA 1TQ7B 2GX4A 1BRAA 2O8WA 1AIXH 4BTIB 1MAYA 1QRXA 1FNIA 1ELVA 1AB9B 3QZRA 1Q3XA 1KLTA 3CENA 2ZHWH 1GHZA 4GAWA 1LVYA 3GYLB 4LZ1H 5JBAS 3OTJE 2QGRA 1ZRKA 3SUEA 1V2JT 1MKXH 2YMSB 4LZ4B 1S0RA 2BXUH 3LH1A 3WW7A 1C2GA 2GCTC 3LU9B 1KLJH 3KF2A 2STAE 1MZDA 4Y8YA 3PV5A 3RXHA 3RMOH 5EPYA 3UPEA 1GMHG 2C93B 8GCHG 4MPWA 5C5OA 5LPRA 1TGTA 1O3EA 2KZ4A 4YT6H 2NWNA 1W0YH 1O2RA 3LC3A 4RN6A 4MVNA 4JK6A 3W94A 2TRMA 4NA9H 1PFXC 2ZQ2A 4NGAH 3SNCA 2P3UB 3PMAB 2ZG0H 4OS7A 2V35A 2FX4A 4YLQH 3QGJA 1G3DA 2HLCA 3ELAH 5F8XA 1LCYA 1DSUA 3F1SB 1IQNA 3GOVB 1HIAA 1TBZH 1DUEA 1HNEE 4IN1A 3I77A 1VGCC 1Z6EA 2ANWA 3PO1B 1ETSH 4NFEA 1GBMA 2BX4A 4WY3A 2P3FH 4IS5A 4K69A 2THFB 1ABIH 3M7QA 1DANH 1P2IA 1GDNA 2Y7ZA 1THPB 4U30A 3RXQA 3PB1E 1UJ1A 1HJAC 2AIQA 2BLWA 2G5VA 2TIOA 4I8HA 1JRTA 3AVZA 1GMHF 1IHTH 1ZTKA 3LGIA 4JZDH 2FOGA 2FI3E 1UTPA 1OHHD 5TCCA 2BTCE 4FXGH 3SNEA 4R8TB 5A2MH 1QFKH 1EATA 2DUCA 2A5IA 1G3BA 4K1TA 4JZEH 3RXIA 3A89A 4JMYA 2JJ1D 1O2WA 3ZIAD 1QA7A 2JDID 2PFEA 4B6FA 1SFQB 1PPBH 4ZKNU 3U1IB 1BJVA 1Q2WA 2BDBA 2ZGCA 1O5BB 1ZTJA 3MU8A 5BPEA 3P92A 5CHBA 1GL1A 2HLDD 1C2IA 2OBQA 3I78A 3TPIZ 3ZVGA 1NBMD 1KXBA 4MPUA 3HKIB 3VPKA 1HAVA 2ZGBH 1GI2A 1EFRD 2QXJA 1QL9A 1V3XA 2FM2A 4Z6AH 2FWWA 1MU8B 4ABAA 1PPZA 2FYRA 1P8VC 2FO9A 1O31A 1YY3A 3KQBA 1Y3WA 5A0CA 2AEIH 4GLYA 1UTKA 1UTOA 2GZ7A 2M2AA 1BJUA 5ESTE 1GBTA 3SQHE 1UVOA 2L74A 3RM2H 3CS7A 3F2FA 5E2OA 1ESBA 3PLBA 4HZHA 1W0JD 2BOKA 4GCHG 4Q63A 3G01A 2AMQA 1GWAA 1GI1A 2ZGXH
chains in the Genus database with same CATH topology
1MABB 3N7DA 3WWBA 4A1XA 4NWLA 3O8CA 2KZ4A 3SU5A 4KTCA 1E1QD 2CK3D 2OK5A 3RC5A 2F9UA 3M5OA 2F4LA 3OFND 5EQRA 4YXWD 4I32A 4I33A 3P8NA 3WWFA 3SU4A 2FOMB 2GVFA 3SZEA 2YMSC 3M5MA 2WSSD 3RC4A 1WXRA 4WH6A 1FX0B 3NRLA 5F53A 2J5UA 3SUFA 3O8RA 3SV8A 2OC7A 3GS9A 3O8BA 3OE7D 2FP7B 2KM0A 3DSOA 1CU1A 5C0TA 4WF8A 2OC1A 3EYDA 2XNIA 3F2GA 3N99A 5DN6D 2OC0A 2XCNA 3DSPA 4I31A 1DY8A 3VG8A 5B6LA 2GGVB 2V7QD 5FPTA 3SU2A 1COWD 3SUGA 2A4GA 5IDKA 2WZQA 2L6OA 2XNDD 4U01A 3LONA 3F0OA 4XD7D 1JXPA 1H8HD 2JJ2D 2KCAA 1RGQA 3OYPA 2AHME 5EQQA 3SU1A 2F43B 4B71A 3O8DA 3PRDA 5C17A 2KFWA 3UB0A 2IJOB 3P8OA 4B74A 3LOXA 5ESBA 5FPYA 1A1RA 1BT7A 2YOLA 5GNDA 5HKKD 3KNXA 2LELA 3PV2A 1OHHD 4TYDA 1W0KD 3SYJA 4R8TB 4ASUD 3M5NA 3F3BA 1S6LA 3SU0A 5IK2D 2QF5A 1DXWA 2QF4A 4JMYA 2JJ1D 3KEEA 4TT3D 2OBOA 3SUDA 4WH8A 4K8BA 3ZIAD 2JDID 1W3CA 3FKSD 5EQSA 3SV7A 3RC6A 3PRBA 4B75A 5GJ4B 3SU3A 4B6FA 4B76A 4A1TA 2QE7D 1DY9A 1E79D 4TSFD 5H4IB 3U1IB 4B73A 2WV9A 1E1RD 1KMHB 2KCPA 2O8MA 2OINA 3E90B 5GPIB 2W6JD 5CHBA 4RI0A 2HLDD 3FO8D 2WPDD 2OBQA 2YMSD 2K1QA 3F2HA 1NBMD 2JIZD 5DSFA 3N7EA 4ZCNA 2IJD1 1NS3A 4DT4A 4A1VA 2W6ID 3KN2A 4Q4LA 3AK5A 1RTLA 2F9VA 4A92A 2A4RA 3OAAD 1EFRD 2XOKD 3F0PA 3SV6A 3OEHD 5T1VA 2KR7A 3OEED 5FL7D 2FM2A 2A4QA 1BMFD 2K8IA 1H8ED 1DXPA 3M5LA 3DCLA 4Z1MD 2WHXA 4FETA 3SUEA 4M9FA 3LKWA 2YMSB 4OM9A 3U1JB 2K0QA 5ETXA 3W1EA 3WW7A 5CDFE 3OTPA 3SV9A 3FOAA 2KCYA 2M2AA 5EPNA 3KF2A 4F55A 1N1LA 2QV1A 3PV5A 5C0UA 3F2FA 5EPYA 5FPSA 1SKYE 1NBME 2P59A 2XCFA 4B6EA 2VBCA 1W0JD 4NWKA 2OC8A 4Q63A 3SU6A 2KCOA 3L6PA 3H09A 3FN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7D A;  2KM0 A;  3DSO A;  2K0Q A;  3N7E A;  2LEL A;  3DSP A; 
#chains in the Genus database with same CATH topology
 3WWB A;  2Y5G A;  1MKW K;  4GUX A;  3ATL A;  3AAV A;  5EOK A;  1F2S E;  3A8A A;  3QWC H;  3RC5 A;  2IOT A;  1ORF A;  1AKS A;  1BRU P;  4I33 A;  1H4W A;  1A46 H;  1CT0 E;  4X0W U;  5F53 A;  2WPL S;  1EKB B;  1BBR E;  3E16 B;  1S85 A;  3Q3Y A;  2FYQ A;  1GBK A;  1JMO H;  2XC5 A;  4ZRO A;  3MH5 A;  3RXM A;  2XC0 A;  4IC6 A;  5DG6 A;  1DY8 A;  4VGC C;  2F91 A;  3TJN A;  3RXV A;  1NFW A;  2VB0 A;  2J97 A;  4X1P U;  3SOR A;  2W3K A;  5EJL A;  4O03 A;  2HVX A;  3SHC H;  2NU3 E;  2A4G A;  2ZDM A;  5J4Q A;  1C2M A;  1C5U A;  1QB6 A;  2BHG A;  2HOB A;  1H8H D;  2WV4 A;  3ZZD A;  4X1S U;  1FDP A;  2ZDK A;  4Y79 A;  4ABB A;  1UMA H;  4ZAE A;  1GHB G;  1GI9 B;  2XBV A;  2Y81 A;  1TGN A;  2GCH G;  3LT3 A;  1O3P B;  3KQE A;  2VIV A;  3QUM P;  1LHF H;  3VB4 A;  1XXF A;  1GJ7 B;  4H6S B;  1GVZ A;  1O3N A;  1B7X B;  3RXP A;  2QF4 A;  1T4U H;  1YC0 A;  1D4P B;  1QL7 A;  3TNS A;  3ZZ3 A;  1GJA B;  1JBU H;  2VIP A;  1C2E A;  4IGD A;  2QE7 D;  1DY9 A;  4TY6 A;  4GHT A;  2KCP A;  1VGC B;  2BDG A;  4NG9 H;  1HAZ B;  4DUR A;  2IJD 1;  2JH0 D;  1EJA A;  2QCY A;  2WPM S;  2A2Q H;  1YM0 A;  1KXA A;  3GY7 A;  5BRR E;  2KAI B;  1A0L A;  9EST A;  1K1L A;  1C9T A;  1LTO A;  2D26 C;  3E1X B;  3ZVB A;  1YPH C;  4MNV A;  3GDU A;  3URE A;  2CMY A;  3ZV8 A;  4YZU A;  2YNA A;  3GDV A;  3SV9 A;  3NPS A;  1HYL A;  1P10 A;  3KYG A;  1ZSJ A;  3OY6 U;  1C5W B;  2Q6F A;  1NPM A;  2A5A A;  1ZPB A;  3H09 A;  1NTP A;  3SOS A;  1CA0 C;  1DVA H;  1GL0 E;  3FP7 E;  3K9X B;  4KTC A;  2W7S A;  3SU5 A;  3ZV9 A;  5A8Y A;  4Q7Y A;  1GCT B;  2Z9K A;  3V13 A;  2ZGJ A;  3SU4 A;  3M5M A;  1BIT A;  2ZFS A;  1AN1 E;  2OC7 A;  2C8Y B;  4X2V A;  2H9E H;  3RXL A;  1OX1 A;  1QGF A;  1LVO A;  2A32 A;  5FBE A;  3SJI A;  1Z71 A;  3KID U;  3SNA A;  1QJ6 B;  1EJN A;  4O3U A;  1C5T A;  1NRQ H;  2OQU A;  1A7S A;  1BTU A;  5DP9 A;  1S5S A;  1GCD A;  2GTB A;  1F0U A;  1XUK A;  1TA6 A;  1MTS A;  6EST A;  3TK9 A;  1EPT B;  5FX5 A;  2L6O A;  2G4U A;  1WTH D;  1MMJ N;  1DDJ A;  3NZI A;  1O3F A;  2VVU A;  1O3J A;  2P94 A;  5C17 A;  2CHA C;  1EB2 A;  3A85 A;  2UUK B;  1HXF H;  4BNR A;  2YOL A;  5GND A;  1GI7 B;  1LPZ B;  4E7N A;  3SJO A;  1CT4 E;  4ZXY H;  1SLW B;  4GVU A;  5JDU B;  3KEE A;  4TT3 D;  2OBO A;  2TGP Z;  1ZPC A;  4K5Z A;  1KXF A;  1TQ0 B;  1IAU A;  2FI4 E;  1TGB A;  2OTV A;  1P03 A;  4D9R A;  3K6Y A;  1MD8 A;  1TWX B;  1AHT H;  3E90 B;  4ACB A;  4FVD A;  1QCP A;  4Y71 A;  3N7E A;  3VXE H;  4XBC A;  2GZ9 A;  4O9V A;  2BVX H;  2W6I D;  3KN2 A;  1V2N T;  1J17 T;  4I8J A;  1O38 A;  1A0J A;  1O30 A;  3SV6 A;  2F9P A;  2W3I A;  3SZN A;  1AQ7 A;  3LH3 A;  5C5N A;  3VXF H;  1D3T B;  1DXP A;  2Y5F A;  3HAT H;  4NFF A;  2AFQ B;  1GDU A;  3RXG A;  2DE9 A;  3TJO A;  1GJ8 B;  5DP6 A;  2FXR A;  1FN8 A;  1W7X H;  2WPJ S;  1C5S A;  1CBW B;  1ZHM A;  2HRV A;  1ELC A;  2AS9 A;  5GDS H;  5EXL A;  3A87 A;  1SG8 B;  1C2J A;  3LGT A;  3GCH B;  1F0T A;  3ODD A;  1G2M A;  4Y10 E;  1IQF A;  1BIO A;  3U9A H;  3UWJ H;  2HPP H;  3ZZ5 A;  2ZO3 H;  6CHA B;  1Y5B T;  1NRS H;  1RTK A;  1YBW A;  3FAN A;  3MO9 A;  2BDH A;  1AO5 A;  1AWF H;  1T7C A;  7LPR A;  3EA9 A;  4FU7 A;  3MHW U;  3NRL A;  4XRN A;  4Y0Z E;  1L2E A;  1SQT A;  2BX3 A;  3GS9 A;  1L1G A;  1EZS C;  1X7A C;  1P0S H;  1HAP H;  3N99 A;  4ZMA H;  2CF8 H;  2FS9 A;  5FXL A;  2ZU4 A;  1DLE A;  4I31 A;  1TNJ A;  3ZYD A;  3A81 A;  1WQS A;  1ZYO A;  2RA0 A;  1SL3 A;  3BTE E;  2HNT E;  2A7C A;  3RP2 A;  3LGY A;  1HCG A;  5FCR A;  1TMT H;  3Q00 A;  4XSK U;  1NM6 A;  3V0X A;  1O2P A;  1FI8 A;  1XMN B;  1OWK A;  2PUX B;  1NO9 H;  4FUD A;  2I6S A;  3RXC A;  4BTU B;  2AER H;  2ZCL P;  1C9P A;  1VIT F;  2OQ5 A;  2H5C A;  2LEL A;  1CA0 B;  1AFQ B;  2F83 A;  1XUG A;  2B0F A;  4IW4 E;  1MH0 A;  1YYY 1;  1GGD C;  1P9U A;  1OWH A;  3SU0 A;  5IK2 D;  3M7T A;  4Y7B A;  1QJ1 B;  4CRB A;  1DXW A;  1TLD A;  1G3C A;  3GCT F;  1KXC A;  5EQS A;  3PRB A;  1DPO A;  1A5G H;  1RD3 B;  1T32 A;  4B73 A;  2WV9 A;  2ZCK P;  2K1Q A;  3EA8 A;  4AZ2 B;  3SV2 H;  1HAO H;  1EOJ A;  1QRZ A;  2WPH S;  1TBQ H;  1ABJ H;  2WPK S;  5F8Z A;  3BIV H;  4Y6D A;  2TPI Z;  4DIH H;  1EAU A;  1ZJK A;  1E37 B;  4DJZ B;  5FL7 D;  4XBD A;  2SGP E;  2ZDV H;  1O2O A;  1UO6 A;  3TK5 A;  4ABH A;  1GBC A;  1H8E D;  2FOA A;  1C5X B;  3VEQ B;  4F4O C;  1HXE H;  2GMT C;  6LPR A;  1D3P B;  3U1J B;  1W7G H;  4MQA A;  2UWL A;  4ISL A;  2OP9 A;  5ETX A;  4AX9 H;  5EXM A;  3A8D A;  1UCY H;  5AF9 H;  2ZTZ A;  3SQE E;  2CF9 H;  1PPG E;  3K6Z A;  1O0D H;  3BTG E;  4INK A;  2ANY A;  4AB9 A;  1GI3 A;  1RIW B;  1EAW A;  2BD4 A;  2GJG A;  3UUZ A;  1C5V A;  1AY6 H;  2CN0 H;  3L6P A;  4A1T A;  4YLU A;  3TU7 H;  2PSX A;  2F9U A;  1C2K A;  1LVM A;  4K1S A;  5AVD A;  2GVF A;  2CJI A;  1A61 H;  2WSS D;  2EEK A;  2ALP A;  2D8W A;  1GJB B;  2RA3 A;  1CGJ E;  1WAY B;  1YLD A;  1NFU A;  1DLK B;  4WVP E;  3VGC C;  4WF8 A;  2BDC A;  3E0N B;  2OC0 A;  2XCN A;  3WY8 A;  2ZDL A;  1TA2 A;  1GDQ A;  1Y3V A;  2GP9 B;  2XBW A;  1B0E A;  3QX5 H;  4AYY B;  4FU9 A;  1MTN C;  1XUI A;  1S83 A;  1UTQ A;  2SNV A;  2WZQ A;  1NT1 A;  1ZJD A;  3F0O A;  4UDW H;  1EOL A;  1ZOM A;  1GBI A;  3DFL A;  1INC A;  1IOE A;  1QA0 A;  4Y11 E;  2J34 A;  3SGQ E;  2VH6 A;  2G52 A;  1PPC E;  3P8O A;  3VGC B;  1HGT H;  3GY6 A;  4BXS A;  1TRM A;  1O5E H;  1BT7 A;  3CNR A;  1O36 A;  1VIT H;  2AGG X;  2IPH A;  4AG1 A;  2J38 A;  3HK6 B;  1WBG B;  5I46 H;  1ZHP A;  2ZHQ H;  1EPT C;  2J4I A;  5HGG A;  1QB9 A;  4OS1 A;  4TPI Z;  5CMX H;  2ZU2 A;  3MH6 A;  5DP5 A;  3PWB A;  3SHA H;  1ZGI A;  1DWB H;  4BAN B;  2ZFF H;  4AYV B;  1O5G H;  4CBN A;  3ZVC A;  2FES H;  1QQ4 A;  1C2H A;  3IWM A;  3A7Z A;  2A2X H;  2F3C E;  1B5G H;  1OKX A;  4JK5 A;  3FAO A;  1UCY K;  5E0H A;  2HWL B;  1AUJ A;  3EAJ A;  1F0R A;  5A0B A;  1NS3 A;  1F92 A;  2UWP A;  1T4V H;  3OAA D;  3PLP A;  4ISO A;  5HYO A;  1YKT A;  2YNB A;  3A80 A;  1ZTL A;  5T1V A;  1O3H A;  3A8C A;  2TGT A;  5JYI A;  1O33 A;  2C90 B;  1V2Q T;  4UON A;  3EGK H;  1K1M A;  1O2Z A;  1UK3 A;  1DWD H;  1K1J A;  1YPM H;  3ZZ6 A;  3BV9 B;  3PLK A;  3S9A A;  2BQW B;  4FU8 A;  1TNL A;  1WU1 A;  1H1B A;  1C4Y 2;  2BD5 A;  3T29 A;  1AND A;  4F55 A;  2JH5 D;  5FPS A;  1NBM E;  1C1T A;  1XXD A;  1OWD A;  3EA7 A;  3FN8 A;  4JZ1 A;  2P16 A;  2TGA A;  3MNS A;  1EZU C;  1O3K A;  5EIY A;  3E3T A;  1E1Q D;  1H9L B;  1GMD F;  1O5A B;  1P09 A;  1GJ9 B;  3P8N A;  1SQA A;  2ZEC A;  5JPM H;  3OSY A;  3CS0 A;  1QUR H;  3RXO A;  1BTX A;  1G36 A;  2ANK H;  4ZKO U;  2UUY A;  1J9C H;  4OS2 A;  3M61 U;  5T6D A;  2A7J A;  5T6G A;  1O37 A;  1S6H A;  2ALV A;  4MG3 A;  1UK4 A;  2BM2 A;  4UE7 H;  3SU2 A;  1QNJ A;  2F9O A;  2BXT H;  2ZU5 A;  4ZH8 A;  2VH0 A;  2BLQ A;  1BRB E;  4U01 A;  4Q7X A;  2FLR H;  6GCH G;  3S7H B;  2DE8 A;  1JXP A;  3GY4 A;  3OYP A;  3JZ2 B;  4ZHA A;  3LPR A;  3A7Y A;  2LP6 A;  1HAY B;  3LOX A;  1YPJ H;  3KCG H;  4GHQ A;  5FPY A;  2PTN A;  3D62 A;  1W0K D;  1C1N A;  1WQV H;  2V0B A;  3MO6 A;  1TMB H;  1KLI H;  2PKS C;  4NCY A;  1S6L A;  1Y5U T;  1VJA U;  4NA8 A;  1Y8T A;  2BB4 A;  2BY9 X;  3MNC A;  1O3G A;  1TAB E;  1YLN A;  4FUC A;  1YF4 A;  4K60 A;  4NSV A;  1YP9 A;  1WYK A;  1TB6 H;  1P12 E;  4Y8X A;  4B76 A;  1ZLR A;  1O2M A;  5LH8 A;  1TMU H;  3MWI U;  1VIT G;  1TX8 A;  5AFZ H;  2BDA A;  2W6J D;  2WYJ A;  3BF6 H;  4CH8 B;  2Z9J A;  5JBC S;  3DSG A;  3RXR A;  2FZZ A;  4X6M A;  2JIZ D;  1GHA G;  1S0Q A;  4ISH H;  2ZA5 A;  4Q7Z A;  1O3L A;  3M35 A;  4DT4 A;  4HTC H;  3AK5 A;  3URD A;  1S6F A;  3ZZ8 A;  2A4R A;  1MBQ A;  1WTG H;  5DKM A;  3L33 A;  3UQO A;  2ODP A;  4JYV H;  1EUF A;  1EPT A;  1O3O A;  5EG4 A;  3LJO A;  3DCL A;  1EX3 A;  4FET A;  1NRP H;  3F9E A;  3BIU H;  3QK1 A;  3F9G A;  4OM9 A;  3BTT E;  2O9Q A;  3LGV A;  2C8X B;  3UY9 A;  1TPP A;  1HDT H;  2VNT A;  1LPK B;  3TIT A;  3TIU A;  1N1L A;  4KTS A;  1ID5 H;  3D49 H;  3T27 A;  2OC8 A;  4UFG H;  3RXF A;  1XVO A;  1DIC A;  2G5N A;  2G51 A;  3BG4 C;  2FIR H;  1BOQ A;  3UOP A;  3T2N A;  2ZFR H;  2BD9 A;  4P02 A;  1TNK A;  3N7O A;  3EE0 B;  2BVR H;  3TLO A;  3T5F H;  3O8B A;  2GT7 A;  3BTK E;  5LPE A;  1AFE H;  2KM0 A;  3GDS A;  2ANM H;  5E0G A;  5K7R A;  3MU0 A;  4X1Q U;  2F9B H;  1Y3X A;  4YT7 H;  5TJX A;  4IBL H;  4AC9 A;  1TNG A;  4DII H;  2ILN A;  1IQK A;  1GI5 A;  2NU4 E;  2UWO A;  2QA9 E;  2CHA B;  1YPL H;  1SOZ A;  5HIY A;  4CH2 B;  5IDK A;  1NRO H;  1CA8 B;  3B23 B;  4I8K A;  3TJV A;  3W95 A;  3SN8 A;  5C94 A;  2KX4 A;  3RXJ A;  3UNR A;  4OGY A;  1SLX B;  2ODY B;  3MNX A;  3ATK A;  3SU1 A;  1G37 A;  2V3H H;  2XWA A;  3PRD A;  1NZQ H;  1OWE A;  2IJO B;  2Z9G A;  2FPZ A;  1JRS A;  1GHX H;  2QAA A;  1TYN A;  3ATM A;  3E8L A;  3QN7 A;  4LOY H;  4RT0 A;  2R9P A;  5HKK D;  2ZWL H;  3U8R H;  3RU4 E;  5F6M A;  4A7I B;  1DIT H;  1FUJ A;  3SUD A;  3DHK H;  1GVK B;  3VB3 A;  3MMG A;  4DOQ A;  1NU9 A;  1JOU B;  1SGR E;  3PM3 A;  3TGI E;  4BXW A;  3KQ5 A;  2FTL E;  4LXB H;  3FO8 D;  3UFA A;  1SQR A;  1A0H B;  2AGE X;  4I7Y H;  2BDI A;  2VIW A;  1C1O A;  3M3T A;  1AE5 A;  1FLE E;  1C5M D;  2CV3 A;  1V2V T;  1XUH A;  3B8J A;  4RKJ B;  1HV7 A;  3BTF E;  2A5K A;  4NIX A;  3SJ9 A;  2J98 A;  1HFD A;  3AAS A;  3C1K A;  1G3E A;  2ZFT A;  1FV9 A;  1P3C A;  2C3S A;  1EZQ A;  1SGP E;  5KGO A;  5C3N A;  4F49 A;  2OLG A;  3GCN A;  3DT0 H;  1OP2 A;  1PQ8 A;  2K0Q A;  4B2C A;  3SND A;  3W1E A;  1CGH A;  2ZU3 A;  2PLX A;  4X1N U;  3NKK A;  1O2I A;  3E6P H;  4UFF H;  4X8V H;  1ZR0 A;  5AHG H;  4NZL A;  5DK1 A;  3RLY H;  3VFE A;  3SU6 A;  1C5N H;  1NN6 A;  2KCO A;  4X8U H;  1HAI H;  5EXN A;  1IQM A;  1YPK H;  3BEU A;  4UD9 H;  4I8L A;  3QTV H;  2VGC C;  2J9N A;  1TBR H;  3Q76 A;  4AFS A;  2EI6 A;  1O3C A;  1UTM A;  2ZHE H;  4FUJ A;  3AAU A;  5DGJ A;  1WXR A;  1IHS H;  1W12 U;  2ZFP H;  2HGT H;  3R3G B;  2PV9 B;  3UWI A;  3OE7 D;  1GI4 A;  1MU6 B;  1C1W H;  1C5Y B;  1CU1 A;  1O3D A;  1W2K H;  3KYF A;  3SO3 A;  1O3B A;  1LQE A;  1SPJ A;  3DSP A;  2ZC9 H;  2R0L A;  1W11 U;  4QT8 C;  5FPT A;  4CR5 A;  2XXL A;  3U69 H;  3QO6 A;  2PKA A;  2B9L A;  1RJX B;  4B2A A;  2D1J A;  3LON A;  4OS6 A;  3A86 A;  4XD7 D;  3H7O A;  3ODF A;  4GPG A;  1S84 A;  2R0K A;  2V6N A;  1HLT H;  2AYW A;  3P8G A;  1U6Q A;  1V6D A;  1W10 U;  1GJ6 A;  4AOQ A;  1Z7K A;  4VGC B;  1AGJ A;  2ZF0 H;  3RXU A;  4K1E A;  2GV7 A;  2TGD A;  4Y76 A;  1NFY A;  3L3T A;  1H8D H;  1ARB A;  1QQU A;  3V7T A;  1SB1 H;  4BAK B;  5K0H A;  1RFN A;  5GJ4 B;  3UNQ A;  3VB7 A;  1FAK H;  4J1Y A;  1DE7 H;  1EZX C;  3DFJ A;  3AW0 A;  1LPG B;  2O8U A;  2ZTX A;  4ZHM U;  2W5E A;  1C1M A;  3E0P B;  2XRC A;  1BTW A;  4AG2 A;  3Q3X A;  1VR1 H;  2KR7 A;  1CO7 E;  2SGD E;  3BG8 A;  1L1J A;  1V2U T;  2TBS A;  1MUE B;  1AVX A;  3BTM E;  2ZHF H;  1NFX A;  4UEH H;  4FVB A;  1K0H A;  3ENS B;  1SGT A;  3P70 B;  1E36 B;  1FPH H;  2VIN A;  2Z7F E;  4DCD A;  2H9H A;  1BTP A;  4Y8Z A;  4CRA A;  3DUX H;  2XW9 A;  1TE0 A;  1Z8G A;  4X6O A;  1XUF A;  3UIR A;  2PWX A;  1OP8 A;  3GY8 A;  1ZPZ A;  1IQJ A;  2OUA A;  1FY1 A;  1LHE H;  4CBO A;  2BLO A;  3B9F H;  1D3Q B;  2IN2 A;  4B6E A;  1T8L A;  3GCH C;  1MTW A;  1IQI A;  2STB E;  1PPF E;  5EJZ A;  1HIA B;  4NIV A;  1HBT H;  4X2X A;  3OFN D;  4AFU A;  1A2C H;  1V2O T;  1BQY A;  1QJ7 B;  4ABG A;  2ZGH A;  1AD8 H;  1JIM A;  3A8B A;  1F0S A;  1S81 A;  1K1P A;  4NZQ A;  1IQH A;  1P2K A;  5DN6 D;  4WMF A;  1OYT H;  1O2Y A;  1TAW A;  2GKV E;  5FAH A;  4ABE A;  1BML A;  3D23 A;  1Q31 A;  1N6Y A;  5C1Y A;  2SFA A;  2G55 A;  1GHY H;  1C5O H;  1GMC G;  2LNC A;  3SUG A;  4D7F A;  1SI5 H;  2EQN A;  3H7T A;  2BD7 A;  2NU2 E;  2ZPQ A;  3UAI C;  1QB1 A;  4JZF H;  1XUJ A;  1K21 H;  5EU8 A;  4XDE A;  8EST E;  2HAL A;  2ZU1 A;  1A4W H;  1G9I E;  1UVP A;  2Q1J A;  5ESB A;  1H9I E;  1P2M A;  1D6W A;  2G81 E;  2BZ6 H;  3PTB A;  3KL6 A;  3M5N A;  2ZPR A;  3F3B A;  5KED A;  1V2S T;  2A31 A;  1H8I H;  1ZHR A;  1QTF A;  1BDA A;  4K8Y A;  4K2Y A;  1K2I 1;  1NC6 A;  4B75 A;  3S69 A;  1BTY A;  1ZGV A;  3KGP A;  1XKA C;  2NU0 E;  1ELG A;  2J92 A;  1KMH B;  1A3E H;  1HAV B;  2OIN A;  2AH4 X;  1TGC A;  4KKD A;  1HAX B;  1K22 H;  4D9Q A;  3BEI B;  4X2W A;  4M7G A;  3F2H A;  1MCV A;  4FUF A;  3RLW H;  1TIO A;  1FY3 A;  2BVS H;  2XOK D;  1FY8 E;  1MKX K;  1OPH B;  3F0P A;  1EAS A;  1RRK A;  5SGA E;  1NRN H;  2PUQ H;  2GD4 B;  4X6N A;  1ANE A;  4DW2 U;  1WOF A;  1TRY A;  3GY5 A;  2A45 B;  1HJ8 A;  3S0N A;  4XOJ A;  1GI8 B;  2O8T A;  1W13 U;  5C20 A;  4AB8 A;  1GI0 A;  2SGA A;  3GYM A;  1GBH A;  2BQ7 B;  5F8T A;  1GHW H;  1SKY E;  1WCZ A;  4IN2 A;  2Z3D A;  1O2G H;  1P3E A;  1J14 A;  3U28 C;  5FCK A;  7KME H;  2ZQ1 A;  2EI7 A;  1C5R A;  3N7D A;  3RML H;  1K1O A;  1KSN A;  1E35 B;  2H5D A;  1YCP H;  1Z1I A;  4XFQ A;  2FOM B;  2QF3 A;  1P2J A;  1UHB B;  4BAH B;  1BTZ A;  3O8R A;  4CRF A;  3UR6 A;  1OS8 A;  1GI6 A;  3F9H A;  3LJJ A;  2OC1 A;  4WMD A;  4X1R U;  1PPH E;  2FOF A;  3MOC A;  2PGB B;  2JET C;  1AVG H;  2ZI2 H;  1G32 B;  2IPQ X;  2V7Q D;  3RXA A;  2G00 A;  2GZ8 A;  5G4B A;  1C5Q A;  1GBJ A;  2NU1 E;  1XKB C;  3EE7 A;  1O2L A;  1DS2 E;  4FUG A;  4HGC A;  3D65 E;  5CHA C;  1DX5 M;  1C4V 2;  2XYA A;  2KCA A;  3ZVA A;  2ULL A;  1T8O A;  2RG3 A;  3M7U A;  3P95 A;  2PP6 A;  5IYT A;  2ZNK H;  4I86 A;  1Z8R A;  2FOE A;  1T31 A;  2EST E;  1RS0 A;  4E05 H;  2Y5H A;  1GBD A;  3NXP A;  4A6L A;  4NIW A;  4X8T H;  1AE8 H;  1DOJ A;  5I25 A;  3MO3 A;  4JZI A;  3RU4 D;  1ZML A;  1NES E;  1WUN H;  3FKS D;  3PYH A;  1KXD A;  3U98 H;  4HG6 A;  4DT7 B;  2ZFQ H;  1MQ5 A;  2O8M A;  2R2M B;  5T6F A;  1CVW H;  5JBT A;  4RKO B;  4RT1 A;  1BTH H;  3P8F A;  3CP7 A;  2SGF E;  4E7R G;  1GGD B;  4P00 A;  2V3O H;  3TNT A;  2F9V A;  4YES B;  3TH2 H;  2ZZU H;  2BY5 X;  2PGQ B;  3RU4 T;  3OEH D;  1WV7 H;  5L30 H;  4WWY A;  1EP5 A;  2AGI X;  2BY6 X;  2A4Q A;  2FTM A;  1W14 U;  3HGN A;  2WUB A;  2FI5 E;  1C4U 2;  1EXF A;  3SGB E;  1V2P T;  3LKW A;  4CRC A;  4YTA A;  1IQG A;  1FQ3 A;  5CDF E;  1SHY A;  3FP8 E;  1BB0 B;  4ZKS U;  5GCH F;  1LO6 A;  1B0F A;  1GBL A;  1HB0 B;  1CHO F;  3KQC A;  1F5L A;  1TPA E;  1V2R T;  4NWK A;  4DG4 A;  1AU8 A;  1QRW A;  2BYA X;  5FHT A;  3TJU A;  5DO4 H;  4WME A;  4LK4 A;  1Y5A T;  2EC9 H;  3FVF B;  2ZHD A;  2H2Z A;  1KTS B;  4YXW D;  3EDX B;  4MPX A;  5A8Z A;  5L2Z H;  5GWZ A;  3BSQ A;  2AMD A;  3UNS A;  1BRC E;  2XBX A;  1SHH B;  4MNX A;  3RUO A;  1GMD G;  2FP7 B;  2C8Z B;  2W26 A;  2SGE E;  3DSO A;  3PMB B;  8LPR A;  5DP8 A;  3TVJ B;  8GCH F;  4FOU C;  3VG8 A;  5B6L A;  2GGV B;  4KP0 A;  3ZVD A;  1ESA A;  5DPA A;  1SGQ E;  1UW7 A;  5C67 A;  2BY7 X;  1KY9 A;  2XND D;  5T3H A;  2WUC A;  2VJ1 A;  1THR H;  5GIB A;  1GBE A;  2RFK C;  3F6U H;  1Z1J A;  1G30 B;  5LGO A;  1LHC H;  4ACA A;  1HAG E;  3ATI A;  1BMA A;  4TYD A;  4DVA U;  1IQL A;  1AUT C;  2XWB I;  4ZKR U;  1VKY A;  4MLF B;  1FIW A;  3T62 A;  4AOR A;  2XTT B;  4YM9 A;  4WJG 2;  1WDI A;  1P11 E;  4TWY A;  4ABJ A;  2M5T A;  3FZD A;  2VWO A;  2FOC A;  1V2L T;  1SMF E;  1DUA A;  5GXP A;  4PRO A;  1F5K U;  2LPR A;  1LKA A;  3ZYE A;  1OOK B;  1P2N A;  2VU8 E;  2J2U A;  3DA9 B;  2YMS D;  4AN7 A;  2JH6 D;  1PQA A;  3MFJ A;  4ZCN A;  2Y6T A;  1ZMN A;  1L1N A;  3A82 A;  3LGW A;  1C5P A;  1O2K A;  5L2Y H;  3OEE D;  4FUE A;  1GBF A;  2B5T B;  3TH3 H;  3GY2 A;  5B6O A;  5JB9 S;  1C2F A;  1SQO A;  1ELF A;  1D3D B;  1ELA A;  3NUM A;  5DJ7 A;  5HM2 A;  3C27 B;  1ZSL A;  2P3T B;  1O5D H;  1C1V H;  1MBM A;  2AMP A;  1FXY A;  1ETT H;  1OWI A;  3BG4 B;  3MU4 A;  2A1D B;  1C2D A;  1O2T A;  3BN9 A;  4H42 U;  3FZZ A;  1O2V A;  2Z6B D;  2Y82 A;  1SSX A;  7EST E;  3SJ8 A;  1UTJ A;  1OWJ A;  4TPY A;  3RMM H;  4ZUH A;  3ZZ4 A;  1SGY E;  2CK3 D;  1XVM A;  1E0F D;  2OK5 A;  3M5O A;  2F4L A;  2WV5 A;  1YLC A;  1YCP M;  1W0Z U;  1GG6 C;  2J5U A;  1EAX A;  3IIT A;  1LVB A;  4TY7 A;  1GPZ A;  4WXI A;  1AVW A;  3EQ0 H;  1KXE A;  1D6R A;  3MH4 A;  1FN6 A;  1FON A;  2FLB H;  1VCW A;  3OX7 U;  3DD2 H;  3GY3 A;  3M36 A;  3RXE A;  1SVP A;  1RIW C;  5FBI A;  2VVC A;  1YGC H;  3LDX H;  1O2Q A;  4I8G A;  9LPR A;  2JJ2 D;  2GMT B;  3HGP A;  2XC4 A;  1Z8J B;  1SGF G;  1DFP A;  1KDQ A;  1T8N A;  1GJC B;  1ZMJ A;  4IMZ A;  4KTU A;  2FMJ A;  6GCH F;  5A0A E;  1RTF B;  1LHD H;  1N8O C;  1LKB A;  1A5H A;  4GCH F;  3SYJ A;  3T26 A;  3SI4 H;  2HPQ H;  3VB5 A;  2C4F H;  1UVT H;  4O97 A;  3RDZ A;  4FUB A;  3FP6 E;  1TX6 A;  4CRE A;  3UTU H;  3NWU A;  4U2W A;  2Z9I A;  1L0Z A;  3SV7 A;  1Y59 T;  3RXS A;  3SU3 A;  2VWL A;  5H4I B;  1EJM A;  2GCH F;  3E91 A;  1VCP A;  2A4O A;  2R2W U;  3SI3 H;  4OS4 A;  4ZXX H;  5AFY H;  3BTQ E;  2GV6 A;  1RTL A;  4YOI A;  2BMG B;  3U8O H;  2QYI A;  4A92 A;  1EQ9 A;  1VZQ H;  4BAM B;  5GCH G;  5KEC A;  1P02 A;  2Y7X A;  3I29 A;  2QY0 B;  5HIZ A;  4DY7 B;  2FOB A;  3ZZ7 A;  1MKW H;  1O2S A;  1BMF D;  1SGN E;  3RXK A;  1FY5 A;  4IMQ A;  3HK3 B;  1OP0 A;  4CRG A;  1Y3Y A;  1FZZ A;  1RXP A;  1F5R A;  1LQD B;  3SW2 B;  2H6M A;  4H4F A;  5HXF A;  2BY8 X;  2GDD A;  1E34 B;  1FMG A;  1UTN A;  4IC5 A;  3RXT A;  1ELB A;  1PQ5 A;  1GHA F;  1AB9 C;  5TCA A;  7GCH F;  1TX7 A;  1PQ7 A;  5FX6 A;  1AKS B;  1CQQ A;  1GJ4 H;  5DP4 A;  2YMS C;  1MD7 A;  2OCV B;  1CHG A;  2VIQ A;  2ZIQ H;  4CHA C;  1O2J A;  1O5C B;  1ZRB A;  3QDZ B;  2QXI A;  2FOH A;  1BCU H;  2XNI A;  1QHR B;  3MQK C;  1Y3U A;  1GJ5 H;  4MTB A;  2RDE A;  4ABD A;  4SGA E;  1FJS A;  1O35 A;  1K1N A;  3H5C B;  2RDL A;  4CHA B;  4Y0Y E;  4H6T A;  3PMH B;  5PTP A;  1V2T T;  3VB6 A;  1TAL A;  1OSS A;  3A83 A;  3A7V A;  2FS8 A;  3LIW A;  5JBB S;  3UR9 A;  1EP6 A;  4XBB A;  5HMA A;  2KFW A;  3S7K B;  1C1Q A;  2ODQ A;  1O3A A;  1TOM H;  4THN H;  4X6P A;  2ASU B;  1QBN A;  2BLV A;  3S9B A;  1GMC F;  2ZTY A;  1SBW A;  2EY4 C;  2XBY A;  4ASU D;  3SNB A;  1YPG H;  1O3M A;  1SLU B;  3OU0 A;  2OXS A;  2EI8 A;  2QXH A;  2R3Y A;  4WH8 A;  4K8B A;  3NCL A;  2Z3C A;  2Q6D A;  1GHB F;  4BTT B;  3RC6 A;  2QIQ A;  1M9U A;  1TON A;  3ZZC A;  1MTU A;  4J2Y B;  2FOD A;  1BHX B;  1EAI A;  2ZEB A;  1C1U H;  4ISN A;  3HKJ B;  1SFI A;  4Z0K A;  1P2O A;  1N6X A;  2WPD D;  4F48 B;  1IQE A;  1NU7 B;  5DSF A;  5C1X A;  3ZVF A;  3TGJ E;  1A5I A;  1AI8 H;  1T8M A;  1UCY E;  2H1U A;  2ZCH P;  4Q4L A;  4ASH A;  1TNI A;  3PO1 C;  4MDS A;  1ARC A;  4TWW A;  4MPV A;  4Q80 A;  2WPI S;  3HPT B;  2BOH B;  2K8I A;  3F68 H;  3M5L A;  1P01 A;  1O2H A;  1EB1 H;  4Z1M D;  4UFD H;  4D7G A;  5CE1 A;  2RCE A;  1TNH A;  1NY2 2;  1V2M T;  5A09 A;  1JWT A;  5E0J A;  3OY5 U;  2EA3 A;  3UQV A;  4UFE H;  1TGS Z;  4BAQ B;  1ETR H;  1HJA B;  3OTP A;  1L4D A;  2PSY A;  3FOA A;  2BQ6 B;  2KCY A;  3GIS B;  5EPN A;  1GBB A;  2PTC E;  2QF0 A;  5C0U A;  3QTO H;  3ZZA A;  1J16 A;  1UHB A;  3ZZ9 A;  1DT2 A;  2ZDA H;  1XM1 A;  5LPF A;  1MAB B;  3NK8 A;  4A1X A;  1O3I A;  1LMW B;  4GSO A;  4ISI H;  1SR5 C;  1G2L A;  3STJ A;  3SZE A;  1BA8 B;  1THS H;  1TFX A;  5EW2 H;  4B2B A;  2AIP A;  1C1R A;  1PYT D;  1CHO G;  3A7T A;  1ELD E;  3TH4 H;  3RM0 H;  1QZ8 A;  1DST A;  2KAI A;  3KQD A;  2WYG A;  3T28 A;  2BD8 A;  1COW D;  2B7D H;  3EST A;  3QLP H;  3PRO A;  2A0Q B;  3MNB A;  2P8O C;  3A88 A;  4NSY A;  1AWH B;  1RGQ A;  5F03 A;  2AHM E;  3KHV A;  4CR9 A;  4B71 A;  2F43 B;  4SGB E;  1SGE E;  3F9F A;  1V2W T;  2R3U A;  3UB0 A;  4KGA A;  2W7U A;  2VID A;  3QGN B;  2FX6 A;  1ANC A;  1ELT A;  3KNX A;  5HM9 A;  3R0F A;  1JIR A;  4HFP B;  4R0I A;  3U8T H;  1ZSK A;  4INL A;  4YOJ A;  2HNT C;  8KME 2;  4WXV A;  1SOT A;  3Q3K A;  5ABW A;  1HUT H;  2P95 A;  4TSF D;  1E79 D;  3BTD E;  1E1R D;  1O2X A;  1P2Q A;  2F9N A;  4D76 A;  3GIC B;  1N8O B;  2ZP0 H;  2J98 B;  1YWU A;  1O32 A;  1HRT H;  2HNT F;  1QBO A;  4AGJ A;  1GG6 B;  1C5L H;  2GDE H;  5C1U A;  2Z3E A;  3MTY A;  3MYW A;  3Q77 A;  1SGC A;  1BMM H;  4CRD A;  3ATW A;  4NA7 A;  1LDT T;  4XE4 A;  1BBR K;  2FDA A;  4OGX A;  3PWC A;  2WHX A;  1SLV B;  3BTW E;  1CBW C;  5JB8 S;  3SJK A;  3M3V A;  3ZZB A;  3FFG A;  1PPE E;  4K3J A;  2G4T A;  1P57 B;  7GCH G;  1SGF A;  2VWM A;  4AFZ A;  2BD3 A;  2QV1 A;  1KDQ B;  4O3T A;  2P59 A;  5CHA B;  2XCF A;  1MQ6 A;  2PKS B;  1QL8 A;  4DGJ A;  1D9I A;  3RXD A;  1VJ9 U;  3O8C A;  1K28 D;  3K65 B;  3V12 A;  3RMN H;  3QZQ A;  1P05 A;  1YPE H;  1XX9 A;  1TPS A;  4I32 A;  1J15 A;  3S9C A;  2UUJ B;  3WWF A;  4BOH A;  1TPO A;  4Y7A A;  2Z9L A;  1FX0 B;  2PW8 H;  4YO9 A;  3V3M A;  4KEL A;  2PR3 A;  3A84 A;  1BUI A;  3A7W A;  4JYT A;  4MNY A;  3IG6 B;  4U32 A;  2PHB A;  1CGI E;  1QR3 E;  1PJP A;  2VWN A;  4ZHL U;  2JET B;  3MU5 A;  1PYT C;  5EOD A;  1K9O E;  4X8S H;  1HPG A;  1HAH H;  3UOU A;  4EST E;  1L4Z A;  2CXV A;  4AGK A;  4OS5 A;  1CT2 E;  5EQQ A;  2P8O B;  1UTL M;  3O8D A;  1K1I A;  2GT8 A;  1C5Z B;  1TOC B;  1P9S A;  4X2Y A;  4B74 A;  1OXG A;  3JZ1 B;  1A1R A;  1UK2 A;  1AMH A;  1SGD E;  4ABF A;  3PV2 A;  3BTH E;  1UVU H;  3ITI A;  3AW1 A;  3TK6 A;  1FIZ A;  2QF5 A;  1QY6 A;  5E2P A;  1LHG H;  1W8B H;  3MU1 A;  2VGC B;  3M3S A;  1GCT C;  3PMJ A;  5E8E H;  1OYQ A;  1BMN H;  1KIG H;  4AFQ A;  1VCQ A;  2HVY B;  5EJ1 A;  2QC2 A;  2I6Q A;  4FUH A;  3P6Z B;  4YOG A;  1DM4 B;  1H9H E;  2UUF B;  1BHX F;  1KYN A;  2SNW A;  4A1V A;  1MAX A;  1ELE E;  2C8W B;  4D8N A;  1GBA A;  1CE5 A;  2G8T A;  1Z6J H;  1QIX B;  2CGA A;  1AFQ C;  1QBV H;  2PKA B;  4FUI A;  1S82 A;  2O8L A;  1YPH E;  2QN5 T;  1O5F H;  1P04 A;  4M9F A;  3P17 H;  4E06 H;  3RXB A;  1J8A A;  1BZX E;  3LC5 A;  4RSP A;  3SGA E;  3T25 A;  1YCP K;  4ABI A;  5DP7 A;  2V3M A;  3MH7 A;  2Z94 A;  1GVL A;  2VBC A;  2Y80 A;  1C1P A;  3LGU A;  2BD2 A;  1GHV H;  4NWL A;  1SC8 U;  5EQR A;  2VVV A;  1V2K T;  1MZA A;  2Q6G A;  2SGQ E;  1F7Z A;  3K2U A;  2P93 A;  1ANB A;  3RC4 A;  4WH6 A;  1NRR H;  1TRN A;  3SUF A;  3PV4 A;  3SV8 A;  3TGK E;  1C1S A;  1AZZ A;  2ZKS A;  5C0T A;  2ZPS A;  1AZ8 A;  3EYD A;  1A3B H;  3F2G A;  6CHA C;  4MNW A;  4A5T S;  1MTN B;  1MCT A;  3URC A;  1DWC H;  1Z8I B;  1P06 A;  3A7X A;  1FPC H;  2J95 A;  3STI A;  1O2U A;  1O39 A;  2WIN I;  5L6N H;  1WSS H;  2B8O H;  1CSO E;  2QXG A;  5C2Z A;  2OD3 B;  1GJD B;  1FY4 A;  4HI3 A;  3PTN A;  3BEF B;  3MI4 A;  1SGI B;  4JYU H;  3SBK A;  4NIY A;  4Q2K A;  5EGM A;  2BDY A;  1DWE H;  1O2N A;  1FAX A;  1UVS H;  2FEQ H;  2JKH A;  1KTT B;  2VIO A;  4INH A;  1O34 A;  1ZZZ A;  3GCO A;  2ZDN A;  5EW1 H;  2A7H A;  5J4S A;  1MTV A;  1ACB E;  2J94 A;  1W3C A;  2H9T H;  4BAO B;  1HJ9 A;  3GCT G;  1EST A;  5DP3 A;  5GPI B;  2D2D A;  3ZVE A;  1E38 B;  4RI0 A;  4B1T A;  2BZA A;  1BBR H;  2GCT B;  5A8X A;  3M37 A;  4JCN A;  1C2L A;  1TQ7 B;  2GX4 A;  1BRA A;  2O8W A;  1AIX H;  4BTI B;  1MAY A;  1QRX A;  1FNI A;  1ELV A;  1AB9 B;  3QZR A;  1Q3X A;  1KLT A;  3CEN A;  2ZHW H;  1GHZ A;  4GAW A;  1LVY A;  3GYL B;  4LZ1 H;  5JBA S;  3OTJ E;  2QGR A;  1ZRK A;  3SUE A;  1V2J T;  1MKX H;  2YMS B;  4LZ4 B;  1S0R A;  2BXU H;  3LH1 A;  3WW7 A;  1C2G A;  2GCT C;  3LU9 B;  1KLJ H;  3KF2 A;  2STA E;  1MZD A;  4Y8Y A;  3PV5 A;  3RXH A;  3RMO H;  5EPY A;  3UPE A;  1GMH G;  2C93 B;  8GCH G;  4MPW A;  5C5O A;  5LPR A;  1TGT A;  1O3E A;  2KZ4 A;  4YT6 H;  2NWN A;  1W0Y H;  1O2R A;  3LC3 A;  4RN6 A;  4MVN A;  4JK6 A;  3W94 A;  2TRM A;  4NA9 H;  1PFX C;  2ZQ2 A;  4NGA H;  3SNC A;  2P3U B;  3PMA B;  2ZG0 H;  4OS7 A;  2V35 A;  2FX4 A;  4YLQ H;  3QGJ A;  1G3D A;  2HLC A;  3ELA H;  5F8X A;  1LCY A;  1DSU A;  3F1S B;  1IQN A;  3GOV B;  1HIA A;  1TBZ H;  1DUE A;  1HNE E;  4IN1 A;  3I77 A;  1VGC C;  1Z6E A;  2ANW A;  3PO1 B;  1ETS H;  4NFE A;  1GBM A;  2BX4 A;  4WY3 A;  2P3F H;  4IS5 A;  4K69 A;  2THF B;  1ABI H;  3M7Q A;  1DAN H;  1P2I A;  1GDN A;  2Y7Z A;  1THP B;  4U30 A;  3RXQ A;  3PB1 E;  1UJ1 A;  1HJA C;  2AIQ A;  2BLW A;  2G5V A;  2TIO A;  4I8H A;  1JRT A;  3AVZ A;  1GMH F;  1IHT H;  1ZTK A;  3LGI A;  4JZD H;  2FOG A;  2FI3 E;  1UTP A;  1OHH D;  5TCC A;  2BTC E;  4FXG H;  3SNE A;  4R8T B;  5A2M H;  1QFK H;  1EAT A;  2DUC A;  2A5I A;  1G3B A;  4K1T A;  4JZE H;  3RXI A;  3A89 A;  4JMY A;  2JJ1 D;  1O2W A;  3ZIA D;  1QA7 A;  2JDI D;  2PFE A;  4B6F A;  1SFQ B;  1PPB H;  4ZKN U;  3U1I B;  1BJV A;  1Q2W A;  2BDB A;  2ZGC A;  1O5B B;  1ZTJ A;  3MU8 A;  5BPE A;  3P92 A;  5CHB A;  1GL1 A;  2HLD D;  1C2I A;  2OBQ A;  3I78 A;  3TPI Z;  3ZVG A;  1NBM D;  1KXB A;  4MPU A;  3HKI B;  3VPK A;  1HAV A;  2ZGB H;  1GI2 A;  1EFR D;  2QXJ A;  1QL9 A;  1V3X A;  2FM2 A;  4Z6A H;  2FWW A;  1MU8 B;  4ABA A;  1PPZ A;  2FYR A;  1P8V C;  2FO9 A;  1O31 A;  1YY3 A;  3KQB A;  1Y3W A;  5A0C A;  2AEI H;  4GLY A;  1UTK A;  1UTO A;  2GZ7 A;  2M2A A;  1BJU A;  5EST E;  1GBT A;  3SQH E;  1UVO A;  2L74 A;  3RM2 H;  3CS7 A;  3F2F A;  5E2O A;  1ESB A;  3PLB A;  4HZH A;  1W0J D;  2BOK A;  4GCH G;  4Q63 A;  3G01 A;  2AMQ A;  1GWA A;  1GI1 A;  2ZGX H; 
#chains in the Genus database with same CATH homology
 1MAB B;  3N7D A;  3WWB A;  4A1X A;  4NWL A;  3O8C A;  2KZ4 A;  3SU5 A;  4KTC A;  1E1Q D;  2CK3 D;  2OK5 A;  3RC5 A;  2F9U A;  3M5O A;  2F4L A;  3OFN D;  5EQR A;  4YXW D;  4I32 A;  4I33 A;  3P8N A;  3WWF A;  3SU4 A;  2FOM B;  2GVF A;  3SZE A;  2YMS C;  3M5M A;  2WSS D;  3RC4 A;  1WXR A;  4WH6 A;  1FX0 B;  3NRL A;  5F53 A;  2J5U A;  3SUF A;  3O8R A;  3SV8 A;  2OC7 A;  3GS9 A;  3O8B A;  3OE7 D;  2FP7 B;  2KM0 A;  3DSO A;  1CU1 A;  5C0T A;  4WF8 A;  2OC1 A;  3EYD A;  2XNI A;  3F2G A;  3N99 A;  5DN6 D;  2OC0 A;  2XCN A;  3DSP A;  4I31 A;  1DY8 A;  3VG8 A;  5B6L A;  2GGV B;  2V7Q D;  5FPT A;  3SU2 A;  1COW D;  3SUG A;  2A4G A;  5IDK A;  2WZQ A;  2L6O A;  2XND D;  4U01 A;  3LON A;  3F0O A;  4XD7 D;  1JXP A;  1H8H D;  2JJ2 D;  2KCA A;  1RGQ A;  3OYP A;  2AHM E;  5EQQ A;  3SU1 A;  2F43 B;  4B71 A;  3O8D A;  3PRD A;  5C17 A;  2KFW A;  3UB0 A;  2IJO B;  3P8O A;  4B74 A;  3LOX A;  5ESB A;  5FPY A;  1A1R A;  1BT7 A;  2YOL A;  5GND A;  5HKK D;  3KNX A;  2LEL A;  3PV2 A;  1OHH D;  4TYD A;  1W0K D;  3SYJ A;  4R8T B;  4ASU D;  3M5N A;  3F3B A;  1S6L A;  3SU0 A;  5IK2 D;  2QF5 A;  1DXW A;  2QF4 A;  4JMY A;  2JJ1 D;  3KEE A;  4TT3 D;  2OBO A;  3SUD A;  4WH8 A;  4K8B A;  3ZIA D;  2JDI D;  1W3C A;  3FKS D;  5EQS A;  3SV7 A;  3RC6 A;  3PRB A;  4B75 A;  5GJ4 B;  3SU3 A;  4B6F A;  4B76 A;  4A1T A;  2QE7 D;  1DY9 A;  1E79 D;  4TSF D;  5H4I B;  3U1I B;  4B73 A;  2WV9 A;  1E1R D;  1KMH B;  2KCP A;  2O8M A;  2OIN A;  3E90 B;  5GPI B;  2W6J D;  5CHB A;  4RI0 A;  2HLD D;  3FO8 D;  2WPD D;  2OBQ A;  2YMS D;  2K1Q A;  3F2H A;  1NBM D;  2JIZ D;  5DSF A;  3N7E A;  4ZCN A;  2IJD 1;  1NS3 A;  4DT4 A;  4A1V A;  2W6I D;  3KN2 A;  4Q4L A;  3AK5 A;  1RTL A;  2F9V A;  4A92 A;  2A4R A;  3OAA D;  1EFR D;  2XOK D;  3F0P A;  3SV6 A;  3OEH D;  5T1V A;  2KR7 A;  3OEE D;  5FL7 D;  2FM2 A;  2A4Q A;  1BMF D;  2K8I A;  1H8E D;  1DXP A;  3M5L A;  3DCL A;  4Z1M D;  2WHX A;  4FET A;  3SUE A;  4M9F A;  3LKW A;  2YMS B;  4OM9 A;  3U1J B;  2K0Q A;  5ETX A;  3W1E A;  3WW7 A;  5CDF E;  3OTP A;  3SV9 A;  3FOA A;  2KCY A;  2M2A A;  5EPN A;  3KF2 A;  4F55 A;  1N1L A;  2QV1 A;  3PV5 A;  5C0U A;  3F2F A;  5EPY A;  5FPS A;  1SKY E;  1NBM E;  2P59 A;  2XCF A;  4B6E A;  2VBC A;  1W0J D;  4NWK A;  2OC8 A;  4Q63 A;  3SU6 A;  2KCO A;  3L6P A;  3H09 A;  3FN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...