2K0QA

Solution structure of copk, a periplasmic protein involved in copper resistance in cupriavidus metallidurans ch34
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
74
structure length
74
Chain Sequence
b'VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEALRKGHSEGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein copK
publication title Molecular structure and metal-binding properties of the periplasmic CopK protein expressed in Cupriavidus metallidurans CH34 during copper challenge.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Metal binding protein
total genus 16
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2008-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2k0qA00
3N7EA 2K0QA 2LELA 3DSPA 2KM0A 3DSOA 3N7DA
chains in the Genus database with same CATH superfamily
4D7GA 1ARBA 1EQ9A 3JZ1B 1VJ9U 1TNLA 4GUXA 4I32A 1O2VA 2I6QA 3F68H 5DN6D 2ZGXH 1KXDA 1NU9A 1QBOA 3SI3H 4AZ2B 1DSUA 1L1JA 2K0QA 3M7TA 4AN7A 2BLQA 2THFB 1W0ZU 4KP0A 4IC5A 2BLVA 4I86A 1NRSH 2UUFB 1J8AA 2RG3A 3OE7D 1HAPH 3TH4H 5IK2D 1A4WH 1PQ7A 1S81A 1TAWA 4FOUC 3VB6A 4AYYB 3P92A 3KHVA 5DP5A 1GVZA 1MD7A 2V3MA 4ACBA 3NRLA 4GHQA 1BTWA 3A8DA 3LIWA 3EA8A 5C3NA 3T26A 4MPXA 3M5MA 2FO9A 1LHEH 4YM9A 4IS5A 4NG9H 5GCHG 1DVAH 2VIPA 1TB6H 4H6SB 3RXMA 4QT8C 3UFAA 1AD8H 2LELA 1HAIH 2A45B 1NRQH 1FUJA 1JRTA 4HTCH 1RS0A 2OBQA 1D3TB 4RN6A 1TGCA 4AGJA 1TPOA 2XCNA 2PTNA 1SHHB 3M61U 1F0UA 4WWYA 5F8ZA 4INHA 1DS2E 4UE7H 1FONA 3LDXH 1Y59T 4FUHA 1ZTLA 4SGBE 1AFEH 3AW1A 2KZ4A 2GZ9A 4GAWA 3RC5A 5JB9S 2GT7A 3UQVA 4WH8A 4JMYA 1NT1A 2VNTA 2W3IA 2F3CE 2H2ZA 4Q7ZA 1Q3XA 1DOJA 5TCCA 3NWUA 3N7DA 5HIYA 1LCYA 2O8WA 3I29A 3RXSA 1H8IH 1K1LA 4DVAU 3K6ZA 2JH6D 2HNTE 3M35A 1P2JA 1ETTH 3GS9A 3ZIAD 3KIDU 3O8RA 1C5ZB 1SQAA 1Z71A 2PUXB 5HYOA 5EXLA 5TCAA 3SUEA 1LKAA 1K1IA 2HNTF 1ESAA 4ZKNU 3UR9A 3K65B 4A7IB 1BTPA 4VGCC 5AFYH 1O3OA 3RXRA 3A8AA 2WYGA 1G3EA 4GVUA 5JPMH 3BEIB 2VBCA 4OGYA 3LH1A 3C27B 4K5ZA 1QURH 2WPHS 1GMHG 1L4ZA 7ESTE 1C5QA 4CH2B 3MHWU 5C2ZA 2D8WA 1O31A 1OP8A 1CT4E 2ZDMA 1NBME 3MH7A 1HGTH 1KY9A 2O8UA 2XC5A 4IMZA 3GY8A 4FUFA 1EB1H 4TWYA 4E7NA 2VWNA 3BG8A 2FOCA 2W5EA 1AKSB 4JZ1A 2A2QH 1TYNA 1VITG 1EUFA 1QNJA 4IGDA 1C5WB 1C5YB 1NFWA 1XXFA 3T27A 2XTTB 1C1MA 1LHCH 4GLYA 3SV9A 4CHAB 3RU4T 2I6SA 3GYLB 1KLJH 1PPHE 4F4OC 2Z3EA 3SNDA 2CJIA 1LDTT 2ZFPH 1XVMA 3MNXA 1SGIB 2G00A 3ZZ3A 3DFLA 2ZGCA 1EZUC 1CQQA 2OC1A 2Y81A 2HVXA 1GDQA 4TT3D 1C2DA 5ESBA 3KGPA 4KGAA 1C1OA 4UFDH 1P11E 1CHGA 5DP7A 4IW4E 5HKKD 4RKOB 2G55A 1MABB 2BX3A 3ATIA 2ZFQH 1EOLA 3I77A 1A7SA 1W13U 4WMFA 5EG4A 1OWKA 2ZWLH 2BD5A 3RM2H 3SGQE 4BTUB 2HWLB 2JETC 1TPAE 1KLTA 4X8SH 1ZMNA 1V2VT 1GI5A 3M5LA 5L2ZH 1CU1A 5EPNA 1IQHA 3OFND 4K8YA 1PPCE 1K22H 1YPMH 5FX6A 1TOCB 1A46H 2LNCA 1DXWA 4M7GA 3G01A 3Q3XA 5EJ1A 2QXJA 1MAXA 5FCRA 9LPRA 1LMWB 2AERH 3RMNH 2PTCE 2EI8A 1BHXB 1O3LA 1BQYA 1C5PA 2PP6A 1TX7A 4B71A 1N8OB 4VGCB 2QIQA 2F9NA 1V2LT 3HPTB 1BRUP 1KTSB 1SGQE 2L6OA 1UMAH 3ATLA 1W12U 2Z94A 2ZA5A 1S6LA 1XUKA 3MTYA 2ZU1A 1E36B 1T31A 4FU7A 3UR6A 1V2QT 1L1NA 2AHME 5LH8A 1C2MA 1ZPBA 1VGCC 4X1RU 4I31A 3SOSA 4Y8YA 4GCHF 1DLEA 2AH4X 1DLKB 4DCDA 3MH4A 5DO4H 3KYGA 3TH3H 1EFRD 1YCPM 1DWDH 1HAZB 3M36A 1P12E 3Q77A 2BM2A 2G5VA 3VPKA 2WPKS 3RXKA 1GGDC 3CNRA 4I8HA 1LPZB 1GJ6A 4XOJA 1GBAA 5DP6A 2PUQH 4TPIZ 3ZZCA 4Y6DA 1YPJH 3S9CA 2BQ7B 1YLDA 4O9VA 2W7SA 3TNTA 4ZCNA 1UCYK 9ESTA 2OQ5A 1FLEE 3KQ5A 2JKHA 2M5TA 1P10A 2CN0H 2QYIA 3S9BA 4Q2KA 4FUBA 1O2TA 2BD7A 1QFKH 1A3EH 1NFYA 1UHBA 1DFPA 1CHOG 1O2GH 1ZZZA 3FANA 1SOTA 3EE0B 3GY3A 4KKDA 4XBCA 2PV9B 2Q6FA 3MU0A 1O3KA 1SR5C 2YOLA 4ACAA 5CHAC 1BTZA 5I46H 2BYAX 1FV9A 1O5CB 3A85A 7GCHG 4F48B 3MU4A 4ASUD 3SJ9A 1C1QA 1YYY1 1AGJA 1ELAA 2IJD1 4Y79A 3LGWA 1BHXF 3RM0H 5EJZA 2FM2A 4Y0ZE 1YY3A 1MKXH 3GCTF 1LPGB 4A92A 1EAIA 4J2YB 5EXMA 1E35B 1SGCA 1ZSJA 2F43B 3QGNB 4ABFA 2R2WU 5DP9A 3UOUA 3D65E 4X6OA 3NKKA 3SJ8A 4MTBA 3PMHB 2KCYA 4YESB 1ZHMA 2B8OH 3HATH 1DE7H 1UO6A 2ZECA 1IQJA 1OWDA 1O3PB 2A7JA 3GCHC 1AU8A 1C2FA 1YPGH 3L33A 3DUXH 1O2JA 4XDEA 2A2XH 1ELFA 3F2GA 5EPYA 4AYVB 3AASA 1EATA 1H1BA 3E6PH 2BD2A 2CGAA 1GBTA 3A7WA 2R9PA 1ELBA 4FUGA 4FVBA 2BTCE 2BVXH 2P3TB 3SGAE 1YC0A 2H9HA 3DT0H 5EQQA 2LP6A 4AFSA 4ZHLU 1G3DA 2IN2A 2Y5FA 1GGDB 3TNSA 2FI4E 1C2IA 1EAXA 2KCPA 2ESTE 3BIUH 2OINA 3TGJE 3Q3YA 3TLOA 4CRBA 2ZHFH 1EP6A 4AB8A 1SGRE 3T25A 3A84A 1SQOA 4RI0A 3SJOA 4F55A 1A2CH 2WYJA 1QBNA 3BTGE 1NU7B 5KEDA 1O3IA 3KF2A 1FPHH 1LHGH 3RXIA 5CHAB 3SU6A 1ELEE 2A4QA 1GI4A 4X6MA 2Z9IA 5GWZA 1BITA 1O35A 1D3QB 4MPUA 1A0HB 1GMCF 2ANMH 5C0UA 1D9IA 1P02A 2ZU5A 3E16B 5FPSA 1AVXA 2OC8A 3GCNA 4Y11E 1S0QA 1C4V2 6GCHG 1NY22 2GCTC 2GZ8A 2ZPRA 1GMDG 2AYWA 3FP6E 2Z7FE 3A8CA 2FOMB 4BAHB 2P16A 5LGOA 1TQ7B 3GDUA 4I8LA 1HFDA 3MU8A 1UJ1A 2HPQH 1XM1A 2QA9E 1O3AA 4WMEA 1CA8B 4I8GA 4AORA 5ABWA 5KECA 2NU2E 1EXFA 2PSXA 3A86A 3KL6A 4DGJA 2C93B 1ZYOA 3OEHD 3U8OH 1YWUA 3QZRA 2Y82A 2D26C 4D76A 1HIAB 1YLCA 1MD8A 2QE7D 3GCHB 1GJBB 1GI1A 2ZGHA 5F8XA 1J15A 3UUZA 5C1YA 1MUEB 1MTNC 1F7ZA 3U1IB 1ZMJA 5IYTA 1GCTC 2ZPQA 3RXCA 1S0RA 4Q7YA 1SGNE 4HI3A 1K1NA 3ZZ8A 2WPDD 1THRH 3A7XA 2OP9A 2UWOA 1TGSZ 5ETXA 1TNKA 4UEHH 3VB3A 3RDZA 1FDPA 1EJNA 1ZRKA 2FESH 2FS9A 4MQAA 3TU7H 1UHBB 1GBFA 1THSH 1C9TA 1C5LH 2W6JD 1O38A 2XNDD 2DE9A 2Z3CA 2A7CA 1NRNH 1IHTH 1LVBA 3TK6A 1O3GA 2ZI2H 5EODA 4OS6A 3SUGA 8KME2 1C4Y2 3P70B 4X2YA 1C5SA 3FZDA 2ZFRH 3E3TA 1W10U 2C90B 2QCYA 2A5IA 1FIZA 3P8NA 1RXPA 2JH5D 3OTPA 6CHAB 1O2LA 3Q76A 3SQHE 2SGEE 3PMBB 1GBBA 3SV6A 1AFQB 3F1SB 3E91A 1TMUH 1VCPA 1EPTA 3P6ZB 3TGIE 3BTEE 3RXDA 4MNXA 3UAIC 4FUCA 1NROH 2GZ7A 1W0KD 1MH0A 1HV7A 1YPEH 4ABJA 4X1PU 1FY1A 3MO9A 4DW2U 2CV3A 1ZPZA 1ANEA 1XKAC 2XBXA 4K2YA 1SB1H 2AEIH 2GTBA 4Y7AA 1MKWK 2ZTXA 1KYNA 4A5TS 3T62A 2HNTC 2RA3A 4ZKOU 2H1UA 2WPIS 1GHVH 4OGXA 1TOMH 4BNRA 3UIRA 1QHRB 1XKBC 3BEFB 1MU6B 3F3BA 4OS1A 4YT6H 1FAXA 3OAAD 1ID5H 3FZZA 4WVPE 5K7RA 5EU8A 1QB1A 4GSOA 2D2DA 1ANBA 1OYTH 1WXRA 2QXHA 1WDIA 3M3SA 1QRZA 4BXSA 3F6UH 1WQVH 3PMJA 3QDZB 2TBSA 3MH5A 1DY9A 1C5MD 2EC9H 3DSPA 1WCZA 3B8JA 3ZZBA 7KMEH 1W0JD 2B5TB 3DSGA 1Y8TA 2ILNA 2C4FH 2CF9H 2BDBA 3NZIA 1P2NA 4E7RG 2UUYA 8ESTE 3M7QA 1ZMLA 4ISLA 2VIVA 1HXEH 1SLUB 2ODYB 2PGQB 5J4QA 4P00A 1WAYB 4E06H 2K1QA 1LVYA 4X6PA 1FJSA 4NFFA 1QL7A 4Q63A 1C1WH 1DY8A 3SU0A 2QAAA 1FN8A 3LONA 1NRPH 1O2KA 2FOBA 2ZTZA 1UTNA 2A4RA 1W2KH 1NS3A 5A09A 4FUJA 3OTJE 5FXLA 1O2HA 1HJ8A 5DKMA 3BTQE 4NA9H 1CVWH 2SGFE 2R2MB 2FLRH 5E2OA 1AUTC 2PKSB 3AVZA 2GMTB 1TNHA 5C1XA 1GI3A 3N7EA 2ODPA 2RFKC 2NU0E 1GG6B 2FOGA 1E0FD 3MI4A 4MPWA 3VGCB 1P09A 3B23B 2ZDLA 2G4TA 4DOQA 1KMHB 2GCHG 2GD4B 2O8TA 1SVPA 5JB8S 1BTXA 2WZQA 3OY5U 1GJ5H 3ODFA 2PWXA 3A83A 1Y3UA 2A4GA 3PWCA 3S69A 4ISNA 2ANYA 1IQEA 5CE1A 2Y7ZA 1EX3A 4AGKA 3DD2H 5LPRA 3SV7A 3ZVAA 3SI4H 2V35A 5HMAA 2VVCA 4NCYA 1GBHA 2QXGA 1G32B 1XXDA 3M5OA 2ZF0H 1O3MA 2ZCHP 1L2EA 4MPVA 3F2HA 3T5FH 3GY5A 3ZVFA 4NFEA 2AMQA 1Z1IA 2BOHB 1CA0B 4AFUA 3HK6B 1KXAA 3LPRA 4BXWA 1E34B 1V2KT 3O8DA 1QA7A 2F91A 1PPFE 1SLVB 2ZP0H 1JIRA 1GPZA 4CHAC 1VCWA 3BIVH 2BMGB 2ANKH 1Z8GA 5GCHF 4K69A 1N6XA 3RU4D 2Y80A 2WV9A 5FAHA 1S5SA 2PSYA 1V6DA 1TMTH 4FETA 3RXQA 5K0HA 2QV1A 2BXUH 3QZQA 1GWAA 3WY8A 3ZV8A 2OD3B 5CHBA 3RXGA 3RU4E 4DIIH 1O2WA 1P8VC 4B73A 1JMOH 1BMNH 5DSFA 4OM9A 3GICB 1LQDB 5A8XA 1O2PA 3SZEA 2FX4A 3GY6A 1DITH 1EPTB 4H6TA 3SNCA 1AWHB 1BTUA 2W7UA 1NFXA 1TQ0B 1MU8B 4WJG2 2P59A 1MKWH 2Z6BD 1QB9A 2OK5A 3ZZ4A 4DG4A 1V2UT 1MTUA 2ALVA 1O30A 3V0XA 2XWAA 5DPAA 1UTPA 5C1UA 2SGDE 4JK5A 1KDQA 4ZKRU 1SGFG 5G4BA 3SNEA 4ABGA 3ATWA 1T4VH 2KAIA 3FN8A 3F9HA 4ABAA 2XNIA 1CT0E 1BIOA 1OP0A 4TYDA 4UFEH 1P2MA 4H4FA 2H5CA 3QWCH 1N8OC 1JWTA 2FDAA 2AGGX 3QTOH 1JBUH 5DP3A 2VIOA 1AVGH 1Z7KA 1P3CA 2P93A 4CRFA 1AE5A 3A7YA 1TA2A 1Q2WA 4UFFH 1OPHB 3ZZ6A 3BN9A 1C1VH 1ELTA 1MKXK 1TPPA 2TGAA 4U2WA 3T29A 1NBMD 2BD8A 3H7OA 2XW9A 1Y5UT 1NN6A 3P8OA 1Z8IB 4B6FA 2FX6A 1FNIA 1MQ5A 5E0HA 1QRWA 4YOIA 2A31A 1XUHA 3GOVB 4KELA 4A1TA 1ETRH 1PJPA 1H9LB 1FZZA 5B6OA 1GMHF 1O2RA 1MBMA 2ZGJA 1NM6A 4U01A 2KR7A 3DFJA 2ZZUH 2VGCB 2OTVA 2BY8X 1GHYH 4I7YH 1T8NA 5FCKA 1AN1E 1ZGVA 2KFWA 1GBCA 3DSOA 3SU1A 1L4DA 2GX4A 1RFNA 1P0SH 1AY6H 1HAXB 2STBE 1GDNA 1IAUA 1TE0A 1VITF 2QY0B 2FEQH 2KCOA 4MNYA 4Q7XA 1YF4A 1GHZA 1BTHH 1CE5A 3PWBA 2BQ6B 3MU5A 1ABIH 2D1JA 5C5NA 2OUAA 1TBQH 1HCGA 4K1TA 1UVPA 4DURA 3PTNA 2OC7A 2XC0A 1UW7A 1AB9B 1HRTH 5GNDA 1QL8A 4FUEA 3RXAA 1GBLA 3RC6A 3NXPA 1BOQA 2OC0A 1LHFH 2BZ6H 2C8WB 2JDID 2BZAA 1C5XB 1EZSC 1O5GH 3BF6H 3ZYDA 4JYVH 3U8TH 2AIPA 1GBKA 1RIWB 4IC6A 3STJA 2ZHQH 4HFPB 3TGKE 3NCLA 1YPKH 4A6LA 3RXUA 2EQNA 2PKAA 1RTFB 2RDLA 1HB0B 1O33A 1VITH 5FPTA 4CRDA 4B2AA 4R0IA 2UUKB 1TBZH 3A7ZA 4ZXYH 1RRKA 3VXFH 1WOFA 1BMFD 1GVKB 1BJUA 2JJ1D 2Z9KA 4B76A 3RXPA 4DY7B 2VINA 1GHBG 2VH6A 4AC9A 1V2TT 3VB7A 4LZ1H 3TJVA 5T6GA 1ZOMA 2H5DA 4UDWH 1G30B 4ZAEA 3ZYEA 4YXWD 1HPGA 1IQLA 1QR3E 3Q3KA 1SC8U 2BY5X 2PLXA 1A0LA 1JRSA 1QQ4A 1NC6A 2G51A 3EDXB 3MU1A 5JBTA 3K6YA 3ZZ7A 1GJ4H 1S85A 1SLWB 1EOJA 4XBDA 3RXVA 2ZDVH 3ZZDA 5HM9A 3S7HB 1O3NA 4Y8ZA 2ODQA 1M9UA 1AWFH 1TNJA 1UTOA 1OX1A 5F03A 2QXIA 1C5TA 1INCA 4DJZB 1G3CA 4CR9A 3MH6A 1TNIA 2V7QD 1FY3A 4AB9A 1VKYA 2Y7XA 1XUFA 3A80A 3EA7A 3QUMP 2A7HA 2XWBI 1J9CH 1DUAA 4SGAE 1P9SA 3OX7U 1QZ8A 1WTGH 1KDQB 2FWWA 2P3FH 1CHOF 2FOFA 3ITIA 1ELVA 3LGYA 1RGQA 1P57B 1TPSA 3ZZ5A 4NWLA 2Z9GA 5DP4A 3TVJB 4J1YA 4I8JA 4FU8A 3HKJB 2WHXA 1ZLRA 1GHAG 2HPPH 2A5AA 4P02A 3RMLH 1K1PA 2ZPSA 7GCHF 1IOEA 3TH2H 4YT7H 2VWMA 3UY9A 3SU5A 2EI7A 4Q4LA 1E1QD 1XMNB 3LKWA 3M37A 2P8OB 5A8YA 2IPQX 2BVRH 3PYHA 2PGBB 1O3EA 2BD4A 2C8XB 2A0QB 5AF9H 1O2UA 2J9NA 4FUIA 2EEKA 3H7TA 3PTBA 1FQ3A 1XUJA 1C9PA 4MDSA 1P06A 3MNSA 1ELCA 1P04A 3NPSA 2KX4A 4Y71A 3LJOA 3E1XB 4FUDA 4ESTE 1MQ6A 1SGDE 1SGTA 3KQBA 3PLKA 4BOHA 4NGAH 1FX0B 1WTHD 2JJ2D 3SO3A 2P3UB 2Y6TA 2B7DH 1LO6A 1WV7H 4NZLA 2ZTYA 5JBCS 3RXLA 3N7OA 1GVLA 1OP2A 1LPKB 3M7UA 3F0PA 1PQ5A 3PLPA 1GJ8B 4X2VA 3F9GA 2XXLA 3SV2H 5AVDA 4JZFH 1D6WA 1O2YA 1ZPCA 4IN2A 4ZHAA 5T6DA 1GI2A 5C67A 4Z1MD 2QF0A 1UTLM 4MNWA 1FPCH 1GI7B 3MFJA 3DA9B 4B2CA 2CXVA 1WUNH 2PFEA 4X2WA 1A5IA 1BB0B 5L6NH 5LPFA 3ATMA 1AUJA 1BMLA 3CENA 1UTJA 1VJAU 2NU3E 2VVVA 8LPRA 1TLDA 5JDUB 1HUTH 1TFXA 2ZCKP 6CHAC 2WV5A 2BDAA 1G3BA 3KCGH 2FZZA 3BTHE 3A81A 3KEEA 4NWKA 1VR1H 1AFQC 2A1DB 4B74A 1UVTH 1EZQA 1OHHD 2HOBA 5DK1A 3AAUA 1LQEA 2ZU4A 1ZSKA 3ZVEA 1O2OA 1NFUA 1KXBA 1A5GH 2C8YB 1AIXH 3NK8A 5H4IB 1TWXB 4O3UA 3OEED 1ZSLA 3T28A 1K0HA 2F83A 2M2AA 1UVUH 3A7TA 1KIGH 6GCHF 5HIZA 3OSYA 4AX9H 1GMDF 3MWIU 2VH0A 3F0OA 3RXJA 1FY4A 1K28D 3BTFE 4ASHA 1P2IA 5C5OA 1K21H 4WXIA 2OXSA 3EYDA 1BBRH 2TGTA 3U9AH 3FO8D 1GBJA 2ZFSA 3V12A 1DICA 1CSOE 2AS9A 1K9OE 3MNCA 1Q31A 2ZCLP 1ACBE 1FAKH 1SGFA 2UUJB 4ISHH 2K8IA 1H8ED 8GCHG 1MAYA 3UPEA 1EB2A 4Q80A 1DPOA 1Y3YA 2BY6X 1SGEE 2W3KA 1X7AC 1BJVA 1RJXB 1VZQH 2ASUB 4YTAA 2CMYA 1OS8A 3CS7A 1C5OH 4YO9A 1GBDA 3R3GB 1XX9A 1GHWH 2SNVA 5GPIB 3DHKH 3SU2A 3SJIA 3D62A 2J5UA 1GJAB 1V2JT 1B7XB 4NA7A 3O8BA 2PKSC 2BDGA 2GMTC 4FXGH 4ABEA 1QY6A 1AMHA 3PV4A 2FLBH 1GG6C 2FYQA 2WSSD 3BTDE 3KNXA 1N6YA 3OU0A 3TIUA 4AOQA 3VGCC 3PRBA 2YNBA 1T8MA 3QGJA 4CBOA 2ZDAH 3A82A 2FPZA 5GJ4B 1QA0A 4A1VA 4O03A 1GDUA 2XBWA 3SYJA 3D23A 3GDSA 3UREA 4AG1A 1O0DH 1P9UA 3BEUA 2GT8A 3F2FA 1V2PT 1Y3WA 1AHTH 1PPGE 1O34A 1ZGIA 2WV4A 1C5UA 1C1PA 5GIBA 2Z9LA 2ZU2A 3LGVA 3UNSA 2P95A 4I8KA 5JYIA 2ZFFH 4IN1A 2QF5A 1CA0C 1T32A 1TIOA 2O8LA 3SNAA 2V3HH 2FIRH 4LOYH 3EQ0H 2F9VA 4FVDA 4YLQH 3EA9A 2OLGA 2VU8E 2BDHA 3BTWE 4X8UH 1YPHC 1C5RA 4DT7B 1P3EA 4XSKU 2ZG0H 2FI3E 1EJAA 3TJNA 3LH3A 1A0JA 1TBRH 1Z1JA 2A32A 5EXNA 2SNWA 2L74A 2HGTH 2R0LA 3GY7A 5ESTE 3R0FA 1K1OA 1C2JA 1HAHH 4KTSA 5GDSH 3U1JB 1L1GA 1MZAA 2UWPA 1F5RA 3E0NB 4GPGA 1F0RA 3SORA 3BG4B 2BDYA 2ZDNA 1DWCH 4HGCA 1AI8H 3B9FH 1UVSH 3O8CA 1J16A 1E38B 1GCDA 1A5HA 3H5CB 4FU9A 3PMAB 3OYPA 1EPTC 3KQDA 2FTMA 2PR3A 1T8OA 2R0KA 5DGJA 1AKSA 2TGDA 1PQ8A 1OWHA 1TRNA 3M3TA 2O9QA 1O3CA 3LU9B 1O3BA 2ZIQH 1V2NT 4CRCA 4I33A 4X8VH 1WU1A 1BCUH 2F9OA 2VWOA 2XOKD 2FOAA 1A1RA 1N1LA 1DUEA 3TJUA 3QX5H 4TY6A 1THPB 2QN5T 5A0AE 2ZEBA 1D3PB 3UWJH 1O2MA 1FY5A 3ESTA 3RXBA 2DE8A 3HKIB 3IWMA 1F0SA 1O3JA 2VVUA 3U8RH 3VB5A 1W14U 1IQFA 2O8MA 2KCAA 1PPZA 1P03A 1P05A 2GCHF 1KXCA 3W1EA 2NWNA 2C8ZB 2WPMS 1OWEA 3A8BA 3MQKC 2FMJA 2LPRA 1C5VA 2BD3A 3SJKA 1HNEE 2BDIA 1UK4A 2GV7A 5JBAS 1T4UH 2Z9JA 1L0ZA 1HBTH 4X1QU 4CH8B 2GDEH 1DM4B 4TY7A 2B0FA 1BRCE 1DDJA 5PTPA 1KTTB 1T8LA 2OCVB 4CBNA 3QN7A 1SG8B 2VGCC 4INLA 1P2QA 2V6NA 1G2LA 1QJ6B 3LC3A 2GP9B 1TX8A 2ULLA 5TJXA 2XCFA 4U30A 1IQGA 1Y3XA 1YLNA 2VIQA 4D9RA 1H9HE 3D49H 1DSTA 2XBYA 1SPJA 2Y5HA 2BLOA 1AVWA 1TX6A 3NUMA 3U28C 3PLBA 1W8BH 2H9TH 1AZ8A 4ZUHA 1IQNA 1A3BH 3URCA 3F9FA 3S9AA 5A8ZA 5EIYA 2IOTA 1V2ST 2FI5E 3LC5A 1ZJDA 5C17A 5DP8A 2KM0A 3PO1B 1O5EH 4NIYA 1MTWA 1AB9C 2IJOB 1O2SA 1YCPH 4Z6AH 1V3XA 3S0NA 1DXPA 1NZQH 2BDCA 2R3YA 4Y76A 4BAOB 1UVOA 1O5FH 1G2MA 4ZMAH 2ZNKH 3PV2A 5EW2H 3TK9A 2VWLA 1XUIA 4Y8XA 2BXTH 3JZ2B 2NU4E 4IBLH 1OSSA 2G81E 5E0GA 4THNH 3WWFA 1ZJKA 2XC4A 4BANB 3I78A 3L6PA 1O3HA 3N99A 5EGMA 3KYFA 5FBIA 1TGNA 3UTUH 4B2BA 1IHSH 1EAUA 1S83A 1SGYE 1ZHRA 1RIWC 3V13A 3SGBE 4Y7BA 2VIDA 2J94A 2EY4C 3OY6U 3BTME 3DCLA 5GXPA 1YPHE 5F8TA 5HXFA 1BMAA 3RXFA 2ZQ1A 4OS4A 1C2EA 3AAVA 2H6MA 1ZTKA 3RLWH 3SU4A 4WF8A 3RXOA 1CGIE 4AFZA 1CO7E 3P8FA 3ZZ9A 3QK1A 2FP7B 1XVOA 4ISOA 2W26A 4NSYA 5AFZH 3V3MA 1YPLH 1PYTC 3FP8E 1MCTA 1PPEE 2ALPA 3GYMA 5CDFE 5T3HA 3RC4A 3SN8A 2ZGBH 1V2RT 2NU1E 3SZNA 1J17T 5EQSA 2PW8H 1E1RD 1BUIA 1O37A 3GDVA 1QRXA 1SFQB 1J14A 1K2I1 1BRAA 1CT2E 3MO3A 3H09A 4M9FA 1D6RA 2UWLA 1DX5M 3LT3A 3RXHA 1YM0A 1FXYA 1OWIA 4X2XA 7LPRA 2ZO3H 1GJ7B 1NO9H 2J92A 3KN2A 1GI6A 1JOUB 3LGIA 4TWWA 4RKJB 4YLUA 2TPIZ 1ETSH 4LZ4B 1C2GA 1O2QA 1Z6EA 1Z6JH 1YBWA 2QGRA 1GJ9B 2ZQ2A 1C1RA 3CP7A 3Q00A 3BSQA 4XRNA 2GJGA 3VB4A 1W0YH 1TGBA 3E90B 3PB1E 1YGCH 4XD7D 1O2NA 1ELGA 1UTQA 1H4WA 4GHTA 5HGGA 3ZZAA 3HGPA 1PFXC 4XBBA 4ZHMU 1KSNA 1NRRH 2AMDA 3UB0A 3UQOA 4WXVA 2BHGA 2G4UA 2JIZD 2IPHA 3AK5A 1CGJE 3K2UA 1D3DB 2G8TA 2ZKSA 4NZQA 3PM3A 3MYWA 3U69H 3VXEH 2SGAA 4RT1A 1NTPA 5FPYA 3RUOA 1O2IA 2P8OC 1G9IE 1EJMA 1Z8JB 3ATKA 2EI6A 1MCVA 5SGAE 1HXFH 4INKA 1S6FA 1ARCA 2QF4A 3P8GA 2J38A 1F5LA 1KXFA 4MLFB 3F9EA 4B6EA 1TABE 1TGTA 5L2YH 1DWEH 1DT2A 2EA3A 4K60A 4A1XA 4BAQB 1W7GH 2WINI 2GVFA 2YMSC 3SHCH 1EP5A 1ESTA 1QBVH 1WSSH 1O5BB 2TIOA 2XBVA 4JZIA 1HAVA 3ZVGA 3KQCA 2V0BA 1B0FA 2VIWA 5A0CA 4OS2A 1NESE 1HJ9A 3QTVH 4YOGA 4KTCA 3FKSD 2WUBA 4GCHG 2AGIX 1QGFA 1O39A 3TK5A 1MZDA 1FY8E 4YOJA 1GHBF 1QQUA 2ZFTA 2RDEA 1LKBA 5EQRA 4DIHH 1P2KA 4TPYA 1BBRK 4WMDA 1HIAA 4ABBA 1GJCB 3L3TA 3M5NA 1NPMA 1CBWC 1W7XH 4D7FA 1QB6A 5DG6A 5HM2A 5IDKA 2F4LA 3E0PB 1QL9A 1SL3A 2WPLS 5AHGH 2Q6GA 3SUDA 4Z0KA 5C0TA 2A5KA 2ANWA 1DWBH 1EKBB 1S84A 1W3CA 2STAE 3TITA 4AG2A 4NIXA 1FI8A 3LGUA 3A7VA 1V2OT 1G37A 1IQMA 1C1SA 2W6ID 5C20A 1ELDE 2KAIB 1UK2A 3ZVBA 3FP7E 4MNVA 3CS0A 1Y3VA 4BTTB 1WYKA 2HLCA 1O5DH 1FIWA 1PQAA 2BVSH 1PYTD 1K1JA 5CMXH 4NA8A 1TRMA 1F92A 4TSFD 1BRBE 1QJ1B 3LOXA 1JIMA 1AO5A 2CHAC 1O5AB 3GCTG 1O3FA 4KTUA 3RXTA 1BA8B 1XUGA 1GI9B 2JETB 5L30H 1GHAF 3SQEE 1Z8RA 2VB0A 4UFGH 1ABJH 1F2SE 2H9EH 1C1TA 1UTKA 3PROA 2TGPZ 4ABIA 5BPEA 1TONA 4NSVA 1E37B 1F0TA 1OKXA 1BDAA 4F49A 2HALA 1H9IE 4CR5A 2YMSB 4ISIH 1HAYB 4U32A 2ZHDA 1C2KA 4K1SA 2C3SA 2SFAA 3A88A 4YZUA 5EOKA 1GI8B 1SQRA 3ZVDA 1C2LA 5F53A 1EASA 1C1UH 4RSPA 5FL7D 1D4PB 5E2PA 4ZKSU 1GBIA 1TA6A 1JXPA 1GJDB 2QC2A 2ZDKA 1QCPA 3EAJA 3P17H 1Y5AT 1A61H 3UWIA 1O2ZA 1HYLA 2Y5GA 1BBRE 1VGCB 1HJAC 3TPIZ 2CK3D 4AFQA 4JZEH 1CBWB 2HRVA 4OS7A 3SHAH 2RCEA 4OS5A 4X1SU 4JCNA 2XYAA 1V2WT 4NIVA 4BAMB 2AIQA 1S6HA 4BAKB 2SGQE 2YNAA 2F9UA 2J98A 1YKTA 1UCYE 4PROA 1BZXE 1HDTH 5KGOA 1RTLA 3FOAA 4E05H 2V3OH 1BMMH 1QTFA 2FS8A 1AE8H 4JK6A 2JH0D 2SGPE 1UK3A 2YMSD 1E79D 1SKYE 1HAOH 1GMCG 4O97A 4ABHA 2PKAB 3MMGA 4K8BA 1OXGA 5JBBS 5B6LA 1MMJN 1C1NA 2BX4A 3W95A 4H42U 5T6FA 1LHDH 1TNGA 1WBGB 2BD9A 5E0JA 3UOPA 2CHAB 1QIXB 4LK4A 4ABDA 3BTTE 4DT4A 1O3DA 2BY7X 3PV5A 1TRYA 3STIA 1S82A 1HAVB 1OYQA 3AW0A 4JYTA 1T7CA 4R8TB 4JYUH 2ZU3A 2J4IA 1HLTH 4MG3A 3MNBA 2RA0A 1MTVA 2FODA 4Y0YE 2FOEA 3SBKA 4K3JA 3S7KB 1G36A 3LJJA 1WQSA 3GISB 4X6NA 1AQ7A 1O2XA 1EAWA 1FMGA 5I25A 1O36A 2Z3DA 2XRCA 4UONA 3E8LA 2WUCA 1P2OA 4O3TA 4X8TH 3QLPH 4ZH8A 3ENSB 2F9PA 3M3VA 4IMQA 5E8EH 1OOKB 3MOCA 3RXEA 2ZHEH 3WWBA 4CRAA 1V2MT 2BY9X 1VCQA 1SMFE 4WH6A 4LXBH 4B75A 1MTSA 3GY2A 3C1KA 1B5GH 1SLXB 1UCYH 1AZZA 4XE4A 3BG4C 1P01A 3HK3B 3GCOA 2AGEX 4ZXXH 4NIWA 1HJAB 2FTLE 3VEQB 8GCHF 3A87A 1ZTJA 1ZR0A 5A2MH 1BTYA 3RMOH 3TJOA 1GI0A 1SOZA 2BLWA 2G5NA 2GGVB 1F5KU 5LPEA 4MVNA 2CF8H 3FFGA 5T1VA 2P94A 3MO6A 1GL0E 1C5NH 3VFEA 3KQEA 3VG8A 1SI5H 4RT0A 1TALA 2OBOA 2BQWB 1H8DH 1FN6A 4HG6A 1IQKA 4XFQA 2FXRA 2GV6A 1HAGE 3UNQA 5EJLA 1C4U2 1LVOA 1SBWA 5EW1H 1ORFA 1CGHA 1YCPK 4CREA 3FAOA 3RMMH 1ZRBA 5FX5A 3LGTA 1ANCA 3SNBA 3UNRA 2TRMA 5J4SA 3SU3A 2BB4A 3K9XB 1YP9A 4JZDH 2FYRA 2DUCA 3EGKH 2QF3A 4UD9H 3V7TA 2ZC9H 1LVMA 3RP2A 3IITA 1SQTA 1LTOA 3SW2B 1O32A 1GBEA 5F6MA 3WW7A 2B9LA 5FBEA 1C2HA 1SHYA 2GCTB 3T2NA 1KLIH 1RD3B 3FVFB 1U6QA 1OWJA 3ZVCA 1PPBH 4CRGA 6LPRA 1H8HD 3ODDA 1RTKA 3HGNA 2ZHWH 3QO6A 1Y5BT 2G52A 2A4OA 3A89A 4D8NA 4D9QA 4B1TA 1SFIA 2R3UA 3EE7A 1ZHPA 4X0WU 3U98H 3ZV9A 1MBQA 4WY3A 3P95A 2AFQB 3BV9B 3SV8A 4BTIB 4Y10E 3RLYH 5DJ7A 2PHBA 2Q6DA 2VJ1A 1MTNB 1KXEA 1W11U 2J97A 1B0EA 1QJ7B 1GCTB 1SGPE 2OQUA 2J2UA 2J95A 3SUFA 2Q1JA 3IG6B 5A0BA 4X1NU 1ANDA 2AMPA 2J98B 4ZROA 3PO1C 2F9BH 2HVYB 2BOKA 2FOHA 3ELAH 3URDA 5C94A 3W94A 1K1MA 1UTMA 1DANH 2WPJS 1GL1A 1BT7A 1IQIA 1COWD 3BTKE 1TMBH 1GHXH 3GY4A 2GDDA 2GKVE 5BRRE 3PRDA 5FHTA 1GBMA 2HLDD 1ESBA 2J34A 4HZHA 1EZXC 1SSXA 6ESTA 4K1EA
chains in the Genus database with same CATH topology
5CHBA 2GGVB 5EQRA 1E1RD 1DY9A 4B73A 3DSPA 3U1IB 1DXWA 5T1VA 1RGQA 3GS9A 1W0JD 4NWLA 5DSFA 3VG8A 2OC7A 3M5NA 3ZIAD 4OM9A 2OBOA 5H4IB 2WPDD 4I32A 2WHXA 5IDKA 3O8RA 5GNDA 2F4LA 3OEED 2F9UA 3H09A 3SZEA 4M9FA 3F2GA 2QF5A 5EPYA 4B71A 2M2AA 5DN6D 3SUEA 3SUDA 5ETXA 3RC6A 5C0TA 1RTLA 3FOAA 2OC0A 2F9VA 2L6OA 3F0OA 2K1QA 2K0QA 2JDID 1E1QD 3KN2A 4Q4LA 3LKWA 1W3CA 2XCFA 3SU5A 2YMSD 1S6LA 4Q63A 1DY8A 1E79D 3SU0A 1SKYE 2W6JD 3SU3A 3LONA 2XNDD 5EQQA 4K8BA 2P59A 2VBCA 2A4RA 2AHME 2OK5A 1NS3A 3EYDA 2W6ID 3OE7D 5B6LA 4I31A 5IK2D 3FO8D 3E90B 3SUGA 4XD7D 3WW7A 3U1JB 2KCPA 3NRLA 1EFRD 2OINA 4DT4A 5C17A 3P8NA 1NBME 5FPTA 2KM0A 4TSFD 3PV5A 3FN8A 2IJOB 1FX0B 2JJ2D 3LOXA 3N7EA 3OTPA 3UB0A 2XNIA 1DXPA 2K8IA 1H8ED 1H8HD 3M5MA 4TYDA 2JIZD 4R8TB 3AK5A 1BMFD 3PV2A 4ZCNA 3SV6A 1KMHB 2JJ1D 3F0PA 4RI0A 3O8CA 4B76A 4F55A 3OYPA 2WZQA 3SV9A 5FPYA 3KF2A 2LELA 2A4GA 3WWFA 3SU6A 3L6PA 1W0KD 2A4QA 3N99A 1NBMD 4Z1MD 3SV8A 2OBQA 3SV7A 3P8OA 4YXWD 2QF4A 2XCNA 2YOLA 4B6FA 5C0UA 2YMSB 5GPIB 4B6EA 3M5OA 4I33A 2OC1A 3SU2A 3SUFA 5FPSA 2J5UA 3WWBA 4A1TA 2OC8A 4A1XA 4TT3D 3DCLA 3F2HA 3O8BA 4WH6A 4B75A 2XOKD 5ESBA 2GVFA 2YMSC 4ASUD 5F53A 5HKKD 4U01A 1A1RA 2FOMB 2KR7A 1N1LA 1MABB 5FL7D 3SU4A 2WSSD 3KNXA 2IJD1 1JXPA 2KZ4A 3PRBA 2KFWA 4WF8A 3RC5A 3DSOA 3SU1A 2FM2A 2V7QD 3KEEA 4NWKA 1BT7A 5GJ4B 3O8DA 4B74A 4WH8A 3F3BA 1COWD 1OHHD 2FP7B 3OAAD 4JMYA 4A1VA 4KTCA 3FKSD 2O8MA 3PRDA 2KCAA 3SYJA 3M5LA 4A92A 3N7DA 3OEHD 2HLDD 2F43B 1CU1A 3W1EA 5CDFE 1WXRA 5EPNA 2KCOA 3RC4A 2QE7D 2WV9A 4FETA 3OFND 3F2FA 2QV1A 2CK3D 2KCYA 5EQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7E A;  2K0Q A;  2LEL A;  3DSP A;  2KM0 A;  3DSO A;  3N7D A; 
#chains in the Genus database with same CATH topology
 4D7G A;  1ARB A;  1EQ9 A;  3JZ1 B;  1VJ9 U;  1TNL A;  4GUX A;  4I32 A;  1O2V A;  2I6Q A;  3F68 H;  5DN6 D;  2ZGX H;  1KXD A;  1NU9 A;  1QBO A;  3SI3 H;  4AZ2 B;  1DSU A;  1L1J A;  2K0Q A;  3M7T A;  4AN7 A;  2BLQ A;  2THF B;  1W0Z U;  4KP0 A;  4IC5 A;  2BLV A;  4I86 A;  1NRS H;  2UUF B;  1J8A A;  2RG3 A;  3OE7 D;  1HAP H;  3TH4 H;  5IK2 D;  1A4W H;  1PQ7 A;  1S81 A;  1TAW A;  4FOU C;  3VB6 A;  4AYY B;  3P92 A;  3KHV A;  5DP5 A;  1GVZ A;  1MD7 A;  2V3M A;  4ACB A;  3NRL A;  4GHQ A;  1BTW A;  3A8D A;  3LIW A;  3EA8 A;  5C3N A;  3T26 A;  4MPX A;  3M5M A;  2FO9 A;  1LHE H;  4YM9 A;  4IS5 A;  4NG9 H;  5GCH G;  1DVA H;  2VIP A;  1TB6 H;  4H6S B;  3RXM A;  4QT8 C;  3UFA A;  1AD8 H;  2LEL A;  1HAI H;  2A45 B;  1NRQ H;  1FUJ A;  1JRT A;  4HTC H;  1RS0 A;  2OBQ A;  1D3T B;  4RN6 A;  1TGC A;  4AGJ A;  1TPO A;  2XCN A;  2PTN A;  1SHH B;  3M61 U;  1F0U A;  4WWY A;  5F8Z A;  4INH A;  1DS2 E;  4UE7 H;  1FON A;  3LDX H;  1Y59 T;  4FUH A;  1ZTL A;  4SGB E;  1AFE H;  3AW1 A;  2KZ4 A;  2GZ9 A;  4GAW A;  3RC5 A;  5JB9 S;  2GT7 A;  3UQV A;  4WH8 A;  4JMY A;  1NT1 A;  2VNT A;  2W3I A;  2F3C E;  2H2Z A;  4Q7Z A;  1Q3X A;  1DOJ A;  5TCC A;  3NWU A;  3N7D A;  5HIY A;  1LCY A;  2O8W A;  3I29 A;  3RXS A;  1H8I H;  1K1L A;  4DVA U;  3K6Z A;  2JH6 D;  2HNT E;  3M35 A;  1P2J A;  1ETT H;  3GS9 A;  3ZIA D;  3KID U;  3O8R A;  1C5Z B;  1SQA A;  1Z71 A;  2PUX B;  5HYO A;  5EXL A;  5TCA A;  3SUE A;  1LKA A;  1K1I A;  2HNT F;  1ESA A;  4ZKN U;  3UR9 A;  3K65 B;  4A7I B;  1BTP A;  4VGC C;  5AFY H;  1O3O A;  3RXR A;  3A8A A;  2WYG A;  1G3E A;  4GVU A;  5JPM H;  3BEI B;  2VBC A;  4OGY A;  3LH1 A;  3C27 B;  4K5Z A;  1QUR H;  2WPH S;  1GMH G;  1L4Z A;  7EST E;  1C5Q A;  4CH2 B;  3MHW U;  5C2Z A;  2D8W A;  1O31 A;  1OP8 A;  1CT4 E;  2ZDM A;  1NBM E;  3MH7 A;  1HGT H;  1KY9 A;  2O8U A;  2XC5 A;  4IMZ A;  3GY8 A;  4FUF A;  1EB1 H;  4TWY A;  4E7N A;  2VWN A;  3BG8 A;  2FOC A;  2W5E A;  1AKS B;  4JZ1 A;  2A2Q H;  1TYN A;  1VIT G;  1EUF A;  1QNJ A;  4IGD A;  1C5W B;  1C5Y B;  1NFW A;  1XXF A;  3T27 A;  2XTT B;  1C1M A;  1LHC H;  4GLY A;  3SV9 A;  4CHA B;  3RU4 T;  2I6S A;  3GYL B;  1KLJ H;  1PPH E;  4F4O C;  2Z3E A;  3SND A;  2CJI A;  1LDT T;  2ZFP H;  1XVM A;  3MNX A;  1SGI B;  2G00 A;  3ZZ3 A;  3DFL A;  2ZGC A;  1EZU C;  1CQQ A;  2OC1 A;  2Y81 A;  2HVX A;  1GDQ A;  4TT3 D;  1C2D A;  5ESB A;  3KGP A;  4KGA A;  1C1O A;  4UFD H;  1P11 E;  1CHG A;  5DP7 A;  4IW4 E;  5HKK D;  4RKO B;  2G55 A;  1MAB B;  2BX3 A;  3ATI A;  2ZFQ H;  1EOL A;  3I77 A;  1A7S A;  1W13 U;  4WMF A;  5EG4 A;  1OWK A;  2ZWL H;  2BD5 A;  3RM2 H;  3SGQ E;  4BTU B;  2HWL B;  2JET C;  1TPA E;  1KLT A;  4X8S H;  1ZMN A;  1V2V T;  1GI5 A;  3M5L A;  5L2Z H;  1CU1 A;  5EPN A;  1IQH A;  3OFN D;  4K8Y A;  1PPC E;  1K22 H;  1YPM H;  5FX6 A;  1TOC B;  1A46 H;  2LNC A;  1DXW A;  4M7G A;  3G01 A;  3Q3X A;  5EJ1 A;  2QXJ A;  1MAX A;  5FCR A;  9LPR A;  1LMW B;  2AER H;  3RMN H;  2PTC E;  2EI8 A;  1BHX B;  1O3L A;  1BQY A;  1C5P A;  2PP6 A;  1TX7 A;  4B71 A;  1N8O B;  4VGC B;  2QIQ A;  2F9N A;  1V2L T;  3HPT B;  1BRU P;  1KTS B;  1SGQ E;  2L6O A;  1UMA H;  3ATL A;  1W12 U;  2Z94 A;  2ZA5 A;  1S6L A;  1XUK A;  3MTY A;  2ZU1 A;  1E36 B;  1T31 A;  4FU7 A;  3UR6 A;  1V2Q T;  1L1N A;  2AHM E;  5LH8 A;  1C2M A;  1ZPB A;  1VGC C;  4X1R U;  4I31 A;  3SOS A;  4Y8Y A;  4GCH F;  1DLE A;  2AH4 X;  1DLK B;  4DCD A;  3MH4 A;  5DO4 H;  3KYG A;  3TH3 H;  1EFR D;  1YCP M;  1DWD H;  1HAZ B;  3M36 A;  1P12 E;  3Q77 A;  2BM2 A;  2G5V A;  3VPK A;  2WPK S;  3RXK A;  1GGD C;  3CNR A;  4I8H A;  1LPZ B;  1GJ6 A;  4XOJ A;  1GBA A;  5DP6 A;  2PUQ H;  4TPI Z;  3ZZC A;  4Y6D A;  1YPJ H;  3S9C A;  2BQ7 B;  1YLD A;  4O9V A;  2W7S A;  3TNT A;  4ZCN A;  1UCY K;  9EST A;  2OQ5 A;  1FLE E;  3KQ5 A;  2JKH A;  2M5T A;  1P10 A;  2CN0 H;  2QYI A;  3S9B A;  4Q2K A;  4FUB A;  1O2T A;  2BD7 A;  1QFK H;  1A3E H;  1NFY A;  1UHB A;  1DFP A;  1CHO G;  1O2G H;  1ZZZ A;  3FAN A;  1SOT A;  3EE0 B;  3GY3 A;  4KKD A;  4XBC A;  2PV9 B;  2Q6F A;  3MU0 A;  1O3K A;  1SR5 C;  2YOL A;  4ACA A;  5CHA C;  1BTZ A;  5I46 H;  2BYA X;  1FV9 A;  1O5C B;  3A85 A;  7GCH G;  4F48 B;  3MU4 A;  4ASU D;  3SJ9 A;  1C1Q A;  1YYY 1;  1AGJ A;  1ELA A;  2IJD 1;  4Y79 A;  3LGW A;  1BHX F;  3RM0 H;  5EJZ A;  2FM2 A;  4Y0Z E;  1YY3 A;  1MKX H;  3GCT F;  1LPG B;  4A92 A;  1EAI A;  4J2Y B;  5EXM A;  1E35 B;  1SGC A;  1ZSJ A;  2F43 B;  3QGN B;  4ABF A;  2R2W U;  5DP9 A;  3UOU A;  3D65 E;  4X6O A;  3NKK A;  3SJ8 A;  4MTB A;  3PMH B;  2KCY A;  4YES B;  1ZHM A;  2B8O H;  3HAT H;  1DE7 H;  1UO6 A;  2ZEC A;  1IQJ A;  1OWD A;  1O3P B;  2A7J A;  3GCH C;  1AU8 A;  1C2F A;  1YPG H;  3L33 A;  3DUX H;  1O2J A;  4XDE A;  2A2X H;  1ELF A;  3F2G A;  5EPY A;  4AYV B;  3AAS A;  1EAT A;  1H1B A;  3E6P H;  2BD2 A;  2CGA A;  1GBT A;  3A7W A;  2R9P A;  1ELB A;  4FUG A;  4FVB A;  2BTC E;  2BVX H;  2P3T B;  3SGA E;  1YC0 A;  2H9H A;  3DT0 H;  5EQQ A;  2LP6 A;  4AFS A;  4ZHL U;  1G3D A;  2IN2 A;  2Y5F A;  1GGD B;  3TNS A;  2FI4 E;  1C2I A;  1EAX A;  2KCP A;  2EST E;  3BIU H;  2OIN A;  3TGJ E;  3Q3Y A;  3TLO A;  4CRB A;  2ZHF H;  1EP6 A;  4AB8 A;  1SGR E;  3T25 A;  3A84 A;  1SQO A;  4RI0 A;  3SJO A;  4F55 A;  1A2C H;  2WYJ A;  1QBN A;  3BTG E;  1NU7 B;  5KED A;  1O3I A;  3KF2 A;  1FPH H;  1LHG H;  3RXI A;  5CHA B;  3SU6 A;  1ELE E;  2A4Q A;  1GI4 A;  4X6M A;  2Z9I A;  5GWZ A;  1BIT A;  1O35 A;  1D3Q B;  4MPU A;  1A0H B;  1GMC F;  2ANM H;  5C0U A;  1D9I A;  1P02 A;  2ZU5 A;  3E16 B;  5FPS A;  1AVX A;  2OC8 A;  3GCN A;  4Y11 E;  1S0Q A;  1C4V 2;  6GCH G;  1NY2 2;  2GCT C;  2GZ8 A;  2ZPR A;  1GMD G;  2AYW A;  3FP6 E;  2Z7F E;  3A8C A;  2FOM B;  4BAH B;  2P16 A;  5LGO A;  1TQ7 B;  3GDU A;  4I8L A;  1HFD A;  3MU8 A;  1UJ1 A;  2HPQ H;  1XM1 A;  2QA9 E;  1O3A A;  4WME A;  1CA8 B;  4I8G A;  4AOR A;  5ABW A;  5KEC A;  2NU2 E;  1EXF A;  2PSX A;  3A86 A;  3KL6 A;  4DGJ A;  2C93 B;  1ZYO A;  3OEH D;  3U8O H;  1YWU A;  3QZR A;  2Y82 A;  2D26 C;  4D76 A;  1HIA B;  1YLC A;  1MD8 A;  2QE7 D;  3GCH B;  1GJB B;  1GI1 A;  2ZGH A;  5F8X A;  1J15 A;  3UUZ A;  5C1Y A;  1MUE B;  1MTN C;  1F7Z A;  3U1I B;  1ZMJ A;  5IYT A;  1GCT C;  2ZPQ A;  3RXC A;  1S0R A;  4Q7Y A;  1SGN E;  4HI3 A;  1K1N A;  3ZZ8 A;  2WPD D;  1THR H;  3A7X A;  2OP9 A;  2UWO A;  1TGS Z;  5ETX A;  1TNK A;  4UEH H;  3VB3 A;  3RDZ A;  1FDP A;  1EJN A;  1ZRK A;  2FES H;  2FS9 A;  4MQA A;  3TU7 H;  1UHB B;  1GBF A;  1THS H;  1C9T A;  1C5L H;  2W6J D;  1O38 A;  2XND D;  2DE9 A;  2Z3C A;  2A7C A;  1NRN H;  1IHT H;  1LVB A;  3TK6 A;  1O3G A;  2ZI2 H;  5EOD A;  4OS6 A;  3SUG A;  8KME 2;  1C4Y 2;  3P70 B;  4X2Y A;  1C5S A;  3FZD A;  2ZFR H;  3E3T A;  1W10 U;  2C90 B;  2QCY A;  2A5I A;  1FIZ A;  3P8N A;  1RXP A;  2JH5 D;  3OTP A;  6CHA B;  1O2L A;  3Q76 A;  3SQH E;  2SGE E;  3PMB B;  1GBB A;  3SV6 A;  1AFQ B;  3F1S B;  3E91 A;  1TMU H;  1VCP A;  1EPT A;  3P6Z B;  3TGI E;  3BTE E;  3RXD A;  4MNX A;  3UAI C;  4FUC A;  1NRO H;  2GZ7 A;  1W0K D;  1MH0 A;  1HV7 A;  1YPE H;  4ABJ A;  4X1P U;  1FY1 A;  3MO9 A;  4DW2 U;  2CV3 A;  1ZPZ A;  1ANE A;  1XKA C;  2XBX A;  4K2Y A;  1SB1 H;  2AEI H;  2GTB A;  4Y7A A;  1MKW K;  2ZTX A;  1KYN A;  4A5T S;  3T62 A;  2HNT C;  2RA3 A;  4ZKO U;  2H1U A;  2WPI S;  1GHV H;  4OGX A;  1TOM H;  4BNR A;  3UIR A;  1QHR B;  1XKB C;  3BEF B;  1MU6 B;  3F3B A;  4OS1 A;  4YT6 H;  1FAX A;  3OAA D;  1ID5 H;  3FZZ A;  4WVP E;  5K7R A;  5EU8 A;  1QB1 A;  4GSO A;  2D2D A;  1ANB A;  1OYT H;  1WXR A;  2QXH A;  1WDI A;  3M3S A;  1QRZ A;  4BXS A;  3F6U H;  1WQV H;  3PMJ A;  3QDZ B;  2TBS A;  3MH5 A;  1DY9 A;  1C5M D;  2EC9 H;  3DSP A;  1WCZ A;  3B8J A;  3ZZB A;  7KME H;  1W0J D;  2B5T B;  3DSG A;  1Y8T A;  2ILN A;  2C4F H;  2CF9 H;  2BDB A;  3NZI A;  1P2N A;  4E7R G;  2UUY A;  8EST E;  3M7Q A;  1ZML A;  4ISL A;  2VIV A;  1HXE H;  1SLU B;  2ODY B;  2PGQ B;  5J4Q A;  4P00 A;  1WAY B;  4E06 H;  2K1Q A;  1LVY A;  4X6P A;  1FJS A;  4NFF A;  1QL7 A;  4Q63 A;  1C1W H;  1DY8 A;  3SU0 A;  2QAA A;  1FN8 A;  3LON A;  1NRP H;  1O2K A;  2FOB A;  2ZTZ A;  1UTN A;  2A4R A;  1W2K H;  1NS3 A;  5A09 A;  4FUJ A;  3OTJ E;  5FXL A;  1O2H A;  1HJ8 A;  5DKM A;  3BTQ E;  4NA9 H;  1CVW H;  2SGF E;  2R2M B;  2FLR H;  5E2O A;  1AUT C;  2PKS B;  3AVZ A;  2GMT B;  1TNH A;  5C1X A;  1GI3 A;  3N7E A;  2ODP A;  2RFK C;  2NU0 E;  1GG6 B;  2FOG A;  1E0F D;  3MI4 A;  4MPW A;  3VGC B;  1P09 A;  3B23 B;  2ZDL A;  2G4T A;  4DOQ A;  1KMH B;  2GCH G;  2GD4 B;  2O8T A;  1SVP A;  5JB8 S;  1BTX A;  2WZQ A;  3OY5 U;  1GJ5 H;  3ODF A;  2PWX A;  3A83 A;  1Y3U A;  2A4G A;  3PWC A;  3S69 A;  4ISN A;  2ANY A;  1IQE A;  5CE1 A;  2Y7Z A;  1EX3 A;  4AGK A;  3DD2 H;  5LPR A;  3SV7 A;  3ZVA A;  3SI4 H;  2V35 A;  5HMA A;  2VVC A;  4NCY A;  1GBH A;  2QXG A;  1G32 B;  1XXD A;  3M5O A;  2ZF0 H;  1O3M A;  2ZCH P;  1L2E A;  4MPV A;  3F2H A;  3T5F H;  3GY5 A;  3ZVF A;  4NFE A;  2AMQ A;  1Z1I A;  2BOH B;  1CA0 B;  4AFU A;  3HK6 B;  1KXA A;  3LPR A;  4BXW A;  1E34 B;  1V2K T;  3O8D A;  1QA7 A;  2F91 A;  1PPF E;  1SLV B;  2ZP0 H;  1JIR A;  1GPZ A;  4CHA C;  1VCW A;  3BIV H;  2BMG B;  2ANK H;  1Z8G A;  5GCH F;  4K69 A;  1N6X A;  3RU4 D;  2Y80 A;  2WV9 A;  5FAH A;  1S5S A;  2PSY A;  1V6D A;  1TMT H;  4FET A;  3RXQ A;  5K0H A;  2QV1 A;  2BXU H;  3QZQ A;  1GWA A;  3WY8 A;  3ZV8 A;  2OD3 B;  5CHB A;  3RXG A;  3RU4 E;  4DII H;  1O2W A;  1P8V C;  4B73 A;  1JMO H;  1BMN H;  5DSF A;  4OM9 A;  3GIC B;  1LQD B;  5A8X A;  1O2P A;  3SZE A;  2FX4 A;  3GY6 A;  1DIT H;  1EPT B;  4H6T A;  3SNC A;  1AWH B;  1BTU A;  2W7U A;  1NFX A;  1TQ0 B;  1MU8 B;  4WJG 2;  2P59 A;  1MKW H;  2Z6B D;  1QB9 A;  2OK5 A;  3ZZ4 A;  4DG4 A;  1V2U T;  1MTU A;  2ALV A;  1O30 A;  3V0X A;  2XWA A;  5DPA A;  1UTP A;  5C1U A;  2SGD E;  4JK5 A;  1KDQ A;  4ZKR U;  1SGF G;  5G4B A;  3SNE A;  4ABG A;  3ATW A;  1T4V H;  2KAI A;  3FN8 A;  3F9H A;  4ABA A;  2XNI A;  1CT0 E;  1BIO A;  1OP0 A;  4TYD A;  4UFE H;  1P2M A;  4H4F A;  2H5C A;  3QWC H;  1N8O C;  1JWT A;  2FDA A;  2AGG X;  3QTO H;  1JBU H;  5DP3 A;  2VIO A;  1AVG H;  1Z7K A;  1P3C A;  2P93 A;  4CRF A;  1AE5 A;  3A7Y A;  1TA2 A;  1Q2W A;  4UFF H;  1OPH B;  3ZZ6 A;  3BN9 A;  1C1V H;  1ELT A;  1MKX K;  1TPP A;  2TGA A;  4U2W A;  3T29 A;  1NBM D;  2BD8 A;  3H7O A;  2XW9 A;  1Y5U T;  1NN6 A;  3P8O A;  1Z8I B;  4B6F A;  2FX6 A;  1FNI A;  1MQ5 A;  5E0H A;  1QRW A;  4YOI A;  2A31 A;  1XUH A;  3GOV B;  4KEL A;  4A1T A;  1ETR H;  1PJP A;  1H9L B;  1FZZ A;  5B6O A;  1GMH F;  1O2R A;  1MBM A;  2ZGJ A;  1NM6 A;  4U01 A;  2KR7 A;  3DFJ A;  2ZZU H;  2VGC B;  2OTV A;  2BY8 X;  1GHY H;  4I7Y H;  1T8N A;  5FCK A;  1AN1 E;  1ZGV A;  2KFW A;  1GBC A;  3DSO A;  3SU1 A;  1L4D A;  2GX4 A;  1RFN A;  1P0S H;  1AY6 H;  1HAX B;  2STB E;  1GDN A;  1IAU A;  1TE0 A;  1VIT F;  2QY0 B;  2FEQ H;  2KCO A;  4MNY A;  4Q7X A;  1YF4 A;  1GHZ A;  1BTH H;  1CE5 A;  3PWB A;  2BQ6 B;  3MU5 A;  1ABI H;  2D1J A;  5C5N A;  2OUA A;  1TBQ H;  1HCG A;  4K1T A;  1UVP A;  4DUR A;  3PTN A;  2OC7 A;  2XC0 A;  1UW7 A;  1AB9 B;  1HRT H;  5GND A;  1QL8 A;  4FUE A;  3RXA A;  1GBL A;  3RC6 A;  3NXP A;  1BOQ A;  2OC0 A;  1LHF H;  2BZ6 H;  2C8W B;  2JDI D;  2BZA A;  1C5X B;  1EZS C;  1O5G H;  3BF6 H;  3ZYD A;  4JYV H;  3U8T H;  2AIP A;  1GBK A;  1RIW B;  4IC6 A;  3STJ A;  2ZHQ H;  4HFP B;  3TGK E;  3NCL A;  1YPK H;  4A6L A;  3RXU A;  2EQN A;  2PKA A;  1RTF B;  2RDL A;  1HB0 B;  1O33 A;  1VIT H;  5FPT A;  4CRD A;  4B2A A;  4R0I A;  2UUK B;  1TBZ H;  3A7Z A;  4ZXY H;  1RRK A;  3VXF H;  1WOF A;  1BMF D;  1GVK B;  1BJU A;  2JJ1 D;  2Z9K A;  4B76 A;  3RXP A;  4DY7 B;  2VIN A;  1GHB G;  2VH6 A;  4AC9 A;  1V2T T;  3VB7 A;  4LZ1 H;  3TJV A;  5T6G A;  1ZOM A;  2H5D A;  4UDW H;  1G30 B;  4ZAE A;  3ZYE A;  4YXW D;  1HPG A;  1IQL A;  1QR3 E;  3Q3K A;  1SC8 U;  2BY5 X;  2PLX A;  1A0L A;  1JRS A;  1QQ4 A;  1NC6 A;  2G51 A;  3EDX B;  3MU1 A;  5JBT A;  3K6Y A;  3ZZ7 A;  1GJ4 H;  1S85 A;  1SLW B;  1EOJ A;  4XBD A;  3RXV A;  2ZDV H;  3ZZD A;  5HM9 A;  3S7H B;  1O3N A;  4Y8Z A;  2ODQ A;  1M9U A;  1AWF H;  1TNJ A;  1UTO A;  1OX1 A;  5F03 A;  2QXI A;  1C5T A;  1INC A;  4DJZ B;  1G3C A;  4CR9 A;  3MH6 A;  1TNI A;  2V7Q D;  1FY3 A;  4AB9 A;  1VKY A;  2Y7X A;  1XUF A;  3A80 A;  3EA7 A;  3QUM P;  2A7H A;  2XWB I;  1J9C H;  1DUA A;  4SGA E;  1P9S A;  3OX7 U;  1QZ8 A;  1WTG H;  1KDQ B;  2FWW A;  2P3F H;  1CHO F;  2FOF A;  3ITI A;  1ELV A;  3LGY A;  1RGQ A;  1P57 B;  1TPS A;  3ZZ5 A;  4NWL A;  2Z9G A;  5DP4 A;  3TVJ B;  4J1Y A;  4I8J A;  4FU8 A;  3HKJ B;  2WHX A;  1ZLR A;  1GHA G;  2HPP H;  2A5A A;  4P02 A;  3RML H;  1K1P A;  2ZPS A;  7GCH F;  1IOE A;  3TH2 H;  4YT7 H;  2VWM A;  3UY9 A;  3SU5 A;  2EI7 A;  4Q4L A;  1E1Q D;  1XMN B;  3LKW A;  3M37 A;  2P8O B;  5A8Y A;  2IPQ X;  2BVR H;  3PYH A;  2PGB B;  1O3E A;  2BD4 A;  2C8X B;  2A0Q B;  5AF9 H;  1O2U A;  2J9N A;  4FUI A;  2EEK A;  3H7T A;  3PTB A;  1FQ3 A;  1XUJ A;  1C9P A;  4MDS A;  1P06 A;  3MNS A;  1ELC A;  1P04 A;  3NPS A;  2KX4 A;  4Y71 A;  3LJO A;  3E1X B;  4FUD A;  4EST E;  1MQ6 A;  1SGD E;  1SGT A;  3KQB A;  3PLK A;  4BOH A;  4NGA H;  1FX0 B;  1WTH D;  2JJ2 D;  3SO3 A;  2P3U B;  2Y6T A;  2B7D H;  1LO6 A;  1WV7 H;  4NZL A;  2ZTY A;  5JBC S;  3RXL A;  3N7O A;  1GVL A;  1OP2 A;  1LPK B;  3M7U A;  3F0P A;  1PQ5 A;  3PLP A;  1GJ8 B;  4X2V A;  3F9G A;  2XXL A;  3SV2 H;  5AVD A;  4JZF H;  1D6W A;  1O2Y A;  1ZPC A;  4IN2 A;  4ZHA A;  5T6D A;  1GI2 A;  5C67 A;  4Z1M D;  2QF0 A;  1UTL M;  4MNW A;  1FPC H;  1GI7 B;  3MFJ A;  3DA9 B;  4B2C A;  2CXV A;  1WUN H;  2PFE A;  4X2W A;  1A5I A;  1BB0 B;  5L6N H;  5LPF A;  3ATM A;  1AUJ A;  1BML A;  3CEN A;  1UTJ A;  1VJA U;  2NU3 E;  2VVV A;  8LPR A;  1TLD A;  5JDU B;  1HUT H;  1TFX A;  2ZCK P;  6CHA C;  2WV5 A;  2BDA A;  1G3B A;  3KCG H;  2FZZ A;  3BTH E;  3A81 A;  3KEE A;  4NWK A;  1VR1 H;  1AFQ C;  2A1D B;  4B74 A;  1UVT H;  1EZQ A;  1OHH D;  2HOB A;  5DK1 A;  3AAU A;  1LQE A;  2ZU4 A;  1ZSK A;  3ZVE A;  1O2O A;  1NFU A;  1KXB A;  1A5G H;  2C8Y B;  1AIX H;  3NK8 A;  5H4I B;  1TWX B;  4O3U A;  3OEE D;  1ZSL A;  3T28 A;  1K0H A;  2F83 A;  2M2A A;  1UVU H;  3A7T A;  1KIG H;  6GCH F;  5HIZ A;  3OSY A;  4AX9 H;  1GMD F;  3MWI U;  2VH0 A;  3F0O A;  3RXJ A;  1FY4 A;  1K28 D;  3BTF E;  4ASH A;  1P2I A;  5C5O A;  1K21 H;  4WXI A;  2OXS A;  3EYD A;  1BBR H;  2TGT A;  3U9A H;  3FO8 D;  1GBJ A;  2ZFS A;  3V12 A;  1DIC A;  1CSO E;  2AS9 A;  1K9O E;  3MNC A;  1Q31 A;  2ZCL P;  1ACB E;  1FAK H;  1SGF A;  2UUJ B;  4ISH H;  2K8I A;  1H8E D;  8GCH G;  1MAY A;  3UPE A;  1EB2 A;  4Q80 A;  1DPO A;  1Y3Y A;  2BY6 X;  1SGE E;  2W3K A;  1X7A C;  1BJV A;  1RJX B;  1VZQ H;  2ASU B;  4YTA A;  2CMY A;  1OS8 A;  3CS7 A;  1C5O H;  4YO9 A;  1GBD A;  3R3G B;  1XX9 A;  1GHW H;  2SNV A;  5GPI B;  3DHK H;  3SU2 A;  3SJI A;  3D62 A;  2J5U A;  1GJA B;  1V2J T;  1B7X B;  4NA7 A;  3O8B A;  2PKS C;  2BDG A;  2GMT C;  4FXG H;  4ABE A;  1QY6 A;  1AMH A;  3PV4 A;  2FLB H;  1GG6 C;  2FYQ A;  2WSS D;  3BTD E;  3KNX A;  1N6Y A;  3OU0 A;  3TIU A;  4AOQ A;  3VGC C;  3PRB A;  2YNB A;  1T8M A;  3QGJ A;  4CBO A;  2ZDA H;  3A82 A;  2FPZ A;  5GJ4 B;  1QA0 A;  4A1V A;  4O03 A;  1GDU A;  2XBW A;  3SYJ A;  3D23 A;  3GDS A;  3URE A;  4AG1 A;  1O0D H;  1P9U A;  3BEU A;  2GT8 A;  3F2F A;  1V2P T;  1Y3W A;  1AHT H;  1PPG E;  1O34 A;  1ZGI A;  2WV4 A;  1C5U A;  1C1P A;  5GIB A;  2Z9L A;  2ZU2 A;  3LGV A;  3UNS A;  2P95 A;  4I8K A;  5JYI A;  2ZFF H;  4IN1 A;  2QF5 A;  1CA0 C;  1T32 A;  1TIO A;  2O8L A;  3SNA A;  2V3H H;  2FIR H;  4LOY H;  3EQ0 H;  2F9V A;  4FVD A;  4YLQ H;  3EA9 A;  2OLG A;  2VU8 E;  2BDH A;  3BTW E;  4X8U H;  1YPH C;  1C5R A;  4DT7 B;  1P3E A;  4XSK U;  2ZG0 H;  2FI3 E;  1EJA A;  3TJN A;  3LH3 A;  1A0J A;  1TBR H;  1Z1J A;  2A32 A;  5EXN A;  2SNW A;  2L74 A;  2HGT H;  2R0L A;  3GY7 A;  5EST E;  3R0F A;  1K1O A;  1C2J A;  1HAH H;  4KTS A;  5GDS H;  3U1J B;  1L1G A;  1MZA A;  2UWP A;  1F5R A;  3E0N B;  4GPG A;  1F0R A;  3SOR A;  3BG4 B;  2BDY A;  2ZDN A;  1DWC H;  4HGC A;  1AI8 H;  3B9F H;  1UVS H;  3O8C A;  1J16 A;  1E38 B;  1GCD A;  1A5H A;  3H5C B;  4FU9 A;  3PMA B;  3OYP A;  1EPT C;  3KQD A;  2FTM A;  2PR3 A;  1T8O A;  2R0K A;  5DGJ A;  1AKS A;  2TGD A;  1PQ8 A;  1OWH A;  1TRN A;  3M3T A;  2O9Q A;  1O3C A;  3LU9 B;  1O3B A;  2ZIQ H;  1V2N T;  4CRC A;  4I33 A;  4X8V H;  1WU1 A;  1BCU H;  2F9O A;  2VWO A;  2XOK D;  2FOA A;  1A1R A;  1N1L A;  1DUE A;  3TJU A;  3QX5 H;  4TY6 A;  1THP B;  2QN5 T;  5A0A E;  2ZEB A;  1D3P B;  3UWJ H;  1O2M A;  1FY5 A;  3EST A;  3RXB A;  2DE8 A;  3HKI B;  3IWM A;  1F0S A;  1O3J A;  2VVU A;  3U8R H;  3VB5 A;  1W14 U;  1IQF A;  2O8M A;  2KCA A;  1PPZ A;  1P03 A;  1P05 A;  2GCH F;  1KXC A;  3W1E A;  2NWN A;  2C8Z B;  2WPM S;  1OWE A;  3A8B A;  3MQK C;  2FMJ A;  2LPR A;  1C5V A;  2BD3 A;  3SJK A;  1HNE E;  2BDI A;  1UK4 A;  2GV7 A;  5JBA S;  1T4U H;  2Z9J A;  1L0Z A;  1HBT H;  4X1Q U;  4CH8 B;  2GDE H;  1DM4 B;  4TY7 A;  2B0F A;  1BRC E;  1DDJ A;  5PTP A;  1KTT B;  1T8L A;  2OCV B;  4CBN A;  3QN7 A;  1SG8 B;  2VGC C;  4INL A;  1P2Q A;  2V6N A;  1G2L A;  1QJ6 B;  3LC3 A;  2GP9 B;  1TX8 A;  2ULL A;  5TJX A;  2XCF A;  4U30 A;  1IQG A;  1Y3X A;  1YLN A;  2VIQ A;  4D9R A;  1H9H E;  3D49 H;  1DST A;  2XBY A;  1SPJ A;  2Y5H A;  2BLO A;  1AVW A;  1TX6 A;  3NUM A;  3U28 C;  3PLB A;  1W8B H;  2H9T H;  1AZ8 A;  4ZUH A;  1IQN A;  1A3B H;  3URC A;  3F9F A;  3S9A A;  5A8Z A;  5EIY A;  2IOT A;  1V2S T;  2FI5 E;  3LC5 A;  1ZJD A;  5C17 A;  5DP8 A;  2KM0 A;  3PO1 B;  1O5E H;  4NIY A;  1MTW A;  1AB9 C;  2IJO B;  1O2S A;  1YCP H;  4Z6A H;  1V3X A;  3S0N A;  1DXP A;  1NZQ H;  2BDC A;  2R3Y A;  4Y76 A;  4BAO B;  1UVO A;  1O5F H;  1G2M A;  4ZMA H;  2ZNK H;  3PV2 A;  5EW2 H;  3TK9 A;  2VWL A;  1XUI A;  4Y8X A;  2BXT H;  3JZ2 B;  2NU4 E;  4IBL H;  1OSS A;  2G81 E;  5E0G A;  4THN H;  3WWF A;  1ZJK A;  2XC4 A;  4BAN B;  3I78 A;  3L6P A;  1O3H A;  3N99 A;  5EGM A;  3KYF A;  5FBI A;  1TGN A;  3UTU H;  4B2B A;  1IHS H;  1EAU A;  1S83 A;  1SGY E;  1ZHR A;  1RIW C;  3V13 A;  3SGB E;  4Y7B A;  2VID A;  2J94 A;  2EY4 C;  3OY6 U;  3BTM E;  3DCL A;  5GXP A;  1YPH E;  5F8T A;  5HXF A;  1BMA A;  3RXF A;  2ZQ1 A;  4OS4 A;  1C2E A;  3AAV A;  2H6M A;  1ZTK A;  3RLW H;  3SU4 A;  4WF8 A;  3RXO A;  1CGI E;  4AFZ A;  1CO7 E;  3P8F A;  3ZZ9 A;  3QK1 A;  2FP7 B;  1XVO A;  4ISO A;  2W26 A;  4NSY A;  5AFZ H;  3V3M A;  1YPL H;  1PYT C;  3FP8 E;  1MCT A;  1PPE E;  2ALP A;  3GYM A;  5CDF E;  5T3H A;  3RC4 A;  3SN8 A;  2ZGB H;  1V2R T;  2NU1 E;  3SZN A;  1J17 T;  5EQS A;  2PW8 H;  1E1R D;  1BUI A;  1O37 A;  3GDV A;  1QRX A;  1SFQ B;  1J14 A;  1K2I 1;  1BRA A;  1CT2 E;  3MO3 A;  3H09 A;  4M9F A;  1D6R A;  2UWL A;  1DX5 M;  3LT3 A;  3RXH A;  1YM0 A;  1FXY A;  1OWI A;  4X2X A;  7LPR A;  2ZO3 H;  1GJ7 B;  1NO9 H;  2J92 A;  3KN2 A;  1GI6 A;  1JOU B;  3LGI A;  4TWW A;  4RKJ B;  4YLU A;  2TPI Z;  1ETS H;  4LZ4 B;  1C2G A;  1O2Q A;  1Z6E A;  1Z6J H;  1YBW A;  2QGR A;  1GJ9 B;  2ZQ2 A;  1C1R A;  3CP7 A;  3Q00 A;  3BSQ A;  4XRN A;  2GJG A;  3VB4 A;  1W0Y H;  1TGB A;  3E90 B;  3PB1 E;  1YGC H;  4XD7 D;  1O2N A;  1ELG A;  1UTQ A;  1H4W A;  4GHT A;  5HGG A;  3ZZA A;  3HGP A;  1PFX C;  4XBB A;  4ZHM U;  1KSN A;  1NRR H;  2AMD A;  3UB0 A;  3UQO A;  4WXV A;  2BHG A;  2G4U A;  2JIZ D;  2IPH A;  3AK5 A;  1CGJ E;  3K2U A;  1D3D B;  2G8T A;  2ZKS A;  4NZQ A;  3PM3 A;  3MYW A;  3U69 H;  3VXE H;  2SGA A;  4RT1 A;  1NTP A;  5FPY A;  3RUO A;  1O2I A;  2P8O C;  1G9I E;  1EJM A;  1Z8J B;  3ATK A;  2EI6 A;  1MCV A;  5SGA E;  1HXF H;  4INK A;  1S6F A;  1ARC A;  2QF4 A;  3P8G A;  2J38 A;  1F5L A;  1KXF A;  4MLF B;  3F9E A;  4B6E A;  1TAB E;  1TGT A;  5L2Y H;  1DWE H;  1DT2 A;  2EA3 A;  4K60 A;  4A1X A;  4BAQ B;  1W7G H;  2WIN I;  2GVF A;  2YMS C;  3SHC H;  1EP5 A;  1EST A;  1QBV H;  1WSS H;  1O5B B;  2TIO A;  2XBV A;  4JZI A;  1HAV A;  3ZVG A;  3KQC A;  2V0B A;  1B0F A;  2VIW A;  5A0C A;  4OS2 A;  1NES E;  1HJ9 A;  3QTV H;  4YOG A;  4KTC A;  3FKS D;  2WUB A;  4GCH G;  2AGI X;  1QGF A;  1O39 A;  3TK5 A;  1MZD A;  1FY8 E;  4YOJ A;  1GHB F;  1QQU A;  2ZFT A;  2RDE A;  1LKB A;  5EQR A;  4DIH H;  1P2K A;  4TPY A;  1BBR K;  4WMD A;  1HIA A;  4ABB A;  1GJC B;  3L3T A;  3M5N A;  1NPM A;  1CBW C;  1W7X H;  4D7F A;  1QB6 A;  5DG6 A;  5HM2 A;  5IDK A;  2F4L A;  3E0P B;  1QL9 A;  1SL3 A;  2WPL S;  5AHG H;  2Q6G A;  3SUD A;  4Z0K A;  5C0T A;  2A5K A;  2ANW A;  1DWB H;  1EKB B;  1S84 A;  1W3C A;  2STA E;  3TIT A;  4AG2 A;  4NIX A;  1FI8 A;  3LGU A;  3A7V A;  1V2O T;  1G37 A;  1IQM A;  1C1S A;  2W6I D;  5C20 A;  1ELD E;  2KAI B;  1UK2 A;  3ZVB A;  3FP7 E;  4MNV A;  3CS0 A;  1Y3V A;  4BTT B;  1WYK A;  2HLC A;  1O5D H;  1FIW A;  1PQA A;  2BVS H;  1PYT D;  1K1J A;  5CMX H;  4NA8 A;  1TRM A;  1F92 A;  4TSF D;  1BRB E;  1QJ1 B;  3LOX A;  1JIM A;  1AO5 A;  2CHA C;  1O5A B;  3GCT G;  1O3F A;  4KTU A;  3RXT A;  1BA8 B;  1XUG A;  1GI9 B;  2JET B;  5L30 H;  1GHA F;  3SQE E;  1Z8R A;  2VB0 A;  4UFG H;  1ABJ H;  1F2S E;  2H9E H;  1C1T A;  1UTK A;  3PRO A;  2TGP Z;  4ABI A;  5BPE A;  1TON A;  4NSV A;  1E37 B;  1F0T A;  1OKX A;  1BDA A;  4F49 A;  2HAL A;  1H9I E;  4CR5 A;  2YMS B;  4ISI H;  1HAY B;  4U32 A;  2ZHD A;  1C2K A;  4K1S A;  2C3S A;  2SFA A;  3A88 A;  4YZU A;  5EOK A;  1GI8 B;  1SQR A;  3ZVD A;  1C2L A;  5F53 A;  1EAS A;  1C1U H;  4RSP A;  5FL7 D;  1D4P B;  5E2P A;  4ZKS U;  1GBI A;  1TA6 A;  1JXP A;  1GJD B;  2QC2 A;  2ZDK A;  1QCP A;  3EAJ A;  3P17 H;  1Y5A T;  1A61 H;  3UWI A;  1O2Z A;  1HYL A;  2Y5G A;  1BBR E;  1VGC B;  1HJA C;  3TPI Z;  2CK3 D;  4AFQ A;  4JZE H;  1CBW B;  2HRV A;  4OS7 A;  3SHA H;  2RCE A;  4OS5 A;  4X1S U;  4JCN A;  2XYA A;  1V2W T;  4NIV A;  4BAM B;  2AIQ A;  1S6H A;  4BAK B;  2SGQ E;  2YNA A;  2F9U A;  2J98 A;  1YKT A;  1UCY E;  4PRO A;  1BZX E;  1HDT H;  5KGO A;  1RTL A;  3FOA A;  4E05 H;  2V3O H;  1BMM H;  1QTF A;  2FS8 A;  1AE8 H;  4JK6 A;  2JH0 D;  2SGP E;  1UK3 A;  2YMS D;  1E79 D;  1SKY E;  1HAO H;  1GMC G;  4O97 A;  4ABH A;  2PKA B;  3MMG A;  4K8B A;  1OXG A;  5JBB S;  5B6L A;  1MMJ N;  1C1N A;  2BX4 A;  3W95 A;  4H42 U;  5T6F A;  1LHD H;  1TNG A;  1WBG B;  2BD9 A;  5E0J A;  3UOP A;  2CHA B;  1QIX B;  4LK4 A;  4ABD A;  3BTT E;  4DT4 A;  1O3D A;  2BY7 X;  3PV5 A;  1TRY A;  3STI A;  1S82 A;  1HAV B;  1OYQ A;  3AW0 A;  4JYT A;  1T7C A;  4R8T B;  4JYU H;  2ZU3 A;  2J4I A;  1HLT H;  4MG3 A;  3MNB A;  2RA0 A;  1MTV A;  2FOD A;  4Y0Y E;  2FOE A;  3SBK A;  4K3J A;  3S7K B;  1G36 A;  3LJJ A;  1WQS A;  3GIS B;  4X6N A;  1AQ7 A;  1O2X A;  1EAW A;  1FMG A;  5I25 A;  1O36 A;  2Z3D A;  2XRC A;  4UON A;  3E8L A;  2WUC A;  1P2O A;  4O3T A;  4X8T H;  3QLP H;  4ZH8 A;  3ENS B;  2F9P A;  3M3V A;  4IMQ A;  5E8E H;  1OOK B;  3MOC A;  3RXE A;  2ZHE H;  3WWB A;  4CRA A;  1V2M T;  2BY9 X;  1VCQ A;  1SMF E;  4WH6 A;  4LXB H;  4B75 A;  1MTS A;  3GY2 A;  3C1K A;  1B5G H;  1SLX B;  1UCY H;  1AZZ A;  4XE4 A;  3BG4 C;  1P01 A;  3HK3 B;  3GCO A;  2AGE X;  4ZXX H;  4NIW A;  1HJA B;  2FTL E;  3VEQ B;  8GCH F;  3A87 A;  1ZTJ A;  1ZR0 A;  5A2M H;  1BTY A;  3RMO H;  3TJO A;  1GI0 A;  1SOZ A;  2BLW A;  2G5N A;  2GGV B;  1F5K U;  5LPE A;  4MVN A;  2CF8 H;  3FFG A;  5T1V A;  2P94 A;  3MO6 A;  1GL0 E;  1C5N H;  3VFE A;  3KQE A;  3VG8 A;  1SI5 H;  4RT0 A;  1TAL A;  2OBO A;  2BQW B;  1H8D H;  1FN6 A;  4HG6 A;  1IQK A;  4XFQ A;  2FXR A;  2GV6 A;  1HAG E;  3UNQ A;  5EJL A;  1C4U 2;  1LVO A;  1SBW A;  5EW1 H;  1ORF A;  1CGH A;  1YCP K;  4CRE A;  3FAO A;  3RMM H;  1ZRB A;  5FX5 A;  3LGT A;  1ANC A;  3SNB A;  3UNR A;  2TRM A;  5J4S A;  3SU3 A;  2BB4 A;  3K9X B;  1YP9 A;  4JZD H;  2FYR A;  2DUC A;  3EGK H;  2QF3 A;  4UD9 H;  3V7T A;  2ZC9 H;  1LVM A;  3RP2 A;  3IIT A;  1SQT A;  1LTO A;  3SW2 B;  1O32 A;  1GBE A;  5F6M A;  3WW7 A;  2B9L A;  5FBE A;  1C2H A;  1SHY A;  2GCT B;  3T2N A;  1KLI H;  1RD3 B;  3FVF B;  1U6Q A;  1OWJ A;  3ZVC A;  1PPB H;  4CRG A;  6LPR A;  1H8H D;  3ODD A;  1RTK A;  3HGN A;  2ZHW H;  3QO6 A;  1Y5B T;  2G52 A;  2A4O A;  3A89 A;  4D8N A;  4D9Q A;  4B1T A;  1SFI A;  2R3U A;  3EE7 A;  1ZHP A;  4X0W U;  3U98 H;  3ZV9 A;  1MBQ A;  4WY3 A;  3P95 A;  2AFQ B;  3BV9 B;  3SV8 A;  4BTI B;  4Y10 E;  3RLY H;  5DJ7 A;  2PHB A;  2Q6D A;  2VJ1 A;  1MTN B;  1KXE A;  1W11 U;  2J97 A;  1B0E A;  1QJ7 B;  1GCT B;  1SGP E;  2OQU A;  2J2U A;  2J95 A;  3SUF A;  2Q1J A;  3IG6 B;  5A0B A;  4X1N U;  1AND A;  2AMP A;  2J98 B;  4ZRO A;  3PO1 C;  2F9B H;  2HVY B;  2BOK A;  2FOH A;  3ELA H;  3URD A;  5C94 A;  3W94 A;  1K1M A;  1UTM A;  1DAN H;  2WPJ S;  1GL1 A;  1BT7 A;  1IQI A;  1COW D;  3BTK E;  1TMB H;  1GHX H;  3GY4 A;  2GDD A;  2GKV E;  5BRR E;  3PRD A;  5FHT A;  1GBM A;  2HLD D;  1ESB A;  2J34 A;  4HZH A;  1EZX C;  1SSX A;  6EST A;  4K1E A; 
#chains in the Genus database with same CATH homology
 5CHB A;  2GGV B;  5EQR A;  1E1R D;  1DY9 A;  4B73 A;  3DSP A;  3U1I B;  1DXW A;  5T1V A;  1RGQ A;  3GS9 A;  1W0J D;  4NWL A;  5DSF A;  3VG8 A;  2OC7 A;  3M5N A;  3ZIA D;  4OM9 A;  2OBO A;  5H4I B;  2WPD D;  4I32 A;  2WHX A;  5IDK A;  3O8R A;  5GND A;  2F4L A;  3OEE D;  2F9U A;  3H09 A;  3SZE A;  4M9F A;  3F2G A;  2QF5 A;  5EPY A;  4B71 A;  2M2A A;  5DN6 D;  3SUE A;  3SUD A;  5ETX A;  3RC6 A;  5C0T A;  1RTL A;  3FOA A;  2OC0 A;  2F9V A;  2L6O A;  3F0O A;  2K1Q A;  2K0Q A;  2JDI D;  1E1Q D;  3KN2 A;  4Q4L A;  3LKW A;  1W3C A;  2XCF A;  3SU5 A;  2YMS D;  1S6L A;  4Q63 A;  1DY8 A;  1E79 D;  3SU0 A;  1SKY E;  2W6J D;  3SU3 A;  3LON A;  2XND D;  5EQQ A;  4K8B A;  2P59 A;  2VBC A;  2A4R A;  2AHM E;  2OK5 A;  1NS3 A;  3EYD A;  2W6I D;  3OE7 D;  5B6L A;  4I31 A;  5IK2 D;  3FO8 D;  3E90 B;  3SUG A;  4XD7 D;  3WW7 A;  3U1J B;  2KCP A;  3NRL A;  1EFR D;  2OIN A;  4DT4 A;  5C17 A;  3P8N A;  1NBM E;  5FPT A;  2KM0 A;  4TSF D;  3PV5 A;  3FN8 A;  2IJO B;  1FX0 B;  2JJ2 D;  3LOX A;  3N7E A;  3OTP A;  3UB0 A;  2XNI A;  1DXP A;  2K8I A;  1H8E D;  1H8H D;  3M5M A;  4TYD A;  2JIZ D;  4R8T B;  3AK5 A;  1BMF D;  3PV2 A;  4ZCN A;  3SV6 A;  1KMH B;  2JJ1 D;  3F0P A;  4RI0 A;  3O8C A;  4B76 A;  4F55 A;  3OYP A;  2WZQ A;  3SV9 A;  5FPY A;  3KF2 A;  2LEL A;  2A4G A;  3WWF A;  3SU6 A;  3L6P A;  1W0K D;  2A4Q A;  3N99 A;  1NBM D;  4Z1M D;  3SV8 A;  2OBQ A;  3SV7 A;  3P8O A;  4YXW D;  2QF4 A;  2XCN A;  2YOL A;  4B6F A;  5C0U A;  2YMS B;  5GPI B;  4B6E A;  3M5O A;  4I33 A;  2OC1 A;  3SU2 A;  3SUF A;  5FPS A;  2J5U A;  3WWB A;  4A1T A;  2OC8 A;  4A1X A;  4TT3 D;  3DCL A;  3F2H A;  3O8B A;  4WH6 A;  4B75 A;  2XOK D;  5ESB A;  2GVF A;  2YMS C;  4ASU D;  5F53 A;  5HKK D;  4U01 A;  1A1R A;  2FOM B;  2KR7 A;  1N1L A;  1MAB B;  5FL7 D;  3SU4 A;  2WSS D;  3KNX A;  2IJD 1;  1JXP A;  2KZ4 A;  3PRB A;  2KFW A;  4WF8 A;  3RC5 A;  3DSO A;  3SU1 A;  2FM2 A;  2V7Q D;  3KEE A;  4NWK A;  1BT7 A;  5GJ4 B;  3O8D A;  4B74 A;  4WH8 A;  3F3B A;  1COW D;  1OHH D;  2FP7 B;  3OAA D;  4JMY A;  4A1V A;  4KTC A;  3FKS D;  2O8M A;  3PRD A;  2KCA A;  3SYJ A;  3M5L A;  4A92 A;  3N7D A;  3OEH D;  2HLD D;  2F43 B;  1CU1 A;  3W1E A;  5CDF E;  1WXR A;  5EPN A;  2KCO A;  3RC4 A;  2QE7 D;  2WV9 A;  4FET A;  3OFN D;  3F2F A;  2QV1 A;  2CK3 D;  2KCY A;  5EQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...