2K0QA

Solution structure of copk, a periplasmic protein involved in copper resistance in cupriavidus metallidurans ch34
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
74
structure length
74
Chain Sequence
VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEALRKGHSEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein copK
publication title Molecular structure and metal-binding properties of the periplasmic CopK protein expressed in Cupriavidus metallidurans CH34 during copper challenge.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Metal binding protein
total genus 16
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2008-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2k0qA00
3N7EA 2K0QA 3N7DA 2LELA 3DSPA 3DSOA 2KM0A
chains in the Genus database with same CATH superfamily
2YMSD 5K0HA 3EA8A 1BBRE 2XBVA 3LJOA 2A4RA 3BTHE 1NFYA 8LPRA 1ELEE 1AMHA 1SGNE 1UTQA 2GCHG 3RXJA 1SQTA 4CH2B 1AE8H 4U01A 3U8TH 4KP0A 1O3AA 1T4VH 3F1SB 1IQFA 5A0AE 2K0QA 3TITA 3SU4A 3QLPH 1A5HA 1Z6JH 3PV5A 4JYVH 3ZZ4A 1LPGB 5F6MA 1E35B 3DT0H 5GIBA 1P06A 2L6OA 4Q80A 4CH8B 5DKMA 1W14U 1LHDH 2F9OA 1SSXA 2GJGA 1LVOA 1BIOA 5F8TA 1BOQA 3RXIA 4NIVA 4XBBA 1HNEE 1O5BB 4NCYA 4QT8C 1YPKH 2WPHS 4X6NA 4Y8ZA 1W8BH 1GI4A 1EB2A 5CHAC 3AVZA 2THFB 4MQAA 3RXDA 2BOKA 2AYWA 4INHA 2QXIA 3W95A 1YWUA 1C1VH 3LH3A 2WPJS 3QTVH 3UNSA 4AYYB 3LGYA 5EQRA 1O2JA 5DP8A 2FOCA 4NGAH 1GI6A 1K21H 3PV2A 2ZP0H 1ZTJA 4BAOB 1K0HA 2ODYB 1SGPE 2OK5A 5J4QA 4B75A 1GWAA 2OQ5A 1GJAB 1C2LA 1IAUA 1LMWB 1QTFA 2WSSD 2RG3A 5DPAA 1EX3A 2FPZA 5A0BA 4DT4A 2DE8A 6GCHG 2BX4A 3VB4A 1EOLA 4GVUA 3MYWA 1QRZA 2TBSA 1J14A 1Q2WA 2PTCE 2IPHA 2BYAX 2ZHEH 3BTME 1Y3XA 1LKBA 1O36A 1OP0A 3T29A 1MUEB 2WPMS 3UFAA 2R9PA 1D3DB 1SGYE 4GSOA 1S82A 3H7OA 1K1IA 2FS9A 1O5DH 2P8OC 1C1UH 3BSQA 3A7WA 1AIXH 1LCYA 3BF6H 5EQQA 1EPTB 1GI1A 1UTLM 4D9RA 1O39A 1MMJN 2OXSA 3UREA 1GCTB 3F0OA 4UFFH 5FX5A 3WWBA 2J2UA 5GCHF 1NFXA 3SU6A 1TPOA 1V2LT 3EE0B 4BTTB 3GCHC 4BXSA 2QIQA 2TGPZ 5JPMH 1PPBH 4NIXA 4KTCA 5HM9A 4I33A 3DFJA 4ABHA 1TGSZ 5G4BA 2J94A 1EAUA 2BQWB 2CV3A 1NT1A 3E3TA 1V2TT 1G3EA 4B76A 5DP3A 3RXHA 4NZQA 3SYJA 3MO6A 1YPHC 4UE7H 1P2NA 1OYQA 2ZQ1A 1DFPA 2ZFQH 1HIAA 2ZFTA 9ESTA 4DURA 1YCPK 1OXGA 3FZDA 1UJ1A 1FN8A 2FI5E 4YLUA 5IYTA 1Z7KA 4Y6DA 5IK2D 2HLDD 5C94A 1G32B 1Q3XA 4AYVB 3M3SA 1DDJA 4DW2U 2FO9A 1ZGVA 1O2TA 1GBBA 1QBNA 2BD9A 2PW8H 1J9CH 4ABJA 1TBQH 2BD8A 3RM2H 3V3MA 1TPSA 3M3TA 1GBIA 2PV9B 2JIZD 1TALA 2GDEH 1AKSA 1O2OA 1RS0A 3Q77A 1H9HE 4GLYA 5CHBA 3SN8A 3A7VA 5CE1A 2QYIA 3F2HA 2V0BA 1FIWA 4TPIZ 1F5LA 1S6HA 2VIDA 1VCQA 2HNTC 5C1YA 2FXRA 2ZU4A 3KGPA 1VITF 1BJUA 2Z94A 5JYIA 1ELTA 1B5GH 2C4FH 1FV9A 1HGTH 1ZR0A 3ZIAD 1BITA 4FUEA 2QV1A 2ZU3A 3MWIU 1ESBA 3MQKC 3CS7A 1CO7E 1ID5H 1AB9B 1HAIH 3ZZ6A 2VVCA 3V12A 2Q6FA 1TOCB 1QQUA 1B0FA 2W3IA 1AZZA 4Z1MD 2ZDMA 4UONA 2BDCA 1MAYA 2W7UA 4MNYA 1MCVA 1EXFA 1G30B 1F5KU 1C1RA 4K5ZA 6CHAB 2OINA 1JBUH 3TGJE 1GG6C 4X2VA 1RD3B 3T28A 3UOPA 1TGTA 3S69A 8GCHF 1TNGA 1C5XB 1QA7A 2WUBA 2Z3DA 1ETSH 3IWMA 1O3IA 3FKSD 1AFQB 3MU4A 1QL9A 1HAGE 3ESTA 4YZUA 2W7SA 2JETB 4RT0A 2BDYA 1ELFA 1GHWH 4X0WU 2FOBA 4M9FA 4X6MA 2C93B 4MPWA 1SHHB 1FAKH 2BD2A 2OUAA 1EJMA 3FP7E 4Y79A 1YLDA 3L6PA 2KM0A 3SV8A 5TCAA 4NZLA 4TT3D 2WYGA 3OEHD 1XUHA 2GMTB 4HG6A 4A1VA 1BRBE 3ODDA 2PP6A 1CA0B 3T62A 1AI8H 5HKKD 2VIWA 3QUMP 2KR7A 1AHTH 4KKDA 2GCTB 1DITH 2A5KA 1CGJE 3B8JA 3BTWE 1GBMA 1C2KA 4LOYH 4AX9H 1L1NA 2BDHA 1S5SA 2FOMB 2TRMA 2VWNA 1QL8A 3GY5A 4AG1A 2PUXB 1ZYOA 3U69H 3ZVGA 2Z3EA 1HAZB 4BTIB 2TPIZ 5FXLA 1B7XB 5GJ4B 1GCDA 1L4DA 2WPIS 3HK6B 1D6RA 4MNVA 1HBTH 2ULLA 1O3KA 4Y10E 3F9FA 1BHXF 1TLDA 2OTVA 4O97A 4JYTA 3SI3H 3NKKA 1P2MA 4H6TA 3TK9A 1W7XH 1E38B 1DE7H 1V2NT 4VGCB 4X8VH 1TFXA 2TGTA 3SZNA 1SFQB 1UK3A 2GX4A 2J92A 1EAIA 2PTNA 1P09A 1S81A 3JZ2B 2I6SA 3O8BA 3E16B 4TYDA 3OSYA 4DJZB 3PRBA 3P8FA 1O5GH 2XOKD 2ZDLA 5LGOA 2G52A 7LPRA 4IN2A 2OD3B 2ZDNA 1V2WT 2GGVB 3MMGA 3A85A 2HNTE 2ASUB 3RU4T 1LQEA 4GPGA 4Z0KA 1G36A 3T25A 2FOGA 1XMNB 3PROA 1THRH 3AW1A 1DLEA 1FAXA 1FX0B 4FUGA 3W94A 4B6FA 1AFEH 2BM2A 1XVOA 4ZCNA 1NROH 1OS8A 3U1JB 2P3FH 4FVBA 2PKAB 3PWCA 4NA8A 1V3XA 3BTFE 1QA0A 5TJXA 3KQCA 2AGEX 3RMLH 4ASHA 2A5IA 3GCOA 3MH6A 1P2KA 2FYRA 1GVLA 1C5NH 2QA9E 4GUXA 5F53A 4TSFD 4BNRA 5JBAS 4DG4A 1EAWA 3LU9B 3SJKA 3RUOA 3WY8A 3A88A 4O3TA 1SGTA 2TIOA 3DUXH 1AO5A 1NRSH 2AMDA 3NUMA 5JB8S 4NSYA 2AGIX 1JIMA 2BXTH 1XUJA 1P3EA 3RU4E 6ESTA 3VB5A 1NRRH 5EQSA 2VVUA 2ZGJA 1H9IE 3HKIB 4B71A 2W3KA 1IQJA 1D9IA 3SORA 4YESB 5HM2A 2VIPA 1QIXB 3M7UA 5EU8A 1C1NA 2QF4A 4Y0ZE 5TCCA 5GNDA 4K1SA 4RT1A 1TGNA 1NRPH 4E06H 2HGTH 2QF3A 2BY7X 1P2OA 1EAXA 1TA2A 1QB9A 1C2JA 2J38A 3BG4B 2D1JA 2G51A 4HGCA 2BLQA 4K8YA 5HMAA 2XYAA 6LPRA 1JRTA 2UUJB 4IS5A 1UCYE 1WSSH 3S7HB 1DXPA 4U2WA 5H4IB 1ZHMA 3TGIE 2EQNA 2ANYA 2OQUA 1COWD 2P16A 2TGAA 1CE5A 3SI4H 3EE7A 1ESTA 2F83A 2Z9JA 1A7SA 1WDIA 4KGAA 5EPNA 1C5VA 1SGDE 3MI4A 4RKOB 3A80A 1Y3VA 1SQOA 1C1OA 1RTLA 1YM0A 3A8AA 1O2VA 1E0FD 3LKWA 3SU1A 1SMFE 1P2JA 2LNCA 1DOJA 4Q7ZA 1P03A 1F92A 1MZAA 3QZRA 2ZFFH 2VINA 3LJJA 5ESTE 1O3CA 1CHOF 1FJSA 1N1LA 2VIVA 4FUIA 5FHTA 4WY3A 2OC1A 1PQ5A 2QE7D 3AAUA 3ATKA 3SJOA 1HUTH 3MNXA 2A4QA 4I8HA 4DOQA 4X2XA 5JBCS 3ZVAA 2F9BH 1LKAA 2EEKA 8KME2 1GJ6A 4GHTA 1W3CA 1LDTT 4LZ4B 2WINI 1GBCA 1GBJA 2AGGX 4H4FA 1K28D 5FCRA 3PM3A 1D4PB 1S6LA 1N8OB 4AB9A 2GZ8A 3OAAD 1BBRK 4FOUC 1UHBB 1GI8B 5A8YA 4P00A 1CHGA 3FAOA 3FN8A 3GISB 4ZUHA 5DGJA 3MH7A 1GMHF 1NPMA 5FPSA 1OWJA 3HKJB 2XCFA 1BMNH 4H42U 1V2ST 5HIZA 4AG2A 8ESTE 4ABDA 3QDZB 1D3PB 2C8WB 1GL0E 2Q6DA 3F3BA 3OX7U 3M7QA 1AWHB 1K1NA 2QXJA 2SNWA 2IJD1 1GPZA 1GBLA 5A2MH 1KXCA 2B5TB 1GMDG 2RA0A 4X8SH 2XBWA 1PQ7A 2FWWA 2M2AA 3UR6A 1A3EH 3VEQB 3PTNA 4AFZA 4ISNA 2YMSC 3VFEA 1RIWC 3DA9B 2ZGBH 3PMBB 2FOAA 1ELCA 1UTOA 5EJLA 1QFKH 1NU9A 1VR1H 4B6EA 4X1SU 1QR3E 3S9BA 1KIGH 2W5EA 5LH8A 1Y5AT 1TNLA 2ZDAH 1KDQA 4D7GA 3QN7A 3RXFA 1MTUA 1NBME 1QJ7B 1YPLH 1DS2E 3ENSB 5C17A 5GCHG 2QXGA 3RM0H 1UVTH 2ZGHA 4I32A 1CT2E 1WCZA 1TOMH 5DP5A 1K1MA 2P59A 2P94A 1A0JA 3GCTF 4YOIA 5C5OA 1IQHA 1DPOA 1SB1H 3U8RH 2CHAC 2BX3A 1LHCH 4UD9H 5A8XA 4AC9A 3DCLA 1P04A 4CBNA 2R3UA 1TRMA 4WXIA 1V2UT 4JZDH 1C5WB 2O8UA 1ORFA 2QF0A 1QGFA 1Y59T 3QX5H 4GCHF 4ABEA 3U1IB 2ZCHP 3OU0A 1A0HB 3SU0A 5GDSH 1PQ8A 5DSFA 4KTSA 1GHZA 1O2YA 1P57B 3SOSA 4AB8A 1EZQA 5E8EH 1MKWH 1QBOA 3BEFB 3K9XB 4O9VA 2KCPA 3SUEA 2O8LA 2Y5HA 2K8IA 4OGXA 1BMFD 1OWKA 2VVVA 1DSTA 1WBGB 1MTNB 1LQDB 1G3CA 2Z9GA 1TMUH 4UFGH 3BTQE 1C2MA 2HRVA 2VNTA 2UWLA 3E1XB 1FMGA 3MNBA 5DP7A 1WTHD 1L0ZA 1QB6A 1UTKA 1XUKA 1YPGH 1C5YB 5JBTA 1TX8A 2ANMH 5EW2H 2Y5FA 4ZKRU 1YCPM 1K1LA 5E0HA 1LHGH 1D6WA 1UW7A 4I7YH 1IQKA 1D3TB 1FY3A 3O8RA 5E2PA 3ZZ5A 3LC3A 1T31A 3JZ1B 1IHSH 3ATMA 2D2DA 2ZWLH 1LHFH 1VITG 3UNQA 5KGOA 1GDQA 5C5NA 3KL6A 3BEIB 2V35A 3SUDA 1H8ED 1O35A 3N7EA 4ISHH 1K9OE 4I8KA 3MO9A 1ELDE 3P92A 4X2WA 3GY2A 2GT8A 3ELAH 1FZZA 1O3MA 1J17T 1O31A 2KX4A 1L4ZA 3BTTE 1BQYA 1N6YA 2FM2A 5C2ZA 4Y8YA 3SNCA 1EP5A 1O2XA 4Y0YE 4INLA 1O3LA 4OS1A 1K1JA 3MFJA 3KEEA 3B23B 3MU5A 1ZMNA 3TU7H 3SU3A 1TYNA 3MH4A 3U8OH 2H6MA 2YNAA 4OS6A 4DGJA 3ZZ9A 4ZXYH 3KN2A 1IQNA 3IITA 3F2GA 1YLNA 3BTEE 1UK4A 1TNHA 3CP7A 1HAPH 1TPAE 3KF2A 4JCNA 4TWYA 3V7TA 1MH0A 4I8GA 2NU3E 4MPVA 4AZ2B 2BZAA 1MBQA 3RXKA 3F68H 4ABFA 2Z9IA 1TWXB 3MH5A 1HJAC 1N6XA 1QBVH 4Y7BA 1O2ZA 1OWDA 2G81E 2V3HH 1THSH 3KHVA 3TJNA 2PR3A 3TJOA 3N7OA 4IMQA 4HTCH 2PKAA 2H9EH 1O2HA 1ZMJA 1O3EA 2GCHF 1BMMH 4M7GA 1NRNH 1TAWA 4IC5A 3U9AH 1CT4E 2ANKH 1OWHA 4ZHLU 3QO6A 2CJIA 3SJ8A 1C5QA 3RLWH 2J98B 1LPKB 1YYY1 1V2OT 2PWXA 1WYKA 4J1YA 5T6GA 2ZTXA 3RXAA 1O2UA 3BIUH 5CDFE 1KXDA 1HAVB 3NPSA 5C1XA 3SNEA 4HI3A 1F7ZA 1AZ8A 5LPEA 3PLPA 5EXLA 3P8NA 1SVPA 2ZDKA 5FL7D 2H5CA 1ABIH 3M37A 3P6ZB 5EIYA 4IGDA 4FUJA 3TK5A 3VB7A 4I86A 1P11E 2V6NA 3LH1A 2G00A 2ZTZA 7GCHG 2IPQX 1MTVA 1WV7H 1GJ7B 1IQGA 3T2NA 2ZCKP 1J15A 5A8ZA 3VGCC 3GDVA 1GHAF 3QTOH 3RXOA 3HK3B 5J4SA 3U28C 1J16A 2C8YB 2P95A 1AVGH 3VB6A 1KDQB 3ZZDA 2ALPA 1PQAA 4DT7B 6GCHF 4DIHH 1ZJKA 3OEED 1INCA 4X1RU 4IN1A 1ANBA 2CF9H 4OS4A 3EA7A 2KCYA 2HVYB 4CHAC 2GKVE 5E0JA 3SNAA 2BD3A 4NWLA 2VU8E 1A3BH 4THNH 1TQ7B 1PYTD 3RXUA 1EB1H 3OY5U 3GY6A 3KIDU 1GJ9B 1T32A 4K3JA 3A84A 4CRAA 1ZMLA 2FOHA 1ANDA 5DO4H 2GZ7A 2FODA 1NESE 5L2YH 4HZHA 3RXCA 3S7KB 3FOAA 1ABJH 2HOBA 2Z9LA 1YPMH 2WV4A 1H8IH 5F03A 2QN5T 2NU1E 3S9CA 2AMQA 2HNTF 1CVWH 3SQEE 1VCPA 1OWIA 1CQQA 2H5DA 2LELA 1EJAA 4MVNA 1SOTA 2J9NA 3KNXA 3P70B 2ZFPH 1A5GH 4LZ1H 2ZC9H 3M5OA 1FDPA 2JDID 1DY8A 1SBWA 1G3BA 4MLFB 2HALA 5I25A 3ZV9A 3RMOH 1TRNA 2ZG0H 3TPIZ 4CR9A 1ZOMA 1ZTLA 2VWOA 1KYNA 1P2IA 1Y5UT 3M61U 5C20A 2VWLA 1PFXC 1TONA 1C2FA 2QAAA 5GXPA 1EZSC 1DX5M 2PKSB 3PO1C 2I6QA 3DSPA 1GI9B 1UCYH 1UVUH 2FI3E 4K8BA 1HXFH 2YMSB 1Z1JA 1W0KD 1V6DA 3ZZ3A 2HVXA 1BA8B 4MG3A 1EKBB 3E0PB 1UHBA 1TGBA 2ZHWH 2Q6GA 2J4IA 1GBHA 1YPHE 2BD4A 2Y81A 2P3UB 4ZROA 1BDAA 4WWYA 4Y7AA 3VXEH 1QJ1B 1BTHH 2R2MB 1HJ9A 1HAOH 1SGCA 3RU4D 3ZYEA 1C5SA 5JB9S 3L33A 4ISIH 4K60A 1EATA 1S0RA 2SNVA 3F9HA 1FPHH 5DG6A 5BRRE 1DM4B 5HIYA 1IHTH 2LPRA 1C1SA 1QL7A 1UTJA 4BTUB 1TNKA 3MU1A 5FAHA 3FFGA 4D9QA 2H2ZA 4IBLH 2CGAA 3SO3A 1AU8A 3D23A 2BB4A 3LGTA 3RXSA 1MABB 3KCGH 5DJ7A 3QK1A 3M36A 2JKHA 3MNSA 3RLYH 1KLIH 3M5NA 1F0RA 3A8CA 3CS0A 3EDXB 1Y5BT 3LONA 1P9SA 1C1PA 2PHBA 1NFUA 5C3NA 5B6LA 2STAE 4FU8A 5EJ1A 3SJIA 1C2EA 1RFNA 4B2CA 5T6FA 1DLKB 1GDNA 4AFUA 2ZZUH 3EQ0H 1VKYA 4WVPE 3P95A 1SGFA 1UCYK 1W2KH 2IJOB 1GJCB 1FNIA 1Z8GA 2Y80A 4WH6A 3LC5A 3QGJA 1E1RD 2SGQE 5CHAB 2G5NA 1C9PA 1CHOG 1P9UA 5EXNA 1BUIA 1C5RA 1SR5C 2A5AA 1P8VC 1MBMA 3FO8D 3ZZ7A 3PMHB 3TH3H 3H09A 2VIOA 4NFFA 3PWBA 1Y3WA 3V13A 1O2RA 1EPTC 1YPEH 1CGIE 1BTPA 5FX6A 3HATH 1E36B 4K1TA 2BY8X 3U98H 4A5TS 1O2PA 1A5IA 2QCYA 2B8OH 2OCVB 3W1EA 2BXUH 1ZSLA 2R0KA 1GCTC 1Z8JB 1MQ6A 2Z7FE 1T7CA 2SGFE 4ACBA 1O3PB 3UB0A 2VIQA 1ARCA 4CBOA 1SQRA 3GY4A 1LO6A 3CNRA 1NRQH 2NU2E 1W10U 4FUCA 1DWEH 1KLJH 1UMAH 1ZPBA 1GBKA 3NWUA 3UY9A 3BTKE 1U6QA 2EY4C 1C1WH 2C90B 3UAIC 2FS8A 2P8OB 2YNBA 1T8MA 3RMNH 3M5MA 2W6ID 1XUGA 3ZVFA 4A6LA 9LPRA 2L74A 3A7TA 4ASUD 1WTGH 3E6PH 3S0NA 3WWFA 2Y82A 7ESTE 1J8AA 3SGQE 1ZGIA 1SLUB 4O03A 1EOJA 2FLBH 2SGDE 1ZJDA 1TIOA 2Y6TA 1C5PA 3GCHB 4CRDA 1GBDA 1ZZZA 2G4UA 3UIRA 1QJ6B 1V2QT 2Y7XA 1HRTH 5K7RA 1C2HA 1TBRH 3PRDA 3P8GA 3NZIA 3R0FA 4IC6A 4FUDA 3Q3KA 1JMOH 1C4V2 5ETXA 5CMXH 1HAYB 1FY8E 1A46H 2PFEA 1AE5A 1DUEA 4OS7A 1NZQH 5FBEA 4NFEA 1S85A 3M35A 2BDAA 1ZPCA 1ETTH 2QY0B 1P05A 2HWLB 4F4OC 5AVDA 2DE9A 1G9IE 3B9FH 1O38A 4NG9H 2A7JA 1FI8A 1GHBF 2XWBI 2BMGB 2QGRA 2XBYA 3VB3A 2Y5GA 3P17H 1E34B 1ZLRA 3PLKA 3RXBA 1KTSB 2BD7A 4ZAEA 4X6OA 2ODPA 1GHVH 1SGIB 4MDSA 1NBMD 2LP6A 5JBBS 1VCWA 2Z9KA 4UFDH 2P3TB 2UWOA 2V3OH 3SV6A 2UUKB 2ESTE 3ATLA 3TLOA 1FY1A 2ZHDA 4MNWA 1G2MA 2BTCE 3WW7A 4F55A 5C1UA 3PLBA 4GCHG 1AB9C 1GJBB 3SNBA 4FXGH 5C67A 1V2PT 2A1DB 1C5ZB 2BY9X 1O2IA 1A2CH 2H9HA 2CMYA 4PROA 1MKXH 4XBDA 1JRSA 4JZFH 2P93A 3HGNA 5ABWA 1HAXB 1O3DA 2AHME 1FXYA 1LPZB 2XBXA 2ZECA 2IOTA 1ZRBA 2CK3D 1W0YH 3FZZA 2ZTYA 2J5UA 3N99A 3UNRA 1ELGA 1FN6A 4TY6A 4ABAA 3QWCH 1VGCC 3RXRA 2GD4B 3CENA 2J98A 1QRXA 4ZHMU 3GS9A 1Z8RA 2ZFRH 1P10A 1V2KT 2ZU1A 4BAHB 4U30A 1MU8B 2ZDVH 3RXPA 1SGEE 5E2OA 3A83A 1YKTA 1HAVA 4SGBE 5A09A 2JETC 1FPCH 4Y11E 4SGAE 1SGRE 4AGJA 1UK2A 2KAIB 1GJ4H 3RMMH 3ZZAA 4MTBA 5A0CA 3S9AA 3SNDA 2UUFB 4K69A 4K1EA 4NA9H 1ZHPA 4TWWA 4CRCA 1DICA 3E0NB 3PB1E 2ZEBA 2WZQA 4X1NU 2FESH 2Z3CA 2ZGXH 4FU7A 1W0JD 1GG6B 1RRKA 1C1TA 2F4LA 4OS2A 2GMTC 3A7XA 2ZI2H 1AUJA 2JJ2D 1SI5H 1CA0C 3KQBA 1C4Y2 4D8NA 1AVWA 3Q00A 1O2QA 1SLWB 1SC8U 1YBWA 2GCTC 2O8WA 1GBAA 3F9GA 1BCUH 2A2XH 1CA8B 1MKXK 2FOFA 2XC4A 1ANEA 4RI0A 1GMCF 4WF8A 1PPZA 1W0ZU 3RDZA 1KTTB 1IQMA 1VZQH 2ZFSA 4FUFA 4FVDA 4ZKSU 2UUYA 2CF8H 2AEIH 2EI8A 4I8LA 3SV7A 1S0QA 1OP8A 2C3SA 5ESBA 2EI7A 5KECA 1K2I1 3K6YA 1Z8IB 3TH2H 1W7GH 1DWBH 1TPPA 1KMHB 1GI7B 3TIUA 1FLEE 3SGBE 3O8DA 4AN7A 3FVFB 4UEHH 3PYHA 3UPEA 1FONA 1GI3A 3I77A 4X6PA 2OC8A 2IN2A 4VGCC 1WXRA 2FIRH 2G55A 1TX7A 4Q2KA 5EPYA 1PPGE 3URDA 3NXPA 5F8ZA 1EZUC 1GL1A 2O8MA 2KCOA 2BD5A 4UDWH 2Z6BD 1L1JA 1P2QA 1FY5A 3UR9A 4E05H 2ZPQA 2WPKS 2ZGCA 4RKJB 2Y7ZA 4BAMB 1XUFA 1PPCE 1GJ5H 2SGAA 3FP8E 3IG6B 1HV7A 3F9EA 4X2YA 1GBTA 3STJA 2QF5A 4JMYA 1GHXH 1XKBC 1JOUB 4Y8XA 2J95A 1UTMA 5AHGH 2C8ZB 3TGKE 1QY6A 4JYUH 2GTBA 4ISOA 3RP2A 1CU1A 1SLVB 3KQ5A 1O2WA 4ZKOU 1C5UA 1EUFA 3LGUA 1F0SA 1SKYE 2ZQ2A 5LPFA 1XXFA 2V7QD 1P0SH 4JK6A 1NM6A 1EZXC 4B74A 2GVFA 1NS3A 1SL3A 1ZRKA 2XW9A 4A1XA 1GHAG 3BN9A 1G2LA 1JIRA 2BY5X 2XNIA 3UOUA 4YOJA 3E91A 1GI0A 1P02A 2HPQH 1XKAC 3GICB 1V2VT 2FMJA 3LGVA 1TMTH 1GMDF 1ZSJA 4ACAA 2XRCA 1BZXE 4WMEA 3ZYDA 2RDLA 3GOVB 3ZZBA 1TRYA 2K1QA 2AS9A 3PMAB 1GGDC 5I46H 2VH6A 1YCPH 2BLOA 1MKWK 3C27B 2SGEE 2H9TH 1JXPA 4XOJA 4XBCA 4YOGA 1OWEA 1TX6A 4X8UH 3ZVEA 2VBCA 3LT3A 3AW0A 1AN1E 1TE0A 8GCHG 3RC6A 4CREA 3BG4C 2XC0A 1CT0E 1AGJA 1GBEA 2TGDA 1A1RA 3ZVCA 5C0UA 3LOXA 2G8TA 1EP6A 1P01A 3RXGA 2A31A 1ZHRA 1QURH 5HYOA 1YGCH 1PJPA 5GPIB 2J34A 2KFWA 2ILNA 4IMZA 1LVBA 3RXMA 5C0TA 5AFYH 4J2YB 1DWCH 1C5OH 1KY9A 1NTPA 2FTLE 2XNDD 3SZEA 1QZ8A 1FY4A 3UQOA 1C4U2 2F3CE 4O3UA 1O3OA 3GYMA 3N7DA 1T8NA 2ANWA 3A89A 1E37B 1CSOE 1HAHH 2A4OA 3OY6U 2VWMA 2ZHFH 1AD8H 3ODFA 4JK5A 2XTTB 1OHHD 2F9VA 1O3NA 4NA7A 4CRBA 2J97A 1QHRB 3SQHE 5EJZA 1OOKB 2AMPA 3SV2H 5DN6D 4Y76A 1YY3A 4D76A 3H5CB 1BJVA 3A7ZA 1V2JT 4KTUA 2GT7A 5EGMA 1VITH 1IQLA 3LGWA 3DSOA 2BLWA 2FZZA 1PYTC 1NU7B 4E7RG 2PGBB 4JZEH 1TMBH 1IQIA 4NIYA 1O3JA 1HJ8A 4Q7YA 2GP9B 1SGFG 3AAVA 1C5LH 3KQDA 2VH0A 1G3DA 2B9LA 1D3QB 1O34A 3GY3A 3RC5A 1GJDB 1H9LB 1NFWA 4GHQA 1FUJA 3GY8A 3RXLA 1SLXB 1UTNA 3D49H 1RTKA 4ZH8A 3LIWA 4X8TH 1RJXB 3A86A 4H6SB 3UWIA 2WYJA 1SG8B 4AOQA 1O0DH 2FDAA 4YM9A 1N8OC 1O37A 3SU2A 5SGAE 4NWKA 1O3HA 2VJ1A 5B6OA 1ZPZA 4DIIH 3FANA 4X1QU 1SOZA 1DVAH 4R8TB 1Y3UA 1QB1A 4Y71A 1GVKB 3Q3YA 3V0XA 4XE4A 1AY6H 3VXFH 1IOEA 4B2BA 1HXEH 2OC0A 4IW4E 3SU5A 1MZDA 3F2FA 1ZTKA 4MPXA 1GI2A 3TK6A 1GBFA 4XRNA 4KELA 2YOLA 3MHWU 5FCKA 1HDTH 3K2UA 5AFZH 1K1OA 2R2WU 4AORA 2EC9H 2PGQB 2VGCC 2A7HA 1VGCB 1CBWC 1A4WH 3TNSA 1O3BA 2FI4E 1DXWA 1TGCA 4I31A 1H1BA 1K22H 3SUFA 3G01A 3MOCA 2ZO3H 3DHKH 4YO9A 1KSNA 1C2DA 3RXVA 1F0UA 4YT6H 1BTWA 1KXFA 1SGQE 3A8BA 1Z6EA 2B0FA 1MD7A 3F6UH 2WHXA 2BQ6B 1PPFE 1SFIA 2ZU5A 3GCNA 5FPTA 1WU1A 4R0IA 1A61H 4WMDA 2XWAA 4BAKB 5EG4A 1MU6B 4YTAA 3HPTB 1QCPA 1AVXA 3ZV8A 1SHYA 1KXAA 5DP6A 3SW2B 2AERH 3UQVA 1NN6A 5T1VA 4F49A 3SUGA 3DD2H 1RIWB 5LPRA 1YP9A 5F8XA 1NC6A 5PTPA 1GHYH 2OLGA 1MCTA 1UO6A 1GDUA 3L3TA 2VB0A 1XUIA 3AK5A 1O2KA 1P3CA 3EA9A 3H7TA 3EYDA 4AGKA 1BRAA 4F48B 1BMLA 4ABIA 1OSSA 1EQ9A 1A0LA 2AH4X 2NWNA 2BVXH 4DVAU 5L30H 4Q63A 4JZ1A 2KAIA 2F91A 1KLTA 2KZ4A 2PLXA 2UWPA 3EGKH 4DY7B 3KYFA 3ZZCA 4HFPB 2A32A 3BEUA 3NK8A 2D26C 4XDEA 2XC5A 5EW1H 7GCHF 2M5TA 1TA6A 1G37A 2CHAB 1O3GA 5AF9H 1BRUP 2PSXA 2O8TA 3NRLA 3VPKA 1EFRD 1L2EA 2H1UA 1WQSA 2BDIA 1MTNC 3A7YA 3KQEA 4BOHA 1NY22 4A1TA 2WPLS 4B2AA 4NIWA 1Q31A 2SFAA 3OE7D 2CXVA 4XD7D 4CRGA 1ETRH 1CGHA 3OYPA 2A7CA 2ZHQH 2QC2A 3D62A 1V2MT 2GV7A 2JJ1D 2ZKSA 1O5FH 3A82A 3SHCH 2BDGA 1ANCA 1FIZA 1GHBG 2ALVA 2OBOA 5EODA 1ACBE 4INKA 1ARBA 1LVMA 1MQ5A 1YLCA 1HPGA 2W6JD 4FUBA 4Z6AH 4D7FA 1XM1A 3GDUA 1E79D 1MTWA 1B0EA 1DWDH 4B1TA 3ITIA 2R0LA 4RN6A 1H8HD 1QQ4A 1GVZA 3ZVBA 4WXVA 4ZMAH 2FTMA 1S84A 1ELVA 2BVSH 5EOKA 1BMAA 4LK4A 5FBIA 1O5CB 1NO9H 1HIAB 2RCEA 4CR5A 1AQ7A 2JH6D 2STBE 3AASA 1O2LA 2F9NA 3PV4A 1BTZA 3TH4H 1C2IA 1YC0A 2GDDA 1HLTH 3STIA 1DT2A 3A8DA 3T26A 2FYQA 3VG8A 2QXHA 3RC4A 1DSUA 1GMHG 1O3FA 1S83A 2BOHB 1FQ3A 2BVRH 2ZNKH 2RA3A 1THPB 2JH0D 3ATWA 1O32A 3ZVDA 1JWTA 4YXWD 1O2NA 4FETA 4WH8A 2FEQH 2A2QH 2Q1JA 1L1GA 2ZPSA 4OS5A 4OGYA 2F9PA 3E90B 3I29A 2PSYA 5DK1A 3PMJA 2A45B 1QRWA 3ATIA 3SHAH 4ZKNU 1AKSB 2FOEA 2G5VA 2WUCA 4RSPA 1ELBA 1MD8A 2RDEA 1UTPA 1OYTH 1W13U 3QZQA 1EJNA 1X7AC 1GGDB 1H4WA 1HCGA 2ODQA 1O30A 1QNJA 5JDUB 1GJ8B 4LXBH 1T8OA 1OPHB 3T5FH 1Z71A 1SQAA 3K6ZA 4ESTE 1E1QD 2ZPRA 4E7NA 1YF4A 3R3GB 1Y8TA 4BAQB 1DUAA 3TNTA 1O2SA 2FP7B 2O9QA 3SV9A 3MU8A 5DP4A 3BTGE 3EAJA 1TNIA 3RXQA 3LDXH 5IDKA 5L2ZH 2HPPH 3BG8A 3Q3XA 1O2MA 3SGAE 2W26A 2RFKC 1ZSKA 1DY9A 4ABGA 1W12U 1HJAB 2BY6X 2ZA5A 3BV9B 2F9UA 1TQ0B 2ZU2A 2EA3A 1PPEE 1GMCG 2ZCLP 4MNXA 2OC7A 2NU4E 2ZF0H 2F43B 2A0QB 3LGIA 1C9TA 4DCDA 1LVYA 3M3VA 5BPEA 1BBRH 1ESAA 1KXBA 4JZIA 5DP9A 3SBKA 3A87A 1AUTC 1BT7A 1WAYB 1UVOA 3MU0A 3GCTG 1TNJA 2BLVA 1HB0B 2JH5D 4ZHAA 1XXDA 3MNCA 1C5TA 1EPTA 4BANB 2AFQB 3LPRA 4B73A 2C8XB 4OM9A 3DFLA 1TBZH 1F2SE 4FU9A 3BTDE 1T4UH 2AIQA 3OTPA 3M5LA 1IQEA 1MTSA 2BHGA 3UUZA 3UTUH 3M7TA 3GYLB 3QGNB 2OBQA 3RXTA 2WV5A 2BQ7B 5HGGA 3ZZ8A 2XXLA 2A4GA 4TPYA 4XFQA 3GDSA 4A92A 4FUHA 7KMEH 2HLCA 4AFQA 4BXWA 4X1PU 1HYLA 4Q4LA 1T8LA 3D65E 6CHAC 3TJUA 1ELAA 3PTBA 1K1PA 3C1KA 3VGCB 2G4TA 4U32A 2PUQH 1O5AB 2XCNA 1W11U 3OTJE 1Y3YA 2D8WA 1RXPA 2NU0E 1AFQC 5GWZA 1MAXA 5L6NH 1OKXA 2V3MA 1HFDA 3HGPA 5E0GA 1KXEA 1BTXA 1SPJA 1XVMA 3BIVH 4CHAB 3E8LA 5T6DA 1GI5A 1AWFH 4ABBA 3TVJB 1F0TA 4WMFA 4NSVA 4ZXXH 4K2YA 3GY7A 2AIPA 1LTOA 1VJAU 1H8DH 3MTYA 1C2GA 3URCA 4AFSA 1S6FA 3T27A 1BB0B 1WQVH 1C1MA 4XSKU 2WPDD 2FX4A 1PPHE 1TABE 1UVPA 2R3YA 2GV6A 1O33A 2B7DH 2WV9A 4A7IB 3K65B 4WJG2 3OFND 5FPYA 4TY7A 2SGPE 1C1QA 1BTUA 1YPJH 4GAWA 3SJ9A 1F5RA 1V2RT 1TB6H 2PKSC 4UFEH 3Q76A 5KEDA 1M9UA 1C5MD 1RGQA 1LHEH 2CN0H 5EXMA 4YLQH 3RXEA 3TJVA 2VGCB 5HXFA 3UWJH 2OP9A 1CBWB 4CRFA 3MO3A 1VJ9U 4P02A 2FLRH 4YT7H 1OX1A 2DUCA 1O2GH 3FP6E 1DANH 3NCLA 3DSGA 4Q7XA 1WOFA 4MPUA 2EI6A 3A81A 1P12E 1RTFB 2KCAA 1EASA 2ZIQH 3P8OA 3O8CA 3I78A 4ISLA 1XX9A 3KYGA 4I8JA 1WUNH 1OP2A 1BRCE 2FX6A 2BDBA 5T3HA 3PO1B 3F0PA 2GZ9A 1BHXB 1UVSH 2BZ6H 1Z1IA 1O5EH 1BTYA
chains in the Genus database with same CATH topology
4B6EA 2A4GA 2OINA 5DN6D 2YMSD 3PRBA 2QF5A 4JMYA 3SUDA 4A92A 5EPNA 4ASUD 2XOKD 1H8ED 2A4RA 4KTCA 3N7EA 4I33A 3WWFA 5T1VA 3SUGA 4Q4LA 1CU1A 2GGVB 4U01A 3DSOA 3OEED 1RTLA 1NBME 3VG8A 3RC4A 1SKYE 2K0QA 3FKSD 2KCYA 3SU4A 3LKWA 3SU1A 3PV5A 2V7QD 2WZQA 5C17A 2FM2A 4NWLA 2XCNA 4B76A 4YXWD 1MABB 1W0JD 4FETA 4WH8A 3AK5A 4B74A 3SYJA 2GVFA 4I32A 3PRDA 1NS3A 2F4LA 1FX0B 2L6OA 3M5NA 4A1XA 3EYDA 4B6FA 3KEEA 3E90B 2JJ2D 3LONA 4M9FA 3RC5A 4ZCNA 2P59A 3SU3A 3U1JB 2XNIA 5ETXA 5B6LA 3L6PA 2KM0A 3SV8A 3KN2A 1N1LA 4TT3D 3F2GA 4Q63A 2OC1A 2KZ4A 3DCLA 3KF2A 3FOAA 2QE7D 3OEHD 4A1VA 5F53A 2A4QA 4TSFD 3SU2A 1E1QD 4RI0A 4WF8A 5IK2D 4NWKA 2IJOB 5EQRA 2HLDD 5HKKD 2K1QA 2KR7A 4WH6A 3PV2A 3SV9A 2FP7B 1E1RD 2WPDD 1W3CA 2LELA 3NRLA 4R8TB 3U1IB 1EFRD 2OK5A 3SU0A 1JXPA 3SV7A 4B75A 5IDKA 3KNXA 5DSFA 2WSSD 2WV9A 2VBCA 5ESBA 4A1TA 2JIZD 1S6LA 1NBMD 3OFND 5FPYA 4DT4A 1DY9A 3M5OA 5EQSA 3RC6A 2FOMB 2JDID 3OAAD 1DY8A 4B71A 3OE7D 2OC0A 1KMHB 2F9UA 5CHBA 3FN8A 4XD7D 3F2FA 3SU5A 2KCPA 3SV6A 3SUEA 2K8IA 3FO8D 1A1RA 1RGQA 1BMFD 3LOXA 3OYPA 5C0UA 5FPSA 3WW7A 4F55A 2QF4A 3H09A 2JJ1D 2XCFA 3F2HA 3O8DA 5GNDA 2OC7A 2F43B 2YOLA 5CDFE 2OC8A 1WXRA 5GJ4B 2OBOA 5EPYA 5GPIB 3F3BA 3W1EA 2KFWA 1BT7A 2O8MA 2IJD1 2KCOA 2W6JD 3ZIAD 3UB0A 5C0TA 3DSPA 2QV1A 4K8BA 2KCAA 2AHME 2YMSB 3P8NA 1E79D 1W0KD 5EQQA 3P8OA 5FL7D 3O8CA 1DXWA 2XNDD 4I31A 3SUFA 2CK3D 3SZEA 2M2AA 4B73A 2J5UA 3N99A 1DXPA 4OM9A 5H4IB 3O8RA 3N7DA 4Z1MD 3F0OA 1COWD 2YMSC 3WWBA 1H8HD 3OTPA 3M5LA 3SU6A 3F0PA 3GS9A 2WHXA 2OBQA 3O8BA 3M5MA 2W6ID 5FPTA 1OHHD 2F9VA 4TYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7E A;  2K0Q A;  3N7D A;  2LEL A;  3DSP A;  3DSO A;  2KM0 A; 
#chains in the Genus database with same CATH topology
 2YMS D;  5K0H A;  3EA8 A;  1BBR E;  2XBV A;  3LJO A;  2A4R A;  3BTH E;  1NFY A;  8LPR A;  1ELE E;  1AMH A;  1SGN E;  1UTQ A;  2GCH G;  3RXJ A;  1SQT A;  4CH2 B;  1AE8 H;  4U01 A;  3U8T H;  4KP0 A;  1O3A A;  1T4V H;  3F1S B;  1IQF A;  5A0A E;  2K0Q A;  3TIT A;  3SU4 A;  3QLP H;  1A5H A;  1Z6J H;  3PV5 A;  4JYV H;  3ZZ4 A;  1LPG B;  5F6M A;  1E35 B;  3DT0 H;  5GIB A;  1P06 A;  2L6O A;  4Q80 A;  4CH8 B;  5DKM A;  1W14 U;  1LHD H;  2F9O A;  1SSX A;  2GJG A;  1LVO A;  1BIO A;  5F8T A;  1BOQ A;  3RXI A;  4NIV A;  4XBB A;  1HNE E;  1O5B B;  4NCY A;  4QT8 C;  1YPK H;  2WPH S;  4X6N A;  4Y8Z A;  1W8B H;  1GI4 A;  1EB2 A;  5CHA C;  3AVZ A;  2THF B;  4MQA A;  3RXD A;  2BOK A;  2AYW A;  4INH A;  2QXI A;  3W95 A;  1YWU A;  1C1V H;  3LH3 A;  2WPJ S;  3QTV H;  3UNS A;  4AYY B;  3LGY A;  5EQR A;  1O2J A;  5DP8 A;  2FOC A;  4NGA H;  1GI6 A;  1K21 H;  3PV2 A;  2ZP0 H;  1ZTJ A;  4BAO B;  1K0H A;  2ODY B;  1SGP E;  2OK5 A;  5J4Q A;  4B75 A;  1GWA A;  2OQ5 A;  1GJA B;  1C2L A;  1IAU A;  1LMW B;  1QTF A;  2WSS D;  2RG3 A;  5DPA A;  1EX3 A;  2FPZ A;  5A0B A;  4DT4 A;  2DE8 A;  6GCH G;  2BX4 A;  3VB4 A;  1EOL A;  4GVU A;  3MYW A;  1QRZ A;  2TBS A;  1J14 A;  1Q2W A;  2PTC E;  2IPH A;  2BYA X;  2ZHE H;  3BTM E;  1Y3X A;  1LKB A;  1O36 A;  1OP0 A;  3T29 A;  1MUE B;  2WPM S;  3UFA A;  2R9P A;  1D3D B;  1SGY E;  4GSO A;  1S82 A;  3H7O A;  1K1I A;  2FS9 A;  1O5D H;  2P8O C;  1C1U H;  3BSQ A;  3A7W A;  1AIX H;  1LCY A;  3BF6 H;  5EQQ A;  1EPT B;  1GI1 A;  1UTL M;  4D9R A;  1O39 A;  1MMJ N;  2OXS A;  3URE A;  1GCT B;  3F0O A;  4UFF H;  5FX5 A;  3WWB A;  2J2U A;  5GCH F;  1NFX A;  3SU6 A;  1TPO A;  1V2L T;  3EE0 B;  4BTT B;  3GCH C;  4BXS A;  2QIQ A;  2TGP Z;  5JPM H;  1PPB H;  4NIX A;  4KTC A;  5HM9 A;  4I33 A;  3DFJ A;  4ABH A;  1TGS Z;  5G4B A;  2J94 A;  1EAU A;  2BQW B;  2CV3 A;  1NT1 A;  3E3T A;  1V2T T;  1G3E A;  4B76 A;  5DP3 A;  3RXH A;  4NZQ A;  3SYJ A;  3MO6 A;  1YPH C;  4UE7 H;  1P2N A;  1OYQ A;  2ZQ1 A;  1DFP A;  2ZFQ H;  1HIA A;  2ZFT A;  9EST A;  4DUR A;  1YCP K;  1OXG A;  3FZD A;  1UJ1 A;  1FN8 A;  2FI5 E;  4YLU A;  5IYT A;  1Z7K A;  4Y6D A;  5IK2 D;  2HLD D;  5C94 A;  1G32 B;  1Q3X A;  4AYV B;  3M3S A;  1DDJ A;  4DW2 U;  2FO9 A;  1ZGV A;  1O2T A;  1GBB A;  1QBN A;  2BD9 A;  2PW8 H;  1J9C H;  4ABJ A;  1TBQ H;  2BD8 A;  3RM2 H;  3V3M A;  1TPS A;  3M3T A;  1GBI A;  2PV9 B;  2JIZ D;  1TAL A;  2GDE H;  1AKS A;  1O2O A;  1RS0 A;  3Q77 A;  1H9H E;  4GLY A;  5CHB A;  3SN8 A;  3A7V A;  5CE1 A;  2QYI A;  3F2H A;  2V0B A;  1FIW A;  4TPI Z;  1F5L A;  1S6H A;  2VID A;  1VCQ A;  2HNT C;  5C1Y A;  2FXR A;  2ZU4 A;  3KGP A;  1VIT F;  1BJU A;  2Z94 A;  5JYI A;  1ELT A;  1B5G H;  2C4F H;  1FV9 A;  1HGT H;  1ZR0 A;  3ZIA D;  1BIT A;  4FUE A;  2QV1 A;  2ZU3 A;  3MWI U;  1ESB A;  3MQK C;  3CS7 A;  1CO7 E;  1ID5 H;  1AB9 B;  1HAI H;  3ZZ6 A;  2VVC A;  3V12 A;  2Q6F A;  1TOC B;  1QQU A;  1B0F A;  2W3I A;  1AZZ A;  4Z1M D;  2ZDM A;  4UON A;  2BDC A;  1MAY A;  2W7U A;  4MNY A;  1MCV A;  1EXF A;  1G30 B;  1F5K U;  1C1R A;  4K5Z A;  6CHA B;  2OIN A;  1JBU H;  3TGJ E;  1GG6 C;  4X2V A;  1RD3 B;  3T28 A;  3UOP A;  1TGT A;  3S69 A;  8GCH F;  1TNG A;  1C5X B;  1QA7 A;  2WUB A;  2Z3D A;  1ETS H;  3IWM A;  1O3I A;  3FKS D;  1AFQ B;  3MU4 A;  1QL9 A;  1HAG E;  3EST A;  4YZU A;  2W7S A;  2JET B;  4RT0 A;  2BDY A;  1ELF A;  1GHW H;  4X0W U;  2FOB A;  4M9F A;  4X6M A;  2C93 B;  4MPW A;  1SHH B;  1FAK H;  2BD2 A;  2OUA A;  1EJM A;  3FP7 E;  4Y79 A;  1YLD A;  3L6P A;  2KM0 A;  3SV8 A;  5TCA A;  4NZL A;  4TT3 D;  2WYG A;  3OEH D;  1XUH A;  2GMT B;  4HG6 A;  4A1V A;  1BRB E;  3ODD A;  2PP6 A;  1CA0 B;  3T62 A;  1AI8 H;  5HKK D;  2VIW A;  3QUM P;  2KR7 A;  1AHT H;  4KKD A;  2GCT B;  1DIT H;  2A5K A;  1CGJ E;  3B8J A;  3BTW E;  1GBM A;  1C2K A;  4LOY H;  4AX9 H;  1L1N A;  2BDH A;  1S5S A;  2FOM B;  2TRM A;  2VWN A;  1QL8 A;  3GY5 A;  4AG1 A;  2PUX B;  1ZYO A;  3U69 H;  3ZVG A;  2Z3E A;  1HAZ B;  4BTI B;  2TPI Z;  5FXL A;  1B7X B;  5GJ4 B;  1GCD A;  1L4D A;  2WPI S;  3HK6 B;  1D6R A;  4MNV A;  1HBT H;  2ULL A;  1O3K A;  4Y10 E;  3F9F A;  1BHX F;  1TLD A;  2OTV A;  4O97 A;  4JYT A;  3SI3 H;  3NKK A;  1P2M A;  4H6T A;  3TK9 A;  1W7X H;  1E38 B;  1DE7 H;  1V2N T;  4VGC B;  4X8V H;  1TFX A;  2TGT A;  3SZN A;  1SFQ B;  1UK3 A;  2GX4 A;  2J92 A;  1EAI A;  2PTN A;  1P09 A;  1S81 A;  3JZ2 B;  2I6S A;  3O8B A;  3E16 B;  4TYD A;  3OSY A;  4DJZ B;  3PRB A;  3P8F A;  1O5G H;  2XOK D;  2ZDL A;  5LGO A;  2G52 A;  7LPR A;  4IN2 A;  2OD3 B;  2ZDN A;  1V2W T;  2GGV B;  3MMG A;  3A85 A;  2HNT E;  2ASU B;  3RU4 T;  1LQE A;  4GPG A;  4Z0K A;  1G36 A;  3T25 A;  2FOG A;  1XMN B;  3PRO A;  1THR H;  3AW1 A;  1DLE A;  1FAX A;  1FX0 B;  4FUG A;  3W94 A;  4B6F A;  1AFE H;  2BM2 A;  1XVO A;  4ZCN A;  1NRO H;  1OS8 A;  3U1J B;  2P3F H;  4FVB A;  2PKA B;  3PWC A;  4NA8 A;  1V3X A;  3BTF E;  1QA0 A;  5TJX A;  3KQC A;  2AGE X;  3RML H;  4ASH A;  2A5I A;  3GCO A;  3MH6 A;  1P2K A;  2FYR A;  1GVL A;  1C5N H;  2QA9 E;  4GUX A;  5F53 A;  4TSF D;  4BNR A;  5JBA S;  4DG4 A;  1EAW A;  3LU9 B;  3SJK A;  3RUO A;  3WY8 A;  3A88 A;  4O3T A;  1SGT A;  2TIO A;  3DUX H;  1AO5 A;  1NRS H;  2AMD A;  3NUM A;  5JB8 S;  4NSY A;  2AGI X;  1JIM A;  2BXT H;  1XUJ A;  1P3E A;  3RU4 E;  6EST A;  3VB5 A;  1NRR H;  5EQS A;  2VVU A;  2ZGJ A;  1H9I E;  3HKI B;  4B71 A;  2W3K A;  1IQJ A;  1D9I A;  3SOR A;  4YES B;  5HM2 A;  2VIP A;  1QIX B;  3M7U A;  5EU8 A;  1C1N A;  2QF4 A;  4Y0Z E;  5TCC A;  5GND A;  4K1S A;  4RT1 A;  1TGN A;  1NRP H;  4E06 H;  2HGT H;  2QF3 A;  2BY7 X;  1P2O A;  1EAX A;  1TA2 A;  1QB9 A;  1C2J A;  2J38 A;  3BG4 B;  2D1J A;  2G51 A;  4HGC A;  2BLQ A;  4K8Y A;  5HMA A;  2XYA A;  6LPR A;  1JRT A;  2UUJ B;  4IS5 A;  1UCY E;  1WSS H;  3S7H B;  1DXP A;  4U2W A;  5H4I B;  1ZHM A;  3TGI E;  2EQN A;  2ANY A;  2OQU A;  1COW D;  2P16 A;  2TGA A;  1CE5 A;  3SI4 H;  3EE7 A;  1EST A;  2F83 A;  2Z9J A;  1A7S A;  1WDI A;  4KGA A;  5EPN A;  1C5V A;  1SGD E;  3MI4 A;  4RKO B;  3A80 A;  1Y3V A;  1SQO A;  1C1O A;  1RTL A;  1YM0 A;  3A8A A;  1O2V A;  1E0F D;  3LKW A;  3SU1 A;  1SMF E;  1P2J A;  2LNC A;  1DOJ A;  4Q7Z A;  1P03 A;  1F92 A;  1MZA A;  3QZR A;  2ZFF H;  2VIN A;  3LJJ A;  5EST E;  1O3C A;  1CHO F;  1FJS A;  1N1L A;  2VIV A;  4FUI A;  5FHT A;  4WY3 A;  2OC1 A;  1PQ5 A;  2QE7 D;  3AAU A;  3ATK A;  3SJO A;  1HUT H;  3MNX A;  2A4Q A;  4I8H A;  4DOQ A;  4X2X A;  5JBC S;  3ZVA A;  2F9B H;  1LKA A;  2EEK A;  8KME 2;  1GJ6 A;  4GHT A;  1W3C A;  1LDT T;  4LZ4 B;  2WIN I;  1GBC A;  1GBJ A;  2AGG X;  4H4F A;  1K28 D;  5FCR A;  3PM3 A;  1D4P B;  1S6L A;  1N8O B;  4AB9 A;  2GZ8 A;  3OAA D;  1BBR K;  4FOU C;  1UHB B;  1GI8 B;  5A8Y A;  4P00 A;  1CHG A;  3FAO A;  3FN8 A;  3GIS B;  4ZUH A;  5DGJ A;  3MH7 A;  1GMH F;  1NPM A;  5FPS A;  1OWJ A;  3HKJ B;  2XCF A;  1BMN H;  4H42 U;  1V2S T;  5HIZ A;  4AG2 A;  8EST E;  4ABD A;  3QDZ B;  1D3P B;  2C8W B;  1GL0 E;  2Q6D A;  3F3B A;  3OX7 U;  3M7Q A;  1AWH B;  1K1N A;  2QXJ A;  2SNW A;  2IJD 1;  1GPZ A;  1GBL A;  5A2M H;  1KXC A;  2B5T B;  1GMD G;  2RA0 A;  4X8S H;  2XBW A;  1PQ7 A;  2FWW A;  2M2A A;  3UR6 A;  1A3E H;  3VEQ B;  3PTN A;  4AFZ A;  4ISN A;  2YMS C;  3VFE A;  1RIW C;  3DA9 B;  2ZGB H;  3PMB B;  2FOA A;  1ELC A;  1UTO A;  5EJL A;  1QFK H;  1NU9 A;  1VR1 H;  4B6E A;  4X1S U;  1QR3 E;  3S9B A;  1KIG H;  2W5E A;  5LH8 A;  1Y5A T;  1TNL A;  2ZDA H;  1KDQ A;  4D7G A;  3QN7 A;  3RXF A;  1MTU A;  1NBM E;  1QJ7 B;  1YPL H;  1DS2 E;  3ENS B;  5C17 A;  5GCH G;  2QXG A;  3RM0 H;  1UVT H;  2ZGH A;  4I32 A;  1CT2 E;  1WCZ A;  1TOM H;  5DP5 A;  1K1M A;  2P59 A;  2P94 A;  1A0J A;  3GCT F;  4YOI A;  5C5O A;  1IQH A;  1DPO A;  1SB1 H;  3U8R H;  2CHA C;  2BX3 A;  1LHC H;  4UD9 H;  5A8X A;  4AC9 A;  3DCL A;  1P04 A;  4CBN A;  2R3U A;  1TRM A;  4WXI A;  1V2U T;  4JZD H;  1C5W B;  2O8U A;  1ORF A;  2QF0 A;  1QGF A;  1Y59 T;  3QX5 H;  4GCH F;  4ABE A;  3U1I B;  2ZCH P;  3OU0 A;  1A0H B;  3SU0 A;  5GDS H;  1PQ8 A;  5DSF A;  4KTS A;  1GHZ A;  1O2Y A;  1P57 B;  3SOS A;  4AB8 A;  1EZQ A;  5E8E H;  1MKW H;  1QBO A;  3BEF B;  3K9X B;  4O9V A;  2KCP A;  3SUE A;  2O8L A;  2Y5H A;  2K8I A;  4OGX A;  1BMF D;  1OWK A;  2VVV A;  1DST A;  1WBG B;  1MTN B;  1LQD B;  1G3C A;  2Z9G A;  1TMU H;  4UFG H;  3BTQ E;  1C2M A;  2HRV A;  2VNT A;  2UWL A;  3E1X B;  1FMG A;  3MNB A;  5DP7 A;  1WTH D;  1L0Z A;  1QB6 A;  1UTK A;  1XUK A;  1YPG H;  1C5Y B;  5JBT A;  1TX8 A;  2ANM H;  5EW2 H;  2Y5F A;  4ZKR U;  1YCP M;  1K1L A;  5E0H A;  1LHG H;  1D6W A;  1UW7 A;  4I7Y H;  1IQK A;  1D3T B;  1FY3 A;  3O8R A;  5E2P A;  3ZZ5 A;  3LC3 A;  1T31 A;  3JZ1 B;  1IHS H;  3ATM A;  2D2D A;  2ZWL H;  1LHF H;  1VIT G;  3UNQ A;  5KGO A;  1GDQ A;  5C5N A;  3KL6 A;  3BEI B;  2V35 A;  3SUD A;  1H8E D;  1O35 A;  3N7E A;  4ISH H;  1K9O E;  4I8K A;  3MO9 A;  1ELD E;  3P92 A;  4X2W A;  3GY2 A;  2GT8 A;  3ELA H;  1FZZ A;  1O3M A;  1J17 T;  1O31 A;  2KX4 A;  1L4Z A;  3BTT E;  1BQY A;  1N6Y A;  2FM2 A;  5C2Z A;  4Y8Y A;  3SNC A;  1EP5 A;  1O2X A;  4Y0Y E;  4INL A;  1O3L A;  4OS1 A;  1K1J A;  3MFJ A;  3KEE A;  3B23 B;  3MU5 A;  1ZMN A;  3TU7 H;  3SU3 A;  1TYN A;  3MH4 A;  3U8O H;  2H6M A;  2YNA A;  4OS6 A;  4DGJ A;  3ZZ9 A;  4ZXY H;  3KN2 A;  1IQN A;  3IIT A;  3F2G A;  1YLN A;  3BTE E;  1UK4 A;  1TNH A;  3CP7 A;  1HAP H;  1TPA E;  3KF2 A;  4JCN A;  4TWY A;  3V7T A;  1MH0 A;  4I8G A;  2NU3 E;  4MPV A;  4AZ2 B;  2BZA A;  1MBQ A;  3RXK A;  3F68 H;  4ABF A;  2Z9I A;  1TWX B;  3MH5 A;  1HJA C;  1N6X A;  1QBV H;  4Y7B A;  1O2Z A;  1OWD A;  2G81 E;  2V3H H;  1THS H;  3KHV A;  3TJN A;  2PR3 A;  3TJO A;  3N7O A;  4IMQ A;  4HTC H;  2PKA A;  2H9E H;  1O2H A;  1ZMJ A;  1O3E A;  2GCH F;  1BMM H;  4M7G A;  1NRN H;  1TAW A;  4IC5 A;  3U9A H;  1CT4 E;  2ANK H;  1OWH A;  4ZHL U;  3QO6 A;  2CJI A;  3SJ8 A;  1C5Q A;  3RLW H;  2J98 B;  1LPK B;  1YYY 1;  1V2O T;  2PWX A;  1WYK A;  4J1Y A;  5T6G A;  2ZTX A;  3RXA A;  1O2U A;  3BIU H;  5CDF E;  1KXD A;  1HAV B;  3NPS A;  5C1X A;  3SNE A;  4HI3 A;  1F7Z A;  1AZ8 A;  5LPE A;  3PLP A;  5EXL A;  3P8N A;  1SVP A;  2ZDK A;  5FL7 D;  2H5C A;  1ABI H;  3M37 A;  3P6Z B;  5EIY A;  4IGD A;  4FUJ A;  3TK5 A;  3VB7 A;  4I86 A;  1P11 E;  2V6N A;  3LH1 A;  2G00 A;  2ZTZ A;  7GCH G;  2IPQ X;  1MTV A;  1WV7 H;  1GJ7 B;  1IQG A;  3T2N A;  2ZCK P;  1J15 A;  5A8Z A;  3VGC C;  3GDV A;  1GHA F;  3QTO H;  3RXO A;  3HK3 B;  5J4S A;  3U28 C;  1J16 A;  2C8Y B;  2P95 A;  1AVG H;  3VB6 A;  1KDQ B;  3ZZD A;  2ALP A;  1PQA A;  4DT7 B;  6GCH F;  4DIH H;  1ZJK A;  3OEE D;  1INC A;  4X1R U;  4IN1 A;  1ANB A;  2CF9 H;  4OS4 A;  3EA7 A;  2KCY A;  2HVY B;  4CHA C;  2GKV E;  5E0J A;  3SNA A;  2BD3 A;  4NWL A;  2VU8 E;  1A3B H;  4THN H;  1TQ7 B;  1PYT D;  3RXU A;  1EB1 H;  3OY5 U;  3GY6 A;  3KID U;  1GJ9 B;  1T32 A;  4K3J A;  3A84 A;  4CRA A;  1ZML A;  2FOH A;  1AND A;  5DO4 H;  2GZ7 A;  2FOD A;  1NES E;  5L2Y H;  4HZH A;  3RXC A;  3S7K B;  3FOA A;  1ABJ H;  2HOB A;  2Z9L A;  1YPM H;  2WV4 A;  1H8I H;  5F03 A;  2QN5 T;  2NU1 E;  3S9C A;  2AMQ A;  2HNT F;  1CVW H;  3SQE E;  1VCP A;  1OWI A;  1CQQ A;  2H5D A;  2LEL A;  1EJA A;  4MVN A;  1SOT A;  2J9N A;  3KNX A;  3P70 B;  2ZFP H;  1A5G H;  4LZ1 H;  2ZC9 H;  3M5O A;  1FDP A;  2JDI D;  1DY8 A;  1SBW A;  1G3B A;  4MLF B;  2HAL A;  5I25 A;  3ZV9 A;  3RMO H;  1TRN A;  2ZG0 H;  3TPI Z;  4CR9 A;  1ZOM A;  1ZTL A;  2VWO A;  1KYN A;  1P2I A;  1Y5U T;  3M61 U;  5C20 A;  2VWL A;  1PFX C;  1TON A;  1C2F A;  2QAA A;  5GXP A;  1EZS C;  1DX5 M;  2PKS B;  3PO1 C;  2I6Q A;  3DSP A;  1GI9 B;  1UCY H;  1UVU H;  2FI3 E;  4K8B A;  1HXF H;  2YMS B;  1Z1J A;  1W0K D;  1V6D A;  3ZZ3 A;  2HVX A;  1BA8 B;  4MG3 A;  1EKB B;  3E0P B;  1UHB A;  1TGB A;  2ZHW H;  2Q6G A;  2J4I A;  1GBH A;  1YPH E;  2BD4 A;  2Y81 A;  2P3U B;  4ZRO A;  1BDA A;  4WWY A;  4Y7A A;  3VXE H;  1QJ1 B;  1BTH H;  2R2M B;  1HJ9 A;  1HAO H;  1SGC A;  3RU4 D;  3ZYE A;  1C5S A;  5JB9 S;  3L33 A;  4ISI H;  4K60 A;  1EAT A;  1S0R A;  2SNV A;  3F9H A;  1FPH H;  5DG6 A;  5BRR E;  1DM4 B;  5HIY A;  1IHT H;  2LPR A;  1C1S A;  1QL7 A;  1UTJ A;  4BTU B;  1TNK A;  3MU1 A;  5FAH A;  3FFG A;  4D9Q A;  2H2Z A;  4IBL H;  2CGA A;  3SO3 A;  1AU8 A;  3D23 A;  2BB4 A;  3LGT A;  3RXS A;  1MAB B;  3KCG H;  5DJ7 A;  3QK1 A;  3M36 A;  2JKH A;  3MNS A;  3RLY H;  1KLI H;  3M5N A;  1F0R A;  3A8C A;  3CS0 A;  3EDX B;  1Y5B T;  3LON A;  1P9S A;  1C1P A;  2PHB A;  1NFU A;  5C3N A;  5B6L A;  2STA E;  4FU8 A;  5EJ1 A;  3SJI A;  1C2E A;  1RFN A;  4B2C A;  5T6F A;  1DLK B;  1GDN A;  4AFU A;  2ZZU H;  3EQ0 H;  1VKY A;  4WVP E;  3P95 A;  1SGF A;  1UCY K;  1W2K H;  2IJO B;  1GJC B;  1FNI A;  1Z8G A;  2Y80 A;  4WH6 A;  3LC5 A;  3QGJ A;  1E1R D;  2SGQ E;  5CHA B;  2G5N A;  1C9P A;  1CHO G;  1P9U A;  5EXN A;  1BUI A;  1C5R A;  1SR5 C;  2A5A A;  1P8V C;  1MBM A;  3FO8 D;  3ZZ7 A;  3PMH B;  3TH3 H;  3H09 A;  2VIO A;  4NFF A;  3PWB A;  1Y3W A;  3V13 A;  1O2R A;  1EPT C;  1YPE H;  1CGI E;  1BTP A;  5FX6 A;  3HAT H;  1E36 B;  4K1T A;  2BY8 X;  3U98 H;  4A5T S;  1O2P A;  1A5I A;  2QCY A;  2B8O H;  2OCV B;  3W1E A;  2BXU H;  1ZSL A;  2R0K A;  1GCT C;  1Z8J B;  1MQ6 A;  2Z7F E;  1T7C A;  2SGF E;  4ACB A;  1O3P B;  3UB0 A;  2VIQ A;  1ARC A;  4CBO A;  1SQR A;  3GY4 A;  1LO6 A;  3CNR A;  1NRQ H;  2NU2 E;  1W10 U;  4FUC A;  1DWE H;  1KLJ H;  1UMA H;  1ZPB A;  1GBK A;  3NWU A;  3UY9 A;  3BTK E;  1U6Q A;  2EY4 C;  1C1W H;  2C90 B;  3UAI C;  2FS8 A;  2P8O B;  2YNB A;  1T8M A;  3RMN H;  3M5M A;  2W6I D;  1XUG A;  3ZVF A;  4A6L A;  9LPR A;  2L74 A;  3A7T A;  4ASU D;  1WTG H;  3E6P H;  3S0N A;  3WWF A;  2Y82 A;  7EST E;  1J8A A;  3SGQ E;  1ZGI A;  1SLU B;  4O03 A;  1EOJ A;  2FLB H;  2SGD E;  1ZJD A;  1TIO A;  2Y6T A;  1C5P A;  3GCH B;  4CRD A;  1GBD A;  1ZZZ A;  2G4U A;  3UIR A;  1QJ6 B;  1V2Q T;  2Y7X A;  1HRT H;  5K7R A;  1C2H A;  1TBR H;  3PRD A;  3P8G A;  3NZI A;  3R0F A;  4IC6 A;  4FUD A;  3Q3K A;  1JMO H;  1C4V 2;  5ETX A;  5CMX H;  1HAY B;  1FY8 E;  1A46 H;  2PFE A;  1AE5 A;  1DUE A;  4OS7 A;  1NZQ H;  5FBE A;  4NFE A;  1S85 A;  3M35 A;  2BDA A;  1ZPC A;  1ETT H;  2QY0 B;  1P05 A;  2HWL B;  4F4O C;  5AVD A;  2DE9 A;  1G9I E;  3B9F H;  1O38 A;  4NG9 H;  2A7J A;  1FI8 A;  1GHB F;  2XWB I;  2BMG B;  2QGR A;  2XBY A;  3VB3 A;  2Y5G A;  3P17 H;  1E34 B;  1ZLR A;  3PLK A;  3RXB A;  1KTS B;  2BD7 A;  4ZAE A;  4X6O A;  2ODP A;  1GHV H;  1SGI B;  4MDS A;  1NBM D;  2LP6 A;  5JBB S;  1VCW A;  2Z9K A;  4UFD H;  2P3T B;  2UWO A;  2V3O H;  3SV6 A;  2UUK B;  2EST E;  3ATL A;  3TLO A;  1FY1 A;  2ZHD A;  4MNW A;  1G2M A;  2BTC E;  3WW7 A;  4F55 A;  5C1U A;  3PLB A;  4GCH G;  1AB9 C;  1GJB B;  3SNB A;  4FXG H;  5C67 A;  1V2P T;  2A1D B;  1C5Z B;  2BY9 X;  1O2I A;  1A2C H;  2H9H A;  2CMY A;  4PRO A;  1MKX H;  4XBD A;  1JRS A;  4JZF H;  2P93 A;  3HGN A;  5ABW A;  1HAX B;  1O3D A;  2AHM E;  1FXY A;  1LPZ B;  2XBX A;  2ZEC A;  2IOT A;  1ZRB A;  2CK3 D;  1W0Y H;  3FZZ A;  2ZTY A;  2J5U A;  3N99 A;  3UNR A;  1ELG A;  1FN6 A;  4TY6 A;  4ABA A;  3QWC H;  1VGC C;  3RXR A;  2GD4 B;  3CEN A;  2J98 A;  1QRX A;  4ZHM U;  3GS9 A;  1Z8R A;  2ZFR H;  1P10 A;  1V2K T;  2ZU1 A;  4BAH B;  4U30 A;  1MU8 B;  2ZDV H;  3RXP A;  1SGE E;  5E2O A;  3A83 A;  1YKT A;  1HAV A;  4SGB E;  5A09 A;  2JET C;  1FPC H;  4Y11 E;  4SGA E;  1SGR E;  4AGJ A;  1UK2 A;  2KAI B;  1GJ4 H;  3RMM H;  3ZZA A;  4MTB A;  5A0C A;  3S9A A;  3SND A;  2UUF B;  4K69 A;  4K1E A;  4NA9 H;  1ZHP A;  4TWW A;  4CRC A;  1DIC A;  3E0N B;  3PB1 E;  2ZEB A;  2WZQ A;  4X1N U;  2FES H;  2Z3C A;  2ZGX H;  4FU7 A;  1W0J D;  1GG6 B;  1RRK A;  1C1T A;  2F4L A;  4OS2 A;  2GMT C;  3A7X A;  2ZI2 H;  1AUJ A;  2JJ2 D;  1SI5 H;  1CA0 C;  3KQB A;  1C4Y 2;  4D8N A;  1AVW A;  3Q00 A;  1O2Q A;  1SLW B;  1SC8 U;  1YBW A;  2GCT C;  2O8W A;  1GBA A;  3F9G A;  1BCU H;  2A2X H;  1CA8 B;  1MKX K;  2FOF A;  2XC4 A;  1ANE A;  4RI0 A;  1GMC F;  4WF8 A;  1PPZ A;  1W0Z U;  3RDZ A;  1KTT B;  1IQM A;  1VZQ H;  2ZFS A;  4FUF A;  4FVD A;  4ZKS U;  2UUY A;  2CF8 H;  2AEI H;  2EI8 A;  4I8L A;  3SV7 A;  1S0Q A;  1OP8 A;  2C3S A;  5ESB A;  2EI7 A;  5KEC A;  1K2I 1;  3K6Y A;  1Z8I B;  3TH2 H;  1W7G H;  1DWB H;  1TPP A;  1KMH B;  1GI7 B;  3TIU A;  1FLE E;  3SGB E;  3O8D A;  4AN7 A;  3FVF B;  4UEH H;  3PYH A;  3UPE A;  1FON A;  1GI3 A;  3I77 A;  4X6P A;  2OC8 A;  2IN2 A;  4VGC C;  1WXR A;  2FIR H;  2G55 A;  1TX7 A;  4Q2K A;  5EPY A;  1PPG E;  3URD A;  3NXP A;  5F8Z A;  1EZU C;  1GL1 A;  2O8M A;  2KCO A;  2BD5 A;  4UDW H;  2Z6B D;  1L1J A;  1P2Q A;  1FY5 A;  3UR9 A;  4E05 H;  2ZPQ A;  2WPK S;  2ZGC A;  4RKJ B;  2Y7Z A;  4BAM B;  1XUF A;  1PPC E;  1GJ5 H;  2SGA A;  3FP8 E;  3IG6 B;  1HV7 A;  3F9E A;  4X2Y A;  1GBT A;  3STJ A;  2QF5 A;  4JMY A;  1GHX H;  1XKB C;  1JOU B;  4Y8X A;  2J95 A;  1UTM A;  5AHG H;  2C8Z B;  3TGK E;  1QY6 A;  4JYU H;  2GTB A;  4ISO A;  3RP2 A;  1CU1 A;  1SLV B;  3KQ5 A;  1O2W A;  4ZKO U;  1C5U A;  1EUF A;  3LGU A;  1F0S A;  1SKY E;  2ZQ2 A;  5LPF A;  1XXF A;  2V7Q D;  1P0S H;  4JK6 A;  1NM6 A;  1EZX C;  4B74 A;  2GVF A;  1NS3 A;  1SL3 A;  1ZRK A;  2XW9 A;  4A1X A;  1GHA G;  3BN9 A;  1G2L A;  1JIR A;  2BY5 X;  2XNI A;  3UOU A;  4YOJ A;  3E91 A;  1GI0 A;  1P02 A;  2HPQ H;  1XKA C;  3GIC B;  1V2V T;  2FMJ A;  3LGV A;  1TMT H;  1GMD F;  1ZSJ A;  4ACA A;  2XRC A;  1BZX E;  4WME A;  3ZYD A;  2RDL A;  3GOV B;  3ZZB A;  1TRY A;  2K1Q A;  2AS9 A;  3PMA B;  1GGD C;  5I46 H;  2VH6 A;  1YCP H;  2BLO A;  1MKW K;  3C27 B;  2SGE E;  2H9T H;  1JXP A;  4XOJ A;  4XBC A;  4YOG A;  1OWE A;  1TX6 A;  4X8U H;  3ZVE A;  2VBC A;  3LT3 A;  3AW0 A;  1AN1 E;  1TE0 A;  8GCH G;  3RC6 A;  4CRE A;  3BG4 C;  2XC0 A;  1CT0 E;  1AGJ A;  1GBE A;  2TGD A;  1A1R A;  3ZVC A;  5C0U A;  3LOX A;  2G8T A;  1EP6 A;  1P01 A;  3RXG A;  2A31 A;  1ZHR A;  1QUR H;  5HYO A;  1YGC H;  1PJP A;  5GPI B;  2J34 A;  2KFW A;  2ILN A;  4IMZ A;  1LVB A;  3RXM A;  5C0T A;  5AFY H;  4J2Y B;  1DWC H;  1C5O H;  1KY9 A;  1NTP A;  2FTL E;  2XND D;  3SZE A;  1QZ8 A;  1FY4 A;  3UQO A;  1C4U 2;  2F3C E;  4O3U A;  1O3O A;  3GYM A;  3N7D A;  1T8N A;  2ANW A;  3A89 A;  1E37 B;  1CSO E;  1HAH H;  2A4O A;  3OY6 U;  2VWM A;  2ZHF H;  1AD8 H;  3ODF A;  4JK5 A;  2XTT B;  1OHH D;  2F9V A;  1O3N A;  4NA7 A;  4CRB A;  2J97 A;  1QHR B;  3SQH E;  5EJZ A;  1OOK B;  2AMP A;  3SV2 H;  5DN6 D;  4Y76 A;  1YY3 A;  4D76 A;  3H5C B;  1BJV A;  3A7Z A;  1V2J T;  4KTU A;  2GT7 A;  5EGM A;  1VIT H;  1IQL A;  3LGW A;  3DSO A;  2BLW A;  2FZZ A;  1PYT C;  1NU7 B;  4E7R G;  2PGB B;  4JZE H;  1TMB H;  1IQI A;  4NIY A;  1O3J A;  1HJ8 A;  4Q7Y A;  2GP9 B;  1SGF G;  3AAV A;  1C5L H;  3KQD A;  2VH0 A;  1G3D A;  2B9L A;  1D3Q B;  1O34 A;  3GY3 A;  3RC5 A;  1GJD B;  1H9L B;  1NFW A;  4GHQ A;  1FUJ A;  3GY8 A;  3RXL A;  1SLX B;  1UTN A;  3D49 H;  1RTK A;  4ZH8 A;  3LIW A;  4X8T H;  1RJX B;  3A86 A;  4H6S B;  3UWI A;  2WYJ A;  1SG8 B;  4AOQ A;  1O0D H;  2FDA A;  4YM9 A;  1N8O C;  1O37 A;  3SU2 A;  5SGA E;  4NWK A;  1O3H A;  2VJ1 A;  5B6O A;  1ZPZ A;  4DII H;  3FAN A;  4X1Q U;  1SOZ A;  1DVA H;  4R8T B;  1Y3U A;  1QB1 A;  4Y71 A;  1GVK B;  3Q3Y A;  3V0X A;  4XE4 A;  1AY6 H;  3VXF H;  1IOE A;  4B2B A;  1HXE H;  2OC0 A;  4IW4 E;  3SU5 A;  1MZD A;  3F2F A;  1ZTK A;  4MPX A;  1GI2 A;  3TK6 A;  1GBF A;  4XRN A;  4KEL A;  2YOL A;  3MHW U;  5FCK A;  1HDT H;  3K2U A;  5AFZ H;  1K1O A;  2R2W U;  4AOR A;  2EC9 H;  2PGQ B;  2VGC C;  2A7H A;  1VGC B;  1CBW C;  1A4W H;  3TNS A;  1O3B A;  2FI4 E;  1DXW A;  1TGC A;  4I31 A;  1H1B A;  1K22 H;  3SUF A;  3G01 A;  3MOC A;  2ZO3 H;  3DHK H;  4YO9 A;  1KSN A;  1C2D A;  3RXV A;  1F0U A;  4YT6 H;  1BTW A;  1KXF A;  1SGQ E;  3A8B A;  1Z6E A;  2B0F A;  1MD7 A;  3F6U H;  2WHX A;  2BQ6 B;  1PPF E;  1SFI A;  2ZU5 A;  3GCN A;  5FPT A;  1WU1 A;  4R0I A;  1A61 H;  4WMD A;  2XWA A;  4BAK B;  5EG4 A;  1MU6 B;  4YTA A;  3HPT B;  1QCP A;  1AVX A;  3ZV8 A;  1SHY A;  1KXA A;  5DP6 A;  3SW2 B;  2AER H;  3UQV A;  1NN6 A;  5T1V A;  4F49 A;  3SUG A;  3DD2 H;  1RIW B;  5LPR A;  1YP9 A;  5F8X A;  1NC6 A;  5PTP A;  1GHY H;  2OLG A;  1MCT A;  1UO6 A;  1GDU A;  3L3T A;  2VB0 A;  1XUI A;  3AK5 A;  1O2K A;  1P3C A;  3EA9 A;  3H7T A;  3EYD A;  4AGK A;  1BRA A;  4F48 B;  1BML A;  4ABI A;  1OSS A;  1EQ9 A;  1A0L A;  2AH4 X;  2NWN A;  2BVX H;  4DVA U;  5L30 H;  4Q63 A;  4JZ1 A;  2KAI A;  2F91 A;  1KLT A;  2KZ4 A;  2PLX A;  2UWP A;  3EGK H;  4DY7 B;  3KYF A;  3ZZC A;  4HFP B;  2A32 A;  3BEU A;  3NK8 A;  2D26 C;  4XDE A;  2XC5 A;  5EW1 H;  7GCH F;  2M5T A;  1TA6 A;  1G37 A;  2CHA B;  1O3G A;  5AF9 H;  1BRU P;  2PSX A;  2O8T A;  3NRL A;  3VPK A;  1EFR D;  1L2E A;  2H1U A;  1WQS A;  2BDI A;  1MTN C;  3A7Y A;  3KQE A;  4BOH A;  1NY2 2;  4A1T A;  2WPL S;  4B2A A;  4NIW A;  1Q31 A;  2SFA A;  3OE7 D;  2CXV A;  4XD7 D;  4CRG A;  1ETR H;  1CGH A;  3OYP A;  2A7C A;  2ZHQ H;  2QC2 A;  3D62 A;  1V2M T;  2GV7 A;  2JJ1 D;  2ZKS A;  1O5F H;  3A82 A;  3SHC H;  2BDG A;  1ANC A;  1FIZ A;  1GHB G;  2ALV A;  2OBO A;  5EOD A;  1ACB E;  4INK A;  1ARB A;  1LVM A;  1MQ5 A;  1YLC A;  1HPG A;  2W6J D;  4FUB A;  4Z6A H;  4D7F A;  1XM1 A;  3GDU A;  1E79 D;  1MTW A;  1B0E A;  1DWD H;  4B1T A;  3ITI A;  2R0L A;  4RN6 A;  1H8H D;  1QQ4 A;  1GVZ A;  3ZVB A;  4WXV A;  4ZMA H;  2FTM A;  1S84 A;  1ELV A;  2BVS H;  5EOK A;  1BMA A;  4LK4 A;  5FBI A;  1O5C B;  1NO9 H;  1HIA B;  2RCE A;  4CR5 A;  1AQ7 A;  2JH6 D;  2STB E;  3AAS A;  1O2L A;  2F9N A;  3PV4 A;  1BTZ A;  3TH4 H;  1C2I A;  1YC0 A;  2GDD A;  1HLT H;  3STI A;  1DT2 A;  3A8D A;  3T26 A;  2FYQ A;  3VG8 A;  2QXH A;  3RC4 A;  1DSU A;  1GMH G;  1O3F A;  1S83 A;  2BOH B;  1FQ3 A;  2BVR H;  2ZNK H;  2RA3 A;  1THP B;  2JH0 D;  3ATW A;  1O32 A;  3ZVD A;  1JWT A;  4YXW D;  1O2N A;  4FET A;  4WH8 A;  2FEQ H;  2A2Q H;  2Q1J A;  1L1G A;  2ZPS A;  4OS5 A;  4OGY A;  2F9P A;  3E90 B;  3I29 A;  2PSY A;  5DK1 A;  3PMJ A;  2A45 B;  1QRW A;  3ATI A;  3SHA H;  4ZKN U;  1AKS B;  2FOE A;  2G5V A;  2WUC A;  4RSP A;  1ELB A;  1MD8 A;  2RDE A;  1UTP A;  1OYT H;  1W13 U;  3QZQ A;  1EJN A;  1X7A C;  1GGD B;  1H4W A;  1HCG A;  2ODQ A;  1O30 A;  1QNJ A;  5JDU B;  1GJ8 B;  4LXB H;  1T8O A;  1OPH B;  3T5F H;  1Z71 A;  1SQA A;  3K6Z A;  4EST E;  1E1Q D;  2ZPR A;  4E7N A;  1YF4 A;  3R3G B;  1Y8T A;  4BAQ B;  1DUA A;  3TNT A;  1O2S A;  2FP7 B;  2O9Q A;  3SV9 A;  3MU8 A;  5DP4 A;  3BTG E;  3EAJ A;  1TNI A;  3RXQ A;  3LDX H;  5IDK A;  5L2Z H;  2HPP H;  3BG8 A;  3Q3X A;  1O2M A;  3SGA E;  2W26 A;  2RFK C;  1ZSK A;  1DY9 A;  4ABG A;  1W12 U;  1HJA B;  2BY6 X;  2ZA5 A;  3BV9 B;  2F9U A;  1TQ0 B;  2ZU2 A;  2EA3 A;  1PPE E;  1GMC G;  2ZCL P;  4MNX A;  2OC7 A;  2NU4 E;  2ZF0 H;  2F43 B;  2A0Q B;  3LGI A;  1C9T A;  4DCD A;  1LVY A;  3M3V A;  5BPE A;  1BBR H;  1ESA A;  1KXB A;  4JZI A;  5DP9 A;  3SBK A;  3A87 A;  1AUT C;  1BT7 A;  1WAY B;  1UVO A;  3MU0 A;  3GCT G;  1TNJ A;  2BLV A;  1HB0 B;  2JH5 D;  4ZHA A;  1XXD A;  3MNC A;  1C5T A;  1EPT A;  4BAN B;  2AFQ B;  3LPR A;  4B73 A;  2C8X B;  4OM9 A;  3DFL A;  1TBZ H;  1F2S E;  4FU9 A;  3BTD E;  1T4U H;  2AIQ A;  3OTP A;  3M5L A;  1IQE A;  1MTS A;  2BHG A;  3UUZ A;  3UTU H;  3M7T A;  3GYL B;  3QGN B;  2OBQ A;  3RXT A;  2WV5 A;  2BQ7 B;  5HGG A;  3ZZ8 A;  2XXL A;  2A4G A;  4TPY A;  4XFQ A;  3GDS A;  4A92 A;  4FUH A;  7KME H;  2HLC A;  4AFQ A;  4BXW A;  4X1P U;  1HYL A;  4Q4L A;  1T8L A;  3D65 E;  6CHA C;  3TJU A;  1ELA A;  3PTB A;  1K1P A;  3C1K A;  3VGC B;  2G4T A;  4U32 A;  2PUQ H;  1O5A B;  2XCN A;  1W11 U;  3OTJ E;  1Y3Y A;  2D8W A;  1RXP A;  2NU0 E;  1AFQ C;  5GWZ A;  1MAX A;  5L6N H;  1OKX A;  2V3M A;  1HFD A;  3HGP A;  5E0G A;  1KXE A;  1BTX A;  1SPJ A;  1XVM A;  3BIV H;  4CHA B;  3E8L A;  5T6D A;  1GI5 A;  1AWF H;  4ABB A;  3TVJ B;  1F0T A;  4WMF A;  4NSV A;  4ZXX H;  4K2Y A;  3GY7 A;  2AIP A;  1LTO A;  1VJA U;  1H8D H;  3MTY A;  1C2G A;  3URC A;  4AFS A;  1S6F A;  3T27 A;  1BB0 B;  1WQV H;  1C1M A;  4XSK U;  2WPD D;  2FX4 A;  1PPH E;  1TAB E;  1UVP A;  2R3Y A;  2GV6 A;  1O33 A;  2B7D H;  2WV9 A;  4A7I B;  3K65 B;  4WJG 2;  3OFN D;  5FPY A;  4TY7 A;  2SGP E;  1C1Q A;  1BTU A;  1YPJ H;  4GAW A;  3SJ9 A;  1F5R A;  1V2R T;  1TB6 H;  2PKS C;  4UFE H;  3Q76 A;  5KED A;  1M9U A;  1C5M D;  1RGQ A;  1LHE H;  2CN0 H;  5EXM A;  4YLQ H;  3RXE A;  3TJV A;  2VGC B;  5HXF A;  3UWJ H;  2OP9 A;  1CBW B;  4CRF A;  3MO3 A;  1VJ9 U;  4P02 A;  2FLR H;  4YT7 H;  1OX1 A;  2DUC A;  1O2G H;  3FP6 E;  1DAN H;  3NCL A;  3DSG A;  4Q7X A;  1WOF A;  4MPU A;  2EI6 A;  3A81 A;  1P12 E;  1RTF B;  2KCA A;  1EAS A;  2ZIQ H;  3P8O A;  3O8C A;  3I78 A;  4ISL A;  1XX9 A;  3KYG A;  4I8J A;  1WUN H;  1OP2 A;  1BRC E;  2FX6 A;  2BDB A;  5T3H A;  3PO1 B;  3F0P A;  2GZ9 A;  1BHX B;  1UVS H;  2BZ6 H;  1Z1I A;  1O5E H;  1BTY A; 
#chains in the Genus database with same CATH homology
 4B6E A;  2A4G A;  2OIN A;  5DN6 D;  2YMS D;  3PRB A;  2QF5 A;  4JMY A;  3SUD A;  4A92 A;  5EPN A;  4ASU D;  2XOK D;  1H8E D;  2A4R A;  4KTC A;  3N7E A;  4I33 A;  3WWF A;  5T1V A;  3SUG A;  4Q4L A;  1CU1 A;  2GGV B;  4U01 A;  3DSO A;  3OEE D;  1RTL A;  1NBM E;  3VG8 A;  3RC4 A;  1SKY E;  2K0Q A;  3FKS D;  2KCY A;  3SU4 A;  3LKW A;  3SU1 A;  3PV5 A;  2V7Q D;  2WZQ A;  5C17 A;  2FM2 A;  4NWL A;  2XCN A;  4B76 A;  4YXW D;  1MAB B;  1W0J D;  4FET A;  4WH8 A;  3AK5 A;  4B74 A;  3SYJ A;  2GVF A;  4I32 A;  3PRD A;  1NS3 A;  2F4L A;  1FX0 B;  2L6O A;  3M5N A;  4A1X A;  3EYD A;  4B6F A;  3KEE A;  3E90 B;  2JJ2 D;  3LON A;  4M9F A;  3RC5 A;  4ZCN A;  2P59 A;  3SU3 A;  3U1J B;  2XNI A;  5ETX A;  5B6L A;  3L6P A;  2KM0 A;  3SV8 A;  3KN2 A;  1N1L A;  4TT3 D;  3F2G A;  4Q63 A;  2OC1 A;  2KZ4 A;  3DCL A;  3KF2 A;  3FOA A;  2QE7 D;  3OEH D;  4A1V A;  5F53 A;  2A4Q A;  4TSF D;  3SU2 A;  1E1Q D;  4RI0 A;  4WF8 A;  5IK2 D;  4NWK A;  2IJO B;  5EQR A;  2HLD D;  5HKK D;  2K1Q A;  2KR7 A;  4WH6 A;  3PV2 A;  3SV9 A;  2FP7 B;  1E1R D;  2WPD D;  1W3C A;  2LEL A;  3NRL A;  4R8T B;  3U1I B;  1EFR D;  2OK5 A;  3SU0 A;  1JXP A;  3SV7 A;  4B75 A;  5IDK A;  3KNX A;  5DSF A;  2WSS D;  2WV9 A;  2VBC A;  5ESB A;  4A1T A;  2JIZ D;  1S6L A;  1NBM D;  3OFN D;  5FPY A;  4DT4 A;  1DY9 A;  3M5O A;  5EQS A;  3RC6 A;  2FOM B;  2JDI D;  3OAA D;  1DY8 A;  4B71 A;  3OE7 D;  2OC0 A;  1KMH B;  2F9U A;  5CHB A;  3FN8 A;  4XD7 D;  3F2F A;  3SU5 A;  2KCP A;  3SV6 A;  3SUE A;  2K8I A;  3FO8 D;  1A1R A;  1RGQ A;  1BMF D;  3LOX A;  3OYP A;  5C0U A;  5FPS A;  3WW7 A;  4F55 A;  2QF4 A;  3H09 A;  2JJ1 D;  2XCF A;  3F2H A;  3O8D A;  5GND A;  2OC7 A;  2F43 B;  2YOL A;  5CDF E;  2OC8 A;  1WXR A;  5GJ4 B;  2OBO A;  5EPY A;  5GPI B;  3F3B A;  3W1E A;  2KFW A;  1BT7 A;  2O8M A;  2IJD 1;  2KCO A;  2W6J D;  3ZIA D;  3UB0 A;  5C0T A;  3DSP A;  2QV1 A;  4K8B A;  2KCA A;  2AHM E;  2YMS B;  3P8N A;  1E79 D;  1W0K D;  5EQQ A;  3P8O A;  5FL7 D;  3O8C A;  1DXW A;  2XND D;  4I31 A;  3SUF A;  2CK3 D;  3SZE A;  2M2A A;  4B73 A;  2J5U A;  3N99 A;  1DXP A;  4OM9 A;  5H4I B;  3O8R A;  3N7D A;  4Z1M D;  3F0O A;  1COW D;  2YMS C;  3WWB A;  1H8H D;  3OTP A;  3M5L A;  3SU6 A;  3F0P A;  3GS9 A;  2WHX A;  2OBQ A;  3O8B A;  3M5M A;  2W6I D;  5FPT A;  1OHH D;  2F9V A;  4TYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...