1O2PA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2pA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2pA02
1MBQA 1GDQA 5DJ7A 1QGFA 3M5OA 1NO9H 3A7ZA 5BPEA 1YCPM 2OC1A 1TAWA 2BLQA 2WPMS 1MH0A 1DPOA 2BDGA 5L2ZH 2XCNA 3RXAA 3PLKA 1JIRA 1BA8B 3D62A 3EA8A 1C5LH 1RXPA 3SV6A 3LIWA 1HJ9A 1TWXB 3FFGA 1O39A 1GHBF 2Y5GA 1QQ4A 2ZU2A 3RP2A 4Y10E 1OS8A 3P8OA 4B1TA 4BXSA 1CQQA 2G81E 1DXWA 3ZZCA 4K60A 1O3MA 2ZGCA 1G36A 5FCRA 2J92A 3LH1A 1ARBA 4AB9A 4FVDA 1FPHH 3RU4T 1CGIE 3Q76A 1C4U2 1DY8A 1AD8H 1P9SA 1EP5A 3EGKH 3GY3A 2R2MB 2Z9JA 1ETRH 3MU4A 1GWAA 1GG6C 3ATIA 1NRQH 2ZGHA 1QNJA 2JETC 4TY7A 1BHXF 1GBLA 4XBCA 5JBBS 1HDTH 1RRKA 2G4TA 2QYIA 3GCHB 2BHGA 2HPQH 1GI0A 2A5AA 1K1OA 1KSNA 4NCYA 1VZQH 2QXHA 1EP6A 1K2I1 4X2VA 2DE8A 1QBVH 1FIZA 2BZAA 3RXGA 1ELAA 1MTNB 3SGBE 3UNSA 3DA9B 4WH6A 2VGCB 2D2DA 4AYVB 1BJVA 2P93A 1C5PA 1JWTA 1SGFA 2PTCE 3ATKA 1C5RA 2BM2A 1K21H 4IS5A 2UWLA 1GMCF 2D8WA 4O03A 3MNCA 2QF0A 1O2SA 5TCAA 1BIOA 3ZZ8A 1O35A 1YP9A 2R3UA 3ZVGA 2Z94A 2FDAA 5JYIA 5C5OA 2O9QA 5K7RA 1P3CA 1UVPA 1TIOA 3WY8A 3E3TA 4KKDA 1B0EA 1WCZA 1L4ZA 4ISLA 1V2MT 4B76A 3BTWE 1MTUA 1TGCA 1UHBA 3SJ9A 3B8JA 2BDAA 1O3DA 1LPGB 4TYDA 1EZUC 1Z8JB 1F5LA 2VIDA 2A7CA 1ZOMA 9ESTA 4X1NU 3SGQE 1C1QA 1O3HA 2SGDE 1MTSA 4I8HA 2ZU3A 3E0PB 2NU4E 1O36A 2XBVA 1GHAG 4ZXYH 1E38B 2VVCA 1LPKB 3PYHA 3Q3YA 1GJ7B 4UD9H 4MNVA 2F91A 1BHXB 3SV7A 5DGJA 5E2PA 2J4IA 1E37B 4H42U 4DY7B 1XXFA 4CR9A 3SV2H 2BXTH 4OGXA 4ZAEA 4B73A 3UUZA 2ZFSA 1O3OA 3A8CA 1EAXA 2C8ZB 1VITF 4ABEA 1EATA 2XBXA 2HWLB 2TPIZ 3QGJA 1V2PT 1O3FA 3PMAB 1IQKA 2TGDA 3A8AA 3KL6A 1CO7E 1TX6A 4ISHH 5EGMA 3W94A 2W5EA 1HV7A 1WOFA 2XRCA 1V3XA 1XUGA 1QBOA 2Z7FE 4ZHLU 1TA2A 3VB7A 5E0JA 1YCPK 1ELCA 2PTNA 1O37A 1T8NA 3HGPA 3ZZ5A 4X8TH 1EB2A 1OPHB 4HTCH 1O2PA 3IITA 1QJ7B 4RKOB 1EKBB 2GZ9A 1D3QB 1C1NA 5FCKA 1GJ8B 1EZXC 1C5XB 1RTKA 1UK2A 3MYWA 1THSH 2ANMH 4KGAA 2ZZUH 4MPUA 1GMDG 2WPHS 1OP8A 3C1KA 4J2YB 1FY3A 2OC0A 3PWCA 1HJ8A 1QB1A 5F03A 4Y0YE 1Y5AT 3NCLA 1F0RA 3RXDA 4A1VA 3DUXH 1MBMA 2QN5T 1C1VH 2BY7X 3KF2A 3PV4A 3ODDA 1P9UA 2WPLS 1TMTH 3RM0H 1XKAC 1OP0A 2J95A 4HGCA 4OS2A 2Y5FA 3SV9A 1KY9A 1SLVB 3OU0A 1DE7H 1H1BA 1Z6EA 1FIWA 2ZHFH 1C5UA 2ZEBA 1CVWH 2ZCHP 3AAUA 3MH5A 4UE7H 2O8TA 5FBEA 2OXSA 1XVMA 2GKVE 1NRSH 1SB1H 1NTPA 2EA3A 3K9XB 1OOKB 1Q31A 5G4BA 2GD4B 2PGBB 5LPEA 1S84A 3CS0A 2QAAA 4K8BA 1N6YA 3VGCB 1EJNA 2C90B 3GCTG 4JK6A 5DP4A 2TGTA 1N8OC 1SLXB 3PMJA 1QHRB 1V2RT 1HYLA 3F9GA 4UFFH 1TNIA 3RXEA 1TRMA 4YZUA 1SFIA 4TWYA 5PTPA 3S0NA 2CHAB 1SQTA 1CA0C 3LGWA 3RXKA 3F6UH 3MH4A 1A0LA 2FS9A 3UREA 3UQOA 4X2WA 4GHTA 1C5TA 2BD5A 2HOBA 1A3EH 2AGGX 1ELFA 2QF3A 1BBRK 1ZHPA 4B71A 4WF8A 3KN2A 1HAOH 5E0GA 4K1SA 1BMLA 2XBYA 4DT7B 5IYTA 3I77A 1KTTB 4DG4A 1AWHB 4FUDA 3H7TA 4JZFH 3RU4D 1JIMA 1GJ6A 2YNAA 4AG1A 1PPBH 1DWBH 1F0SA 1XVOA 2Y7XA 1MD7A 1AIXH 4XFQA 1GBFA 2ZU4A 3UOUA 2D1JA 1YPJH 1O2KA 1SHYA 1GI5A 1H9IE 5C1XA 3TH3H 4A5TS 1HB0B 1FV9A 1CT4E 3SQEE 4J1YA 3VB6A 1GVLA 5JBAS 1JOUB 1S0QA 1GHAF 3RXMA 1GPZA 1ZGIA 4HFPB 1C9TA 1N1LA 4B74A 1QRWA 2ZHQH 4IMZA 7ESTE 2OINA 4UEHH 2ZCKP 4CH8B 5T6DA 2OQUA 2BDIA 2QXJA 1LPZB 2PKSC 3M3SA 1GBHA 2AH4X 2XTTB 1OKXA 2BYAX 2ZPQA 2I6QA 3BEFB 4AN7A 4Y6DA 1O30A 1GDNA 1P0SH 1GJ9B 1W0YH 1AKSA 1EPTA 1O2GH 4JMYA 4ABGA 1O0DH 1GL1A 5GXPA 1A5HA 2ILNA 4NGAH 4IMQA 5A09A 2GT7A 2PKAA 5T6GA 3NXPA 4Q80A 4WMFA 1HAHH 1AZZA 1SGTA 1PPFE 1QTFA 1EX3A 3MH7A 4Y0ZE 1O5BB 5J4SA 3MNSA 1ELGA 1Z1IA 1GMDF 1J17T 4NZLA 1QJ6B 2PWXA 4OS4A 2ZU5A 4ZHAA 1SGFG 1S82A 1C5OH 3NKKA 1TE0A 4KTCA 2EC9H 1LQEA 3RXSA 4TPIZ 3D49H 6CHAC 2DE9A 1AFQB 4DJZB 1FAKH 1ZZZA 1UCYE 4CBOA 3RMNH 1GI3A 1O2LA 1WQVH 3B23B 2NU1E 1NS3A 1A5GH 4TY6A 1DSUA 1AVXA 2ZG0H 3T5FH 2ESTE 4GSOA 3TLOA 4E06H 5DP8A 2QGRA 1OSSA 2BLWA 5E0HA 1HLTH 3L33A 2QV1A 4JZ1A 2ZP0H 4Y76A 4B2AA 2OC8A 1HAVB 1ACBE 4CHAC 4IN2A 2BQ7B 1B7XB 1QB9A 1T31A 2PHBA 4B75A 1DY9A 4U32A 1OX1A 2BVSH 2RDLA 4A7IB 2NU0E 1O2WA 1SFQB 1D3TB 2GVFA 1ZSKA 2ZFQH 1BCUH 2F9NA 3PTBA 1P2NA 2YOLA 3ZZ3A 1O2NA 1P3EA 2VNTA 1RTFB 3QWCH 3BTGE 4AFQA 1ANEA 4WXIA 2B5TB 1A0JA 1GCTB 2ZDNA 1K1PA 1EJAA 4XBDA 2WUCA 1P2QA 4GLYA 1W8BH 2ALPA 3S9BA 3M5LA 4THNH 3TNTA 3BTTE 2BX4A 5GCHG 4ABFA 4NSYA 1C5QA 4XBBA 3VB3A 3RC5A 1TBQH 1DITH 2VIOA 1FLEE 2QC2A 2B7DH 2OCVB 5DP6A 5EU8A 1K1LA 1W7GH 3RXQA 1F92A 1MUEB 1P2IA 1C5MD 2R0KA 3SHAH 1NRNH 1O2UA 2UWPA 4GVUA 4YOGA 4E05H 2ZFFH 2KAIB 2Z9IA 4PROA 3GDVA 1BRBE 2XBWA 2SGPE 1AQ7A 1G3EA 2ZDVH 1Y5UT 1O5FH 3GYLB 3L3TA 2BTCE 1YF4A 4X8VH 1EJMA 3GISB 2C8XB 4IW4E 4X1RU 5ABWA 3KHVA 1TGSZ 1PPZA 3RXVA 2A5KA 1G3DA 4AGJA 2FLBH 2BOHB 1J14A 2RA3A 3BG8A 2FOEA 2XNIA 1ETTH 3TH4H 4CRBA 1THPB 5C1YA 3PLPA 3P8FA 3SUEA 2ULLA 4WMDA 2OC7A 2XYAA 3RXCA 3ZV8A 1AE8H 1XM1A 1H8DH 3BIUH 3HKJB 1EAWA 5LPRA 1A4WH 2JH0D 2FODA 2FMJA 1Y8TA 4NSVA 4B2CA 1SGEE 1YCPH 1QY6A 4JYUH 3A8BA 1KXEA 2A1DB 2RG3A 3M5NA 5AFYH 2J94A 3RC6A 1BTHH 1L1JA 1E36B 3HK3B 4CR5A 2I6SA 2ZFTA 2ZDMA 1WBGB 1HAPH 1ABJH 3UNQA 3UWJH 1IQFA 5EOKA 1IHSH 1O2JA 2ZDKA 4FU9A 3UQVA 2GTBA 1SOZA 3GY5A 1FNIA 3A81A 2F9PA 1V2TT 1GGDC 1ELEE 3QZQA 3A7TA 3AASA 1IQNA 3OSYA 2P94A 3QO6A 1ESAA 5ESBA 2H6MA 5HXFA 1AB9C 1TA6A 3M37A 2WYJA 2HNTC 2O8UA 3FP8E 3SQHE 4BAHB 3U1IB 1P2MA 2W3KA 4BANB 1CHGA 1O2RA 1TYNA 3HATH 4RN6A 3U69H 4BTTB 5AVDA 2Y81A 1V2ST 5DP5A 1TGTA 1QRXA 4WJG2 4NFFA 5FPSA 1AI8H 1C2EA 5FBIA 1TQ0B 3L6PA 3RMLH 4BOHA 1PQAA 4GPGA 3PB1E 1G9IE 1AVWA 1D6WA 1CSOE 1GHVH 3UR9A 4FVBA 2WINI 3JZ1B 1GVKB 1DANH 3ZVBA 1TRNA 1TOCB 4CRCA 2PW8H 5GIBA 1JMOH 1DOJA 1YPHC 3O8DA 4ABJA 8GCHF 5ESTE 1G2LA 2ZDLA 5DKMA 5EXLA 1C2HA 1ZTJA 3P17H 3TH2H 3SU3A 3RXJA 3LPRA 4Y7BA 1ELTA 3MI4A 1HAIH 5FX5A 1CA8B 1Q2WA 1A61H 2ZHEH 1BBRH 1ORFA 3ZZ7A 4B2BA 2ZQ2A 1UTKA 2W26A 3UOPA 2JKHA 1KDQA 1OXGA 1Y5BT 3A89A 4KTUA 5FX6A 1MCVA 2O8LA 2OP9A 2GMTC 2PSXA 4X6NA 2ZHDA 5H4IB 5GCHF 1K9OE 4NIVA 2CF9H 3SBKA 2PSYA 3DFJA 3GY4A 1OWDA 1GJBB 1SQOA 2VU8E 4BTIB 1KXDA 3PWBA 3O8CA 2FOFA 2Y6TA 4GUXA 1XUHA 5CE1A 6CHAB 2GZ7A 2FO9A 1QJ1B 4XE4A 2AMDA 4X6PA 5AHGH 1XUKA 3RM2H 3QGNB 2UWOA 2SGFE 2B9LA 1ZHMA 1C5WB 1ZYOA 4NA7A 4Y71A 1DSTA 3VXFH 2GDDA 1EPTC 1DICA 3ZZ9A 4NIYA 1GBMA 2GT8A 3SUGA 2W7SA 3BTME 1W12U 1FY4A 2GZ8A 4FUGA 1AMHA 1MQ6A 1SR5C 2BDBA 4D7GA 3CENA 1NPMA 1PYTD 1ZHRA 4ABBA 2W7UA 1UTNA 1TNGA 3F9HA 4BNRA 1DWCH 2XXLA 1LHGH 4GCHG 5EW1H 4D7FA 1O3IA 3SUDA 1GI9B 1RIWC 1U6QA 1ANDA 1SSXA 5DP9A 4MPWA 1WSSH 5EQSA 1EXFA 1V2LT 1KLJH 2CXVA 2Q6GA 1LMWB 3V12A 3SN8A 3DT0H 1O2TA 3IG6B 1O38A 4UDWH 2TBSA 1BTUA 1BRUP 1GBDA 1UO6A 1SC8U 4IN1A 2UUJB 4ISOA 3UNRA 1TGNA 3NK8A 6GCHG 3E91A 4NG9H 1O5EH 1OWKA 4INLA 4INKA 1O3LA 3E0NB 2J34A 4QT8C 1QIXB 2P16A 4X0WU 1Z7KA 4DURA 1C1PA 1ZPCA 3BG4B 3SGAE 4UFGH 1TQ7B 2Q1JA 2Z9LA 4Y79A 4DCDA 3SI4H 1G30B 1O2VA 4Y7AA 2HNTF 1SI5H 2BD3A 4MPVA 1XUIA 5CMXH 4MLFB 1O32A 2FLRH 2FP7B 1C1WH 2FOMB 3EQ0H 5T6FA 2Y80A 1DLKB 4RSPA 2ANYA 4ZUHA 3O8BA 2A0QB 5L2YH 1GJ5H 1LCYA 2M5TA 1H4WA 2ZGJA 1T4UH 3FVFB 3TK6A 1V2KT 1ZPZA 4GHQA 4AOQA 2FX4A 4OS7A 2QXGA 4LXBH 1LTOA 3FANA 1ESTA 1ZGVA 2WPKS 1NM6A 3U98H 1V2VT 1P12E 1NU9A 1L2EA 2B8OH 1YC0A 1BUIA 1HXEH 1PFXC 1Y3WA 3M7TA 3R0FA 3M7UA 1VITH 1AUTC 3SO3A 3TU7H 2HNTE 2BOKA 1BTPA 5GDSH 4Y8XA 3RXPA 3FAOA 3ENSB 3PM3A 3M5MA 1GBCA 1O3KA 4WVPE 5JBCS 2H1UA 4A6LA 1TNJA 5A8XA 1VJAU 1WU1A 2ODPA 1JRSA 2A7JA 1QBNA 2AIQA 3RMOH 1ZSLA 1S5SA 2QIQA 2Y7ZA 6ESTA 1MAXA 2GGVB 2GCTB 2GDEH 4A1XA 2ZKSA 1C1RA 1JBUH 1QCPA 3MU1A 3ZV9A 1C5VA 4JYTA 1TPPA 1T8OA 1NY22 4MDSA 4I8LA 3E90B 3ZVAA 1E35B 1GBTA 1Y3XA 2ANWA 3MOCA 4ISNA 4U2WA 1QQUA 1HAGE 3NUMA 1BMMH 1C4V2 1YPHE 1MAYA 3K6ZA 2ZFRH 4ZKRU 1A46H 1D3PB 1CGJE 2TGPZ 5EODA 3RC4A 2HVXA 2G55A 1GBEA 2W3IA 5F8ZA 3UTUH 1AB9B 1DFPA 3VFEA 2FIRH 3LJJA 1T4VH 2SFAA 1L1NA 1W13U 2ZPRA 2P95A 1GI7B 1KXBA 2P8OC 4MTBA 4X8SH 4E7RG 4ZHMU 3A8DA 1GBKA 3BN9A 4Q7YA 4TWWA 5C1UA 3MTYA 2ZA5A 3UFAA 1Q3XA 3P95A 3NPSA 1JXPA 3ATMA 5FPYA 1W2KH 3VXEH 2AGEX 1HXFH 2STBE 1DWEH 1HIAA 1V2UT 2BLVA 1FAXA 1LVOA 3K6YA 2A4QA 1TMUH 2A31A 3T25A 5I46H 1ZJDA 3LOXA 2YNBA 3PTNA 1EQ9A 1SGYE 2QA9E 4U30A 2FOAA 1RJXB 3S69A 2ZTZA 2ZTYA 5DP7A 5CHAC 3T26A 3M3TA 1UTPA 3GYMA 1GG6B 1O3AA 4JZIA 4XOJA 2F9OA 1D6RA 1WAYB 2BDYA 2JETB 6GCHF 1WV7H 4BAMB 2CJIA 2BZ6H 4D9QA 1YPKH 2FOGA 1NFWA 3OX7U 4O97A 3MNBA 3RDZA 1O3BA 2FOHA 3SJIA 1QB6A 3U8RH 2PUQH 1C2KA 3U1JB 1ELVA 1AY6H 4OS1A 5DP3A 4YLUA 1FN8A 3IWMA 3ATWA 3SORA 4BAQB 3SU6A 1YBWA 3Q3XA 7GCHG 8ESTE 5FPTA 1LVYA 1S83A 3T28A 1WQSA 4X1SU 1HJAC 1BJUA 1W7XH 1F0TA 1UJ1A 2QY0B 1AKSB 3R3GB 1EPTB 4DOQA 3F68H 4BXWA 5F8TA 1AVGH 3BTEE 3QTOH 1QRZA 2D26C 3A87A 4E7NA 5FAHA 3BV9B 2G52A 2GCHG 5IDKA 1AFEH 2JH6D 1TBZH 2Z9GA 2J9NA 1DX5M 1GBIA 3EE0B 4WH8A 4DIIH 1OP2A 2Y5HA 1ZRKA 3S7HB 2Z3EA 2PKAB 1DS2E 2FOBA 1C2FA 4AB8A 1YGCH 4O3TA 4BAOB 3GCOA 1IHTH 2Z6BD 3P8NA 3VPKA 1C1OA 4MPXA 4OS5A 3SU2A 3SOSA 2HALA 1SGDE 1GI6A 3TGIE 3I78A 4WWYA 5A2MH 3TK9A 1W14U 1SGCA 3SW2B 3S7KB 1P02A 1V2WT 4I7YH 2VWMA 3BF6H 5FHTA 3BTDE 3A7VA 2ODQA 1C2DA 1GHXH 4Z0KA 4KTSA 4F4OC 2VIPA 1KXFA 4I8GA 3GCHC 2A2QH 1W0ZU 3KQEA 1WUNH 3Q3KA 3A84A 3TJOA 4MG3A 4JZDH 1O5DH 1G2MA 3AVZA 2GV6A 3T62A 3EA9A 1TFXA 2V3HH 2DUCA 3NWUA 3T29A 1G3CA 1FJSA 3E16B 3RXRA 1CT2E 2VH0A 1ANBA 5T3HA 3O8RA 3CP7A 1A2CH 4D9RA 3A7WA 1MKWK 3W95A 3V0XA 1EAUA 2ZWLH 2VGCC 1GJAB 2ZC9H 2OBOA 2VWNA 1XX9A 1W3CA 1UTMA 5F6MA 1H9HE 4OS6A 3QX5H 4H4FA 4NZQA 1TNLA 1GHBG 2Y82A 2VINA 2H9HA 2R0LA 1GHWH 3GCTF 2BD8A 2CMYA 3TNSA 3A86A 1FMGA 3KNXA 3SJ8A 1NT1A 3SJKA 2WPJS 1IQLA 3HPTB 1W10U 1IQMA 2P3UB 1DUEA 2R2WU 4ZH8A 1ZLRA 2G5NA 2TGAA 3F9EA 4AGKA 3LJOA 1FY8E 3MH6A 1C2MA 1ESBA 1BTXA 2AEIH 2PR3A 3U9AH 1EUFA 1GMHG 1P06A 3P92A 3LGUA 3C27B 4AFUA 3F1SB 1O3GA 2BY5X 5LGOA 1FN6A 4A1TA 1S6HA 3ITIA 1VCWA 1C5NH 2ZIQH 3CS7A 1NN6A 2XC5A 2XCFA 1FI8A 3LGYA 2ZCLP 1MU6B 1J9CH 1OYTH 2FZZA 3A83A 5FXLA 1WYKA 2CN0H 2V0BA 2STAE 1GL0E 4Y11E 3SU0A 4H6TA 3V7TA 4ABIA 1XUJA 1LDTT 3A80A 4NA8A 4X1PU 2ZI2H 4MNWA 5DO4H 1SQAA 3LGVA 4K5ZA 4NFEA 2H5DA 2IPHA 3BTKE 3OYPA 1QA0A 1BMAA 4AX9H 4ZMAH 5BRRE 1FXYA 1IQEA 5A0BA 3TJUA 2PLXA 1SLWB 3GDUA 1AE5A 3UPEA 2O8MA 1UK4A 4I33A 2LNCA 7GCHF 1GMCG 3QTVH 1WTGH 3RU4E 3LC5A 1C5SA 1TONA 1N8OB 1NZQH 2Z3CA 2P8OB 1MKXH 2A7HA 1TX7A 3MMGA 3MO6A 4FUIA 2FI4E 1K1MA 1M9UA 1J16A 4ZXXH 2WPIS 3M35A 1P10A 1CA0B 2BD7A 1RTLA 3KGPA 1MTVA 2XC0A 3MFJA 2Z9KA 1DWDH 3LGIA 1C1UH 2BVRH 3KQDA 2P59A 2ZPSA 1ZR0A 1MZAA 5HYOA 1TNKA 1HNEE 1IQHA 3A7YA 1G32B 1V2QT 1YKTA 2A4RA 4ASHA 1PPGE 3P70B 3KQCA 5AFZH 3V13A 2NU2E 2BLOA 3AW1A 4UONA 3VB4A 1F5RA 1TPSA 1C1MA 2PFEA 4D76A 1CE5A 1VCQA 1MCTA 1O2MA 2C8WB 3TJNA 3S9AA 3ZZ6A 4AZ2B 5A8YA 3FP7E 1S6FA 1GDUA 4VGCC 2FEQH 4JCNA 1KLTA 2FI5E 1WTHD 3LGTA 2FX6A 3MO9A 1BQYA 1HUTH 4MNYA 3SI3H 1SOTA 1EOJA 4FXGH 3PMHB 4WMEA 3TPIZ 1O5GH 1CGHA 2QXIA 2TIOA 1F5KU 2BQWB 1LKAA 1VITG 4ZROA 4GAWA 3ZZDA 3K65B 2PGQB 3VGCC 1ZTKA 1GBJA 2PKSB 4ABDA 1MTWA 3QN7A 4BAKB 4Z6AH 2CV3A 1SGRE 1LVBA 2VWLA 1TBRH 3SNBA 1HJAB 3GOVB 1ELBA 1HAXB 1PPCE 4ZKSU 2OBQA 1O2IA 4R8TB 3UWIA 2HGTH 1O3PB 4MNXA 3UY9A 1UCYK 2CHAC 2G51A 2OQ5A 3HK6B 5HMAA 3MU5A 5A8ZA 1GJDB 1A7SA 2BY8X 3E6PH 4NWKA 1GI4A 1TNHA 3RUOA 1O3CA 4DVAU 3LC3A 5C5NA 2XW9A 1O31A 1C1SA 4X6MA 4AORA 1DXPA 2V35A 4JK5A 1AHTH 1P11E 4K8YA 1KDQB 5DK1A 1DLEA 4AFZA 4FU7A 3E1XB 3BSQA 1K1IA 3RXUA 1UTLM 1GMHF 2EI6A 3KCGH 4K3JA 2J2UA 3SUFA 1SBWA 3GY7A 4CRDA 1N6XA 3SV8A 4X2YA 2LPRA 4Q7XA 8LPRA 4HZHA 2VWOA 4WY3A 1DT2A 2O8WA 1V2OT 3H7OA 1LHCH 1C2GA 3D65E 2IJOB 2VIQA 3M3VA 1BTZA 2AERH 2ZECA 1AN1E 3TK5A 5F8XA 1D4PB 4JYVH 4AG2A 1AWFH 2ZU1A 3LT3A 1KLIH 1BRCE 2BXUH 3RXOA 2AS9A 2GV7A 4I32A 3SNDA 2SNVA 1BBRE 5HM2A 1A3BH 1W11U 5L6NH 3ZYEA 1QL8A 1EB1H 5A0AE 4INHA 2THFB 4CH2B 2BD9A 2C4FH 2ZFPH 3Q00A 1B0FA 1NC6A 2ZHWH 1AGJA 2AIPA 4CHAB 1MZDA 1EAIA 1LQDB 1RGQA 2BX3A 1YPEH 3UR6A 1FZZA 4ZKOU 3OY6U 1GJ4H 1PYTC 2G5VA 1S81A 1UHBB 1UMAH 2SGAA 2RA0A 3MHWU 1PQ5A 2EI8A 1Z8IB 1AZ8A 2J38A 1L4DA 2H9EH 3SJOA 2Z3DA 3LONA 3QDZB 1LHFH 1P2OA 1HPGA 4M7GA 2BD2A 5ETXA 4YESB 2ZDAH 4ABHA 4IC5A 1BB0B 2ANKH 1CHOG 1PQ8A 1BDAA 1SL3A 1CU1A 3PROA 1K28D 4CRAA 1HCGA 4Q7ZA 2OD3B 3B9FH 5EQRA 3KEEA 1KYNA 4CRGA 1AFQC 4RKJB 1HAZB 1RFNA 1QA7A 1SGPE 3MWIU 1LHEH 2FYRA 2VIWA 1RD3B 1XKBC 1KTSB 3PO1C 2H2ZA 1PJPA 1THRH 1Z1JA 3GCNA 4HI3A 4K1TA 4IGDA 3A82A 3GDSA 1NFXA 3PLBA 1P01A 1FONA 1O5AB 2XC4A 1MKXK 1VR1H 3QK1A 3ZVEA 1OWHA 1O3JA 1UVUH 3TJVA 2B0FA 1DVAH 3AW0A 4Q2KA 3ZZBA 4U01A 4AFSA 1DM4B 1SHHB 2FI3E 1MKWH 2SNWA 2ZTXA 2ZGXH 1BTWA 1EOLA 1TRYA 4X2XA 1HAYB 3P6ZB 7LPRA 1SPJA 1ABIH 3ODFA 1P2KA 1GBAA 1GI1A 1TLDA 1C1TA 4K2YA 3I29A 1TOMH 2CGAA 4DGJA 2ODYB 1PQ7A 1NFYA 4FUCA 2WUBA 2C3SA 1YPGH 1IQIA 1GCTC 3BTHE 1T8LA 1XXDA 5GJ4B 2BDCA 1ZJKA 2VB0A 1O2XA 1GBBA 2PV9B 4YOJA 1GHYH 5JB9S 2HPPH 1VGCC 3AAVA 2AGIX 6LPRA 1E34B 1H9LB 3H5CB 2FTLE 1O3NA 5EG4A 1ETSH 1YM0A 1GGDB 2A5IA 3ZVDA 1C5ZB 1O2YA 3BEIB 1FUJA 4SGAE 3A85A 1GCDA 4VGCB 4BTUB 1UVTH 3U8TH 2AFQB 1T8MA 1VJ9U 1CBWC 4D8NA 1SGIB 1QFKH 3BTFE 1MU8B 3T27A 2ZGBH 3SNEA 5K0HA 2BY6X 1TPAE 1Y3UA 2BQ6B 4DW2U 1JRTA 4SGBE 2A2XH 1FDPA 3ATLA 2R3YA 1P09A 4LK4A 2FTMA 3S9CA 1SGNE 2A4OA 2NWNA 2AMQA 1S0RA 4FUBA 1KXAA 1FY5A 2IN2A 1QURH 1HIAB 3BEUA 1Y59T 1ARCA 1TX8A 3TGKE 1QR3E 1YPLH 2SGQE 1G3BA 2EEKA 4GCHF 1LHDH 2Q6DA 1T7CA 3DHKH 3GY2A 2F9UA 2XWAA 1SLUB 3URCA 1B5GH 3V3MA 3QZRA 1GHZA 3ELAH 1S85A 3EDXB 4XDEA 2P3FH 1T32A 2F3CE 3OTJE 3TGJE 1PPHE 4NWLA 2VVVA 1K1NA 4Y8YA 1LO6A 2G4UA 3FP6E 4I31A 2V6NA 4XSKU 1TMBH 3KIDU 3PMBB 1TB6H 5A0CA 5JDUB 4WXVA 2GMTB 2OUAA 2ZQ1A 1CHOF 2ASUB 1P57B 1OWIA 3HKIB 2F83A 1HFDA 1IQGA 4ESTE 1Z71A 1OWEA 4MQAA 1P2JA 2K1QA 5LPFA 2WV4A 3M61U 2AYWA 3RLYH 2PUXB 1V2JT 3SNAA 1EZSC 3MU0A 1UTQA 1K22H 1O5CB 1YPMH 1SMFE 2FS8A 1LKBA 4NIXA 4ISIH 4KP0A 3GY8A 1GI2A 1J15A 2NU3E 1NESE 1FY1A 5C67A 2FM2A 4R0IA 1NFUA 5GWZA 1TGBA 4ZKNU 2P3TB 1ZPBA 3NZIA 1MQ5A 1BOQA 3MU8A 3LKWA 4K1EA 1Z8GA 1ZMNA 1O3EA 1C2JA 1P8VC 1RIWB 1ZSJA 2WV5A 1SGQE 1F2SE 1UCYH 2A45B 1NROH 2FESH 4FUHA 3K2UA 4IC6A 8KME2 2BDHA 5I25A 4IBLH 2SGEE 1NU7B 2C93B 3SHCH 2GP9B 1Y3YA 1P05A 1DDJA 5E2OA 4YT7H 5LH8A 2OTVA 3STIA 3BTQE 5L30H 2FYQA 2WYGA 2TRMA 1YLDA 2RCEA 4A92A 2HLCA 9LPRA 4Y8ZA 1UTOA 3G01A 4YLQH 5EQQA 1HBTH 1NRPH 1YLCA 1L0ZA 1IOEA 1BRAA 1RS0A 1L1GA 5JBTA 3LH3A 1YYY1 3SU5A 1QL7A 2OLGA 3M36A 1V6DA 3RXLA 1KIGH 1QL9A 2C8YB 1A5IA 1NRRH 1UK3A 3ESTA 3M7QA 2XWBI 1CT0E 1O2QA 1MTNC 1C2LA 2BY9X 1ANCA 4FUJA 1KXCA 1BITA 2V3OH 4O3UA 1H8IH 1GI8B 3PO1B 1MD8A 2R9PA 1O2HA 2A4GA 1XUFA 1DUAA 4FU8A 5E8EH 1VCPA 4X6OA 3ZYDA 1O2ZA 2VVUA 2AMPA 3TIUA 2GX4A 3EAJA 5C3NA 3BIVH 3STJA 2BD4A 1UVSH 3GICB 2FWWA 3ZVCA 4CRFA 3A88A 5TCCA 3QLPH 2EI7A 1IAUA 1UTJA 4NIWA 5JB8S 1HAVA 1XMNB 4YO9A 3RMMH 3UIRA 5J4QA 5HGGA 8GCHG 1SVPA 1TABE 2VH6A 3FZDA 3LDXH 5GPIB 3T2NA 2H5CA 2UUYA 1FPCH 3D23A 5DG6A 1LVMA 3F9FA 2F9VA 3ZVFA 1G37A 2G00A 1Z6JH 4LZ4B 4YTAA 3U8OH 4YM9A 2FOCA 1F0UA 4CREA 3FZZA 3N7OA 3EYDA 1AO5A 1C9PA 1E0FD 3Q77A 3EA7A 5C2ZA 2BB4A 3BG4C 4O9VA 4LOYH 5SGAE 5JPMH 4FUEA 4DIHH 3SZNA 5AF9H 3GY6A 1Y3VA 4KELA 1VGCB 2BMGB 3RLWH 3LU9B 2CF8H 4MVNA 4I8JA 1ZTLA 1BMNH 2IOTA 1OYQA 1EASA 3DD2H 4UFEH 1J8AA 3QUMP 3MNXA 2VJ1A 1X7AC 4AYYB 3KQBA 2H9TH 1ZMJA 7KMEH 1K1JA 2F9BH 2FXRA 1AUJA 1AU8A 1FQ3A 3RXBA 2KAIA 4X8UH 3JZ2B 1F7ZA 4FUFA 2A32A 3VEQB 1A1RA 1CBWB 2ALVA 4I8KA 3ZZAA 4YOIA 5C20A 2UUKB 1V2NT 4H6SB 2HRVA 5EPYA 5EXMA 1ZRBA 3RXFA 4CBNA 1HGTH 3URDA 1INCA 1C4Y2 2ZNKH 4JZEH 3SU1A 5TJXA 3RXHA 2ZF0H 3TITA 1OWJA 2ZO3H 3HGNA 1EZQA 2JH5D 4YT6H 1BZXE 3SNCA 2VIVA 4ABAA 1BT7A 1D3DB 2GCHF 3E8LA 1ID5H 5DPAA 1UVOA 4TPYA 4UFDH 4NA9H 4OGYA 2UUFB 3ZZ4A 3DFLA 1BTYA 5HM9A 4K69A 1ZMLA 5B6OA 1C5YB 1PPEE 3P8GA 3RXTA 2GCTC 1D9IA 1C2IA 3A7XA 2BVXH 1MMJN 5EW2H 3MO3A 5CHAB 4F49A 1SG8B 4X1QU 2QCYA 5EXNA 2Q6FA 1P04A 3OY5U 1Z8RA 1IQJA 2G8TA 5EPNA 1P03A 1O34A 3SU4A 1HRTH 4LZ1H 1GJCB 3VB5A 3RXIA 1TPOA 1O2OA 1ELDE 3TVJB 1A0HB 2FPZA 1O33A 1TALA 1GVZA
chains in the Genus database with same CATH superfamily
1MBQA 1GDQA 5DJ7A 1QGFA 3M5OA 1NO9H 3A7ZA 4DT4A 5BPEA 1YCPM 2OC1A 1TAWA 2BLQA 2WPMS 1MH0A 1DPOA 2BDGA 5L2ZH 2XCNA 3KYGA 3RXAA 3PLKA 1JIRA 1BA8B 3D62A 3EA8A 1C5LH 1RXPA 3SV6A 3LIWA 1HJ9A 1TWXB 3FFGA 1O39A 1MABB 1GHBF 2Y5GA 1QQ4A 2ZU2A 3RP2A 4Y10E 1OS8A 3P8OA 4B1TA 4BXSA 1CQQA 2G81E 1DXWA 3ZZCA 4K60A 1O3MA 2ZGCA 1G36A 5FCRA 2J92A 5HIYA 3LH1A 1ARBA 4AB9A 4FVDA 1FPHH 3RU4T 1CGIE 3Q76A 3EE7A 1C4U2 1DY8A 2J98B 1AD8H 1P9SA 1EP5A 3EGKH 3GY3A 2R2MB 2Z9JA 1ETRH 3MU4A 1GWAA 1GG6C 3ATIA 1NRQH 2ZGHA 5EJLA 1QNJA 2JETC 4TY7A 1YY3A 1BHXF 1GBLA 3F0PA 4XBCA 5JBBS 3DCLA 1HDTH 1RRKA 2G4TA 2QYIA 3GCHB 2BHGA 2HPQH 1GI0A 2A5AA 3N7EA 1K1OA 1KSNA 4NCYA 1VZQH 2QXHA 3PRDA 1EP6A 1K2I1 4X2VA 2DE8A 1QBVH 1FIZA 2BZAA 3RXGA 1ELAA 1MTNB 3SGBE 3UNSA 3DA9B 4WH6A 2VGCB 2D2DA 4AYVB 1BJVA 2V3MA 2P93A 1C5PA 1JWTA 1SGFA 2PTCE 3ATKA 1C5RA 2BM2A 1K21H 4IS5A 2UWLA 1GMCF 2D8WA 4O03A 3MNCA 2QF0A 1O2SA 5TCAA 1BIOA 3ZZ8A 1O35A 1YP9A 2R3UA 5KECA 3ZVGA 2Z94A 2FDAA 2JDID 5JYIA 5C5OA 2O9QA 5K7RA 1P3CA 1UVPA 1TIOA 3WY8A 3E3TA 4KKDA 1B0EA 1WCZA 2WZQA 1L4ZA 4ISLA 1V2MT 4B76A 3BTWE 1MTUA 1TGCA 3DSPA 1UHBA 3SJ9A 3B8JA 2BDAA 1O3DA 5T1VA 1LPGB 4TYDA 1EZUC 1Z8JB 1F5LA 5KEDA 2VIDA 2A7CA 1ZOMA 9ESTA 4X1NU 3SGQE 1C1QA 1O3HA 2SGDE 1MTSA 4I8HA 2ZU3A 3E0PB 2NU4E 1O36A 2XBVA 3FN8A 1GHAG 3F2GA 4ZXYH 1E38B 2VVCA 1LPKB 3PYHA 3Q3YA 1GJ7B 4UD9H 4MNVA 2F91A 1BHXB 3SV7A 5DGJA 5FL7D 5E2PA 2J4IA 1E37B 4H42U 4DY7B 1XXFA 4CR9A 3SV2H 2BXTH 4OGXA 4ZAEA 4B73A 3UUZA 2ZFSA 1O3OA 3A8CA 2WSSD 1EAXA 2C8ZB 1VITF 4ABEA 1EATA 2XBXA 2HWLB 2TPIZ 3QGJA 1V2PT 1O3FA 3PMAB 1IQKA 2TGDA 3A8AA 3KL6A 1CO7E 1TX6A 4ISHH 4TT3D 5EGMA 3W94A 2W5EA 1HV7A 1WOFA 2XRCA 1V3XA 1XUGA 1QBOA 2Z7FE 4ZHLU 1TA2A 3VB7A 5E0JA 1YCPK 1ELCA 2PTNA 1O37A 1T8NA 3HGPA 3ZZ5A 4X8TH 1EB2A 1OPHB 4HTCH 1O2PA 3IITA 1SQRA 1QJ7B 4RKOB 1EKBB 2GZ9A 1D3QB 1C1NA 5FCKA 1GJ8B 1EZXC 1C5XB 1RTKA 1UK2A 3MYWA 1THSH 2ANMH 4KGAA 3WW7A 2ZZUH 4MPUA 1GMDG 2WPHS 1OP8A 3C1KA 4J2YB 1FY3A 2OC0A 3PWCA 1HJ8A 1QB1A 5F03A 4Y0YE 1Y5AT 3NCLA 1F0RA 3RXDA 4A1VA 3DUXH 1MBMA 2QN5T 1C1VH 2BY7X 3KF2A 3PV4A 3ODDA 1P9UA 2WPLS 1TMTH 3RM0H 1XKAC 1OP0A 2J95A 4HGCA 4OS2A 2Y5FA 4FOUC 4I86A 3SV9A 1KY9A 1SLVB 3OU0A 1DE7H 1H1BA 1Z6EA 1FIWA 2ZHFH 1C5UA 2ZEBA 1CVWH 2ZCHP 3AAUA 3MH5A 4UE7H 2O8TA 5FBEA 2OXSA 1XVMA 2GKVE 1NRSH 1SB1H 1NTPA 2EA3A 3K9XB 1OOKB 2RDEA 1Q31A 5G4BA 2GD4B 2PGBB 5LPEA 1S84A 3CS0A 2QAAA 4K8BA 3GS9A 4ACBA 1N6YA 3UB0A 3VGCB 1EJNA 2C90B 3GCTG 4JK6A 5DP4A 2TGTA 1N8OC 1SLXB 3PMJA 1QHRB 1V2RT 1HYLA 3F9GA 4UFFH 1TNIA 3RXEA 1TRMA 4YZUA 1SFIA 4TWYA 5PTPA 3S0NA 2CHAB 2L6OA 1SQTA 1CA0C 3LGWA 3RXKA 3F6UH 3MH4A 1A0LA 2FS9A 3UREA 3UQOA 4X2WA 4GHTA 3VG8A 1C5TA 2BD5A 2HOBA 1A3EH 2AGGX 1ELFA 2QF3A 1BBRK 1ZHPA 4B71A 4WF8A 3KN2A 1HAOH 5E0GA 4K1SA 1BMLA 2XBYA 4DT7B 5IYTA 3I77A 1KTTB 4DG4A 1AWHB 4FUDA 3H7TA 4JZFH 3RU4D 1JIMA 1GJ6A 2YNAA 1OHHD 4AG1A 1PPBH 1DWBH 1F0SA 1XVOA 2Y7XA 1MD7A 2WHXA 1AIXH 4XFQA 1GBFA 2ZU4A 3UOUA 2D1JA 1YPJH 1O2KA 1SHYA 1GI5A 1H9IE 5C1XA 3TH3H 4A5TS 1HB0B 1FV9A 1CT4E 3SQEE 4J1YA 3VB6A 1GVLA 5KGOA 5JBAS 1JOUB 1S0QA 1GHAF 3RXMA 1GPZA 1ZGIA 4HFPB 1C9TA 1N1LA 4B74A 1QRWA 2ZHQH 4IMZA 7ESTE 2OINA 4UEHH 2ZCKP 4CH8B 4B6FA 5T6DA 2OQUA 2BDIA 5DN6D 2QXJA 2W6JD 1LPZB 2PKSC 3M3SA 1GBHA 1E79D 2AH4X 2XTTB 2L74A 1OKXA 2BYAX 2ZPQA 2I6QA 3BEFB 4AN7A 4Y6DA 2KFWA 1O30A 1GDNA 1P0SH 1GJ9B 1W0YH 1AKSA 1EPTA 1O2GH 4JMYA 4ABGA 1O0DH 1GL1A 5GXPA 1A5HA 2ILNA 3ZIAD 4NGAH 4IMQA 5A09A 2GT7A 1W0KD 2PKAA 5T6GA 3NXPA 4Q80A 4WMFA 1HAHH 1AZZA 1SGTA 1PPFE 1QTFA 1EX3A 3MH7A 4Y0ZE 1O5BB 5J4SA 3MNSA 1ELGA 1Z1IA 1GMDF 1J17T 4NZLA 1QJ6B 2PWXA 4OS4A 2ZU5A 1KMHB 4ZHAA 1SGFG 1S82A 1C5OH 3NKKA 1TE0A 4KTCA 2EC9H 1LQEA 3RXSA 4TPIZ 3D49H 6CHAC 2DE9A 1AFQB 4DJZB 1FAKH 1S6LA 1UCYE 1ZZZA 4CBOA 3RMNH 1GI3A 1O2LA 1WQVH 3B23B 2NU1E 1NS3A 1A5GH 4TY6A 1DSUA 1AVXA 2ZG0H 3T5FH 2ESTE 4GSOA 3TLOA 4E06H 5DP8A 2QGRA 1OSSA 2BLWA 5E0HA 4XRNA 1HLTH 3L33A 2QV1A 4JZ1A 2ZP0H 4Y76A 4B2AA 1SKYE 2OC8A 1HAVB 1ACBE 4CHAC 4IN2A 2BQ7B 1B7XB 1QB9A 1T31A 2PHBA 4B75A 1DY9A 4U32A 1OX1A 2BVSH 2RDLA 4A7IB 2NU0E 1O2WA 1SFQB 1D3TB 2GVFA 1ZSKA 2ZFQH 2OK5A 1BCUH 2F9NA 3PTBA 1P2NA 2YOLA 3ZZ3A 1O2NA 1P3EA 2VNTA 1RTFB 3QWCH 3BTGE 4AFQA 1ANEA 4WXIA 2B5TB 1A0JA 1GCTB 2CK3D 2ZDNA 1K1PA 1EJAA 4XBDA 2WUCA 1P2QA 3F0OA 4GLYA 1W8BH 2ALPA 3S9BA 3M5LA 4THNH 3TNTA 3BTTE 2BX4A 5GCHG 4ABFA 4NSYA 1C5QA 4XBBA 3VB3A 3RC5A 1TBQH 1DITH 2VIOA 1FLEE 2QC2A 2B7DH 2OCVB 5DP6A 5EU8A 1K1LA 1W7GH 2VBCA 3RXQA 1F92A 1MUEB 3OEHD 1P2IA 1C5MD 2R0KA 3SHAH 1NRNH 1O2UA 2UWPA 4GVUA 4YOGA 4E05H 2ZFFH 2KAIB 2Z9IA 4PROA 3GDVA 1BRBE 2XBWA 2SGPE 1AQ7A 1G3EA 2ZDVH 1Y5UT 1O5FH 3GYLB 3L3TA 2BTCE 1YF4A 4X8VH 1EJMA 3GISB 2C8XB 4IW4E 4X1RU 5ABWA 3KHVA 1TGSZ 1PPZA 3RXVA 2A5KA 1G3DA 4AGJA 2FLBH 2BOHB 1J14A 2RA3A 3BG8A 2FOEA 3OFND 2XNIA 1ETTH 3TH4H 4CRBA 3KYFA 1THPB 5C1YA 3PLPA 3P8FA 3SUEA 2ULLA 5C94A 4WMDA 2OC7A 2XYAA 3RXCA 3ZV8A 1AE8H 1XM1A 1H8DH 3BIUH 3HKJB 1EAWA 5LPRA 1A4WH 1BMFD 2JH0D 2FODA 2FMJA 1Y8TA 4NSVA 4B2CA 1NBME 1SGEE 1YCPH 1QY6A 4JYUH 3A8BA 1KXEA 2A1DB 2RG3A 3M5NA 5AFYH 2J94A 3RC6A 1BTHH 1L1JA 1E36B 3HK3B 4CR5A 4HG6A 2I6SA 2ZFTA 2ZDMA 1WBGB 1HAPH 1ABJH 3UNQA 3UWJH 1IQFA 5EOKA 1IHSH 3U28C 1O2JA 2ZDKA 4FU9A 3UQVA 4FETA 4RT1A 2GTBA 1SOZA 3GY5A 1FNIA 3A81A 2F9PA 1V2TT 1GGDC 4P02A 1ELEE 3QZQA 3A7TA 3AASA 1IQNA 3OSYA 2P94A 3QO6A 1ESAA 5ESBA 2H6MA 5HXFA 1AB9C 1TA6A 3M37A 2WYJA 2HNTC 2O8UA 3FP8E 3SQHE 4BAHB 3U1IB 1P2MA 2W3KA 4BANB 1CHGA 1O2RA 1TYNA 3HATH 4RN6A 3U69H 4BTTB 5AVDA 2Y81A 1V2ST 4Q4LA 5DP5A 1TGTA 1QRXA 4WJG2 4NFFA 5FPSA 1AI8H 1C2EA 5FBIA 1TQ0B 3L6PA 4AC9A 3RMLH 4BOHA 1PQAA 4GPGA 3PB1E 1G9IE 1AVWA 1D6WA 1CSOE 1GHVH 3UR9A 4FVBA 2WINI 3JZ1B 1GVKB 1DANH 4RT0A 3ZVBA 1TRNA 1TOCB 2YMSB 2PW8H 5GIBA 1JMOH 4CRCA 1DOJA 1YPHC 3O8DA 4ABJA 8GCHF 5ESTE 1G2LA 2ZDLA 5DKMA 5EXLA 1C2HA 1ZTJA 3P17H 3TH2H 3SU3A 3RXJA 3LPRA 4Y7BA 1ELTA 3MI4A 1HAIH 5FX5A 1CA8B 1Q2WA 1A61H 2ZHEH 5B6LA 1BBRH 1ORFA 3ZZ7A 4B2BA 2ZQ2A 1UTKA 2W26A 3UOPA 2JKHA 1KDQA 1OXGA 1Y5BT 3A89A 4KTUA 5FX6A 1MCVA 2O8LA 2OP9A 2GMTC 2PSXA 4X6NA 2ZHDA 3N99A 5H4IB 5GCHF 1K9OE 4NIVA 2CF9H 3SBKA 2PSYA 3DFJA 3GY4A 1OWDA 1GJBB 1SQOA 2VU8E 4BTIB 1KXDA 3PWBA 3O8CA 2FOFA 2Y6TA 4GUXA 1XUHA 5CE1A 6CHAB 2GZ7A 2FO9A 1QJ1B 4XE4A 2AMDA 4X6PA 5AHGH 1XUKA 3RM2H 3QGNB 2UWOA 2SGFE 2B9LA 1ZHMA 1C5WB 1ZYOA 4NA7A 4Y71A 1DSTA 3VXFH 2GDDA 1EPTC 1DICA 3ZZ9A 4NIYA 1GBMA 2GT8A 2K8IA 3SUGA 2W7SA 3BTME 1W12U 1FY4A 2M2AA 2GZ8A 4FUGA 1AMHA 1MQ6A 1SR5C 2BDBA 4D7GA 3CENA 1NPMA 1PYTD 1ZHRA 4ABBA 2W7UA 1UTNA 1TNGA 3F9HA 4BNRA 1DWCH 2PP6A 1LHGH 2XXLA 4GCHG 5EW1H 4D7FA 1O3IA 3SUDA 1GI9B 1RIWC 1U6QA 1ANDA 1SSXA 5DP9A 4MPWA 1WSSH 5EQSA 1EXFA 1V2LT 1KLJH 2CXVA 2Q6GA 1LMWB 3V12A 3SN8A 3DT0H 1O2TA 3IG6B 1O38A 3KQ5A 4UDWH 2TBSA 1BTUA 1BRUP 1GBDA 1UO6A 1SC8U 4IN1A 2UUJB 4ISOA 3UNRA 1TGNA 3NK8A 6GCHG 3E91A 4NG9H 1W0JD 1O5EH 1OWKA 3FOAA 4INLA 4INKA 1O3LA 2LELA 3E0NB 2J34A 4QT8C 1QIXB 2P16A 4X0WU 5F53A 1Z7KA 4DURA 1C1PA 1ZPCA 3BG4B 3SGAE 4UFGH 1TQ7B 2Q1JA 2Z9LA 4Y79A 1WXRA 4DCDA 3F2FA 3SI4H 3N7DA 1G30B 1O2VA 4Y7AA 2HNTF 1SI5H 2BD3A 4MPVA 1XUIA 2J5UA 5CMXH 1YWUA 4MLFB 4M9FA 1O32A 2FLRH 2FP7B 2LP6A 1C1WH 2FOMB 2KCAA 3EQ0H 5T6FA 2Y80A 1DLKB 4RSPA 2ANYA 4ZUHA 3O8BA 2A0QB 5L2YH 1GJ5H 1LCYA 2M5TA 1H4WA 2ZGJA 1T4UH 3FVFB 3TK6A 1V2KT 1ZPZA 4GHQA 4AOQA 2FX4A 4OS7A 2QXGA 4LXBH 1LTOA 3FANA 1ESTA 1ZGVA 2WPKS 1NM6A 3U98H 1V2VT 1P12E 1NU9A 1L2EA 2B8OH 1YC0A 1BUIA 1HXEH 1PFXC 1Y3WA 3M7TA 3R0FA 3M7UA 1VITH 1AUTC 2IPQX 3SO3A 2RFKC 3TU7H 2HNTE 2BOKA 2HLDD 3DSOA 1BTPA 5GDSH 4Y8XA 3RXPA 3FAOA 3ENSB 3PM3A 3M5MA 1GBCA 1O3KA 4WVPE 5JBCS 2H1UA 4A6LA 1TNJA 5A8XA 1VJAU 1WU1A 2ODPA 1JRSA 2A7JA 1QBNA 2AIQA 3RMOH 1ZSLA 1K0HA 1S5SA 2QIQA 2Y7ZA 6ESTA 1MAXA 2GGVB 2GCTB 2GDEH 4A1XA 2ZKSA 1C1RA 1JBUH 1QCPA 3MU1A 3ZV9A 1C5VA 4JYTA 1TPPA 1T8OA 1NY22 4MDSA 4I8LA 3E90B 3ZVAA 1E35B 1GBTA 1Y3XA 2ANWA 3MOCA 4ISNA 4U2WA 1QQUA 1HAGE 3NUMA 1BMMH 1C4V2 1YPHE 1MAYA 1EFRD 3K6ZA 2ZFRH 4ZKRU 1A46H 1D3PB 1CGJE 2TGPZ 5EODA 3RC4A 2HVXA 2G55A 1GBEA 5HKKD 2W3IA 5F8ZA 5CHBA 2KR7A 3UTUH 1AB9B 1DFPA 3VFEA 2FIRH 3LJJA 1T4VH 2SFAA 1L1NA 3F3BA 1W13U 2ZPRA 2P95A 1GI7B 1KXBA 2P8OC 4MTBA 4X8SH 4E7RG 4ZHMU 3A8DA 1GBKA 3BN9A 4Q7YA 4TWWA 5C1UA 3MTYA 2ZA5A 3UFAA 1Q3XA 3P95A 3NPSA 1JXPA 3ATMA 5FPYA 1W2KH 3VXEH 2AGEX 1HXFH 2STBE 1DWEH 1HIAA 1V2UT 2BLVA 1FAXA 1LVOA 3K6YA 2A4QA 1TMUH 2A31A 3T25A 5I46H 2WPDD 1ZJDA 3LOXA 2YNBA 3PTNA 1EQ9A 1SGYE 2QA9E 4U30A 2FOAA 1RJXB 3S69A 2ZTZA 2ZTYA 4F48B 5DP7A 5CHAC 3T26A 3M3TA 1UTPA 3GYMA 1GG6B 1O3AA 4JZIA 4XOJA 2F9OA 1D6RA 1WAYB 2BDYA 2JETB 6GCHF 1WV7H 4BAMB 2CJIA 2BZ6H 4D9QA 1YPKH 2FOGA 1NFWA 3OX7U 4O97A 3MNBA 3RDZA 1O3BA 2FOHA 3SJIA 1QB6A 3U8RH 2PUQH 1C2KA 3U1JB 1ELVA 1AY6H 4OS1A 5DP3A 4YLUA 1E1QD 5CDFE 1FN8A 3IWMA 3ATWA 3SORA 4BAQB 3SU6A 1YBWA 3Q3XA 7GCHG 8ESTE 5FPTA 1LVYA 1S83A 3T28A 1WQSA 4X1SU 1HJAC 1BJUA 3CNRA 1W7XH 1F0TA 1UJ1A 2QY0B 1AKSB 3R3GB 1EPTB 4DOQA 3F68H 4BXWA 5F8TA 1AVGH 3BTEE 3QTOH 1QRZA 2D26C 2XOKD 3A87A 4E7NA 5FAHA 3BV9B 2G52A 2GCHG 5IDKA 1AFEH 2JH6D 1TBZH 2Z9GA 2J9NA 1DX5M 1GBIA 3EE0B 4WH8A 4DIIH 1OP2A 2Y5HA 1ZRKA 3S7HB 2Z3EA 2PKAB 1DS2E 4B6EA 2FOBA 1C2FA 4AB8A 2QF4A 1YGCH 1H8ED 4O3TA 4BAOB 3GCOA 1IHTH 2Z6BD 3P8NA 3VPKA 1C1OA 2JIZD 4MPXA 4OS5A 3SU2A 3SOSA 2HALA 1SGDE 1GI6A 3FO8D 3TGIE 3I78A 4WWYA 5A2MH 3TK9A 1W14U 1SGCA 3SW2B 3S7KB 1P02A 1V2WT 4I7YH 2VWMA 3BF6H 5FHTA 3BTDE 3A7VA 2ODQA 1C2DA 1GHXH 4Z0KA 4KTSA 4F4OC 2VIPA 1KXFA 4I8GA 3GCHC 2A2QH 1W0ZU 3KQEA 1WUNH 3Q3KA 3A84A 3TJOA 4MG3A 4JZDH 1O5DH 1G2MA 3AVZA 2GV6A 3T62A 3EA9A 1TFXA 2V3HH 2DUCA 3NWUA 3T29A 1G3CA 1FJSA 3E16B 3RXRA 1CT2E 2VH0A 1ANBA 5T3HA 3O8RA 3CP7A 1A2CH 4D9RA 3A7WA 1MKWK 3W95A 3V0XA 1EAUA 2ZWLH 2VGCC 1GJAB 2ZC9H 2OBOA 2VWNA 1XX9A 1W3CA 1UTMA 5F6MA 1H9HE 4OS6A 3QX5H 4H4FA 4NZQA 1TNLA 1GHBG 2Y82A 2VINA 2H9HA 2R0LA 3DSGA 1GHWH 3GCTF 2BD8A 2CMYA 3TNSA 3A86A 1FMGA 3KNXA 3SJ8A 4TSFD 1NT1A 3SJKA 2WPJS 1IQLA 3HPTB 3F2HA 3MQKC 1W10U 1IQMA 2P3UB 1DUEA 2R2WU 4ZH8A 1ZLRA 2G5NA 2TGAA 3F9EA 4AGKA 3LJOA 1FY8E 3MH6A 1C2MA 1ESBA 1BTXA 2AEIH 2PR3A 3U9AH 1EUFA 5EJ1A 1GMHG 1P06A 3P92A 3LGUA 1COWD 3C27B 4AFUA 3F1SB 1O3GA 2BY5X 5LGOA 1FN6A 4A1TA 1S6HA 3ITIA 1VCWA 1C5NH 2ZIQH 3CS7A 1NN6A 2XC5A 2XCFA 1FI8A 3LGYA 2ZCLP 1MU6B 2KX4A 1J9CH 1OYTH 2FZZA 3A83A 5FXLA 1WYKA 2CN0H 2V0BA 2STAE 3WWFA 1GL0E 4Y11E 3SU0A 4H6TA 3V7TA 4ABIA 1XUJA 1LDTT 3A80A 4NA8A 4X1PU 2ZI2H 4MNWA 5DO4H 1SQAA 3LGVA 4K5ZA 4NFEA 2KZ4A 2H5DA 2IPHA 3BTKE 3OYPA 1QA0A 1BMAA 4AX9H 4ZMAH 5BRRE 4YXWD 1FXYA 1IQEA 5A0BA 3TJUA 2PLXA 1SLWB 3GDUA 1AE5A 3UPEA 2O8MA 1UK4A 4I33A 2LNCA 7GCHF 1GMCG 3QTVH 1WTGH 3RU4E 3LC5A 1C5SA 1TONA 1N8OB 1NZQH 2Z3CA 2P8OB 1MKXH 2A7HA 1TX7A 3MMGA 3MO6A 4FUIA 3FKSD 2FI4E 2KCYA 1K1MA 1M9UA 1J16A 4ZXXH 2WPIS 3M35A 1P10A 1CA0B 2BD7A 1RTLA 3KGPA 1MTVA 2XC0A 3MFJA 2Z9KA 1DWDH 3LGIA 1C1UH 3UAIC 2BVRH 3KQDA 2P59A 2ZPSA 1ZR0A 1MZAA 5HYOA 1TNKA 1HNEE 1IQHA 3A7YA 1G32B 1V2QT 1YKTA 2A4RA 4ASHA 1PPGE 3P70B 3KQCA 5AFZH 3V13A 2NU2E 2BLOA 3AW1A 4UONA 3VB4A 1F5RA 1TPSA 1C1MA 2PFEA 4D76A 1CE5A 1VCQA 1MCTA 1O2MA 2C8WB 3TJNA 3S9AA 3ZZ6A 4AZ2B 5A8YA 3FP7E 4XD7D 1S6FA 1GDUA 4VGCC 5IK2D 2FEQH 4JCNA 2QE7D 3NRLA 1KLTA 2FI5E 1WTHD 3LGTA 2FX6A 3MO9A 1BQYA 1HUTH 4MNYA 3SI3H 1SOTA 1EOJA 4Q63A 5EJZA 4FXGH 3PMHB 4WMEA 2EY4C 3TPIZ 1O5GH 1CGHA 2QXIA 2TIOA 1F5KU 2BQWB 1YLNA 1LKAA 1VITG 4ZROA 4GAWA 3ZZDA 4ZCNA 3K65B 2PGQB 3VGCC 1ZTKA 1GBJA 2PKSB 4P00A 1MTWA 4ABDA 3QN7A 4BAKB 4Z6AH 2CV3A 1SGRE 1LVBA 2VWLA 1TBRH 3SNBA 1HJAB 3GOVB 1ELBA 1HAXB 1PPCE 4ZKSU 2OBQA 1O2IA 4R8TB 3UWIA 2HGTH 1O3PB 4MNXA 3UY9A 1UCYK 2CHAC 2G51A 2OQ5A 3HK6B 5HMAA 3MU5A 4Z1MD 5A8ZA 1GJDB 1A7SA 2BY8X 3E6PH 4NWKA 1GI4A 1TNHA 3RUOA 5HIZA 2QF5A 1O3CA 4DVAU 3LC3A 5C5NA 2XW9A 1O31A 1C1SA 4X6MA 4AORA 1DXPA 2V35A 4JK5A 1AHTH 1P11E 4K8YA 1KDQB 5DK1A 1DLEA 4AFZA 4FU7A 3E1XB 3BSQA 1K1IA 3RXUA 1UTLM 1GMHF 2EI6A 2J98A 1E1RD 3KCGH 2J2UA 4K3JA 3SUFA 1SBWA 3GY7A 4CRDA 1N6XA 3SV8A 4X2YA 2LPRA 4Q7XA 8LPRA 4HZHA 2VWOA 4WY3A 1DT2A 2O8WA 1V2OT 3H7OA 1LHCH 1C2GA 3D65E 2IJOB 2VIQA 3M3VA 1BTZA 2AERH 2ZECA 1AN1E 3TK5A 5F8XA 1D4PB 4JYVH 4AG2A 1AWFH 2ZU1A 3LT3A 1KLIH 1BRCE 2BXUH 3RXOA 2AS9A 2GV7A 3PV2A 4I32A 3SNDA 2SNVA 1BBRE 5HM2A 1A3BH 1W11U 5L6NH 3ZYEA 1QL8A 1EB1H 5A0AE 4INHA 3OE7D 2THFB 4CH2B 3OTPA 5C17A 2BD9A 2C4FH 2ZFPH 3Q00A 1H8HD 1B0FA 3WWBA 1NC6A 2ZHWH 1AGJA 2AIPA 4CHAB 1MZDA 1EAIA 1LQDB 1RGQA 2BX3A 2JJ2D 1YPEH 3UR6A 1FZZA 4ZKOU 3OY6U 1GJ4H 1PYTC 2G5VA 1S81A 1UHBB 1UMAH 2SGAA 2RA0A 3MHWU 1PQ5A 2EI8A 1Z8IB 1AZ8A 2J38A 1L4DA 2H9EH 3SJOA 2Z3DA 3LONA 3PRBA 3QDZB 1LHFH 1P2OA 2IJD1 1HPGA 4M7GA 2BD2A 5ETXA 4YESB 2ZDAH 2JJ1D 4ABHA 4IC5A 1BB0B 2ANKH 1CHOG 1PQ8A 1BDAA 1SL3A 1CU1A 3PROA 1K28D 2K0QA 4CRAA 1HCGA 4Q7ZA 2OD3B 3B9FH 5EQRA 3KEEA 1KYNA 4CRGA 1AFQC 4RKJB 1HAZB 1RFNA 1QA7A 1SGPE 3MWIU 1LHEH 2FYRA 2VIWA 1RD3B 1XKBC 1KTSB 3PO1C 2H2ZA 1PJPA 1THRH 1Z1JA 3GCNA 4HI3A 4K1TA 4IGDA 3A82A 3GDSA 1NFXA 3PLBA 1P01A 3SZEA 1FONA 1O5AB 2XC4A 1MKXK 1VR1H 3QK1A 2AHME 3ZVEA 1OWHA 1O3JA 1UVUH 2HVYB 3TJVA 2B0FA 1DVAH 3AW0A 4Q2KA 3ZZBA 4U01A 4AFSA 1DM4B 1SHHB 2FI3E 1MKWH 2SNWA 2ZTXA 2ZGXH 1BTWA 1EOLA 1TRYA 4X2XA 1HAYB 3P6ZB 7LPRA 1SPJA 1ABIH 3ODFA 1P2KA 1GBAA 1GI1A 1TLDA 1C1TA 4K2YA 5DSFA 3I29A 1TOMH 2CGAA 4DGJA 2ODYB 1PQ7A 1NFYA 4FUCA 2WUBA 2C3SA 1YPGH 1IQIA 1GCTC 3BTHE 1T8LA 1XXDA 5GJ4B 2BDCA 1ZJKA 3SYJA 2VB0A 1O2XA 1GBBA 2PV9B 4YOJA 1GHYH 5JB9S 2HPPH 1VGCC 3AAVA 2AGIX 6LPRA 1E34B 1H9LB 4ACAA 3H5CB 2FTLE 1O3NA 5EG4A 1ETSH 1YM0A 1GGDB 2A5IA 3ZVDA 1C5ZB 1O2YA 3BEIB 1FUJA 4SGAE 3A85A 2WV9A 1GCDA 4VGCB 4BTUB 1UVTH 3U8TH 2AFQB 3OEED 1T8MA 1VJ9U 1CBWC 4D8NA 1SGIB 1QFKH 3BTFE 1MU8B 3T27A 2ZGBH 3SNEA 5K0HA 2BY6X 1TPAE 1Y3UA 2BQ6B 5C0TA 4DW2U 1JRTA 4SGBE 2A2XH 1FDPA 3ATLA 2R3YA 1P09A 4LK4A 2FTMA 3S9CA 1SGNE 2A4OA 2NWNA 2AMQA 1S0RA 4FUBA 4RI0A 1KXAA 1FY5A 2IN2A 1QURH 1HIAB 1VKYA 3BEUA 1Y59T 1ARCA 3OAAD 1TX8A 3TGKE 1QR3E 1YPLH 2SGQE 3H09A 1G3BA 2EEKA 4GCHF 1LHDH 2Q6DA 1T7CA 3DHKH 2XNDD 3GY2A 2F9UA 2XWAA 1SLUB 3URCA 1B5GH 3V3MA 3QZRA 1GHZA 3ELAH 1S85A 1UW7A 3EDXB 4XDEA 2P3FH 1T32A 2F3CE 3OTJE 3TGJE 1PPHE 4NWLA 2VVVA 1K1NA 4Y8YA 1LO6A 2G4UA 3FP6E 4I31A 2V6NA 4OM9A 1TMBH 3KIDU 4XSKU 3PMBB 1TB6H 5A0CA 5JDUB 4WXVA 5GNDA 2GMTB 2OUAA 2ZQ1A 1CHOF 2ASUB 1P57B 1OWIA 3HKIB 2F83A 1HFDA 1IQGA 3W1EA 4ESTE 1NBMD 5C0UA 1Z71A 1OWEA 4MQAA 1P2JA 2K1QA 5LPFA 2WV4A 3M61U 2AYWA 3RLYH 2PUXB 1V2JT 3SNAA 1EZSC 1FX0B 3MU0A 1UTQA 1K22H 3AK5A 1O5CB 1YPMH 1SMFE 2FS8A 1LKBA 4NIXA 4ISIH 4KP0A 3GY8A 1GI2A 1J15A 2YMSD 2NU3E 1NESE 1FY1A 5C67A 2FM2A 4R0IA 1NFUA 5GWZA 1TGBA 4ZKNU 2P3TB 1ZPBA 3NZIA 1MQ5A 1BOQA 3MU8A 3LKWA 4K1EA 2YMSC 1Z8GA 1ZMNA 1O3EA 1C2JA 1P8VC 1RIWB 1ZSJA 2WV5A 4ASUD 1SGQE 1F2SE 1UCYH 2A45B 5EIYA 1NROH 2FESH 4FUHA 1QZ8A 3K2UA 4IC6A 8KME2 2BDHA 5I25A 4IBLH 2SGEE 1NU7B 2C93B 3SHCH 2GP9B 1Y3YA 1P05A 1DDJA 5E2OA 4YT7H 5LH8A 2OTVA 3STIA 3BTQE 5L30H 2FYQA 2WYGA 2TRMA 1YLDA 2RCEA 4A92A 2HLCA 9LPRA 4Y8ZA 1UTOA 3G01A 4YLQH 5EQQA 1HBTH 1NRPH 1YLCA 1L0ZA 1IOEA 1BRAA 1RS0A 1L1GA 5JBTA 3LH3A 1YYY1 3SU5A 1QL7A 2OLGA 3M36A 1V6DA 3RXLA 1KIGH 2W6ID 1QL9A 2C8YB 1A5IA 1NRRH 1UK3A 2KCOA 2F4LA 3ESTA 3M7QA 2XWBI 1CT0E 1O2QA 1MTNC 1C2LA 2BY9X 1ANCA 4FUJA 1KXCA 4F55A 1BITA 2V3OH 4O3UA 1H8IH 1GI8B 3PO1B 1MD8A 2R9PA 1O2HA 2A4GA 1XUFA 1DUAA 4FU8A 5E8EH 1VCPA 4X6OA 3ZYDA 1O2ZA 2VVUA 2AMPA 3TIUA 2GX4A 3EAJA 5C3NA 3BIVH 3STJA 2BD4A 1UVSH 3GICB 2FWWA 3ZVCA 4CRFA 3A88A 5TCCA 3QLPH 2EI7A 1IAUA 1UTJA 4NIWA 5JB8S 1HAVA 1XMNB 4YO9A 3RMMH 3UIRA 5J4QA 5HGGA 8GCHG 1SVPA 1TABE 2VH6A 3FZDA 3LDXH 5GPIB 3T2NA 2H5CA 2UUYA 1FPCH 3D23A 5DG6A 2J97A 3PV5A 1LVMA 3F9FA 2F9VA 2EQNA 3ZVFA 1G37A 2G00A 1Z6JH 4LZ4B 4YTAA 3U8OH 4YM9A 2GJGA 2FOCA 1F0UA 4CREA 3FZZA 3N7OA 3EYDA 1AO5A 1C9PA 1E0FD 3Q77A 3EA7A 5C2ZA 2BB4A 3BG4C 4O9VA 4LOYH 5SGAE 5JPMH 4FUEA 4DIHH 3SZNA 5AF9H 3GY6A 1Y3VA 4KELA 1WDIA 1VGCB 2BMGB 3RLWH 3LU9B 2CF8H 4MVNA 4I8JA 1ZTLA 1BMNH 2IOTA 1OYQA 1EASA 3DD2H 4UFEH 1J8AA 3QUMP 3MNXA 2VJ1A 1X7AC 4AYYB 3KQBA 2H9TH 2V7QD 1ZMJA 7KMEH 1K1JA 2F9BH 2FXRA 1AUJA 1AU8A 1FQ3A 3RXBA 2KAIA 4X8UH 3JZ2B 1F7ZA 4FUFA 2A32A 3VEQB 1A1RA 1CBWB 2ALVA 4I8KA 3ZZAA 4YOIA 5C20A 2UUKB 1V2NT 4H6SB 2HRVA 5EPYA 5EXMA 1ZRBA 3RXFA 4CBNA 1HGTH 3URDA 1INCA 1C4Y2 2ZNKH 4JZEH 3SU1A 5TJXA 3RXHA 2ZF0H 3TITA 1OWJA 2ZO3H 3HGNA 1EZQA 2JH5D 4YT6H 1BZXE 3SNCA 2VIVA 4ABAA 1BT7A 1D3DB 2GCHF 3E8LA 1ID5H 5DPAA 1UVOA 4TPYA 4UFDH 4NA9H 4OGYA 2UUFB 3ZZ4A 3DFLA 1BTYA 5HM9A 4K69A 1ZMLA 5B6OA 1C5YB 1PPEE 3P8GA 3RXTA 2GCTC 1D9IA 1C2IA 3A7XA 2BVXH 1MMJN 2KM0A 5EW2H 3MO3A 5CHAB 4F49A 1SG8B 4X1QU 2QCYA 5EXNA 2Q6FA 1P04A 2F43B 3OY5U 1Z8RA 1IQJA 2G8TA 5EPNA 1P03A 2KCPA 1O34A 3SU4A 1HRTH 4LZ1H 1GJCB 3VB5A 3RXIA 1TPOA 1O2OA 1ELDE 3TVJB 1A0HB 2FPZA 1O33A 1TALA 1GVZA
chains in the Genus database with same CATH topology
1MBQA 1GDQA 5DJ7A 1QGFA 3M5OA 1NO9H 3A7ZA 5BPEA 1YCPM 2OC1A 1TAWA 2BLQA 2WPMS 1MH0A 1DPOA 2BDGA 5L2ZH 2XCNA 3RXAA 3PLKA 1JIRA 1BA8B 3D62A 3EA8A 1C5LH 1RXPA 3SV6A 3LIWA 1HJ9A 1TWXB 3FFGA 1O39A 1GHBF 2Y5GA 1QQ4A 2ZU2A 3RP2A 4Y10E 1OS8A 3P8OA 4B1TA 4BXSA 1CQQA 2G81E 1DXWA 3ZZCA 4K60A 1O3MA 2ZGCA 1G36A 5FCRA 2J92A 3LH1A 1ARBA 4AB9A 4FVDA 1FPHH 3RU4T 1CGIE 3Q76A 1C4U2 1DY8A 1AD8H 1P9SA 1EP5A 3EGKH 3GY3A 2R2MB 2Z9JA 1ETRH 3MU4A 1GWAA 1GG6C 3ATIA 1NRQH 2ZGHA 1QNJA 2JETC 4TY7A 1BHXF 1GBLA 4XBCA 5JBBS 1HDTH 1RRKA 2G4TA 2QYIA 3GCHB 2BHGA 2HPQH 1GI0A 2A5AA 1K1OA 1KSNA 4NCYA 1VZQH 2QXHA 1EP6A 1K2I1 4X2VA 2DE8A 1QBVH 1FIZA 2BZAA 3RXGA 1ELAA 1MTNB 3SGBE 3UNSA 3DA9B 4WH6A 2VGCB 2D2DA 4AYVB 1BJVA 2P93A 1C5PA 1JWTA 1SGFA 2PTCE 3ATKA 1C5RA 2BM2A 1K21H 4IS5A 2UWLA 1GMCF 2D8WA 4O03A 3MNCA 2QF0A 1O2SA 5TCAA 1BIOA 3ZZ8A 1O35A 1YP9A 2R3UA 3ZVGA 2Z94A 2FDAA 5JYIA 5C5OA 2O9QA 5K7RA 1P3CA 1UVPA 1TIOA 3WY8A 3E3TA 4KKDA 1B0EA 1WCZA 1L4ZA 4ISLA 1V2MT 4B76A 3BTWE 1MTUA 1TGCA 1UHBA 3SJ9A 3B8JA 2BDAA 1O3DA 1LPGB 4TYDA 1EZUC 1Z8JB 1F5LA 2VIDA 2A7CA 1ZOMA 9ESTA 4X1NU 3SGQE 1C1QA 1O3HA 2SGDE 1MTSA 4I8HA 2ZU3A 3E0PB 2NU4E 1O36A 2XBVA 1GHAG 4ZXYH 1E38B 2VVCA 1LPKB 3PYHA 3Q3YA 1GJ7B 4UD9H 4MNVA 2F91A 1BHXB 3SV7A 5DGJA 5E2PA 2J4IA 1E37B 4H42U 4DY7B 1XXFA 4CR9A 3SV2H 2BXTH 4OGXA 4ZAEA 4B73A 3UUZA 2ZFSA 1O3OA 3A8CA 1EAXA 2C8ZB 1VITF 4ABEA 1EATA 2XBXA 2HWLB 2TPIZ 3QGJA 1V2PT 1O3FA 3PMAB 1IQKA 2TGDA 3A8AA 3KL6A 1CO7E 1TX6A 4ISHH 5EGMA 3W94A 2W5EA 1HV7A 1WOFA 2XRCA 1V3XA 1XUGA 1QBOA 2Z7FE 4ZHLU 1TA2A 3VB7A 5E0JA 1YCPK 1ELCA 2PTNA 1O37A 1T8NA 3HGPA 3ZZ5A 4X8TH 1EB2A 1OPHB 4HTCH 1O2PA 3IITA 1QJ7B 4RKOB 1EKBB 2GZ9A 1D3QB 1C1NA 5FCKA 1GJ8B 1EZXC 1C5XB 1RTKA 1UK2A 3MYWA 1THSH 2ANMH 4KGAA 2ZZUH 4MPUA 1GMDG 2WPHS 1OP8A 3C1KA 4J2YB 1FY3A 2OC0A 3PWCA 1HJ8A 1QB1A 5F03A 4Y0YE 1Y5AT 3NCLA 1F0RA 3RXDA 4A1VA 3DUXH 1MBMA 2QN5T 1C1VH 2BY7X 3KF2A 3PV4A 3ODDA 1P9UA 2WPLS 1TMTH 3RM0H 1XKAC 1OP0A 2J95A 4HGCA 4OS2A 2Y5FA 3SV9A 1KY9A 1SLVB 3OU0A 1DE7H 1H1BA 1Z6EA 1FIWA 2ZHFH 1C5UA 2ZEBA 1CVWH 2ZCHP 3AAUA 3MH5A 4UE7H 2O8TA 5FBEA 2OXSA 1XVMA 2GKVE 1NRSH 1SB1H 1NTPA 2EA3A 3K9XB 1OOKB 1Q31A 5G4BA 2GD4B 2PGBB 5LPEA 1S84A 3CS0A 2QAAA 4K8BA 1N6YA 3VGCB 1EJNA 2C90B 3GCTG 4JK6A 5DP4A 2TGTA 1N8OC 1SLXB 3PMJA 1QHRB 1V2RT 1HYLA 3F9GA 4UFFH 1TNIA 3RXEA 1TRMA 4YZUA 1SFIA 4TWYA 5PTPA 3S0NA 2CHAB 1SQTA 1CA0C 3LGWA 3RXKA 3F6UH 3MH4A 1A0LA 2FS9A 3UREA 3UQOA 4X2WA 4GHTA 1C5TA 2BD5A 2HOBA 1A3EH 2AGGX 1ELFA 2QF3A 1BBRK 1ZHPA 4B71A 4WF8A 3KN2A 1HAOH 5E0GA 4K1SA 1BMLA 2XBYA 4DT7B 5IYTA 3I77A 1KTTB 4DG4A 1AWHB 4FUDA 3H7TA 4JZFH 3RU4D 1JIMA 1GJ6A 2YNAA 4AG1A 1PPBH 1DWBH 1F0SA 1XVOA 2Y7XA 1MD7A 1AIXH 4XFQA 1GBFA 2ZU4A 3UOUA 2D1JA 1YPJH 1O2KA 1SHYA 1GI5A 1H9IE 5C1XA 3TH3H 4A5TS 1HB0B 1FV9A 1CT4E 3SQEE 4J1YA 3VB6A 1GVLA 5JBAS 1JOUB 1S0QA 1GHAF 3RXMA 1GPZA 1ZGIA 4HFPB 1C9TA 1N1LA 4B74A 1QRWA 2ZHQH 4IMZA 7ESTE 2OINA 4UEHH 2ZCKP 4CH8B 5T6DA 2OQUA 2BDIA 2QXJA 1LPZB 2PKSC 3M3SA 1GBHA 2AH4X 2XTTB 1OKXA 2BYAX 2ZPQA 2I6QA 3BEFB 4AN7A 4Y6DA 1O30A 1GDNA 1P0SH 1GJ9B 1W0YH 1AKSA 1EPTA 1O2GH 4JMYA 4ABGA 1O0DH 1GL1A 5GXPA 1A5HA 2ILNA 4NGAH 4IMQA 5A09A 2GT7A 2PKAA 5T6GA 3NXPA 4Q80A 4WMFA 1HAHH 1AZZA 1SGTA 1PPFE 1QTFA 1EX3A 3MH7A 4Y0ZE 1O5BB 5J4SA 3MNSA 1ELGA 1Z1IA 1GMDF 1J17T 4NZLA 1QJ6B 2PWXA 4OS4A 2ZU5A 4ZHAA 1SGFG 1S82A 1C5OH 3NKKA 1TE0A 4KTCA 2EC9H 1LQEA 3RXSA 4TPIZ 3D49H 6CHAC 2DE9A 1AFQB 4DJZB 1FAKH 1ZZZA 1UCYE 4CBOA 3RMNH 1GI3A 1O2LA 1WQVH 3B23B 2NU1E 1NS3A 1A5GH 4TY6A 1DSUA 1AVXA 2ZG0H 3T5FH 2ESTE 4GSOA 3TLOA 4E06H 5DP8A 2QGRA 1OSSA 2BLWA 5E0HA 1HLTH 3L33A 2QV1A 4JZ1A 2ZP0H 4Y76A 4B2AA 2OC8A 1HAVB 1ACBE 4CHAC 4IN2A 2BQ7B 1B7XB 1QB9A 1T31A 2PHBA 4B75A 1DY9A 4U32A 1OX1A 2BVSH 2RDLA 4A7IB 2NU0E 1O2WA 1SFQB 1D3TB 2GVFA 1ZSKA 2ZFQH 1BCUH 2F9NA 3PTBA 1P2NA 2YOLA 3ZZ3A 1O2NA 1P3EA 2VNTA 1RTFB 3QWCH 3BTGE 4AFQA 1ANEA 4WXIA 2B5TB 1A0JA 1GCTB 2ZDNA 1K1PA 1EJAA 4XBDA 2WUCA 1P2QA 4GLYA 1W8BH 2ALPA 3S9BA 3M5LA 4THNH 3TNTA 3BTTE 2BX4A 5GCHG 4ABFA 4NSYA 1C5QA 4XBBA 3VB3A 3RC5A 1TBQH 1DITH 2VIOA 1FLEE 2QC2A 2B7DH 2OCVB 5DP6A 5EU8A 1K1LA 1W7GH 3RXQA 1F92A 1MUEB 1P2IA 1C5MD 2R0KA 3SHAH 1NRNH 1O2UA 2UWPA 4GVUA 4YOGA 4E05H 2ZFFH 2KAIB 2Z9IA 4PROA 3GDVA 1BRBE 2XBWA 2SGPE 1AQ7A 1G3EA 2ZDVH 1Y5UT 1O5FH 3GYLB 3L3TA 2BTCE 1YF4A 4X8VH 1EJMA 3GISB 2C8XB 4IW4E 4X1RU 5ABWA 3KHVA 1TGSZ 1PPZA 3RXVA 2A5KA 1G3DA 4AGJA 2FLBH 2BOHB 1J14A 2RA3A 3BG8A 2FOEA 2XNIA 1ETTH 3TH4H 4CRBA 1THPB 5C1YA 3PLPA 3P8FA 3SUEA 2ULLA 4WMDA 2OC7A 2XYAA 3RXCA 3ZV8A 1AE8H 1XM1A 1H8DH 3BIUH 3HKJB 1EAWA 5LPRA 1A4WH 2JH0D 2FODA 2FMJA 1Y8TA 4NSVA 4B2CA 1SGEE 1YCPH 1QY6A 4JYUH 3A8BA 1KXEA 2A1DB 2RG3A 3M5NA 5AFYH 2J94A 3RC6A 1BTHH 1L1JA 1E36B 3HK3B 4CR5A 2I6SA 2ZFTA 2ZDMA 1WBGB 1HAPH 1ABJH 3UNQA 3UWJH 1IQFA 5EOKA 1IHSH 1O2JA 2ZDKA 4FU9A 3UQVA 2GTBA 1SOZA 3GY5A 1FNIA 3A81A 2F9PA 1V2TT 1GGDC 1ELEE 3QZQA 3A7TA 3AASA 1IQNA 3OSYA 2P94A 3QO6A 1ESAA 5ESBA 2H6MA 5HXFA 1AB9C 1TA6A 3M37A 2WYJA 2HNTC 2O8UA 3FP8E 3SQHE 4BAHB 3U1IB 1P2MA 2W3KA 4BANB 1CHGA 1O2RA 1TYNA 3HATH 4RN6A 3U69H 4BTTB 5AVDA 2Y81A 1V2ST 5DP5A 1TGTA 1QRXA 4WJG2 4NFFA 5FPSA 1AI8H 1C2EA 5FBIA 1TQ0B 3L6PA 3RMLH 4BOHA 1PQAA 4GPGA 3PB1E 1G9IE 1AVWA 1D6WA 1CSOE 1GHVH 3UR9A 4FVBA 2WINI 3JZ1B 1GVKB 1DANH 3ZVBA 1TRNA 1TOCB 4CRCA 2PW8H 5GIBA 1JMOH 1DOJA 1YPHC 3O8DA 4ABJA 8GCHF 5ESTE 1G2LA 2ZDLA 5DKMA 5EXLA 1C2HA 1ZTJA 3P17H 3TH2H 3SU3A 3RXJA 3LPRA 4Y7BA 1ELTA 3MI4A 1HAIH 5FX5A 1CA8B 1Q2WA 1A61H 2ZHEH 1BBRH 1ORFA 3ZZ7A 4B2BA 2ZQ2A 1UTKA 2W26A 3UOPA 2JKHA 1KDQA 1OXGA 1Y5BT 3A89A 4KTUA 5FX6A 1MCVA 2O8LA 2OP9A 2GMTC 2PSXA 4X6NA 2ZHDA 5H4IB 5GCHF 1K9OE 4NIVA 2CF9H 3SBKA 2PSYA 3DFJA 3GY4A 1OWDA 1GJBB 1SQOA 2VU8E 4BTIB 1KXDA 3PWBA 3O8CA 2FOFA 2Y6TA 4GUXA 1XUHA 5CE1A 6CHAB 2GZ7A 2FO9A 1QJ1B 4XE4A 2AMDA 4X6PA 5AHGH 1XUKA 3RM2H 3QGNB 2UWOA 2SGFE 2B9LA 1ZHMA 1C5WB 1ZYOA 4NA7A 4Y71A 1DSTA 3VXFH 2GDDA 1EPTC 1DICA 3ZZ9A 4NIYA 1GBMA 2GT8A 3SUGA 2W7SA 3BTME 1W12U 1FY4A 2GZ8A 4FUGA 1AMHA 1MQ6A 1SR5C 2BDBA 4D7GA 3CENA 1NPMA 1PYTD 1ZHRA 4ABBA 2W7UA 1UTNA 1TNGA 3F9HA 4BNRA 1DWCH 2XXLA 1LHGH 4GCHG 5EW1H 4D7FA 1O3IA 3SUDA 1GI9B 1RIWC 1U6QA 1ANDA 1SSXA 5DP9A 4MPWA 1WSSH 5EQSA 1EXFA 1V2LT 1KLJH 2CXVA 2Q6GA 1LMWB 3V12A 3SN8A 3DT0H 1O2TA 3IG6B 1O38A 4UDWH 2TBSA 1BTUA 1BRUP 1GBDA 1UO6A 1SC8U 4IN1A 2UUJB 4ISOA 3UNRA 1TGNA 3NK8A 6GCHG 3E91A 4NG9H 1O5EH 1OWKA 4INLA 4INKA 1O3LA 3E0NB 2J34A 4QT8C 1QIXB 2P16A 4X0WU 1Z7KA 4DURA 1C1PA 1ZPCA 3BG4B 3SGAE 4UFGH 1TQ7B 2Q1JA 2Z9LA 4Y79A 4DCDA 3SI4H 1G30B 1O2VA 4Y7AA 2HNTF 1SI5H 2BD3A 4MPVA 1XUIA 5CMXH 4MLFB 1O32A 2FLRH 2FP7B 1C1WH 2FOMB 3EQ0H 5T6FA 2Y80A 1DLKB 4RSPA 2ANYA 4ZUHA 3O8BA 2A0QB 5L2YH 1GJ5H 1LCYA 2M5TA 1H4WA 2ZGJA 1T4UH 3FVFB 3TK6A 1V2KT 1ZPZA 4GHQA 4AOQA 2FX4A 4OS7A 2QXGA 4LXBH 1LTOA 3FANA 1ESTA 1ZGVA 2WPKS 1NM6A 3U98H 1V2VT 1P12E 1NU9A 1L2EA 2B8OH 1YC0A 1BUIA 1HXEH 1PFXC 1Y3WA 3M7TA 3R0FA 3M7UA 1VITH 1AUTC 3SO3A 3TU7H 2HNTE 2BOKA 1BTPA 5GDSH 4Y8XA 3RXPA 3FAOA 3ENSB 3PM3A 3M5MA 1GBCA 1O3KA 4WVPE 5JBCS 2H1UA 4A6LA 1TNJA 5A8XA 1VJAU 1WU1A 2ODPA 1JRSA 2A7JA 1QBNA 2AIQA 3RMOH 1ZSLA 1S5SA 2QIQA 2Y7ZA 6ESTA 1MAXA 2GGVB 2GCTB 2GDEH 4A1XA 2ZKSA 1C1RA 1JBUH 1QCPA 3MU1A 3ZV9A 1C5VA 4JYTA 1TPPA 1T8OA 1NY22 4MDSA 4I8LA 3E90B 3ZVAA 1E35B 1GBTA 1Y3XA 2ANWA 3MOCA 4ISNA 4U2WA 1QQUA 1HAGE 3NUMA 1BMMH 1C4V2 1YPHE 1MAYA 3K6ZA 2ZFRH 4ZKRU 1A46H 1D3PB 1CGJE 2TGPZ 5EODA 3RC4A 2HVXA 2G55A 1GBEA 2W3IA 5F8ZA 3UTUH 1AB9B 1DFPA 3VFEA 2FIRH 3LJJA 1T4VH 2SFAA 1L1NA 1W13U 2ZPRA 2P95A 1GI7B 1KXBA 2P8OC 4MTBA 4X8SH 4E7RG 4ZHMU 3A8DA 1GBKA 3BN9A 4Q7YA 4TWWA 5C1UA 3MTYA 2ZA5A 3UFAA 1Q3XA 3P95A 3NPSA 1JXPA 3ATMA 5FPYA 1W2KH 3VXEH 2AGEX 1HXFH 2STBE 1DWEH 1HIAA 1V2UT 2BLVA 1FAXA 1LVOA 3K6YA 2A4QA 1TMUH 2A31A 3T25A 5I46H 1ZJDA 3LOXA 2YNBA 3PTNA 1EQ9A 1SGYE 2QA9E 4U30A 2FOAA 1RJXB 3S69A 2ZTZA 2ZTYA 5DP7A 5CHAC 3T26A 3M3TA 1UTPA 3GYMA 1GG6B 1O3AA 4JZIA 4XOJA 2F9OA 1D6RA 1WAYB 2BDYA 2JETB 6GCHF