1O2PA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
molecule tags Hydrolase
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2pA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2pA02
3RC5A 1EATA 5EXNA 5C20A 2GV6A 3SU5A 3RM0H 3VFEA 1K1LA 2XBXA 2Z6BD 2BTCE 4LZ4B 1EAIA 1RJXB 1V2NT 1AY6H 2M5TA 1CGIE 3ATWA 4I8LA 1V2LT 3K9XB 1HBTH 1UVOA 1VCQA 5LH8A 1GI9B 4XBDA 1UVPA 1C5SA 5IDKA 3RXDA 3MOCA 1X7AC 1VJAU 1A61H 1NFXA 2G4TA 1BMNH 3D65E 2VIWA 1K1OA 3RP2A 1HPGA 1A3BH 2W26A 4AFZA 1Z1IA 2BD5A 1ESTA 2P59A 1YPLH 3TH4H 2GX4A 3QDZB 4JK5A 5EW2H 4UONA 1HAVA 2O8TA 3MU0A 4I8HA 5A0BA 1F0TA 3GCTG 2H9HA 2BY8X 1TA2A 1O2OA 1MTWA 2Y7XA 3KQEA 4ZKSU 2ZPRA 1SGRE 1C5NH 1WQSA 3QK1A 1V2KT 4F49A 1UMAH 2YOLA 1AO5A 5FAHA 2FO9A 2FOEA 3QZQA 1ZMNA 4JYUH 2A0QB 1LPZB 4XBCA 3VXEH 1GHBF 5C5OA 5GIBA 3A86A 4HFPB 1T8OA 5TCCA 4O3UA 1PPCE 1SHYA 2STBE 1QR3E 2A31A 1WBGB 2FYQA 4XFQA 3BIUH 1MCTA 3HGNA 3GY4A 4BTTB 1D3TB 4O9VA 1CBWB 1CBWC 1K1PA 1KXBA 2H2ZA 1C2EA 1IQFA 4WH6A 3SBKA 1DANH 1BCUH 1ESAA 3PWCA 3GYMA 3BF6H 4K5ZA 1F2SE 1GDNA 2TGTA 2GCHF 3ATLA 3SUFA 1SOTA 4RKOB 2QA9E 1FAXA 3SV8A 1GVZA 2VU8E 3BTEE 2R0LA 3UIRA 3A7ZA 1TOCB 3DT0H 1O30A 1BT7A 1D3PB 5G4BA 2P93A 4B76A 6GCHF 2XBVA 3NCLA 1GG6B 1A0LA 1GG6C 2TGDA 3A85A 3RU4E 1UCYH 3ENSB 3HPTB 1C1WH 4ZH8A 3ZZAA 1C1NA 1V2JT 4AX9H 3Q76A 1S81A 1KXCA 2WPMS 2ZFSA 2V3OH 1SGYE 1BTHH 3KN2A 1TABE 2BY9X 3I29A 1O39A 2QXJA 3S9AA 3ZZBA 3S0NA 1BQYA 4MNXA 1NFYA 1QHRB 2RG3A 3BEUA 3GCOA 1QJ7B 2OC8A 1ZYOA 3UWIA 1QBOA 1JRTA 5T6DA 4NA7A 1O3JA 4XOJA 2WUCA 2ZFFH 3EDXB 1FDPA 4LK4A 1E35B 1ZLRA 2ZDLA 4Y79A 1SFQB 4KTSA 1AFEH 1EPTB 1ABJH 1EPTC 2C8YB 5GWZA 4FUFA 4INHA 4D9RA 2Z9JA 4MNYA 3B9FH 2J2UA 1ZSJA 2HNTF 1UCYE 1YC0A 3A84A 3ZV9A 3A83A 1GMDF 1TGSZ 3UREA 1AVXA 1BTXA 1G2LA 3UWJH 4A1TA 2PTNA 1GBIA 2DE8A 3T5FH 1MU6B 1IHTH 5TCAA 2SFAA 2G5NA 2BD9A 1O2NA 3U9AH 1H9HE 4YOJA 3FZDA 3K6YA 1ETRH 5JBCS 1Q31A 4ZHLU 4KELA 1C2IA 2ZECA 4Z6AH 4B2CA 2ZNKH 1AU8A 2VIDA 2UUKB 3RXJA 4Y8ZA 1GGDB 1Y59T 2GZ7A 3I77A 1GGDC 5GPIB 5AFZH 4GHQA 4TPYA 3PLKA 2RA3A 2QXHA 2WUBA 4X1QU 1TNHA 3LC3A 3AVZA 5E0GA 1JRSA 2VNTA 3Q3XA 2BQ6B 4AYYB 1LQEA 1W7XH 1BMMH 1YPMH 2Y81A 3BSQA 1QJ6B 3SZNA 1B7XB 4TYDA 3R3GB 3ZYDA 3TIUA 2CXVA 1GBJA 1K1MA 1L0ZA 1ZTJA 4B71A 3SNAA 1YPGH 2FTLE 8LPRA 1O3OA 3LGWA 3V3MA 2CJIA 2BDAA 1ZHMA 1GJ7B 1A5IA 1MTVA 1WYKA 4I8JA 1ABIH 2V6NA 4GSOA 3RXBA 5A0CA 1P9SA 2GGVB 5E2PA 1O32A 3C27B 1ZPBA 3BEFB 4ABGA 1DWBH 1IQGA 2FM2A 1INCA 1OXGA 1RTFB 1T8LA 1C5MD 4WMFA 1NRRH 1AMHA 1MKXK 4DGJA 2GP9B 4WVPE 1E37B 2ANYA 5GJ4B 4Q7XA 2J9NA 1Z6JH 2VWNA 2WPKS 2ZHDA 2GKVE 1DM4B 4NWLA 2R9PA 5ABWA 1TGBA 3SJ8A 2ZU5A 2XRCA 4X1NU 2AGEX 1ANBA 3EE0B 4Y6DA 3FVFB 1EJNA 4FVBA 1LO6A 3WY8A 1P2MA 1TX6A 1JXPA 4MDSA 3GCNA 1PPFE 3SW2B 2F83A 2R3UA 1PYTC 2PUXB 1YPHE 4Y7AA 3LIWA 1RTLA 1GHBG 3Q77A 2BZ6H 5EQQA 1ORFA 3RXQA 1J8AA 1SQOA 1UVTH 1GBEA 3RC6A 1V2MT 1GI1A 1Z8RA 1O2WA 2Z3CA 4A5TS 4MQAA 1Z71A 2ZU1A 4XDEA 2C93B 2CMYA 1FY8E 1LHDH 1OWDA 2GMTB 1TFXA 2BD3A 1IQIA 1EJAA 1C5QA 2BZAA 1OKXA 2GZ8A 1J16A 4Y8XA 4BNRA 3SJIA 5JPMH 4K2YA 1HAIH 1MZAA 1A7SA 3F9FA 5HM9A 5C3NA 1C2KA 3NWUA 1TQ7B 2GCHG 3IITA 3U69H 2A4OA 1C1QA 1EB2A 2A1DB 2ZFPH 1L1JA 2J92A 1ACBE 1GBLA 1TQ0B 3ZVAA 3K6ZA 1SC8U 2VWLA 3VEQB 2VWMA 5HYOA 2VJ1A 1TRYA 2PWXA 3UQOA 2OP9A 6GCHG 4A1VA 1HAVB 3URDA 5C1UA 3RC4A 3LGUA 3RMOH 4GCHF 3SQEE 4E7NA 1YPEH 1T31A 3QLPH 1HNEE 2HOBA 1DS2E 3QN7A 4AZ2B 1HIAA 3RXPA 3M7UA 2IN2A 3KQCA 3ATMA 3RDZA 1OWKA 2QXIA 2ZGXH 6CHAB 2PLXA 3SNCA 1A0HB 1FN8A 4KTUA 1J14A 3FP6E 1TPAE 1AN1E 3SU6A 3L33A 1SFIA 3TGJE 1SI5H 1EZQA 1N6XA 3KNXA 3QGJA 3SNBA 1NESE 3GY8A 4YT6H 1C2DA 3A81A 3HK3B 1ELAA 4B74A 1QY6A 3M7TA 1U6QA 5EODA 1V2RT 1O2ZA 3TJOA 3RU4T 4BAOB 1B5GH 3ZZ6A 2RDLA 1C2FA 4B73A 2ZDKA 1P10A 1OWIA 2WINI 2ZHQH 3E0PB 3EAJA 4INLA 5A2MH 1HB0B 2WPJS 3GISB 4DT7B 1GMDG 3VB4A 1Y3YA 4B1TA 4I8GA 3EA7A 5DG6A 1TBZH 3DFLA 5F03A 4Q2KA 1S6FA 1W14U 3MI4A 1VITG 1N6YA 3KHVA 4ABBA 2OXSA 2NWNA 4I31A 3NXPA 1QRWA 2D2DA 1W11U 5FBIA 4I32A 1O3HA 1WU1A 3LGVA 2PSXA 1NRPH 1L4DA 1FY1A 3NK8A 5TJXA 5E8EH 3GY3A 2NU3E 1LVMA 3RXAA 2LNCA 4NGAH 2R2WU 3B8JA 1KTSB 1LCYA 2I6SA 4UFDH 1O37A 3QTOH 2ANKH 4Q7YA 1EPTA 3PM3A 1OP0A 1MKXH 4K60A 3UR9A 5JBBS 1CGJE 1GI4A 2PW8H 1ELCA 1DWDH 1Y5AT 3QTVH 1GBDA 4BXWA 1P3EA 1MZDA 3OU0A 2FS9A 4WY3A 5AF9H 2TGPZ 1C5ZB 2HVXA 3K65B 3FP7E 3SGAE 1SGIB 1WAYB 3DFJA 3T25A 1OPHB 1TRMA 2BXUH 2UWOA 3EQ0H 2XBYA 2FOGA 1Y3UA 3SGBE 1MD8A 4DJZB 4CRBA 1O3DA 3MNXA 2AMPA 3A88A 5J4QA 1EKBB 1QIXB 2ZGCA 4ABIA 5C5NA 1PQ5A 4FUIA 3D62A 3KL6A 1AE8H 4JYVH 4AFQA 2WYGA 5HMAA 2QF3A 3EGKH 1CQQA 4H4FA 2A7JA 1KLJH 1AI8H 1O3NA 4X6PA 5FHTA 4JZDH 2GVFA 2AFQB 1HJAB 4TWYA 2ZO3H 1HJAC 1OWHA 3BTGE 3E0NB 1C2GA 4NZLA 2G81E 1RFNA 4J1YA 1O33A 1LMWB 4IS5A 3RMLH 3U1IB 2FTMA 4O3TA 1A46H 2Q6GA 3SNDA 2BM2A 2F9UA 1ZTKA 2W7SA 1NRNH 1GMCF 1C5TA 3A7TA 4FXGH 3TNTA 1MAXA 1C1VH 1K1JA 1BITA 4ZHAA 3O8DA 2XW9A 1QNJA 5GCHF 5FCRA 2BYAX 3M3SA 3SI3H 7GCHF 3M5MA 2ZI2H 2J4IA 3SUEA 1EOLA 3MH5A 3CS7A 2G4UA 1SGFA 4NZQA 4DG4A 1UTPA 2QIQA 2GV7A 4MPXA 1E36B 2A7CA 1ZHRA 2PKAB 2O9QA 4X8SH 2B5TB 4E05H 2OC0A 3D49H 3PYHA 1P11E 3Q3KA 1V2VT 4LOYH 4WXIA 3E90B 1E0FD 1Y8TA 1NS3A 4BOHA 4AB9A 1GJ4H 3GDUA 3KF2A 1V2TT 1SQTA 2GTBA 5E0HA 3SN8A 2VH6A 3LU9B 4GUXA 4BXSA 1PPBH 3Q00A 1KLIH 1CGHA 4BANB 5K7RA 4DIIH 3AASA 5BPEA 1TX8A 2PGBB 1GI0A 1G3EA 1GHYH 1Z8GA 2J34A 3NZIA 3N7OA 3K2UA 2Y5FA 3MU1A 1C5UA 1GJCB 1ELBA 4GAWA 3LDXH 1PYTD 2VIVA 2XTTB 1WQVH 3PLBA 5A09A 2BLWA 3E1XB 4H6TA 4UD9H 2HNTC 1PPGE 4CRDA 3P8NA 1LHFH 2AGIX 4UFFH 1TGTA 5JB8S 2LPRA 2ODPA 1DPOA 2F91A 4O03A 2EI8A 3ZZ7A 1TNIA 3A89A 1S6HA 2VWOA 3E6PH 1NZQH 1T4UH 2GDEH 2RA0A 2R2MB 2DE9A 1IQEA 5EQSA 5HXFA 1KSNA 1ZSLA 4X2WA 1CE5A 2VH0A 3TPIZ 3UNRA 3IG6B 1GHVH 1O3MA 3LJOA 4YOIA 1UTQA 2ZA5A 4CHAB 1HAXB 1O2TA 1SGNE 4CHAC 4MNWA 5ETXA 1O3IA 3M7QA 5BRRE 1OX1A 1SGFG 3LT3A 3M61U 2FI4E 3OY5U 1C2JA 1HAOH 3SGQE 2ZG0H 4OS4A 2XC5A 4MPVA 5T3HA 4Y0YE 3ODFA 1HIAB 5FCKA 1NPMA 1FAKH 4B2BA 1XKBC 3HKIB 1ELGA 2ZFQH 1AZ8A 1TLDA 1NO9H 4HI3A 3RXKA 3MO9A 4CBOA 1OSSA 1KXEA 1A0JA 3STIA 3F6UH 2UWLA 1QL9A 2WV5A 4H42U 1K2I1 2ZU4A 1L2EA 4B75A 3A8BA 1ETTH 1THSH 2QCYA 5FPSA 1O2HA 1SOZA 7KMEH 3ZV8A 4TY6A 1BHXF 4R0IA 2F9VA 1NRSH 1PQAA 1GHWH 1UTOA 1C5VA 4JZEH 4YZUA 1GVKB 4GLYA 2HALA 9ESTA 2OQUA 4ASHA 3DHKH 4UE7H 5DP4A 4YOGA 2QYIA 4IMZA 1EUFA 1PPEE 2WPIS 1V6DA 3QGNB 1EP6A 1O5BB 1UVUH 1TB6H 1YBWA 3LC5A 1IQLA 2XC4A 4FUCA 2ZFRH 1QB9A 1ZOMA 1SGPE 1A3EH 2Y5GA 3LGTA 3RXUA 5JBTA 1LVOA 1HAPH 3E91A 2BY5X 1C2HA 1DWEH 1TMBH 4IN1A 3MNBA 1C1SA 1FV9A 5DP3A 1LKAA 3BTTE 1EZUC 1QA0A 1C5PA 2BDGA 1F5LA 2F9BH 4U01A 3PWBA 3TJNA 4U30A 3SOSA 1P8VC 1GI2A 1KLTA 3MO6A 5AHGH 1THPB 3JZ1B 2UUYA 2SGAA 2ZU3A 3SV2H 3TH3H 3RXMA 1SGCA 1Z8JB 5F6MA 1ZPCA 3W95A 2Z3DA 2G8TA 1V2WT 2GZ9A 2A5AA 4FUEA 3SU3A 1GJ5H 1NRQH 4FUDA 2OD3B 3BTWE 2PHBA 1P05A 1LDTT 1P04A 1C5WB 3KQBA 1GMCG 4BTIB 1QB6A 3SI4H 1GI8B 3GY7A 1C9PA 1H8DH 3ZZ9A 4JMYA 5GCHG 1HFDA 2XBWA 2FZZA 1C9TA 1EXFA 1OWJA 1BTYA 3QX5H 4D76A 2H5DA 7GCHG 2R3YA 3H7TA 5GXPA 5J4SA 1W0YH 3I78A 1YYY1 2THFB 3H5CB 1TRNA 1NN6A 4Y8YA 3VB6A 3NUMA 1GJ9B 1P03A 3PMJA 1E38B 1AWHB 4ISLA 4KP0A 1XX9A 3TJVA 5FPTA 1AZZA 5DO4H 5I25A 5CHAB 2BLOA 3F68H 5CHAC 5DKMA 5LPRA 4WMDA 1FXYA 4CRAA 3M3TA 4ZKOU 4HZHA 1G30B 1S5SA 1XVOA 4I7YH 2A7HA 1AFQB 1J15A 1AFQC 1JWTA 2HPQH 4NCYA 3ZVCA 1HYLA 1FIZA 1WUNH 1HAYB 3LJJA 1W3CA 2ZFTA 2VIOA 1YKTA 3Q3YA 4AGJA 1P06A 4KKDA 2C8WB 1GJAB 1F0SA 3ZZ4A 2QN5T 2FOCA 2CHAB 4WMEA 1NTPA 2CHAC 1UHBA 1ELVA 2A2QH 1W13U 3RXLA 2BX3A 1G37A 3ZZ8A 1C1PA 1F5RA 4ZUHA 2EA3A 1O3GA 1IQKA 2ZQ1A 1IQMA 4XE4A 3SJOA 1YLDA 5FXLA 5DK1A 1G2MA 1WSSH 2ZTXA 2F9PA 1HXEH 1BDAA 2PR3A 1QL7A 2ZWLH 2ZHFH 3A8CA 2PKAA 2Y6TA 1T8MA 1PFXC 1JOUB 1QQ4A 1CHGA 4YM9A 2FYRA 2BQ7B 2EI7A 1XVMA 4MPWA 4YLQH 1O35A 2H1UA 4OS5A 4K1EA 1AKSA 1DITH 4DY7B 3TGIE 1AUTC 1FNIA 5AFYH 2HGTH 1WV7H 5DJ7A 4K1TA 1Y5BT 3MFJA 3S7KB 4UDWH 1GPZA 3M5NA 1QFKH 3VXFH 2FLRH 1BTZA 1NC6A 1P3CA 2ZTYA 3LKWA 3L3TA 1YCPK 3B23B 2WV4A 4YLUA 1N1LA 3ATIA 1EOJA 4OS6A 4YTAA 1TYNA 2VVVA 4WH8A 4QT8C 2J95A 3S69A 1BBRK 4PROA 1SGTA 4IGDA 3SJ9A 4IW4E 2TGAA 3LGYA 1P9UA 4O97A 4ABEA 1C5XB 3UOUA 5A0AE 3PTNA 1NU9A 1TMTH 2V0BA 1CT0E 2STAE 2JKHA 2XWBI 1F0RA 2C8XB 1LVBA 1O2SA 1HAGE 1BTWA 3SU1A 2Y7ZA 1Y3VA 3HKJB 3LH3A 1DDJA 1TOMH 3ITIA 4INKA 1KY9A 1B0FA 1UJ1A 1BB0B 3M36A 1KTTB 1MH0A 1KXDA 1CT4E 1ZGIA 1KDQA 1MU8B 4U32A 3MHWU 1SLXB 1O5GH 5EXMA 2H6MA 3P92A 3EA9A 5DGJA 2O8MA 1G9IE 1QRZA 1N8OC 1O2GH 1AQ7A 2OC7A 4X1SU 1VITH 1RIWB 1MKWK 1RIWC 3A8DA 1DX5M 3U8TH 2QY0B 3BTFE 1IQJA 1BMAA 1O2JA 1ZSKA 1W12U 1O38A 4IMQA 2ESTE 1RXPA 1J17T 2FWWA 2EC9H 2PFEA 5K0HA 2A45B 2B7DH 3G01A 3RLYH 2RCEA 5L2YH 2P16A 1XM1A 2BVSH 2UUFB 4ABFA 2O8WA 2BD4A 3SV9A 2ALVA 1P2OA 4FUGA 3RXCA 3CENA 1S85A 1O2UA 4ISHH 3BN9A 5JYIA 4TWWA 1PJPA 1TAWA 2XWAA 1SVPA 5C1YA 1ID5H 2WYJA 4NFEA 3A7YA 2ZGJA 1MAYA 4NA9H 4X1PU 2KAIA 1BRUP 2ZC9H 1K22H 1KXFA 2ZIQH 4DW2U 2AERH 3O8CA 1P57B 1SR5C 1PQ8A 1T8NA 1ARBA 2PV9B 1GJ6A 1XUJA 1LTOA 1Y3XA 1TNKA 1S84A 3P17H 3ZZDA 1C5YB 1NROH 2ALPA 1AB9B 1AB9C 4OGYA 3V13A 1AGJA 5SGAE 4XSKU 3PO1B 4ZMAH 3PO1C 4NSVA 4ZROA 4Y10E 3T26A 4BTUB 3GCTF 3OX7U 1RRKA 2ZZUH 2G55A 1JIMA 1GJBB 3AAVA 3GY2A 3DD2H 3E8LA 2PTCE 3VB7A 3V0XA 3JZ2B 4FUHA 4D7FA 1SMFE 2XYAA 1EB1H 1GDUA 1NFWA 1P2QA 1RS0A 1AWFH 2C8ZB 1QCPA 3PV4A 2BDYA 2OBOA 2XXLA 3M3VA 3TGKE 3S9BA 1HAZB 4K1SA 3U8RH 2BB4A 3ESTA 3RXGA 2VVCA 1HGTH 4Z0KA 2ZEBA 1GI6A 5JB9S 2XCNA 3RXOA 4DCDA 1BTPA 1C1TA 1NU7B 1O3KA 2AH4X 2ZGBH 5DP5A 2Y82A 1XXFA 3AW0A 1IQNA 3ZZ3A 2IOTA 3OSYA 1DY8A 3UNSA 1YCPH 1GVLA 1DFPA 5EOKA 1ETSH 1IQHA 1SGDE 2CN0H 1TWXB 2FX6A 1MD7A 2AIPA 1C4U2 4X6NA 2HRVA 3A80A 1TGNA 4ZAEA 1WTGH 1BBRH 4CREA 5L30H 1O3BA 2JH6D 1UK4A 4JK6A 2FOFA 1QURH 1CVWH 4DOQA 1TE0A 1O2PA 2ZDNA 5L6NH 1O2MA 2ILNA 1AHTH 2ZDVH 1HRTH 1P2KA 3BV9B 9LPRA 1BOQA 1YPHC 3T29A 3HGPA 1YM0A 3OY6U 3BTQE 1C1OA 2HLCA 1TNJA 2JETB 2XCFA 1ELFA 2JETC 3A7XA 2AGGX 1C5OH 2C90B 2XNIA 2Z9KA 1GBTA 3SQHE 1BHXB 3SU4A 1V2ST 4NIVA 4DVAU 3FANA 1CHOF 1KXAA 2FI3E 1UHBB 2VIPA 1MQ6A 1ZMJA 1FY4A 4U2WA 2FOMB 1Y3WA 2Z9LA 4FU9A 3TJUA 3BG4B 3BG4C 4J2YB 2SGDE 1ZGVA 3MH4A 4JCNA 3V12A 5B6OA 1MKWH 1OP8A 1BBRE 4ISOA 2G51A 3A87A 1DSUA 1TMUH 1A4WH 1WCZA 1QJ1B 1G3DA 2R0KA 2WPLS 5DP6A 2P95A 2FESH 4NIWA 2ANMH 4LXBH 4OGXA 4AN7A 1E34B 5HGGA 3ZVBA 1GWAA 4CH8B 2V3HH 1ZR0A 2G00A 3GYLB 4GCHG 5F8XA 3SUGA 1MMJN 1AKSB 3UNQA 1O5DH 1VGCC 2FODA 5DP9A 4ABJA 1T7CA 2ASUB 5F8TA 2OTVA 4GPGA 2Q6FA 4H6SB 2BMGB 1AVGH 1NFUA 2ZPSA 3T28A 1F7ZA 1QBNA 1GHZA 2IPHA 1XUKA 4NWKA 4BAMB 1FI8A 3GOVB 2QXGA 1SQAA 2Y5HA 1HV7A 1FPCH 3A8AA 3TNSA 2B8OH 2FMJA 3GY6A 1YP9A 2A32A 2ODQA 4RN6A 1TALA 2BY6X 1M9UA 2ZQ2A 3URCA 1OYTH 4BAHB 1GBBA 3S9CA 7LPRA 2TBSA 4SGAE 5EG4A 4ESTE 1XUIA 3LGIA 4CRFA 4THNH 3TH2H 1TONA 2ZU2A 1FPHH 1LHGH 4X6OA 1GHAF 1HCGA 3U8OH 1A1RA 2F9NA 1Z8IB 3P8OA 1D3QB 3TK9A 1QB1A 1F5KU 5JBAS 3P8GA 1IOEA 4M7GA 3M37A 4D7GA 1QGFA 1D6RA 2CF8H 1MBMA 3EA8A 1NM6A 1GCTB 1YF4A 1GCTC 1K1NA 5GDSH 1H9IE 1HJ9A 1SHHB 2FP7B 1V3XA 2ZCKP 4JYTA 5EPYA 5CMXH 1KDQB 1YCPM 2K1QA 1CT2E 2BQWB 5C1XA 3ATKA 2Z94A 2VINA 3DA9B 3T27A 1ANDA 1XXDA 3MTYA 3F1SB 1AE5A 3BIVH 4K8BA 3M5LA 2BD2A 2JH5D 3SHCH 1SGEE 1C1UH 1O34A 2BDCA 1SB1H 4FUJA 3RU4D 3BTDE 4SGBE 2D8WA 2Q6DA 2VB0A 1TBRH 1GBMA 5FX5A 1FIWA 2SGFE 2FOHA 3P8FA 1UVSH 1MTUA 3LOXA 2HPPH 4FVDA 3AAUA 4WF8A 1TA6A 2C3SA 3TITA 2SNVA 3VGCB 3VGCC 1THRH 2BXTH 1ZMLA 2ZP0H 1UK2A 3S7HB 4I8KA 1VR1H 3RXTA 2EEKA 4XBBA 1C5LH 1QBVH 2BVRH 1ZHPA 2HWLB 1LHEH 2Y80A 3BG8A 4ZXXH 5EU8A 2AMDA 3P70B 2ULLA 3TK5A 2Q1JA 1K21H 2BD8A 3RXIA 4HGCA 2KAIB 2BX4A 2ZCHP 5E2OA 1WTHD 2UUJB 3D23A 3QO6A 5ESBA 3EYDA 1GHXH 1TPOA 1LPGB 1Z6EA 1EAWA 1O2RA 4UFEH 1DSTA 1FUJA 2W3KA 1T32A 2FLBH 3UR6A 3C1KA 3SV6A 2F9OA 1AUJA 3KQDA 1DT2A 3BTKE 1O0DH 3BTHE 1QA7A 2OC1A 3DUXH 1D3DB 1K28D 1IHSH 1C2LA 1C4Y2 1J9CH 1EAUA 2ZPQA 1SPJA 1SG8B 4CR9A 1L4ZA 3SV7A 1P02A 1ELEE 2BDIA 1UTLM 4R8TB 4YESB 1KIGH 1MQ5A 1RTKA 3HK6B 4JZIA 5T6GA 1GBCA 5FX6A 1ZRBA 2G5VA 3W94A 4AORA 1QQUA 5LGOA 2FPZA 1TNGA 2G52A 4AFSA 2OUAA 3RM2H 1GI3A 3F9EA 4A6LA 1CHOG 1A5HA 3LONA 1AIXH 1LQDB 1YPKH 3PMBB 3VB3A 2Z9IA 4OS2A 1ELTA 1JMOH 4NIYA 4AG1A 1G36A 1GBKA 4X2VA 2EI6A 1SSXA 3T2NA 2AYWA 4TPIZ 1TNLA 3CS0A 1W7GH 2V35A 2O8UA 1OYQA 1OWEA 2H9TH 1HUTH 1AVWA 5DP8A 2AEIH 1HLTH 2D1JA 2A4QA 2ANWA 3MYWA 1EX3A 2AIQA 1Z7KA 4ABAA 4ISIH 1UTMA 4NIXA 1VITF 3PB1E 3U1JB 4K3JA 1O5EH 2D26C 4WJG2 4AYVB 4RKJB 6LPRA 3UUZA 1K1IA 1EZXC 2C4FH 1P2IA 3ZVDA 1C5RA 1DICA 4YT7H 6ESTA 1O36A 5E0JA 5EQRA 2VGCB 1O2LA 1SLUB 2VGCC 5T6FA 3FZZA 1A2CH 3RXVA 2TRMA 3FP8E 1D6WA 1XKAC 1ELDE 2FEQH 2JH0D 1TPSA 2BDBA 1ANEA 1O2XA 2QF0A 5C2ZA 3UPEA 1BUIA 1SLWB 4CRGA 1W10U 1PQ7A 2BLVA 1D9IA 5FPYA 4X6MA 4DURA 1MTNB 1MTNC 1FY5A 3KIDU 2BDHA 1GHAG 4AOQA 1C1MA 4VGCB 4VGCC 1RGQA 1SGQE 4HTCH 5A8ZA 2ZGHA 3M5OA 1FLEE 5LPEA 5HM2A 1DXPA 2ZDMA 1F92A 1B0EA 4X8TH 2OLGA 5EXLA 3RMMH 3QWCH 3VPKA 1UO6A 1H4WA 2QC2A 1SL3A 2QAAA 3BTME 3O8RA 3LH1A 1O3AA 1O5CB 3UY9A 1BRBE 1EQ9A 1DUEA 4GHTA 1EJMA 1O3LA 1O3PB 1L1GA 4X1RU 1GI5A 3RXEA 5AVDA 1V2OT 3HATH 1GBAA 1EASA 1HDTH 1W2KH 1O2KA 2CV3A 1EZSC 3SORA 2XC0A 3KCGH 2ZHEH 1C1RA 5IYTA 2FOBA 2FOAA 1LPKB 4Q7ZA 1ZJDA 3SO3A 3F9GA 2NU0E 3NKKA 3H7OA 1O5AB 1D4PB 3V7TA 1GCDA 2P3TB 4MG3A 2GDDA 1UTNA 4NA8A 2A5KA 4I33A 4CR5A 1A5GH 1TGCA 1HXFH 1P01A 2FIRH 1ZTLA 2PGQB 5ESTE 4OS1A 1VZQH 2YNBA 4OS7A 2ZDAH 4WWYA 3MNSA 2GMTC 1ESBA 1O3EA 3E3TA 4JZFH 1OP2A 1DLEA 1GI7B 4TY7A 1TBQH 4ABHA 1DOJA 2BHGA 3P6ZB 1BZXE 1SBWA 1H8IH 2PUQH 1GMHF 1Q3XA 3IWMA 3PTBA 2W5EA 1BMLA 2ZCLP 3A82A 1GJDB 1GBHA 1FN6A 2Z3EA 4LZ1H 2WPHS 2ODYB 1N8OB 2DUCA 2OINA 4D9QA 2UWPA 2FX4A 1XMNB 2CGAA 3ELAH 4UFGH 2W3IA 2B9LA 4X2XA 3SNEA 4MTBA 1K9OE 1O5FH 3QUMP 8GCHF 3PLPA 5I46H 1O2VA 1G32B 1UTJA 2OBQA 2FDAA 4ZXYH 1HJ8A 2W7UA 4A92A 5CE1A 3MNCA 2A4RA 4GVUA 1IAUA 1S83A 1P09A 7ESTE 3LPRA 3KGPA 4X2YA 1DWCH 3U98H 1JIRA 1H9LB 2ZTZA 1DY9A 6CHAC 3A7WA 1XUGA 1NY22 1DXWA 1MUEB 2HNTE 1P2NA 2BOHB 3KEEA 3FFGA 3MU4A 4Y11E 2F3CE 4Q80A 1OS8A 5F8ZA 1O2IA 1CSOE 2NU1E 1T4VH 3MH7A 2QGRA 2SGQE 1FJSA 4E7RG 3CP7A 5LPFA 1DLKB 3QZRA 1YLCA 3PROA 2H5CA 4BAKB 1XUFA 3MWIU 4KGAA 1C4V2 2J38A 3RXRA 1ZPZA 1CA0B 1CA0C 3P95A 8KME2 1Y5UT 2P8OB 1YPJH 2P8OC 3RXSA 2P3FH 3AW1A 3M35A 1TPPA 4K8YA 1VCPA 3ZZ5A 4NSYA 4FUBA 2I6QA 2ZKSA 4FU7A 1ANCA 1GL0E 4AB8A 1LKBA 1VJ9U 4X8VH 2FS8A 2ZHWH 1O3CA 1FY3A 2NU2E 1TX7A 1DE7H 1L1NA 2P3UB 3RXHA 1FONA 2A2XH 3SHAH 4MVNA 1KYNA 2TIOA 3MO3A 1BTUA 5PTPA 1H1BA 2VIQA 4MPUA 5DPAA 3GDSA 3PMAB 4Y0ZE 2VVUA 1QTFA 1BIOA 3UFAA 4MNVA 1EP5A 1O3FA 3OYPA 3ZVFA 1HAHH 3T62A 2BOKA 2GT7A 4K69A 1OOKB 1V2PT 3PMHB 2Z7FE 3RUOA 4Y76A 8ESTE 1BJVA 2Z9GA 1TIOA 3TK6A 2AS9A 3MU8A 2SGPE 3GCHB 1SLVB 3GCHC 1GDQA 1BRCE 4DIHH 3MMGA 2IJOB 3E16B 3GICB 3RXFA 4IC5A 1DVAH 1MCVA 2BD7A 2A5IA 4KTCA 4NG9H 1V2QT 3L6PA 4ZKRU 1ZZZA 3UQVA 1LVYA 4ABDA 1ARCA 1VCWA 4NFFA 3ZVEA 1PPHE 1Q2WA 2GD4B 4IN2A 5L2ZH 3F9HA 2NU4E 3TVJB 2GCTB 2GCTC 1G3CA 5EGMA 1DUAA 1QL8A 3RLWH 4IBLH 1S82A 4E06H 2QV1A 2PKSB 1P2JA 2PKSC 5FBEA 4CRCA 2PSYA 3ZZCA 1PPZA 4CBNA 4WXVA 3SJKA 4BAQB 1G3BA 5A8XA 3RMNH 5H4IB 4AGKA 2YNAA 1W8BH 1MBQA 2J94A 1EAXA 4YO9A 4A7IB 4Y7BA 1CO7E 2FXRA 2O8LA 2TPIZ 4MLFB 5EPNA 5DP7A 2GT8A 2B0FA 5JDUB 2OQ5A 1AD8H 3MU5A 1O2YA 1FQ3A 1RD3B 1GJ8B 1ZRKA 4FU8A 4UEHH 4AFUA 4AG2A 4X0WU 1WOFA 1XUHA 4IC6A 2P94A 2SGEE 3STJA 3ZYEA 1UCYK 1GBFA 4A1XA 1NT1A 1O31A 1BJUA 1BRAA 3BEIB 1LHCH 3OTJE 3SU2A 4ISNA 2AMQA 3A7VA 1MTSA 4ZKNU 3SU0A 1Z1JA 2BLQA 1S0QA 4F4OC 5C67A 1ZJKA 1V2UT 3NPSA 4RSPA 2BY7X 4CH2B 3UTUH 1FZZA 1JBUH 1BA8B 1S0RA 1F0UA 3SUDA 1GMHG 3MH6A 1UK3A 2FI5E 4Y71A 4JZ1A 3VB5A 1UTKA 4D8NA 5A8YA 2OCVB 4ZHMU 3ZVGA 3ODDA 1P12E 2A4GA 1CA8B 2BVXH 1VGCB 1GL1A 1W0ZU 4X8UH 2ZF0H 1O2QA 3O8BA 3R0FA 5EW1H 2CF9H 1YGCH 1FMGA 4B2AA 2H9EH 3GY5A 1QRXA 3TLOA 3TU7H 2SNWA 3FAOA 1C2MA 1CU1A 3GDVA 3UOPA 1P0SH 8GCHG
chains in the Genus database with same CATH superfamily
2JDID 3RC5A 1EATA 2K0QA 5EXNA 5C20A 2GV6A 3SU5A 3RM0H 3VFEA 1K1LA 2XBXA 2Z6BD 2BTCE 4LZ4B 1EAIA 1RJXB 1V2NT 1AY6H 2M5TA 1CGIE 3ATWA 4I8LA 1V2LT 3K9XB 1HBTH 1UVOA 1VCQA 5LH8A 1GI9B 4XBDA 1UVPA 1C5SA 5IDKA 3RXDA 3MOCA 1X7AC 1VJAU 1A61H 1NFXA 2G4TA 1BMNH 3D65E 2VIWA 1NBME 1K1OA 2VBCA 3RP2A 1HPGA 1A3BH 2L6OA 2W26A 4AFZA 1Z1IA 2BD5A 1ESTA 2P59A 1YPLH 3TH4H 2GX4A 3U28C 2JJ1D 3QDZB 4JK5A 5EW2H 3WW7A 4UONA 1HAVA 2O8TA 3MU0A 4I8HA 5A0BA 1F0TA 3GCTG 2H9HA 2BY8X 1TA2A 1O2OA 1MTWA 2Y7XA 3KQEA 4ZKSU 2ZPRA 1SGRE 1C5NH 1WQSA 3QK1A 1V2KT 1WDIA 4F49A 1UMAH 2YOLA 1AO5A 5FAHA 2FO9A 2FOEA 3QZQA 1ZMNA 4JYUH 2A0QB 1LPZB 4XBCA 3VXEH 1GHBF 5C5OA 5GIBA 1YWUA 3A86A 4HFPB 1T8OA 5TCCA 4O3UA 1PPCE 1SHYA 2STBE 1QR3E 2A31A 1WBGB 2FYQA 4XFQA 3BIUH 1MCTA 1W0KD 3HGNA 3GY4A 4BTTB 1D3TB 4O9VA 1CBWB 5B6LA 1CBWC 1K1PA 1KXBA 2H2ZA 1C2EA 1IQFA 4WH6A 3SBKA 1DANH 1W0JD 1BCUH 1ESAA 3PWCA 3GYMA 3BF6H 4K5ZA 1F2SE 1GDNA 2TGTA 2GCHF 3ATLA 3SUFA 1SOTA 4RKOB 2QA9E 1FAXA 3SV8A 1GVZA 2VU8E 3BTEE 2R0LA 3UIRA 3A7ZA 1TOCB 3DT0H 5DN6D 1O30A 1BT7A 1D3PB 5G4BA 2P93A 4B76A 6GCHF 2XBVA 3NCLA 1GG6B 1A0LA 1GG6C 2TGDA 3A85A 3RU4E 1UCYH 3ENSB 3HPTB 1C1WH 4ZH8A 3ZZAA 1C1NA 1V2JT 4AX9H 3Q76A 1S81A 1KXCA 2WPMS 2ZFSA 2V3OH 1SGYE 1BTHH 1E79D 3KN2A 3PRBA 1TABE 2BY9X 3I29A 1O39A 2QXJA 3S9AA 3ZZBA 3S0NA 1BQYA 4MNXA 1NFYA 1QHRB 2RG3A 3BEUA 3GCOA 1QJ7B 2OC8A 1ZYOA 3UWIA 1QBOA 1JRTA 5T6DA 4NA7A 1O3JA 4XOJA 2WUCA 2ZFFH 3EDXB 5GNDA 1FDPA 4LK4A 1E35B 3FO8D 1ZLRA 2ZDLA 4Y79A 1SFQB 4KTSA 1AFEH 1EPTB 1ABJH 1EPTC 2C8YB 5CDFE 5GWZA 4FUFA 2CK3D 4INHA 4D9RA 2Z9JA 4MNYA 3B9FH 2J2UA 1ZSJA 2HNTF 1UCYE 1YC0A 3A84A 3ZV9A 3A83A 1GMDF 1YY3A 1TGSZ 3UREA 3KQ5A 1AVXA 2AHME 1BTXA 1G2LA 3UWJH 4A1TA 2PTNA 1GBIA 2DE8A 3T5FH 1MU6B 1IHTH 5TCAA 3UAIC 2SFAA 2G5NA 2BD9A 1O2NA 3U9AH 1H9HE 4YOJA 3EE7A 3FZDA 3K6YA 2WPDD 1ETRH 5JBCS 1Q31A 4ZHLU 4KELA 1C2IA 2L74A 2ZECA 4B2CA 4Z6AH 2ZNKH 1AU8A 2VIDA 2UUKB 3RXJA 4Y8ZA 1GGDB 1Y59T 2GZ7A 3I77A 1GGDC 5GPIB 5AFZH 4GHQA 4TPYA 3PLKA 2RA3A 2QXHA 2WUBA 4X1QU 1TNHA 3LC3A 3AVZA 5E0GA 1JRSA 2VNTA 3Q3XA 2BQ6B 4AYYB 1LQEA 1W7XH 1BMMH 1YPMH 2Y81A 3BSQA 5EJLA 1QJ6B 3SZNA 1B7XB 4TYDA 3R3GB 3ZYDA 3TIUA 2CXVA 1GBJA 1K1MA 1L0ZA 1ZTJA 4B71A 3SNAA 1YPGH 2FTLE 8LPRA 1O3OA 1BMFD 3LGWA 3V3MA 2CJIA 2BDAA 1ZHMA 1GJ7B 2XNDD 1A5IA 1MTVA 1WYKA 4I8JA 1ABIH 2V6NA 4GSOA 3RXBA 5A0CA 1P9SA 2GGVB 5E2PA 1H8ED 3H09A 1O32A 3C27B 1ZPBA 3BEFB 3W1EA 4ABGA 1DWBH 1IQGA 2FM2A 1INCA 1OXGA 1RTFB 1T8LA 1C5MD 2WZQA 4WMFA 1NRRH 1AMHA 1MKXK 2GJGA 4DGJA 2GP9B 4WVPE 1E37B 2ANYA 5GJ4B 4Q7XA 2J9NA 1Z6JH 2VWNA 2WPKS 2ZHDA 2GKVE 1DM4B 5CHBA 4NWLA 2R9PA 5ABWA 1TGBA 3SJ8A 2ZU5A 2XRCA 4X1NU 2AGEX 1ANBA 3EE0B 4Y6DA 2JJ2D 3FVFB 1EJNA 4FVBA 1LO6A 3WY8A 1P2MA 1TX6A 1JXPA 4MDSA 3GCNA 1PPFE 3SW2B 2F83A 2R3UA 1PYTC 2PUXB 1YPHE 4Y7AA 3LIWA 1RTLA 1GHBG 3Q77A 2BZ6H 5EQQA 1ORFA 3RXQA 5HKKD 1J8AA 1SQOA 1WXRA 1UVTH 1GBEA 2QF4A 3RC6A 1V2MT 1GI1A 3N99A 1Z8RA 1O2WA 2Z3CA 4A5TS 4MQAA 5HIYA 1Z71A 2QF5A 2ZU1A 4XDEA 2C93B 2CMYA 1FY8E 1LHDH 1OWDA 2GMTB 1TFXA 2BD3A 1IQIA 1EJAA 1C5QA 2BZAA 1OKXA 2GZ8A 1J16A 4Y8XA 1SQRA 4BNRA 3SJIA 5JPMH 4K2YA 1HAIH 1MZAA 1A7SA 5FL7D 3F9FA 5HM9A 5C3NA 1C2KA 3NWUA 1TQ7B 2GCHG 3IITA 3U69H 2A4OA 1C1QA 1EB2A 2A1DB 2ZFPH 1L1JA 2J92A 1ACBE 1GBLA 1TQ0B 3ZVAA 3K6ZA 1SC8U 2VWLA 3VEQB 2VWMA 5HYOA 2VJ1A 1TRYA 2PWXA 3UQOA 1OHHD 2OP9A 6GCHG 4A1VA 1HAVB 3URDA 5C1UA 3RC4A 3LGUA 3RMOH 4GCHF 3SQEE 3CNRA 4E7NA 4ZCNA 1YPEH 1T31A 3QLPH 4HG6A 1HNEE 2HOBA 1DS2E 3QN7A 4AZ2B 1HIAA 3RXPA 2F43B 3M7UA 2KX4A 2IN2A 3KQCA 3ATMA 3RDZA 1OWKA 2QXIA 2ZGXH 6CHAB 2PLXA 3SNCA 1A0HB 1FN8A 4KTUA 1J14A 3FP6E 1TPAE 1AN1E 3SU6A 3L33A 1SFIA 3TGJE 1SI5H 1EZQA 1N6XA 3KNXA 3QGJA 3SNBA 1NESE 3GY8A 4YT6H 1C2DA 3A81A 3HK3B 1ELAA 4B74A 1QY6A 3M7TA 3F2HA 1U6QA 5EODA 1V2RT 1O2ZA 2EY4C 3RU4T 3TJOA 4BAOB 1B5GH 3ZZ6A 2RDLA 1C2FA 4B73A 2ZDKA 1P10A 3OFND 1OWIA 2WINI 2ZHQH 3E0PB 3EAJA 4INLA 5A2MH 1HB0B 2WPJS 3GISB 4DT7B 1GMDG 3VB4A 1Y3YA 4B1TA 4I8GA 3EA7A 5DG6A 1TBZH 3DFLA 5F03A 4Q2KA 2KFWA 1S6FA 1W14U 3MI4A 1VITG 1N6YA 3KHVA 4ABBA 2OXSA 2NWNA 4I31A 3NXPA 1QRWA 2D2DA 2WHXA 1W11U 2LP6A 5FBIA 4I32A 1O3HA 1WU1A 3LGVA 2PSXA 1NRPH 1L4DA 4AC9A 1FY1A 1E1RD 3NK8A 5TJXA 5E8EH 3GY3A 2NU3E 1LVMA 3RXAA 2LNCA 4NGAH 2R2WU 3B8JA 1KTSB 2KZ4A 1LCYA 2I6SA 4UFDH 1O37A 3QTOH 2ANKH 4Q7YA 1EPTA 3PM3A 1OP0A 1MKXH 4K60A 3UR9A 5JBBS 1CGJE 1GI4A 2PW8H 1ELCA 1DWDH 1Y5AT 3QTVH 4ASUD 1GBDA 4BXWA 1P3EA 1MZDA 2KCYA 3OU0A 2FS9A 4WY3A 5AF9H 2TGPZ 1C5ZB 2HVXA 3K65B 3NRLA 3FP7E 3SGAE 1SGIB 1WAYB 3DFJA 3T25A 1OPHB 1TRMA 2BXUH 2UWOA 3EQ0H 2XBYA 2FOGA 1Y3UA 3SGBE 1MD8A 4DJZB 4CRBA 1O3DA 3MNXA 2AMPA 3A88A 5J4QA 1EKBB 1QIXB 2ZGCA 4ABIA 5C5NA 5KECA 3OEHD 1PQ5A 4FUIA 3D62A 3KL6A 1AE8H 4JYVH 4AFQA 2WYGA 5HMAA 2QF3A 3EGKH 1CQQA 3DCLA 2A7JA 4H4FA 1KLJH 3DSGA 1AI8H 1O3NA 3DSOA 4X6PA 5FHTA 4JZDH 2GVFA 2AFQB 1HJAB 4TWYA 2ZO3H 1HJAC 1OWHA 3BTGE 3E0NB 1C2GA 4NZLA 2G81E 1RFNA 4J1YA 1O33A 1LMWB 4IS5A 5C0TA 3RMLH 3U1IB 2FTMA 4O3TA 1A46H 2Q6GA 3SNDA 2BM2A 2F9UA 1ZTKA 2W7SA 1NRNH 1GMCF 1C5TA 3A7TA 4FXGH 3TNTA 1MAXA 1C1VH 1K1JA 1BITA 3GS9A 4ZHAA 3O8DA 2XW9A 1QNJA 5GCHF 5FCRA 2BYAX 3M3SA 3SI3H 7GCHF 3M5MA 2W6ID 2ZI2H 2J4IA 3SUEA 1EOLA 3MH5A 3CS7A 2G4UA 1SGFA 4NZQA 4DG4A 1UTPA 2QIQA 3F0OA 2GV7A 4MPXA 2V3MA 1E36B 2A7CA 1ZHRA 2PKAB 2O9QA 4X8SH 2B5TB 1FX0B 4E05H 2OC0A 3D49H 4P00A 3PYHA 1P11E 3Q3KA 1V2VT 4LOYH 4WXIA 3E90B 1E0FD 1Y8TA 1NS3A 4BOHA 4AB9A 1GJ4H 3GDUA 3KF2A 1V2TT 5EJ1A 1SQTA 2GTBA 5E0HA 3SN8A 2VH6A 3LU9B 4GUXA 4BXSA 1PPBH 3Q00A 1KLIH 1CGHA 4BANB 5K7RA 4DIIH 3AASA 5BPEA 1TX8A 2PGBB 2IJD1 1GI0A 5C94A 1G3EA 1GHYH 1Z8GA 2J34A 3NZIA 3N7OA 3K2UA 2Y5FA 3MU1A 1C5UA 1GJCB 1ELBA 4GAWA 3LDXH 1PYTD 2VIVA 2XTTB 1WQVH 3PLBA 5A09A 2BLWA 3E1XB 4H6TA 4UD9H 2HNTC 1PPGE 4CRDA 3P8NA 1LHFH 2AGIX 4UFFH 1TGTA 5JB8S 2LPRA 2ODPA 1DPOA 2F91A 4O03A 2EI8A 3ZZ7A 1TNIA 3A89A 1S6HA 2VWOA 3E6PH 1NZQH 1T4UH 2GDEH 2RA0A 2R2MB 2DE9A 1IQEA 5EQSA 5KEDA 5HXFA 1KSNA 1ZSLA 3KYFA 4X2WA 1CE5A 2VH0A 3TPIZ 3UNRA 3IG6B 1GHVH 1O3MA 3LJOA 4YOIA 1UTQA 2ZA5A 4CHAB 1HAXB 1O2TA 1SGNE 4CHAC 4MNWA 5ETXA 1O3IA 3M7QA 5BRRE 1OX1A 1SGFG 3LT3A 3M61U 2FI4E 3OY5U 1C2JA 1HAOH 3SGQE 2ZG0H 4OS4A 2XC5A 4MPVA 5T3HA 4Y0YE 3ODFA 1HIAB 5FCKA 1NPMA 1FAKH 4F48B 4B2BA 1XKBC 3HKIB 1ELGA 2ZFQH 1AZ8A 1TLDA 1NO9H 4HI3A 3RXKA 3MO9A 4CBOA 1OSSA 1KXEA 3FN8A 1A0JA 3STIA 3F6UH 2UWLA 1QL9A 2WV5A 4H42U 1K2I1 2ZU4A 1L2EA 4B75A 3A8BA 1ETTH 1THSH 2QCYA 5FPSA 1O2HA 1SOZA 7KMEH 3ZV8A 4TY6A 1BHXF 4R0IA 2F9VA 1NRSH 1PQAA 1GHWH 1UTOA 1C5VA 4JZEH 4YZUA 1GVKB 4GLYA 2HALA 9ESTA 2OQUA 4ASHA 2JIZD 3DHKH 4UE7H 5DP4A 4YOGA 2QYIA 4IMZA 1EUFA 1PPEE 2WPIS 1V6DA 3QGNB 1EP6A 1O5BB 1UVUH 1TB6H 1YBWA 3LC5A 1IQLA 2XC4A 4FUCA 2ZFRH 1QB9A 1ZOMA 4RT1A 1SGPE 1A3EH 2Y5GA 3LGTA 3RXUA 5JBTA 1LVOA 1HAPH 3E91A 2BY5X 1C2HA 1DWEH 1TMBH 4IN1A 3MNBA 1C1SA 1FV9A 5DP3A 1LKAA 3BTTE 1EZUC 1QA0A 1C5PA 2BDGA 1F5LA 2F9BH 4U01A 3PWBA 3TJNA 4U30A 3SOSA 1P8VC 1GI2A 1KLTA 3MO6A 5AHGH 1THPB 3OEED 3JZ1B 2UUYA 2SGAA 2ZU3A 3SV2H 3TH3H 3RXMA 1SGCA 1Z8JB 5F6MA 1ZPCA 3W95A 2Z3DA 2G8TA 1V2WT 2GZ9A 2A5AA 4FUEA 3SU3A 1GJ5H 1NRQH 2WSSD 4FUDA 2OD3B 3BTWE 2PHBA 1P05A 1LDTT 1P04A 1C5WB 3KQBA 1GMCG 4BTIB 1QB6A 3SI4H 1GI8B 3GY7A 1C9PA 1H8DH 3ZZ9A 4JMYA 5GCHG 1HFDA 2XBWA 2FZZA 1C9TA 1EXFA 1OWJA 1BTYA 3QX5H 4D76A 2H5DA 7GCHG 2R3YA 3H7TA 5GXPA 5J4SA 1W0YH 3I78A 2F4LA 1YYY1 2THFB 3H5CB 1TRNA 1NN6A 1H8HD 4Y8YA 3VB6A 3NUMA 1GJ9B 1P03A 3PMJA 1E38B 1AWHB 4ISLA 4KP0A 1XX9A 4Q63A 3TJVA 5FPTA 1AZZA 5DO4H 5I25A 5CHAB 2BLOA 3F68H 5CHAC 5DKMA 5LPRA 4WMDA 1FXYA 3F3BA 4CRAA 3M3TA 4ZKOU 4HZHA 1G30B 1S5SA 1XVOA 4I7YH 2A7HA 1AFQB 1J15A 1AFQC 1JWTA 2HPQH 4NCYA 3ZVCA 1HYLA 1FIZA 1WUNH 1HAYB 3LJJA 1W3CA 2ZFTA 2J98B 2VIOA 1YKTA 3Q3YA 4AGJA 1P06A 4KKDA 2C8WB 1GJAB 1F0SA 3ZZ4A 2QN5T 2FOCA 2CHAB 4WMEA 5HIZA 1NTPA 2CHAC 1UHBA 1ELVA 2A2QH 1W13U 2WV9A 3RXLA 2J97A 2BX3A 2KCPA 1G37A 3ZZ8A 1C1PA 1F5RA 4ZUHA 2EA3A 1O3GA 1IQKA 2ZQ1A 1IQMA 4XE4A 3SJOA 1YLDA 5FXLA 5DK1A 1G2MA 1WSSH 2ZTXA 2F9PA 1HXEH 1BDAA 2PR3A 1QL7A 2ZWLH 2ZHFH 3A8CA 2EQNA 2PKAA 2Y6TA 1T8MA 1PFXC 1JOUB 1QQ4A 1CHGA 4YM9A 2FYRA 2BQ7B 2EI7A 1XVMA 4MPWA 4YLQH 1O35A 2H1UA 4OS5A 4K1EA 1AKSA 1DITH 4DY7B 3TGIE 1AUTC 1FNIA 4B6FA 5AFYH 4M9FA 2RDEA 2HGTH 2HLDD 1WV7H 5DJ7A 4K1TA 4Q4LA 1Y5BT 3MFJA 3S7KB 4UDWH 1GPZA 3M5NA 1QFKH 3VXFH 2FLRH 1BTZA 1NC6A 1P3CA 2ZTYA 3LKWA 3L3TA 1YCPK 3UB0A 3B23B 2WV4A 4YLUA 1N1LA 3ATIA 1EOJA 4OS6A 4YTAA 1TYNA 2VVVA 4WH8A 4QT8C 2J95A 3S69A 1BBRK 1UW7A 4PROA 1SGTA 4IGDA 3SJ9A 4IW4E 2TGAA 3DSPA 4XD7D 3LGYA 1P9UA 4O97A 4ABEA 1C5XB 3UOUA 5A0AE 3PTNA 1NU9A 1TMTH 2V0BA 1CT0E 2STAE 2JKHA 2XWBI 1F0RA 2C8XB 1LVBA 1O2SA 1HAGE 1BTWA 3SU1A 2Y7ZA 1E1QD 1Y3VA 3HKJB 3LH3A 1DDJA 1TOMH 3ITIA 4INKA 1KY9A 1B0FA 1UJ1A 1BB0B 3M36A 1KTTB 1MH0A 1KXDA 1CT4E 1ZGIA 1KDQA 1MU8B 4U32A 3MHWU 1SLXB 1O5GH 5EXMA 2H6MA 3P92A 3EA9A 5DGJA 2O8MA 1G9IE 1QRZA 1N8OC 1O2GH 1AQ7A 2OC7A 4X1SU 1VITH 1RIWB 1MKWK 1RIWC 5EJZA 3A8DA 1DX5M 3U8TH 2QY0B 3BTFE 4RT0A 1IQJA 1BMAA 1O2JA 1ZSKA 1W12U 1O38A 4IMQA 2ESTE 1RXPA 1J17T 2FWWA 2EC9H 2PFEA 5K0HA 2A45B 2B7DH 3G01A 3RLYH 2RCEA 5L2YH 2P16A 1XM1A 2BVSH 2UUFB 4ABFA 2O8WA 2BD4A 3SV9A 2ALVA 1P2OA 4FUGA 3RXCA 3CENA 1S85A 1O2UA 4ISHH 3BN9A 5JYIA 4TWWA 1PJPA 1TAWA 2XWAA 1SVPA 5C1YA 1ID5H 2WYJA 4NFEA 3A7YA 2ZGJA 1MAYA 4NA9H 4X1PU 2KAIA 1BRUP 2ZC9H 1K22H 1KXFA 2ZIQH 4DW2U 2AERH 3O8CA 1P57B 1SR5C 1PQ8A 1T8NA 1ARBA 2K8IA 2PV9B 1GJ6A 1XUJA 1LTOA 1Y3XA 1TNKA 1S84A 3P17H 3ZZDA 1C5YB 1NROH 2ALPA 1AB9B 1AB9C 5KGOA 4OGYA 3V13A 1AGJA 5SGAE 4XSKU 3PO1B 4ZMAH 3PO1C 4NSVA 4ZROA 4Y10E 1QZ8A 3T26A 4BTUB 3GCTF 3OX7U 1RRKA 2ZZUH 2G55A 1JIMA 1GJBB 3AAVA 3GY2A 3DD2H 3E8LA 2PTCE 3VB7A 3V0XA 3JZ2B 4FUHA 4D7FA 1SMFE 2XYAA 1EB1H 1GDUA 1NFWA 1P2QA 1RS0A 1AWFH 2C8ZB 1QCPA 3PV4A 2BDYA 2OBOA 2XXLA 3M3VA 3TGKE 3S9BA 1HAZB 4K1SA 3U8RH 2BB4A 3ESTA 3RXGA 2VVCA 1HGTH 4Z0KA 2ZEBA 1GI6A 5JB9S 2XCNA 1S6LA 3RXOA 4DCDA 1BTPA 1C1TA 1NU7B 1O3KA 2AH4X 2ZGBH 5DP5A 2Y82A 4I86A 4Z1MD 1XXFA 3AW0A 1IQNA 3ZZ3A 2IOTA 3OSYA 1DY8A 3UNSA 1YCPH 1GVLA 1DFPA 5EOKA 1ETSH 1IQHA 1SGDE 2CN0H 1TWXB 2FX6A 1MD7A 2AIPA 1C4U2 4X6NA 2HRVA 3A80A 1TGNA 2YMSB 4ZAEA 1WTGH 2YMSC 1BBRH 4CREA 5L30H 1O3BA 2JH6D 1UK4A 4JK6A 2FOFA 1QURH 1CVWH 4DOQA 1TE0A 2J98A 1O2PA 2ZDNA 5L6NH 1O2MA 2ILNA 1AHTH 2ZDVH 2HVYB 1HRTH 1P2KA 3BV9B 9LPRA 1BOQA 1YPHC 3T29A 3HGPA 1YM0A 3OY6U 5C17A 3BTQE 1C1OA 2HLCA 1TNJA 2JETB 2XCFA 1ELFA 2JETC 3A7XA 2AGGX 1C5OH 2C90B 2XNIA 2Z9KA 1GBTA 3SQHE 1BHXB 3SU4A 1V2ST 1EFRD 4NIVA 4DVAU 3FANA 2RFKC 1CHOF 1KXAA 2FI3E 1UHBB 2VIPA 1MQ6A 1ZMJA 1FY4A 4U2WA 2FOMB 1Y3WA 2Z9LA 4FU9A 3TJUA 3BG4B 3BG4C 4J2YB 2SGDE 1ZGVA 3MH4A 4JCNA 3V12A 5B6OA 1MKWH 1OP8A 1BBRE 4ISOA 2G51A 3A87A 1DSUA 1TMUH 1A4WH 1WCZA 1QJ1B 1G3DA 2R0KA 2WPLS 5DP6A 2P95A 2FESH 4NIWA 2W6JD 2ANMH 4LXBH 1NBMD 4OGXA 4AN7A 1E34B 3N7EA 5HGGA 3ZVBA 1GWAA 4CH8B 2V3HH 1ZR0A 2G00A 3GYLB 4GCHG 5F8XA 3SUGA 1MMJN 1AKSB 3UNQA 4DT4A 1O5DH 1VGCC 2FODA 5DP9A 4ABJA 1T7CA 2ASUB 5F8TA 2OTVA 5T1VA 4GPGA 2Q6FA 4H6SB 2BMGB 1AVGH 1NFUA 2ZPSA 3T28A 1F7ZA 1QBNA 1GHZA 2IPHA 1XUKA 4NWKA 4P02A 4BAMB 1FI8A 3GOVB 2QXGA 1SQAA 2Y5HA 1HV7A 1FPCH 3A8AA 3OTPA 3TNSA 2B8OH 2FMJA 2KCOA 3GY6A 1YP9A 2A32A 2ODQA 4RN6A 1TALA 2BY6X 1M9UA 2ZQ2A 3URCA 4ACBA 1OYTH 4BAHB 4OM9A 2V7QD 1GBBA 3S9CA 7LPRA 2TBSA 4SGAE 5EG4A 4ESTE 1XUIA 3LGIA 4CRFA 4THNH 3TH2H 1TONA 2ZU2A 1FPHH 1LHGH 4X6OA 3SYJA 1GHAF 1HCGA 3U8OH 1A1RA 2F9NA 1Z8IB 3P8OA 1D3QB 3TK9A 1QB1A 1F5KU 5JBAS 3P8GA 1IOEA 4M7GA 3M37A 4D7GA 1QGFA 1D6RA 2CF8H 1MBMA 3EA8A 1NM6A 1GCTB 1YF4A 1GCTC 1K1NA 5GDSH 1H9IE 1HJ9A 1SHHB 2FP7B 1V3XA 2ZCKP 4JYTA 5EPYA 5CMXH 1KDQB 1YCPM 2K1QA 1CT2E 2BQWB 5C1XA 3ATKA 2Z94A 2VINA 3DA9B 3T27A 1ANDA 1XXDA 3MTYA 3F1SB 1AE5A 3BIVH 4K8BA 3M5LA 2BD2A 2JH5D 4RI0A 3SHCH 1SGEE 1C1UH 1O34A 2BDCA 1SB1H 4FUJA 3RU4D 3BTDE 4SGBE 2D8WA 2Q6DA 2VB0A 1TBRH 1GBMA 5FX5A 1FIWA 2SGFE 2FOHA 3P8FA 1UVSH 1MTUA 3LOXA 2HPPH 4FVDA 3AAUA 4WF8A 1TA6A 4ACAA 2C3SA 3TITA 2SNVA 3VGCB 3VGCC 1THRH 2BXTH 1ZMLA 2ZP0H 1UK2A 3S7HB 4I8KA 1VR1H 3RXTA 2EEKA 4XBBA 1C5LH 1QBVH 2BVRH 1ZHPA 2HWLB 1LHEH 1VKYA 2Y80A 3BG8A 3FOAA 4ZXXH 5EU8A 2AMDA 3P70B 2ULLA 3TK5A 2Q1JA 1K21H 2BD8A 3RXIA 3F2FA 3N7DA 4HGCA 2KAIB 2BX4A 2ZCHP 5E2OA 1WTHD 2UUJB 3D23A 3QO6A 5ESBA 3EYDA 1GHXH 1TPOA 1LPGB 1Z6EA 1EAWA 1O2RA 4UFEH 1DSTA 1FUJA 2W3KA 1T32A 2FLBH 3UR6A 3C1KA 3SV6A 2F9OA 1AUJA 3KQDA 1DT2A 3BTKE 1O0DH 3BTHE 1QA7A 2OC1A 3DUXH 1D3DB 1K28D 1IHSH 1C2LA 1C4Y2 1J9CH 1EAUA 2ZPQA 1SPJA 1SG8B 3WWBA 1L4ZA 4CR9A 3SV7A 1P02A 1ELEE 2BDIA 1UTLM 4R8TB 4YESB 1KIGH 1MQ5A 1RTKA 3HK6B 3KYGA 4JZIA 5T6GA 1GBCA 5FX6A 1ZRBA 2G5VA 3W94A 4AORA 1QQUA 5LGOA 2FPZA 1TNGA 2G52A 4AFSA 1KMHB 2OUAA 3RM2H 1GI3A 3F9EA 2XOKD 4A6LA 5EIYA 1CHOG 1A5HA 4F55A 1YLNA 3LONA 1AIXH 1LQDB 1YPKH 3PMBB 3VB3A 2Z9IA 3MQKC 4OS2A 1ELTA 1JMOH 4NIYA 4AG1A 1G36A 1GBKA 4X2VA 2EI6A 1SSXA 3T2NA 2AYWA 4TPIZ 1TNLA 3CS0A 1W7GH 2V35A 5F53A 2M2AA 2O8UA 1OYQA 1OWEA 2H9TH 1HUTH 1AVWA 5DP8A 2AEIH 1HLTH 2D1JA 2A4QA 2ANWA 3MYWA 1EX3A 2AIQA 1Z7KA 3ZIAD 4ABAA 3PRDA 4ISIH 1UTMA 4NIXA 1VITF 3PB1E 3U1JB 4K3JA 1O5EH 2D26C 4WJG2 4AYVB 4RKJB 6LPRA 3UUZA 1K1IA 1EZXC 2C4FH 1P2IA 3ZVDA 1C5RA 2YMSD 1DICA 4YT7H 6ESTA 1O36A 5E0JA 5EQRA 2VGCB 1O2LA 1SLUB 2VGCC 5T6FA 3FZZA 1A2CH 3RXVA 2TRMA 3FP8E 1D6WA 1XKAC 1ELDE 2FEQH 2JH0D 1TPSA 2BDBA 1ANEA 1O2XA 2QF0A 5C2ZA 3UPEA 3VG8A 1BUIA 1SLWB 4CRGA 1W10U 1PQ7A 2BLVA 1D9IA 4TSFD 5FPYA 4X6MA 4DURA 1MTNB 1MTNC 1FY5A 3KIDU 2BDHA 1GHAG 4AOQA 1C1MA 4VGCB 4VGCC 1RGQA 1SGQE 4HTCH 5A8ZA 5C0UA 2ZGHA 3M5OA 1FLEE 5LPEA 5HM2A 1DXPA 2ZDMA 2KR7A 1F92A 1B0EA 4X8TH 2OLGA 5EXLA 3RMMH 3QWCH 3VPKA 1UO6A 1H4WA 2QC2A 1SL3A 2QAAA 3BTME 3O8RA 3LH1A 1O3AA 1O5CB 3UY9A 1BRBE 1EQ9A 1DUEA 4GHTA 1EJMA 1O3LA 1O3PB 1L1GA 4X1RU 1GI5A 3RXEA 5AVDA 2KCAA 1V2OT 3HATH 1GBAA 1EASA 1HDTH 1W2KH 1O2KA 2CV3A 1EZSC 3SORA 2XC0A 3KCGH 2ZHEH 1C1RA 5IYTA 2FOBA 2FOAA 1LPKB 4Q7ZA 1ZJDA 3SO3A 3F9GA 2NU0E 3NKKA 3H7OA 1O5AB 1D4PB 3V7TA 1GCDA 2P3TB 4MG3A 2GDDA 1UTNA 4NA8A 3OE7D 2A5KA 4I33A 4CR5A 1A5GH 1TGCA 1HXFH 1P01A 2FIRH 1ZTLA 2PGQB 5ESTE 4OS1A 1VZQH 2YNBA 4OS7A 2ZDAH 4WWYA 3MNSA 2GMTC 1ESBA 1O3EA 3E3TA 4JZFH 1OP2A 1DLEA 1GI7B 4TY7A 1TBQH 4ABHA 1DOJA 2BHGA 3P6ZB 1BZXE 1SBWA 1H8IH 2PUQH 1GMHF 1Q3XA 3IWMA 3PTBA 2W5EA 1BMLA 2ZCLP 3A82A 1GJDB 1GBHA 1FN6A 2Z3EA 1SKYE 4LZ1H 2WPHS 2ODYB 1N8OB 2DUCA 2OINA 4D9QA 2UWPA 2FX4A 1XMNB 2CGAA 3ELAH 4UFGH 4TT3D 2W3IA 2B9LA 4X2XA 3SNEA 4MTBA 1K9OE 1O5FH 3QUMP 8GCHF 3PLPA 3FKSD 1O2VA 1G32B 1UTJA 5I46H 2OBQA 2FDAA 4FOUC 2PP6A 4ZXYH 1HJ8A 2W7UA 4A92A 5CE1A 3MNCA 2A4RA 4GVUA 1IAUA 1S83A 1P09A 7ESTE 2IPQX 3LPRA 3KGPA 4X2YA 1DWCH 3U98H 1JIRA 1H9LB 2ZTZA 1DY9A 6CHAC 3A7WA 1COWD 1XUGA 1NY22 1DXWA 1MUEB 2HNTE 1P2NA 2BOHB 3KEEA 3FFGA 3MU4A 4FETA 4Y11E 2F3CE 4Q80A 1OS8A 5F8ZA 1O2IA 1CSOE 2NU1E 1T4VH 3MH7A 3WWFA 2QGRA 2SGQE 1FJSA 4E7RG 3CP7A 5LPFA 1DLKB 3QZRA 1YLCA 3PROA 2H5CA 4BAKB 1XUFA 2LELA 1MABB 3MWIU 3F0PA 4KGAA 2KM0A 1C4V2 2J38A 3RXRA 1ZPZA 1CA0B 1CA0C 3AK5A 3P95A 3PV2A 8KME2 1Y5UT 2P8OB 1YPJH 2P8OC 3RXSA 2P3FH 3AW1A 2J5UA 3M35A 1TPPA 4K8YA 1VCPA 3OAAD 3ZZ5A 4NSYA 4FUBA 2I6QA 2ZKSA 4FU7A 1ANCA 1GL0E 4AB8A 1LKBA 1VJ9U 4X8VH 2FS8A 2ZHWH 1O3CA 1FY3A 2NU2E 1TX7A 1DE7H 1L1NA 2P3UB 3RXHA 1FONA 2A2XH 3SHAH 4MVNA 1KYNA 2TIOA 3MO3A 1BTUA 5PTPA 1H1BA 2VIQA 4MPUA 5DPAA 3GDSA 3PMAB 4Y0ZE 2VVUA 1QTFA 1BIOA 3UFAA 4MNVA 1EP5A 1O3FA 3OYPA 3ZVFA 1HAHH 3T62A 2BOKA 2GT7A 4K69A 1OOKB 1V2PT 3PMHB 2Z7FE 3RUOA 4Y76A 8ESTE 1BJVA 2Z9GA 1TIOA 3TK6A 2AS9A 3MU8A 2SGPE 3GCHB 1SLVB 3GCHC 1GDQA 1BRCE 4DIHH 3SZEA 3MMGA 2IJOB 3E16B 3GICB 3RXFA 4IC5A 1DVAH 1MCVA 2BD7A 2A5IA 4KTCA 4NG9H 1V2QT 3L6PA 4B6EA 4ZKRU 5IK2D 1ZZZA 3UQVA 1LVYA 4ABDA 1ARCA 1VCWA 4NFFA 3ZVEA 1PPHE 1Q2WA 2GD4B 4IN2A 5L2ZH 3F9HA 2NU4E 3TVJB 2GCTB 2GCTC 1G3CA 5EGMA 1DUAA 1QL8A 3RLWH 4IBLH 1S82A 4E06H 2QV1A 2PKSB 1P2JA 2PKSC 5FBEA 4CRCA 2PSYA 3ZZCA 1PPZA 4CBNA 4WXVA 3SJKA 4BAQB 1G3BA 5A8XA 3RMNH 5H4IB 4AGKA 2YNAA 1W8BH 1MBQA 2J94A 1EAXA 4YO9A 4A7IB 4Y7BA 1CO7E 2FXRA 2O8LA 2TPIZ 4MLFB 4XRNA 5EPNA 5DP7A 2GT8A 2B0FA 4YXWD 2OQ5A 5JDUB 1AD8H 3MU5A 1O2YA 1FQ3A 1RD3B 1GJ8B 1ZRKA 4FU8A 4UEHH 4AFUA 4AG2A 4X0WU 1WOFA 2QE7D 1XUHA 4IC6A 2P94A 2SGEE 3STJA 3ZYEA 1UCYK 1GBFA 4A1XA 1NT1A 1O31A 1BJUA 1BRAA 3BEIB 1LHCH 3OTJE 3SU2A 1K0HA 4ISNA 2AMQA 3A7VA 1MTSA 4ZKNU 3SU0A 1Z1JA 2BLQA 1S0QA 4F4OC 5C67A 1ZJKA 1V2UT 3PV5A 3NPSA 4RSPA 2BY7X 4CH2B 3UTUH 1FZZA 1JBUH 1BA8B 1S0RA 1F0UA 2OK5A 1GMHG 3SUDA 3MH6A 1UK3A 3F2GA 2FI5E 4Y71A 4JZ1A 3VB5A 1UTKA 4D8NA 5A8YA 2OCVB 4ZHMU 3ZVGA 3ODDA 5DSFA 1P12E 2A4GA 1CA8B 2BVXH 1VGCB 1GL1A 1W0ZU 4X8UH 2ZF0H 1O2QA 3O8BA 3R0FA 5EW1H 2CF9H 1YGCH 1FMGA 4B2AA 2H9EH 3GY5A 1QRXA 3TLOA 3TU7H 2SNWA 3FAOA 1C2MA 1CU1A 3GDVA 3UOPA 1P0SH 8GCHG
chains in the Genus database with same CATH topology
3RC5A 1EATA 5EXNA 5C20A 2GV6A 3SU5A 3RM0H 3VFEA 1K1LA 2XBXA 2Z6BD 2BTCE 4LZ4B 1EAIA 1RJXB 1V2NT 1AY6H 2M5TA 1CGIE 3ATWA 4I8LA 1V2LT 3K9XB 1HBTH 1UVOA 1VCQA 5LH8A 1GI9B 4XBDA 1UVPA 1C5SA 5IDKA 3RXDA 3MOCA 1X7AC 1VJAU 1A61H 1NFXA 2G4TA 1BMNH 3D65E 2VIWA 1K1OA 3RP2A 1HPGA 1A3BH 2W26A 4AFZA 1Z1IA 2BD5A 1ESTA 2P59A 1YPLH 3TH4H 2GX4A 3QDZB 4JK5A 5EW2H 4UONA 1HAVA 2O8TA 3MU0A 4I8HA 5A0BA 1F0TA 3GCTG 2H9HA 2BY8X 1TA2A 1O2OA 1MTWA 2Y7XA 3KQEA 4ZKSU 2ZPRA 1SGRE 1C5NH 1WQSA 3QK1A 1V2KT 4F49A 1UMAH 2YOLA 1AO5A 5FAHA 2FO9A 2FOEA 3QZQA 1ZMNA 4JYUH 2A0QB 1LPZB 4XBCA 3VXEH 1GHBF 5C5OA 5GIBA 3A86A 4HFPB 1T8OA 5TCCA 4O3UA 1PPCE 1SHYA 2STBE 1QR3E 2A31A 1WBGB 2FYQA 4XFQA 3BIUH 1MCTA 3HGNA 3GY4A 4BTTB 1D3TB 4O9VA 1CBWB 1CBWC 1K1PA 1KXBA 2H2ZA 1C2EA 1IQFA 4WH6A 3SBKA 1DANH 1BCUH 1ESAA 3PWCA 3GYMA 3BF6H 4K5ZA 1F2SE 1GDNA 2TGTA 2GCHF 3ATLA 3SUFA 1SOTA 4RKOB 2QA9E 1FAXA 3SV8A 1GVZA 2VU8E 3BTEE 2R0LA 3UIRA 3A7ZA 1TOCB 3DT0H 1O30A 1BT7A 1D3PB 5G4BA 2P93A 4B76A 6GCHF 2XBVA 3NCLA 1GG6B 1A0LA 1GG6C 2TGDA 3A85A 3RU4E 1UCYH 3ENSB 3HPTB 1C1WH 4ZH8A 3ZZAA 1C1NA 1V2JT 4AX9H 3Q76A 1S81A 1KXCA 2WPMS 2ZFSA 2V3OH 1SGYE 1BTHH 3KN2A 1TABE 2BY9X 3I29A 1O39A 2QXJA 3S9AA 3ZZBA 3S0NA 1BQYA 4MNXA 1NFYA 1QHRB 2RG3A 3BEUA 3GCOA 1QJ7B 2OC8A 1ZYOA 3UWIA 1QBOA 1JRTA 5T6DA 4NA7A 1O3JA 4XOJA 2WUCA 2ZFFH 3EDXB 1FDPA 4LK4A 1E35B 1ZLRA 2ZDLA 4Y79A 1SFQB 4KTSA 1AFEH 1EPTB 1ABJH 1EPTC 2C8YB 5GWZA 4FUFA 4INHA 4D9RA 2Z9JA 4MNYA 3B9FH 2J2UA 1ZSJA 2HNTF 1UCYE 1YC0A 3A84A 3ZV9A 3A83A 1GMDF 1TGSZ 3UREA 1AVXA 1BTXA 1G2LA 3UWJH 4A1TA 2PTNA 1GBIA 2DE8A 3T5FH 1MU6B 1IHTH 5TCAA 2SFAA 2G5NA 2BD9A 1O2NA 3U9AH 1H9HE 4YOJA 3FZDA 3K6YA 1ETRH 5JBCS 1Q31A 4ZHLU 4KELA 1C2IA 2ZECA 4Z6AH 4B2CA 2ZNKH 1AU8A 2VIDA 2UUKB 3RXJA 4Y8ZA 1GGDB 1Y59T 2GZ7A 3I77A 1GGDC 5GPIB 5AFZH 4GHQA 4TPYA 3PLKA 2RA3A 2QXHA 2WUBA 4X1QU 1TNHA 3LC3A 3AVZA 5E0GA 1JRSA 2VNTA 3Q3XA 2BQ6B 4AYYB 1LQEA 1W7XH 1BMMH 1YPMH 2Y81A 3BSQA 1QJ6B 3SZNA 1B7XB 4TYDA 3R3GB 3ZYDA 3TIUA 2CXVA 1GBJA 1K1MA 1L0ZA 1ZTJA 4B71A 3SNAA 1YPGH 2FTLE 8LPRA 1O3OA 3LGWA 3V3MA 2CJIA 2BDAA 1ZHMA 1GJ7B 1A5IA 1MTVA 1WYKA 4I8JA 1ABIH 2V6NA 4GSOA 3RXBA 5A0CA 1P9SA 2GGVB 5E2PA 1O32A 3C27B 1ZPBA 3BEFB 4ABGA 1DWBH 1IQGA 2FM2A 1INCA 1OXGA 1RTFB 1T8LA 1C5MD 4WMFA 1NRRH 1AMHA 1MKXK 4DGJA 2GP9B 4WVPE 1E37B 2ANYA 5GJ4B 4Q7XA 2J9NA 1Z6JH 2VWNA 2WPKS 2ZHDA 2GKVE 1DM4B 4NWLA 2R9PA 5ABWA 1TGBA 3SJ8A 2ZU5A 2XRCA 4X1NU 2AGEX 1ANBA 3EE0B 4Y6DA 3FVFB 1EJNA 4FVBA 1LO6A 3WY8A 1P2MA 1TX6A 1JXPA 4MDSA 3GCNA 1PPFE 3SW2B 2F83A 2R3UA 1PYTC 2PUXB 1YPHE 4Y7AA 3LIWA 1RTLA 1GHBG 3Q77A 2BZ6H 5EQQA 1ORFA 3RXQA 1J8AA 1SQOA 1UVTH 1GBEA 3RC6A 1V2MT 1GI1A 1Z8RA 1O2WA 2Z3CA 4A5TS 4MQAA 1Z71A 2ZU1A 4XDEA 2C93B 2CMYA 1FY8E 1LHDH 1OWDA 2GMTB 1TFXA 2BD3A 1IQIA 1EJAA 1C5QA 2BZAA 1OKXA 2GZ8A 1J16A 4Y8XA 4BNRA 3SJIA 5JPMH 4K2YA 1HAIH 1MZAA 1A7SA 3F9FA 5HM9A 5C3NA 1C2KA 3NWUA 1TQ7B 2GCHG 3IITA 3U69H 2A4OA 1C1QA 1EB2A 2A1DB 2ZFPH 1L1JA 2J92A 1ACBE 1GBLA 1TQ0B 3ZVAA 3K6ZA 1SC8U 2VWLA 3VEQB 2VWMA 5HYOA 2VJ1A 1TRYA 2PWXA 3UQOA 2OP9A 6GCHG 4A1VA 1HAVB 3URDA 5C1UA 3RC4A 3LGUA 3RMOH 4GCHF 3SQEE 4E7NA 1YPEH 1T31A 3QLPH 1HNEE 2HOBA 1DS2E 3QN7A 4AZ2B 1HIAA 3RXPA 3M7UA 2IN2A 3KQCA 3ATMA 3RDZA 1OWKA 2QXIA 2ZGXH 6CHAB 2PLXA 3SNCA 1A0HB 1FN8A 4KTUA 1J14A 3FP6E 1TPAE 1AN1E 3SU6A 3L33A 1SFIA 3TGJE 1SI5H 1EZQA 1N6XA 3KNXA 3QGJA 3SNBA 1NESE 3GY8A 4YT6H 1C2DA 3A81A 3HK3B 1ELAA 4B74A 1QY6A 3M7TA 1U6QA 5EODA 1V2RT 1O2ZA 3TJOA 3RU4T 4BAOB 1B5GH 3ZZ6A 2RDLA 1C2FA 4B73A 2ZDKA 1P10A 1OWIA 2WINI 2ZHQH 3E0PB 3EAJA 4INLA 5A2MH 1HB0B 2WPJS 3GISB 4DT7B 1GMDG 3VB4A 1Y3YA 4B1TA 4I8GA 3EA7A 5DG6A 1TBZH 3DFLA 5F03A 4Q2KA 1S6FA 1W14U 3MI4A 1VITG 1N6YA 3KHVA 4ABBA 2OXSA 2NWNA 4I31A 3NXPA 1QRWA 2D2DA 1W11U 5FBIA 4I32A 1O3HA 1WU1A 3LGVA 2PSXA 1NRPH 1L4DA 1FY1A 3NK8A 5TJXA 5E8EH 3GY3A 2NU3E 1LVMA 3RXAA 2LNCA 4NGAH 2R2WU 3B8JA 1KTSB 1LCYA 2I6SA 4UFDH 1O37A 3QTOH 2ANKH 4Q7YA 1EPTA 3PM3A 1OP0A 1MKXH 4K60A 3UR9A 5JBBS 1CGJE 1GI4A 2PW8H 1ELCA 1DWDH 1Y5AT 3QTVH 1GBDA 4BXWA 1P3EA 1MZDA 3OU0A 2FS9A 4WY3A 5AF9H 2TGPZ 1C5ZB 2HVXA 3K65B 3FP7E 3SGAE 1SGIB 1WAYB 3DFJA 3T25A 1OPHB 1TRMA 2BXUH 2UWOA 3EQ0H 2XBYA 2FOGA 1Y3UA 3SGBE 1MD8A 4DJZB 4CRBA 1O3DA 3MNXA 2AMPA 3A88A 5J4QA 1EKBB 1QIXB 2ZGCA 4ABIA 5C5NA 1PQ5A 4FUIA 3D62A 3KL6A 1AE8H 4JYVH 4AFQA 2WYGA 5HMAA 2QF3A 3EGKH 1CQQA 4H4FA 2A7JA 1KLJH 1AI8H 1O3NA 4X6PA 5FHTA 4JZDH 2GVFA 2AFQB 1HJAB 4TWYA 2ZO3H 1HJAC 1OWHA 3BTGE 3E0NB 1C2GA 4NZLA 2G81E 1RFNA 4J1YA 1O33A 1LMWB 4IS5A 3RMLH 3U1IB 2FTMA 4O3TA 1A46H 2Q6GA 3SNDA 2BM2A 2F9UA 1ZTKA 2W7SA 1NRNH 1GMCF 1C5TA 3A7TA 4FXGH 3TNTA 1MAXA 1C1VH 1K1JA 1BITA 4ZHAA 3O8DA 2XW9A 1QNJA 5GCHF 5FCRA 2BYAX 3M3SA 3SI3H 7GCHF 3M5MA 2ZI2H 2J4IA 3SUEA 1EOLA 3MH5A 3CS7A 2G4UA 1SGFA 4NZQA 4DG4A 1UTPA 2QIQA 2GV7A 4MPXA 1E36B 2A7CA 1ZHRA 2PKAB 2O9QA 4X8SH 2B5TB 4E05H 2OC0A 3D49H 3PYHA 1P11E 3Q3KA 1V2VT 4LOYH 4WXIA 3E90B 1E0FD 1Y8TA 1NS3A 4BOHA 4AB9A 1GJ4H 3GDUA 3KF2A 1V2TT 1SQTA 2GTBA 5E0HA 3SN8A 2VH6A 3LU9B 4GUXA 4BXSA 1PPBH 3Q00A 1KLIH 1CGHA 4BANB 5K7RA 4DIIH 3AASA 5BPEA 1TX8A 2PGBB 1GI0A 1G3EA 1GHYH 1Z8GA 2J34A 3NZIA 3N7OA 3K2UA 2Y5FA 3MU1A 1C5UA 1GJCB 1ELBA 4GAWA 3LDXH 1PYTD 2VIVA 2XTTB 1WQVH 3PLBA 5A09A 2BLWA 3E1XB 4H6TA 4UD9H 2HNTC 1PPGE 4CRDA 3P8NA 1LHFH 2AGIX 4UFFH 1TGTA 5JB8S 2LPRA 2ODPA 1DPOA 2F91A 4O03A 2EI8A 3ZZ7A 1TNIA 3A89A 1S6HA 2VWOA 3E6PH 1NZQH 1T4UH 2GDEH 2RA0A 2R2MB 2DE9A 1IQEA 5EQSA 5HXFA 1KSNA 1ZSLA 4X2WA 1CE5A 2VH0A 3TPIZ 3UNRA 3IG6B 1GHVH 1O3MA 3LJOA 4YOIA 1UTQA 2ZA5A 4CHAB 1HAXB 1O2TA 1SGNE 4CHAC 4MNWA 5ETXA 1O3IA 3M7QA 5BRRE 1OX1A 1SGFG 3LT3A 3M61U 2FI4E 3OY5U 1C2JA 1HAOH 3SGQE 2ZG0H 4OS4A 2XC5A 4MPVA 5T3HA 4Y0YE 3ODFA 1HIAB 5FCKA 1NPMA 1FAKH 4B2BA 1XKBC 3HKIB 1ELGA 2ZFQH 1AZ8A 1TLDA 1NO9H 4HI3A 3RXKA 3MO9A 4CBOA 1OSSA 1KXEA 1A0JA 3STIA 3F6UH 2UWLA 1QL9A 2WV5A 4H42U 1K2I1 2ZU4A 1L2EA 4B75A 3A8BA 1ETTH 1THSH 2QCYA 5FPSA 1O2HA 1SOZA 7KMEH 3ZV8A 4TY6A 1BHXF 4R0IA 2F9VA 1NRSH 1PQAA 1GHWH 1UTOA 1C5VA 4JZEH 4YZUA 1GVKB 4GLYA 2HALA 9ESTA 2OQUA 4ASHA 3DHKH 4UE7H 5DP4A 4YOGA 2QYIA 4IMZA 1EUFA 1PPEE 2WPIS 1V6DA 3QGNB 1EP6A 1O5BB 1UVUH 1TB6H 1YBWA 3LC5A 1IQLA 2XC4A 4FUCA 2ZFRH 1QB9A 1ZOMA 1SGPE 1A3EH 2Y5GA 3LGTA 3RXUA 5JBTA 1LVOA 1HAPH 3E91A 2BY5X 1C2HA 1DWEH 1TMBH 4IN1A 3MNBA 1C1SA 1FV9A 5DP3A 1LKAA 3BTTE 1EZUC 1QA0A 1C5PA 2BDGA 1F5LA 2F9BH 4U01A 3PWBA 3TJNA 4U30A 3SOSA 1P8VC 1GI2A 1KLTA 3MO6A 5AHGH 1THPB 3JZ1B 2UUYA 2SGAA 2ZU3A 3SV2H 3TH3H 3RXMA 1SGCA 1Z8JB 5F6MA 1ZPCA 3W95A 2Z3DA 2G8TA 1V2WT 2GZ9A 2A5AA 4FUEA 3SU3A 1GJ5H 1NRQH 4FUDA 2OD3B 3BTWE 2PHBA 1P05A 1LDTT 1P04A 1C5WB 3KQBA 1GMCG 4BTIB 1QB6A 3SI4H 1GI8B 3GY7A 1C9PA 1H8DH 3ZZ9A 4JMYA 5GCHG 1HFDA 2XBWA 2FZZA 1C9TA 1EXFA 1OWJA 1BTYA 3QX5H 4D76A 2H5DA 7GCHG 2R3YA 3H7TA 5GXPA 5J4SA 1W0YH 3I78A 1YYY1 2THFB 3H5CB 1TRNA 1NN6A 4Y8YA 3VB6A 3NUMA 1GJ9B 1P03A 3PMJA 1E38B 1AWHB 4ISLA 4KP0A 1XX9A 3TJVA 5FPTA 1AZZA 5DO4H 5I25A 5CHAB 2BLOA 3F68H 5CHAC 5DKMA 5LPRA 4WMDA 1FXYA 4CRAA 3M3TA 4ZKOU 4HZHA 1G30B 1S5SA 1XVOA 4I7YH 2A7HA 1AFQB 1J15A 1AFQC 1JWTA 2HPQH 4NCYA 3ZVCA 1HYLA 1FIZA 1WUNH 1HAYB 3LJJA 1W3CA 2ZFTA 2VIOA 1YKTA 3Q3YA 4AGJA 1P06A 4KKDA 2C8WB 1GJAB 1F0SA 3ZZ4A 2QN5T 2FOCA 2CHAB 4WMEA 1NTPA 2CHAC 1UHBA 1ELVA 2A2QH 1W13U 3RXLA 2BX3A 1G37A 3ZZ8A 1C1PA 1F5RA 4ZUHA 2EA3A 1O3GA 1IQKA 2ZQ1A 1IQMA 4XE4A 3SJOA 1YLDA 5FXLA 5DK1A 1G2MA 1WSSH 2ZTXA 2F9PA 1HXEH 1BDAA 2PR3A 1QL7A 2ZWLH 2ZHFH 3A8CA 2PKAA 2Y6TA 1T8MA 1PFXC 1JOUB 1QQ4A 1CHGA 4YM9A 2FYRA 2BQ7B 2EI7A 1XVMA 4MPWA 4YLQH 1O35A 2H1UA 4OS5A 4K1EA 1AKSA 1DITH 4DY7B 3TGIE 1AUTC 1FNIA 5AFYH 2HGTH 1WV7H 5DJ7A 4K1TA 1Y5BT 3MFJA 3S7KB 4UDWH 1GPZA 3M5NA 1QFKH 3VXFH 2FLRH 1BTZA 1NC6A 1P3CA 2ZTYA 3LKWA 3L3TA 1YCPK 3B23B 2WV4A 4YLUA 1N1LA 3ATIA 1EOJA 4OS6A 4YTAA 1TYNA 2VVVA 4WH8A 4QT8C 2J95A 3S69A 1BBRK 4PROA 1SGTA 4IGDA 3SJ9A 4IW4E 2TGAA 3LGYA 1P9UA 4O97A 4ABEA 1C5XB 3UOUA 5A0AE 3PTNA 1NU9A 1TMTH 2V0BA 1CT0E 2STAE 2JKHA 2XWBI