1O2PA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
molecule tags Hydrolase
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2pA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2pA02
4HZHA 3FZDA 1XUGA 1L1GA 2BDBA 3S69A 3PV4A 1GVKB 3LC5A 1WBGB 2ZU4A 4D9QA 3GY6A 5EODA 4UD9H 1AKSA 3SNAA 1K1IA 1ETSH 3FAOA 2OBQA 1HAZB 2P95A 1O34A 1DWBH 5AHGH 3RXAA 3ZVDA 4GUXA 4ZHMU 1LHGH 4O97A 2QF3A 3NZIA 3ZVGA 1H8IH 2GCTC 4Y7AA 1RRKA 1FY1A 2RA0A 2A4OA 1DWDH 4XDEA 2EEKA 3BTEE 4ESTE 1D3DB 2H9HA 3F1SB 4K1SA 5EG4A 4BAKB 4TWYA 1IQGA 2C8WB 1O2QA 4GAWA 2ZTYA 1Z8IB 2LPRA 2C8YB 1ETTH 3UPEA 5DP6A 4OS5A 1TQ7B 5E2OA 1TB6H 5HGGA 8KME2 1KLIH 4RKOB 1FAKH 4BANB 1FLEE 3BG8A 2ZGXH 5L6NH 1RTFB 1FPCH 1O33A 2HPQH 4GPGA 1W2KH 3QK1A 1GI8B 2D1JA 3VEQB 5EPNA 1C4U2 1WCZA 4ABFA 2ZPRA 3SU3A 1VJ9U 1F0UA 3AW1A 3C27B 3ZVBA 4NIWA 2BD9A 5DP3A 1SSXA 1O2UA 4LOYH 1C1UH 3SV2H 3M37A 3HATH 3HKJB 4ZHAA 3PWCA 1O35A 1OWIA 4PROA 3TH4H 1P05A 4HGCA 1EJNA 3STIA 1EASA 3BEFB 4MPWA 3K6ZA 3MNSA 3RXGA 1AU8A 3MYWA 4ASHA 2PTNA 1SL3A 4BOHA 3P8OA 1QJ1B 1SR5C 3T25A 3A82A 2QXIA 1BBRK 1O3PB 2ZFQH 1GI5A 3IITA 2Y5HA 1P09A 3ZYDA 1GJ8B 2UWPA 5F03A 2AIPA 5K0HA 2XBYA 1PYTD 2PLXA 1N8OC 1BHXB 2F9BH 4H6SB 5CMXH 5FPSA 4LZ1H 4Q7YA 1UTOA 2A1DB 1GPZA 1BZXE 1Y5UT 3ZV8A 1IQKA 4A6LA 1V2ST 5IDKA 1PQ8A 3U98H 2FOGA 3RXLA 2WYJA 1PPGE 2G4TA 2BX3A 5E0JA 1AY6H 4DOQA 5JDUB 4K1EA 3ATWA 3RUOA 1V2TT 3MMGA 3P8GA 3H7TA 5GDSH 4INKA 1ACBE 1LCYA 1DVAH 1CHOF 3BF6H 1BCUH 1UHBB 1V2WT 1V2VT 1OWJA 1BITA 1EAXA 1XVMA 2CGAA 2XC5A 4WH6A 3EAJA 3ESTA 1BRBE 2WYGA 5GCHF 4WXVA 3DHKH 4X8VH 1GMDF 1NPMA 3QO6A 1C5YB 4XFQA 2KAIB 2SGDE 2EA3A 4BTTB 1C9PA 1G2LA 2BQ6B 1QBVH 1O32A 2F9NA 2FTMA 3GCHB 3AW0A 4Y0YE 4IN2A 1S0QA 3OY6U 1OKXA 2ZCLP 1HLTH 1HAVB 3I77A 5L30H 1XX9A 2GZ7A 2FX6A 1ANCA 1PQ7A 1NY22 1UTNA 1ZSJA 2R9PA 2GV7A 3OX7U 1ANEA 1AIXH 1ARCA 1WSSH 1T8LA 1QFKH 2XCFA 1GG6B 3S9CA 1SFIA 3BTFE 3M5MA 3GY2A 4DIIH 5EU8A 5FXLA 3LPRA 7ESTE 3GCOA 4FU8A 1ZPBA 4IBLH 1O3JA 1ZTJA 2BX4A 1Z7KA 3BTGE 4CHAB 6GCHG 1W0ZU 2ZCKP 2XYAA 2Z7FE 1TGBA 1O37A 1O3KA 2ODQA 1CA0B 2Q6FA 4QT8C 3GDUA 1AVXA 2F9OA 4JK6A 3ZVCA 3Q3XA 2AMPA 1L1JA 3BTHE 2NU4E 1KLTA 2QXJA 3A89A 1FZZA 3RXRA 2XC0A 1EUFA 1D3TB 4E7NA 1OX1A 1GVLA 2WUCA 1V2NT 2UUFB 3MO6A 2GDEH 3KL6A 4A5TS 3GDVA 4AX9H 5HMAA 3QGJA 2J34A 3TJNA 1Z8RA 3M5NA 3M5OA 1AFQB 4X1NU 1HJ9A 5JBAS 1CBWC 1GJDB 1EZUC 3SZNA 3P95A 3D49H 1C2DA 8ESTE 1CA8B 4FU7A 4Z0KA 4A1VA 4CRCA 1IQLA 1BOQA 3LGTA 3N7OA 1MZDA 1XXFA 1A0LA 3T28A 1TMBH 3M36A 2ZPSA 1GBIA 1NRNH 1O3DA 1O36A 1K1LA 4ZHLU 1TNGA 2FLRH 3MNBA 3I78A 5A0CA 1H9LB 1P01A 3SW2B 3SV6A 5C1UA 4K8BA 3VB5A 4AGJA 1G37A 2ZFRH 5JBBS 1OP2A 2ZA5A 1OYTH 3O8DA 3RM0H 1BHXF 1ABIH 1IQHA 4GHQA 1YP9A 3SV8A 2H2ZA 1MAXA 3DA9B 4Y6DA 2DE9A 5HM2A 9LPRA 1NESE 1F7ZA 2PUQH 5JB8S 1UTQA 1GI3A 5A8ZA 2Y82A 3QDZB 1C2IA 1BQYA 1O38A 1P2JA 3PMAB 2ZU1A 2ALVA 1YPHE 1FY8E 3V3MA 1NRPH 4AB9A 1HAXB 1C2GA 2LNCA 2OC1A 2WV5A 4B75A 4NIVA 3VFEA 5FBIA 1YPKH 9ESTA 3MFJA 1PYTC 3LGUA 1C2KA 1LHDH 1O2OA 4K8YA 1V2QT 1MBQA 4JZ1A 4D8NA 1GHYH 4YT6H 2GV6A 3SN8A 2ZFSA 1HFDA 5FBEA 1BTWA 1Z6JH 3KHVA 3V7TA 2HNTC 1YPJH 2BDYA 1C2LA 1XUHA 1C1NA 3S7HB 5H4IB 2VH0A 4B2CA 2Y5GA 1FI8A 2ESTE 1Q3XA 4ABIA 1UCYH 2QV1A 3K6YA 2BD7A 2R2WU 1UVOA 3RXDA 4CBOA 1ELEE 1SQAA 2XBXA 1HUTH 1L4ZA 4Q7ZA 4VGCB 1WTHD 3UFAA 3E6PH 2C8ZB 3PO1C 3A7YA 1SVPA 1YPLH 1SHYA 4AFQA 1C9TA 1DSUA 1CSOE 4AN7A 1P02A 1XKBC 3EE0B 2Y81A 3TITA 1MTWA 4WXIA 6GCHF 3P70B 4INLA 2RDLA 1A5GH 4NWLA 4TY7A 2FOEA 4FUDA 1FUJA 1LHFH 1MD8A 1EQ9A 1BJUA 1SLXB 3PYHA 1QB1A 1T8MA 1S85A 4AG1A 4X8TH 1DWCH 2ZDMA 3W95A 3SUDA 2WPMS 3FZZA 2ZHQH 4F49A 1OP0A 3UNSA 3R0FA 2YOLA 2FOMB 1C2FA 1ZJDA 2C8XB 5JB9S 2FP7B 1GJ9B 1O3AA 2FODA 4HI3A 1NM6A 1YCPH 1FONA 2A7HA 1P10A 1IOEA 3QLPH 4B71A 2AMQA 1TNJA 2FYRA 5AF9H 1OPHB 1P2KA 2J94A 4JZFH 3TH2H 4RN6A 1NU9A 1DXWA 4H42U 2BLOA 1O39A 2BXTH 3E3TA 1C5XB 1OOKB 4ZKNU 1HAPH 3K9XB 4ISIH 3MU1A 1QBNA 1M9UA 4CRFA 1KXBA 3RLWH 4FUEA 3PMJA 1CGIE 4FUJA 1PPBH 3EQ0H 3A85A 1C5PA 2C3SA 1DLEA 4AYVB 4AOQA 1FN8A 1SBWA 3V12A 1OP8A 1EAWA 1P9UA 4MLFB 2BDHA 1QB6A 4ABGA 7GCHG 3AASA 5EPYA 3RXFA 4ZKRU 1CO7E 2OBOA 4A1TA 5C1XA 1MKXH 4RSPA 1FAXA 3SJOA 2CF8H 6CHAB 1VITG 1O2JA 1GHVH 1GGDC 5DP5A 1PQAA 5DP4A 2GMTC 4BTIB 3ZZ7A 1Z6EA 1TBZH 4R8TB 1L0ZA 1VZQH 4X1PU 4FXGH 2UUJB 4MPUA 3E16B 4UFGH 1P57B 1NFUA 1VCQA 4Q2KA 3RXKA 1K22H 3BEUA 4H4FA 1LPKB 3S7KB 5FCKA 5LH8A 3S9BA 3GDSA 3ZVAA 4MPXA 3IG6B 5L2ZH 1UCYK 3SJ8A 1TALA 1MTNB 2JETB 5DP8A 2OC0A 4J2YB 2AFQB 1J17T 1JWTA 1NS3A 4U30A 2ANYA 1EPTB 1AZZA 5C67A 1MU8B 2AERH 2ZDAH 5DP7A 3Q3YA 1C4Y2 2ODPA 1DY8A 2BM2A 5JPMH 3HK3B 2VH6A 1LVOA 1PPHE 3E91A 4DY7B 1C1WH 1ORFA 3SU0A 2TGTA 5L2YH 3SGAE 3NCLA 2JKHA 3BTME 2PGQB 3O8BA 1THRH 2FLBH 2Q1JA 1GHWH 4K5ZA 4TYDA 1GL1A 3SJIA 2AGEX 1YPEH 2ZDVH 3RXSA 1Y3YA 2V6NA 1S83A 1CT0E 3ZZ5A 1NT1A 4ZH8A 1FPHH 2HALA 3LGYA 3MOCA 1O2LA 1A0JA 2VIDA 1CT2E 4XE4A 2BQWB 2Y5FA 1C5UA 3UOUA 3KEEA 1GI4A 3SNCA 1B5GH 3AAVA 3T26A 3A7XA 1YCPK 2VIVA 1C5TA 3RMNH 1O2XA 1GHAG 4Y71A 3QWCH 4YLUA 1RIWC 2IOTA 3ZZ4A 2XNIA 1ZZZA 2ZGCA 3RMMH 4Y76A 1YYY1 1A3BH 5TJXA 1Q31A 4UEHH 5T6DA 1BDAA 1O3GA 1RTLA 1K1JA 3RU4E 2YNAA 2ZEBA 1XUFA 1PJPA 1KY9A 3GY3A 1P9SA 1TA2A 3MH7A 5E0HA 2PKSB 4B2BA 5LPFA 2BZ6H 1HCGA 1H9IE 2OQUA 2BZAA 2F9VA 1BTHH 3VGCC 1IQEA 1HNEE 4JZEH 4YM9A 1O2ZA 1C1PA 2F3CE 2GGVB 1UCYE 1UTMA 1HAIH 1NZQH 1FIWA 2BVXH 2G5VA 2CJIA 1KXAA 1S6HA 1MKXK 2AEIH 3C1KA 2CV3A 1H1BA 1KXCA 4NWKA 1GBFA 2BLWA 1W0YH 2W7SA 2BDAA 3ZZCA 4IS5A 1K1MA 2UWLA 3LJOA 1LKBA 1HIAB 4X1QU 1BMMH 2TPIZ 4XSKU 8LPRA 2QF0A 5ETXA 1QCPA 1GDUA 2Q6GA 4X2VA 7GCHF 1AB9C 4AG2A 5BPEA 3MWIU 1O3FA 1PPFE 1MAYA 4BAHB 2PKAB 1B7XB 4KTUA 1TNHA 2Z9JA 3T5FH 2VU8E 3A7ZA 2XC4A 4AYYB 1GI0A 1B0FA 4J1YA 1VITF 1YC0A 1UK2A 1TMTH 2Y7XA 4XBBA 1GMHF 3TJUA 1ELGA 3LONA 2OC7A 3EGKH 1NU7B 1UVUH 2ZFFH 1HBTH 4GVUA 2CXVA 3MU0A 1TAWA 1C1QA 2QC2A 4OS4A 2ZGHA 3LDXH 4JYVH 4NIXA 2HLCA 2RCEA 2F9PA 1O5GH 2O8LA 1ARBA 2CHAB 2BMGB 1T7CA 5FX6A 2FOBA 1GHBG 3ODDA 1HXFH 2G51A 3PWBA 3TH3H 1SGFG 3EYDA 1SGQE 1O3BA 2A5KA 1DFPA 4IGDA 1AFEH 1QA7A 1TX7A 2ZECA 3SJ9A 4MNWA 1AE8H 1PPCE 3D23A 2PHBA 1O2KA 1HAHH 4BAQB 1GBHA 1UMAH 1TNIA 2FPZA 5DP9A 1P11E 1YGCH 1Y5BT 2GDDA 3RDZA 3GY7A 1NTPA 4OGXA 4ABBA 5AFZH 1O2YA 1NRRH 1CT4E 1YLDA 2Y6TA 1XUJA 4DURA 4KKDA 1NFWA 1YPMH 3SNEA 5T6FA 3UQOA 1LHCH 3U8OH 5EQSA 1A61H 2BQ7B 5C2ZA 2HRVA 1KYNA 1GHAF 1G9IE 3U8RH 5BRRE 5A2MH 1F0RA 4I8JA 4Y0ZE 3AAUA 3P8NA 1EZXC 2BY5X 3M7UA 1BTPA 1SQTA 3SU4A 1C5ZB 5ESBA 4BXSA 1DY9A 1A46H 1C5QA 3RXVA 4KTCA 1G30B 1N1LA 1TOMH 3O8RA 4IC5A 1HDTH 2J95A 4JZDH 1O2WA 3IWMA 5ESTE 3BN9A 2PR3A 1FJSA 1QRZA 1E35B 5EW2H 5C1YA 2NU3E 3T62A 4YOIA 1QL8A 3BTQE 3GY4A 2GCHG 3KQBA 2SNWA 3LKWA 1WU1A 3F9FA 1AVGH 3VB4A 4CR5A 3U8TH 2BXUH 1G32B 1V3XA 2OTVA 4XOJA 5C5OA 1AN1E 1W7GH 1G36A 3SNDA 1UHBA 2C93B 1GCTC 1P2IA 1ZSKA 2FOAA 2RG3A 4Y8ZA 3SI4H 3UY9A 2P8OC 1KXEA 2O8UA 2B8OH 1EB2A 2A2XH 1Y3VA 1AI8H 3SUFA 3RXTA 1K9OE 2BD2A 1ZMLA 4FUGA 2KAIA 1VCPA 2FXRA 3M3SA 4E7RG 2FI3E 3TLOA 3A8BA 2GX4A 5T6GA 1KDQB 5A0BA 3A7WA 1BRCE 1BBRE 3QN7A 3TGJE 1W10U 5A8XA 1GBDA 2WPKS 2Y80A 4NIYA 2VWMA 3RXCA 8GCHG 3GYLB 1W12U 1HAVA 2EI6A 3B23B 1FQ3A 3URDA 4ZKOU 3PLKA 1UVPA 2H5DA 2BVSH 1VGCB 1FY3A 1GI6A 1ELDE 4WMEA 2Q6DA 2RA3A 1A4WH 2A7JA 3UR6A 1EAIA 2IPHA 1GHBF 2STAE 2ZNKH 4ISOA 4ISLA 5LPEA 3KQCA 1DSTA 1J16A 3LC3A 1THSH 3BG4C 2A5IA 1EXFA 1O5FH 1QHRB 1SOTA 1D3QB 1TLDA 3ZZ9A 3TIUA 2ZKSA 1UJ1A 3ENSB 1L2EA 4Z6AH 4FUHA 2SGAA 2A4GA 2VGCB 1K21H 3SU1A 1AD8H 2QAAA 5EXLA 1G3EA 4LK4A 1LHEH 2B9LA 1ESBA 4DGJA 3MH5A 5CHAB 1ZRBA 2TRMA 4JYTA 4A1XA 1SMFE 3EA8A 3PM3A 1AVWA 3S9AA 1JRTA 1SGEE 2ZF0H 1BA8B 1IQJA 2VIOA 3PTBA 1V6DA 1EOJA 1P0SH 1ZLRA 1ANDA 5JBTA 1QL7A 3NWUA 3URCA 5CE1A 1HJAC 1K1NA 4TPIZ 1P2MA 1P2NA 4K69A 1CHGA 2PTCE 3P6ZB 5FPTA 1MKWH 4I33A 1O2RA 1O31A 4BAMB 1GBKA 1GI1A 2K1QA 3PMBB 1G3BA 1W14U 1LQEA 4NSYA 5E8EH 1AWHB 3RC4A 3B9FH 2ANWA 3RXUA 1Z1IA 1Z8GA 2M5TA 3BV9B 2OD3B 4WJG2 2THFB 4ZXXH 4DCDA 1Y8TA 2ZIQH 1GJ6A 5EQRA 1A0HB 2GCHF 2XRCA 1ID5H 2NU2E 5SGAE 1ZHMA 2OCVB 3PROA 3KNXA 1GHZA 3TVJB 2TGDA 1LQDB 7KMEH 3BTTE 4AFUA 2HNTE 2A45B 3KGPA 2ODYB 1ETRH 1F2SE 1GBLA 1P2OA 4OGYA 4ABAA 1Y3WA 1BRUP 2VB0A 4AB8A 1KXDA 1SPJA 2G4UA 2XCNA 3MI4A 2UUYA 4TPYA 4H6TA 1BJVA 4LZ4B 2QY0B 2GCTB 1HYLA 2C4FH 4KP0A 5J4SA 2PWXA 1GL0E 1SC8U 1JIMA 3BIUH 4B73A 2ZU3A 3UIRA 2FI4E 3SORA 3WY8A 8GCHF 1A5IA 1O5BB 1GHXH 3GYMA 2ZHDA 1KLJH 4NA8A 3GCTG 1SGPE 2ZHFH 2FOHA 4WMDA 4X1SU 1DICA 1J15A 1V2PT 4X6NA 2J92A 4X1RU 2QGRA 1RJXB 2W7UA 1O2IA 2R0KA 2O9QA 4O3TA 3I29A 3ZZDA 1IQMA 1YPHC 1BMLA 2G81E 1P3EA 1MQ5A 1ZPZA 2VWLA 4OS7A 1GBCA 2OP9A 1BIOA 4ABDA 3ATLA 3GISB 4F4OC 1HPGA 2ZDLA 4X6PA 1Z1JA 1WQVH 1YPGH 4MVNA 2AGIX 3RU4D 4B74A 1ZHPA 1QGFA 2AGGX 1MTVA 2G8TA 1GMCG 1O2SA 2PGBB 1HV7A 1V2OT 2XBVA 1ABJH 4MDSA 1C5OH 1IQIA 1GJ7B 1MD7A 1IHTH 1MTSA 4ZXYH 1EJAA 3U9AH 1SLVB 2DE8A 1MKWK 1TWXB 3MTYA 2ZHEH 4Q7XA 1BMAA 4IMZA 3T27A 1BMNH 3CP7A 3D62A 1N8OB 4K1TA 1O5AB 1F5LA 2W26A 2FI5E 3TNSA 3KIDU 1QJ6B 3QZQA 1QIXB 1O5DH 4FVBA 1NO9H 3RXOA 3OY5U 4NFEA 2EC9H 2H5CA 4NSVA 3F9HA 1OXGA 3HGNA 2J38A 3JZ1B 1DPOA 2V3OH 4DG4A 3QGNB 2ILNA 3RC6A 1NRQH 5GXPA 3OYPA 1BTUA 2FS8A 2BD5A 4ISHH 4NG9H 2QXGA 3A7TA 3SBKA 2Z9GA 1JXPA 3PTNA 2R3YA 4ISNA 2OXSA 1O2VA 4Y8XA 2P3FH 3ATKA 1EX3A 2Z3EA 1QY6A 1F92A 1MUEB 1ZR0A 2AS9A 1A5HA 3MH6A 1N6YA 1UTLM 3MO9A 3TU7H 4E06H 1QJ7B 5TCAA 1T4VH 3B8JA 3VXEH 5HM9A 1HGTH 4UE7H 2A5AA 3A8AA 3HPTB 4UFFH 3RC5A 3SNBA 3TJVA 3SHCH 1O3MA 2NU1E 2QXHA 1F0SA 4I8HA 1T8NA 2BDGA 3QZRA 2GKVE 3LGIA 1YF4A 1D6RA 1TGNA 2VVUA 3ZYEA 1MU6B 2BY6X 1CU1A 2XBWA 3GCHC 4UFDH 1SGTA 1W3CA 2Z6BD 5DG6A 4MNVA 3P92A 5HXFA 3LGVA 3GY5A 1F0TA 5JYIA 1YM0A 1EP5A 2GP9B 1G2MA 4YLQH 2XW9A 4D9RA 1A3EH 2ASUB 3U1IB 1PFXC 3EA9A 2J9NA 4I8GA 4D7FA 2ZTZA 3DT0H 1ZPCA 1DANH 2H9TH 1KSNA 4GCHG 4JMYA 1GG6C 1EPTA 2GT7A 2V3HH 3ATMA 3CENA 2VIQA 1Z8JB 3EDXB 2W3KA 2P3TB 4CR9A 3MNXA 2BY7X 2VWOA 1H8DH 1FN6A 1OWHA 4WMFA 1TQ0B 5GIBA 3QX5H 4UDWH 1GBJA 2A32A 3KQDA 4FUFA 4U32A 4NGAH 3LOXA 5HYOA 2G5NA 1MZAA 1QA0A 1LVBA 5FX5A 2Z3DA 4CHAC 4UFEH 1SGYE 3FP8E 1O5EH 2ZFPH 4AFSA 1TMUH 3PLBA 2WPHS 2SGFE 1SOZA 1TOCB 1ESAA 2H1UA 1CA0C 5FHTA 1DDJA 3QUMP 4Y7BA 1QNJA 3SHAH 5A09A 1QB9A 3E8LA 1GCDA 1GMCF 1Y59T 4LXBH 4CRDA 3R3GB 1NFXA 3TPIZ 1SGRE 5DGJA 2XWAA 1TX6A 1K1OA 2TGPZ 2FOCA 5K7RA 3TNTA 1CBWB 2W5EA 5E0GA 3NPSA 1SGNE 5GPIB 1V2UT 3V0XA 1EOLA 2FIRH 4MPVA 4I8LA 1CGHA 1GDNA 1AFQC 1K2I1 4JYUH 1EJMA 1S6FA 3M7QA 3UNQA 2A7CA 1ZTKA 1O2HA 5B6OA 3FP6E 5IYTA 3Q00A 4KTSA 1ZGIA 2GTBA 1ELFA 1V2RT 4I31A 1CQQA 3A8CA 1ZTLA 2Z3CA 3H7OA 1O3IA 1C5NH 4CH2B 1XUKA 2ANKH 1HAGE 1S84A 1SFQB 1QQUA 5F8XA 1AUJA 1IHSH 1GMDG 1HIAA 1AKSB 1QTFA 1S81A 3ZZ6A 1UK4A 1JOUB 2BD3A 2ZGBH 3KF2A 2P94A 2VWNA 2QN5T 2PKAA 3GY8A 3VPKA 1E34B 1C2JA 1L1NA 3SUEA 4A92A 5DO4H 3RMLH 2ZFTA 1ZJKA 1ZYOA 1Y5AT 3OU0A 1SGFA 3SU5A 3SUGA 1MH0A 1J9CH 2A4QA 1C1TA 1ZRKA 4O3UA 4ZAEA 2I6SA 3SV7A 1GDQA 3P8FA 2WV4A 1MTUA 1N6XA 5FAHA 3H5CB 1QRXA 1KTTB 3MU8A 2VINA 3A7VA 4FU9A 4M7GA 1AQ7A 2B7DH 3NKKA 2ZWLH 3MH4A 3ATIA 4Y8YA 3ZV9A 1Y3XA 2P16A 4AGKA 3DD2H 1TYNA 4THNH 1TX8A 2B0FA 1CGJE 4IC6A 4CREA 4GCHF 5GJ4B 4WVPE 3RXBA 1BT7A 3M3TA 1EZQA 2HVXA 2P59A 5F6MA 2Z9LA 1O3OA 3PO1B 4MNYA 3LH3A 2W3IA 1K28D 4MG3A 2FWWA 4VGCC 1INCA 1D4PB 1TPOA 2DUCA 4NA7A 2BY9X 5GWZA 5G4BA 3W94A 3E0PB 3M61U 3T29A 4TWWA 1MQ6A 3K65B 2P93A 3ODFA 1ELAA 2WINI 4MTBA 2EI7A 4SGBE 4ABJA 2HGTH 2QA9E 3NXPA 3F9EA 4JZIA 1HAOH 4DW2U 5C3NA 3SQHE 1C2HA 2WUBA 1C1VH 1GBAA 4Q80A 3VB7A 3UWIA 1Y3UA 2PSXA 1NFYA 1KXFA 1SLUB 1OSSA 1E36B 1NN6A 2GVFA 3OSYA 1TGTA 1UVTH 3VXFH 1FNIA 2QCYA 4K60A 1ZMJA 2BTCE 1TRNA 3ZZAA 3T2NA 2ZQ2A 2FMJA 4WH8A 2G00A 1ZMNA 1MCTA 1V2KT 5F8ZA 1QRWA 3CS0A 3UR9A 3A81A 6ESTA 1AHTH 1VR1H 2ZHWH 3M3VA 1TE0A 1WV7H 1AO5A 1UVSH 2VJ1A 1C5SA 2ZCHP 4GHTA 4HFPB 2IN2A 3HKIB 4ZMAH 1T31A 1LKAA 2HOBA 1GWAA 2BD4A 3MU4A 2VVVA 1YLCA 3STJA 4A7IB 1C2MA 2QIQA 2PUXB 2GD4B 2FDAA 1LDTT 4JCNA 2GT8A 2TBSA 4SGAE 1OS8A 5EXNA 1V2LT 4NZQA 5AFYH 3BTDE 6CHAC 3A84A 1GGDB 2F83A 3SU6A 2GMTB 1TFXA 4NFFA 3SQEE 3RU4T 3CS7A 5C20A 1SHHB 1D9IA 1GBMA 3RLYH 4IMQA 1TPPA 4CRBA 1V2MT 2O8MA 1LTOA 1AE5A 3MNCA 1KDQA 2PSYA 1GJCB 1LPGB 3LIWA 3FANA 4MNXA 1TGCA 2WPIS 2CN0H 2FESH 4U2WA 1O30A 4Y10E 1P2QA 3E1XB 4FUIA 1XMNB 4YESB 1S0RA 1T4UH 1G3CA 1BTZA 2UWOA 2Y7ZA 2ZU2A 1MTNC 1P8VC 3Q77A 1SGCA 1C5LH 2JETC 2R3UA 2ZDKA 2QYIA 1TRMA 2OC8A 1EPTC 5EXMA 4DT7B 1O3EA 1WUNH 1W13U 5ABWA 2H6MA 4HTCH 1FV9A 3QTVH 3QTOH 5C5NA 4UONA 1G3DA 1O2NA 4D76A 3UREA 3P17H 1O3NA 3RXQA 2FZZA 3TGIE 2A0QB 1T8OA 1JRSA 1THPB 1TABE 4X2YA 2HNTF 2Z9IA 3MHWU 1W8BH 1DS2E 2ZU5A 1C2EA 1GBTA 4O03A 1SGIB 1S5SA 1ELBA 1BTXA 4BTUB 1GJ5H 1RIWB 3Q3KA 3PLPA 3GOVB 4X6MA 2A2QH 2WPLS 3K2UA 2JH0D 1E0FD 1MBMA 3VB6A 5JBCS 1A1RA 4INHA 4KGAA 3BTKE 3VB3A 2Z9KA 5A0AE 1RD3B 2F91A 1RXPA 1XXDA 2BOHB 3BSQA 3NUMA 2FEQH 1AWFH 1EATA 1MMJN 3F9GA 3SV9A 3KCGH 5LPRA 3F68H 2O8TA 1QBOA 3ZVEA 2PKSC 3A83A 1TPAE 3JZ2B 3VGCB 1DX5M 1TPSA 4Y11E 1C4V2 2ZPQA 1LPZB 2AYWA 1H9HE 2D2DA 4X8UH 4CH8B 2TGAA 3DFJA 2Z94A 4TY6A 5DPAA 4CRAA 1VCWA 2EI8A 1EZSC 2AMDA 4MQAA 2D8WA 3UTUH 1KIGH 1O2TA 1ELCA 1SB1H 1SG8B 4ZROA 3U1JB 2ZP0H 1GBEA 1YCPM 1TNKA 2VIWA 3AVZA 1DITH 4GLYA 4DJZB 3F6UH 4X2XA 1DOJA 1HAYB 3HGPA 2ULLA 2C90B 2SGQE 2V35A 2JH6D 2XWBI 1C1RA 1MCVA 2FS9A 4X0WU 1AB9B 1C5WB 1WOFA 1IQFA 1VJAU 3RXMA 4D7GA 1GJBB 1FY4A 4FUCA 1C1MA 2AIQA 1K1PA 3UUZA 1ZSLA 1D3PB 5I25A 1NROH 1F5RA 3PB1E 4XBCA 1V2JT 1FY5A 4Y79A 2A31A 4BAOB 3UNRA 3E90B 1ELTA 1UTJA 5FCRA 2STBE 4I32A 1EAUA 1WQSA 1QQ4A 1BRAA 1HRTH 2BLVA 4NZLA 1IQNA 3ZVFA 7LPRA 4AFZA 4OS1A 2XXLA 3NK8A 1O3HA 1PQ5A 4FVDA 3SI3H 1BB0B 1O0DH 2PFEA 3SO3A 4WF8A 3UQVA 2SGEE 2ZZUH 2CHAC 3TK5A 4U01A 1TA6A 4ABEA 6LPRA 5LGOA 2VNTA 3E0NB 1AGJA 1B0EA 1UO6A 1GJ4H 2OUAA 2SFAA 5EW1H 1DXPA 2FM2A 1TIOA 2V0BA 4R0IA 3TK6A 3KN2A 1P12E 1J14A 4CBNA 2ZO3H 1X7AC 1PPZA 1ANBA 1GI9B 3Q76A 2F9UA 4WY3A 2BD8A 3LGWA 1UTPA 1BUIA 1RFNA 3RXIA 1FMGA 3G01A 4E05H 1DUEA 2XTTB 4K3JA 1C1OA 1IAUA 1QL9A 1WAYB 1DM4B 3LU9B 4IW4E 3SGQE 3UOPA 2OINA 3RXPA 1KTSB 4YTAA 2NU0E 3U69H 1XKAC 5EQQA 2PV9B 4ABHA 1W7XH 3M35A 4IN1A 2ZTXA 5PTPA 1OWEA 2BY8X 1A2CH 2ZG0H 4K2YA 1P3CA 4X6OA 2FTLE 1P06A 1HB0B 1YBWA 2TIOA 3ELAH 1Z71A 5E2PA 1CVWH 3GICB 4XBDA 4GSOA 3FP7E 3V13A 1NRSH 4YZUA 1SLWB 4YT7H 2CF9H 2BHGA 2J4IA 1E38B 3DFLA 1J8AA 3TGKE 1O3CA 2G55A 3DUXH 2ZC9H 2OLGA 1RTKA 1ELVA 3MU5A 3ZZ8A 3UWJH 2NWNA 4KELA 1QURH 2H9EH 3GCNA 3SJKA 2FYQA 4CRGA 5DK1A 2FOFA 1AMHA 1GBBA 4YOGA 4O9VA 1F5KU 4YOJA 4DIHH 1HXEH 4WWYA 2PW8H 3BTWE 3ZZ3A 2ZQ1A 5FPYA 3OTJE 3SGBE 1DWEH 2G52A 1GI2A 2B5TB 3BEIB 1GCTB 5EGMA 1D6WA 2I6QA 2P8OB 3MO3A 3A87A 4RKJB 3ITIA 1O2GH 2HWLB 2ALPA 3A8DA 1TBRH 4X8SH 2FO9A 4B1TA 3EA7A 1XUIA 5AVDA 1TNLA 1RGQA 1O2MA 3RXEA 1GMHG 1UK3A 1VITH 2BLQA 1U6QA 3L3TA 1T32A 3TK9A 2BDIA 2AH4X 3RMOH 3M5LA 5DJ7A 5T3HA 4OS2A 2ZI2H 1SQOA 5EOKA 5J4QA 1LMWB 2BB4A 3RM2H 1YKTA 2O8WA 3LJJA 2YNBA 5A8YA 1VGCC 1WTGH 3GCTF 1EB1H 4FUBA 3M7TA 1DT2A 4I8KA 2J2UA 1H4WA 1P04A 1XM1A 2VIPA 2BVRH 1SI5H 3O8CA 2WPJS 2VVCA 1TBQH 2OQ5A 1OWKA 3BG4B 1FIZA 3LT3A 4B2AA 1GI7B 3RXHA 1TONA 1QR3E 4YO9A 3FFGA 4I7YH 1HJ8A 5F8TA 1GJAB 2ZGJA 3SU2A 2CMYA 1GVZA 1JBUH 4AZ2B 1S82A 4BNRA 1O2PA 4DVAU 3KQEA 2A4RA 2SGPE 1E37B 1XVOA 2VGCC 2FX4A 1C5RA 2R0LA 3RP2A 1P03A 1SGDE 4NA9H 1ZOMA 1C5VA 2ANMH 2D26C 3RXJA 1LVMA 5CHAC 3PMHB 1FXYA 4ZKSU 1RS0A 1OYQA 1ZGVA 1CE5A 3L6PA 5TCCA 3A80A 3BIVH 4X2WA 1HJAB 2BYAX 1C5MD 3LH1A 2HPPH 3L33A 1ZHRA 3HK6B 3S0NA 1JIRA 1LVYA 1FDPA 1DE7H 1PPEE 1O3LA 1JMOH 1W11U 1TGSZ 5I46H 1BBRH 2GZ9A 2GZ8A 3TJOA 1AZ8A 4AORA 4ZUHA 2ZDNA 1ESTA 4NCYA 2P3UB 5DKMA 1EKBB 3A86A 3D65E 1TRYA 2JH5D 4OS6A 1UTKA 2UUKB 2BOKA 1DLKB 1AUTC 1OWDA 3SOSA 3FVFB 1O5CB 2IJOB 4BXWA 1CHOG 1LO6A 2BDCA 1BTYA 1WYKA 2R2MB 3A88A 2SNVA 1DUAA 1A7SA 5GCHG 1L4DA 4JK5A 3ZZBA 1Q2WA 4B76A 1EP6A 1C1SA 1NC6A
chains in the Genus database with same CATH superfamily
4HZHA 3FZDA 1XUGA 1L1GA 2BDBA 3S69A 3PV4A 1GVKB 3LC5A 1WBGB 2ZU4A 4D9QA 1VKYA 3GY6A 4Z1MD 5EODA 4UD9H 1AKSA 3SNAA 1K1IA 1ETSH 2LP6A 3FAOA 2OBQA 1HAZB 2P95A 1O34A 1DWBH 2KCPA 5AHGH 3RXAA 3ZVDA 4GUXA 4ZHMU 1LHGH 4O97A 2QF3A 3NZIA 3ZVGA 1H8IH 2GCTC 4Y7AA 1RRKA 1FY1A 2RA0A 2A4OA 1DWDH 4XDEA 2EEKA 3BTEE 4ESTE 1D3DB 2H9HA 3F1SB 4K1SA 5EG4A 4BAKB 4TWYA 1IQGA 2C8WB 1O2QA 4GAWA 2ZTYA 1Z8IB 2LPRA 2C8YB 1ETTH 3UPEA 5DP6A 4OS5A 1TQ7B 5E2OA 1TB6H 5HGGA 8KME2 1KLIH 4RKOB 1FAKH 4BANB 1FLEE 3BG8A 2ZGXH 5L6NH 1RTFB 1FPCH 1O33A 2HPQH 4GPGA 1W2KH 3QK1A 1GI8B 2D1JA 3VEQB 5EPNA 1C4U2 1WCZA 4ABFA 2ZPRA 3SU3A 1VJ9U 1F0UA 3AW1A 3C27B 2RDEA 3ZVBA 4NIWA 2BD9A 5DP3A 1SSXA 1O2UA 4LOYH 1C1UH 3SV2H 3M37A 3HATH 3HKJB 4ZHAA 3PWCA 1O35A 1OWIA 4PROA 3TH4H 1P05A 4HGCA 1EJNA 3STIA 1EASA 3BEFB 4MPWA 3K6ZA 3MNSA 3RXGA 1AU8A 3MYWA 4ASHA 2PTNA 1SL3A 4BOHA 3P8OA 1QJ1B 1SR5C 3T25A 3A82A 2QXIA 1BBRK 1O3PB 2ZFQH 1GI5A 3IITA 2IPQX 2Y5HA 1P09A 3ZYDA 1GJ8B 2UWPA 5F03A 2AIPA 5K0HA 2XBYA 1PYTD 2PLXA 1N8OC 1BHXB 2F9BH 2F4LA 4H6SB 5CMXH 5FPSA 4LZ1H 4Q7YA 1UTOA 2A1DB 1GPZA 1BZXE 1Y5UT 3ZV8A 1IQKA 4A6LA 1V2ST 5IDKA 1PQ8A 3U98H 2FOGA 3RXLA 2WYJA 1PPGE 2G4TA 2BX3A 5E0JA 1AY6H 4DOQA 5JDUB 4K1EA 3ATWA 3RUOA 1V2TT 3MMGA 3P8GA 3H7TA 5GDSH 4INKA 1ACBE 1LCYA 1DVAH 1CHOF 3BF6H 1BCUH 1UHBB 1V2WT 2JJ1D 1V2VT 1OWJA 1BITA 1EAXA 1XVMA 2CGAA 2XC5A 4WH6A 3EAJA 3ESTA 2RFKC 1COWD 1BRBE 2WYGA 5GCHF 1UW7A 3DHKH 4WXVA 4X8VH 1GMDF 1NPMA 3QO6A 1C5YB 4XFQA 2KAIB 2SGDE 2EA3A 4BTTB 1C9PA 1G2LA 2BQ6B 1QBVH 1O32A 2F9NA 2FTMA 3GCHB 3AW0A 4Y0YE 4IN2A 1S0QA 3OY6U 1OKXA 2ZCLP 1HLTH 1HAVB 3I77A 5L30H 1XX9A 2GZ7A 2FX6A 1ANCA 1PQ7A 1NY22 1UTNA 1ZSJA 2R9PA 2GV7A 3OX7U 2LELA 2W6JD 1ANEA 1AIXH 1ARCA 1WSSH 1T8LA 1QFKH 2XCFA 1GG6B 3S9CA 1SFIA 3BTFE 3M5MA 3GY2A 4DIIH 5EU8A 5FXLA 3LPRA 7ESTE 3GCOA 4FU8A 1FX0B 1ZPBA 4IBLH 1O3JA 1ZTJA 2BX4A 1Z7KA 3BTGE 4CHAB 6GCHG 1W0ZU 2ZCKP 2XYAA 2Z7FE 1TGBA 1O37A 1O3KA 2ODQA 1CA0B 2Q6FA 4QT8C 4XD7D 3GDUA 1AVXA 2F9OA 1MABB 4JK6A 3ZVCA 3Q3XA 2AMPA 1L1JA 3BTHE 2NU4E 1KLTA 2QXJA 3A89A 3OEED 1FZZA 3RXRA 2XC0A 1EUFA 1D3TB 4E7NA 1OX1A 1GVLA 2WUCA 1V2NT 2UUFB 3MO6A 2GDEH 3KL6A 4A5TS 3GDVA 4AX9H 5HMAA 3QGJA 2J34A 3TJNA 1Z8RA 3M5NA 3M5OA 1AFQB 4X1NU 1HJ9A 5JBAS 1CBWC 1GJDB 1EZUC 3SZNA 3P95A 3D49H 1C2DA 8ESTE 1CA8B 4FU7A 4Z0KA 4A1VA 4CRCA 1IQLA 1BOQA 3LGTA 3N7OA 1MZDA 1XXFA 1A0LA 3T28A 1TMBH 3M36A 2ZPSA 1GBIA 1NRNH 1O3DA 1O36A 1K1LA 4ZHLU 1TNGA 2FLRH 3MNBA 3I78A 5A0CA 1H9LB 1P01A 3SW2B 3SV6A 5C1UA 4K8BA 3VB5A 4AGJA 1G37A 2ZFRH 5JBBS 4B6FA 1OP2A 2ZA5A 1OYTH 3O8DA 3RM0H 1BHXF 1ABIH 1IQHA 4GHQA 1YP9A 3SV8A 1S6LA 2H2ZA 1MAXA 3DA9B 4Y6DA 2DE9A 3PRDA 5HM2A 9LPRA 1NESE 1F7ZA 2PUQH 5JB8S 1UTQA 1GI3A 5A8ZA 2Y82A 3QDZB 1C2IA 1BQYA 1O38A 1P2JA 3PMAB 2ZU1A 2ALVA 1YPHE 1FY8E 3V3MA 1NRPH 4AB9A 1HAXB 1C2GA 2LNCA 2OC1A 2WV5A 4B75A 4NIVA 3VFEA 5FBIA 1YPKH 9ESTA 3MFJA 1PYTC 3LGUA 1C2KA 1LHDH 1O2OA 4K8YA 1V2QT 1MBQA 4JZ1A 4D8NA 1GHYH 2OK5A 4YT6H 2GV6A 3UAIC 3SN8A 2ZFSA 1HFDA 5FBEA 1BTWA 1Z6JH 3KHVA 3V7TA 2HNTC 1YPJH 2BDYA 1C2LA 1XUHA 1C1NA 3S7HB 5H4IB 3H09A 2VH0A 4B2CA 2Y5GA 1FI8A 4FETA 2ESTE 1Q3XA 4ABIA 1UCYH 2QV1A 3K6YA 2BD7A 2R2WU 1UVOA 3RXDA 4CBOA 1ELEE 3N7DA 1SQAA 2XBXA 1HUTH 3OEHD 1L4ZA 4Q7ZA 4VGCB 1WTHD 3UFAA 3E6PH 3OE7D 2C8ZB 3PO1C 3A7YA 1SVPA 1YPLH 1SHYA 4AFQA 1C9TA 1DSUA 1CSOE 4AN7A 1P02A 1XKBC 3EE0B 2Y81A 3TITA 1MTWA 5EJZA 4WXIA 6GCHF 3P70B 4INLA 2J5UA 2RDLA 1A5GH 4NWLA 4TY7A 2FOEA 4FUDA 1FUJA 1LHFH 1MD8A 1EQ9A 1BJUA 1SLXB 3PYHA 1QB1A 1T8MA 1S85A 4AG1A 4X8TH 1DWCH 2ZDMA 3W95A 3SUDA 2WPMS 3FZZA 1E1RD 2ZHQH 4F49A 1OP0A 3UNSA 2KCOA 3R0FA 2YOLA 2FOMB 1C2FA 1ZJDA 2C8XB 5HIYA 3F0PA 5JB9S 2FP7B 1GJ9B 1O3AA 2FODA 2JDID 1NM6A 4HI3A 1YCPH 1FONA 2A7HA 1P10A 2L6OA 1IOEA 3QLPH 4B71A 2AMQA 3F2HA 1TNJA 2FYRA 5AF9H 1OPHB 1P2KA 2J94A 4JZFH 3TH2H 4RN6A 1NU9A 1DXWA 4H42U 2BLOA 1O39A 2BXTH 3E3TA 3PV5A 1C5XB 1OOKB 4ZKNU 3OFND 1HAPH 3K9XB 4ISIH 3MU1A 1QBNA 1M9UA 4CRFA 1KXBA 3RLWH 4FUEA 3PMJA 1CGIE 4FUJA 5IK2D 1H8HD 1PPBH 3EQ0H 3A85A 1C5PA 2C3SA 1DLEA 2K0QA 4AYVB 4AOQA 1FN8A 1SBWA 2YMSB 3V12A 1OP8A 1EAWA 1P9UA 4MLFB 2BDHA 1QB6A 4ABGA 4YXWD 7GCHG 3AASA 5EPYA 2AHME 3CNRA 3RXFA 4ZKRU 1CO7E 2OBOA 4A1TA 5C1XA 1MKXH 4RSPA 1FAXA 3FO8D 3SJOA 2CF8H 6CHAB 1VITG 1O2JA 1GHVH 4DT4A 2K8IA 1GGDC 5DP5A 1PQAA 5DP4A 2GMTC 4BTIB 5GNDA 3ZZ7A 1Z6EA 1TBZH 4R8TB 1L0ZA 1VZQH 4X1PU 4FXGH 2UUJB 4MPUA 3E16B 4UFGH 1P57B 1NFUA 2WHXA 1VCQA 4Q2KA 3RXKA 1K22H 3BEUA 4H4FA 1LPKB 3S7KB 5FCKA 5LH8A 3S9BA 3GDSA 3ZVAA 4MPXA 3IG6B 5L2ZH 1UCYK 3SJ8A 1TALA 1MTNB 3WWBA 2JETB 5DP8A 2OC0A 4J2YB 2AFQB 1J17T 1JWTA 1NS3A 4U30A 2ANYA 1EPTB 1AZZA 5C67A 3ZIAD 1MU8B 2JJ2D 2AERH 2ZDAH 5DP7A 3Q3YA 1C4Y2 2ODPA 1DY8A 2BM2A 5JPMH 3HK3B 2VH6A 1LVOA 1PPHE 3E91A 4DY7B 1C1WH 1ORFA 3SU0A 2TGTA 5L2YH 3SGAE 3NCLA 2JKHA 2QF5A 2PGQB 3BTME 3O8BA 1THRH 2FLBH 2Q1JA 1GHWH 4K5ZA 4TYDA 1GL1A 3SJIA 2AGEX 1YPEH 2ZDVH 3RXSA 3AK5A 3N7EA 1Y3YA 2V6NA 1S83A 1CT0E 3ZZ5A 1NT1A 4ZH8A 1FPHH 2HALA 3LGYA 3MOCA 1O2LA 1A0JA 2VIDA 1CT2E 4XE4A 2V7QD 2BQWB 2Y5FA 1C5UA 3UOUA 5KGOA 3KEEA 1GI4A 3SNCA 1B5GH 3AAVA 3T26A 3A7XA 1YCPK 2VIVA 1C5TA 3RMNH 1O2XA 1GHAG 4Y71A 3QWCH 4YLUA 1RIWC 2IOTA 3ZZ4A 2XNIA 1ZZZA 2ZGCA 3RMMH 4Y76A 1YYY1 1A3BH 5TJXA 1Q31A 4UEHH 5T6DA 1BDAA 1O3GA 1RTLA 1K1JA 3RU4E 4OM9A 2YNAA 2ZEBA 1XUFA 1PJPA 1KY9A 3GY3A 1P9SA 1TA2A 3MH7A 5E0HA 2PKSB 4B2BA 5LPFA 2BZ6H 1HCGA 1H9IE 2OQUA 2BZAA 2F9VA 1BTHH 3VGCC 1IQEA 1HNEE 4JZEH 4YM9A 1O2ZA 1C1PA 2F3CE 2GGVB 1UCYE 1UTMA 1HAIH 1NZQH 1FIWA 2BVXH 2G5VA 2CJIA 1KXAA 4B6EA 1S6HA 1MKXK 2AEIH 3C1KA 2CV3A 1H1BA 1KXCA 4NWKA 1GBFA 2BLWA 1W0YH 2W7SA 2BDAA 3ZZCA 2JIZD 4IS5A 1K1MA 2UWLA 3LJOA 1LKBA 1HIAB 4X1QU 1BMMH 2TPIZ 4XSKU 8LPRA 2QF0A 5ETXA 1QCPA 1GDUA 2Q6GA 4X2VA 7GCHF 1AB9C 4AG2A 5BPEA 3MWIU 1O3FA 1PPFE 1MAYA 4BAHB 2PKAB 1B7XB 4KTUA 1TNHA 4AC9A 2Z9JA 3T5FH 2VU8E 3A7ZA 2XC4A 4AYYB 1GI0A 1B0FA 4J1YA 1VITF 1YC0A 1UK2A 1TMTH 2Y7XA 4XBBA 1GMHF 3TJUA 1ELGA 3LONA 2OC7A 3EGKH 1NU7B 1UVUH 2ZFFH 1HBTH 4GVUA 2CXVA 2EY4C 3KQ5A 3MU0A 1TAWA 1C1QA 2QC2A 4OS4A 2ZGHA 3LDXH 4JYVH 4NIXA 2HLCA 3SZEA 2RCEA 2F9PA 1O5GH 2O8LA 1ARBA 2CHAB 2BMGB 1T7CA 5FX6A 2FOBA 1GHBG 3ODDA 1HXFH 2G51A 3PWBA 3TH3H 1SGFG 3EYDA 1SGQE 1O3BA 2A5KA 1DFPA 4IGDA 1AFEH 1QA7A 1TX7A 2ZECA 3SJ9A 4MNWA 1AE8H 4F48B 1PPCE 3D23A 2PHBA 1O2KA 1HAHH 4BAQB 1GBHA 1UMAH 1TNIA 2FPZA 3OAAD 5DP9A 1P11E 1YGCH 1Y5BT 2GDDA 3RDZA 3GY7A 1NTPA 4OGXA 4ABBA 5AFZH 1O2YA 1NRRH 1CT4E 1YLDA 2Y6TA 4ACAA 1XUJA 4DURA 4KKDA 1NFWA 1YPMH 3SNEA 5T6FA 3UQOA 1LHCH 3U8OH 5EQSA 1A61H 2BQ7B 5C2ZA 2HRVA 1KYNA 1GHAF 1G9IE 1SQRA 3U8RH 5BRRE 5A2MH 1F0RA 4I8JA 4Y0ZE 3AAUA 3P8NA 1EZXC 3VG8A 2BY5X 1E79D 1BTPA 1SQTA 3M7UA 3SU4A 1C5ZB 4XRNA 5ESBA 4BXSA 1DY9A 1A46H 1C5QA 3RXVA 4KTCA 1G30B 1N1LA 1TOMH 3O8RA 4IC5A 1HDTH 2J95A 4JZDH 1O2WA 3IWMA 5ESTE 3BN9A 2PR3A 1FJSA 1QRZA 1E35B 5EW2H 5C1YA 2NU3E 3T62A 4YOIA 1QL8A 3BTQE 3GY4A 2GCHG 3KQBA 2SNWA 3LKWA 1WU1A 3F9FA 1AVGH 3VB4A 4CR5A 3U8TH 2BXUH 1G32B 1V3XA 2OTVA 4XOJA 5C5OA 5KEDA 1AN1E 1W7GH 1G36A 3SNDA 1UHBA 2C93B 1GCTC 1P2IA 1ZSKA 2FOAA 2RG3A 2J98B 3WWFA 4Y8ZA 1E1QD 3SI4H 3UY9A 2P8OC 1KXEA 2O8UA 2B8OH 1EB2A 2A2XH 1Y3VA 1AI8H 3SUFA 3RXTA 1K9OE 2BD2A 1ZMLA 4FUGA 2KAIA 1VCPA 2FXRA 3M3SA 4E7RG 2VBCA 2FI3E 3TLOA 3A8BA 2GX4A 5T6GA 1KDQB 5A0BA 3F0OA 3A7WA 1BRCE 1BBRE 3QN7A 3TGJE 1W10U 5A8XA 1GBDA 2WPKS 2Y80A 4NIYA 2VWMA 3RXCA 8GCHG 3GYLB 1W12U 1HAVA 2EI6A 3B23B 1FQ3A 3URDA 4ZKOU 5DN6D 3PLKA 1UVPA 2H5DA 2BVSH 1VGCB 1FY3A 1GI6A 1ELDE 4WMEA 2Q6DA 2RA3A 1WXRA 1A4WH 2A7JA 3UR6A 1EAIA 2IPHA 1GHBF 2STAE 2ZNKH 4ISOA 4ISLA 5LPEA 3KQCA 1DSTA 1J16A 3LC3A 1THSH 3BG4C 2A5IA 1EXFA 1O5FH 1QHRB 1SOTA 1D3QB 1TLDA 3ZZ9A 3TIUA 2ZKSA 1UJ1A 3ENSB 2HVYB 1L2EA 4Z6AH 4FUHA 5CHBA 2SGAA 2A4GA 2VGCB 1K21H 3SU1A 1AD8H 2QAAA 5EXLA 1G3EA 4LK4A 1LHEH 2B9LA 1ESBA 4DGJA 3MH5A 5CHAB 1ZRBA 2TRMA 4P00A 4JYTA 4A1XA 1SMFE 3EA8A 3PM3A 1AVWA 3S9AA 1JRTA 1SGEE 2ZF0H 1BA8B 1IQJA 2VIOA 3PTBA 2WV9A 1V6DA 1EOJA 1P0SH 1ZLRA 1ANDA 5JBTA 1QL7A 3NWUA 3URCA 5CE1A 1HJAC 1K1NA 4TPIZ 1P2MA 1P2NA 4K69A 1CHGA 2PTCE 3P6ZB 5FPTA 1MKWH 4I33A 1O2RA 1O31A 4BAMB 1GBKA 1GI1A 2K1QA 3PMBB 1G3BA 1W14U 1LQEA 4NSYA 4I86A 5E8EH 1AWHB 3RC4A 3B9FH 2ANWA 3RXUA 1Z1IA 1Z8GA 2M5TA 3BV9B 2OD3B 4WJG2 2THFB 4ZXXH 4DCDA 2GJGA 1Y8TA 2ZIQH 1GJ6A 5EQRA 1A0HB 2GCHF 2XRCA 1ID5H 2NU2E 5SGAE 1ZHMA 2OCVB 3PROA 3KNXA 3WW7A 5C94A 1GHZA 3TVJB 2TGDA 1LQDB 7KMEH 3BTTE 4AFUA 2HNTE 2A45B 3KGPA 2ODYB 4Q4LA 1ETRH 1F2SE 1GBLA 1P2OA 4OGYA 4ABAA 1Y3WA 1BRUP 4F55A 2VB0A 2IJD1 4AB8A 1KXDA 1SPJA 2G4UA 2XCNA 3MI4A 2UUYA 4TPYA 4H6TA 1BJVA 4LZ4B 2QY0B 2GCTB 1HYLA 2C4FH 4KP0A 5J4SA 2PWXA 1GL0E 1SC8U 1JIMA 3BIUH 4B73A 2ZU3A 3UIRA 2FI4E 3SORA 3WY8A 8GCHF 1A5IA 1O5BB 1GHXH 3GYMA 2ZHDA 4ZCNA 1KLJH 4NA8A 3GCTG 1SGPE 2ZHFH 4P02A 2FOHA 4WMDA 4X1SU 1DICA 1J15A 1V2PT 4X6NA 2J92A 3KYGA 4X1RU 2QGRA 1RJXB 2W7UA 1O2IA 2R0KA 2O9QA 4O3TA 3I29A 3ZZDA 1IQMA 1YPHC 1BMLA 2G81E 1P3EA 1MQ5A 1ZPZA 2VWLA 4OS7A 1GBCA 2OP9A 1BIOA 4ABDA 3ATLA 3GISB 4F4OC 2KX4A 1HPGA 2ZDLA 4X6PA 1Z1JA 1WQVH 1YPGH 4MVNA 2AGIX 3RU4D 4TT3D 4B74A 1ZHPA 1QGFA 2AGGX 1MTVA 2G8TA 1GMCG 1O2SA 2PGBB 1HV7A 1V2OT 2XBVA 1ABJH 4MDSA 1C5OH 1IQIA 1GJ7B 1MD7A 1IHTH 1MTSA 4ZXYH 1EJAA 3U9AH 1SLVB 2DE8A 1MKWK 1TWXB 5T1VA 3MTYA 2ZHEH 4Q7XA 3GS9A 1BMAA 4IMZA 3T27A 1BMNH 3CP7A 3D62A 1N8OB 4K1TA 1O5AB 1F5LA 2W26A 2FI5E 3TNSA 3KIDU 1QJ6B 3QZQA 1QIXB 1O5DH 4FVBA 1NO9H 4Q63A 3RXOA 3OY5U 4NFEA 2EC9H 2H5CA 4NSVA 3F9HA 1OXGA 3HGNA 2J38A 3JZ1B 1DPOA 2V3OH 4DG4A 3QGNB 2ILNA 3RC6A 1NRQH 5GXPA 2XOKD 3OYPA 1BTUA 2FS8A 2BD5A 4ISHH 4NG9H 2QXGA 3A7TA 3SBKA 2Z9GA 3EE7A 1JXPA 3PTNA 2R3YA 4ISNA 2OXSA 1O2VA 5F53A 4Y8XA 2P3FH 1SKYE 3ATKA 1EX3A 2Z3EA 1QY6A 1F92A 1MUEB 1ZR0A 2AS9A 1A5HA 3MH6A 1N6YA 1UTLM 3MO9A 3TU7H 4E06H 1QJ7B 2KZ4A 5TCAA 1T4VH 3B8JA 3VXEH 5HM9A 3F2FA 1HGTH 4UE7H 2A5AA 3A8AA 3HPTB 4UFFH 3RC5A 3SNBA 3TJVA 3SHCH 1O3MA 2NU1E 2QXHA 1F0SA 4I8HA 1T8NA 2BDGA 3QZRA 2GKVE 3LGIA 1YF4A 2QE7D 1D6RA 1TGNA 2VVUA 3ZYEA 1MU6B 2BY6X 1CU1A 2XBWA 3GCHC 4UFDH 1SGTA 1W3CA 2Z6BD 5DG6A 4MNVA 3P92A 5HXFA 3LGVA 3GY5A 1F0TA 5JYIA 1YM0A 1EP5A 5KECA 2GP9B 1G2MA 4YLQH 2XW9A 4D9RA 1A3EH 1BMFD 2ASUB 3UB0A 3U1IB 1PFXC 3EA9A 2J9NA 4I8GA 4D7FA 2ZTZA 3DT0H 1ZPCA 2KCAA 1DANH 2H9TH 1KSNA 4GCHG 4JMYA 1GG6C 1EPTA 2GT7A 2V3HH 3ATMA 2CK3D 3CENA 2VIQA 1Z8JB 3EDXB 2W3KA 2P3TB 4CR9A 3MNXA 2BY7X 2VWOA 1H8DH 1FN6A 1OWHA 4WMFA 1TQ0B 5GIBA 3W1EA 3QX5H 4UDWH 1GBJA 2A32A 3KQDA 4FUFA 4U32A 4NGAH 3LOXA 5HYOA 2G5NA 1MZAA 1QA0A 1LVBA 3DCLA 5FX5A 2Z3DA 4CHAC 2YMSD 4UFEH 5FL7D 1SGYE 3FP8E 1O5EH 2ZFPH 4AFSA 1TMUH 3PLBA 2WPHS 2SGFE 1SOZA 1TOCB 1ESAA 2H1UA 3FN8A 1CA0C 5FHTA 1DDJA 3QUMP 4Y7BA 1QNJA 3SHAH 5A09A 3OTPA 1QB9A 3E8LA 1GCDA 1GMCF 2V3MA 1Y59T 4LXBH 5C0TA 4CRDA 5EJLA 3R3GB 1NFXA 3TPIZ 1SGRE 5DGJA 1KMHB 2XWAA 2WPDD 1TX6A 1K1OA 2TGPZ 2FOCA 5K7RA 3TNTA 1CBWB 1YWUA 2W5EA 3NPSA 5E0GA 1SGNE 5GPIB 1V2UT 3V0XA 1EOLA 2FIRH 4MPVA 4I8LA 2WSSD 1CGHA 1GDNA 1AFQC 1K2I1 4JYUH 1EJMA 1S6FA 3M7QA 3UNQA 2A7CA 2J97A 3DSPA 1ZTKA 1O2HA 5B6OA 4ACBA 3FP6E 5IYTA 3Q00A 4KTSA 1ZGIA 2GTBA 3U28C 1ELFA 1V2RT 4I31A 1CQQA 3A8CA 1ZTLA 2Z3CA 3H7OA 1O3IA 1C5NH 1WDIA 4CH2B 1XUKA 2ANKH 1HAGE 1S84A 1SFQB 1QQUA 5C0UA 5F8XA 1AUJA 1IHSH 1GMDG 1HIAA 1AKSB 1QTFA 1S81A 3ZZ6A 1UK4A 1JOUB 2BD3A 2QF4A 2ZGBH 3KF2A 4ASUD 2P94A 2VWNA 2QN5T 2PKAA 3GY8A 3VPKA 1E34B 1C2JA 1L1NA 2W6ID 4HG6A 3SUEA 4A92A 5DO4H 3RMLH 2ZFTA 1ZJKA 1ZYOA 1Y5AT 3OU0A 3PRBA 1SGFA 3SU5A 3SUGA 1MH0A 1J9CH 2A4QA 1C1TA 1ZRKA 4O3UA 4ZAEA 2I6SA 3SV7A 1GDQA 3P8FA 2WV4A 1MTUA 1N6XA 5FAHA 3H5CB 1QRXA 1KTTB 3MU8A 2VINA 3A7VA 4FU9A 4M7GA 1AQ7A 2B7DH 3NKKA 2ZWLH 3DSOA 3MH4A 3ATIA 4Y8YA 3ZV9A 1Y3XA 2P16A 4AGKA 3DD2H 1TYNA 4THNH 1TX8A 2B0FA 1CGJE 4IC6A 4CREA 4GCHF 5GJ4B 4WVPE 3RXBA 3MQKC 1BT7A 3M3TA 1EZQA 2HVXA 2P59A 5F6MA 2Z9LA 1O3OA 3PO1B 4MNYA 3LH3A 2W3IA 1K28D 4MG3A 2FWWA 4VGCC 1INCA 1D4PB 1TPOA 2DUCA 4NA7A 2BY9X 5GWZA 5G4BA 3W94A 3E0PB 3M61U 3T29A 4TWWA 3PV2A 5DSFA 1MQ6A 3K65B 2P93A 3ODFA 1ELAA 2WINI 4MTBA 2EI7A 4SGBE 4ABJA 2HGTH 2QA9E 3NXPA 3F9EA 4JZIA 1HAOH 4DW2U 5C3NA 3DSGA 3SQHE 1C2HA 2WUBA 1C1VH 1GBAA 4Q80A 3VB7A 3UWIA 1Y3UA 2PSXA 1NFYA 1YLNA 1KXFA 1SLUB 1OSSA 1E36B 1NN6A 2GVFA 3OSYA 1TGTA 1UVTH 3VXFH 1FNIA 2QCYA 4K60A 1ZMJA 2BTCE 1TRNA 3ZZAA 3T2NA 2ZQ2A 2FMJA 4WH8A 2G00A 1ZMNA 1MCTA 1V2KT 5F8ZA 1QRWA 3CS0A 3UR9A 3A81A 6ESTA 1AHTH 1VR1H 5C17A 2ZHWH 3M3VA 1TE0A 1WV7H 1AO5A 1UVSH 2VJ1A 1C5SA 2ZCHP 4GHTA 4HFPB 2IN2A 3HKIB 4ZMAH 1T31A 1LKAA 2HOBA 1GWAA 2BD4A 3MU4A 2YMSC 2VVVA 1YLCA 3STJA 4A7IB 1C2MA 2QIQA 2PUXB 2GD4B 2FDAA 1LDTT 4JCNA 2GT8A 2TBSA 4FOUC 3FKSD 4SGAE 1OS8A 5EXNA 1V2LT 4NZQA 2J98A 5AFYH 3BTDE 6CHAC 3A84A 1GGDB 2F83A 3SU6A 2GMTB 1TFXA 4NFFA 3SQEE 3RU4T 3CS7A 5C20A 1K0HA 1SHHB 1D9IA 1GBMA 3RLYH 4IMQA 1TPPA 4CRBA 1V2MT 2O8MA 1LTOA 1AE5A 3MNCA 1KDQA 2PSYA 1GJCB 1LPGB 3LIWA 3FANA 4MNXA 1TGCA 2WPIS 2CN0H 2FESH 4U2WA 1O30A 4Y10E 1P2QA 4M9FA 3E1XB 4FUIA 1XMNB 4YESB 1S0RA 1T4UH 1G3CA 1BTZA 2UWOA 2Y7ZA 2ZU2A 1MTNC 1P8VC 3Q77A 1SGCA 1C5LH 1H8ED 2JETC 2R3UA 2ZDKA 2QYIA 1TRMA 2OC8A 2KM0A 1EPTC 3SYJA 5EXMA 4DT7B 1O3EA 1WUNH 1W13U 5ABWA 4RI0A 2H6MA 4HTCH 1FV9A 3QTVH 2XNDD 1W0JD 3QTOH 5C5NA 4UONA 1G3DA 1O2NA 4D76A 3UREA 3P17H 1O3NA 3RXQA 1YY3A 2FZZA 3TGIE 2A0QB 1T8OA 1JRSA 1THPB 1TABE 1NBMD 4X2YA 2HNTF 2Z9IA 3MHWU 1W8BH 1DS2E 2ZU5A 1C2EA 1GBTA 4RT1A 4O03A 1SGIB 1S5SA 1ELBA 1BTXA 4BTUB 1GJ5H 1RIWB 3Q3KA 3PLPA 3GOVB 4X6MA 2A2QH 2WPLS 3K2UA 2JH0D 1E0FD 1MBMA 3VB6A 5JBCS 1A1RA 4INHA 4KGAA 3BTKE 3VB3A 2Z9KA 5A0AE 1RD3B 2F91A 1RXPA 1XXDA 2BOHB 3BSQA 3NUMA 2FEQH 1AWFH 1EATA 1MMJN 3F9GA 3SV9A 3KCGH 5LPRA 3F68H 2O8TA 1QBOA 3ZVEA 2PKSC 3A83A 1TPAE 3JZ2B 3VGCB 1DX5M 1TPSA 4Y11E 1C4V2 2ZPQA 1LPZB 2AYWA 1H9HE 2D2DA 4X8UH 4CH8B 2TGAA 3DFJA 2HLDD 2Z94A 4TY6A 5DPAA 2M2AA 4CRAA 1VCWA 2EI8A 1EZSC 2AMDA 4MQAA 2D8WA 3UTUH 1KIGH 1O2TA 1ELCA 1SB1H 1SG8B 4ZROA 4TSFD 3U1JB 2ZP0H 1GBEA 1YCPM 1TNKA 2VIWA 3AVZA 1DITH 4GLYA 4DJZB 3F6UH 4X2XA 1DOJA 1HAYB 3HGPA 2ULLA 2C90B 2SGQE 2EQNA 2V35A 2JH6D 2XWBI 1C1RA 1MCVA 2FS9A 4X0WU 1AB9B 1C5WB 1WOFA 1IQFA 1VJAU 3RXMA 4D7GA 1GJBB 1FY4A 4FUCA 1C1MA 2AIQA 1K1PA 3UUZA 1ZSLA 1D3PB 5I25A 1NROH 1F5RA 3PB1E 4XBCA 1V2JT 1FY5A 4Y79A 2A31A 4BAOB 3UNRA 3E90B 1ELTA 1UTJA 5FCRA 2STBE 4I32A 1EAUA 1WQSA 1QQ4A 1BRAA 1HRTH 2BLVA 4NZLA 1IQNA 3ZVFA 7LPRA 4AFZA 4OS1A 2XXLA 3NK8A 1O3HA 1PQ5A 4FVDA 3SI3H 1BB0B 1O0DH 2PFEA 3SO3A 4WF8A 3UQVA 2SGEE 2ZZUH 2CHAC 3TK5A 4U01A 1TA6A 4ABEA 6LPRA 5LGOA 2L74A 2VNTA 3E0NB 1AGJA 1B0EA 1UO6A 1GJ4H 2OUAA 2SFAA 5EW1H 1DXPA 2FM2A 2F43B 1TIOA 2V0BA 4R0IA 3TK6A 3KN2A 1P12E 1J14A 4CBNA 2ZO3H 1X7AC 1PPZA 1ANBA 1GI9B 3Q76A 2F9UA 4WY3A 2BD8A 3LGWA 1UTPA 1BUIA 1RFNA 3RXIA 1FMGA 3G01A 4E05H 1DUEA 2XTTB 4K3JA 1C1OA 1IAUA 1QL9A 1WAYB 1DM4B 3LU9B 5EIYA 4IW4E 3SGQE 3UOPA 2OINA 3RXPA 1KTSB 4YTAA 2NU0E 3U69H 1XKAC 5EQQA 2PV9B 4ABHA 1W7XH 3M35A 4IN1A 2ZTXA 1NBME 1OWEA 2BY8X 1A2CH 2ZG0H 5PTPA 4K2YA 1P3CA 4X6OA 2FTLE 1P06A 1HB0B 1YBWA 2TIOA 3ELAH 1Z71A 5E2PA 1CVWH 3GICB 4XBDA 4GSOA 3FP7E 3V13A 1NRSH 4YZUA 1SLWB 4YT7H 2CF9H 2BHGA 2J4IA 1E38B 3DFLA 1J8AA 3TGKE 1O3CA 2G55A 3DUXH 2ZC9H 2OLGA 1RTKA 1ELVA 3MU5A 3ZZ8A 3UWJH 2NWNA 4KELA 2KFWA 1QURH 2H9EH 3GCNA 3SJKA 2FYQA 4CRGA 5DK1A 2FOFA 3FOAA 1AMHA 1GBBA 4YOGA 4O9VA 1F5KU 4YOJA 4DIHH 1HXEH 4WWYA 2PW8H 3BTWE 3ZZ3A 2ZQ1A 3KYFA 5FPYA 3OTJE 3SGBE 1W0KD 2PP6A 1DWEH 2G52A 1GI2A 2B5TB 3BEIB 1GCTB 5EGMA 1D6WA 3N99A 2I6QA 2P8OB 3MO3A 3A87A 4RKJB 3ITIA 1O2GH 2HWLB 2ALPA 3A8DA 1TBRH 4X8SH 2FO9A 4B1TA 3EA7A 1XUIA 5AVDA 1TNLA 3F2GA 1RGQA 1O2MA 2KR7A 3RXEA 1GMHG 1UK3A 1VITH 2BLQA 1U6QA 3L3TA 1T32A 3TK9A 2BDIA 2AH4X 3RMOH 1EFRD 3M5LA 5DJ7A 5T3HA 4OS2A 2ZI2H 1SQOA 5EOKA 5J4QA 1LMWB 1QZ8A 2BB4A 3RM2H 1YKTA 2O8WA 3LJJA 2YNBA 5A8YA 1VGCC 1WTGH 5B6LA 3GCTF 1EB1H 4FUBA 3M7TA 1DT2A 4I8KA 2J2UA 3NRLA 5HKKD 1H4WA 1P04A 1XM1A 2VIPA 2BVRH 1SI5H 3O8CA 5CDFE 2WPJS 2VVCA 1TBQH 2OQ5A 1OWKA 3BG4B 1FIZA 3LT3A 4B2AA 1GI7B 3RXHA 1TONA 1QR3E 4YO9A 3FFGA 4I7YH 1HJ8A 5F8TA 1GJAB 2ZGJA 3SU2A 2CMYA 1GVZA 1JBUH 4AZ2B 1OHHD 5HIZA 1S82A 4BNRA 1O2PA 4DVAU 3KQEA 2A4RA 2SGPE 1E37B 1XVOA 2VGCC 2FX4A 1C5RA 2R0LA 3RP2A 1P03A 1SGDE 3F3BA 4NA9H 1ZOMA 1C5VA 2ANMH 2D26C 3RXJA 1LVMA 5CHAC 3PMHB 1FXYA 4ZKSU 1RS0A 1OYQA 1ZGVA 1CE5A 3L6PA 5TCCA 3A80A 3BIVH 4X2WA 1HJAB 2BYAX 1C5MD 3LH1A 2HPPH 3L33A 1ZHRA 3HK6B 3S0NA 1JIRA 1LVYA 1FDPA 1DE7H 1PPEE 1O3LA 1JMOH 1W11U 1TGSZ 5I46H 1BBRH 2GZ9A 2GZ8A 3TJOA 1AZ8A 4AORA 4ZUHA 2ZDNA 1ESTA 4NCYA 2P3UB 5DKMA 1EKBB 3A86A 4RT0A 3D65E 1TRYA 2JH5D 4OS6A 1UTKA 2UUKB 2BOKA 1DLKB 1AUTC 1OWDA 3SOSA 3FVFB 1O5CB 2IJOB 4BXWA 1CHOG 1LO6A 2KCYA 2BDCA 1BTYA 1WYKA 2R2MB 3A88A 2SNVA 1DUAA 1A7SA 5GCHG 5EJ1A 1L4DA 4JK5A 3ZZBA 1Q2WA 4B76A 1EP6A 1C1SA 1NC6A 2WZQA
chains in the Genus database with same CATH topology
4HZHA 3FZDA 1XUGA 1L1GA 2BDBA 3S69A 3PV4A 1GVKB 3LC5A 1WBGB 2ZU4A 4D9QA 3GY6A 5EODA 4UD9H 1AKSA 3SNAA 1K1IA 1ETSH 3FAOA 2OBQA 1HAZB 2P95A 1O34A 1DWBH 5AHGH 3RXAA 3ZVDA 4GUXA 4ZHMU 1LHGH 4O97A 2QF3A 3NZIA 3ZVGA 1H8IH 2GCTC 4Y7AA 1RRKA 1FY1A 2RA0A 2A4OA 1DWDH 4XDEA 2EEKA 3BTEE 4ESTE 1D3DB 2H9HA 3F1SB 4K1SA 5EG4A 4BAKB 4TWYA 1IQGA 2C8WB 1O2QA 4GAWA 2ZTYA 1Z8IB 2LPRA 2C8YB 1ETTH 3UPEA 5DP6A 4OS5A 1TQ7B 5E2OA 1TB6H 5HGGA 8KME2 1KLIH 4RKOB 1FAKH 4BANB 1FLEE 3BG8A 2ZGXH 5L6NH 1RTFB 1FPCH 1O33A 2HPQH 4GPGA 1W2KH 3QK1A 1GI8B 2D1JA 3VEQB 5EPNA 1C4U2 1WCZA 4ABFA 2ZPRA 3SU3A 1VJ9U 1F0UA 3AW1A 3C27B 3ZVBA 4NIWA 2BD9A 5DP3A 1SSXA 1O2UA 4LOYH 1C1UH 3SV2H 3M37A 3HATH 3HKJB 4ZHAA 3PWCA 1O35A 1OWIA 4PROA 3TH4H 1P05A 4HGCA 1EJNA 3STIA 1EASA 3BEFB 4MPWA 3K6ZA 3MNSA 3RXGA 1AU8A 3MYWA 4ASHA 2PTNA 1SL3A 4BOHA 3P8OA 1QJ1B 1SR5C 3T25A 3A82A 2QXIA 1BBRK 1O3PB 2ZFQH 1GI5A 3IITA 2Y5HA 1P09A 3ZYDA 1GJ8B 2UWPA 5F03A 2AIPA 5K0HA 2XBYA 1PYTD 2PLXA 1N8OC 1BHXB 2F9BH 4H6SB 5CMXH 5FPSA 4LZ1H 4Q7YA 1UTOA 2A1DB 1GPZA 1BZXE 1Y5UT 3ZV8A 1IQKA 4A6LA 1V2ST 5IDKA 1PQ8A 3U98H 2FOGA 3RXLA 2WYJA 1PPGE 2G4TA 2BX3A 5E0JA 1AY6H 4DOQA 5JDUB 4K1EA 3ATWA 3RUOA 1V2TT 3MMGA 3P8GA 3H7TA 5GDSH 4INKA 1ACBE 1LCYA 1DVAH 1CHOF 3BF6H 1BCUH 1UHBB 1V2WT 1V2VT 1OWJA 1BITA 1EAXA 1XVMA 2CGAA 2XC5A 4WH6A 3EAJA 3ESTA 1BRBE 2WYGA 5GCHF 4WXVA 3DHKH 4X8VH 1GMDF 1NPMA 3QO6A 1C5YB 4XFQA 2KAIB 2SGDE 2EA3A 4BTTB 1C9PA 1G2LA 2BQ6B 1QBVH 1O32A 2F9NA 2FTMA 3GCHB 3AW0A 4Y0YE 4IN2A 1S0QA 3OY6U 1OKXA 2ZCLP 1HLTH 1HAVB 3I77A 5L30H 1XX9A 2GZ7A 2FX6A 1ANCA 1PQ7A 1NY22 1UTNA 1ZSJA 2R9PA 2GV7A 3OX7U 1ANEA 1AIXH 1ARCA 1WSSH 1T8LA 1QFKH 2XCFA 1GG6B 3S9CA 1SFIA 3BTFE 3M5MA 3GY2A 4DIIH 5EU8A 5FXLA 3LPRA 7ESTE 3GCOA 4FU8A 1ZPBA 4IBLH 1O3JA 1ZTJA 2BX4A 1Z7KA 3BTGE 4CHAB 6GCHG 1W0ZU 2ZCKP 2XYAA 2Z7FE 1TGBA 1O37A 1O3KA 2ODQA 1CA0B 2Q6FA 4QT8C 3GDUA 1AVXA 2F9OA 4JK6A 3ZVCA 3Q3XA 2AMPA 1L1JA 3BTHE 2NU4E 1KLTA 2QXJA 3A89A 1FZZA 3RXRA 2XC0A 1EUFA 1D3TB 4E7NA 1OX1A 1GVLA 2WUCA 1V2NT 2UUFB 3MO6A 2GDEH 3KL6A 4A5TS 3GDVA 4AX9H 5HMAA 3QGJA 2J34A 3TJNA 1Z8RA 3M5NA 3M5OA 1AFQB 4X1NU 1HJ9A 5JBAS 1CBWC 1GJDB 1EZUC 3SZNA 3P95A 3D49H 1C2DA 8ESTE 1CA8B 4FU7A 4Z0KA 4A1VA 4CRCA 1IQLA 1BOQA 3LGTA 3N7OA 1MZDA 1XXFA 1A0LA 3T28A 1TMBH 3M36A 2ZPSA 1GBIA 1NRNH 1O3DA 1O36A 1K1LA 4ZHLU 1TNGA 2FLRH 3MNBA 3I78A 5A0CA 1H9LB 1P01A 3SW2B 3SV6A 5C1UA 4K8BA 3VB5A 4AGJA 1G37A 2ZFRH 5JBBS 1OP2A 2ZA5A 1OYTH 3O8DA 3RM0H 1BHXF 1ABIH 1IQHA 4GHQA 1YP9A 3SV8A 2H2ZA 1MAXA 3DA9B 4Y6DA 2DE9A 5HM2A 9LPRA 1NESE 1F7ZA 2PUQH 5JB8S 1UTQA 1GI3A 5A8ZA 2Y82A 3QDZB 1C2IA 1BQYA 1O38A 1P2JA 3PMAB 2ZU1A 2ALVA 1YPHE 1FY8E 3V3MA 1NRPH 4AB9A 1HAXB 1C2GA 2LNCA 2OC1A 2WV5A 4B75A 4NIVA 3VFEA 5FBIA 1YPKH 9ESTA 3MFJA 1PYTC 3LGUA 1C2KA 1LHDH 1O2OA 4K8YA 1V2QT 1MBQA 4JZ1A 4D8NA 1GHYH 4YT6H 2GV6A 3SN8A 2ZFSA 1HFDA 5FBEA 1BTWA 1Z6JH 3KHVA 3V7TA 2HNTC 1YPJH 2BDYA 1C2LA 1XUHA 1C1NA 3S7HB 5H4IB 2VH0A 4B2CA 2Y5GA 1FI8A 2ESTE 1Q3XA 4ABIA 1UCYH 2QV1A 3K6YA 2BD7A 2R2WU 1UVOA 3RXDA 4CBOA 1ELEE 1SQAA 2XBXA 1HUTH 1L4ZA 4Q7ZA 4VGCB 1WTHD 3UFAA 3E6PH 2C8ZB 3PO1C 3A7YA 1SVPA 1YPLH 1SHYA 4AFQA 1C9TA 1DSUA 1CSOE 4AN7A 1P02A 1XKBC 3EE0B 2Y81A 3TITA 1MTWA 4WXIA 6GCHF 3P70B 4INLA 2RDLA 1A5GH 4NWLA 4TY7A 2FOEA 4FUDA 1FUJA 1LHFH 1MD8A 1EQ9A 1BJUA 1SLXB 3PYHA 1QB1A 1T8MA 1S85A 4AG1A 4X8TH 1DWCH 2ZDMA 3W95A 3SUDA 2WPMS 3FZZA 2ZHQH 4F49A 1OP0A 3UNSA 3R0FA 2YOLA 2FOMB 1C2FA 1ZJDA 2C8XB 5JB9S 2FP7B 1GJ9B 1O3AA 2FODA 4HI3A 1NM6A 1YCPH 1FONA 2A7HA 1P10A 1IOEA 3QLPH 4B71A 2AMQA 1TNJA 2FYRA 5AF9H 1OPHB 1P2KA 2J94A 4JZFH 3TH2H 4RN6A 1NU9A 1DXWA 4H42U 2BLOA 1O39A 2BXTH 3E3TA 1C5XB 1OOKB 4ZKNU 1HAPH 3K9XB 4ISIH 3MU1A 1QBNA 1M9UA 4CRFA 1KXBA 3RLWH 4FUEA 3PMJA 1CGIE 4FUJA 1PPBH 3EQ0H 3A85A 1C5PA 2C3SA 1DLEA 4AYVB 4AOQA 1FN8A 1SBWA 3V12A 1OP8A 1EAWA 1P9UA 4MLFB 2BDHA 1QB6A 4ABGA 7GCHG 3AASA 5EPYA 3RXFA 4ZKRU 1CO7E 2OBOA 4A1TA 5C1XA 1MKXH 4RSPA 1FAXA 3SJOA 2CF8H 6CHAB 1VITG 1O2JA 1GHVH 1GGDC 5DP5A 1PQAA 5DP4A 2GMTC 4BTIB 3ZZ7A 1Z6EA 1TBZH 4R8TB 1L0ZA 1VZQH 4X1PU 4FXGH 2UUJB 4MPUA 3E16B 4UFGH 1P57B 1NFUA 1VCQA 4Q2KA 3RXKA 1K22H 3BEUA 4H4FA 1LPKB 3S7KB 5FCKA 5LH8A 3S9BA 3GDSA 3ZVAA 4MPXA 3IG6B 5L2ZH 1UCYK 3SJ8A 1TALA 1MTNB 2JETB 5DP8A 2OC0A 4J2YB 2AFQB 1J17T 1JWTA 1NS3A 4U30A 2ANYA 1EPTB 1AZZA 5C67A 1MU8B 2AERH 2ZDAH 5DP7A 3Q3YA 1C4Y2 2ODPA 1DY8A 2BM2A 5JPMH 3HK3B 2VH6A 1LVOA 1PPHE 3E91A 4DY7B 1C1WH 1ORFA 3SU0A 2TGTA 5L2YH 3SGAE 3NCLA 2JKHA 3BTME 2PGQB 3O8BA 1THRH 2FLBH 2Q1JA 1GHWH 4K5ZA 4TYDA 1GL1A 3SJIA 2AGEX 1YPEH 2ZDVH 3RXSA 1Y3YA 2V6NA 1S83A 1CT0E 3ZZ5A 1NT1A 4ZH8A 1FPHH 2HALA 3LGYA 3MOCA 1O2LA 1A0JA 2VIDA 1CT2E 4XE4A 2BQWB 2Y5FA 1C5UA 3UOUA 3KEEA 1GI4A 3SNCA 1B5GH 3AAVA 3T26A 3A7XA 1YCPK 2VIVA 1C5TA 3RMNH 1O2XA 1GHAG 4Y71A 3QWCH 4YLUA 1RIWC 2IOTA 3ZZ4A 2XNIA 1ZZZA 2ZGCA 3RMMH 4Y76A 1YYY1 1A3BH 5TJXA 1Q31A 4UEHH 5T6DA 1BDAA 1O3GA 1RTLA 1K1JA 3RU4E 2YNAA 2ZEBA 1XUFA 1PJPA 1KY9A 3GY3A 1P9SA 1TA2A 3MH7A 5E0HA 2PKSB 4B2BA 5LPFA 2BZ6H 1HCGA 1H9IE 2OQUA 2BZAA 2F9VA 1BTHH 3VGCC 1IQEA 1HNEE 4JZEH 4YM9A 1O2ZA 1C1PA 2F3CE 2GGVB 1UCYE 1UTMA 1HAIH 1NZQH 1FIWA 2BVXH 2G5VA 2CJIA 1KXAA 1S6HA 1MKXK 2AEIH 3C1KA 2CV3A 1H1BA 1KXCA 4NWKA 1GBFA 2BLWA 1W0YH 2W7SA 2BDAA 3ZZCA 4IS5A 1K1MA 2UWLA 3LJOA 1LKBA 1HIAB 4X1QU 1BMMH 2TPIZ 4XSKU 8LPRA 2QF0A 5ETXA 1QCPA 1GDUA 2Q6GA 4X2VA 7GCHF 1AB9C 4AG2A 5BPEA 3MWIU 1O3FA 1PPFE 1MAYA 4BAHB 2PKAB 1B7XB 4KTUA 1TNHA 2Z9JA 3T5FH 2VU8E 3A7ZA 2XC4A 4AYYB 1GI0A 1B0FA 4J1YA 1VITF 1YC0A 1UK2A 1TMTH 2Y7XA 4XBBA 1GMHF 3TJUA 1ELGA 3LONA 2OC7A 3EGKH 1NU7B 1UVUH 2ZFFH 1HBTH 4GVUA 2CXVA 3MU0A 1TAWA 1C1QA 2QC2A 4OS4A 2ZGHA 3LDXH 4JYVH 4NIXA 2HLCA 2RCEA 2F9PA 1O5GH 2O8LA 1ARBA 2CHAB 2BMGB 1T7CA 5FX6A 2FOBA 1GHBG 3ODDA 1HXFH 2G51A 3PWBA 3TH3H 1SGFG 3EYDA 1SGQE 1O3BA 2A5KA 1DFPA 4IGDA 1AFEH 1QA7A 1TX7A 2ZECA 3SJ9A 4MNWA 1AE8H 1PPCE 3D23A 2PHBA 1O2KA 1HAHH 4BAQB 1GBHA 1UMAH 1TNIA 2FPZA 5DP9A 1P11E 1YGCH 1Y5BT 2GDDA 3RDZA 3GY7A 1NTPA 4OGXA 4ABBA 5AFZH 1O2YA 1NRRH 1CT4E 1YLDA 2Y6TA 1XUJA 4DURA 4KKDA 1NFWA 1YPMH 3SNEA 5T6FA 3UQOA 1LHCH 3U8OH 5EQSA 1A61H 2BQ7B 5C2ZA 2HRVA 1KYNA 1GHAF 1G9IE 3U8RH 5BRRE 5A2MH 1F0RA 4I8JA 4Y0ZE 3AAUA 3P8NA 1EZXC 2BY5X 3M7UA 1BTPA 1SQTA 3SU4A 1C5ZB 5ESBA 4BXSA 1DY9A 1A46H 1C5QA 3RXVA 4KTCA 1G30B 1N1LA 1TOMH 3O8RA 4IC5A 1HDTH 2J95A 4JZDH 1O2WA 3IWMA 5ESTE 3BN9A 2PR3A 1FJSA 1QRZA 1E35B 5EW2H 5C1YA 2NU3E 3T62A 4YOIA 1QL8A 3BTQE 3GY4A 2GCHG 3KQBA 2SNWA 3LKWA 1WU1A 3F9FA 1AVGH 3VB4A 4CR5A 3U8TH 2BXUH 1G32B 1V3XA 2OTVA 4XOJA 5C5OA 1AN1E 1W7GH 1G36A 3SNDA 1UHBA 2C93B 1GCTC 1P2IA 1ZSKA 2FOAA 2RG3A 4Y8ZA 3SI4H 3UY9A 2P8OC 1KXEA 2O8UA 2B8OH 1EB2A 2A2XH 1Y3VA 1AI8H 3SUFA 3RXTA 1K9OE 2BD2A 1ZMLA 4FUGA 2KAIA 1VCPA 2FXRA 3M3SA 4E7RG 2FI3E 3TLOA 3A8BA 2GX4A 5T6GA 1KDQB 5A0BA 3A7WA 1BRCE 1BBRE 3QN7A 3TGJE 1W10U 5A8XA 1GBDA 2WPKS 2Y80A 4NIYA 2VWMA 3RXCA 8GCHG 3GYLB 1W12U 1HAVA 2EI6A 3B23B 1FQ3A 3URDA 4ZKOU 3PLKA 1UVPA 2H5DA 2BVSH 1VGCB 1FY3A 1GI6A 1ELDE 4WMEA 2Q6DA 2RA3A 1A4WH 2A7JA 3UR6A 1EAIA 2IPHA 1GHBF 2STAE 2ZNKH 4ISOA 4ISLA 5LPEA 3KQCA 1DSTA 1J16A 3LC3A 1THSH 3BG4C 2A5IA 1EXFA 1O5FH 1QHRB 1SOTA 1D3QB 1TLDA 3ZZ9A 3TIUA 2ZKSA 1UJ1A 3ENSB 1L2EA 4Z6AH 4FUHA 2SGAA 2A4GA 2VGCB 1K21H 3SU1A 1AD8H 2QAAA 5EXLA 1G3EA 4LK4A 1LHEH 2B9LA 1ESBA 4DGJA 3MH5A 5CHAB 1ZRBA 2TRMA 4JYTA 4A1XA 1SMFE 3EA8A 3PM3A 1AVWA 3S9AA 1JRTA 1SGEE 2ZF0H 1BA8B 1IQJA 2VIOA 3PTBA 1V6DA 1EOJA 1P0SH 1ZLRA 1ANDA 5JBTA 1QL7A 3NWUA 3URCA 5CE1A 1HJAC 1K1NA 4TPIZ 1P2MA 1P2NA 4K69A 1CHGA 2PTCE 3P6ZB 5FPTA 1MKWH 4I33A 1O2RA 1O31A 4BAMB 1GBKA 1GI1A 2K1QA 3PMBB 1G3BA 1W14U 1LQEA 4NSYA 5E8EH 1AWHB 3RC4A 3B9FH 2ANWA 3RXUA 1Z1IA 1Z8GA 2M5TA 3BV9B 2OD3B 4WJG2 2THFB 4ZXXH 4DCDA 1Y8TA 2ZIQH 1GJ6A 5EQRA 1A0HB 2GCHF 2XRCA 1ID5H 2NU2E 5SGAE 1ZHMA 2OCVB 3PROA 3KNXA 1GHZA 3TVJB 2TGDA 1LQDB 7KMEH 3BTTE 4AFUA 2HNTE 2A45B 3KGPA 2ODYB 1ETRH 1F2SE 1GBLA 1P2OA 4OGYA 4ABAA 1Y3WA 1BRUP 2VB0A 4AB8A 1KXDA 1SPJA