1TRNA

Crystal structure of human trypsin 1: unexpected phosphorylation of tyrosine 151
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
224
structure length
223
Chain Sequence
IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Crystal structure of human trypsin 1: unexpected phosphorylation of Tyr151.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase (serine proteinase)
total genus 55
structure length 223
sequence length 224
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1995-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1trnA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1trnA02
4YT7H 4DURA 2F9NA 2GX4A 4B71A 1FY5A 1HFDA 4X2VA 2STAE 4CH8B 3C27B 2H5DA 4B74A 1YPHC 3GCHB 2UUKB 3Q76A 5GJ4B 1V2KT 5HGGA 3OU0A 1ZSLA 1FONA 3LT3A 3GCTG 1HAOH 2VVCA 2WPMS 1QY6A 1THPB 1GI1A 3B23B 3P8GA 1HPGA 2AGEX 2D2DA 1SHYA 3TK6A 3S69A 3ZZAA 1ZTKA 2EI8A 1W7XH 1BJUA 1YYY1 5ESBA 1FUJA 3SU2A 1MKWK 3RM2H 1SSXA 3ZVCA 1C1UH 4CBOA 1OYTH 1AB9B 1EPTC 1QRXA 1LVMA 4K2YA 1C1TA 3SU1A 1Y5BT 4BTUB 2OUAA 3SN8A 3P70B 4CRCA 2VWOA 1TGSZ 1O3NA 1TONA 5AFZH 5HM9A 2CF8H 4Y71A 5FBIA 2O8TA 2WPLS 4IMZA 1HJAB 2H9TH 1SQOA 4AFZA 1PYTC 2EA3A 3SQEE 1GG6C 2BQ7B 2CHAC 1SOZA 2QAAA 1D3DB 4ISLA 3CENA 5EQSA 1K2I1 1O34A 1LPKB 2WINI 3T25A 5JBBS 3Q3KA 5CMXH 3RXCA 2SGQE 3A80A 3RXHA 1L1JA 2BD8A 1XUJA 3F9EA 1E0FD 3EDXB 1RTFB 1XKBC 3SV6A 3NXPA 1XKAC 2ZDAH 3A8AA 4A92A 2ZP0H 3SHAH 1YPJH 1C2GA 1GMCG 1SOTA 3UTUH 2FYRA 4NZQA 2XRCA 3DHKH 4FUBA 4HTCH 2O8MA 1GJ5H 2FOCA 1QGFA 3UNSA 1SFIA 3M35A 4GLYA 1CSOE 1TMTH 4X0WU 3TK9A 4ASHA 1BBRH 3TJVA 1UHBA 5JBCS 4K3JA 1ELBA 4GUXA 4CRFA 5K0HA 2A32A 2ILNA 2FODA 1D6RA 4Z6AH 1KXBA 4ZHAA 2ZDLA 4JYVH 2Z94A 1ZYOA 1CT4E 4IC6A 3T62A 3BTKE 2CJIA 3TNTA 4I7YH 1VGCB 1ZPBA 1V2TT 4GCHG 1T8NA 1V6DA 1YBWA 1GBJA 3SJ8A 1TGNA 3B9FH 2P8OC 4JK5A 1VJ9U 1GMHF 2R3YA 2H1UA 3MU4A 2BOHB 4NSVA 1IAUA 1GMDF 3VFEA 1P2QA 4INLA 1P09A 3F9GA 3MU0A 2B5TB 3KIDU 1RTKA 1Y3WA 1AY6H 3GY7A 2W26A 4ZHLU 1YPGH 1VZQH 4K8BA 1GGDC 1BZXE 1A1RA 1TNJA 1RXPA 3VXEH 2G8TA 5FX6A 3RLYH 1H1BA 8LPRA 1ANDA 1E34B 1SMFE 3PTNA 4ZH8A 1P04A 1TYNA 1SVPA 1TIOA 1DXWA 2A4OA 2ZHDA 1NT1A 1D3QB 2TIOA 2P3TB 1SGDE 3ATMA 5JDUB 4UFEH 1FAXA 5BRRE 1O38A 4BXSA 1C9TA 1P11E 3M61U 2GKVE 3P17H 4FUEA 2D26C 8GCHF 3PO1C 5FCRA 4D8NA 4KKDA 1DLEA 1XM1A 3GY2A 1EAUA 1GBDA 1VJAU 1YCPH 4Q80A 5EQQA 3SJOA 1C5MD 2D8WA 1ELGA 2ZU3A 1EZSC 1CE5A 4FU8A 1A61H 1UVUH 5JBTA 1O2NA 3MH7A 3MMGA 1SBWA 1GG6B 2JETB 1BMMH 1EAXA 2FTLE 2Z7FE 4R8TB 3U98H 2HNTC 1DE7H 1RD3B 1T8MA 5A8YA 1UTMA 3SNCA 2WUCA 3N7OA 1DOJA 2H2ZA 3UFAA 1H9HE 2F9PA 2J34A 4KELA 3F6UH 1Z71A 1P02A 2LPRA 1AZ8A 1HAGE 4WJG2 3MO3A 1SQTA 5DP3A 1YCPK 4JYUH 1LVYA 4FU7A 2VIQA 2ZDVH 1MU6B 4NWKA 3U8OH 1C2MA 1V2NT 3TK5A 1YCPM 1O5AB 2P95A 4X6PA 4F4OC 1O36A 2B9LA 2SNVA 4ABHA 2Z9GA 2BLOA 1P9UA 1ANCA 4UFGH 4ESTE 1W0ZU 1ELCA 1YLCA 1EJMA 1N6YA 2ZDKA 5HXFA 1D3TB 1FXYA 2QCYA 2R0LA 3TU7H 1UTNA 2Q6GA 2P3FH 4HFPB 4Y7AA 4ZUHA 2V3OH 3GY5A 3D49H 2P8OB 1GL1A 2J2UA 4Q2KA 4NCYA 1AU8A 3HKIB 1HXFH 4THNH 4BOHA 1CBWC 2ZG0H 2Y5HA 1NS3A 1QJ7B 3GCNA 1FJSA 1GJAB 3GY3A 2WV4A 4YOIA 1TB6H 1C5SA 3GY6A 1QA0A 3BTTE 1C9PA 2QC2A 3JZ2B 1NFXA 4MG3A 1ZPCA 1UMAH 1A46H 1O31A 1UHBB 2FZZA 1GCTC 4QT8C 1BRAA 1W11U 1ZMJA 3MNXA 2OP9A 3M36A 1FPHH 1Y3YA 2O8LA 5B6OA 2Z9LA 1N6XA 2HRVA 1SLWB 1LVBA 1Z8JB 4O97A 3RXLA 2HNTF 1RFNA 1K1MA 1EAIA 3PMBB 4DW2U 9LPRA 1IQJA 1O39A 4YLUA 1OWDA 2VWNA 4VGCB 4I8GA 1WYKA 4TY7A 2I6SA 1OWJA 1S6FA 1NRRH 1AI8H 3LJOA 2VVVA 1P2IA 1O2ZA 1UVSH 3RP2A 4X2YA 3M7QA 1LHEH 2VVUA 3EGKH 2C8XB 2PFEA 1FDPA 1LQDB 3S7HB 1OWIA 2XW9A 1KLTA 5E0HA 3RXVA 1QR3E 2GGVB 4AX9H 1RJXB 2ZU5A 1K21H 1ZHMA 1MZAA 2G5VA 1LPGB 1NRSH 1TNHA 4H6TA 3STIA 2ZTZA 3SU0A 7GCHF 1DWDH 2A4QA 3UIRA 4JCNA 2ZNKH 1LPZB 1OX1A 2TGAA 2ODYB 4OS4A 1TPOA 3FZDA 3U9AH 1KXCA 1KLIH 3BG8A 1HIAA 5ESTE 1TX7A 1IQNA 4YZUA 4B1TA 2HPQH 7LPRA 2F9OA 1W12U 3PWBA 4DJZB 3SI3H 4LZ1H 2C8ZB 5HYOA 1P05A 1C1SA 1GHBF 2BY5X 5PTPA 1UTOA 4ZKRU 2EC9H 1IHTH 3U69H 5H4IB 2FPZA 3VB5A 3NWUA 2M5TA 2F9VA 3LGVA 1C1NA 4JK6A 4WVPE 1C5OH 4RKJB 2SGFE 5TJXA 1LO6A 2ZFPH 2ZGJA 1SGYE 1AGJA 4LOYH 4D9QA 2FM2A 3EQ0H 3O8BA 3RXOA 3RU4E 3AW1A 3ATIA 3K6YA 2RA3A 2A0QB 1RIWB 1C5UA 2A7JA 2DE9A 2RCEA 4YTAA 4ABEA 3L33A 4X8UH 5TCAA 3A84A 3UR9A 1MD8A 1NFYA 4Q7XA 4FUIA 3ZVBA 2UUFB 1C1PA 1TWXB 1MTNC 2YNBA 1N8OB 4XFQA 2VINA 1Z1IA 5FXLA 1MQ5A 2A2XH 2O8UA 4IN2A 3RXKA 1G3EA 3MH6A 1B0EA 3HATH 2V3HH 4NIWA 3RXBA 4O03A 3A7YA 5C1XA 1AE5A 4FUCA 3LC5A 3A89A 1LHGH 1HJ8A 4YM9A 4IGDA 3V13A 4MNWA 3VB3A 1ELVA 3L6PA 4ZAEA 1G3DA 4XOJA 5EGMA 1ZRKA 3MO6A 3ZVEA 1AVXA 1P57B 5T6DA 5EG4A 3MOCA 1ABIH 4J1YA 2GCHF 4CRDA 1BTYA 3WY8A 1IHSH 4B73A 4AFQA 4UFFH 3A83A 4YOGA 1WAYB 3QN7A 1F5RA 2FOBA 2AH4X 1AE8H 2GCTC 1V2LT 3SU6A 1SFQB 1WUNH 3KEEA 1KXAA 1MCVA 1SGRE 4I8HA 1TOCB 3P92A 1VITF 1AFQB 1TRMA 5LPEA 1NU7B 4GHTA 2BHGA 2FOFA 2GD4B 3NKKA 3VXFH 1MUEB 4AG1A 2AEIH 4TWWA 1GHWH 1O37A 1CT0E 1BMLA 1O3AA 2UWLA 1SL3A 3KQBA 1A4WH 4RN6A 5GCHF 2ODPA 2FP7B 4I31A 5C5OA 1EAWA 4DT7B 3PLKA 1KYNA 2QXIA 2NWNA 1AKSA 1O5CB 1UJ1A 4BTIB 1LDTT 3ZZ7A 3VB7A 1F92A 1YPKH 1JOUB 1XUFA 3MYWA 1EZQA 2J38A 2BOKA 3LH1A 1GWAA 1QRWA 2KAIA 3HPTB 3A7VA 5C5NA 1F0TA 1TX8A 1NRQH 1THSH 2FOMB 5C2ZA 1ANBA 1UTLM 1C5WB 2ZU2A 2A5IA 3M5OA 3M7UA 4NIYA 2QF0A 1A5GH 2K1QA 1MTUA 1H4WA 3KQCA 2ODQA 1O32A 2A7CA 3B8JA 2PSXA 4K5ZA 1OP2A 1P2OA 4AYYB 1QNJA 1XUGA 1C2LA 3T28A 3ZVFA 1Y8TA 1ZZZA 1PQ8A 4H6SB 4DY7B 1WSSH 3GOVB 2BLWA 4X8SH 4D76A 3MWIU 2XC5A 1GHAF 4A1VA 3Q00A 4JZEH 4SGAE 5FBEA 4E7NA 3U8RH 2ZFTA 3A87A 4OS6A 3KF2A 5ETXA 1QFKH 2YOLA 3E16B 1HIAB 1CGHA 2ZTXA 3R0FA 6GCHF 2IJOB 3MFJA 2O9QA 1CA0C 2ZHWH 2B0FA 2VH0A 4X8TH 1S84A 1GMDG 1SLXB 1XVOA 1H9IE 1K1PA 2GT7A 1Q31A 4WH6A 2VGCC 1O3MA 2ZGXH 3A7TA 1MTNB 1FY3A 1UK3A 4Q7ZA 3MTYA 1TQ0B 4FVDA 1GDNA 1O2YA 2A45B 1BIOA 5EU8A 3H7OA 3FFGA 2OLGA 1DFPA 4B2CA 1MD7A 5FPYA 5L2YH 1O2MA 2EI6A 1Z6EA 3SUFA 5JBAS 5G4BA 4I8JA 1EZXC 4H4FA 4ZKSU 4HGCA 5J4SA 1BOQA 1FIZA 1TE0A 1QURH 1ETRH 1K22H 3QTVH 4WXVA 1A5HA 5F8ZA 2CF9H 5TCCA 4UDWH 3ZZ4A 4I32A 4TPYA 4DIIH 1TA6A 1JMOH 1EB2A 1GJBB 2SNWA 3BIUH 3PMJA 3NUMA 3SV9A 4X1NU 1KXEA 3SJKA 2AMQA 5A0AE 1FI8A 3M7TA 5GPIB 1JXPA 1KDQA 1HRTH 3SHCH 1FY4A 1K9OE 1YP9A 1OXGA 4ABIA 8GCHG 3QX5H 2GCTB 2J94A 4ISNA 1C5RA 3R3GB 4BAOB 1A5IA 2RA0A 3EYDA 3UNQA 5CE1A 2GTBA 7KMEH 1C5ZB 1ELAA 4D7GA 4GSOA 2J9NA 1S0RA 1V2QT 2FX4A 1ZJDA 1BRCE 2FDAA 2ZGHA 5DO4H 5EXMA 3RMNH 1S81A 4TYDA 1C2FA 5E2PA 2WPIS 1FN6A 5FPTA 1EOLA 2GVFA 3V0XA 2ZHEH 2C8YB 2FI4E 3IITA 5EPNA 3A85A 1KXFA 5F8XA 3RXPA 4AFUA 1HGTH 1SGIB 1K1JA 4Y6DA 5A09A 1MKXH 1ACBE 2AIPA 1LHFH 4MNYA 1ZPZA 1O2RA 5DP8A 1ZMNA 1FAKH 1P2KA 2WUBA 1C4Y2 3SORA 3NCLA 5F03A 2F3CE 3ODDA 3PM3A 1UTQA 1MQ6A 3E0NB 4CRAA 4OS5A 3UUZA 5T6GA 3T2NA 2G00A 3RC4A 5GWZA 4YOJA 4X2WA 3DA9B 3UNRA 1GDQA 2UUJB 2EEKA 5C1UA 3RMLH 1XX9A 2WV5A 1O5FH 3ZV8A 1O3PB 1O2HA 1SLVB 3MU1A 2XCNA 2PKAA 2THFB 3BG4B 6LPRA 3IWMA 3QGNB 1MTWA 1C1RA 1E35B 1QJ6B 4U01A 3UWIA 4MDSA 4F49A 3SBKA 2BTCE 1TNLA 2GZ7A 1ARBA 1MKXK 4DOQA 1TGBA 1TRNA 1ZSJA 3PTBA 4Y11E 1GI9B 1WU1A 3SUEA 1L4DA 3ZZ5A 1AKSB 1G30B 4CRBA 5FPSA 1F5KU 1O5BB 1GDUA 1BTHH 1J9CH 3HKJB 1V2MT 5JYIA 5GIBA 1AMHA 3GYMA 2A5KA 3KQDA 3QTOH 4MNXA 2KAIB 1BBRK 2PR3A 1CO7E 3W94A 1A0LA 2GMTC 1PYTD 2A2QH 2Z9JA 2D1JA 1PPFE 2FIRH 3E1XB 1GI6A 3K9XB 1GVZA 5EPYA 1BDAA 1EZUC 1ZOMA 2BDAA 3QZQA 1UCYH 2SFAA 1P3CA 3CS7A 3V3MA 4IC5A 2BXUH 5DP5A 4YO9A 4X6OA 1ETSH 3MNSA 3RU4D 3RUOA 3E3TA 4U2WA 3RXTA 3SNDA 1C2IA 2Q6FA 2P94A 3HGNA 3ZYDA 3ZZBA 4CH2B 1TFXA 1FMGA 1O0DH 1T7CA 1ZGIA 5E0GA 2FX6A 1B7XB 3TLOA 1G2MA 3P95A 2AGGX 1NC6A 1QTFA 1QRZA 1EPTB 2ZI2H 2P59A 1HAPH 1OOKB 2ZEBA 3ELAH 3KGPA 1QBVH 1PQ7A 1O2TA 5L2ZH 2OC0A 2JH6D 2XBWA 1JWTA 1UCYK 1ELEE 4NZLA 4K1TA 3FP6E 2ZCKP 1O2QA 2FOGA 5ABWA 1DWEH 2ZTYA 1WTHD 3SGQE 4NIXA 2CHAB 7GCHG 1YC0A 1JRSA 4XDEA 1TX6A 1VCPA 2FWWA 1WOFA 1EP5A 2WPJS 1SGCA 2QA9E 1Z6JH 3RXAA 1GI3A 1MZDA 2NU3E 3SV8A 1FLEE 2IPHA 1G37A 3ZZ3A 5DGJA 3VPKA 1V2RT 3VEQB 1KDQB 2G5NA 1GHBG 1ELDE 1CU1A 3U1JB 2BX3A 2HOBA 3RMMH 2J95A 2R3UA 2FI3E 3A82A 2TGPZ 4UE7H 5JB8S 4Q7YA 3E8LA 1IQGA 3KQEA 3A88A 3Q3YA 1HAVA 2C3SA 2QGRA 4Y8ZA 3U8TH 4DGJA 3F9HA 1Z7KA 1C5YB 3SOSA 3TGKE 1HYLA 3UOPA 3E6PH 3GICB 4MPVA 3RXFA 1WCZA 1MAXA 1IQMA 3ATLA 4A5TS 3GDVA 4GAWA 3SU4A 1KTSB 1V2OT 2Y82A 1ARCA 1BHXF 3D23A 1DWBH 2PW8H 3FZZA 1ZRBA 2PWXA 1OWKA 1ZGVA 1GBKA 1PPGE 4E7RG 3LU9B 2PHBA 3ATKA 1DUEA 4R0IA 4B2BA 1TABE 1F7ZA 1Z8IB 2A4GA 2GMTB 4GHQA 1C1MA 4SGBE 3I77A 3MHWU 1HBTH 4K1SA 4WH8A 1GI5A 5IDKA 2ZU4A 1GJ9B 1GGDB 3PLBA 2VJ1A 1LCYA 5DP9A 3H5CB 4WMDA 2F9BH 2PKAB 1Z1JA 2FLBH 1JBUH 1EKBB 3AVZA 2BD3A 1DUAA 2AFQB 1YPEH 2BDBA 1P2JA 1C1WH 2BY8X 2ZGBH 4RKOB 1BHXB 1D9IA 3QZRA 2GCHG 2OCVB 1O30A 2QIQA 3QK1A 3ZZCA 4MVNA 1C1VH 1F0RA 3RLWH 3RXGA 3SNAA 2BMGB 2FOHA 4MPXA 1NFWA 2CXVA 1GBAA 4BAKB 3GISB 1O2VA 4FXGH 3LGTA 3LONA 4WMEA 3PO1B 4K69A 4JZIA 4CBNA 1LMWB 1G2LA 3KHVA 2A1DB 5GDSH 2ZZUH 1CHOG 2ASUB 1D4PB 1BCUH 2UWPA 1C1QA 1NESE 2F91A 2HWLB 2Q6DA 5EOKA 2BLQA 3A81A 4JZDH 1EX3A 1A0HB 3SO3A 1HNEE 5J4QA 3SV2H 3P8NA 3QDZB 3A86A 4DVAU 4WMFA 2JH5D 1QB1A 1K1LA 4ISOA 2BD7A 4DG4A 3A8DA 3VGCC 2XXLA 4D9RA 1DDJA 2VWLA 2PTNA 1G3CA 4X1RU 3PMAB 2OC7A 4A1XA 1Z8GA 3UWJH 2ZHFH 2BLVA 1LHCH 1TGCA 1G3BA 4ABDA 4AN7A 1EQ9A 2G4UA 2VB0A 4E06H 3A7XA 4TWYA 1RTLA 2QXGA 4Y79A 2BYAX 1OPHB 3HGPA 1HAZB 2FMJA 2G81E 4AB8A 2BZAA 1HJ9A 2QXJA 1O3EA 1GBHA 2UWOA 8ESTE 2ZFSA 2VWMA 4E05H 2ZGCA 2FS8A 2XBYA 4MTBA 1W14U 1DM4B 1T4UH 2FI5E 2TBSA 2ZPRA 3SQHE 3RXEA 1GI2A 1ZHRA 2R0KA 1FZZA 1TPPA 1LKAA 2BX4A 1BJVA 1QQ4A 3M5LA 2QXHA 2BDCA 4X8VH 1E38B 5IYTA 2GT8A 1VCQA 4NWLA 4ZMAH 2ZPQA 4BAHB 3LDXH 5A8XA 4Y76A 4Y8XA 2GZ9A 3TH4H 2GDEH 1CBWB 2PUQH 3PB1E 1FV9A 2TGTA 3HK3B 4Y7BA 2FYQA 2LNCA 1O2XA 1P03A 4ZKOU 1BRBE 2B7DH 4MNVA 2A4RA 2JKHA 1HUTH 1UVOA 4ABGA 1GCDA 2G4TA 2NU4E 1GCTB 1MBQA 1OKXA 1O2PA 2ZA5A 1ABJH 1TBRH 4ISHH 3SJIA 3K2UA 3BTFE 2OQUA 2ESTE 1P2MA 3LC3A 4IS5A 1O3GA 5DG6A 1DSTA 3STJA 5EODA 1ETTH 2O8WA 4NGAH 3SI4H 5A8ZA 3GCHC 3BV9B 3BTWE 4KP0A 3SZNA 1Y59T 3AAVA 3FP8E 1CVWH 2ZKSA 4ABJA 4CRGA 5FCKA 1AFEH 1AHTH 1O2WA 1TQ7B 1Y5AT 1C5LH 3M5NA 2ZHQH 1GJDB 5AHGH 1WTGH 1AVGH 4KTSA 1O2JA 5EQRA 1HAIH 4YT6H 1ID5H 1SGFA 2H5CA 1N1LA 2W7UA 2AS9A 1BTZA 2BXTH 3BTME 3MU8A 5EXNA 1J17T 3OSYA 1C5PA 2G55A 4LZ4B 4ABAA 3SNBA 3VB6A 1XUIA 5LPFA 3UQVA 1AB9C 2VIDA 2XCFA 3PLPA 4OS7A 2AERH 4INKA 1DY9A 5DP4A 3TITA 2GZ8A 3PV4A 2BDIA 3ATWA 4HI3A 4H42U 3GY4A 4FVBA 1PPZA 4PROA 1HJAC 1HAYB 2AGIX 1A2CH 3LGYA 3ZVAA 2GV7A 2ZC9H 4CR9A 1GBIA 2HVXA 1CGJE 3SU3A 4BXWA 3PROA 4I33A 1DLKB 5LPRA 1BTWA 1YF4A 1GJCB 1O2IA 1H8IH 1XXFA 1BMAA 4KTCA 1UTJA 4X6NA 1O3KA 1OSSA 1NU9A 1B0FA 4K60A 3M3VA 1ESTA 5A0BA 1J14A 1KSNA 2JH0D 1M9UA 1V2WT 5DK1A 1GBTA 3TGIE 3ZV9A 1UO6A 2VIVA 4OS1A 1DSUA 2W3IA 3PYHA 1BUIA 5C67A 1PQAA 1RGQA 2OBOA 3KN2A 1QB9A 4O3UA 4UFDH 3GY8A 2SGAA 3FAOA 3GDUA 1OWHA 1HDTH 1HCGA 2GDDA 1T4VH 1T8LA 1GMHG 4KGAA 5T6FA 4AZ2B 1GBEA 3S9CA 3BEUA 1FN8A 1O2GH 3TJOA 1OP0A 2W5EA 3QUMP 3EA7A 1GHYH 1SPJA 3TGJE 1K28D 3ODFA 1UVTH 4UONA 2VH6A 3TPIZ 3RXMA 1O3IA 1W10U 5C3NA 1VGCC 3AASA 3F9FA 1QBNA 2P16A 4DIHH 1F5LA 1LQEA 1BITA 2ZCLP 3SNEA 3DT0H 1BMNH 1EJNA 1TGTA 2QV1A 1C2DA 1JIRA 3BIVH 1AUTC 5CHAC 3SUDA 2BY6X 4AORA 1MAYA 2EI7A 5LGOA 1BA8B 5FAHA 1OYQA 4KTUA 3UOUA 3RXUA 1UTPA 3P8OA 4INHA 1PFXC 1FQ3A 1YPLH 1XVMA 3EA8A 2ZFRH 5HMAA 1O3JA 3A8BA 4ABBA 2BD4A 3T26A 1CHGA 1Q3XA 2C8WB 2NU2E 2PSYA 4JYTA 4HZHA 3S0NA 3OYPA 1T31A 1LHDH 2H9HA 3UY9A 1CT2E 4MQAA 4BNRA 1O2UA 1WQVH 1TMBH 3RU4T 3RXQA 3UR6A 3URCA 4B76A 3A8CA 1NM6A 3I78A 4X1PU 3LOXA 1SGEE 1O5EH 5AFYH 1EATA 3SGBE 1NPMA 1G9IE 4FUDA 3A7ZA 3I29A 4O9VA 3O8CA 2TPIZ 1FPCH 1W2KH 5JB9S 1GJ4H 2B8OH 3DFLA 2PKSC 2H9EH 1YGCH 2Z9KA 2JETC 1DITH 1P12E 1T32A 3EAJA 3M37A 3TJUA 1DT2A 2J4IA 4OGXA 4GPGA 4AFSA 1EP6A 1C4U2 4XBBA 5E2OA 2F83A 3LGIA 1L1GA 1PQ5A 4WY3A 2G52A 4CHAC 3ENSB 4BTTB 3NK8A 1PPBH 1TA2A 1HAHH 1F2SE 2SGDE 4MLFB 1VITH 1FY8E 1DXPA 2BY9X 2ZDMA 1UTKA 2A5AA 4U32A 5A2MH 1V2UT 3T5FH 1GL0E 4JZ1A 3K65B 1CA0B 1KTTB 1Q2WA 1QA7A 3BN9A 1V3XA 2DE8A 1OS8A 2VGCB 1S82A 1S0QA 6ESTA 3RXRA 1GPZA 2BDHA 2TGDA 2AYWA 1MBMA 3E90B 1BBRE 2H6MA 4AG2A 3MH4A 4U30A 2WYJA 1ESAA 2XWAA 1FNIA 4AYVB 2VIWA 1O2LA 2CV3A 2ALPA 3ZZ9A 3ZYEA 2QYIA 3SUGA 2G51A 3EA9A 2FS9A 1GHVH 3SU5A 4AGJA 3ZZ8A 5CHAB 2BM2A 3LKWA 1F0UA 1O35A 3SJ9A 5EW1H 2OBQA 1GBMA 1TNKA 4NFFA 4CREA 9ESTA 3QLPH 1AO5A 2ZQ1A 2PLXA 3BTDE 1EXFA 3QO6A 1L4ZA 5GXPA 3DUXH 2XC0A 1V2JT 1NRPH 4FUHA 5I25A 1GBBA 3GCTF 1P06A 5A0CA 4X2XA 4AB9A 3S9AA 2Q1JA 2OQ5A 1V2VT 4XBDA 1QL9A 4X1SU 3RMOH 1EJAA 1ZTLA 1GVKB 2PV9B 4VGCC 2BD5A 3E0PB 1UCYE 1HAXB 3BTHE 2Y5GA 3LGUA 2NU0E 5DJ7A 3JZ1B 1DS2E 1X7AC 5C20A 1AN1E 4FUGA 2GP9B 4IMQA 3MU5A 1EOJA 4ABFA 1O3HA 3D65E 1SLUB 1K1IA 1A3EH 2CGAA 3GCOA 1GI8B 1BT7A 3SGAE 1EUFA 1TAWA 1MU8B 2XYAA 4ISIH 3S7KB 1F0SA 1BQYA 1AVWA 2PKSB 3LJJA 1C2HA 3BF6H 1PJPA 1AWFH 2QY0B 3GDSA 2OC1A 1G32B 4NFEA 4Y0ZE 5C1YA 4TPIZ 1VCWA 1GI4A 3OTJE 3RDZA 3F1SB 1HV7A 2CN0H 2W7SA 3FVFB 3ZZDA 3LH3A 2R9PA 4AOQA 2OTVA 3BEIB 1QL7A 5AF9H 2V6NA 1QIXB 1AQ7A 3VB4A 1H9LB 1HXEH 4CHAB 2BQ6B 1C5QA 1AZZA 4Y8YA 2VNTA 2C90B 1GMCF 1P0SH 5DP7A 1O2OA 1GBCA 1PPCE 4LK4A 3DD2H 1G36A 1O3CA 3MNBA 2Z3CA 3TVJB 2BD9A 1D3PB 1P2NA 2ZDNA 5L6NH 3ESTA 1W13U 1J16A 1TNGA 2FXRA 2SGEE 1H8DH 1NY22 5DP6A 4DCDA 4UEHH 3UPEA 3W95A 3ZZ6A 1TRYA 4XSKU 2AMDA 4YESB 1IQLA 4UD9H 3BTEE 5HM2A 1E37B 2FO9A 1B5GH 2SGPE 1UK4A 3PWCA 2PGQB 3UQOA 2UUYA 1PPEE 2OC8A 1RIWC 1ZMLA 4GCHF 4BANB 1O3OA 1NN6A 1VR1H 1C4V2 1TNIA 1C5VA 1LKBA 1YM0A 2ANWA 3HK6B 4ZXYH 2PTCE 1O3DA 2ANYA 1ELFA 2ALVA 2F9UA 4K1EA 1IQKA 4FU9A 4MPWA 1N8OC 1QBOA 1IOEA 1A0JA 5L30H 4NA8A 2C93B 3CS0A 1C2KA 1O5DH 1QHRB 2FOAA 1CGIE 3NPSA 2R2MB 2W3KA 1WV7H 3A7WA 1SGQE 1J8AA 1ZTJA 1AUJA 1BTUA 2XBVA 4J2YB 1O2KA 1RS0A 1GBLA 1Y5UT 2ZPSA 1QQUA 1Y3XA 3MI4A 1ANEA 5EW2H 4A6LA 4GVUA 2STBE 2XTTB 3RXSA 2VIOA 3V12A 1VITG 2FESH 1TBZH 1A7SA 1GHXH 4ZKNU 3OY6U 1DANH 5BPEA 1DY8A 4B75A 2ZU1A 1C5XB 1WQSA 2TRMA 1QB6A 2RDLA 1L2EA 1XXDA 1ORFA 1CQQA 4K8YA 1MH0A 1QJ1B 1ZR0A 1ZSKA 5GCHG 1KIGH 1IQEA 4AGKA 2OXSA 5E0JA 4TY6A 2PUXB 1KLJH 3M5MA 1TALA 1AFQC 2HALA 1TPAE 2R2WU 4Y10E 2ULLA 1D6WA 4XE4A 1V2PT 2Y6TA 1AD8H 4MPUA 5DPAA 1ELTA 3URDA 2PGBB 3RXJA 1MCTA 1YPHE 2QF3A 4JMYA 2Z3EA 4OS2A 3RM0H 1GBFA 1SHHB 2WYGA 3KL6A 5AVDA 1S6HA 1O3BA 1FIWA 1NO9H 2ZO3H 3Q77A 1L0ZA 1XUHA 1Y3UA 1JIMA 3TH2H 1NTPA 2YNAA 2P93A 1IQHA 1RRKA 2P3UB 2I6QA 1IQIA 1U6QA 2IOTA 5F8TA 1C5TA 1GJ8B 2ANMH 1SQAA 3G01A 1GHAG 4A7IB 3Q3XA 1XUKA 1AWHB 1K1NA 3ZVDA 4B2AA 2BDYA 1O2SA 3KNXA 1C5NH 1E36B 3LPRA 1PPHE 6GCHG 2FOEA 3MO9A 3RC5A 2Y7ZA 1JRTA 5DKMA 4RSPA 1Z8RA 4WWYA 1L1NA 4NIVA 4IBLH 1QCPA 3P8FA 5K7RA 1BB0B 1C2EA 3TIUA 2BQWB 2Z3DA 1KXDA 1TOMH 1WBGB 2ANKH 3ITIA 4JZFH 3V7TA 2QN5T 1GI0A 1LTOA 2Y81A 2GV6A 1GHZA 1ZLRA 1INCA 3CP7A 2WPKS 6CHAC 2XC4A 1SB1H 3IG6B 3QGJA 1KY9A 1SR5C 2CMYA 1SGPE 1W7GH 4ZROA 1HAVB 1ZJKA 1IQFA 4A1TA 1P01A 3M3TA 3C1KA 3D62A 2AIQA 1YKTA 3LIWA 1HLTH 1DX5M 1K1OA 3SV7A 1UK2A 2HGTH 1GI7B 1MMJN 1DPOA 3PMHB 3L3TA 1GVLA 2BD2A 3E91A 2AMPA 3TJNA 1S83A 3T27A 2BDGA 1NRNH 3AW0A 4IW4E 1QL8A 2XWBI 3O8DA 3LGWA 4NA7A 3T29A 1SG8B 1TPSA 3TNSA 3GYLB 3MNCA 1UVPA 1LVOA 1S5SA 4LXBH 1BRUP 2ZFQH 2HPPH 3QWCH 2Z6BD 1SGFG 1SC8U 3F68H 4M7GA 2BVSH 1V2ST 1SGTA 3M3SA 2OD3B 1C1OA 2XBXA 2Y7XA 5F6MA 2ZECA 4ZHMU 5FHTA 4BAMB 3AAUA 1P9SA 3VGCB 1P3EA 1CHOF 3S9BA 4X6MA 1MTVA 1NZQH 1THRH 3SW2B 8KME2 1BTPA 4YLQH 1EB1H 2BVXH 5EXLA 4Z0KA 3RXDA 1TLDA 3BTQE 2ZWLH 4D7FA 1O3FA 3MH5A 3NZIA 2V0BA 3K6ZA 1NROH 1ESBA 1P10A 5E8EH 1CA8B 1YPMH 1XMNB 3H7TA 5FX5A 4OGYA 4Y0YE 1FY1A 1DICA 2ZCHP 4WF8A 1O33A 4I8LA 4X1QU 3UREA 3OY5U 3FP7E 5JPMH 1GJ7B 4CR5A 2VU8E 2ZIQH 3RC6A 2XNIA 4XBCA 3TH3H 1J15A 2DUCA 1O5GH 2ZFFH 3RXIA 4NA9H 1SI5H 1OP8A 1YLDA 1GJ6A 4BAQB 1OWEA 3EE0B 1S85A 5LH8A 3BTGE 4NG9H 2BVRH 2IN2A 2BZ6H 3P6ZB 2HLCA 3KCGH 4FUJA 1HB0B 1W0YH 2FLRH 4NSYA 1W8BH 1TBQH 1TMUH 4FUFA 1MTSA 1O3LA 2BY7X 1T8OA 2Z9IA 3BG4C 3BSQA 4ZXXH 7ESTE 2V35A 2A31A 5I46H 4O3TA 2HNTE 1DWCH 2J92A 1C2JA 1SGNE 1AIXH 4WXIA 2A7HA 3U1IB 1NFUA 1BTXA 2OINA 2WPHS 6CHAB 3FANA 2Y5FA 2C4FH 2ZQ2A 4IN1A 1W3CA 1A3BH 1EASA 1DVAH 2BB4A 4I8KA 1P8VC 1EPTA 2Y80A 3ZVGA 3BEFB 1Y3VA 3OX7U 2ZF0H 3DFJA 2RG3A 2FEQH 1MKWH 2NU1E 2FTMA 5T3HA 2VIPA 3O8RA 1ZHPA 5SGAE
chains in the Genus database with same CATH superfamily
4YT7H 4DURA 2F9NA 2GX4A 4B71A 1FY5A 1HFDA 4X2VA 2STAE 4CH8B 3C27B 2H5DA 4B74A 1YPHC 3OE7D 2RDEA 3GCHB 2UUKB 3Q76A 5GJ4B 1V2KT 5HGGA 3OU0A 1ZSLA 1FONA 3LT3A 3GCTG 1HAOH 2VVCA 2WPMS 1QY6A 1THPB 1GI1A 3B23B 3P8GA 1HPGA 2AGEX 2D2DA 1SHYA 3TK6A 3S69A 3ZZAA 1ZTKA 2EI8A 1W7XH 1BJUA 5F53A 1YYY1 5ESBA 1FUJA 3SU2A 1MKWK 3RM2H 1SSXA 3ZVCA 1C1UH 4CBOA 1OYTH 1AB9B 1EPTC 1QRXA 1LVMA 4K2YA 1C1TA 3SU1A 1Y5BT 4BTUB 2OUAA 4FOUC 3SN8A 3P70B 4CRCA 2VWOA 1TGSZ 1O3NA 1TONA 5AFZH 5HM9A 2CF8H 4Y71A 5FBIA 2O8TA 2WPLS 4IMZA 1HJAB 2H9TH 1SQOA 4AFZA 3F0OA 1PYTC 2EA3A 3SQEE 1GG6C 2BQ7B 4B6EA 2CHAC 1SOZA 2QAAA 1D3DB 1UW7A 4ISLA 3CENA 5EQSA 1K2I1 1O34A 1LPKB 2WINI 3T25A 5JBBS 3Q3KA 5CMXH 3RXCA 2SGQE 3A80A 3RXHA 1L1JA 2BD8A 1XUJA 3F9EA 1E0FD 3EDXB 1RTFB 1XKBC 3SV6A 3NXPA 1XKAC 2ZDAH 3A8AA 4A92A 2ZP0H 3SHAH 1YPJH 1C2GA 1GMCG 1SOTA 3UTUH 2FYRA 4NZQA 2XRCA 3DHKH 4FUBA 4HTCH 2W6JD 2O8MA 1GJ5H 2FOCA 1QGFA 3UNSA 1SFIA 3M35A 4GLYA 1CSOE 1TMTH 4X0WU 3TK9A 4ASHA 1BBRH 3TJVA 5FL7D 1UHBA 5JBCS 4K3JA 1ELBA 4GUXA 4CRFA 5K0HA 2A32A 2ILNA 2FODA 1D6RA 3SZEA 1KXBA 4Z6AH 4ZHAA 2ZDLA 4JYVH 2Z94A 1ZYOA 1CT4E 4IC6A 3T62A 3BTKE 2CJIA 3TNTA 4I7YH 1VGCB 1ZPBA 1V2TT 4GCHG 1T8NA 1V6DA 1YBWA 2JIZD 1GBJA 3SJ8A 1TGNA 3B9FH 2P8OC 4JK5A 1VJ9U 1GMHF 2R3YA 2H1UA 3MU4A 2BOHB 1OHHD 1IAUA 1GMDF 4NSVA 3VFEA 1P2QA 4INLA 1P09A 3F9GA 3MU0A 2B5TB 1MABB 3KIDU 3SYJA 1RTKA 1Y3WA 1AY6H 2L74A 3GY7A 2W26A 4ZHLU 1YPGH 1VZQH 4K8BA 1GGDC 1BZXE 1A1RA 1TNJA 1RXPA 3VXEH 2G8TA 5FX6A 3RLYH 1H1BA 8LPRA 1ANDA 1E34B 1SMFE 3PTNA 4ZH8A 1P04A 1TYNA 1SVPA 1TIOA 1DXWA 2A4OA 2ZHDA 1NT1A 1D3QB 2TIOA 2P3TB 1SGDE 3ATMA 5JDUB 3VG8A 4UFEH 1FAXA 5DN6D 5BRRE 1O38A 4BXSA 1C9TA 1P11E 3M61U 2GKVE 3P17H 4FUEA 2D26C 8GCHF 3PO1C 5FCRA 4D8NA 4KKDA 1DLEA 1XM1A 3GY2A 1EAUA 1GBDA 1VJAU 1YCPH 4Q80A 5EQQA 3SJOA 1C5MD 2D8WA 1ELGA 2ZU3A 1EZSC 1CE5A 4FU8A 1A61H 1UVUH 5JBTA 1O2NA 3MH7A 3MMGA 1SBWA 1GG6B 2JETB 1BMMH 1EAXA 2FTLE 2Z7FE 4R8TB 3U98H 2HNTC 1DE7H 1RD3B 1T8MA 5A8YA 1UTMA 3SNCA 2WUCA 3N7OA 1DOJA 2H2ZA 3UFAA 1H9HE 2F9PA 2J34A 4ZCNA 4KELA 3F6UH 1Z71A 1P02A 2LPRA 1AZ8A 1HAGE 4WJG2 3MO3A 1SQTA 5DP3A 1YCPK 3WW7A 4JYUH 1LVYA 4FU7A 2VIQA 2ZDVH 1MU6B 4NWKA 3U8OH 2RFKC 2VBCA 1C2MA 1V2NT 3TK5A 1YCPM 1O5AB 2P95A 4X6PA 4F4OC 1O36A 2B9LA 2SNVA 3FKSD 4ABHA 2Z9GA 3PV2A 2BLOA 1P9UA 1ANCA 4UFGH 4ESTE 1W0ZU 1ELCA 1YLCA 1EJMA 1N6YA 2ZDKA 5HXFA 1D3TB 1FXYA 2QCYA 2R0LA 3TU7H 1UTNA 2Q6GA 2P3FH 4HFPB 4Y7AA 4ZUHA 2V3OH 3GY5A 3D49H 2P8OB 1GL1A 2J2UA 4Q2KA 4NCYA 1AU8A 3HKIB 1HXFH 4THNH 4BOHA 1CBWC 2ZG0H 2Y5HA 1NS3A 1QJ7B 3GCNA 1FJSA 1GJAB 3GY3A 2WV4A 4YOIA 1TB6H 1C5SA 3GY6A 1QA0A 3BTTE 1C9PA 2QC2A 3JZ2B 1NFXA 4MG3A 1ZPCA 1UMAH 1A46H 1O31A 1UHBB 2FZZA 1GCTC 3H09A 4QT8C 1BRAA 1W11U 1ZMJA 3MNXA 2OP9A 3M36A 1FPHH 1Y3YA 2O8LA 5B6OA 2Z9LA 1N6XA 2HRVA 1SLWB 1LVBA 1Z8JB 4O97A 3RXLA 2HNTF 1RFNA 1K1MA 1EAIA 3PMBB 4DW2U 9LPRA 1IQJA 1O39A 4YLUA 3ZIAD 1OWDA 2VWNA 4VGCB 4I8GA 1WYKA 3PV5A 4TY7A 4OM9A 2I6SA 1OWJA 1S6FA 1NRRH 1AI8H 3LJOA 2VVVA 1P2IA 1O2ZA 1UVSH 3RP2A 4X2YA 3M7QA 1LHEH 2VVUA 3EGKH 2C8XB 2PFEA 1FDPA 1LQDB 3S7HB 1OWIA 2XW9A 1KLTA 5E0HA 3RXVA 1QR3E 2GGVB 4AX9H 1RJXB 2ZU5A 1K21H 1ZHMA 1MZAA 2G5VA 1LPGB 1NRSH 1TNHA 4H6TA 3STIA 2ZTZA 3SU0A 7GCHF 1DWDH 2A4QA 3UIRA 1YY3A 4JCNA 2ZNKH 1LPZB 1OX1A 2TGAA 2ODYB 4OS4A 1TPOA 3FZDA 3U9AH 1KXCA 1KLIH 3BG8A 1HIAA 5ESTE 1TX7A 1IQNA 4YZUA 4B1TA 1YLNA 2HPQH 7LPRA 2F9OA 1W12U 3PWBA 4DJZB 3SI3H 4LZ1H 2C8ZB 5HYOA 1P05A 2LELA 1C1SA 1GHBF 2BY5X 5PTPA 1UTOA 4ZKRU 2EC9H 2HLDD 1IHTH 3U69H 5H4IB 2FPZA 3VB5A 3NWUA 2M5TA 2F9VA 3LGVA 1C1NA 4JK6A 4WVPE 1C5OH 4RKJB 2SGFE 5TJXA 1LO6A 2ZFPH 2ZGJA 1SGYE 1AGJA 4LOYH 4D9QA 2FM2A 3EQ0H 3O8BA 3RXOA 2JJ1D 3RU4E 3AW1A 3ATIA 3K6YA 2RA3A 2A0QB 1RIWB 1C5UA 2A7JA 2DE9A 2RCEA 4YTAA 4ABEA 2WSSD 3L33A 4X8UH 5TCAA 3A84A 3UR9A 1MD8A 1NFYA 4Q7XA 4FUIA 3ZVBA 2UUFB 1C1PA 1TWXB 1MTNC 2YNBA 1N8OB 4XFQA 2VINA 1Z1IA 5FXLA 1MQ5A 2A2XH 2O8UA 4IN2A 3RXKA 1G3EA 3MH6A 1B0EA 3HATH 2V3HH 4NIWA 3RXBA 4O03A 3A7YA 5EJZA 5C1XA 3UB0A 1AE5A 4FUCA 3LC5A 3A89A 1LHGH 1HJ8A 4YM9A 4IGDA 1E79D 3V13A 4MNWA 3VB3A 1WXRA 1ELVA 3L6PA 4ZAEA 1G3DA 4XOJA 5EGMA 1ZRKA 3MO6A 3ZVEA 1AVXA 1P57B 5T6DA 5EG4A 3MOCA 1ABIH 4J1YA 2GCHF 4CRDA 1BTYA 3WY8A 1IHSH 4B73A 4AFQA 4UFFH 3A83A 4YOGA 1WAYB 3QN7A 1WDIA 1F5RA 2FOBA 2AH4X 1AE8H 2GCTC 1V2LT 3DSGA 3SU6A 1SFQB 1WUNH 3KEEA 1KXAA 1MCVA 1SGRE 4I8HA 1TOCB 3P92A 1VITF 1AFQB 1TRMA 5LPEA 1NU7B 4GHTA 2BHGA 2FOFA 2GD4B 3N7EA 3NKKA 3VXFH 1MUEB 4AG1A 2AEIH 4TWWA 1GHWH 1O37A 1CT0E 1BMLA 1O3AA 2UWLA 1SL3A 3KQBA 1QZ8A 1A4WH 4RN6A 5GCHF 2ODPA 2FP7B 4I31A 5C5OA 1EAWA 4DT7B 3PLKA 1KYNA 2QXIA 2NWNA 1AKSA 1O5CB 1UJ1A 4BTIB 1LDTT 3ZZ7A 3VB7A 1K0HA 1F92A 1YPKH 1JOUB 1XUFA 3MYWA 1EZQA 2J38A 2BOKA 3LH1A 1GWAA 1QRWA 2KAIA 3HPTB 3A7VA 5C5NA 1F0TA 1TX8A 1NRQH 1THSH 2FOMB 5C2ZA 1ANBA 1UTLM 1C5WB 2ZU2A 2A5IA 3M5OA 3M7UA 4NIYA 2QF0A 1A5GH 2K1QA 1MTUA 1H4WA 3KQCA 2ODQA 1O32A 2A7CA 3B8JA 2PSXA 4K5ZA 1OP2A 1P2OA 4AYYB 1QNJA 1XUGA 1C2LA 3T28A 3ZVFA 1Y8TA 1ZZZA 1PQ8A 4H6SB 4DY7B 1WSSH 3GOVB 2BLWA 4X8SH 4D76A 4TT3D 3MWIU 2XC5A 4ACAA 1GHAF 4A1VA 3Q00A 4JZEH 4SGAE 5FBEA 4E7NA 3U8RH 2ZFTA 3A87A 4OS6A 3KF2A 5ETXA 1QFKH 2YOLA 2QE7D 3E16B 1HIAB 1CGHA 2ZTXA 3R0FA 6GCHF 2IJOB 3MFJA 2O9QA 1CA0C 2ZHWH 2B0FA 2VH0A 4X8TH 1S84A 1GMDG 1SLXB 1XVOA 1H9IE 1K1PA 2GT7A 1Q31A 4WH6A 2VGCC 1O3MA 2ZGXH 3A7TA 1MTNB 1FY3A 1UK3A 3FO8D 4Q7ZA 3MTYA 1TQ0B 4FVDA 1GDNA 1O2YA 2A45B 1BIOA 5EU8A 3H7OA 3FFGA 2OLGA 1DFPA 4B2CA 1MD7A 5FPYA 5L2YH 1VKYA 1O2MA 2EI6A 1Z6EA 3SUFA 5JBAS 5G4BA 4I8JA 1EZXC 4H4FA 4ZKSU 4HGCA 5J4SA 1BOQA 1FIZA 1TE0A 1QURH 1ETRH 1K22H 3QTVH 4WXVA 1A5HA 5F8ZA 2CF9H 5TCCA 4UDWH 3ZZ4A 4I32A 4P00A 4TPYA 4DIIH 1TA6A 1JMOH 1EB2A 1GJBB 2SNWA 3BIUH 3PMJA 3NUMA 3SV9A 4X1NU 1KXEA 3SJKA 2AMQA 5A0AE 1FI8A 3M7TA 5GPIB 1JXPA 1KDQA 5KEDA 1HRTH 3SHCH 1FY4A 1K9OE 1YP9A 1OXGA 4ABIA 8GCHG 3QX5H 2GCTB 2J94A 4ISNA 1C5RA 3R3GB 4BAOB 1A5IA 2RA0A 3EYDA 3UNQA 5CE1A 2GTBA 7KMEH 1C5ZB 1ELAA 4D7GA 4GSOA 2J9NA 1S0RA 1V2QT 2FX4A 1ZJDA 1BRCE 2FDAA 2ZGHA 5DO4H 5EXMA 3RMNH 1S81A 4TYDA 1C2FA 5E2PA 2WPIS 1FN6A 5FPTA 1EOLA 2GVFA 3V0XA 2ZHEH 2C8YB 2FI4E 3IITA 5EPNA 3A85A 1KXFA 5F8XA 3RXPA 4AFUA 1HGTH 1SGIB 1K1JA 4Y6DA 5A09A 1MKXH 1ACBE 4RT0A 2AIPA 1LHFH 4MNYA 1ZPZA 1O2RA 5DP8A 1ZMNA 1FAKH 1P2KA 2WUBA 3FN8A 1C4Y2 3SORA 3NCLA 5F03A 2F3CE 3ODDA 3PM3A 1UTQA 1H8ED 1MQ6A 3E0NB 4CRAA 4OS5A 3UUZA 5T6GA 3T2NA 2G00A 3RC4A 5GWZA 4YOJA 4X2WA 3DA9B 3UNRA 1GDQA 2UUJB 2EEKA 5C1UA 3RMLH 1XX9A 2WV5A 1O5FH 3ZV8A 1O3PB 1O2HA 1SLVB 2KCAA 3MU1A 2XCNA 2PKAA 2THFB 3BG4B 6LPRA 3IWMA 3QGNB 1MTWA 1C1RA 1E35B 1QJ6B 4U01A 3UWIA 4MDSA 4F49A 3SBKA 2BTCE 1TNLA 2GZ7A 1ARBA 1MKXK 4DOQA 1TGBA 1TRNA 1W0KD 1ZSJA 3PTBA 4Y11E 1GI9B 1WU1A 3SUEA 1L4DA 3ZZ5A 1AKSB 1G30B 2IJD1 5FPSA 1F5KU 1O5BB 4CRBA 1GDUA 1BTHH 1J9CH 3HKJB 2GJGA 1V2MT 5JYIA 5GIBA 1AMHA 3GYMA 2A5KA 3KQDA 3QTOH 4MNXA 2KAIB 1BBRK 2PR3A 1CO7E 3W94A 1A0LA 2GMTC 1PYTD 2A2QH 2Z9JA 2D1JA 1PPFE 2FIRH 3E1XB 1GI6A 3K9XB 1GVZA 5EPYA 1BDAA 1EZUC 1ZOMA 2BDAA 3QZQA 1UCYH 2SFAA 1P3CA 3CS7A 3V3MA 4IC5A 2BXUH 5DP5A 4YO9A 4X6OA 1ETSH 3MNSA 5T1VA 3RU4D 4F48B 3RUOA 3E3TA 4U2WA 3RXTA 3SNDA 1C2IA 2Q6FA 2P94A 3HGNA 3ZYDA 3ZZBA 4CH2B 4Z1MD 1TFXA 1FMGA 1O0DH 1T7CA 1ZGIA 5E0GA 3FOAA 2FX6A 1B7XB 3TLOA 3U28C 1G2MA 3P95A 2AGGX 1NC6A 2V7QD 1QTFA 1QRZA 1EPTB 2ZI2H 2P59A 1HAPH 1OOKB 2ZEBA 3ELAH 3KGPA 1QBVH 2KR7A 1PQ7A 1O2TA 5L2ZH 2OC0A 2JH6D 2XBWA 1JWTA 1UCYK 1ELEE 4NZLA 4K1TA 3WWFA 3FP6E 2ZCKP 1O2QA 2FOGA 5ABWA 1DWEH 2ZTYA 1WTHD 3SGQE 4NIXA 2CHAB 7GCHG 1YC0A 1JRSA 4XDEA 5C17A 1TX6A 1VCPA 4XRNA 2FWWA 1WOFA 1EP5A 2KM0A 2WPJS 1SGCA 2QA9E 1Z6JH 2WZQA 1GI3A 1MZDA 2NU3E 3RXAA 3SV8A 1FLEE 2IPHA 1G37A 3ZZ3A 5DGJA 3VPKA 1V2RT 3VEQB 2WV9A 1KDQB 2G5NA 1GHBG 1ELDE 1CU1A 3U1JB 2BX3A 2HOBA 3OEED 3RMMH 4P02A 4ASUD 2J95A 2R3UA 2FI3E 3A82A 2TGPZ 4UE7H 5JB8S 4Q7YA 3E8LA 1IQGA 3KQEA 3A88A 3Q3YA 1HAVA 2C3SA 2QGRA 4Y8ZA 3U8TH 2KZ4A 3PRDA 5HIZA 4DGJA 3F9HA 2K0QA 1Z7KA 1C5YB 3SOSA 2YMSC 1HYLA 3UOPA 3TGKE 3E6PH 5EJ1A 3GICB 4MPVA 3RXFA 1WCZA 1MAXA 1IQMA 3ATLA 4A5TS 3GDVA 4GAWA 4YXWD 3SU4A 1KTSB 1V2OT 2Y82A 1ARCA 1BHXF 3MQKC 3D23A 1DWBH 2PW8H 3FZZA 1ZRBA 1NBMD 2PWXA 1OWKA 1ZGVA 1GBKA 1PPGE 2XOKD 4E7RG 3LU9B 2PHBA 3ATKA 1DUEA 4R0IA 4B2BA 1TABE 1F7ZA 1Z8IB 2A4GA 2GMTB 4GHQA 2OK5A 1C1MA 4SGBE 3I77A 3MHWU 1HBTH 4K1SA 4WH8A 1GI5A 5IDKA 2ZU4A 1GJ9B 1GGDB 3PLBA 2VJ1A 1LCYA 5DP9A 3H5CB 4WMDA 2F9BH 2PKAB 1Z1JA 2FLBH 1JBUH 1EKBB 3AVZA 2BD3A 1DUAA 2AFQB 1YPEH 2BDBA 2JDID 1P2JA 1C1WH 2BY8X 2ZGBH 4RKOB 1BHXB 1D9IA 3QZRA 2GCHG 2OCVB 1O30A 2QIQA 3QK1A 3ZZCA 4MVNA 1C1VH 1F0RA 5C0UA 3RLWH 3RXGA 3SNAA 2BMGB 3KYFA 2FOHA 4MPXA 1NFWA 2CXVA 1GBAA 4BAKB 3GISB 1O2VA 4FXGH 3LGTA 3LONA 4WMEA 3PO1B 4K69A 4JZIA 4CBNA 1LMWB 1G2LA 3KHVA 2A1DB 5GDSH 2JJ2D 2ZZUH 1CHOG 2ASUB 1D4PB 1BCUH 2UWPA 1C1QA 1NESE 2F91A 2CK3D 2HWLB 2Q6DA 5EOKA 2BLQA 3A81A 4JZDH 1EX3A 1A0HB 2K8IA 3SO3A 1HNEE 5J4QA 3SV2H 3P8NA 3QDZB 3A86A 4DVAU 4WMFA 2JH5D 1QB1A 1K1LA 4ISOA 2BD7A 4DG4A 3A8DA 3VGCC 2XXLA 4D9RA 1DDJA 2VWLA 2PTNA 1G3CA 4X1RU 3PMAB 2OC7A 4A1XA 1Z8GA 3UWJH 2ZHFH 2BLVA 1LHCH 1TGCA 1G3BA 3KYGA 4ABDA 4AN7A 1EQ9A 2G4UA 2VB0A 4E06H 2J98A 3A7XA 4TWYA 1RTLA 2QXGA 4Y79A 5KECA 2BYAX 1OPHB 3HGPA 2QF4A 1HAZB 2FMJA 2G81E 4AB8A 2BZAA 1HJ9A 2QXJA 1O3EA 1GBHA 2UWOA 8ESTE 2ZFSA 2KCPA 2VWMA 4E05H 2ZGCA 2FS8A 2XBYA 4MTBA 1W14U 1DM4B 1T4UH 2FI5E 2TBSA 2ZPRA 3SQHE 3RXEA 1GI2A 1ZHRA 2R0KA 1FZZA 1TPPA 1LKAA 2BX4A 1BJVA 1QQ4A 3M5LA 2QXHA 3UAIC 2BDCA 4X8VH 1E38B 3OTPA 2GT8A 5IYTA 1VCQA 4NWLA 4ZMAH 2ZPQA 4BAHB 3LDXH 5A8XA 4Y76A 4Y8XA 2GZ9A 3TH4H 2GDEH 1CBWB 2PUQH 3PB1E 1FV9A 2KCYA 2TGTA 3HK3B 4Y7BA 2FYQA 2LNCA 1O2XA 1P03A 4ZKOU 1BRBE 2B7DH 4MNVA 2A4RA 2JKHA 1HUTH 1UVOA 4ABGA 1GCDA 2G4TA 2NU4E 1GCTB 1MBQA 1OKXA 2J5UA 1O2PA 4Q4LA 2ZA5A 1ABJH 1TBRH 4ISHH 3SJIA 3K2UA 3F2FA 3BTFE 2OQUA 2ESTE 1P2MA 3LC3A 4IS5A 1O3GA 4M9FA 5DG6A 1DSTA 3STJA 5EODA 3F2GA 1ETTH 2O8WA 4NGAH 3SI4H 5A8ZA 3GCHC 3BV9B 3BTWE 4KP0A 3SZNA 1Y59T 3AAVA 3FP8E 1CVWH 2ZKSA 4ABJA 4CRGA 5FCKA 1AFEH 1AHTH 1O2WA 1TQ7B 1Y5AT 1C5LH 3M5NA 2ZHQH 1GJDB 5AHGH 1WTGH 1AVGH 4KTSA 1O2JA 5EQRA 1HAIH 4YT6H 1ID5H 1SGFA 2H5CA 1N1LA 2W7UA 2AS9A 1BTZA 2BXTH 3BTME 3MU8A 5EXNA 1J17T 3OSYA 1C5PA 2G55A 4LZ4B 4ABAA 3SNBA 3VB6A 1XUIA 5LPFA 3UQVA 1AB9C 2VIDA 2XCFA 3PLPA 4OS7A 2AERH 4INKA 1DY9A 5DP4A 3TITA 4B6FA 2GZ8A 3PV4A 2BDIA 3ATWA 4HI3A 4H42U 3GY4A 4FVBA 1PPZA 4PROA 1HJAC 1HAYB 2AGIX 1A2CH 3LGYA 3ZVAA 2GV7A 2ZC9H 4CR9A 1GBIA 2HVXA 1CGJE 2M2AA 3SU3A 4BXWA 3PROA 3WWBA 4I33A 1DLKB 5LPRA 1BTWA 1YF4A 1GJCB 1O2IA 1E1RD 1H8IH 1XXFA 1BMAA 4KTCA 1UTJA 4X6NA 1O3KA 5GNDA 1OSSA 1NU9A 1B0FA 4K60A 3M3VA 1ESTA 5A0BA 1J14A 1KSNA 2JH0D 1M9UA 1V2WT 5DK1A 1GBTA 3TGIE 3ZV9A 1UO6A 2VIVA 4OS1A 1DSUA 2W3IA 3PYHA 1BUIA 5C67A 1PQAA 1RGQA 2OBOA 3KN2A 1QB9A 4O3UA 4UFDH 3GY8A 2SGAA 3FAOA 3GDUA 1OWHA 5C94A 1HDTH 1HCGA 2GDDA 1T4VH 1T8LA 1GMHG 4KGAA 5T6FA 4AZ2B 1GBEA 3S9CA 3BEUA 1FN8A 1O2GH 3TJOA 1OP0A 2W5EA 3QUMP 3EA7A 1GHYH 1SPJA 3TGJE 1K28D 3ODFA 1UVTH 4UONA 2VH6A 3TPIZ 3RXMA 1O3IA 1W10U 5C3NA 1VGCC 3AASA 3F9FA 1QBNA 2P16A 4DIHH 1F5LA 1LQEA 1E1QD 1BITA 2ZCLP 3SNEA 3DT0H 1BMNH 1EJNA 1TGTA 2QV1A 1C2DA 1JIRA 3BIVH 1AUTC 5CHAC 3SUDA 2BY6X 4AORA 1MAYA 2EI7A 5LGOA 1BA8B 5FAHA 1OYQA 4KTUA 3UOUA 3RXUA 1BMFD 1UTPA 3P8OA 4INHA 1PFXC 1FQ3A 1YPLH 1XVMA 3EA8A 2ZFRH 5HMAA 1O3JA 3A8BA 4AC9A 4ABBA 2BD4A 3T26A 1CHGA 1Q3XA 2C8WB 2NU2E 2PSYA 4JYTA 4HZHA 3S0NA 3OYPA 1T31A 1LHDH 2H9HA 3UY9A 1CT2E 4MQAA 4BNRA 1O2UA 1WQVH 1TMBH 3RU4T 3RXQA 3UR6A 3URCA 4B76A 3A8CA 1NM6A 3I78A 4X1PU 3LOXA 1SGEE 1O5EH 5AFYH 1EATA 3SGBE 1NPMA 1G9IE 4FUDA 3A7ZA 3I29A 4O9VA 3O8CA 5CHBA 2TPIZ 1FPCH 1W2KH 5JB9S 4F55A 1GJ4H 2B8OH 3DFLA 2PKSC 2H9EH 1YGCH 2Z9KA 2JETC 1DITH 1P12E 1T32A 3EAJA 3M37A 3TJUA 1DT2A 2J4IA 4OGXA 4GPGA 4AFSA 1EP6A 1H8HD 1C4U2 4XBBA 5E2OA 4RI0A 2F83A 3LGIA 1L1GA 1PQ5A 2LP6A 5KGOA 1SKYE 4WY3A 2G52A 1SQRA 4CHAC 3ENSB 4BTTB 3NK8A 1PPBH 1TA2A 1HAHH 1F2SE 2SGDE 4MLFB 1VITH 1FY8E 1DXPA 4DT4A 2BY9X 2ZDMA 1UTKA 3F0PA 2A5AA 4U32A 5A2MH 1V2UT 3NRLA 2EQNA 3T5FH 1GL0E 4JZ1A 3K65B 1CA0B 1KTTB 3CNRA 1Q2WA 1QA7A 4ACBA 2WPDD 3BN9A 1V3XA 2DE8A 1OS8A 2VGCB 1S82A 1S0QA 2KX4A 6ESTA 3RXRA 1GPZA 2BDHA 2TGDA 2W6ID 2AYWA 1MBMA 3E90B 1BBRE 2H6MA 4AG2A 1S6LA 3MH4A 4U30A 2WYJA 1ESAA 2XWAA 1FNIA 4AYVB 2VIWA 1O2LA 2CV3A 2ALPA 3ZZ9A 3ZYEA 2QYIA 3SUGA 2G51A 3EA9A 2FS9A 1GHVH 3SU5A 4AGJA 3ZZ8A 5CHAB 2BM2A 3LKWA 1F0UA 1O35A 3SJ9A 5EW1H 2OBQA 1GBMA 1TNKA 4NFFA 4CREA 9ESTA 3QLPH 1AO5A 2ZQ1A 2PLXA 3BTDE 1EXFA 2F4LA 3QO6A 1L4ZA 5GXPA 3DUXH 2XC0A 1V2JT 1NRPH 4FUHA 5I25A 1GBBA 3GCTF 1P06A 5A0CA 4X2XA 4FETA 4AB9A 3S9AA 2Q1JA 2OQ5A 1V2VT 4XBDA 1QL9A 4X1SU 3RMOH 1EJAA 3F2HA 1ZTLA 1GVKB 2PV9B 4VGCC 2BD5A 3KQ5A 3E0PB 1UCYE 1HAXB 3BTHE 2Y5GA 3LGUA 2NU0E 5DJ7A 3JZ1B 1DS2E 1X7AC 5C20A 1AN1E 4FUGA 2GP9B 4IMQA 3MU5A 1EOJA 4ABFA 1O3HA 3D65E 1SLUB 1K1IA 1A3EH 2CGAA 3GCOA 1GI8B 1BT7A 3SGAE 1EUFA 1TAWA 1MU8B 2XYAA 4ISIH 3S7KB 1F0SA 1BQYA 1AVWA 2PKSB 3LJJA 1C2HA 3BF6H 1PJPA 1AWFH 2QY0B 3GDSA 2OC1A 1G32B 4NFEA 2KFWA 4Y0ZE 5C1YA 4TPIZ 1VCWA 1GI4A 3OTJE 3RDZA 3F1SB 1HV7A 2QF5A 2CN0H 2W7SA 3FVFB 3ZZDA 3LH3A 2R9PA 4AOQA 2OTVA 3BEIB 1QL7A 4Q63A 5AF9H 2V6NA 1QIXB 1AQ7A 2PP6A 3VB4A 1H9LB 1HXEH 3GS9A 4CHAB 2BQ6B 1C5QA 1AZZA 4Y8YA 2VNTA 2C90B 1GMCF 1P0SH 5DP7A 1O2OA 1GBCA 1PPCE 3EE7A 4LK4A 4RT1A 3DD2H 1G36A 3OFND 1O3CA 1YWUA 3MNBA 2Z3CA 3TVJB 2BD9A 1D3PB 1P2NA 2ZDNA 5L6NH 3ESTA 1W13U 1J16A 1TNGA 2FXRA 2SGEE 1H8DH 1NY22 5DP6A 4DCDA 4UEHH 3UPEA 3W95A 3ZZ6A 1TRYA 4XSKU 2AMDA 4YESB 1IQLA 4UD9H 3BTEE 5HM2A 1E37B 2FO9A 1B5GH 2SGPE 1UK4A 3PWCA 2PGQB 3UQOA 2UUYA 1PPEE 2OC8A 1RIWC 1ZMLA 4GCHF 4BANB 1O3OA 1NN6A 1VR1H 1C4V2 1TNIA 1C5VA 1LKBA 1YM0A 2ANWA 3HK6B 4ZXYH 1W0JD 2PTCE 1O3DA 2ANYA 1ELFA 1FX0B 2ALVA 2F9UA 4K1EA 1IQKA 4FU9A 4MPWA 1N8OC 1QBOA 1IOEA 1A0JA 5L30H 4NA8A 2C93B 3CS0A 1C2KA 1O5DH 1QHRB 2FOAA 1CGIE 3NPSA 2R2MB 5HIYA 2W3KA 1WV7H 3A7WA 1SGQE 1J8AA 1ZTJA 1AUJA 1BTUA 2XBVA 4J2YB 1O2KA 1RS0A 1GBLA 1Y5UT 2ZPSA 1QQUA 1Y3XA 3MI4A 2IPQX 1ANEA 5EW2H 4A6LA 4GVUA 2STBE 2XTTB 3RXSA 2VIOA 3V12A 1VITG 2FESH 1TBZH 1A7SA 1GHXH 4ZKNU 3OY6U 1DANH 5CDFE 5BPEA 1DY8A 4B75A 2ZU1A 1C5XB 1WQSA 2TRMA 1QB6A 2RDLA 2YMSD 1L2EA 1XXDA 1ORFA 1CQQA 4K8YA 1MH0A 1QJ1B 1ZR0A 1ZSKA 5GCHG 1KIGH 1IQEA 4AGKA 2OXSA 5E0JA 4TY6A 1COWD 2PUXB 1KLJH 3M5MA 1TALA 1AFQC 2HALA 1TPAE 2R2WU 3F3BA 4Y10E 2ULLA 1D6WA 4XE4A 1V2PT 2Y6TA 1AD8H 4MPUA 5DPAA 1ELTA 3URDA 2PGBB 3RXJA 1MCTA 1YPHE 2QF3A 4JMYA 2Z3EA 4OS2A 2HVYB 3RM0H 5C0TA 1GBFA 1SHHB 2WYGA 3KL6A 5AVDA 1S6HA 1O3BA 5EIYA 1FIWA 1NO9H 2ZO3H 3Q77A 1L0ZA 1XUHA 1Y3UA 1JIMA 3TH2H 1NTPA 2YNAA 2P93A 1IQHA 1RRKA 2P3UB 5EJLA 2I6QA 1IQIA 1U6QA 2IOTA 5F8TA 1C5TA 1GJ8B 2ANMH 1SQAA 3G01A 1GHAG 3N99A 4A7IB 3Q3XA 3OEHD 1XUKA 1AWHB 1K1NA 2YMSB 3PRBA 3ZVDA 4B2AA 2BDYA 1O2SA 3KNXA 1C5NH 1E36B 3LPRA 1PPHE 6GCHG 2FOEA 3MO9A 3RC5A 2Y7ZA 1JRTA 5DKMA 4RSPA 1Z8RA 4WWYA 1L1NA 4NIVA 4IBLH 1QCPA 3P8FA 5K7RA 1BB0B 1C2EA 3TIUA 2BQWB 2Z3DA 1KXDA 1TOMH 1WBGB 2ANKH 3ITIA 4JZFH 3V7TA 2QN5T 1GI0A 1LTOA 2Y81A 2GV6A 1GHZA 1ZLRA 3N7DA 1INCA 3CP7A 3AK5A 2WPKS 6CHAC 2XC4A 1SB1H 3IG6B 3QGJA 2L6OA 1KY9A 1SR5C 2CMYA 1SGPE 2XNDD 1W7GH 4ZROA 1HAVB 1ZJKA 1IQFA 4A1TA 1P01A 3M3TA 3C1KA 3D62A 2AIQA 1YKTA 3LIWA 4HG6A 1HLTH 1DX5M 1K1OA 3SV7A 1UK2A 2HGTH 1GI7B 1MMJN 1DPOA 5DSFA 3PMHB 3L3TA 1GVLA 2BD2A 3E91A 2AMPA 3TJNA 1S83A 3T27A 2BDGA 1NRNH 3AW0A 4IW4E 1QL8A 2XWBI 3O8DA 3LGWA 2KCOA 4NA7A 3T29A 1SG8B 1TPSA 3TNSA 3GYLB 3MNCA 1UVPA 1LVOA 1S5SA 4LXBH 1BRUP 2ZFQH 2HPPH 2EY4C 3QWCH 2Z6BD 1SGFG 1SC8U 3F68H 4M7GA 2BVSH 1V2ST 1SGTA 3M3SA 4TSFD 2OD3B 1C1OA 2XBXA 2Y7XA 5F6MA 2ZECA 4ZHMU 5FHTA 4BAMB 3AAUA 1P9SA 3VGCB 1P3EA 1CHOF 3S9BA 4X6MA 1MTVA 1NZQH 1THRH 3SW2B 8KME2 1BTPA 4YLQH 1EB1H 2BVXH 5EXLA 4Z0KA 3RXDA 1TLDA 2J97A 3BTQE 4I86A 2ZWLH 3W1EA 4D7FA 1O3FA 3MH5A 3NZIA 2V0BA 3K6ZA 1NROH 1ESBA 1P10A 5E8EH 5IK2D 1CA8B 1YPMH 1XMNB 3H7TA 5FX5A 4OGYA 4Y0YE 1KMHB 1FY1A 1DICA 2ZCHP 4WF8A 1O33A 4I8LA 4X1QU 3UREA 3OY5U 3FP7E 5JPMH 1GJ7B 4CR5A 2VU8E 2ZIQH 5B6LA 3RC6A 2XNIA 4XBCA 3TH3H 1J15A 2DUCA 1O5GH 2ZFFH 3RXIA 4NA9H 1SI5H 2AHME 1OP8A 1YLDA 1GJ6A 4BAQB 1OWEA 3EE0B 1S85A 5LH8A 1NBME 3BTGE 4NG9H 2BVRH 2IN2A 2BZ6H 3P6ZB 2HLCA 3KCGH 4FUJA 1HB0B 1W0YH 2FLRH 4NSYA 1W8BH 1TBQH 1TMUH 1EFRD 4FUFA 1MTSA 1O3LA 2BY7X 1T8OA 2Z9IA 3BG4C 3BSQA 4ZXXH 7ESTE 2V35A 2A31A 3DSPA 5I46H 4O3TA 2HNTE 1DWCH 2J92A 1C2JA 1SGNE 1AIXH 4WXIA 2A7HA 3U1IB 2F43B 1NFUA 1BTXA 2WHXA 2J98B 2OINA 2WPHS 3DCLA 6CHAB 3FANA 2Y5FA 2C4FH 2ZQ2A 4IN1A 1W3CA 1A3BH 1EASA 1DVAH 2BB4A 4I8KA 1P8VC 4XD7D 1EPTA 2Y80A 3ZVGA 3BEFB 1Y3VA 3OX7U 2ZF0H 3DFJA 2RG3A 2FEQH 1MKWH 2NU1E 2FTMA 5T3HA 3DSOA 5HKKD 2VIPA 3O8RA 1ZHPA 5SGAE 2V3MA 3OAAD
chains in the Genus database with same CATH topology
4YT7H 4DURA 2F9NA 2GX4A 4B71A 1FY5A 1HFDA 4X2VA 2STAE 4CH8B 3C27B 2H5DA 4B74A 1YPHC 3GCHB 2UUKB 3Q76A 5GJ4B 1V2KT 5HGGA 3OU0A 1ZSLA 1FONA 3LT3A 3GCTG 1HAOH 2VVCA 2WPMS 1QY6A 1THPB 1GI1A 3B23B 3P8GA 1HPGA 2AGEX 2D2DA 1SHYA 3TK6A 3S69A 3ZZAA 1ZTKA 2EI8A 1W7XH 1BJUA 1YYY1 5ESBA 1FUJA 3SU2A 1MKWK 3RM2H 1SSXA 3ZVCA 1C1UH 4CBOA 1OYTH 1AB9B 1EPTC 1QRXA 1LVMA 4K2YA 1C1TA 3SU1A 1Y5BT 4BTUB 2OUAA 3SN8A 3P70B 4CRCA 2VWOA 1TGSZ 1O3NA 1TONA 5AFZH 5HM9A 2CF8H 4Y71A 5FBIA 2O8TA 2WPLS 4IMZA 1HJAB 2H9TH 1SQOA 4AFZA 1PYTC 2EA3A 3SQEE 1GG6C 2BQ7B 2CHAC 1SOZA 2QAAA 1D3DB 4ISLA 3CENA 5EQSA 1K2I1 1O34A 1LPKB 2WINI 3T25A 5JBBS 3Q3KA 5CMXH 3RXCA 2SGQE 3A80A 3RXHA 1L1JA 2BD8A 1XUJA 3F9EA 1E0FD 3EDXB 1RTFB 1XKBC 3SV6A 3NXPA 1XKAC 2ZDAH 3A8AA 4A92A 2ZP0H 3SHAH 1YPJH 1C2GA 1GMCG 1SOTA 3UTUH 2FYRA 4NZQA 2XRCA 3DHKH 4FUBA 4HTCH 2O8MA 1GJ5H 2FOCA 1QGFA 3UNSA 1SFIA 3M35A 4GLYA 1CSOE 1TMTH 4X0WU 3TK9A 4ASHA 1BBRH 3TJVA 1UHBA 5JBCS 4K3JA 1ELBA 4GUXA 4CRFA 5K0HA 2A32A 2ILNA 2FODA 1D6RA 4Z6AH 1KXBA 4ZHAA 2ZDLA 4JYVH 2Z94A 1ZYOA 1CT4E 4IC6A 3T62A 3BTKE 2CJIA 3TNTA 4I7YH 1VGCB 1ZPBA 1V2TT 4GCHG 1T8NA 1V6DA 1YBWA 1GBJA 3SJ8A 1TGNA 3B9FH 2P8OC 4JK5A 1VJ9U 1GMHF 2R3YA 2H1UA 3MU4A 2BOHB 4NSVA 1IAUA 1GMDF 3VFEA 1P2QA 4INLA 1P09A 3F9GA 3MU0A 2B5TB 3KIDU 1RTKA 1Y3WA 1AY6H 3GY7A 2W26A 4ZHLU 1YPGH 1VZQH 4K8BA 1GGDC 1BZXE 1A1RA 1TNJA 1RXPA 3VXEH 2G8TA 5FX6A 3RLYH 1H1BA 8LPRA 1ANDA 1E34B 1SMFE 3PTNA 4ZH8A 1P04A 1TYNA 1SVPA 1TIOA 1DXWA 2A4OA 2ZHDA 1NT1A 1D3QB 2TIOA 2P3TB 1SGDE 3ATMA 5JDUB 4UFEH 1FAXA 5BRRE 1O38A 4BXSA 1C9TA 1P11E 3M61U 2GKVE 3P17H 4FUEA 2D26C 8GCHF 3PO1C 5FCRA 4D8NA 4KKDA 1DLEA 1XM1A 3GY2A 1EAUA 1GBDA 1VJAU 1YCPH 4Q80A 5EQQA 3SJOA 1C5MD 2D8WA 1ELGA 2ZU3A 1EZSC 1CE5A 4FU8A 1A61H 1UVUH 5JBTA 1O2NA 3MH7A 3MMGA 1SBWA 1GG6B 2JETB 1BMMH 1EAXA 2FTLE 2Z7FE 4R8TB 3U98H 2HNTC 1DE7H 1RD3B 1T8MA 5A8YA 1UTMA 3SNCA 2WUCA 3N7OA 1DOJA 2H2ZA 3UFAA 1H9HE 2F9PA 2J34A 4KELA 3F6UH 1Z71A 1P02A 2LPRA 1AZ8A 1HAGE 4WJG2 3MO3A 1SQTA 5DP3A 1YCPK 4JYUH 1LVYA 4FU7A 2VIQA 2ZDVH 1MU6B 4NWKA 3U8OH 1C2MA 1V2NT 3TK5A 1YCPM 1O5AB 2P95A 4X6PA 4F4OC 1O36A 2B9LA 2SNVA 4ABHA 2Z9GA 2BLOA 1P9UA 1ANCA 4UFGH 4ESTE 1W0ZU 1ELCA 1YLCA 1EJMA 1N6YA 2ZDKA 5HXFA 1D3TB 1FXYA 2QCYA 2R0LA 3TU7H 1UTNA 2Q6GA 2P3FH 4HFPB 4Y7AA 4ZUHA 2V3OH 3GY5A 3D49H 2P8OB 1GL1A 2J2UA 4Q2KA 4NCYA 1AU8A 3HKIB 1HXFH 4THNH 4BOHA 1CBWC 2ZG0H 2Y5HA 1NS3A 1QJ7B 3GCNA 1FJSA 1GJAB 3GY3A 2WV4A 4YOIA 1TB6H 1C5SA 3GY6A 1QA0A 3BTTE 1C9PA 2QC2A 3JZ2B 1NFXA 4MG3A 1ZPCA 1UMAH 1A46H 1O31A 1UHBB 2FZZA 1GCTC 4QT8C 1BRAA 1W11U 1ZMJA 3MNXA 2OP9A 3M36A 1FPHH 1Y3YA 2O8LA 5B6OA 2Z9LA 1N6XA 2HRVA 1SLWB 1LVBA 1Z8JB 4O97A 3RXLA 2HNTF 1RFNA 1K1MA 1EAIA 3PMBB 4DW2U 9LPRA 1IQJA 1O39A 4YLUA 1OWDA 2VWNA 4VGCB 4I8GA 1WYKA 4TY7A 2I6SA 1OWJA 1S6FA 1NRRH 1AI8H 3LJOA 2VVVA 1P2IA 1O2ZA 1UVSH 3RP2A 4X2YA 3M7QA 1LHEH 2VVUA 3EGKH 2C8XB 2PFEA 1FDPA 1LQDB 3S7HB 1OWIA 2XW9A 1KLTA 5E0HA 3RXVA 1QR3E 2GGVB 4AX9H 1RJXB 2ZU5A 1K21H 1ZHMA 1MZAA 2G5VA 1LPGB 1NRSH 1TNHA 4H6TA 3STIA 2ZTZA 3SU0A 7GCHF 1DWDH 2A4QA 3UIRA 4JCNA 2ZNKH 1LPZB 1OX1A 2TGAA 2ODYB 4OS4A 1TPOA 3FZDA 3U9AH 1KXCA 1KLIH 3BG8A 1HIAA 5ESTE 1TX7A 1IQNA 4YZUA 4B1TA 2HPQH 7LPRA 2F9OA 1W12U 3PWBA 4DJZB 3SI3H 4LZ1H 2C8ZB 5HYOA 1P05A 1C1SA 1GHBF 2BY5X 5PTPA 1UTOA 4ZKRU 2EC9H 1IHTH 3U69H 5H4IB 2FPZA 3VB5A 3NWUA 2M5TA 2F9VA 3LGVA 1C1NA 4JK6A 4WVPE 1C5OH 4RKJB 2SGFE 5TJXA 1LO6A 2ZFPH 2ZGJA 1SGYE 1AGJA 4LOYH 4D9QA 2FM2A 3EQ0H 3O8BA 3RXOA 3RU4E 3AW1A 3ATIA 3K6YA 2RA3A 2A0QB 1RIWB 1C5UA 2A7JA 2DE9A 2RCEA 4YTAA 4ABEA 3L33A 4X8UH 5TCAA 3A84A 3UR9A 1MD8A 1NFYA 4Q7XA 4FUIA 3ZVBA 2UUFB 1C1PA 1TWXB 1MTNC 2YNBA 1N8OB 4XFQA 2VINA 1Z1IA 5FXLA 1MQ5A 2A2XH 2O8UA 4IN2A 3RXKA 1G3EA 3MH6A 1B0EA 3HATH 2V3HH 4NIWA 3RXBA 4O03A 3A7YA 5C1XA 1AE5A 4FUCA 3LC5A 3A89A 1LHGH 1HJ8A 4YM9A 4IGDA 3V13A 4MNWA 3VB3A 1ELVA 3L6PA 4ZAEA 1G3DA 4XOJA 5EGMA 1ZRKA 3MO6A 3ZVEA 1AVXA 1P57B 5T6DA 5EG4A 3MOCA 1ABIH 4J1YA 2GCHF 4CRDA 1BTYA 3WY8A 1IHSH 4B73A 4AFQA 4UFFH 3A83A 4YOGA 1WAYB 3QN7A 1F5RA 2FOBA 2AH4X 1AE8H 2GCTC 1V2LT 3SU6A 1SFQB 1WUNH 3KEEA 1KXAA 1MCVA 1SGRE 4I8HA 1TOCB 3P92A 1VITF 1AFQB 1TRMA 5LPEA 1NU7B 4GHTA 2BHGA 2FOFA 2GD4B 3NKKA 3VXFH 1MUEB 4AG1A 2AEIH 4TWWA 1GHWH 1O37A 1CT0E 1BMLA 1O3AA 2UWLA 1SL3A 3KQBA 1A4WH 4RN6A 5GCHF 2ODPA 2FP7B 4I31A 5C5OA 1EAWA 4DT7B 3PLKA 1KYNA 2QXIA 2NWNA 1AKSA 1O5CB 1UJ1A 4BTIB 1LDTT 3ZZ7A 3VB7A 1F92A 1YPKH 1JOUB 1XUFA 3MYWA 1EZQA 2J38A 2BOKA 3LH1A 1GWAA 1QRWA 2KAIA 3HPTB 3A7VA 5C5NA 1F0TA 1TX8A 1NRQH 1THSH 2FOMB 5C2ZA 1ANBA 1UTLM 1C5WB 2ZU2A 2A5IA 3M5OA 3M7UA 4NIYA 2QF0A 1A5GH 2K1QA 1MTUA 1H4WA 3KQCA 2ODQA 1O32A 2A7CA 3B8JA 2PSXA 4K5ZA 1OP2A 1P2OA 4AYYB 1QNJA 1XUGA 1C2LA 3T28A 3ZVFA 1Y8TA 1ZZZA 1PQ8A 4H6SB 4DY7B 1WSSH 3GOVB 2BLWA 4X8SH 4D76A 3MWIU 2XC5A 1GHAF 4A1VA 3Q00A 4JZEH 4SGAE 5FBEA 4E7NA 3U8RH 2ZFTA 3A87A 4OS6A 3KF2A 5ETXA 1QFKH 2YOLA 3E16B 1HIAB 1CGHA 2ZTXA 3R0FA 6GCHF 2IJOB 3MFJA 2O9QA 1CA0C 2ZHWH 2B0FA 2VH0A 4X8TH 1S84A 1GMDG 1SLXB 1XVOA 1H9IE 1K1PA 2GT7A 1Q31A 4WH6A 2VGCC 1O3MA 2ZGXH 3A7TA 1MTNB 1FY3A 1UK3A 4Q7ZA 3MTYA 1TQ0B 4FVDA 1GDNA 1O2YA 2A45B 1BIOA 5EU8A 3H7OA 3FFGA 2OLGA 1DFPA 4B2CA 1MD7A 5FPYA 5L2YH 1O2MA 2EI6A 1Z6EA 3SUFA 5JBAS 5G4BA 4I8JA 1EZXC 4H4FA 4ZKSU 4HGCA 5J4SA 1BOQA 1FIZA 1TE0A 1QURH 1ETRH 1K22H 3QTVH 4WXVA 1A5HA 5F8ZA 2CF9H 5TCCA 4UDWH 3ZZ4A 4I32A 4TPYA 4DIIH 1TA6A 1JMOH 1EB2A 1GJBB 2SNWA 3BIUH 3PMJA 3NUMA 3SV9A 4X1NU 1KXEA 3SJKA 2AMQA 5A0AE 1FI8A 3M7TA 5GPIB 1JXPA 1KDQA 1HRTH 3SHCH 1FY4A 1K9OE 1YP9A 1OXGA 4ABIA 8GCHG 3QX5H 2GCTB 2J94A 4ISNA 1C5RA 3R3GB 4BAOB 1A5IA 2RA0A 3EYDA 3UNQA 5CE1A 2GTBA 7KMEH 1C5ZB 1ELAA 4D7GA 4GSOA 2J9NA 1S0RA 1V2QT 2FX4A 1ZJDA 1BRCE 2FDAA 2ZGHA 5DO4H 5EXMA 3RMNH 1S81A 4TYDA 1C2FA 5E2PA 2WPIS 1FN6A 5FPTA 1EOLA 2GVFA 3V0XA 2ZHEH 2C8YB 2FI4E 3IITA 5EPNA 3A85A 1KXFA 5F8XA 3RXPA 4AFUA 1HGTH 1SGIB 1K1JA 4Y6DA 5A09A 1MKXH 1ACBE 2AIPA 1LHFH 4MNYA 1ZPZA 1O2RA 5DP8A 1ZMNA 1FAKH 1P2KA 2WUBA 1C4Y2 3SORA 3NCLA 5F03A 2F3CE 3ODDA 3PM3A 1UTQA 1MQ6A 3E0NB 4CRAA 4OS5A 3UUZA 5T6GA 3T2NA 2G00A 3RC4A 5GWZA 4YOJA 4X2WA 3DA9B 3UNRA 1GDQA 2UUJB 2EEKA 5C1UA 3RMLH 1XX9A 2WV5A 1O5FH 3ZV8A 1O3PB 1O2HA 1SLVB 3MU1A 2XCNA 2PKAA 2THFB 3BG4B 6LPRA 3IWMA 3QGNB 1MTWA 1C1RA 1E35B 1QJ6B 4U01A 3UWIA 4MDSA 4F49A 3SBKA 2BTCE 1TNLA 2GZ7A 1ARBA 1MKXK 4DOQA 1TGBA 1TRNA 1ZSJA 3PTBA 4Y11E 1GI9B 1WU1A 3SUEA 1L4DA 3ZZ5A 1AKSB 1G30B 4CRBA 5FPSA 1F5KU 1O5BB 1GDUA 1BTHH 1J9CH 3HKJB 1V2MT 5JYIA 5GIBA 1AMHA 3GYMA 2A5KA 3KQDA 3QTOH 4MNXA 2KAIB 1BBRK 2PR3A 1CO7E 3W94A 1A0LA 2GMTC 1PYTD 2A2QH 2Z9JA 2D1JA 1PPFE 2FIRH 3E1XB 1GI6A 3K9XB 1GVZA 5EPYA 1BDAA 1EZUC 1ZOMA 2BDAA 3QZQA 1UCYH 2SFAA 1P3CA 3CS7A 3V3MA 4IC5A 2BXUH 5DP5A 4YO9A 4X6OA 1ETSH 3MNSA 3RU4D 3RUOA 3E3TA 4U2WA 3RXTA 3SNDA 1C2IA 2Q6FA 2P94A 3HGNA 3ZYDA 3ZZBA 4CH2B 1TFXA 1FMGA 1O0DH 1T7CA 1ZGIA 5E0GA 2FX6A 1B7XB 3TLOA 1G2MA 3P95A 2AGGX 1NC6A 1QTFA 1QRZA 1EPTB 2ZI2H 2P59A 1HAPH 1OOKB 2ZEBA 3ELAH 3KGPA 1QBVH 1PQ7A 1O2TA 5L2ZH 2OC0A 2JH6D 2XBWA 1JWTA 1UCYK 1ELEE 4NZLA 4K1TA 3FP6E 2ZCKP 1O2QA 2FOGA 5ABWA 1DWEH 2ZTYA 1WTHD 3SGQE 4NIXA 2CHAB 7GCHG 1YC0A 1JRSA 4XDEA 1TX6A 1VCPA 2FWWA 1WOFA 1EP5A 2WPJS 1SGCA 2QA9E 1Z6JH 3RXAA 1GI3A 1MZDA 2NU3E 3SV8A 1FLEE 2IPHA 1G37A 3ZZ3A 5DGJA 3VPKA 1V2RT 3VEQB 1KDQB 2G5NA 1GHBG 1ELDE 1CU1A 3U1JB 2BX3A 2HOBA 3RMMH 2J95A 2R3UA 2FI3E 3A82A 2TGPZ 4UE7H 5JB8S 4Q7YA 3E8LA 1IQGA 3KQEA 3A88A 3Q3YA 1HAVA 2C3SA 2QGRA 4Y8ZA 3U8TH 4DGJA 3F9HA 1Z7KA 1C5YB 3SOSA 3TGKE 1HYLA 3UOPA 3E6PH 3GICB 4MPVA 3RXFA 1WCZA 1MAXA 1IQMA 3ATLA 4A5TS 3GDVA 4GAWA 3SU4A 1KTSB 1V2OT 2Y82A 1ARCA 1BHXF 3D23A 1DWBH 2PW8H 3FZZA 1ZRBA 2PWXA 1OWKA 1ZGVA 1GBKA 1PPGE 4E7RG 3LU9B 2PHBA 3ATKA 1DUEA 4R0IA 4B2BA 1TABE 1F7ZA 1Z8IB 2A4GA 2GMTB 4GHQA 1C1MA 4SGBE 3I77A 3MHWU 1HBTH 4K1SA 4WH8A 1GI5A 5IDKA 2ZU4A 1GJ9B 1GGDB 3PLBA 2VJ1A 1LCYA 5DP9A 3H5CB 4WMDA 2F9BH 2PKAB 1Z1JA 2FLBH 1JBUH 1EKBB