1TRNA

Crystal structure of human trypsin 1: unexpected phosphorylation of tyrosine 151
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
224
structure length
223
Chain Sequence
IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (serine proteinase)
molecule keywords TRYPSIN
publication title Crystal structure of human trypsin 1: unexpected phosphorylation of Tyr151.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 223
sequence length 224
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1995-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1trnA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1trnA02
3TK5A 4Z0KA 1PPBH 1HB0B 2ODYB 3O8RA 1V2UT 1SL3A 5JBBS 5FCRA 1F5LA 2NU3E 3A85A 3PTNA 3A8AA 4IN1A 3EA8A 4KTUA 1CHGA 1O3KA 1P11E 3VXFH 2QC2A 5FBIA 2O9QA 4ZHAA 1FDPA 1GHBG 3RLYH 4E06H 5HXFA 1LQDB 2BY7X 3TNSA 3RXDA 8LPRA 3SV8A 4ISOA 3K65B 1RIWC 1TMBH 1IOEA 1HJ9A 2BMGB 5DP5A 3ZZBA 1O2JA 4M7GA 2XCFA 1UVSH 3PB1E 4K8YA 2W3KA 1G32B 5HMAA 3A88A 1P2QA 3IWMA 3SNAA 1A1RA 4DGJA 3I78A 2ZPSA 5T6FA 1A0LA 3TGJE 2P3UB 2ZU3A 1O34A 1RS0A 1O38A 3BG4C 1SGDE 1TQ0B 4MVNA 3UFAA 5ETXA 3TVJB 4ISIH 4I32A 3BSQA 2XC5A 2C8YB 1ZOMA 3IITA 1M9UA 1VITH 3A87A 1O3EA 4CR9A 5TCAA 5EXNA 1G2MA 1O2XA 3ZVBA 1X7AC 1P02A 3BTFE 3I29A 3JZ2B 4IMZA 2GV6A 3URDA 1ELCA 1BIOA 5EXMA 4H42U 1VZQH 2HNTE 1P03A 1GHZA 3RXLA 1ZRBA 4ISLA 3BG8A 1SHYA 2ZIQH 3A7VA 1HAZB 2O8MA 2WPMS 1GI1A 3RXOA 2BLVA 2R9PA 1P2JA 2TGTA 1V2TT 5DO4H 4IC5A 4MNWA 1O2LA 3PLPA 4BAKB 1KTTB 4NSYA 2WYJA 4JYTA 1P04A 1K2I1 1GJ9B 3RU4T 2IJOB 4FVBA 2D1JA 1YPJH 2OC8A 1ANCA 1GHXH 4ESTE 1YPEH 1YPHC 1HRTH 2ZC9H 3UOUA 3A8BA 3ZZ4A 1ESAA 1BJVA 2AYWA 1GI4A 2ZFTA 3ESTA 3E1XB 1LHCH 5CHAC 4D7GA 1QBOA 2CHAC 3IG6B 1INCA 2EI6A 1ZTKA 3M35A 4Y8XA 4ZHMU 2BY9X 2V3HH 2WYGA 1C4Y2 1KY9A 1GVZA 1Y5AT 2V6NA 3VB7A 1AB9B 1GPZA 1C2DA 2H5CA 1EAIA 2AGIX 3GDUA 2ZFRH 5A0BA 3NK8A 3A7WA 4ISNA 1J14A 4U32A 1O3CA 1EJAA 1ZR0A 3QZRA 1QNJA 1MQ6A 1O3BA 4ASHA 1C1UH 2ASUB 1FLEE 4Y6DA 1IQEA 1HUTH 2OBQA 4K1SA 5GPIB 1BMNH 4BXWA 1D3PB 5K0HA 2THFB 1O2RA 5EQQA 3EA9A 4DG4A 3I77A 5GCHF 3T2NA 5F8TA 4ABGA 1Q2WA 2PKSB 3MU8A 1A2CH 1O0DH 5A8XA 1FN6A 1C1OA 1SMFE 1UCYE 3M7TA 2GX4A 3DUXH 4AFQA 4B1TA 5A2MH 1HYLA 2OQ5A 4CREA 5GCHG 1TIOA 1O3NA 5FCKA 1FPHH 1O32A 1CT0E 1Z71A 5EG4A 2Z94A 1TMTH 3LIWA 1PQ7A 1W14U 2CF9H 1VR1H 1O5GH 1GI3A 3FZDA 1B5GH 4YT7H 1O5BB 2I6SA 2A1DB 1S82A 3S7HB 1KXCA 1ZHPA 2AGGX 2AS9A 2CJIA 3P8GA 1UTPA 4INLA 1DS2E 4TPYA 2J2UA 1V2VT 3F6UH 5C5OA 1OWEA 1C5MD 3RMLH 4CHAB 3L33A 1SLWB 1V2OT 3QK1A 1SGFG 4VGCC 4NA8A 1H1BA 1LHGH 5IYTA 3RXTA 1BHXF 1YKTA 1BTWA 1BTHH 3L6PA 2ESTE 4GAWA 4ZXYH 2AMPA 3S0NA 3M5NA 4H6TA 1ZHMA 1SOZA 2C8XB 4Y8YA 2JH6D 2ULLA 1OOKB 3RXGA 3F9GA 5F8ZA 1O3GA 3ATLA 1HIAA 2SNVA 4KKDA 3OY6U 4FXGH 1NZQH 2QF0A 4HFPB 3UY9A 1AVGH 1GJ6A 1E35B 1C5SA 1TGTA 3P8FA 1FZZA 1XXFA 3RU4E 3T29A 2V0BA 2H2ZA 1CSOE 3GY8A 1B0FA 4NIYA 3SJ8A 5JB9S 3A84A 2PGBB 1MKWH 1G36A 3TJVA 3K2UA 3ATMA 1EAUA 1EAWA 1WAYB 2ZI2H 3P95A 1O35A 1P2MA 1SQTA 1AD8H 4GSOA 3F9FA 1A0HB 2HPQH 2W26A 1VCQA 1LHDH 2Y7ZA 1EP6A 4K5ZA 4MNXA 1HLTH 3M37A 3GCHB 1O5CB 3QN7A 1W12U 4JK6A 1TX7A 2TPIZ 4X1QU 3HK6B 1MAYA 1C5VA 2W5EA 5C67A 2AFQB 1NRQH 3BN9A 4AYYB 4U30A 3OY5U 1KLTA 3TGIE 4U01A 3UNRA 2ZU5A 2FXRA 2CV3A 2R3UA 3ATKA 3KN2A 1AGJA 1MQ5A 3RMOH 2CMYA 2ZCLP 1FNIA 1TB6H 1OXGA 2BD7A 2GDDA 1QL9A 2A7JA 1IQMA 1AFEH 1B7XB 2BQ6B 4X1RU 2EI7A 3UNQA 4B74A 1ZGIA 1GI7B 1CHOG 2F9NA 1O3MA 2UWPA 2SGPE 4DJZB 4Y10E 4B2BA 1TBQH 3EDXB 3ZZ3A 1E34B 3FAOA 3KHVA 4ABIA 1EKBB 1LPZB 1FIWA 3BTTE 3LT3A 1UTJA 2DE8A 1FONA 1DXWA 1YM0A 5GDSH 3UIRA 3GCOA 1DLKB 4A5TS 4K60A 2UUKB 2BVRH 2BD2A 1GI9B 4KGAA 4XFQA 3GYMA 3F9EA 4Z6AH 1NRRH 4INHA 1XM1A 1G2LA 3ZVFA 1P8VC 3KF2A 1PPEE 1J9CH 1C4U2 1N8OB 1NC6A 1SR5C 1TOCB 3S9AA 1GDQA 3SNBA 2A5AA 2B8OH 1AUJA 1EOLA 1YPKH 1TNLA 1Y3WA 2P3FH 1A5GH 1OPHB 2P95A 3CS7A 2R3YA 3UUZA 1DWBH 1NY22 3RLWH 1K1JA 3QGJA 3MO6A 3GY6A 1NT1A 5EOKA 1KXAA 1GDNA 1EPTC 1RXPA 1O2VA 3SU4A 3E3TA 5CMXH 5DP8A 3NCLA 2Y7XA 1SFQB 2Y5GA 5G4BA 4AG1A 1W7GH 1A3BH 3GISB 1C5YB 1V6DA 1YPMH 5AVDA 4BAMB 2OD3B 3CP7A 1C5LH 1ELEE 1GI2A 2FOAA 1KIGH 1J15A 1O2OA 4JZFH 4DURA 3SUGA 4ZH8A 7GCHF 4MNYA 5I46H 2BDGA 4BANB 4FUCA 5LH8A 1GL1A 4JMYA 1TWXB 4A92A 1RIWB 2GKVE 1TAWA 2EA3A 3PMHB 2BQ7B 4UFEH 4O3TA 1SQOA 4JYVH 1GWAA 3UR6A 3Q3XA 4JZEH 4CHAC 2UUFB 1XMNB 1THRH 1O2QA 1TBZH 1P10A 1DDJA 1GI8B 1OYQA 3PMJA 2PUXB 3MNXA 3E0PB 2A0QB 1ABIH 1HAIH 2PGQB 2LNCA 6ESTA 3SU2A 3LH1A 2ZU4A 1Y3XA 3BG4B 3TH4H 4D7FA 1QB9A 4X6PA 1EJMA 2CF8H 1F7ZA 1SGNE 2ZEBA 5EW2H 4TY7A 2RCEA 4J1YA 2Q6FA 4LXBH 1IAUA 1RTFB 2YNBA 1P2KA 1UJ1A 2UWLA 8GCHF 4DVAU 1PYTD 1KYNA 1L2EA 1P05A 4J2YB 4ABAA 3BTDE 3RUOA 1CT4E 1Z8RA 2QYIA 1ANBA 2F9OA 4WY3A 5F03A 3LONA 5I25A 1AE5A 3K9XB 2QN5T 8GCHG 2FWWA 1MD8A 4XE4A 1GBTA 2Y5HA 3RXUA 1AZZA 4I8GA 2IOTA 3RXJA 1ANEA 1GGDC 2FO9A 1TE0A 1AFQC 2GV7A 2KAIA 5HM9A 3GCHC 3SI4H 1L0ZA 1ARBA 1FY3A 2GZ8A 4WH8A 1HAXB 1MKWK 2WPHS 3A81A 3QDZB 4UONA 1OS8A 3M5LA 2ZPQA 1O2TA 2PV9B 5CHAB 1WBGB 1ACBE 1CVWH 5EODA 2CHAB 3U1JB 3VB5A 2SFAA 4AG2A 6LPRA 7KMEH 4RSPA 3RP2A 2KAIB 2OQUA 1WQVH 2BDYA 1BDAA 1MU8B 1N1LA 1FV9A 2Z9GA 1DY8A 2FOBA 2ANMH 3TPIZ 1O3AA 2OXSA 4KTCA 1PQ8A 3ZZ7A 1MTSA 3V12A 1P06A 3ZZ8A 2W7SA 1QIXB 1GBFA 3KQBA 3U8RH 5AF9H 1BBRE 2VIVA 1GBHA 4FUIA 1SGRE 5EPYA 1KDQA 4ZHLU 1C1RA 3R3GB 2BB4A 1IQFA 1GHVH 2GD4B 2J38A 1CA8B 1O3IA 1KTSB 4BOHA 2XCNA 4AB8A 1AUTC 1BMMH 3VFEA 2GMTC 1C5WB 4I8HA 2JH0D 3BEIB 1KDQB 3SJIA 1GMCF 4NZQA 4ABHA 1E36B 1GDUA 4JYUH 1SGCA 5FPSA 3VGCB 1P2IA 2FOCA 3SJOA 3TJUA 1V2KT 1MBQA 1CGJE 1TA2A 1QBNA 4IMQA 1BBRH 1SGIB 2A5IA 5JBAS 2OC0A 2ZHQH 1GMCG 2OCVB 4K3JA 1T4VH 2XRCA 2VVCA 3MU4A 3EA7A 2YOLA 4GCHF 4ABBA 3TK6A 2OLGA 1N8OC 5JDUB 1YGCH 3E16B 1A5HA 5DP6A 4ABJA 1CO7E 1O39A 2ZGHA 4A1XA 2NU4E 2ZTZA 4GCHG 4AGJA 1QR3E 4GLYA 3UOPA 1C1MA 1CE5A 1C1QA 1N6YA 1G37A 1GVKB 3LU9B 1PQAA 2Y6TA 1MAXA 2SGAA 2UUJB 1G30B 3MTYA 3BTHE 1P09A 4VGCB 3VB4A 5FAHA 2STBE 1S83A 2G51A 3M5MA 3M7QA 1QA7A 2DUCA 4K1EA 4YLQH 3LOXA 1BA8B 1T32A 4XOJA 1KXBA 2FODA 2ZCKP 3A8DA 3LC3A 2QAAA 2VNTA 5E2OA 2GGVB 1O2GH 1KLJH 4AYVB 2GZ7A 3SHCH 1BTUA 4FUJA 2O8WA 3EYDA 1EZSC 2C4FH 4Y0YE 2QXHA 4MTBA 3LGYA 3GCTG 4Y8ZA 3U8TH 2G4TA 2G5VA 4KTSA 5T3HA 1NRPH 2Y5FA 4IW4E 5EQRA 1A61H 3AAUA 2AGEX 2Y82A 3LGVA 3LDXH 2B7DH 3C1KA 3OYPA 1HXFH 4FUEA 3A80A 1KXEA 3K6YA 1THSH 5A0AE 1TNGA 1YF4A 1OP8A 1C5ZB 3MH4A 2ANWA 3PMBB 3VB6A 1A3EH 1GCDA 1SVPA 1XUIA 4HZHA 5E2PA 2F3CE 4HGCA 1F5KU 1DPOA 1AU8A 2HNTC 3RXPA 1EXFA 3U69H 1XXDA 1MZAA 1C5XB 2ZU2A 1YCPH 2SGQE 2FOGA 4MQAA 1RRKA 2FS8A 1C5PA 2ZCHP 2VVVA 2G5NA 1P0SH 3VB3A 2ZF0H 3E91A 1TABE 1SPJA 3MNBA 2H5DA 1ZSLA 1U6QA 1OX1A 4D9RA 1ESBA 1WYKA 1C2FA 2BD8A 1UVOA 4YESB 1GJCB 3STJA 4AORA 5DP4A 2ZGCA 3OSYA 3A86A 1V3XA 1ZMLA 1FY8E 2JETB 2QXJA 2OUAA 1L4ZA 1IQGA 1CA0C 1C2EA 5E0GA 4E05H 1H9IE 1K1IA 4O97A 1S85A 1Y8TA 4FUFA 2A31A 1EX3A 4MLFB 1W0ZU 1AKSA 1G3EA 2GT7A 2FESH 3ELAH 1QQ4A 1MCTA 2Y80A 1SGYE 2BYAX 1JXPA 5B6OA 3BTGE 1JWTA 5GXPA 1ZJKA 4ABFA 1ID5H 2P59A 2PSYA 4CRAA 2VU8E 3OX7U 1T31A 1EOJA 1WCZA 1Z6JH 1BTXA 1AKSB 3RXCA 1QRXA 1C5UA 1EPTA 3S9CA 2Z9KA 1DUAA 3QUMP 2F9BH 1C5RA 1GG6C 1Z8JB 3MYWA 4B75A 3PM3A 4I7YH 2WPKS 2TGPZ 3SUEA 4SGBE 2ZGXH 4R8TB 1MKXH 5FX5A 2BTCE 1SBWA 1EPTB 2QY0B 1LPKB 4LZ4B 1LMWB 3LGTA 2TBSA 1Z1IA 3SU0A 3VGCC 5F8XA 2ZTYA 1BRAA 1GI5A 3QWCH 4CRDA 1CGHA 4HTCH 1EB2A 1YYY1 2FZZA 2C3SA 1AY6H 1Y5UT 2FOFA 3SV7A 1SLVB 1H8IH 2ANYA 2AIPA 3PYHA 1AIXH 1BOQA 4MG3A 2D8WA 3A82A 5GWZA 2P8OC 2PFEA 9ESTA 4BTTB 1O5EH 4YTAA 3C27B 1NESE 2BY8X 1Y3VA 3QLPH 1KLIH 3P6ZB 1NRNH 4UFDH 3V13A 1GBJA 5C20A 1PYTC 4WF8A 3SZNA 2PW8H 5K7RA 5L6NH 3VEQB 3O8CA 1FAKH 4FUGA 1PQ5A 1GBCA 1F0SA 4OS1A 1Z8GA 2HPPH 1TOMH 4WMDA 2H1UA 1UCYH 1TGBA 1Z8IB 3V7TA 1K21H 4AN7A 2ZFPH 4HI3A 1L1GA 3LJOA 1DITH 1LVOA 4FUHA 1O2UA 4WH6A 2W3IA 1O2YA 2BDIA 3ATWA 1JIMA 1O3LA 2Z3EA 4I31A 1LQEA 5A8YA 5DP9A 3D49H 1S84A 1AO5A 1TBRH 2ANKH 3RXQA 2HOBA 3AASA 3TU7H 1O5DH 3SJ9A 3ZVGA 1F0RA 4FU9A 2A5KA 3LGIA 2A4GA 3ZVCA 3TLOA 2WUCA 1HJAC 3TITA 1EJNA 1QY6A 2BVSH 3B8JA 2UWOA 4YOIA 4OS2A 5LPEA 2WV5A 4O9VA 2OC7A 5ABWA 2WUBA 4XDEA 3WY8A 4K69A 4YOGA 1HIAB 1NU7B 1CQQA 1V2PT 2VIDA 4TYDA 2BDCA 1ELVA 1F0UA 2G4UA 1DM4B 3KIDU 2SGDE 2F9PA 1YP9A 1FN8A 2PWXA 1P2OA 1O2IA 1IQIA 2GT8A 5HYOA 5HGGA 1BRCE 3UREA 4QT8C 2ZDLA 2P94A 2GVFA 1GHAG 1HFDA 1OWIA 1DX5M 2VIOA 1DUEA 3PV4A 4NA7A 1HAGE 1GBKA 1NFWA 5CE1A 2J4IA 1ZYOA 1BRBE 1GGDB 2V3OH 1AFQB 3ZYEA 1LVMA 1Y3YA 3EAJA 2C8WB 1RD3B 1C1PA 2FDAA 1ELFA 1IHSH 3KEEA 3QGNB 2ZDAH 4R0IA 2OP9A 4LK4A 2FI4E 1ZRKA 1TNKA 4GHQA 1C9PA 1W2KH 4X6NA 3DD2H 1ZSJA 1FI8A 1MBMA 1TALA 4X1PU 3G01A 1T4UH 1TONA 3ZZCA 3S9BA 1CHOF 2A45B 3TIUA 2A2QH 3MH7A 1O2WA 1UK4A 4X6OA 1NU9A 3N7OA 1YCPK 2C8ZB 2GZ9A 2VIQA 4WMFA 4IGDA 5C5NA 2SGEE 1H4WA 2GCTC 1C2MA 1V2RT 1T8NA 1V2NT 3KQEA 4AB9A 3U8OH 3BTKE 4FVDA 2JETC 1BHXB 3SI3H 2GMTB 3NZIA 2BOHB 5EU8A 4GPGA 3B23B 3AAVA 5EQSA 1V2ST 1VITG 3Q00A 2ZHEH 1RGQA 2XW9A 1LPGB 1QCPA 4AGKA 1EUFA 4NA9H 1K1MA 4YT6H 1F92A 1K1LA 4ZUHA 1KXFA 4DCDA 1CGIE 5L30H 2Z6BD 1LCYA 2P93A 3KL6A 3HGNA 2FS9A 1JRSA 2FIRH 4BNRA 4UE7H 4ABEA 1TNIA 1O3OA 1MMJN 2FOEA 2VGCC 1ELDE 1THPB 1S6HA 2XYAA 3NUMA 3UWIA 4DW2U 4CH2B 4JCNA 2Q1JA 2SGFE 1GCTC 5J4QA 1TGSZ 1GMDG 1JOUB 1KSNA 2HWLB 3P70B 1WQSA 2F9UA 1V2MT 1RTLA 1HNEE 1F0TA 2VJ1A 1VJ9U 1TGCA 1SLXB 2QV1A 3GOVB 2J9NA 2VH0A 2Z7FE 1MKXK 1SSXA 1TRMA 1W7XH 5FHTA 4AFSA 6GCHG 1C2GA 4X8UH 3U98H 1E37B 3S7KB 4NZLA 4FUBA 2GTBA 5FX6A 2PLXA 1DLEA 2TGAA 3K6ZA 1C4V2 1E0FD 1GBMA 1BZXE 2GP9B 2ZP0H 4TWWA 3RXVA 1BJUA 1ZTLA 2P16A 4MDSA 2GDEH 2CGAA 4MPXA 3MNCA 5JPMH 1Q3XA 1CBWB 4CRGA 1C1WH 1OWJA 1G3CA 3F1SB 2QF3A 1OYTH 1C5TA 1TQ7B 1O5AB 1IHTH 2R2WU 2RA3A 1V2JT 4Q7ZA 2ODPA 3PLBA 1GBLA 2I6QA 3SOSA 1HAYB 4F4OC 1TPPA 2PR3A 1LKAA 1LKBA 2ZECA 4NG9H 1VJAU 1DY9A 2XXLA 1UHBA 1Q31A 3SQEE 3T62A 1TFXA 1ESTA 1ETRH 3SU1A 3BIVH 3CS0A 1Y3UA 1UCYK 2R2MB 2ZWLH 2H9TH 1L1JA 2WPJS 1DANH 3UR9A 4THNH 4AFUA 2SNWA 5DGJA 4X6MA 4ZROA 4WMEA 1AMHA 2G8TA 4BAHB 1UHBB 3VPKA 3SV6A 3UQVA 4Y76A 3LH3A 5E0HA 3ZZDA 4Q7YA 1GJ4H 2ZDVH 5ESTE 4K1TA 4RN6A 3RXIA 1EB1H 2BXTH 3GDVA 3A83A 3SNEA 1ZGVA 1NO9H 1O30A 2XBYA 1ARCA 3NWUA 5JBCS 3TGKE 3JZ1B 3GY4A 1A0JA 1YBWA 1HJ8A 4JZDH 1HDTH 1XKAC 1BCUH 3HKIB 3MU1A 4K8BA 1OP2A 9LPRA 3DT0H 1OWKA 2ZPRA 1TGNA 2FYQA 2D26C 4AFZA 5DP7A 1RTKA 1J17T 3PWCA 1TPSA 2HRVA 4TY6A 2ZHDA 1ZTJA 2XNIA 1QRZA 2XC4A 1CA0B 2FPZA 5EGMA 1SGQE 3MWIU 4ZKNU 4PROA 3PO1C 2ZKSA 1ZMNA 1AQ7A 2BD3A 1D9IA 1NFXA 3LC5A 2PSXA 3GYLB 3EGKH 4YOJA 3BTQE 1FUJA 3GY2A 1QHRB 1QBVH 1TYNA 3A7TA 3H5CB 3LPRA 3M7UA 2ZQ1A 2ZG0H 4NIWA 1HAVA 1O2PA 1T8LA 1AVXA 3KGPA 4JZIA 5A0CA 2UUYA 1DWDH 2HVXA 3BF6H 3ZZAA 1S0QA 3RXAA 1DWEH 3HATH 3SNCA 3R0FA 4XBCA 2HLCA 1GG6B 2AMDA 4FUDA 3SGAE 1C1TA 1HAVB 1ORFA 2XWAA 1D6WA 5AHGH 1AN1E 3GDSA 2FTMA 4OS6A 1HAPH 3EE0B 4NWLA 1PPHE 2QCYA 1C2HA 2H9EH 2NWNA 1IQKA 1GBIA 1GI0A 4DIIH 2W7UA 2ODQA 3E8LA 3MH6A 6CHAC 1AZ8A 1SGPE 4D8NA 1O3PB 3A7ZA 2M5TA 4E7RG 2F9VA 1C2KA 2OINA 2BVXH 3M36A 1SGTA 4WVPE 2BLQA 3FVFB 2EC9H 1OP0A 1ELAA 5H4IB 1UVUH 2P8OB 1SC8U 3SQHE 2BY6X 1EATA 2FOMB 1SGEE 2BLWA 1AE8H 2PTNA 3DHKH 1V2LT 1FIZA 1GBAA 8KME2 5T6GA 1GVLA 2Z9IA 2ILNA 3DFJA 2ZNKH 1K22H 3UNSA 3ZZ5A 1WTHD 1G9IE 4NSVA 2A4OA 1IQNA 1BRUP 1QJ6B 2BD4A 3FZZA 3O8BA 1VCPA 1HCGA 3S69A 1YPLH 1IQHA 2NU0E 1C5QA 1PJPA 1HXEH 2FTLE 2EI8A 3FP7E 3F68H 1QFKH 3SGBE 4Y7BA 3M5OA 3RDZA 1H8DH 3RM2H 4FU8A 4X0WU 3H7OA 3GCTF 4IS5A 5BRRE 4MPWA 2Z3CA 1BMAA 1CU1A 4Y11E 1HJAB 1K1NA 1LO6A 4BTIB 1MZDA 3SO3A 2K1QA 1WU1A 1CBWC 3MMGA 1S6FA 1O2KA 5ESBA 2Z9JA 4WXVA 3TH3H 4B71A 1DSTA 3V3MA 1SB1H 4A6LA 2BX3A 3LGUA 4NIXA 3HKJB 1VCWA 5E0JA 4IN2A 4U2WA 1PPGE 3KNXA 4A7IB 2VWMA 1G3BA 2CN0H 2XBXA 1C1NA 4X2XA 3MU5A 1P2NA 1UTNA 1UVPA 4Q2KA 2Q6DA 4X1NU 2AEIH 1ZPCA 4DY7B 2J95A 1BITA 4Q80A 2FEQH 1TA6A 1GMHF 2ZTXA 1TPAE 2D2DA 4ZKOU 3E0NB 1H9LB 1E38B 3MHWU 1T7CA 1UK2A 4NWKA 5C3NA 3A8CA 4O3UA 2TGDA 1K28D 4ZXXH 1GMHG 1LTOA 4BXSA 1NFUA 3ITIA 1FJSA 1UTLM 2BY5X 2CXVA 1XKBC 4NCYA 2BD9A 1WSSH 1QURH 2GCTB 4X2WA 1A4WH 2A32A 2VB0A 1DFPA 2J34A 4GVUA 2STAE 3ZYDA 2QA9E 3RM0H 1S5SA 2AIQA 3VXEH 1ZSKA 2BZAA 3B9FH 4UD9H 4NIVA 2HGTH 4H4FA 5DK1A 1EZUC 1Z1JA 3NKKA 1A7SA 1P12E 1ZMJA 1VGCC 2VH6A 2C90B 2FP7B 1FY4A 3DA9B 1PFXC 4XBBA 4X8TH 2Y81A 5L2YH 1O2HA 5EPNA 1FQ3A 2GCHF 2YNAA 1JRTA 2FX6A 1GBBA 1UMAH 1YPHE 5LPRA 1QA0A 1ZZZA 2ZHFH 1FAXA 3FP6E 3MNSA 1A46H 2GCHG 2FLRH 2NU2E 2VGCB 3QTOH 1ZLRA 2A2XH 1YPGH 2BOKA 5TJXA 1XUJA 1TX6A 1GCTB 2ZGBH 5FPTA 5AFYH 3AVZA 5J4SA 1S0RA 1QL8A 1DVAH 3SU5A 3SV9A 2PUQH 3P17H 2XWBI 1FY5A 1O5FH 2WINI 2G81E 3PLKA 4YLUA 1GL0E 2G52A 3URCA 2V35A 1C9TA 4NFFA 2OTVA 1TMUH 1DXPA 1O2MA 2QGRA 2WPIS 1L4DA 1O37A 3TJOA 3ZZ9A 1AVWA 2BZ6H 1F2SE 4B76A 3D65E 1AWHB 1C5NH 3T25A 1C2IA 2ZA5A 1BBRK 3RXRA 1ZPZA 1HAOH 3QO6A 2ZDNA 3GCNA 1XX9A 1B0EA 1QGFA 3T5FH 5LGOA 5A8ZA 5HM2A 1P57B 2AERH 1O3FA 1YLCA 2BLOA 2XTTB 2ZU1A 3MOCA 2ZGJA 4WWYA 4A1VA 3T27A 1C5OH 2ZFFH 3UWJH 1QJ7B 5E8EH 4JK5A 1AI8H 5AFZH 3T28A 3M3SA 1K1OA 1MTNC 2IPHA 3RMMH 3EQ0H 1OSSA 3ZVAA 1KXDA 3A89A 1TRNA 3MFJA 1QQUA 1PPCE 5L2ZH 1MH0A 1QB1A 3RMNH 3U1IB 2NU1E 5JYIA 3ODDA 3MH5A 3PROA 3ZV8A 1D3QB 1V2QT 1HGTH 1GJDB 4FU7A 1NROH 3SU3A 5C1UA 1SHHB 3UQOA 3L3TA 1EAXA 4LZ1H 3U9AH 1BMLA 1T8MA 4OS7A 1GHAF 4WJG2 2VWOA 1CT2E 1O36A 2A7HA 1V2WT 1SLUB 1TRYA 3SNDA 1Z7KA 2DE9A 1YLDA 2VWNA 1QB6A 3DFLA 3LGWA 3V0XA 3QX5H 3NXPA 3F9HA 1DSUA 1C2LA 4CBOA 1FMGA 1NRSH 2O8TA 1P3EA 1QL7A 5EW1H 1FPCH 2ZFQH 3TNTA 2P3TB 3SGQE 2BQWB 3KQCA 1WUNH 4I33A 3A7XA 5C2ZA 7LPRA 1SGFA 3Q3KA 2O8LA 1W3CA 1EQ9A 3P8NA 1OWDA 4X8VH 2VVUA 1HPGA 1SOTA 2XC0A 4X2YA 3PO1B 4AX9H 2BM2A 2VWLA 1DWCH 4AZ2B 4D76A 3D62A 2F91A 2Z3DA 1DOJA 2FX4A 4MNVA 1O2ZA 3H7TA 4OGXA 2BDAA 4UFGH 1MTWA 1W13U 1UTOA 3W95A 3MI4A 5LPFA 1ELBA 3SORA 1ANDA 1Z6EA 3M3VA 2B5TB 3TJNA 3MO9A 2EEKA 5FPYA 1FY1A 1VITF 1UK3A 4NGAH 1D4PB 4JZ1A 3Q77A 4H6SB 1BB0B 2FYRA 2AH4X 2RA0A 2JKHA 5GIBA 1MCVA 4YM9A 1P01A 1DICA 3QTVH 3SJKA 1S81A 1PPFE 2BDBA 4GHTA 4TWYA 1IQJA 1OWHA 4MPVA 1NFYA 5PTPA 1TNJA 3AW1A 3T26A 4B2AA 4K2YA 6CHAB 3TK9A 3GICB 1EZQA 3LJJA 1QTFA 1UTMA 3HPTB 2G00A 2FMJA 4Y71A 2VIPA 3ODFA 3RXSA 5DKMA 2OBOA 3M61U 4ISHH 3BTWE 1H9HE 3ZVDA 1HBTH 1GMDF 1J16A 3QZQA 1TX8A 1SFIA 5DP3A 1ABJH 1GHYH 2FM2A 3ZZ6A 3RC5A 1AB9C 3SHAH 3SUFA 2HNTF 1QRWA 4OGYA 3TH2H 7ESTE 1O3HA 1GBDA 2ZZUH 4INKA 2R0LA 6GCHF 4I8KA 3M3TA 2FLBH 2FI3E 4ZMAH 1W10U 2FOHA 3O8DA 5A09A 4I8LA 3BTME 2Q6GA 1ETTH 2A4RA 1NTPA 2PTCE 3RXHA 3GY7A 1SQAA 3P8OA 4O03A 2QXIA 3BEUA 2LPRA 3UTUH 1DE7H 2PKSC 1GHWH 1Y59T 4I8JA 4BTUB 3BV9B 1MTUA 2B9LA 1BT7A 3W94A 5EXLA 1G3DA 2BDHA 1GJ5H 2VIWA 3BTEE 1ELTA 1LHEH 1XUHA 4Q7XA 3NPSA 1ETSH 4ZKRU 2ALPA 1F5RA 1AHTH 1L1NA 4X8SH 2VINA 5F6MA 5FBEA 4KELA 3KQDA 3SBKA 5SGAE 1YC0A 1RJXB 4TPIZ 1OKXA 2IN2A 5DJ7A 2ZFSA 3PMAB 5GJ4B 1ZJDA 4OS5A 3RXFA 2PKAA 7GCHG 3ATIA 4DT7B 2BXUH 2A7CA 1D6RA 4ABDA 3E6PH 1MTVA 4CBNA 5C1YA 1GJAB 4OS4A 1P3CA 4Y0ZE 2C93B 2TIOA 3BEFB 1AWFH 3STIA 4A1TA 4RKOB 3SV2H 2B0FA 4KP0A 2PKAB 2J94A 4UEHH 1O33A 1ELGA 2ZQ2A 4ZKSU 3RXBA 1QJ1B 1WTGH 1DT2A 2XBVA 2H6MA 3HK3B 1A5IA 1PPZA 2Z9LA 1W0YH 1O2SA 1BTZA 4UFFH 5DG6A 4X1SU 3RC6A 1NS3A 2RDLA 3KCGH 1SG8B 4BAOB 1LVBA 1C1SA 3D23A 1GI6A 1BTYA 1NN6A 1Y5BT 4F49A 3ENSB 1O31A 2PHBA 1XUGA 1BUIA 1IQLA 5T6DA 5IDKA 1EP5A 3RXKA 3ZV9A 2J92A 5JBTA 1ZHRA 3OU0A 2BD5A 1K1PA 1MD7A 1K9OE 3UPEA 1TLDA 4D9QA 4LOYH 1YCPM 4AOQA 4XSKU 1XVOA 1NM6A 3RC4A 1TNHA 2ZO3H 3AW0A 4DOQA 4NFEA 4CRCA 1JMOH 5JB8S 2RG3A 3GY3A 4CH8B 1VGCB 4B2CA 2ZHWH 1UTQA 2BHGA 2BX4A 2G55A 3BIUH 5BPEA 4WXIA 1N6XA 3RU4D 1RFNA 2AMQA 2WPLS 2ALVA 2OC1A 2ZDKA 3SN8A 3CENA 1ZPBA 3FP8E 4YZUA 1GBEA 1HV7A 3Q3YA 4ZAEA 1NPMA 1TPOA 1XVMA 1D3DB 1T8OA 4IC6A 1O2NA 4IBLH 1BTPA 2TRMA 1WV7H 2A4QA 1WOFA 2JH5D 2QIQA 3FANA 1GJ7B 3MO3A 4BAQB 1UTKA 1J8AA 3MU0A 2QXGA 3ZVEA 4DIHH 1SI5H 3HGPA 5TCCA 3Q76A 2R0KA 1O3JA 3P92A 1GJ8B 1P9SA 4MPUA 4B73A 4YO9A 1UVTH 1HAHH 5FXLA 3FFGA 3E90B 4Y79A 4XBDA 3GY5A 3A7YA 3RXEA 1LDTT 1D3TB 1MUEB 2WV4A 4CRBA 2HALA 1MU6B 1LHFH 1C1VH 1JIRA 3RXMA 5C1XA 5DPAA 3SU6A 8ESTE 4Y7AA 1W11U 4UDWH 1XUFA 2FI5E 1BQYA 1GJBB 1O3DA 3SUDA 4CR5A 1W8BH 4X2VA 1UO6A 1MTNB 3OTJE 4RKJB 3PWBA 4GUXA 2H9HA 4SGAE 2ZDMA 1LVYA 1P9UA 1EZXC 1EASA 1C2JA 4CRFA 2F83A 3PTBA 4E7NA 2XBWA 1XUKA 3SW2B 1JBUH 3LKWA 2O8UA 1FXYA 1GHBF
chains in the Genus database with same CATH superfamily
3TK5A 4Z0KA 1PPBH 2KM0A 1HB0B 2ODYB 3O8RA 1V2UT 1SL3A 5JBBS 5FCRA 1F5LA 2NU3E 3A85A 3PTNA 3A8AA 4IN1A 3EA8A 4KTUA 1CHGA 1O3KA 1P11E 3VXFH 2QC2A 5FBIA 2O9QA 4ZHAA 1FDPA 1GHBG 3RLYH 4E06H 5HXFA 1LQDB 2BY7X 3TNSA 3RXDA 8LPRA 3SV8A 4ISOA 3K65B 1RIWC 1TMBH 1IOEA 1HJ9A 2BMGB 3KYGA 5DP5A 3ZZBA 1O2JA 4M7GA 2XCFA 1UVSH 3PB1E 4K8YA 2W3KA 1G32B 5HMAA 3A88A 1P2QA 3IWMA 3SNAA 1A1RA 4DGJA 3I78A 2ZPSA 5GNDA 5T6FA 1A0LA 4ACBA 5DSFA 3TGJE 2P3UB 2ZU3A 1O34A 1RS0A 1O38A 3BG4C 1SGDE 1TQ0B 4MVNA 3UFAA 5ETXA 3TVJB 4ISIH 4I32A 1NBME 3BSQA 2XC5A 2C8YB 1ZOMA 3IITA 1M9UA 1VITH 3A87A 1O3EA 4CR9A 5TCAA 5EXNA 1G2MA 1O2XA 3ZVBA 1X7AC 1P02A 3BTFE 3I29A 3JZ2B 4IMZA 2GV6A 3URDA 1ELCA 1BIOA 3EE7A 5EXMA 4H42U 1VZQH 2HNTE 1P03A 1GHZA 3RXLA 1ZRBA 4ISLA 3BG8A 1SHYA 2ZIQH 3A7VA 1HAZB 2O8MA 2WPMS 1GI1A 3RXOA 2BLVA 2R9PA 1P2JA 2TGTA 1V2TT 5DO4H 1VKYA 4IC5A 4MNWA 1O2LA 3PLPA 4BAKB 1KTTB 4NSYA 2WYJA 4JYTA 1P04A 1K2I1 2F4LA 1GJ9B 3RU4T 2IJOB 4FVBA 2D1JA 1YPJH 2OC8A 1ANCA 1GHXH 4ESTE 1YPEH 1YPHC 1HRTH 2ZC9H 3UOUA 3A8BA 1YY3A 3ZZ4A 3AK5A 1ESAA 4AC9A 1BJVA 2AYWA 1GI4A 2ZFTA 3ESTA 3E1XB 1LHCH 5CHAC 4D7GA 1QBOA 2CHAC 3IG6B 1INCA 2EI6A 1ZTKA 2KZ4A 3M35A 4Y8XA 4ZHMU 2BY9X 2V3HH 2WYGA 1C4Y2 1KY9A 1GVZA 1Y5AT 2V6NA 3VB7A 1AB9B 1GPZA 1C2DA 2H5CA 1EAIA 2AGIX 3GDUA 2ZFRH 5A0BA 5EIYA 3NK8A 3A7WA 4ISNA 1J14A 4U32A 2HVYB 1H8HD 1O3CA 1EJAA 1ZR0A 3QZRA 1QNJA 1MQ6A 1O3BA 4ASHA 1C1UH 2ASUB 1FLEE 4Y6DA 1IQEA 1HUTH 2OBQA 4K1SA 5GPIB 1BMNH 4BXWA 1D3PB 5K0HA 2THFB 1O2RA 5EQQA 3EA9A 4DG4A 4TT3D 3I77A 5GCHF 3T2NA 5F8TA 2L6OA 4ABGA 1Q2WA 2PKSB 3MU8A 1A2CH 1O0DH 5A8XA 1FN6A 3ZIAD 1C1OA 1SMFE 1UCYE 3M7TA 2GX4A 3DUXH 4AFQA 4B1TA 5A2MH 1HYLA 2OQ5A 4CREA 5GCHG 1TIOA 1O3NA 5FCKA 1FPHH 1O32A 3OE7D 1CT0E 1Z71A 5EG4A 2Z94A 1TMTH 3LIWA 1PQ7A 1W14U 2CF9H 1VR1H 1O5GH 1GI3A 3FZDA 1B5GH 4YT7H 1O5BB 2I6SA 2A1DB 1S82A 3S7HB 1KXCA 1ZHPA 2AGGX 2AS9A 2CJIA 3P8GA 1UTPA 2QF4A 4INLA 1DS2E 4RT0A 4TPYA 2J2UA 1SKYE 1V2VT 2VBCA 1OWEA 3F6UH 5C5OA 1C5MD 2YMSC 3RMLH 4CHAB 3L33A 1SLWB 1V2OT 3QK1A 1SGFG 4VGCC 4NA8A 1H1BA 1LHGH 5IYTA 3RXTA 1BHXF 1YKTA 1BTWA 1BTHH 3L6PA 2ESTE 4GAWA 4ZXYH 3SYJA 2AMPA 3S0NA 1MABB 3M5NA 4H6TA 1ZHMA 1SOZA 2C8XB 4M9FA 4Y8YA 2JH6D 2ULLA 1OOKB 3RXGA 3F9GA 5F8ZA 1O3GA 3ATLA 1HIAA 2SNVA 4KKDA 3OY6U 4FXGH 3F0OA 1NZQH 2QF0A 4HFPB 3UY9A 1AVGH 1GJ6A 1E35B 1C5SA 1TGTA 3P8FA 1FZZA 1XXFA 3RU4E 3T29A 2V0BA 2H2ZA 1CSOE 3GY8A 1B0FA 4NIYA 3SJ8A 5JB9S 3A84A 2PGBB 1MKWH 1G36A 3TJVA 3K2UA 3ATMA 1EAUA 1EAWA 1WAYB 2ZI2H 3P95A 1O35A 1P2MA 2EY4C 1SQTA 1AD8H 4GSOA 3F9FA 1A0HB 2HPQH 2W26A 1VCQA 1LHDH 2Y7ZA 5CHBA 1EP6A 4K5ZA 4MNXA 1HLTH 3M37A 3GCHB 1O5CB 3QN7A 1W12U 4JK6A 1TX7A 2TPIZ 4X1QU 3HK6B 1MAYA 1C5VA 2W5EA 5C67A 2AFQB 1NRQH 3BN9A 4AYYB 4U30A 3OY5U 1KLTA 3TGIE 4U01A 3UNRA 2ZU5A 2FXRA 2CV3A 2R3UA 3ATKA 3KN2A 1AGJA 1MQ5A 3RMOH 2CMYA 2ZCLP 2KCOA 1FNIA 1TB6H 2CK3D 1OXGA 2BD7A 2GDDA 1QL9A 2A7JA 1IQMA 1AFEH 1B7XB 2BQ6B 4X1RU 2EI7A 3UNQA 3FOAA 4B74A 1ZGIA 1GI7B 5C0UA 1CHOG 2F9NA 1YWUA 1O3MA 2UWPA 2SGPE 4DJZB 4Y10E 3NRLA 4B2BA 1TBQH 3EDXB 3ZZ3A 1E34B 3FAOA 3KHVA 4ABIA 1EKBB 1LPZB 1FIWA 3BTTE 3LT3A 1UTJA 2DE8A 1FONA 1DXWA 1YM0A 5GDSH 3UIRA 3GCOA 1DLKB 4A5TS 3F2FA 4K60A 2KCAA 2UUKB 2BVRH 2BD2A 1GI9B 2J5UA 4KGAA 4XFQA 3GYMA 3F9EA 4Z6AH 1NRRH 4INHA 1XM1A 1G2LA 3ZVFA 1P8VC 3KF2A 1PPEE 1J9CH 1C4U2 1N8OB 1NC6A 1SR5C 1TOCB 3S9AA 1GDQA 3SNBA 2A5AA 2B8OH 1AUJA 1EOLA 1YPKH 1TNLA 1Y3WA 3N7EA 2P3FH 1A5GH 1OPHB 2P95A 3CS7A 2R3YA 3UUZA 1DWBH 1NY22 3RLWH 1K1JA 3QGJA 3MO6A 5B6LA 3GY6A 1NT1A 5EOKA 1KXAA 1GDNA 1EPTC 1RXPA 1KMHB 1O2VA 3SU4A 3E3TA 5CMXH 5DP8A 3NCLA 2Y7XA 1SFQB 2Y5GA 5G4BA 4AG1A 1W7GH 1A3BH 3GISB 1C5YB 1V6DA 1YPMH 5AVDA 4BAMB 2OD3B 3CP7A 1C5LH 1ELEE 1GI2A 2FOAA 1KIGH 1J15A 1O2OA 4JZFH 4DURA 3SUGA 4ZH8A 7GCHF 4MNYA 2F43B 5I46H 2BDGA 4BANB 4FUCA 3SZEA 5LH8A 1GL1A 4JMYA 1TWXB 4A92A 1RIWB 2GKVE 1TAWA 2EA3A 3PMHB 2BQ7B 2K0QA 4UFEH 4O3TA 1SQOA 4JYVH 1GWAA 3UR6A 3Q3XA 4JZEH 4CHAC 2UUFB 1XMNB 1THRH 1O2QA 1TBZH 1P10A 1DDJA 1GI8B 1OYQA 3PMJA 2PUXB 3MNXA 3E0PB 2A0QB 1ABIH 1HAIH 2PGQB 2LNCA 6ESTA 3SU2A 3LH1A 2ZU4A 5HIZA 1Y3XA 3BG4B 3TH4H 4D7FA 1QB9A 4X6PA 1EJMA 2CF8H 1F7ZA 1SGNE 2ZEBA 5EW2H 4TY7A 2RCEA 1FX0B 4J1YA 2Q6FA 4LXBH 1IAUA 1RTFB 2YNBA 1P2KA 1UJ1A 2UWLA 8GCHF 4DVAU 1PYTD 1KYNA 1L2EA 1P05A 4J2YB 4ABAA 3BTDE 3RUOA 1CT4E 1Z8RA 2QYIA 1ANBA 2F9OA 4WY3A 5F03A 3LONA 5I25A 1AE5A 3K9XB 2QN5T 8GCHG 2FWWA 2GJGA 1MD8A 4XE4A 1GBTA 2Y5HA 4ACAA 3RXUA 1AZZA 4I8GA 2IOTA 3RXJA 1ANEA 1GGDC 2FO9A 1TE0A 1AFQC 2GV7A 2KAIA 5HM9A 3GCHC 3SI4H 1L0ZA 1ARBA 1FY3A 2GZ8A 4WH8A 1HAXB 1MKWK 2WPHS 3A81A 3QDZB 4UONA 1OS8A 3M5LA 2ZPQA 4Q63A 1O2TA 2PV9B 5CHAB 1WBGB 1ACBE 1CVWH 5EODA 2CHAB 3U1JB 3VB5A 2SFAA 4AG2A 6LPRA 7KMEH 4RSPA 3RP2A 2KAIB 2OQUA 1WQVH 2BDYA 1BDAA 1MU8B 2KX4A 1N1LA 1FV9A 2Z9GA 1DY8A 2FOBA 2ANMH 3TPIZ 1O3AA 2OXSA 4KTCA 1PQ8A 1UW7A 3ZZ7A 1MTSA 3V12A 1P06A 3ZZ8A 2W7SA 1QIXB 1GBFA 3KQBA 3U8RH 5AF9H 1BBRE 2VIVA 1GBHA 4FUIA 1SGRE 1WDIA 5EPYA 4Q4LA 1KDQA 4ZHLU 1C1RA 3R3GB 2BB4A 1IQFA 1GHVH 2GD4B 2J38A 1CA8B 1O3IA 1KTSB 4BOHA 2XCNA 4AB8A 2M2AA 1AUTC 1BMMH 3VFEA 2GMTC 5F53A 1C5WB 4I8HA 2JH0D 3BEIB 1KDQB 3SJIA 1GMCF 4NZQA 4ABHA 1E36B 1GDUA 4JYUH 1SGCA 5FPSA 3VGCB 1P2IA 2FOCA 1SQRA 3SJOA 3TJUA 1V2KT 1MBQA 2JIZD 1CGJE 1TA2A 1QBNA 4IMQA 1BBRH 1SGIB 2A5IA 5JBAS 2OC0A 2ZHQH 1GMCG 2OCVB 4K3JA 1T4VH 2XRCA 2VVCA 3MU4A 3EA7A 2YOLA 4GCHF 4ABBA 3TK6A 3MQKC 2OLGA 1N8OC 5JDUB 1YGCH 3E16B 1A5HA 5DP6A 4ABJA 1CO7E 1O39A 2ZGHA 4A1XA 2NU4E 1EFRD 2ZTZA 4GCHG 4AGJA 1QR3E 4GLYA 3UOPA 1C1MA 1CE5A 1C1QA 1N6YA 1G37A 1GVKB 3LU9B 1PQAA 2Y6TA 1MAXA 2SGAA 2YMSB 2UUJB 1G30B 3MTYA 3BTHE 1P09A 4VGCB 3VB4A 5FAHA 2STBE 1S83A 2G51A 3M5MA 3M7QA 1QA7A 2DUCA 4K1EA 4YLQH 1BMFD 3LOXA 1BA8B 1T32A 4XOJA 1KXBA 2FODA 4FETA 2ZCKP 3A8DA 3LC3A 2QAAA 2VNTA 5E2OA 2GGVB 1O2GH 1KLJH 4AYVB 2GZ7A 3SHCH 1BTUA 4FUJA 2O8WA 3EYDA 1EZSC 2C4FH 4Y0YE 1E79D 2QXHA 4MTBA 3LGYA 3GCTG 4Y8ZA 3U8TH 2G4TA 2G5VA 4KTSA 5T3HA 1NRPH 2Y5FA 4IW4E 5EQRA 1A61H 3AAUA 2AGEX 1E1RD 2Y82A 3LGVA 2HLDD 3LDXH 2B7DH 3C1KA 3OYPA 1HXFH 4FUEA 3A80A 1KXEA 3K6YA 1THSH 5A0AE 1TNGA 5HKKD 1YF4A 1OP8A 1C5ZB 3MH4A 2ANWA 3PMBB 3VB6A 4DT4A 1A3EH 1GCDA 1SVPA 1XUIA 4HZHA 5E2PA 2F3CE 4HGCA 1F5KU 1DPOA 1AU8A 2HNTC 3RXPA 1EXFA 3U69H 1XXDA 2WHXA 1MZAA 1C5XB 2ZU2A 1YCPH 2SGQE 2FOGA 4MQAA 1RRKA 2PP6A 2FS8A 1C5PA 2ZCHP 2VVVA 2G5NA 1P0SH 3VB3A 2ZF0H 3E91A 1TABE 1SPJA 2JDID 3MNBA 2H5DA 1ZSLA 1U6QA 1OX1A 4D9RA 1ESBA 1WYKA 1C2FA 2BD8A 1UVOA 4YESB 1GJCB 3STJA 4AORA 5DP4A 2ZGCA 3OSYA 3A86A 1V3XA 1ZMLA 1FY8E 2JETB 2QXJA 2OUAA 2KCPA 1L4ZA 1IQGA 1CA0C 1C2EA 5E0GA 4E05H 1H9IE 1K1IA 4O97A 1S85A 1Y8TA 4FUFA 2A31A 1EX3A 4MLFB 1W0ZU 1AKSA 1G3EA 2GT7A 2FESH 3ELAH 1QQ4A 1MCTA 2Y80A 1SGYE 2BYAX 3DCLA 1JXPA 5B6OA 3BTGE 1JWTA 5GXPA 1ZJKA 4ABFA 1ID5H 2P59A 2PSYA 4CRAA 2VU8E 3OX7U 1T31A 1EOJA 1WCZA 1Z6JH 1BTXA 1AKSB 3RXCA 1QRXA 1C5UA 1EPTA 3S9CA 4YXWD 2Z9KA 1DUAA 3QUMP 2F9BH 1C5RA 1GG6C 1Z8JB 3F0PA 3MYWA 4B75A 4TSFD 3PM3A 4I7YH 2WPKS 2TGPZ 3SUEA 4SGBE 2ZGXH 4R8TB 1MKXH 5FX5A 2BTCE 1SBWA 1EPTB 2QY0B 1LPKB 3OEHD 1LMWB 5EJLA 4LZ4B 3LGTA 2TBSA 1Z1IA 3SU0A 3VGCC 5F8XA 2ZTYA 1BRAA 1GI5A 3QWCH 4CRDA 1CGHA 4HTCH 1EB2A 1YYY1 2FZZA 2C3SA 1AY6H 1Y5UT 2FOFA 4HG6A 3SV7A 1SLVB 1H8IH 2ANYA 2AIPA 3PYHA 1AIXH 1BOQA 4MG3A 2D8WA 3A82A 5GWZA 2P8OC 2PFEA 4XRNA 9ESTA 4BTTB 1O5EH 4YTAA 3C27B 1NESE 2BY8X 1Y3VA 4OM9A 3QLPH 1KLIH 3P6ZB 1NRNH 4UFDH 3V13A 1GBJA 5C20A 1PYTC 4WF8A 3SZNA 4P00A 2PW8H 5K7RA 5L6NH 3VEQB 3O8CA 1FAKH 4FUGA 1PQ5A 1GBCA 1F0SA 4OS1A 1Z8GA 2HPPH 1TOMH 4WMDA 2H1UA 1UCYH 1TGBA 1Z8IB 3V7TA 1K21H 2AHME 4AN7A 2ZFPH 4HI3A 1L1GA 3LJOA 5T1VA 1DITH 1LVOA 4FUHA 1O2UA 3PV2A 4WH6A 2W3IA 1O2YA 2BDIA 3ATWA 1JIMA 1O3LA 2Z3EA 3PRBA 4I31A 1LQEA 5KGOA 5A8YA 5DP9A 3D49H 1S84A 1AO5A 1TBRH 2ANKH 3RXQA 2HOBA 3AASA 3TU7H 1O5DH 3SJ9A 3ZVGA 1F0RA 4FU9A 2A5KA 3LGIA 2A4GA 3ZVCA 3TLOA 2WUCA 1HJAC 3TITA 1EJNA 1QY6A 2BVSH 3B8JA 2UWOA 4YOIA 4OS2A 5LPEA 2WV5A 4O9VA 2OC7A 2V3MA 5ABWA 2WUBA 4XDEA 3WY8A 3U28C 4K69A 4YOGA 1HIAB 1NU7B 1CQQA 1V2PT 2VIDA 4TYDA 3DSGA 2BDCA 1ELVA 1F0UA 2G4UA 1DM4B 3KIDU 2SGDE 2F9PA 1YP9A 1FN8A 2PWXA 1P2OA 1O2IA 1IQIA 2GT8A 5HYOA 5HGGA 1BRCE 3UREA 4QT8C 2ZDLA 2P94A 2GVFA 1GHAG 1HFDA 1OWIA 1DX5M 2VIOA 1DUEA 3PV4A 4NA7A 1HAGE 1GBKA 1NFWA 5CE1A 1K0HA 2J4IA 1ZYOA 1BRBE 1GGDB 2V3OH 1AFQB 3ZYEA 1LVMA 1Y3YA 3EAJA 2C8WB 1RD3B 1C1PA 2FDAA 1ELFA 1IHSH 2LELA 3KEEA 2ZDAH 3QGNB 4R0IA 2OP9A 4LK4A 2FI4E 1ZRKA 1TNKA 4GHQA 1C9PA 1W2KH 4X6NA 2W6JD 3DD2H 1ZSJA 1FI8A 2LP6A 1MBMA 1TALA 4X1PU 3G01A 1T4UH 1TONA 3ZZCA 3S9BA 1CHOF 2A45B 3TIUA 2A2QH 3MH7A 1O2WA 1UK4A 4X6OA 1NU9A 3N7OA 1YCPK 2C8ZB 2GZ9A 2XNDD 3UAIC 2VIQA 4WMFA 4IGDA 5C5NA 2SGEE 1H4WA 2GCTC 1C2MA 1V2RT 1T8NA 1V2NT 3KQEA 3OAAD 3F3BA 4AB9A 3U8OH 3BTKE 4FVDA 2JETC 5C0TA 1BHXB 3SI3H 2GMTB 3NZIA 2BOHB 5EU8A 4GPGA 3B23B 3AAVA 5EQSA 1NBMD 1V2ST 1VITG 3Q00A 2ZHEH 1RGQA 2XW9A 1LPGB 1QCPA 1COWD 4AGKA 3UB0A 4ASUD 1EUFA 4NA9H 1K1MA 4YT6H 1F92A 1K1LA 4ZUHA 1KXFA 4DCDA 1CGIE 5L30H 2Z6BD 5FL7D 1LCYA 2P93A 3KL6A 3HGNA 2FS9A 1JRSA 2FIRH 5HIYA 4BNRA 3GS9A 2RFKC 4RI0A 4UE7H 4ABEA 1TNIA 1O3OA 1MMJN 2FOEA 2VGCC 1ELDE 1THPB 1S6HA 2XYAA 3NUMA 3UWIA 4DW2U 4CH2B 4JCNA 2Q1JA 2SGFE 2OK5A 1GCTC 5J4QA 1TGSZ 1GMDG 1JOUB 1KSNA 2HWLB 3P70B 1WQSA 2F9UA 1V2MT 1RTLA 1HNEE 1F0TA 2VJ1A 1VJ9U 1TGCA 1SLXB 2QV1A 3GOVB 2J9NA 2VH0A 2Z7FE 1MKXK 1SSXA 1TRMA 1W7XH 5FHTA 4AFSA 6GCHG 1C2GA 4X8UH 3U98H 1E37B 3S7KB 4NZLA 3KQ5A 4FUBA 2GTBA 5FX6A 2PLXA 1DLEA 2TGAA 3K6ZA 1C4V2 3PRDA 1E0FD 1GBMA 1BZXE 2GP9B 2ZP0H 4TWWA 3RXVA 1BJUA 1ZTLA 2P16A 4MDSA 2GDEH 2IJD1 2CGAA 4MPXA 3MNCA 5JPMH 1Q3XA 1CBWB 4CRGA 1C1WH 1OWJA 1G3CA 3F1SB 2QF3A 1OYTH 1C5TA 1TQ7B 2QE7D 1O5AB 1IHTH 2R2WU 2RA3A 1V2JT 4Q7ZA 2ODPA 3WWFA 3PLBA 1GBLA 2I6QA 3SOSA 1HAYB 4F4OC 1TPPA 2PR3A 1LKAA 1LKBA 3F2HA 5CDFE 2ZECA 4NG9H 1VJAU 1DY9A 2XXLA 1UHBA 1Q31A 3SQEE 3T62A 1TFXA 1ESTA 1ETRH 3SU1A 4F55A 3BIVH 3CS0A 1Y3UA 1UCYK 2R2MB 2ZWLH 2H9TH 1L1JA 2WPJS 1DANH 3UR9A 4THNH 4AFUA 2SNWA 2IPQX 5DGJA 4X6MA 4ZROA 4WMEA 1AMHA 2G8TA 4BAHB 2JJ2D 3VG8A 1UHBB 3VPKA 3SV6A 3UQVA 4Y76A 3LH3A 5E0HA 3ZZDA 4Q7YA 1GJ4H 2ZDVH 5ESTE 4K1TA 4RN6A 3RXIA 1EB1H 2BXTH 3GDVA 3A83A 3SNEA 1ZGVA 5KECA 1NO9H 1O30A 2XBYA 1ARCA 3NWUA 5JBCS 3TGKE 3JZ1B 3GY4A 1A0JA 1YBWA 1HJ8A 2WV9A 4JZDH 1HDTH 1XKAC 1BCUH 3HKIB 3MU1A 4K8BA 1OP2A 2JJ1D 9LPRA 3DT0H 1OWKA 2ZPRA 1TGNA 2FYQA 2D26C 2YMSD 3F2GA 5DP7A 1RTKA 1J17T 4AFZA 3PWCA 1TPSA 2HRVA 4TY6A 2ZHDA 1ZTJA 2XNIA 1QRZA 2XC4A 1CA0B 2FPZA 5EGMA 1SGQE 3MWIU 4ZKNU 4PROA 3PO1C 2ZKSA 1WXRA 1S6LA 1ZMNA 1AQ7A 2BD3A 1D9IA 1NFXA 3LC5A 2PSXA 3GYLB 3EGKH 4YOJA 3BTQE 1FUJA 3GY2A 1QHRB 1QBVH 1TYNA 3A7TA 3H5CB 3LPRA 3M7UA 3WW7A 2ZQ1A 2ZG0H 4NIWA 1HAVA 1O2PA 1T8LA 1AVXA 3KGPA 4JZIA 5A0CA 2UUYA 1DWDH 2HVXA 3BF6H 3ZZAA 1S0QA 3RXAA 1DWEH 3HATH 3SNCA 3R0FA 4XBCA 2HLCA 1GG6B 2AMDA 4FUDA 3SGAE 1C1TA 1HAVB 1ORFA 2XWAA 3CNRA 1D6WA 5AHGH 1AN1E 3GDSA 2FTMA 4OS6A 1HAPH 3EE0B 4NWLA 1YLNA 1PPHE 2QCYA 1C2HA 2H9EH 2NWNA 1IQKA 1GBIA 4F48B 1GI0A 1QZ8A 4DIIH 2W7UA 2ODQA 3E8LA 3MH6A 6CHAC 1AZ8A 1SGPE 4D8NA 1O3PB 3A7ZA 2M5TA 4E7RG 2F9VA 1C2KA 2OINA 2BVXH 3M36A 1SGTA 4WVPE 2BLQA 3FVFB 2EC9H 1OP0A 1ELAA 5H4IB 1UVUH 2P8OB 1SC8U 3SQHE 2BY6X 1EATA 5KEDA 2FOMB 1SGEE 2BLWA 1AE8H 2PTNA 3DHKH 1V2LT 1FIZA 1GBAA 8KME2 5T6GA 1GVLA 2Z9IA 2ILNA 3DFJA 2ZNKH 1K22H 3UNSA 3ZZ5A 1WTHD 1G9IE 4NSVA 2A4OA 1IQNA 1BRUP 1QJ6B 2BD4A 3FZZA 3O8BA 1VCPA 1HCGA 3S69A 1YPLH 1IQHA 2NU0E 1C5QA 1PJPA 1HXEH 2FTLE 2EI8A 3FP7E 3F68H 1QFKH 3SGBE 4Y7BA 3M5OA 3RDZA 1H8DH 3RM2H 4FU8A 4X0WU 3H7OA 3GCTF 4IS5A 5BRRE 4MPWA 2Z3CA 1BMAA 3FKSD 1CU1A 4Y11E 1HJAB 1K1NA 1LO6A 4BTIB 1MZDA 3SO3A 2K1QA 3DSPA 1WU1A 1CBWC 3MMGA 4Z1MD 1W0KD 1S6FA 1O2KA 5ESBA 2Z9JA 4WXVA 3TH3H 4B71A 1DSTA 3V3MA 1SB1H 4A6LA 2BX3A 3LGUA 4NIXA 3HKJB 1VCWA 5E0JA 4IN2A 4U2WA 1PPGE 3KNXA 4A7IB 2VWMA 1G3BA 2CN0H 2XBXA 1C1NA 3W1EA 4X2XA 3MU5A 1P2NA 1UTNA 1UVPA 4Q2KA 2Q6DA 4X1NU 2AEIH 1ZPCA 4DY7B 2J95A 1BITA 4Q80A 2FEQH 1TA6A 1GMHF 2ZTXA 1TPAE 2D2DA 4ZKOU 3E0NB 1H9LB 1E38B 3MHWU 1T7CA 1UK2A 4NWKA 5C3NA 3A8CA 5IK2D 2L74A 4O3UA 2TGDA 1K28D 4ZXXH 1GMHG 1LTOA 4BXSA 1NFUA 3ITIA 2XOKD 1FJSA 1UTLM 2BY5X 2CXVA 1XKBC 4NCYA 2BD9A 1WSSH 1QURH 2GCTB 4X2WA 1A4WH 2A32A 2VB0A 1DFPA 2J34A 4GVUA 2STAE 3ZYDA 5EJ1A 2QA9E 3RM0H 1S5SA 2AIQA 3VXEH 1ZSKA 2BZAA 3B9FH 4UD9H 4NIVA 2HGTH 4H4FA 5DK1A 1EZUC 1Z1JA 4RT1A 3NKKA 1A7SA 1P12E 1ZMJA 1VGCC 2VH6A 2C90B 2FP7B 1FY4A 3DA9B 1PFXC 2KR7A 4XBBA 4X8TH 2Y81A 5L2YH 1O2HA 5EPNA 1FQ3A 2GCHF 2YNAA 1JRTA 2FX6A 1GBBA 1UMAH 1YPHE 5LPRA 1QA0A 1ZZZA 2ZHFH 1FAXA 3FP6E 3MNSA 4XD7D 1A46H 2GCHG 2FLRH 2NU2E 2VGCB 3QTOH 1ZLRA 2A2XH 1YPGH 2BOKA 5TJXA 1XUJA 1TX6A 1GCTB 2ZGBH 5FPTA 5AFYH 3AVZA 5J4SA 1S0RA 1QL8A 1DVAH 3SU5A 3N7DA 3SV9A 3FN8A 2PUQH 3P17H 2XWBI 2KCYA 1FY5A 1O5FH 2WINI 2G81E 3PLKA 4YLUA 1GL0E 3H09A 2G52A 3URCA 2V35A 1C9TA 4NFFA 2OTVA 1TMUH 1DXPA 1O2MA 2QGRA 2WPIS 1L4DA 1O37A 3TJOA 3ZZ9A 1AVWA 2BZ6H 1F2SE 4B76A 3D65E 1AWHB 1C5NH 3T25A 1C2IA 2ZA5A 1BBRK 3RXRA 1ZPZA 1HAOH 3QO6A 2ZDNA 3GCNA 1XX9A 1B0EA 1QGFA 3T5FH 5LGOA 5A8ZA 5HM2A 1P57B 2AERH 1O3FA 1YLCA 2BLOA 2XTTB 2ZU1A 3MOCA 2ZGJA 4WWYA 4A1VA 3T27A 1C5OH 2ZFFH 3UWJH 1QJ7B 5E8EH 4JK5A 1AI8H 5AFZH 3T28A 3M3SA 1K1OA 4B6EA 1MTNC 2IPHA 3RMMH 3EQ0H 5C94A 4B6FA 1OSSA 3ZVAA 1KXDA 3A89A 1TRNA 3MFJA 1QQUA 1PPCE 5L2ZH 1MH0A 1QB1A 3RMNH 3U1IB 2NU1E 5JYIA 3ODDA 3MH5A 3PROA 3ZV8A 1D3QB 1V2QT 1HGTH 1GJDB 4FU7A 1NROH 3SU3A 5C1UA 1SHHB 3UQOA 2EQNA 3L3TA 1EAXA 4LZ1H 3U9AH 1W0JD 1BMLA 1T8MA 4OS7A 3KYFA 1GHAF 4WJG2 2VWOA 1CT2E 1O36A 2A7HA 1V2WT 3WWBA 1SLUB 1TRYA 3SNDA 1Z7KA 2DE9A 1YLDA 2QF5A 2VWNA 1QB6A 3DFLA 3LGWA 3V0XA 2K8IA 3QX5H 3NXPA 3F9HA 1DSUA 1C2LA 2W6ID 4CBOA 1FMGA 1NRSH 2O8TA 1P3EA 1QL7A 5EW1H 1FPCH 2ZFQH 3TNTA 2P3TB 3SGQE 2BQWB 3KQCA 1WUNH 4I33A 3A7XA 5C2ZA 7LPRA 1SGFA 3Q3KA 2O8LA 1W3CA 1EQ9A 3P8NA 1OWDA 4X8VH 2VVUA 1HPGA 1SOTA 2XC0A 4X2YA 3PO1B 4AX9H 2BM2A 3DSOA 2VWLA 1DWCH 4AZ2B 4D76A 3D62A 2F91A 2Z3DA 1DOJA 2FX4A 4MNVA 1O2ZA 3H7TA 4OGXA 2BDAA 4UFGH 1MTWA 1W13U 1UTOA 3W95A 3MI4A 5LPFA 1ELBA 3SORA 1ANDA 1Z6EA 3M3VA 2B5TB 3TJNA 3MO9A 2EEKA 5FPYA 1FY1A 1VITF 1UK3A 4NGAH 1D4PB 4JZ1A 3Q77A 4H6SB 1BB0B 2FYRA 2AH4X 2RA0A 2JKHA 5GIBA 1MCVA 4YM9A 1P01A 1DICA 3QTVH 3SJKA 1S81A 3N99A 1PPFE 2BDBA 4GHTA 4TWYA 1IQJA 1OWHA 3FO8D 1NFYA 4MPVA 5PTPA 1TNJA 3AW1A 3T26A 4B2AA 4K2YA 6CHAB 4I86A 3TK9A 3GICB 1EZQA 3LJJA 1QTFA 1UTMA 3HPTB 2G00A 2FMJA 4Y71A 2VIPA 3ODFA 2WPDD 5DKMA 3RXSA 2OBOA 3M61U 4ISHH 3BTWE 1H9HE 3ZVDA 1HBTH 1GMDF 1J16A 3QZQA 1TX8A 1SFIA 5DP3A 5C17A 1ABJH 1GHYH 2FM2A 3ZZ6A 3RC5A 1AB9C 1H8ED 3SHAH 3SUFA 2HNTF 1QRWA 4OGYA 3TH2H 7ESTE 1O3HA 1GBDA 4FOUC 2ZZUH 4INKA 2R0LA 6GCHF 4I8KA 3M3TA 2FLBH 2FI3E 4ZMAH 1W10U 2FOHA 3O8DA 5A09A 4I8LA 3BTME 2Q6GA 1ETTH 2A4RA 1NTPA 2PTCE 3RXHA 3GY7A 1SQAA 3P8OA 4O03A 2QXIA 3BEUA 2LPRA 3UTUH 1DE7H 2PKSC 1GHWH 1Y59T 4I8JA 4BTUB 3BV9B 1MTUA 2B9LA 1BT7A 3W94A 5EXLA 1G3DA 2BDHA 1GJ5H 2VIWA 3BTEE 1ELTA 1LHEH 1XUHA 4Q7XA 3NPSA 1ETSH 4ZKRU 2ALPA 1F5RA 1AHTH 1L1NA 4X8SH 2VINA 5F6MA 4ZCNA 5FBEA 4KELA 3KQDA 3SBKA 5SGAE 1YC0A 1RJXB 4TPIZ 1OKXA 2IN2A 5DJ7A 2ZFSA 3PMAB 5GJ4B 1ZJDA 4OS5A 3RXFA 2PKAA 7GCHG 3ATIA 4DT7B 2BXUH 2A7CA 1D6RA 4ABDA 3E6PH 1MTVA 4CBNA 5C1YA 1GJAB 4OS4A 1P3CA 4Y0ZE 2C93B 2TIOA 3BEFB 1AWFH 3STIA 4A1TA 4RKOB 3SV2H 2B0FA 4KP0A 2PKAB 2J94A 4UEHH 1O33A 1ELGA 2J98A 2ZQ2A 4ZKSU 3RXBA 1QJ1B 1WTGH 1DT2A 2XBVA 2H6MA 3HK3B 3OEED 1A5IA 1PPZA 2Z9LA 2V7QD 1W0YH 1O2SA 1BTZA 4UFFH 5DG6A 4X1SU 3RC6A 1NS3A 2RDLA 3KCGH 1SG8B 2J98B 4BAOB 1LVBA 1C1SA 3D23A 1GI6A 1BTYA 1NN6A 2KFWA 1Y5BT 4F49A 3ENSB 1O31A 2PHBA 1XUGA 1BUIA 1IQLA 5T6DA 5IDKA 1EP5A 3RXKA 3ZV9A 2J92A 5JBTA 1ZHRA 3OU0A 2BD5A 1K1PA 1MD7A 1K9OE 3UPEA 1TLDA 4D9QA 4LOYH 1YCPM 4AOQA 4XSKU 1XVOA 1NM6A 3RC4A 1TNHA 2ZO3H 3AW0A 4DOQA 4NFEA 4CRCA 1JMOH 5JB8S 2RG3A 3GY3A 4CH8B 1VGCB 3PV5A 4B2CA 2ZHWH 1UTQA 2BHGA 2BX4A 2G55A 3BIUH 5BPEA 4WXIA 1N6XA 3RU4D 4P02A 1RFNA 2AMQA 2WPLS 2ALVA 2OC1A 2ZDKA 3SN8A 1E1QD 3CENA 1ZPBA 3FP8E 4YZUA 1GBEA 3OTPA 5EJZA 1HV7A 3Q3YA 4ZAEA 1NPMA 1TPOA 1XVMA 1D3DB 1T8OA 4IC6A 1OHHD 1O2NA 4IBLH 1BTPA 2TRMA 1WV7H 2A4QA 1WOFA 2JH5D 2QIQA 3FANA 1GJ7B 3MO3A 4BAQB 1UTKA 1J8AA 3MU0A 2QXGA 3ZVEA 4DIHH 2RDEA 1SI5H 3HGPA 5TCCA 3Q76A 2R0KA 2J97A 1O3JA 3P92A 1GJ8B 1P9SA 4MPUA 4B73A 4YO9A 1UVTH 1HAHH 5FXLA 3FFGA 3E90B 4Y79A 2WZQA 4XBDA 3GY5A 3A7YA 3RXEA 2WSSD 1LDTT 1D3TB 1MUEB 2WV4A 4CRBA 2HALA 1MU6B 1LHFH 1C1VH 1JIRA 3RXMA 5C1XA 5DPAA 3SU6A 8ESTE 4Y7AA 5DN6D 1W11U 4UDWH 1XUFA 2FI5E 1BQYA 3OFND 1GJBB 1O3DA 3SUDA 4CR5A 1W8BH 4X2VA 1UO6A 1MTNB 3OTJE 4RKJB 3PWBA 4GUXA 2H9HA 4SGAE 2ZDMA 1LVYA 1P9UA 1EZXC 1EASA 1C2JA 4CRFA 2F83A 3PTBA 4E7NA 2XBWA 1XUKA 3SW2B 1JBUH 3LKWA 2O8UA 1FXYA 1GHBF
chains in the Genus database with same CATH topology
3TK5A 4Z0KA 1PPBH 1HB0B 2ODYB 3O8RA 1V2UT 1SL3A 5JBBS 5FCRA 1F5LA 2NU3E 3A85A 3PTNA 3A8AA 4IN1A 3EA8A 4KTUA 1CHGA 1O3KA 1P11E 3VXFH 2QC2A 5FBIA 2O9QA 4ZHAA 1FDPA 1GHBG 3RLYH 4E06H 5HXFA 1LQDB 2BY7X 3TNSA 3RXDA 8LPRA 3SV8A 4ISOA 3K65B 1RIWC 1TMBH 1IOEA 1HJ9A 2BMGB 5DP5A 3ZZBA 1O2JA 4M7GA 2XCFA 1UVSH 3PB1E 4K8YA 2W3KA 1G32B 5HMAA 3A88A 1P2QA 3IWMA 3SNAA 1A1RA 4DGJA 3I78A 2ZPSA 5T6FA 1A0LA 3TGJE 2P3UB 2ZU3A 1O34A 1RS0A 1O38A 3BG4C 1SGDE 1TQ0B 4MVNA 3UFAA 5ETXA 3TVJB 4ISIH 4I32A 3BSQA 2XC5A 2C8YB 1ZOMA 3IITA 1M9UA 1VITH 3A87A 1O3EA 4CR9A 5TCAA 5EXNA 1G2MA 1O2XA 3ZVBA 1X7AC 1P02A 3BTFE 3I29A 3JZ2B 4IMZA 2GV6A 3URDA 1ELCA 1BIOA 5EXMA 4H42U 1VZQH 2HNTE 1P03A 1GHZA 3RXLA 1ZRBA 4ISLA 3BG8A 1SHYA 2ZIQH 3A7VA 1HAZB 2O8MA 2WPMS 1GI1A 3RXOA 2BLVA 2R9PA 1P2JA 2TGTA 1V2TT 5DO4H 4IC5A 4MNWA 1O2LA 3PLPA 4BAKB 1KTTB 4NSYA 2WYJA 4JYTA 1P04A 1K2I1 1GJ9B 3RU4T 2IJOB 4FVBA 2D1JA 1YPJH 2OC8A 1ANCA 1GHXH 4ESTE 1YPEH 1YPHC 1HRTH 2ZC9H 3UOUA 3A8BA 3ZZ4A 1ESAA 1BJVA 2AYWA 1GI4A 2ZFTA 3ESTA 3E1XB 1LHCH 5CHAC 4D7GA 1QBOA 2CHAC 3IG6B 1INCA 2EI6A 1ZTKA 3M35A 4Y8XA 4ZHMU 2BY9X 2V3HH 2WYGA 1C4Y2 1KY9A 1GVZA 1Y5AT 2V6NA 3VB7A 1AB9B 1GPZA 1C2DA 2H5CA 1EAIA 2AGIX 3GDUA 2ZFRH 5A0BA 3NK8A 3A7WA 4ISNA 1J14A 4U32A 1O3CA 1EJAA 1ZR0A 3QZRA 1QNJA 1MQ6A 1O3BA 4ASHA 1C1UH 2ASUB 1FLEE 4Y6DA 1IQEA 1HUTH 2OBQA 4K1SA 5GPIB 1BMNH 4BXWA 1D3PB 5K0HA 2THFB 1O2RA 5EQQA 3EA9A 4DG4A 3I77A 5GCHF 3T2NA 5F8TA 4ABGA 1Q2WA 2PKSB 3MU8A 1A2CH 1O0DH 5A8XA 1FN6A 1C1OA 1SMFE 1UCYE 3M7TA 2GX4A 3DUXH 4AFQA 4B1TA 5A2MH 1HYLA 2OQ5A 4CREA 5GCHG 1TIOA 1O3NA 5FCKA 1FPHH 1O32A 1CT0E 1Z71A 5EG4A 2Z94A 1TMTH 3LIWA 1PQ7A 1W14U 2CF9H 1VR1H 1O5GH 1GI3A 3FZDA 1B5GH 4YT7H 1O5BB 2I6SA 2A1DB 1S82A 3S7HB 1KXCA 1ZHPA 2AGGX 2AS9A 2CJIA 3P8GA 1UTPA 4INLA 1DS2E 4TPYA 2J2UA 1V2VT 3F6UH 5C5OA 1OWEA 1C5MD 3RMLH 4CHAB 3L33A 1SLWB 1V2OT 3QK1A 1SGFG 4VGCC 4NA8A 1H1BA 1LHGH 5IYTA 3RXTA 1BHXF 1YKTA 1BTWA 1BTHH 3L6PA 2ESTE 4GAWA 4ZXYH 2AMPA 3S0NA 3M5NA 4H6TA 1ZHMA 1SOZA 2C8XB 4Y8YA 2JH6D 2ULLA 1OOKB 3RXGA 3F9GA 5F8ZA 1O3GA 3ATLA 1HIAA 2SNVA 4KKDA 3OY6U 4FXGH 1NZQH 2QF0A 4HFPB 3UY9A 1AVGH 1GJ6A 1E35B 1C5SA 1TGTA 3P8FA 1FZZA 1XXFA 3RU4E 3T29A 2V0BA 2H2ZA 1CSOE 3GY8A 1B0FA 4NIYA 3SJ8A 5JB9S 3A84A 2PGBB 1MKWH 1G36A 3TJVA 3K2UA 3ATMA 1EAUA 1EAWA 1WAYB 2ZI2H 3P95A 1O35A 1P2MA 1SQTA 1AD8H 4GSOA 3F9FA 1A0HB 2HPQH 2W26A 1VCQA 1LHDH 2Y7ZA 1EP6A 4K5ZA 4MNXA 1HLTH 3M37A 3GCHB 1O5CB 3QN7A 1W12U 4JK6A 1TX7A 2TPIZ 4X1QU 3HK6B 1MAYA 1C5VA 2W5EA 5C67A 2AFQB 1NRQH 3BN9A 4AYYB 4U30A 3OY5U 1KLTA 3TGIE 4U01A 3UNRA 2ZU5A 2FXRA 2CV3A 2R3UA 3ATKA 3KN2A 1AGJA 1MQ5A 3RMOH 2CMYA 2ZCLP 1FNIA 1TB6H 1OXGA 2BD7A 2GDDA 1QL9A 2A7JA 1IQMA 1AFEH 1B7XB 2BQ6B 4X1RU 2EI7A 3UNQA 4B74A 1ZGIA 1GI7B 1CHOG 2F9NA 1O3MA 2UWPA 2SGPE 4DJZB 4Y10E 4B2BA 1TBQH 3EDXB 3ZZ3A 1E34B 3FAOA 3KHVA 4ABIA 1EKBB 1LPZB 1FIWA 3BTTE 3LT3A 1UTJA 2DE8A 1FONA 1DXWA 1YM0A 5GDSH 3UIRA 3GCOA 1DLKB 4A5TS 4K60A 2UUKB 2BVRH 2BD2A 1GI9B 4KGAA 4XFQA 3GYMA 3F9EA 4Z6AH 1NRRH 4INHA 1XM1A 1G2LA 3ZVFA 1P8VC 3KF2A 1PPEE 1J9CH 1C4U2 1N8OB 1NC6A 1SR5C 1TOCB 3S9AA 1GDQA 3SNBA 2A5AA 2B8OH 1AUJA 1EOLA 1YPKH 1TNLA 1Y3WA 2P3FH 1A5GH 1OPHB 2P95A 3CS7A 2R3YA 3UUZA 1DWBH 1NY22 3RLWH 1K1JA 3QGJA 3MO6A 3GY6A 1NT1A 5EOKA 1KXAA 1GDNA 1EPTC 1RXPA 1O2VA 3SU4A 3E3TA 5CMXH 5DP8A 3NCLA 2Y7XA 1SFQB 2Y5GA 5G4BA 4AG1A 1W7GH 1A3BH 3GISB 1C5YB 1V6DA 1YPMH 5AVDA 4BAMB 2OD3B 3CP7A 1C5LH 1ELEE 1GI2A 2FOAA 1KIGH 1J15A 1O2OA 4JZFH 4DURA 3SUGA 4ZH8A 7GCHF 4MNYA 5I46H 2BDGA 4BANB 4FUCA 5LH8A 1GL1A 4JMYA 1TWXB 4A92A 1RIWB 2GKVE 1TAWA 2EA3A 3PMHB 2BQ7B 4UFEH 4O3TA 1SQOA 4JYVH 1GWAA 3UR6A 3Q3XA 4JZEH 4CHAC 2UUFB 1XMNB 1THRH 1O2QA 1TBZH 1P10A 1DDJA 1GI8B 1OYQA 3PMJA 2PUXB 3MNXA 3E0PB 2A0QB 1ABIH 1HAIH 2PGQB 2LNCA 6ESTA 3SU2A 3LH1A 2ZU4A 1Y3XA 3BG4B 3TH4H 4D7FA 1QB9A 4X6PA 1EJMA 2CF8H 1F7ZA 1SGNE 2ZEBA 5EW2H 4TY7A 2RCEA 4J1YA 2Q6FA 4LXBH 1IAUA 1RTFB 2YNBA 1P2KA 1UJ1A 2UWLA 8GCHF 4DVAU 1PYTD 1KYNA 1L2EA 1P05A 4J2YB 4ABAA 3BTDE 3RUOA 1CT4E 1Z8RA 2QYIA 1ANBA 2F9OA 4WY3A 5F03A 3LONA 5I25A 1AE5A 3K9XB 2QN5T 8GCHG 2FWWA 1MD8A 4XE4A 1GBTA 2Y5HA 3RXUA 1AZZA 4I8GA 2IOTA 3RXJA 1ANEA 1GGDC 2FO9A 1TE0A 1AFQC 2GV7A 2KAIA 5HM9A 3GCHC 3SI4H 1L0ZA 1ARBA 1FY3A 2GZ8A 4WH8A 1HAXB 1MKWK 2WPHS 3A81A 3QDZB 4UONA 1OS8A 3M5LA 2ZPQA 1O2TA 2PV9B 5CHAB 1WBGB 1ACBE 1CVWH 5EODA 2CHAB 3U1JB 3VB5A 2SFAA 4AG2A 6LPRA 7KMEH 4RSPA 3RP2A 2KAIB 2OQUA 1WQVH 2BDYA 1BDAA 1MU8B 1N1LA 1FV9A 2Z9GA 1DY8A 2FOBA 2ANMH 3TPIZ 1O3AA 2OXSA 4KTCA 1PQ8A 3ZZ7A 1MTSA 3V12A 1P06A 3ZZ8A 2W7SA 1QIXB 1GBFA 3KQBA 3U8RH 5AF9H 1BBRE 2VIVA 1GBHA 4FUIA 1SGRE 5EPYA 1KDQA 4ZHLU 1C1RA 3R3GB 2BB4A 1IQFA 1GHVH 2GD4B 2J38A 1CA8B 1O3IA 1KTSB 4BOHA 2XCNA 4AB8A 1AUTC 1BMMH 3VFEA 2GMTC 1C5WB 4I8HA 2JH0D 3BEIB 1KDQB 3SJIA 1GMCF 4NZQA 4ABHA 1E36B 1GDUA 4JYUH 1SGCA 5FPSA 3VGCB 1P2IA 2FOCA 3SJOA 3TJUA 1V2KT 1MBQA 1CGJE 1TA2A 1QBNA 4IMQA 1BBRH 1SGIB 2A5IA 5JBAS 2OC0A 2ZHQH 1GMCG 2OCVB 4K3JA 1T4VH 2XRCA 2VVCA 3MU4A 3EA7A 2YOLA 4GCHF 4ABBA 3TK6A 2OLGA 1N8OC 5JDUB 1YGCH 3E16B 1A5HA 5DP6A 4ABJA 1CO7E 1O39A 2ZGHA 4A1XA 2NU4E 2ZTZA 4GCHG 4AGJA 1QR3E 4GLYA 3UOPA 1C1MA 1CE5A 1C1QA 1N6YA 1G37A 1GVKB 3LU9B 1PQAA 2Y6TA 1MAXA 2SGAA 2UUJB 1G30B 3MTYA 3BTHE 1P09A 4VGCB 3VB4A 5FAHA 2STBE 1S83A 2G51A 3M5MA 3M7QA 1QA7A 2DUCA 4K1EA 4YLQH 3LOXA 1BA8B 1T32A 4XOJA 1KXBA 2FODA 2ZCKP 3A8DA 3LC3A 2QAAA 2VNTA 5E2OA 2GGVB 1O2GH 1KLJH 4AYVB 2GZ7A 3SHCH 1BTUA 4FUJA 2O8WA 3EYDA 1EZSC 2C4FH 4Y0YE 2QXHA 4MTBA 3LGYA 3GCTG 4Y8ZA 3U8TH 2G4TA 2G5VA 4KTSA 5T3HA 1NRPH 2Y5FA 4IW4E 5EQRA 1A61H 3AAUA 2AGEX 2Y82A 3LGVA 3LDXH 2B7DH 3C1KA 3OYPA 1HXFH 4FUEA 3A80A 1KXEA 3K6YA 1THSH 5A0AE 1TNGA 1YF4A 1OP8A 1C5ZB 3MH4A 2ANWA 3PMBB 3VB6A 1A3EH 1GCDA 1SVPA 1XUIA 4HZHA 5E2PA 2F3CE 4HGCA 1F5KU 1DPOA 1AU8A 2HNTC 3RXPA 1EXFA 3U69H 1XXDA 1MZAA 1C5XB 2ZU2A 1YCPH 2SGQE 2FOGA 4MQAA 1RRKA 2FS8A 1C5PA 2ZCHP 2VVVA 2G5NA 1P0SH 3VB3A 2ZF0H 3E91A 1TABE 1SPJA 3MNBA 2H5DA 1ZSLA 1U6QA 1OX1A 4D9RA 1ESBA 1WYKA 1C2FA 2BD8A 1UVOA 4YESB 1GJCB 3STJA 4AORA 5DP4A 2ZGCA 3OSYA 3A86A 1V3XA 1ZMLA 1FY8E 2JETB 2QXJA 2OUAA 1L4ZA 1IQGA 1CA0C 1C2EA 5E0GA 4E05H 1H9IE 1K1IA 4O97A 1S85A 1Y8TA 4FUFA 2A31A 1EX3A 4MLFB 1W0ZU 1AKSA 1G3EA 2GT7A 2FESH 3ELAH 1QQ4A 1MCTA 2Y80A 1SGYE 2BYAX 1JXPA 5B6OA 3BTGE 1JWTA 5GXPA 1ZJKA 4ABFA 1ID5H 2P59A 2PSYA 4CRAA 2VU8E 3OX7U 1T31A 1EOJA 1WCZA 1Z6JH 1BTXA 1AKSB 3RXCA 1QRXA 1C5UA 1EPTA 3S9CA 2Z9KA 1DUAA 3QUMP 2F9BH 1C5RA 1GG6C 1Z8JB 3MYWA 4B75A 3PM3A 4I7YH 2WPKS 2TGPZ 3SUEA 4SGBE 2ZGXH 4R8TB 1MKXH 5FX5A 2BTCE 1SBWA 1EPTB 2QY0B 1LPKB 4LZ4B 1LMWB 3LGTA 2TBSA 1Z1IA 3SU0A 3VGCC 5F8XA 2ZTYA 1BRAA 1GI5A 3QWCH 4CRDA 1CGHA 4HTCH 1EB2A 1YYY1 2FZZA 2C3SA 1AY6H 1Y5UT 2FOFA 3SV7A 1SLVB 1H8IH 2ANYA 2AIPA 3PYHA 1AIXH 1BOQA 4MG3A 2D8WA 3A82A 5GWZA 2P8OC 2PFEA 9ESTA 4BTTB 1O5EH 4YTAA 3C27B 1NESE 2BY8X 1Y3VA 3QLPH 1KLIH 3P6ZB 1NRNH 4UFDH 3V13A 1GBJA 5C20A 1PYTC 4WF8A 3SZNA 2PW8H 5K7RA 5L6NH 3VEQB 3O8CA 1FAKH 4FUGA 1PQ5A 1GBCA 1F0SA 4OS1A 1Z8GA 2HPPH 1TOMH 4WMDA 2H1UA 1UCYH 1TGBA 1Z8IB 3V7TA 1K21H 4AN7A 2ZFPH 4HI3A 1L1GA 3LJOA 1DITH 1LVOA 4FUHA 1O2UA 4WH6A 2W3IA 1O2YA 2BDIA 3ATWA 1JIMA 1O3LA 2Z3EA 4I31A 1LQEA 5A8YA 5DP9A 3D49H 1S84A 1AO5A 1TBRH 2ANKH 3RXQA 2HOBA 3AASA 3TU7H 1O5DH 3SJ9A 3ZVGA 1F0RA 4FU9A 2A5KA 3LGIA 2A4GA 3ZVCA 3TLOA 2WUCA 1HJAC 3TITA 1EJNA 1QY6A 2BVSH 3B8JA 2UWOA 4YOIA 4OS2A 5LPEA 2WV5A 4O9VA 2OC7A 5ABWA 2WUBA 4XDEA 3WY8A 4K69A 4YOGA 1HIAB 1NU7B 1CQQA 1V2PT 2VIDA 4TYDA 2BDCA 1ELVA 1F0UA 2G4UA 1DM4B 3KIDU 2SGDE 2F9PA 1YP9A 1FN8A 2PWXA 1P2OA 1O2IA 1IQIA 2GT8A 5HYOA 5HGGA 1BRCE 3UREA 4QT8C 2ZDLA 2P94A 2GVFA 1GHAG 1HFDA 1OWIA 1DX5M 2VIOA 1DUEA 3PV4A 4NA7A 1HAGE 1GBKA 1NFWA 5CE1A 2J4IA 1ZYOA 1BRBE 1GGDB 2V3OH 1AFQB 3ZYEA 1LVMA 1Y3YA 3EAJA 2C8WB 1RD3B 1C1PA 2FDAA 1ELFA 1IHSH 3KEEA 3QGNB 2ZDAH 4R0IA 2OP9A 4LK4A 2FI4E 1ZRKA 1TNKA 4GHQA 1C9PA 1W2KH 4X6NA 3DD2H 1ZSJA 1FI8A 1MBMA 1TALA</