1TRNA

Crystal structure of human trypsin 1: unexpected phosphorylation of tyrosine 151
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
224
structure length
223
Chain Sequence
IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Crystal structure of human trypsin 1: unexpected phosphorylation of Tyr151.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase (serine proteinase)
total genus 55
structure length 223
sequence length 224
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1995-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1trnA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1trnA02
2W26A 5EOKA 5FPYA 2ZP0H 3RXSA 1C5WB 3TGJE 3O8RA 2YNAA 3FZZA 4WJG2 2ZDVH 3EDXB 4FU7A 1CGHA 1HJ9A 3BEFB 2SGDE 4I8LA 3RC4A 3GCHC 1VGCB 1QBVH 1BTXA 1GBKA 2PSYA 2JH0D 2ZGCA 1P2MA 2VIWA 1ZSKA 1OXGA 4E06H 1YBWA 5DP3A 1FDPA 4OS6A 1BMAA 4YT6H 5GXPA 2VB0A 5HM2A 4O97A 4GCHG 2OC7A 1G32B 3PM3A 2A7CA 4FUBA 2PW8H 4FUCA 1ESBA 1HAIH 4Y7BA 3RXOA 1QL8A 1C5XB 2C4FH 1XKAC 4NIWA 5TJXA 1C1MA 1C2GA 2AIQA 2NU1E 3UR6A 2W3KA 1W0YH 1BCUH 1DUAA 2P16A 1ZZZA 2FIRH 6GCHG 3OU0A 7LPRA 1V2LT 1SQAA 1OWKA 1O5DH 1BMNH 1GHVH 1ZGIA 1L1JA 2P94A 5ETXA 1DWCH 1OYTH 2VVCA 1RS0A 3E16B 4HFPB 3AW0A 4MLFB 4INLA 1XUKA 1LVMA 1P2NA 2Z9LA 5G4BA 5JYIA 1QCPA 4RSPA 3VXEH 4KP0A 2EI6A 5E0JA 1GVZA 1D6RA 2CN0H 3M3TA 1TABE 1D3PB 4OS2A 3N7OA 3L33A 2A4OA 2A4GA 1O3LA 3ZVDA 3SGQE 1PQAA 2VWMA 1JOUB 3TVJB 1MTWA 1NESE 1FY1A 1QJ1B 1NU9A 2OXSA 9ESTA 1ABIH 4GLYA 1UJ1A 1J14A 2Y5FA 2XC4A 3ZZBA 2JETB 1MKWH 1CGJE 2GZ9A 4ZKSU 3E90B 1KXEA 1CT2E 3BTFE 3BTHE 3LOXA 2ZU4A 2A5IA 1AMHA 3LJOA 5AFYH 3TNSA 1EX3A 1GHAF 1VGCC 1ZGVA 1RIWB 4X6MA 2C8WB 1SGDE 4IW4E 1K1IA 1WTGH 1UVUH 3BG8A 1AWFH 1WV7H 5L6NH 1YP9A 1TQ0B 1NY22 1K1LA 1AB9B 2Z7FE 1AVGH 3K9XB 4O3TA 1T31A 4X8SH 4DT7B 1DSTA 2FOGA 1LKBA 1FAKH 5ABWA 3SV7A 1UK2A 4X0WU 2IN2A 1BTZA 1ETSH 2ZEBA 1BTUA 1V6DA 2BZAA 4D76A 2CGAA 2AYWA 1PPCE 3T62A 1GMCF 1H8DH 5HGGA 1TAWA 2BDHA 2Z3EA 4Q80A 1L4DA 4HTCH 1ANEA 1P04A 2SGAA 4K8BA 4CREA 4DJZB 3QUMP 1GHXH 5C1UA 2Z9GA 3FANA 4JZFH 5E8EH 4BAMB 1O30A 2ZGBH 2G4UA 4FUHA 3BEUA 4I8HA 2GDDA 1MU6B 4WF8A 1VITF 3DT0H 1C2HA 1H8IH 3WY8A 1O2RA 2XYAA 3KGPA 3S9BA 2CXVA 1SGTA 4BAQB 2ZFTA 1N6YA 1Y8TA 1DY8A 3F6UH 4ZKNU 2FS8A 3H5CB 3VB3A 1O2ZA 4XBCA 5AFZH 4ISHH 1W0ZU 5GJ4B 2UWLA 3U1JB 2CHAB 5EQQA 3AAVA 2FYRA 5EXLA 3T27A 2XC5A 1OKXA 3LPRA 5EPYA 2AMPA 4TPYA 1PFXC 1YCPH 2FYQA 4BNRA 3LGYA 2JETC 3O8CA 2PSXA 2GZ7A 1P57B 4IN2A 1MUEB 1O5FH 1NRNH 1DANH 1GWAA 4YLUA 4O9VA 3RXLA 1K9OE 1BRUP 3C1KA 4BTTB 4Y71A 4PROA 1GHAG 2FLBH 2GGVB 1BRAA 4B2AA 1V2QT 1C9PA 1WU1A 1O5CB 5BRRE 4Y8ZA 2WUCA 3M36A 1OP0A 1O2GH 1ZJDA 3SU6A 3IWMA 3SU3A 2NWNA 3SUEA 5F8TA 3ZZ7A 4AX9H 2FP7B 1CU1A 1BBRK 3FFGA 1T8MA 2QV1A 3BTTE 4X1QU 1PQ7A 4ISOA 3RP2A 1W14U 2I6SA 1GMCG 1ZOMA 1DWBH 2GKVE 1AU8A 3MI4A 1G37A 3K2UA 3MWIU 3D62A 3S9CA 1G3CA 3MO3A 1ARCA 3V3MA 2XRCA 2FDAA 4YM9A 1GBAA 2OC8A 3FAOA 2HVXA 1Y5AT 4HZHA 1VITG 3ITIA 1G30B 5I46H 3I77A 1BBRE 3PYHA 1NRPH 3E8LA 4BAKB 1B0FA 1DM4B 3TGIE 3U8RH 1GJ5H 1J9CH 1GI5A 2PKAA 3PMJA 2R0KA 3LU9B 2ZFRH 4ZHMU 3TIUA 3HGPA 3P92A 4WMEA 1SL3A 3RLYH 4Y7AA 1N8OB 1ANCA 3QGNB 4A92A 2ZHDA 1H9IE 3NK8A 1AD8H 1HXEH 1GJ4H 1AI8H 2CHAC 4OS4A 2BVXH 1BMMH 1G2MA 1MBQA 1O3GA 1O2WA 1FY4A 5A8XA 3AAUA 2ALPA 1FIWA 1IQEA 1BDAA 4XFQA 1X7AC 3EAJA 4RN6A 1Q3XA 2CF8H 1DICA 1V2NT 1BOQA 1LO6A 1BA8B 1XKBC 3PLKA 5CMXH 2G5NA 1O3IA 1O2QA 1SSXA 5C5NA 3OY5U 1PYTC 2A31A 1O39A 1CVWH 3SORA 3BTWE 2BDCA 4JZ1A 4AOQA 4FXGH 1O3EA 5A0CA 1A7SA 1MQ5A 1NS3A 5DJ7A 1TALA 3AASA 2ZPSA 1UK4A 1Y59T 3L6PA 1S85A 1O38A 4O03A 1B0EA 3VFEA 8GCHF 4ABEA 1EAUA 2J95A 1ANBA 1GDNA 1ZLRA 1MZAA 4KGAA 2V35A 3KNXA 3VB6A 1W8BH 1AO5A 1V2PT 1HAHH 3RMOH 5FCKA 3NKKA 2F9VA 5FBEA 1MMJN 2A5AA 5FPSA 1GBIA 1JIRA 2A32A 1C5LH 3ODDA 1O3FA 5HM9A 1O35A 1T4VH 4AYVB 3SV9A 4FUIA 1AHTH 1HAYB 1HV7A 4A7IB 4FUFA 5A8ZA 1A46H 2GX4A 2PTNA 1XUJA 3EA8A 1BTPA 1QB6A 5K0HA 2ZGHA 1SGQE 1BTWA 1XUIA 1GMHF 1GBLA 2XWAA 1LMWB 4Q7ZA 2DE8A 1S0QA 3TJOA 1EZUC 1C1OA 1KTSB 2ZHQH 3D23A 5C3NA 1N8OC 4ABIA 4IGDA 1CE5A 1O3JA 3M37A 2Y7ZA 4BOHA 2QC2A 3STIA 1GI9B 3ZV9A 1SGPE 4YT7H 3EE0B 1LPZB 2V3HH 2ZCHP 4BTIB 1SGCA 1A3BH 1VITH 1QB1A 2ZHFH 3M3SA 1THSH 1YCPM 4WVPE 1SFQB 2C8XB 1C1QA 1S0RA 2SGPE 1S6FA 2D8WA 1C5UA 2BDGA 2FTMA 1YC0A 2ANKH 2SFAA 1WUNH 5CE1A 4BXWA 1P8VC 3R0FA 4YZUA 2YOLA 2ODYB 1OWHA 2ZTZA 1S83A 1O3HA 2GD4B 1WQSA 1D3QB 4CBNA 1UTJA 2Q1JA 2ZDMA 4DOQA 1C2EA 2DE9A 2W5EA 2ZHEH 3RXPA 1AKSB 4UDWH 8GCHG 4YOIA 3TK9A 2G8TA 2HLCA 4FU9A 4WH6A 1SLXB 2F91A 1Z8GA 2Y80A 3MU8A 1AY6H 4TWYA 1TX6A 4NSVA 1NRSH 1GI3A 3ZVAA 1V2WT 3F9EA 1TGBA 4JK5A 3A83A 3Q00A 5EGMA 2FX4A 4E05H 1HLTH 1C4U2 7GCHF 3OSYA 3BG4B 3FP8E 2H6MA 1ETTH 1EUFA 2FLRH 2W7UA 3LGUA 4CHAC 3GY5A 4Z6AH 1TFXA 1P3EA 3M3VA 3MOCA 2YNBA 2AGIX 1FJSA 1ESTA 1QRXA 3S7HB 1GMHG 2J2UA 2OUAA 5A0BA 1UTNA 4MPUA 3A7VA 4JZDH 1INCA 2PKAB 2STAE 1BIOA 5A8YA 2F83A 4B73A 1LCYA 1GBEA 2GT7A 1C2DA 3LKWA 5AHGH 1TGSZ 5DP5A 3URDA 2STBE 1V2VT 3SJOA 2FOHA 1GL0E 1O2XA 1EJMA 2PV9B 3E91A 1C1RA 3CENA 2QF0A 3HATH 2G00A 1LTOA 1DT2A 4K2YA 4NZQA 2BDIA 2OC1A 3RXAA 4CRDA 1P2OA 3QGJA 2Q6DA 1GMDF 2J9NA 4K8YA 1V2KT 4AG1A 2ZA5A 3LGIA 3LGWA 4H6TA 1LQEA 4NFFA 1F0TA 3RXQA 5K7RA 3BV9B 1MH0A 4AFQA 1F92A 3KEEA 5EXNA 2FOCA 1KLJH 2BVRH 2EA3A 1THPB 1G3EA 3F68H 3MHWU 3GYLB 4D9RA 1ZPBA 1C5QA 2VNTA 2XNIA 3KQBA 1GJBB 1FLEE 2VU8E 2P3FH 1YLCA 1IQMA 3BSQA 2H5DA 4YTAA 2SGFE 4I8KA 3RU4T 2ZDLA 1E37B 4NA8A 1ACBE 4TYDA 3RM0H 3V12A 3QZRA 4UE7H 2UWOA 4U32A 1D9IA 1Q2WA 2Z9KA 1DLKB 2PKSB 4JYUH 1Q31A 3PWCA 3BG4C 3UR9A 1DE7H 4KTSA 1GDQA 2NU2E 2QXHA 3ZZ6A 1UVSH 4H42U 1XM1A 1FQ3A 1HAPH 1MAXA 3PROA 1NPMA 3M5MA 1DDJA 1QRWA 3VB7A 1J16A 1C5VA 3SN8A 1C2MA 1EB2A 4XDEA 1Z8JB 4ZHLU 2PFEA 2HGTH 3ZZ5A 2PR3A 1PPZA 4CR5A 1P03A 3BTEE 3GY7A 3LONA 1MTUA 2ZDNA 1QJ6B 1QHRB 3GCNA 1ORFA 1GMDG 1GL1A 1CT0E 1LHDH 4B2BA 5EPNA 5DPAA 2F9UA 1OWEA 4ZXYH 1S84A 1D4PB 2P59A 3JZ2B 3OTJE 3TK5A 2FPZA 2H1UA 5T6GA 2P3UB 1ELTA 2VIQA 3HPTB 2H9TH 1ETRH 3Q3YA 1IQNA 1K1OA 2O8TA 2ZPQA 3ZZAA 5AVDA 1GBHA 5J4QA 2BXTH 1ZYOA 2O8MA 5A0AE 4ISLA 3MH6A 2PWXA 1BMLA 2HPQH 2Q6GA 3GDSA 5DK1A 2TPIZ 2VIPA 3PB1E 2AS9A 1SQTA 1SHYA 2XWBI 1IHTH 4I32A 1AVXA 1A0LA 1SLWB 1F0RA 4ZKOU 5IDKA 4UONA 1TGCA 5CHAB 4A6LA 3MH5A 1OWDA 4KKDA 4BAHB 1Y3YA 2KAIA 4ZROA 1O2VA 5DKMA 1TPSA 3GY6A 1UTKA 5FXLA 1JWTA 3U69H 1HUTH 3BTME 1FN6A 1UTMA 1IQFA 1GJAB 3RC5A 3TJUA 2IOTA 1ZPCA 1DITH 1FY3A 1GCTB 1LHGH 2PKSC 1GI6A 2UWPA 2ZC9H 3O8DA 1OX1A 2JKHA 1UVOA 1MKWK 2XW9A 5DP8A 1FMGA 2B0FA 2GT8A 2ZQ2A 1OS8A 3SV2H 1ELFA 1D3DB 1ELAA 3QLPH 3ZYEA 1BJUA 3A7YA 4GPGA 1PPGE 2SNVA 1O5EH 5JBBS 1AWHB 3F9GA 4IBLH 3E6PH 3QX5H 4LZ1H 2ZI2H 2XBYA 1BHXF 1GDUA 1DSUA 3OY6U 5FHTA 2BD5A 4MPVA 4Y79A 1HAOH 2V0BA 4LZ4B 3P17H 1GPZA 1KXFA 4BXSA 1O3PB 2Z94A 2ESTE 1L4ZA 2ZECA 5GCHF 2GZ8A 2PHBA 2F9OA 5JBTA 2W3IA 2QXIA 3ESTA 1SGEE 4HGCA 1TNHA 1WQVH 2BD9A 4CRAA 3S69A 1P2KA 2HPPH 3UFAA 1AFQB 1XUFA 2AERH 2ZWLH 3QDZB 4X1NU 4I7YH 5I25A 1YPGH 3RXJA 1V2UT 3SO3A 1V3XA 1F5RA 1ZTKA 3RXRA 3LGVA 3CS7A 3TJVA 2PUQH 1MAYA 2P3TB 1SFIA 3UNQA 2BOKA 1QY6A 3HK3B 2XBVA 4GHQA 4MNYA 3TGKE 1WYKA 4X2XA 3UY9A 3SJ8A 2QXGA 4KELA 3UQVA 2BM2A 1PPFE 1PPBH 2D2DA 1G9IE 2R9PA 1RTKA 5CHAC 3ATLA 3GY3A 2ZF0H 1VCPA 3TJNA 4XOJA 1G36A 5GWZA 5BPEA 1BRCE 1MTVA 4D7GA 2ZU5A 3SJKA 1J15A 6LPRA 1W13U 2ULLA 1A5GH 5HMAA 3A7ZA 4AGJA 1TIOA 1S5SA 3SJIA 1XMNB 3SW2B 1RJXB 1GCTC 2BLQA 4MPXA 1EXFA 1QNJA 1YCPK 3ATKA 2VWNA 1O34A 2WYGA 3ZV8A 4X8UH 2FTLE 4IC5A 2OBQA 3IITA 1ELBA 1ZSJA 3P95A 5JB8S 1AN1E 1YF4A 4R8TB 2EC9H 2OQ5A 3DFLA 1WCZA 1HIAA 1TA6A 3A8BA 4UFGH 3RMNH 3SI3H 4I33A 5TCCA 2ZO3H 2HOBA 5GCHG 5EQRA 5E2OA 2WPHS 3HKIB 5C20A 1DS2E 1CSOE 1P09A 2B9LA 2BZ6H 2SGQE 1C2IA 1SPJA 3SI4H 1K2I1 1EAWA 2QCYA 1NU7B 2A1DB 2GCTB 2VINA 1GG6B 4TY7A 1ZMLA 1OP8A 4F4OC 2CJIA 2ZKSA 1XUGA 1GI1A 1DWDH 4DG4A 4X2VA 1AFQC 2RA3A 4K1SA 2BDYA 2A0QB 3LIWA 4THNH 1O3DA 1TQ7B 3MO6A 3RXIA 3UPEA 2FI5E 4A1XA 2AGEX 2BY8X 2OINA 1ELCA 1GBJA 1VCWA 3A82A 1UVPA 4ASHA 1AZ8A 1IOEA 2G4TA 3P8GA 1TRYA 1Z6JH 1E36B 4D8NA 3G01A 3S9AA 3P6ZB 1PYTD 1YPJH 1MU8B 3GDVA 1H9HE 1P9SA 2RCEA 3EQ0H 4NSYA 1DXPA 4INHA 3RDZA 5L2YH 4UEHH 4B1TA 2KAIB 5F8XA 5C2ZA 1DY9A 5JPMH 4A5TS 1AIXH 2BMGB 2Y6TA 2Y5GA 2BY7X 3RXEA 3DFJA 4NFEA 3M5NA 3ODFA 2HWLB 2Y5HA 2QGRA 4X8VH 2EI8A 1XXDA 3P8OA 2WPJS 3NWUA 1C9TA 3SJ9A 1TNLA 1GBTA 1Z1IA 1JIMA 1GCDA 3RXMA 2THFB 3GOVB 2Z9JA 1SGFG 4FUDA 3UUZA 4K5ZA 2FO9A 3F9HA 3RXVA 1C1VH 2FM2A 2FOFA 4B71A 1FI8A 2TRMA 1O5GH 3QN7A 3RMLH 3K6YA 3KQDA 1K1PA 1V2MT 3P70B 2HNTF 4M7GA 2ZG0H 1K1JA 1NM6A 1TPPA 4YESB 1V2OT 3TU7H 1FV9A 1GVKB 3LC3A 2CV3A 2V6NA 1HNEE 4LXBH 1ZJKA 5DP7A 2UUFB 4A1TA 1TRMA 4AG2A 2FEQH 2GCTC 3SV8A 1Y5BT 1GG6C 2VGCB 2GV6A 5C1XA 3SNCA 1BTYA 4NZLA 3SU0A 4TY6A 1TB6H 2ANYA 3KQCA 5EQSA 5T3HA 3KIDU 1Y3XA 2AIPA 5LPFA 4CH8B 5HYOA 1EZSC 4H4FA 2XCFA 1QRZA 3MNXA 4NWKA 1ZMJA 1GI4A 2FODA 3RC6A 5EXMA 2ZCLP 2GMTB 2ZDKA 2AEIH 1QA0A 2FWWA 4WH8A 1K1MA 3UNSA 2FESH 1C1WH 3K6ZA 4CHAB 2ZFQH 3SUGA 4SGAE 1QBNA 2BTCE 4ABHA 1L1NA 1HJAB 1ZTLA 3KQEA 4WXVA 3VB4A 2ANWA 3BIUH 3M5LA 2D1JA 8ESTE 2Z3CA 1UCYH 3T26A 1TNIA 1GJ8B 2ODPA 1FXYA 2V3OH 1BTHH 1YPHC 2WPIS 4LOYH 3EA9A 3RXGA 2OQUA 4ZMAH 2O8WA 2BVSH 2PGBB 2TIOA 1AUTC 2Z3DA 5LPEA 1HAGE 1AVWA 4Y8YA 1HAXB 1W11U 1XVMA 2ZCKP 3GCTF 1C5YB 1HIAB 2A2XH 1SGFA 4OGYA 1RTFB 1ZPZA 3FZDA 4IC6A 3RXKA 3SV6A 1RRKA 2ILNA 1WTHD 1SR5C 2BLVA 4UD9H 3RU4E 3PV4A 1IQKA 1L2EA 1GJ7B 3E0PB 3Q77A 3MO9A 2B8OH 1PPEE 3ATIA 1O2SA 4YOGA 1SMFE 1C1PA 1LDTT 1E0FD 3DD2H 1P02A 3S0NA 4AB9A 5T6FA 1UTQA 3FP6E 2BDBA 2VGCC 3LT3A 4AFZA 3B9FH 1O3KA 1FY8E 1Z7KA 1G3BA 1NZQH 2ZU1A 2OC0A 1YKTA 1P06A 5JB9S 1JXPA 1F5KU 1NRQH 4JYTA 3W95A 3C27B 1OSSA 1ZHRA 3U8TH 4Y76A 2A7HA 1CA8B 3ZZ9A 5LPRA 4DURA 1TMBH 2GMTC 3T25A 2QXJA 1KTTB 1TNGA 1O33A 1YLDA 1XX9A 4MNWA 3MNBA 3RXHA 1TE0A 1EPTA 5J4SA 1TNJA 1NFYA 3SUDA 3RLWH 3RMMH 1S6HA 3BTQE 3LH3A 1SBWA 1V2ST 1HJAC 1B5GH 2XBXA 1O32A 1D3TB 3M5OA 1DX5M 4K69A 3TH4H 2QY0B 4GVUA 1GBFA 1TMUH 3H7TA 3DUXH 1KLTA 1GBBA 1SLVB 3PMBB 4AFSA 2H9EH 4NG9H 4ABDA 1TGNA 4Z0KA 3VXFH 3OX7U 3VGCB 1J17T 1O2JA 4CBOA 1BUIA 3OYPA 1ZSLA 1K1NA 3GCTG 3QK1A 1S82A 2F9PA 1T8LA 1GBDA 2TGAA 3GYMA 1O2IA 2XBWA 3HK6B 1A5IA 5T6DA 3R3GB 2VVUA 3FP7E 5JDUB 3UREA 1DLEA 5JBAS 1WAYB 2O9QA 4RKJB 1FUJA 4Q7XA 3ZZCA 2BOHB 3FVFB 1SGIB 4IMZA 1BHXB 1A4WH 2BXUH 4MG3A 3TH2H 1WOFA 4JYVH 2BD4A 1HAZB 2EI7A 2TBSA 3ZVGA 2HALA 2G5VA 3PTNA 1W7GH 2BLOA 1ID5H 1QGFA 5GPIB 1MD8A 4GUXA 1TX8A 4U30A 3UOPA 4JK6A 4IMQA 1QBOA 3EGKH 1FAXA 2NU0E 3P8FA 1O3AA 3B8JA 3RXUA 3NCLA 1G2LA 3MMGA 2H2ZA 3PLBA 4OS1A 4X6PA 2BD3A 2F9BH 1HRTH 4MPWA 7GCHG 3TLOA 1IQGA 3SNBA 1OP2A 1UTPA 4FU8A 1FY5A 2OCVB 1LVBA 3B23B 2G81E 2QYIA 1V2RT 1T32A 2ZGXH 2GP9B 1AQ7A 1TOCB 2ALVA 1SGYE 4MNXA 4X6NA 4B2CA 2BD8A 1RXPA 5EODA 3SU1A 1GGDB 1EZXC 4R0IA 1GHYH 1XXFA 4ZH8A 3A87A 2ZQ1A 4B75A 1O31A 3LH1A 1CGIE 3M35A 4H6SB 2RA0A 3SHAH 4AYYB 5L30H 1PPHE 1P10A 5AF9H 1LHFH 2R0LA 1MKXH 3VGCC 1VZQH 3A8AA 1O3CA 2D26C 4E7RG 1SLUB 3SZNA 1AE5A 2ZU3A 4DVAU 1YPEH 1K22H 1Y3VA 5H4IB 1P12E 1A1RA 1GJDB 1NROH 1CHGA 2J94A 4UFFH 5F8ZA 1GJCB 3A85A 1GI8B 1C5ZB 1ELGA 1ELEE 1AE8H 3RU4D 1YPMH 3GY4A 1LPKB 3MH4A 1VJ9U 2QAAA 2F9NA 4X6OA 2GCHF 4DIIH 1HPGA 2FX6A 5FAHA 1NC6A 5E0GA 3RXDA 2Z9IA 3SGBE 3GICB 2VVVA 1IQHA 5DP4A 5LGOA 1O2TA 3QTVH 1KLIH 1HYLA 2OP9A 2R3YA 1AZZA 4LK4A 5DP6A 2OTVA 1TRNA 2G55A 3NXPA 1O3MA 3Q3XA 1GJ9B 2O8LA 3LC5A 4OS5A 1V2JT 1KYNA 1DXWA 1UMAH 2IJOB 2VIDA 4YO9A 3D65E 1MZDA 1DVAH 1ZRBA 3MU0A 2ZU2A 3L3TA 5F03A 1LHEH 1WSSH 2BY6X 4Y0YE 3A80A 1SG8B 3E1XB 3SBKA 4Y11E 1KXAA 2WV4A 2DUCA 5L2ZH 3A7XA 2WV5A 1LVYA 3M7TA 1BZXE 1CA0C 1EPTB 3ZVCA 1LKAA 2CF9H 4NGAH 2BX4A 1KDQA 4J1YA 1F0UA 1JMOH 2Y82A 4NWLA 2XC0A 1EQ9A 1O3NA 2J38A 2C93B 1SHHB 1DOJA 4Y0ZE 2BQWB 4ISIH 3UQOA 4SGBE 1O2HA 1HBTH 2BHGA 1E35B 1BQYA 1GGDC 2J92A 3BTGE 1CO7E 4KTUA 3PMHB 2K1QA 4WY3A 4GHTA 3RUOA 1ESAA 4O3UA 3SQEE 1KY9A 1KSNA 1P05A 3IG6B 2NU3E 3LGTA 1ZRKA 1OWJA 1YPHE 1O2LA 3PMAB 2GCHG 2J34A 2CMYA 3K65B 1N6XA 1A0JA 2LNCA 1EJAA 2GVFA 2BQ7B 4TWWA 1TOMH 3SNAA 3UWIA 1C5MD 1QQUA 4I8GA 1DFPA 1JRSA 1O5BB 3ELAH 2A4RA 1LPGB 1MCTA 2FOBA 1TBRH 1PQ8A 3ZZ3A 1QIXB 1EKBB 1A5HA 2PTCE 4ABFA 2ZIQH 1W12U 3V13A 4ZKRU 2FS9A 4NIXA 4U2WA 3TITA 1O2PA 5A2MH 3I78A 2GTBA 1YPKH 2A2QH 3A89A 1C1UH 2HRVA 2QN5T 4YOJA 1UTOA 4JZEH 2WUBA 3A81A 2A5KA 2H9HA 1L0ZA 4ISNA 3SNEA 3MYWA 2A45B 1Y3UA 1GHBF 1DWEH 2UUYA 3ZZ4A 2VIOA 1M9UA 4CRBA 1CQQA 1EPTC 1HCGA 1PQ5A 4DGJA 1F5LA 3U9AH 4FVBA 3A88A 3DA9B 1TYNA 1O37A 1E34B 4MTBA 2G51A 4XBBA 4MDSA 1Z71A 2AH4X 4DW2U 4AFUA 1ANDA 1AFEH 2AMDA 5IYTA 3ZYDA 3SU4A 4DIHH 1V2TT 2R2WU 1GI0A 1O0DH 1FPHH 1K28D 1YGCH 1UVTH 2R2MB 1Z6EA 8KME2 1BT7A 1YYY1 4FUJA 4Y6DA 3CP7A 2FOAA 4X2YA 1ZTJA 4CRCA 2B5TB 2BYAX 2GV7A 2BB4A 1RFNA 4XSKU 5DP9A 2BDAA 1OOKB 4ZUHA 1ZHPA 1P3CA 1QJ7B 1A0HB 1N1LA 2HNTC 1A2CH 1OYQA 1HDTH 2VIVA 3MFJA 1L1GA 2FI3E 1Z8IB 1C4V2 3BN9A 2WYJA 3MH7A 1QFKH 1NT1A 2ZFSA 1MD7A 1UHBA 1QL9A 1O2YA 1TNKA 3E3TA 4OS7A 1O3BA 1P0SH 1VJAU 4VGCB 5B6OA 2ASUB 4AB8A 2NU4E 1NO9H 1RIWC 2ZFFH 1BJVA 2SGEE 3TNTA 1P01A 1Z8RA 4CRFA 3ATWA 3TK6A 3T5FH 1EOJA 1AKSA 5FPTA 4BANB 3O8BA 2PLXA 1MQ6A 2XCNA 1EAIA 1AB9C 1GHBG 1NFXA 4NA7A 1T8NA 2J4IA 2ZZUH 1TPAE 3A7TA 1TA2A 1P9UA 1K21H 3ZZ8A 1C5PA 3QO6A 1KDQB 1GHWH 2ZTYA 3M7QA 3PTBA 4UFDH 3ZVBA 4HI3A 1C2LA 4J2YB 2I6QA 3LJJA 5DG6A 1JRTA 4E7NA 1A61H 1B7XB 3KF2A 3URCA 2R3UA 4WMDA 3VEQB 1W10U 3HKJB 1BBRH 3AVZA 4IN1A 3V7TA 2EEKA 1W7XH 3A8CA 1C5NH 5TCAA 1QR3E 1HAVA 1O2OA 3UWJH 2C90B 1GBMA 6ESTA 1Y5UT 4YLQH 4ABAA 1SOTA 2VJ1A 2TGPZ 1IQIA 4X1RU 4MQAA 3MU4A 1IHSH 4B74A 4XBDA 3CS0A 1OPHB 3MNSA 3KHVA 3ZZDA 2QIQA 2QA9E 2RG3A 1P2IA 1TMTH 2FOEA 1BB0B 2ZNKH 4K1TA 6CHAB 1F2SE 3U8OH 1P2QA 5EW1H 1MTSA 3MU1A 1T4UH 4ESTE 1EASA 2GDEH 2VH0A 3V0XA 1TWXB 5E0HA 1AGJA 1C5SA 3RXTA 5C67A 4CH2B 4Y10E 3ENSB 4GAWA 1T8OA 1SOZA 4X8TH 4KTCA 2Y7XA 1UK3A 2VWOA 1C5TA 4OGXA 3EYDA 1UCYK 4VGCC 3UTUH 1EP5A 1GJ6A 4TPIZ 2ZDAH 1SI5H 4WWYA 1FNIA 1VR1H 2UUKB 3A86A 3SHCH 1EP6A 3MTYA 1TONA 3AW1A 3BTKE 3UOUA 1O3OA 1C5RA 2P95A 1TBZH 2F3CE 1KXCA 3P8NA 5FX6A 2IPHA 4Q7YA 4QT8C 1AUJA 5EW2H 1NFUA 1ZR0A 4JZIA 1UCYE 1ZMNA 4K1EA 2W7SA 2UUJB 3H7OA 1KIGH 3T28A 4NA9H 1CT4E 3Q3KA 2AFQB 1ZHMA 3F1SB 5C5OA 1F0SA 4AZ2B 1MBMA 1P11E 2LPRA 2P93A 3RXFA 3T2NA 4IS5A 4ABJA 3EA7A 1ELDE 4U01A 1QURH 1OWIA 1QL7A 1WBGB 1NN6A 1TX7A 2OLGA 1TPOA 4FUGA 4A1VA 1P2JA 4X1SU 2C3SA 4JMYA 3A8DA 4BTUB 7KMEH 1HB0B 3SU2A 1EAXA 2XXLA 3VPKA 1D6WA 1RGQA 1IAUA 1TBQH 1ARBA 2FXRA 3ZVEA 1HJ8A 1H9LB 2SNWA 2VWLA 1E38B 3NZIA 3STJA 2BD2A 1O5AB 5FBIA 1PJPA 1JBUH 2FI4E 6CHAC 1LVOA 4K60A 1C1SA 3SNDA 4DY7B 4ABBA 3GDUA 2C8YB 1HGTH 4UFEH 1YPLH 3UNRA 1NTPA 3M61U 3U1IB 3VB5A 2FOMB 1UTLM 1GI7B 3ZVFA 1UHBB 2XTTB 1F7ZA 5A09A 1GHZA 1Y3WA 4WMFA 1FZZA 3LDXH 5ESBA 3GY8A 5JBCS 3E0NB 4GSOA 2AGGX 1W2KH 2ZFPH 1KXDA 1ABJH 4ZHAA 1C2JA 2BX3A 1O2MA 2C8ZB 1DUEA 1HFDA 1QA7A 2Z6BD 2ODQA 4ABGA 1EZQA 4CR9A 1MCVA 2BY9X 1CHOF 1C5OH 1H4WA 2RDLA 3RXBA 1TGTA 1SC8U 3Q76A 1MTNB 3UIRA 2BY5X 5FCRA 4D9QA 1QQ4A 1C1TA 5PTPA 4NIVA 3PWBA 3F9FA 3ATMA 1XVOA 2OD3B 5GDSH 1UO6A 1IQJA 4I8JA 1NFWA 4DCDA 1SGRE 1LQDB 3A84A 5EG4A 4AGKA 1RTLA 1HAVB 2M5TA 3BTDE 3NPSA 2P8OB 2O8UA 3GCOA 3QTOH 5SGAE 1RD3B 1SQOA 2PGQB 2A4QA 2Q6FA 1CBWB 3S7KB 4NCYA 1TLDA 3SQHE 1FONA 5DGJA 1FN8A 3PO1B 1THRH 4MNVA 1LHCH 4Q2KA 4CRGA 1G3DA 3BEIB 3HGNA 5E2PA 1H1BA 3KN2A 1SB1H 1U6QA 2JH5D 3BF6H 3KL6A 4K3JA 3BIVH 3RXCA 2G52A 5EU8A 1HXFH 2FMJA 1BITA 1GI2A 2WPMS 3A7WA 3GCHB 4RKOB 3JZ1B 3SU5A 1A3EH 9LPRA 1GVLA 5GIBA 2PUXB 1VCQA 3RM2H 4D7FA 3MNCA 2TGTA 3SUFA 2HNTE 4AORA 2H5CA 2ZGJA 2Y81A 7ESTE 1DPOA 2ZPRA 4WXIA 1EOLA 1C1NA 3SOSA 3TPIZ 1GBCA 2JH6D 1CA0B 2BQ6B 3I29A 4GCHF 4XE4A 5LH8A 4Y8XA 1CHOG 2A7JA 1EATA 1MKXK 4JCNA 4INKA 1O36A 2ANMH 1ELVA 2FZZA 3MU5A 4FUEA 3QWCH 2WPLS 2WINI 1EB1H 1O2NA 1SVPA 3D49H 3GY2A 2B7DH 1MTNC 3M7UA 1EJNA 6GCHF 1NRRH 3PLPA 1C2FA 2WPKS 1IQLA 3SGAE 3QZQA 5F6MA 1W3CA 2OBOA 3U98H 4FVDA 1C4Y2 3T29A 4B76A 1O2KA 1J8AA 1SGNE 1BRBE 1FIZA 3GISB 8LPRA 3NUMA 4F49A 4ZXXH 2TGDA 1S81A 1QB9A 2AMQA 4X2WA 1T7CA 1FPCH 1XUHA 2ZHWH 4X1PU 5C1YA 2ZTXA 4ZAEA 5DO4H 2BD7A 5HXFA 1C2KA 1Z1JA 3TH3H 5ESTE 4MVNA 3W94A 3KCGH 3DHKH 4BAOB 2QF3A 1YM0A 1O2UA 2P8OC 5FX5A 1KXBA 1CBWC 2BLWA 4I31A 1QTFA 4AN7A 4NIYA 3PO1C 2VH6A
chains in the Genus database with same CATH superfamily
2W26A 5EOKA 5FPYA 2ZP0H 3RXSA 1C5WB 3TGJE 3O8RA 2YNAA 3FZZA 4WJG2 2ZDVH 3EDXB 4FU7A 1CGHA 1HJ9A 3BEFB 2SGDE 1W0KD 4I8LA 3RC4A 3GCHC 1VGCB 1QBVH 1BTXA 1GBKA 2PSYA 2JH0D 2ZGCA 1P2MA 2VIWA 1ZSKA 1OXGA 4E06H 1YBWA 5DP3A 1FDPA 4OS6A 1BMAA 4YT6H 5GXPA 2VB0A 5HM2A 4O97A 4GCHG 2OC7A 1G32B 3PM3A 2A7CA 4FUBA 2PW8H 4FUCA 1ESBA 1HAIH 4Y7BA 3RXOA 1QL8A 1C5XB 2C4FH 1XKAC 4NIWA 5TJXA 1C1MA 1C2GA 2AIQA 2NU1E 3UR6A 2W3KA 1W0YH 1BCUH 1DUAA 2P16A 1ZZZA 2FIRH 6GCHG 3OU0A 7LPRA 1V2LT 1SQAA 1OWKA 1O5DH 1BMNH 1GHVH 1ZGIA 1L1JA 2P94A 5ETXA 1DWCH 1OYTH 2VVCA 1RS0A 3E16B 4HFPB 3AW0A 4MLFB 4INLA 1XUKA 1LVMA 1P2NA 2Z9LA 5G4BA 5JYIA 1QCPA 4RSPA 2OK5A 3VXEH 4KP0A 2EI6A 5E0JA 1GVZA 1D6RA 2CN0H 3M3TA 1TABE 1D3PB 4OS2A 3N7OA 3L33A 2A4OA 2A4GA 1O3LA 3ZVDA 3SGQE 1PQAA 2VWMA 5EJ1A 1JOUB 3TVJB 1MTWA 1NESE 1FY1A 1QJ1B 1NU9A 3SYJA 2OXSA 9ESTA 1ABIH 4GLYA 1UJ1A 1J14A 2Y5FA 2XC4A 3ZZBA 2JETB 1MKWH 1CGJE 2GZ9A 4ZKSU 2VBCA 3E90B 1E1RD 1KXEA 2PP6A 1CT2E 3BTFE 3BTHE 3LOXA 2ZU4A 2A5IA 1AMHA 3LJOA 5AFYH 3TNSA 1EX3A 1GHAF 1VGCC 1ZGVA 1RIWB 4X6MA 2C8WB 1SGDE 4IW4E 1K1IA 2JIZD 1WTGH 1UVUH 3BG8A 3MQKC 1AWFH 1WV7H 1NBME 5L6NH 1YP9A 1TQ0B 1NY22 1K1LA 1AB9B 2Z7FE 1AVGH 3K9XB 4O3TA 1T31A 4DT4A 4X8SH 4DT7B 1DSTA 2FOGA 1LKBA 1FAKH 5ABWA 3SV7A 1UK2A 4X0WU 2IN2A 1BTZA 1ETSH 2ZEBA 1BTUA 1V6DA 2BZAA 4D76A 2CGAA 2AYWA 1PPCE 3T62A 1GMCF 1H8DH 5HGGA 1TAWA 2BDHA 2Z3EA 4Q80A 1L4DA 4HTCH 1ANEA 4XD7D 1P04A 2SGAA 4K8BA 4CREA 4DJZB 3QUMP 1GHXH 5C1UA 2Z9GA 3FANA 4JZFH 5E8EH 4BAMB 1O30A 2ZGBH 5F53A 2G4UA 4FUHA 3BEUA 4I8HA 2GDDA 1MU6B 4WF8A 1VITF 3DT0H 1OHHD 1C2HA 1H8IH 3WY8A 1O2RA 2XYAA 3KGPA 3S9BA 2CXVA 1SGTA 4BAQB 2ZFTA 1N6YA 1Y8TA 1DY8A 3F6UH 4ZKNU 2FS8A 3H5CB 3VB3A 1O2ZA 4XBCA 5AFZH 4ISHH 1W0ZU 5GJ4B 2UWLA 3U1JB 2CHAB 5EQQA 3AAVA 2FYRA 5EXLA 3T27A 2XC5A 1OKXA 3LPRA 5EPYA 2AMPA 4TPYA 1PFXC 1YCPH 2FYQA 4BNRA 3LGYA 2JETC 3O8CA 2PSXA 2GZ7A 1P57B 4IN2A 1MUEB 1O5FH 1NRNH 1DANH 1GWAA 4YLUA 4O9VA 3RXLA 1K9OE 1BRUP 3C1KA 4BTTB 4Y71A 4PROA 1GHAG 2M2AA 2V7QD 2FLBH 2GGVB 1BRAA 4B2AA 1V2QT 1C9PA 1WU1A 2YMSB 1O5CB 5BRRE 4Y8ZA 2WUCA 3M36A 1OP0A 1O2GH 5C17A 1ZJDA 3SU6A 3IWMA 3SU3A 2NWNA 3SUEA 2JJ1D 5F8TA 3ZZ7A 5C0UA 3U28C 4AX9H 2FP7B 1CU1A 1BBRK 3FFGA 1T8MA 2QV1A 2W6JD 3BTTE 4X1QU 1PQ7A 4ISOA 3RP2A 1W14U 2I6SA 1GMCG 1ZOMA 1DWBH 2GKVE 2YMSD 1AU8A 3MI4A 1G37A 3K2UA 3MWIU 3D62A 3S9CA 1G3CA 3MO3A 1ARCA 3V3MA 3EE7A 2XRCA 2FDAA 4YM9A 1GBAA 2OC8A 3FAOA 2HVXA 1Y5AT 4HZHA 1VITG 3ITIA 1G30B 5I46H 3I77A 1BBRE 3PYHA 1NRPH 3E8LA 4BAKB 1B0FA 1DM4B 3TGIE 3U8RH 1GJ5H 1J9CH 1GI5A 2PKAA 3PMJA 2R0KA 3LU9B 2ZFRH 4ZHMU 3TIUA 2L74A 3HGPA 3P92A 4WMEA 1SL3A 3RLYH 4Y7AA 1N8OB 1ANCA 3QGNB 4A92A 2L6OA 2ZHDA 1H9IE 3NK8A 1AD8H 1HXEH 1GJ4H 1AI8H 2CHAC 4OS4A 2BVXH 1BMMH 1G2MA 1MBQA 1O3GA 1O2WA 1FY4A 5A8XA 3AAUA 2ALPA 1FIWA 1IQEA 1BDAA 4XFQA 1X7AC 3EAJA 4RN6A 1Q3XA 2CF8H 1DICA 1V2NT 1BOQA 1LO6A 1BA8B 1XKBC 3PLKA 5CMXH 2G5NA 1O3IA 1O2QA 1SSXA 5C5NA 3OY5U 4B6EA 1PYTC 2A31A 1O39A 2WHXA 1CVWH 1NBMD 3SORA 3BTWE 2BDCA 2IPQX 4JZ1A 2KCAA 4AOQA 4FXGH 1O3EA 5A0CA 1A7SA 1MQ5A 1NS3A 5DJ7A 1TALA 3AASA 2ZPSA 1UK4A 1Y59T 3L6PA 1S85A 1O38A 4O03A 1B0EA 3VFEA 8GCHF 4ABEA 1EAUA 2J95A 1ANBA 1GDNA 1ZLRA 5HIZA 1MZAA 4KGAA 2KCOA 2V35A 3KNXA 3VB6A 1W8BH 2CK3D 1AO5A 3N99A 1V2PT 1HAHH 3RMOH 5FCKA 3NKKA 2F9VA 5FBEA 1MMJN 2A5AA 5FPSA 1GBIA 1JIRA 2A32A 1C5LH 3ODDA 1O3FA 3PV5A 5HM9A 1O35A 1T4VH 4AYVB 1YY3A 3SV9A 4FUIA 1AHTH 1HAYB 1HV7A 4A7IB 4FUFA 5A8ZA 1A46H 2GX4A 2PTNA 1XUJA 3EA8A 1BTPA 1QB6A 5K0HA 2ZGHA 1SGQE 5KECA 1BTWA 1XUIA 1GMHF 1GBLA 2XWAA 1LMWB 4Q7ZA 2KM0A 2DE8A 1S0QA 3TJOA 1EZUC 1C1OA 1KTSB 2ZHQH 3D23A 5C3NA 1N8OC 4ABIA 4IGDA 1CE5A 1O3JA 3M37A 2Y7ZA 4BOHA 2QC2A 3STIA 1GI9B 3ZV9A 1SGPE 4YT7H 3EE0B 1LPZB 2V3HH 2ZCHP 4BTIB 1SGCA 1A3BH 1VITH 1QB1A 2ZHFH 3M3SA 2F4LA 1THSH 1YCPM 4WVPE 1SFQB 3WWBA 2C8XB 1C1QA 1S0RA 2KR7A 3OEED 2SGPE 1S6FA 2D8WA 1C5UA 2BDGA 2FTMA 1YC0A 2ANKH 2SFAA 1WUNH 5CE1A 3F0OA 4BXWA 1YLNA 3NRLA 1P8VC 3R0FA 4YZUA 2YOLA 2ODYB 1OWHA 2ZTZA 1S83A 1O3HA 2GD4B 1WQSA 1D3QB 4CBNA 1UTJA 2Q1JA 2ZDMA 1E1QD 4DOQA 1C2EA 2DE9A 2W5EA 2ZHEH 3RXPA 1AKSB 4UDWH 8GCHG 4YOIA 3TK9A 2G8TA 2HLCA 4FU9A 4WH6A 1SLXB 2F91A 1Z8GA 2Y80A 3MU8A 1AY6H 4TWYA 1TX6A 4NSVA 1NRSH 1GI3A 3ZVAA 1V2WT 3F9EA 1TGBA 4JK5A 3A83A 3Q00A 5EGMA 2FX4A 4E05H 1HLTH 1C4U2 7GCHF 3KYGA 3OSYA 3BG4B 3FP8E 2H6MA 1ETTH 1EUFA 2FLRH 2W7UA 3LGUA 4CHAC 3GY5A 4Z6AH 4FOUC 1TFXA 1P3EA 3M3VA 3MOCA 2YNBA 2AGIX 1FJSA 1ESTA 1QRXA 5C0TA 3S7HB 1GMHG 2J2UA 2OUAA 5A0BA 1UTNA 4MPUA 3A7VA 4JZDH 1INCA 2PKAB 2STAE 1BIOA 5A8YA 2F83A 4B73A 1LCYA 1GBEA 2GT7A 1C2DA 3LKWA 5AHGH 1TGSZ 2HLDD 5DP5A 3URDA 2STBE 1V2VT 4TSFD 3SJOA 2FOHA 1GL0E 1O2XA 1EJMA 2PV9B 3E91A 1C1RA 3CENA 2QF0A 3HATH 2G00A 1LTOA 1DT2A 4K2YA 4NZQA 2BDIA 2OC1A 3RXAA 4CRDA 1P2OA 3QGJA 2Q6DA 1GMDF 2J9NA 4K8YA 1V2KT 4AG1A 2ZA5A 3LGIA 3LGWA 4H6TA 1LQEA 5DN6D 4NFFA 1F0TA 3RXQA 5K7RA 3BV9B 1MH0A 4AFQA 1F92A 3KEEA 5EXNA 3FN8A 5C94A 2FOCA 1KLJH 2BVRH 2RFKC 2EA3A 1THPB 1G3EA 3F68H 3MHWU 3GYLB 4D9RA 1ZPBA 1C5QA 2VNTA 2XNIA 3KQBA 1GJBB 1FLEE 2VU8E 2P3FH 1YLCA 1WXRA 1IQMA 3BSQA 2H5DA 4YTAA 2SGFE 2KFWA 4I8KA 3RU4T 2ZDLA 1E37B 4NA8A 1ACBE 4TYDA 3RM0H 3V12A 4P00A 3QZRA 4UE7H 2UWOA 4U32A 1D9IA 5GNDA 3ZIAD 1Q2WA 2Z9KA 1DLKB 2PKSB 4JYUH 1Q31A 3PWCA 3BG4C 3UR9A 2WSSD 1DE7H 4KTSA 1GDQA 2NU2E 2QXHA 3ZZ6A 1UVSH 4H42U 1XM1A 1FQ3A 1HAPH 1MAXA 3PROA 1NPMA 2KCPA 3M5MA 1DDJA 1QRWA 3VB7A 1J16A 1C5VA 3SN8A 1C2MA 2EY4C 1EB2A 4HG6A 4XDEA 1Z8JB 4ZHLU 2PFEA 2HGTH 3ZZ5A 2PR3A 1PPZA 4CR5A 1P03A 3BTEE 3GY7A 3LONA 1MTUA 2ZDNA 1QJ6B 4ZCNA 1QHRB 3GCNA 1ORFA 1GMDG 1GL1A 1CT0E 1LHDH 4B2BA 5EPNA 5DPAA 2F9UA 5IK2D 1OWEA 4ZXYH 1S84A 1D4PB 2P59A 3JZ2B 3OTJE 3TK5A 2FPZA 2H1UA 5T6GA 2P3UB 1ELTA 2VIQA 1K0HA 2W6ID 3HPTB 2H9TH 1ETRH 3Q3YA 1IQNA 1K1OA 2O8TA 2ZPQA 4XRNA 3ZZAA 5AVDA 1GBHA 5J4QA 2BXTH 1ZYOA 2O8MA 5A0AE 4ISLA 3MH6A 2PWXA 1BMLA 2HPQH 4ASUD 2Q6GA 3GDSA 5DK1A 2TPIZ 2VIPA 3PB1E 2AS9A 1SQTA 1SHYA 2XWBI 1IHTH 4I32A 1AVXA 1A0LA 1SLWB 1F0RA 4ZKOU 5IDKA 4UONA 1TGCA 5CHAB 4A6LA 3MH5A 1OWDA 4KKDA 4BAHB 1Y3YA 2KAIA 4ZROA 1O2VA 5DKMA 1TPSA 3GY6A 1UTKA 5FXLA 1JWTA 3U69H 1HUTH 3BTME 1FN6A 1UTMA 4F55A 1IQFA 1GJAB 3RC5A 3TJUA 2IOTA 1ZPCA 5T1VA 1DITH 1FY3A 1GCTB 1LHGH 2JJ2D 2PKSC 1GI6A 2UWPA 2ZC9H 3O8DA 1OX1A 2JKHA 1UVOA 1MKWK 2XW9A 2F43B 5DP8A 1FMGA 2B0FA 2GT8A 2ZQ2A 1OS8A 3SV2H 1ELFA 1D3DB 1ELAA 3QLPH 3ZYEA 1BJUA 3A7YA 4GPGA 1PPGE 2SNVA 1O5EH 5JBBS 1AWHB 3F9GA 3GS9A 4IBLH 3E6PH 3QX5H 4LZ1H 2ZI2H 2XBYA 1BHXF 1GDUA 1DSUA 3OY6U 5FHTA 2BD5A 4MPVA 4Y79A 1HAOH 2V0BA 4LZ4B 3P17H 1GPZA 1KXFA 4BXSA 1O3PB 2Z94A 2ESTE 1L4ZA 2ZECA 5GCHF 2GZ8A 2PHBA 1H8HD 2F9OA 5JBTA 2W3IA 2QXIA 3ESTA 1SGEE 4HGCA 1TNHA 1WQVH 2BD9A 4CRAA 3S69A 1P2KA 2HPPH 4RT1A 3UFAA 1AFQB 1XUFA 2AERH 2ZWLH 3QDZB 4X1NU 4I7YH 5I25A 1YPGH 3RXJA 1V2UT 3SO3A 1V3XA 1F5RA 1ZTKA 3RXRA 3LGVA 5HKKD 3CS7A 3TJVA 2PUQH 1MAYA 2P3TB 1SFIA 3UNQA 2BOKA 1QY6A 3HK3B 2XBVA 4GHQA 4MNYA 3TGKE 1WYKA 4X2XA 3UY9A 3SJ8A 2QXGA 4KELA 3UQVA 2BM2A 1PPFE 1PPBH 2D2DA 1G9IE 2R9PA 1RTKA 5CHAC 3ATLA 3GY3A 2ZF0H 1VCPA 3TJNA 4XOJA 1G36A 5GWZA 2J5UA 5BPEA 1BRCE 1MTVA 4D7GA 2ZU5A 3SJKA 1J15A 1E79D 6LPRA 1W13U 2ULLA 1A5GH 5HMAA 3A7ZA 4AGJA 1TIOA 1S5SA 3SJIA 1XMNB 3SW2B 5B6LA 1RJXB 1H8ED 1GCTC 2BLQA 4MPXA 1EXFA 1QNJA 1YCPK 3ATKA 2VWNA 1O34A 3F2FA 2WYGA 3ZV8A 4X8UH 2FTLE 3DCLA 4IC5A 2OBQA 3IITA 1ELBA 1ZSJA 3P95A 1QZ8A 1AN1E 5JB8S 1YF4A 4R8TB 2EC9H 2OQ5A 3PRBA 3DFLA 1WCZA 1HIAA 1TA6A 3WW7A 3A8BA 4UFGH 3RMNH 3SI3H 4I33A 5TCCA 2ZO3H 2HOBA 5GCHG 3FKSD 5EQRA 5E2OA 2WPHS 3HKIB 5C20A 1DS2E 1CSOE 1P09A 2B9LA 2BZ6H 2SGQE 1C2IA 1SPJA 3SI4H 1K2I1 1EAWA 2LELA 1NU7B 2A1DB 2GCTB 2QCYA 2VINA 2KCYA 1GG6B 4TY7A 1ZMLA 1OP8A 4F4OC 2CJIA 2ZKSA 2J98A 1XUGA 1GI1A 1DWDH 4DG4A 4X2VA 1AFQC 2RA3A 4K1SA 2BDYA 2A0QB 3LIWA 4THNH 1O3DA 1TQ7B 3MO6A 3RXIA 3UPEA 2FI5E 4A1XA 2AGEX 2BY8X 2OINA 1ELCA 1GBJA 1VCWA 3A82A 1UVPA 4ASHA 1AZ8A 1IOEA 2G4TA 3P8GA 1TRYA 1Z6JH 1E36B 4D8NA 3G01A 3S9AA 3P6ZB 1PYTD 1YPJH 1MU8B 3GDVA 1H9HE 1P9SA 2RCEA 3EQ0H 4NSYA 1DXPA 4INHA 3RDZA 5L2YH 4UEHH 4B1TA 2KAIB 5F8XA 5C2ZA 1DY9A 5JPMH 4A5TS 1AIXH 2BMGB 2Y6TA 2Y5GA 4RI0A 2BY7X 3RXEA 3DFJA 4NFEA 3M5NA 3ODFA 5CDFE 4P02A 2HWLB 5EJLA 2Y5HA 2QGRA 4X8VH 2EI8A 1XXDA 3P8OA 2WPJS 3NWUA 1C9TA 3SJ9A 1TNLA 1GBTA 1Z1IA 1JIMA 1GCDA 3RXMA 2THFB 3GOVB 2Z9JA 1SGFG 4FUDA 3UUZA 4K5ZA 2FO9A 3F9HA 3RXVA 1C1VH 2FM2A 2FOFA 4B71A 1FI8A 2TRMA 1O5GH 3QN7A 3RMLH 3K6YA 3KQDA 1K1PA 1V2MT 3P70B 1SKYE 2HNTF 3OAAD 3F3BA 4M7GA 2ZG0H 1K1JA 1NM6A 1TPPA 4YESB 1V2OT 3TU7H 1FV9A 1GVKB 3LC3A 2CV3A 2V6NA 1HNEE 4LXBH 1ZJKA 5DP7A 2UUFB 4A1TA 1TRMA 2AHME 4AG2A 2FEQH 2GCTC 3SV8A 1Y5BT 1GG6C 2VGCB 5KGOA 2GV6A 5C1XA 3F0PA 4Q63A 3SNCA 1BTYA 4NZLA 2K0QA 3SU0A 4TY6A 1TB6H 2ANYA 3KQCA 5EQSA 5T3HA 3KIDU 1Y3XA 2AIPA 5LPFA 4CH8B 5HYOA 1EZSC 4H4FA 2XCFA 1QRZA 3MNXA 4NWKA 1ZMJA 1GI4A 1VKYA 2FODA 3RC6A 5EXMA 2ZCLP 2GMTB 2ZDKA 2AEIH 1QA0A 2FWWA 4WH8A 1K1MA 3UNSA 2FESH 1C1WH 3K6ZA 4CHAB 2ZFQH 3SUGA 4SGAE 1QBNA 2BTCE 4ABHA 1L1NA 1HJAB 1ZTLA 3KQEA 4WXVA 3VB4A 3CNRA 2ANWA 3BIUH 3M5LA 2D1JA 8ESTE 2Z3CA 1UCYH 3T26A 1TNIA 1GJ8B 2XOKD 2XNDD 2ODPA 2J97A 1FXYA 2V3OH 1BTHH 1YPHC 2WPIS 4LOYH 3EA9A 3RXGA 2OQUA 4ZMAH 2O8WA 2BVSH 2PGBB 2TIOA 1AUTC 2Z3DA 5LPEA 1HAGE 1AVWA 4Y8YA 1HAXB 1W11U 1XVMA 2ZCKP 3GCTF 1C5YB 1HIAB 2A2XH 1SGFA 4OGYA 1RTFB 4F48B 1ZPZA 3FZDA 4IC6A 3RXKA 3SV6A 1RRKA 2JDID 2ILNA 1WTHD 1SR5C 2BLVA 4UD9H 3RU4E 3PV4A 1IQKA 1L2EA 1GJ7B 3E0PB 3Q77A 3MO9A 2B8OH 1PPEE 3ATIA 1O2SA 4YOGA 1SMFE 2RDEA 1C1PA 1LDTT 1E0FD 3DD2H 1P02A 3S0NA 4B6FA 4AB9A 5T6FA 1UTQA 2J98B 3FP6E 2BDBA 2VGCC 3LT3A 4AFZA 3B9FH 1O3KA 1FY8E 1Z7KA 1G3BA 1NZQH 2ZU1A 2OC0A 1YKTA 1P06A 2EQNA 5JB9S 1JXPA 1F5KU 1NRQH 4JYTA 3W95A 3C27B 1OSSA 1ZHRA 3U8TH 4Y76A 2A7HA 1CA8B 3ZZ9A 5LPRA 4DURA 1TMBH 2GMTC 3T25A 2QXJA 1KTTB 1TNGA 1O33A 1YLDA 1XX9A 4MNWA 3MNBA 3RXHA 1TE0A 1EPTA 5J4SA 1TNJA 1NFYA 3SUDA 3RLWH 3RMMH 1S6HA 3BTQE 3OE7D 3LH3A 3N7DA 1SBWA 1V2ST 1HJAC 1B5GH 2XBXA 1O32A 1D3TB 3M5OA 1DX5M 4K69A 3TH4H 2QY0B 4GVUA 1GBFA 1TMUH 3H7TA 3DUXH 1KLTA 1GBBA 1SLVB 3PMBB 4AFSA 2H9EH 4NG9H 4ABDA 1TGNA 4Z0KA 3VXFH 3OX7U 3VGCB 1J17T 2QE7D 1O2JA 4CBOA 1BUIA 3OYPA 1ZSLA 1K1NA 3GCTG 3QK1A 1S82A 2F9PA 1T8LA 1GBDA 2TGAA 3GYMA 1O2IA 4Z1MD 2XBWA 3HK6B 1A5IA 5T6DA 3R3GB 2VVUA 3FP7E 5JDUB 3UREA 1DLEA 5JBAS 1WAYB 2O9QA 4RKJB 1FUJA 4Q7XA 3UAIC 3ZZCA 2BOHB 3FVFB 1SGIB 4IMZA 4ACAA 1BHXB 1A4WH 2BXUH 4MG3A 3TH2H 1WOFA 4JYVH 2BD4A 1HAZB 1S6LA 2EI7A 2TBSA 3ZVGA 2HALA 2G5VA 3PTNA 1W7GH 2BLOA 1ID5H 1QGFA 5GPIB 1MD8A 3FO8D 1BMFD 3OTPA 4GUXA 1TX8A 4U30A 3UOPA 4JK6A 4IMQA 1QBOA 3EGKH 1FAXA 2NU0E 3P8FA 1O3AA 3B8JA 3RXUA 3NCLA 1G2LA 3KQ5A 3MMGA 2H2ZA 3PLBA 4OS1A 3FOAA 4X6PA 2BD3A 2F9BH 1HRTH 4MPWA 4Q4LA 7GCHG 3TLOA 1IQGA 3SNBA 1OP2A 1UTPA 4FU8A 1FY5A 2OCVB 1LVBA 3B23B 5EIYA 2G81E 2QYIA 1V2RT 1T32A 2ZGXH 2WZQA 4AC9A 2GP9B 1AQ7A 1TOCB 2ALVA 1SGYE 4MNXA 4X6NA 4B2CA 2BD8A 1RXPA 5EODA 3SU1A 1GGDB 1EZXC 2KZ4A 1GHYH 4R0IA 3VG8A 1XXFA 4ZH8A 3A87A 2ZQ1A 4B75A 1O31A 3LH1A 1CGIE 3M35A 4H6SB 2RA0A 3SHAH 4AYYB 5L30H 1PPHE 1P10A 5AF9H 1LHFH 2R0LA 1MKXH 3VGCC 5DSFA 1VZQH 3A8AA 1O3CA 2D26C 4E7RG 1SLUB 5HIYA 1AE5A 2ZU3A 3SZNA 4DVAU 1YPEH 1K22H 1Y3VA 5H4IB 1P12E 1A1RA 1GJDB 1NROH 1CHGA 2J94A 4UFFH 5F8ZA 1GJCB 3A85A 1GI8B 1C5ZB 1ELGA 1ELEE 1AE8H 3RU4D 1YPMH 3GY4A 1LPKB 3MH4A 1VJ9U 2QAAA 2F9NA 4X6OA 2GCHF 4DIIH 1HPGA 2FX6A 5FAHA 1NC6A 5E0GA 3RXDA 2Z9IA 3SGBE 3GICB 2VVVA 1IQHA 5DP4A 5LGOA 1O2TA 3QTVH 1KLIH 1HYLA 2OP9A 2R3YA 1AZZA 4LK4A 5DP6A 2OTVA 1TRNA 2G55A 3NXPA 1O3MA 3Q3XA 1GJ9B 2O8LA 3LC5A 4OS5A 1V2JT 1KYNA 1DXWA 4YXWD 1UMAH 1EFRD 2IJOB 2VIDA 4YO9A 3D65E 1MZDA 1DVAH 1ZRBA 3MU0A 1MABB 2ZU2A 3L3TA 5F03A 1LHEH 1WSSH 2BY6X 4Y0YE 3A80A 1SG8B 3E1XB 2WV9A 3F2HA 3SBKA 4Y11E 1KXAA 2LP6A 2WV4A 2DUCA 5L2ZH 3A7XA 2WV5A 1LVYA 3M7TA 1BZXE 1CA0C 1EPTB 3ZVCA 1LKAA 2CF9H 4NGAH 2BX4A 1KDQA 4J1YA 1F0UA 1JMOH 2Y82A 4NWLA 2XC0A 1EQ9A 1O3NA 2J38A 2C93B 1SHHB 1DOJA 4Y0ZE 2BQWB 4ISIH 3UQOA 3H09A 4SGBE 1O2HA 3UB0A 1HBTH 2BHGA 1E35B 1BQYA 1GGDC 2J92A 3BTGE 1CO7E 4KTUA 3PMHB 2K1QA 4WY3A 4GHTA 3RUOA 1ESAA 4O3UA 3SQEE 1KY9A 1KSNA 1P05A 1WDIA 1YWUA 3IG6B 2NU3E 3LGTA 1ZRKA 1OWJA 1YPHE 1O2LA 3SZEA 3PMAB 2GCHG 2J34A 2CMYA 3K65B 1N6XA 2GJGA 1A0JA 2LNCA 1EJAA 2GVFA 2BQ7B 3PV2A 1FX0B 4TWWA 1TOMH 3SNAA 3UWIA 1C5MD 1QQUA 4I8GA 1DFPA 1JRSA 1O5BB 3ELAH 2A4RA 1LPGB 1MCTA 2FOBA 1TBRH 1PQ8A 3ZZ3A 1QIXB 4FETA 1EKBB 1A5HA 2PTCE 4ABFA 5EJZA 2ZIQH 1W12U 3V13A 4ZKRU 2FS9A 4NIXA 4U2WA 3TITA 1O2PA 5A2MH 3I78A 2GTBA 1YPKH 4I86A 2A2QH 3A89A 1C1UH 2HRVA 2QN5T 5FL7D 4YOJA 1UTOA 4JZEH 2WUBA 3A81A 2A5KA 2H9HA 1L0ZA 4ISNA 3SNEA 3MYWA 2A45B 1Y3UA 1GHBF 1DWEH 2UUYA 3ZZ4A 2VIOA 1M9UA 2QF5A 1CQQA 1EPTC 4CRBA 1HCGA 1PQ5A 1COWD 4DGJA 1F5LA 1KMHB 3U9AH 4FVBA 3DSPA 3A88A 3DA9B 1TYNA 1O37A 1E34B 4MTBA 2G51A 4XBBA 4MDSA 1Z71A 2AH4X 3PRDA 4DW2U 4AFUA 1ANDA 1AFEH 2AMDA 5IYTA 3ZYDA 3SU4A 4TT3D 3WWFA 4DIHH 1V2TT 2R2WU 1GI0A 1O0DH 1FPHH 1K28D 1YGCH 1UVTH 2R2MB 1Z6EA 8KME2 1BT7A 1YYY1 4FUJA 4Y6DA 3CP7A 2FOAA 4X2YA 1ZTJA 4CRCA 2B5TB 2BYAX 2GV7A 2BB4A 1RFNA 4XSKU 5DP9A 2BDAA 1OOKB 4ZUHA 1ZHPA 1P3CA 1QJ7B 1A0HB 1N1LA 2HNTC 1A2CH 1OYQA 1HDTH 2VIVA 3MFJA 1L1GA 2FI3E 1Z8IB 1C4V2 3BN9A 2WYJA 3MH7A 1QFKH 1NT1A 2ZFSA 1MD7A 1UHBA 1QL9A 1O2YA 1TNKA 3E3TA 4OS7A 1O3BA 1P0SH 1VJAU 4VGCB 5B6OA 2ASUB 4AB8A 2NU4E 1NO9H 1RIWC 2ZFFH 1BJVA 2SGEE 3TNTA 1P01A 1Z8RA 4CRFA 3ATWA 1W0JD 3TK6A 3T5FH 1EOJA 1AKSA 5FPTA 4BANB 3O8BA 2PLXA 1MQ6A 2XCNA 1EAIA 1AB9C 1GHBG 1NFXA 4NA7A 1T8NA 2J4IA 2ZZUH 3N7EA 1TPAE 3A7TA 1TA2A 1P9UA 1K21H 3ZZ8A 1C5PA 3QO6A 1KDQB 1GHWH 2ZTYA 3M7QA 3PTBA 3OFND 4UFDH 3ZVBA 4HI3A 1C2LA 4J2YB 2I6QA 3LJJA 5DG6A 1JRTA 4E7NA 1A61H 1B7XB 3KF2A 3URCA 2R3UA 4WMDA 3AK5A 3VEQB 1W10U 3HKJB 1BBRH 3AVZA 4IN1A 3V7TA 2EEKA 1W7XH 3A8CA 1C5NH 5TCAA 1QR3E 1HAVA 1O2OA 3UWJH 2C90B 1GBMA 4ACBA 6ESTA 1Y5UT 4YLQH 4ABAA 1SOTA 2VJ1A 2TGPZ 1IQIA 4X1RU 4MQAA 3MU4A 1IHSH 4B74A 4XBDA 3CS0A 1OPHB 3MNSA 3KHVA 3ZZDA 2QIQA 2QA9E 2RG3A 1P2IA 1TMTH 2FOEA 1BB0B 2ZNKH 4K1TA 6CHAB 1F2SE 3U8OH 1P2QA 5EW1H 1SQRA 1MTSA 3MU1A 1T4UH 4ESTE 1EASA 2GDEH 2VH0A 3V0XA 1TWXB 5E0HA 1AGJA 1C5SA 3RXTA 5C67A 4CH2B 4Y10E 3ENSB 4GAWA 1T8OA 1SOZA 4X8TH 4KTCA 2QF4A 2Y7XA 1UK3A 2VWOA 1C5TA 4OGXA 3EYDA 1UCYK 4VGCC 3UTUH 1EP5A 1GJ6A 4TPIZ 2ZDAH 1SI5H 4WWYA 1FNIA 1VR1H 2YMSC 2UUKB 3A86A 3SHCH 1EP6A 3MTYA 1TONA 3AW1A 3BTKE 3UOUA 1O3OA 1C5RA 2P95A 1TBZH 2F3CE 1UW7A 1KXCA 3P8NA 5FX6A 2IPHA 4Q7YA 4QT8C 1AUJA 5EW2H 1NFUA 1ZR0A 4JZIA 4M9FA 1UCYE 1ZMNA 4K1EA 2W7SA 2UUJB 3H7OA 1KIGH 3T28A 4NA9H 1CT4E 3Q3KA 2AFQB 1ZHMA 3F1SB 5C5OA 1F0SA 4AZ2B 1MBMA 1P11E 2LPRA 2P93A 3RXFA 3T2NA 4IS5A 4ABJA 3EA7A 2KX4A 1ELDE 4U01A 1QURH 1OWIA 1QL7A 2IJD1 1WBGB 1NN6A 1TX7A 2OLGA 1TPOA 4FUGA 4A1VA 1P2JA 4X1SU 2C3SA 4JMYA 3A8DA 4BTUB 7KMEH 1HB0B 3SU2A 1EAXA 2XXLA 2K8IA 3VPKA 1D6WA 1RGQA 1IAUA 1TBQH 2HVYB 1ARBA 2FXRA 3ZVEA 1HJ8A 1H9LB 2SNWA 2VWLA 1E38B 3NZIA 3STJA 2BD2A 1O5AB 5FBIA 1PJPA 1JBUH 2FI4E 6CHAC 1LVOA 4K60A 1C1SA 3SNDA 4DY7B 4ABBA 3GDUA 2C8YB 1HGTH 4UFEH 1YPLH 3UNRA 1NTPA 3M61U 3U1IB 3VB5A 2FOMB 1UTLM 1GI7B 3ZVFA 1UHBB 2XTTB 1F7ZA 5A09A 1GHZA 1Y3WA 4WMFA 1FZZA 3LDXH 5ESBA 3GY8A 3KYFA 5JBCS 3E0NB 4GSOA 2AGGX 1W2KH 2ZFPH 1KXDA 1ABJH 4ZHAA 4RT0A 1C2JA 2BX3A 1O2MA 2C8ZB 1DUEA 1HFDA 1QA7A 2Z6BD 2ODQA 4ABGA 1EZQA 4CR9A 1MCVA 2BY9X 1CHOF 1C5OH 1H4WA 2RDLA 3RXBA 1TGTA 1SC8U 3Q76A 3DSGA 1MTNB 3UIRA 2BY5X 5FCRA 2V3MA 4D9QA 1QQ4A 1C1TA 5PTPA 4NIVA 3PWBA 3F9FA 3ATMA 1XVOA 2OD3B 3F2GA 5GDSH 1UO6A 1IQJA 4I8JA 1NFWA 4DCDA 1SGRE 1LQDB 3A84A 5EG4A 5CHBA 4AGKA 1RTLA 1HAVB 2M5TA 3BTDE 3NPSA 3DSOA 2P8OB 2O8UA 3GCOA 3QTOH 5SGAE 1RD3B 1SQOA 2PGQB 2A4QA 2Q6FA 1CBWB 3S7KB 4NCYA 1TLDA 3SQHE 1FONA 5DGJA 1FN8A 3PO1B 1THRH 4MNVA 1LHCH 4Q2KA 4CRGA 1G3DA 3BEIB 3HGNA 5E2PA 1H1BA 3KN2A 1SB1H 1U6QA 2JH5D 3BF6H 3KL6A 4K3JA 3BIVH 3RXCA 2G52A 5EU8A 1HXFH 2FMJA 1BITA 1GI2A 2WPMS 3A7WA 3GCHB 4RKOB 3JZ1B 3SU5A 1A3EH 9LPRA 1GVLA 5GIBA 2PUXB 1VCQA 3RM2H 4D7FA 3MNCA 2TGTA 3SUFA 2HNTE 4AORA 2H5CA 2ZGJA 2Y81A 7ESTE 1DPOA 2ZPRA 4WXIA 1EOLA 1C1NA 3SOSA 3TPIZ 3OEHD 1GBCA 2JH6D 1CA0B 2BQ6B 3I29A 4GCHF 4XE4A 5LH8A 4Y8XA 1CHOG 2A7JA 1EATA 1MKXK 4JCNA 4INKA 1O36A 2ANMH 1ELVA 2FZZA 3MU5A 4FUEA 3QWCH 2WPLS 2WINI 1EB1H 1O2NA 1SVPA 3D49H 3GY2A 2B7DH 1MTNC 3M7UA 1EJNA 6GCHF 1NRRH 3PLPA 1C2FA 2WPKS 1IQLA 3SGAE 3QZQA 5F6MA 1W3CA 2OBOA 3U98H 4FVDA 1C4Y2 3T29A 4B76A 1O2KA 1J8AA 1SGNE 1BRBE 1FIZA 3GISB 8LPRA 3NUMA 4F49A 4ZXXH 2TGDA 1S81A 1QB9A 2AMQA 4X2WA 1T7CA 1FPCH 1XUHA 2ZHWH 4X1PU 5C1YA 2ZTXA 4ZAEA 5DO4H 2BD7A 5HXFA 5KEDA 1C2KA 1Z1JA 4OM9A 3TH3H 3W1EA 5ESTE 4MVNA 3W94A 2WPDD 3DHKH 3KCGH 2QF3A 1YM0A 4BAOB 1O2UA 2P8OC 5FX5A 1KXBA 1CBWC 2BLWA 4I31A 1QTFA 4AN7A 4NIYA 3PO1C 2VH6A
chains in the Genus database with same CATH topology
2W26A 5EOKA 5FPYA 2ZP0H 3RXSA 1C5WB 3TGJE 3O8RA 2YNAA 3FZZA 4WJG2 2ZDVH 3EDXB 4FU7A 1CGHA 1HJ9A 3BEFB 2SGDE 4I8LA 3RC4A 3GCHC 1VGCB 1QBVH 1BTXA 1GBKA 2PSYA 2JH0D 2ZGCA 1P2MA 2VIWA 1ZSKA 1OXGA 4E06H 1YBWA 5DP3A 1FDPA 4OS6A 1BMAA 4YT6H 5GXPA 2VB0A 5HM2A 4O97A 4GCHG 2OC7A 1G32B 3PM3A 2A7CA 4FUBA 2PW8H 4FUCA 1ESBA 1HAIH 4Y7BA 3RXOA 1QL8A 1C5XB 2C4FH 1XKAC 4NIWA 5TJXA 1C1MA 1C2GA 2AIQA 2NU1E 3UR6A 2W3KA 1W0YH 1BCUH 1DUAA 2P16A 1ZZZA 2FIRH 6GCHG 3OU0A 7LPRA 1V2LT 1SQAA 1OWKA 1O5DH 1BMNH 1GHVH 1ZGIA 1L1JA 2P94A 5ETXA 1DWCH 1OYTH 2VVCA 1RS0A 3E16B 4HFPB 3AW0A 4MLFB 4INLA 1XUKA 1LVMA 1P2NA 2Z9LA 5G4BA 5JYIA 1QCPA 4RSPA 3VXEH 4KP0A 2EI6A 5E0JA 1GVZA 1D6RA 2CN0H 3M3TA 1TABE 1D3PB 4OS2A 3N7OA 3L33A 2A4OA 2A4GA 1O3LA 3ZVDA 3SGQE 1PQAA 2VWMA 1JOUB 3TVJB 1MTWA 1NESE 1FY1A 1QJ1B 1NU9A 2OXSA 9ESTA 1ABIH 4GLYA 1UJ1A 1J14A 2Y5FA 2XC4A 3ZZBA 2JETB 1MKWH 1CGJE 2GZ9A 4ZKSU 3E90B 1KXEA 1CT2E 3BTFE 3BTHE 3LOXA 2ZU4A 2A5IA 1AMHA 3LJOA 5AFYH 3TNSA 1EX3A 1GHAF 1VGCC 1ZGVA 1RIWB 4X6MA 2C8WB 1SGDE 4IW4E 1K1IA 1WTGH 1UVUH 3BG8A 1AWFH 1WV7H 5L6NH 1YP9A 1TQ0B 1NY22 1K1LA 1AB9B 2Z7FE 1AVGH 3K9XB 4O3TA 1T31A 4X8SH 4DT7B 1DSTA 2FOGA 1LKBA 1FAKH 5ABWA 3SV7A 1UK2A 4X0WU 2IN2A 1BTZA 1ETSH 2ZEBA 1BTUA 1V6DA 2BZAA 4D76A 2CGAA 2AYWA 1PPCE 3T62A 1GMCF 1H8DH 5HGGA 1TAWA 2BDHA 2Z3EA 4Q80A 1L4DA 4HTCH 1ANEA 1P04A 2SGAA 4K8BA 4CREA 4DJZB 3QUMP 1GHXH 5C1UA 2Z9GA 3FANA 4JZFH 5E8EH 4BAMB 1O30A 2ZGBH 2G4UA 4FUHA 3BEUA 4I8HA 2GDDA 1MU6B 4WF8A 1VITF 3DT0H 1C2HA 1H8IH 3WY8A 1O2RA 2XYAA 3KGPA 3S9BA 2CXVA 1SGTA 4BAQB 2ZFTA 1N6YA 1Y8TA 1DY8A 3F6UH 4ZKNU 2FS8A 3H5CB 3VB3A 1O2ZA 4XBCA 5AFZH 4ISHH 1W0ZU 5GJ4B 2UWLA 3U1JB 2CHAB 5EQQA 3AAVA 2FYRA 5EXLA 3T27A 2XC5A 1OKXA 3LPRA 5EPYA 2AMPA 4TPYA 1PFXC 1YCPH 2FYQA 4BNRA 3LGYA 2JETC 3O8CA 2PSXA 2GZ7A 1P57B 4IN2A 1MUEB 1O5FH 1NRNH 1DANH 1GWAA 4YLUA 4O9VA 3RXLA 1K9OE 1BRUP 3C1KA 4BTTB 4Y71A 4PROA 1GHAG 2FLBH 2GGVB 1BRAA 4B2AA 1V2QT 1C9PA 1WU1A 1O5CB 5BRRE 4Y8ZA 2WUCA 3M36A 1OP0A 1O2GH 1ZJDA 3SU6A 3IWMA 3SU3A 2NWNA 3SUEA 5F8TA 3ZZ7A 4AX9H 2FP7B 1CU1A 1BBRK 3FFGA 1T8MA 2QV1A 3BTTE 4X1QU 1PQ7A 4ISOA 3RP2A 1W14U 2I6SA 1GMCG 1ZOMA 1DWBH 2GKVE 1AU8A 3MI4A 1G37A 3K2UA 3MWIU 3D62A 3S9CA 1G3CA 3MO3A 1ARCA 3V3MA 2XRCA 2FDAA 4YM9A 1GBAA 2OC8A 3FAOA 2HVXA 1Y5AT 4HZHA 1VITG 3ITIA 1G30B 5I46H 3I77A 1BBRE 3PYHA 1NRPH 3E8LA 4BAKB 1B0FA 1DM4B 3TGIE 3U8RH 1GJ5H 1J9CH 1GI5A 2PKAA 3PMJA 2R0KA 3LU9B 2ZFRH 4ZHMU 3TIUA 3HGPA 3P92A 4WMEA 1SL3A 3RLYH 4Y7AA 1N8OB 1ANCA 3QGNB 4A92A 2ZHDA 1H9IE 3NK8A 1AD8H 1HXEH 1GJ4H 1AI8H 2CHAC 4OS4A 2BVXH 1BMMH 1G2MA 1MBQA 1O3GA 1O2WA 1FY4A 5A8XA 3AAUA 2ALPA 1FIWA 1IQEA 1BDAA 4XFQA 1X7AC 3EAJA 4RN6A 1Q3XA 2CF8H 1DICA 1V2NT 1BOQA 1LO6A 1BA8B 1XKBC 3PLKA 5CMXH 2G5NA 1O3IA 1O2QA 1SSXA 5C5NA 3OY5U 1PYTC 2A31A 1O39A 1CVWH 3SORA 3BTWE 2BDCA 4JZ1A 4AOQA 4FXGH 1O3EA 5A0CA 1A7SA 1MQ5A 1NS3A 5DJ7A 1TALA 3AASA 2ZPSA 1UK4A 1Y59T 3L6PA 1S85A 1O38A 4O03A 1B0EA 3VFEA 8GCHF 4ABEA 1EAUA 2J95A 1ANBA 1GDNA 1ZLRA 1MZAA 4KGAA 2V35A 3KNXA 3VB6A 1W8BH 1AO5A 1V2PT 1HAHH 3RMOH 5FCKA 3NKKA 2F9VA 5FBEA 1MMJN 2A5AA 5FPSA 1GBIA 1JIRA 2A32A 1C5LH 3ODDA 1O3FA 5HM9A 1O35A 1T4VH 4AYVB 3SV9A 4FUIA 1AHTH 1HAYB 1HV7A 4A7IB 4FUFA 5A8ZA 1A46H 2GX4A 2PTNA 1XUJA 3EA8A 1BTPA 1QB6A 5K0HA 2ZGHA 1SGQE 1BTWA 1XUIA 1GMHF 1GBLA 2XWAA 1LMWB 4Q7ZA 2DE8A 1S0QA 3TJOA 1EZUC 1C1OA 1KTSB 2ZHQH 3D23A 5C3NA 1N8OC 4ABIA 4IGDA 1CE5A 1O3JA 3M37A 2Y7ZA 4BOHA 2QC2A 3STIA 1GI9B 3ZV9A 1SGPE 4YT7H 3EE0B 1LPZB 2V3HH 2ZCHP 4BTIB 1SGCA 1A3BH 1VITH 1QB1A 2ZHFH 3M3SA 1THSH 1YCPM 4WVPE 1SFQB 2C8XB 1C1QA 1S0RA 2SGPE 1S6FA 2D8WA 1C5UA 2BDGA 2FTMA 1YC0A 2ANKH 2SFAA 1WUNH 5CE1A 4BXWA 1P8VC 3R0FA 4YZUA 2YOLA 2ODYB 1OWHA 2ZTZA 1S83A 1O3HA 2GD4B 1WQSA 1D3QB 4CBNA 1UTJA 2Q1JA 2ZDMA 4DOQA 1C2EA 2DE9A 2W5EA 2ZHEH 3RXPA 1AKSB 4UDWH 8GCHG 4YOIA 3TK9A 2G8TA 2HLCA 4FU9A 4WH6A 1SLXB 2F91A 1Z8GA 2Y80A 3MU8A 1AY6H 4TWYA 1TX6A 4NSVA 1NRSH 1GI3A 3ZVAA 1V2WT 3F9EA 1TGBA 4JK5A 3A83A 3Q00A 5EGMA 2FX4A 4E05H 1HLTH 1C4U2 7GCHF 3OSYA 3BG4B 3FP8E 2H6MA 1ETTH 1EUFA 2FLRH 2W7UA 3LGUA 4CHAC 3GY5A 4Z6AH 1TFXA 1P3EA 3M3VA 3MOCA 2YNBA 2AGIX 1FJSA 1ESTA 1QRXA 3S7HB 1GMHG 2J2UA 2OUAA 5A0BA 1UTNA 4MPUA 3A7VA 4JZDH 1INCA 2PKAB 2STAE 1BIOA 5A8YA 2F83A 4B73A 1LCYA 1GBEA 2GT7A 1C2DA 3LKWA 5AHGH 1TGSZ 5DP5A 3URDA 2STBE 1V2VT 3SJOA 2FOHA 1GL0E 1O2XA 1EJMA 2PV9B 3E91A 1C1RA 3CENA 2QF0A 3HATH 2G00A 1LTOA 1DT2A 4K2YA 4NZQA 2BDIA 2OC1A 3RXAA 4CRDA 1P2OA 3QGJA 2Q6DA 1GMDF 2J9NA 4K8YA 1V2KT 4AG1A 2ZA5A 3LGIA 3LGWA 4H6TA 1LQEA 4NFFA 1F0TA 3RXQA 5K7RA 3BV9B 1MH0A 4AFQA 1F92A 3KEEA 5EXNA 2FOCA 1KLJH 2BVRH 2EA3A 1THPB 1G3EA 3F68H 3MHWU 3GYLB 4D9RA 1ZPBA 1C5QA 2VNTA 2XNIA 3KQBA 1GJBB 1FLEE 2VU8E 2P3FH 1YLCA 1IQMA 3BSQA 2H5DA 4YTAA 2SGFE 4I8KA 3RU4T 2ZDLA 1E37B 4NA8A 1ACBE 4TYDA 3RM0H 3V12A 3QZRA 4UE7H 2UWOA 4U32A 1D9IA 1Q2WA 2Z9KA 1DLKB 2PKSB 4JYUH 1Q31A 3PWCA 3BG4C 3UR9A 1DE7H 4KTSA 1GDQA 2NU2E 2QXHA 3ZZ6A 1UVSH 4H42U 1XM1A 1FQ3A 1HAPH 1MAXA 3PROA 1NPMA 3M5MA 1DDJA 1QRWA 3VB7A 1J16A 1C5VA 3SN8A 1C2MA 1EB2A 4XDEA 1Z8JB 4ZHLU 2PFEA 2HGTH 3ZZ5A 2PR3A 1PPZA 4CR5A 1P03A 3BTEE 3GY7A 3LONA 1MTUA 2ZDNA 1QJ6B 1QHRB 3GCNA 1ORFA 1GMDG 1GL1A 1CT0E 1LHDH 4B2BA 5EPNA 5DPAA 2F9UA 1OWEA 4ZXYH 1S84A 1D4PB 2P59A 3JZ2B 3OTJE 3TK5A 2FPZA 2H1UA 5T6GA 2P3UB 1ELTA 2VIQA 3HPTB 2H9TH 1ETRH 3Q3YA 1IQNA 1K1OA 2O8TA 2ZPQA 3ZZAA 5AVDA 1GBHA 5J4QA 2BXTH 1ZYOA 2O8MA 5A0AE 4ISLA 3MH6A 2PWXA 1BMLA 2HPQH 2Q6GA 3GDSA 5DK1A 2TPIZ 2VIPA 3PB1E 2AS9A 1SQTA 1SHYA 2XWBI 1IHTH 4I32A 1AVXA 1A0LA 1SLWB 1F0RA 4ZKOU 5IDKA 4UONA 1TGCA 5CHAB 4A6LA 3MH5A 1OWDA 4KKDA 4BAHB 1Y3YA 2KAIA 4ZROA 1O2VA 5DKMA 1TPSA 3GY6A 1UTKA 5FXLA 1JWTA 3U69H 1HUTH 3BTME 1FN6A 1UTMA 1IQFA 1GJAB 3RC5A 3TJUA 2IOTA 1ZPCA 1DITH 1FY3A 1GCTB 1LHGH 2PKSC 1GI6A 2UWPA 2ZC9H 3O8DA 1OX1A 2JKHA 1UVOA 1MKWK 2XW9A 5DP8A 1FMGA 2B0FA 2GT8A 2ZQ2A 1OS8A 3SV2H 1ELFA 1D3DB 1ELAA 3QLPH 3ZYEA 1BJUA 3A7YA 4GPGA 1PPGE 2SNVA 1O5EH 5JBBS 1AWHB 3F9GA 4IBLH 3E6PH 3QX5H 4LZ1H 2ZI2H 2XBYA 1BHXF 1GDUA 1DSUA 3OY6U 5FHTA 2BD5A 4MPVA 4Y79A 1HAOH 2V0BA 4LZ4B 3P17H 1GPZA 1KXFA 4BXSA 1O3PB 2Z94A 2ESTE 1L4ZA 2ZECA 5GCHF 2GZ8A 2PHBA 2F9OA 5JBTA 2W3IA 2QXIA 3ESTA 1SGEE 4HGCA 1TNHA 1WQVH 2BD9A 4CRAA 3S69A 1P2KA 2HPPH 3UFAA 1AFQB 1XUFA 2AERH 2ZWLH 3QDZB 4X1NU 4I7YH 5I25A 1YPGH 3RXJA 1V2UT 3SO3A 1V3XA 1F5RA 1ZTKA 3RXRA 3LGVA 3CS7A 3TJVA 2PUQH 1MAYA 2P3TB 1SFIA 3UNQA 2BOKA 1QY6A 3HK3B 2XBVA 4GHQA 4MNYA 3TGKE 1WYKA 4X2XA 3UY9A 3SJ8A 2QXGA 4KELA 3UQVA 2BM2A 1PPFE 1PPBH 2D2DA 1G9IE 2R9PA 1RTKA 5CHAC 3ATLA 3GY3A 2ZF0H 1VCPA 3TJNA 4XOJA 1G36A 5GWZA 5BPEA 1BRCE 1MTVA 4D7GA 2ZU5A 3SJKA 1J15A 6LPRA 1W13U 2ULLA 1A5GH 5HMAA 3A7ZA 4AGJA 1TIOA 1S5SA 3SJIA 1XMNB 3SW2B 1RJXB 1GCTC 2BLQA 4MPXA 1EXFA 1QNJA 1YCPK 3ATKA 2VWNA 1O34A 2WYGA 3ZV8A 4X8UH 2FTLE 4IC5A 2OBQA 3IITA 1ELBA 1ZSJA 3P95A 5JB8S 1AN1E 1YF4A 4R8TB 2EC9H 2OQ5A 3DFLA 1WCZA 1HIAA 1TA6A 3A8BA 4UFGH 3RMNH 3SI3H 4I33A 5TCCA 2ZO3H 2HOBA 5GCHG 5EQRA 5E2OA 2WPHS 3HKIB 5C20A 1DS2E 1CSOE 1P09A 2B9LA 2BZ6H 2SGQE 1C2IA 1SPJA 3SI4H 1K2I1 1EAWA 2QCYA 1NU7B 2A1DB 2GCTB 2VINA 1GG6B 4TY7A 1ZMLA 1OP8A 4F4OC 2CJIA 2ZKSA 1XUGA 1GI1A 1DWDH 4DG4A 4X2VA 1AFQC 2RA3A 4K1SA 2BDYA 2A0QB 3LIWA 4THNH 1O3DA 1TQ7B 3MO6A 3RXIA 3UPEA 2FI5E 4A1XA 2AGEX 2BY8X 2OINA 1ELCA 1GBJA 1VCWA 3A82A 1UVPA 4ASHA 1AZ8A 1IOEA 2G4TA 3P8GA 1TRYA 1Z6JH 1E36B 4D8NA 3G01A 3S9AA 3P6ZB 1PYTD 1YPJH 1MU8B 3GDVA 1H9HE 1P9SA 2RCEA 3EQ0H 4NSYA 1DXPA 4INHA 3RDZA 5L2YH 4UEHH 4B1TA 2KAIB 5F8XA 5C2ZA 1DY9A 5JPMH 4A5TS 1AIXH 2BMGB 2Y6TA 2Y5GA 2BY7X 3RXEA 3DFJA 4NFEA 3M5NA 3ODFA 2HWLB 2Y5HA 2QGRA 4X8VH 2EI8A 1XXDA 3P8OA 2WPJS 3NWUA 1C9TA 3SJ9A 1TNLA 1GBTA 1Z1IA 1JIMA 1GCDA 3RXMA 2THFB 3GOVB 2Z9JA 1SGFG 4FUDA 3UUZA 4K5ZA 2FO9A 3F9HA 3RXVA 1C1VH 2FM2A 2FOFA 4B71A 1FI8A 2TRMA 1O5GH 3QN7A 3RMLH 3K6YA 3KQDA 1K1PA 1V2MT 3P70B 2HNTF 4M7GA 2ZG0H 1K1JA 1NM6A 1TPPA 4YESB 1V2OT 3TU7H 1FV9A 1GVKB 3LC3A