1YLDA

Trypsin/bpti complex mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDAGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin II
publication title Partially folded bovine pancreatic trypsin inhibitor analogues attain fully native structures when co-crystallized with S195A rat trypsin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/inhibitor
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yldA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yldA02
1QQ4A 3SHAH 3TGIE 3IG6B 4H4FA 3HK3B 5AHGH 2XBWA 3SO3A 1YC0A 1HIAA 1GMHG 1ELAA 2VWMA 4OS5A 1YKTA 2F9BH 1AFEH 1W8BH 1XMNB 5J4SA 1PYTC 2PKSC 4X6OA 1KXEA 2BDCA 1SGIB 1NFUA 1UTJA 5DP9A 4B74A 2BDIA 3QK1A 1THSH 2HOBA 4HZHA 2KAIB 2UWPA 2ZDMA 4Y8ZA 1F0UA 4ISOA 3PMJA 3F9HA 2BY6X 5F8ZA 3URDA 1YF4A 1UCYE 3I78A 3AAUA 2Y5FA 1GHZA 3MYWA 1AUJA 3RLYH 3GY6A 3VB5A 5JYIA 2OC8A 4A1XA 1JRTA 1HJ9A 1O5DH 2WPIS 5C1YA 4AOQA 3PMHB 4X1NU 1O3JA 1WTHD 3P70B 1TBQH 4IGDA 2FYQA 1GG6C 4DOQA 2BD3A 1EOLA 1G36A 2WPMS 1N6YA 2QIQA 1UVOA 4YOGA 2FOBA 2VIWA 2AMPA 1O5BB 1MTNC 1A5GH 1VJAU 1DVAH 1DWBH 1S6HA 3KQCA 3A85A 2UWLA 3ZVBA 5GWZA 2A7HA 5JBTA 3MU4A 1AO5A 2ODYB 3L33A 3PTBA 4TY7A 5PTPA 1BTYA 2GV7A 3SJOA 1GI0A 3ZV8A 3LKWA 3A80A 4K8YA 1Q3XA 1BOQA 2WUCA 1V2ST 3SI4H 1O38A 2P3FH 1Q2WA 1DS2E 3SU1A 1BRCE 2AIQA 1EP5A 1XUGA 1ZYOA 7GCHG 1N6XA 3GCHB 3MH6A 3KQBA 4TYDA 1G32B 5JBBS 4YT6H 1FY8E 4K60A 4NWKA 2BD9A 4J2YB 1P0SH 1D4PB 5EW2H 3GYLB 4BXSA 1TGTA 5DP5A 2RCEA 1W0ZU 2OQ5A 1VCQA 3TITA 2V35A 2ZFSA 1GI6A 2ESTE 4CR9A 2BY8X 1Y3XA 1G3BA 1SG8B 2PSXA 1DANH 1AD8H 1AU8A 3UUZA 1V3XA 2RA0A 4CRGA 3GY5A 1BMMH 1XKAC 1ZGIA 4X1SU 5H4IB 3RXLA 1MKWK 2J2UA 1W7GH 4ISNA 3LGVA 5GIBA 2C8ZB 3RDZA 4ABGA 1RIWC 3KQEA 4JYTA 2HPQH 2Y7XA 2Z3CA 2H2ZA 2QY0B 1P03A 3P92A 3URCA 4ABAA 1ANBA 4WMFA 2GDEH 1IHSH 2BYAX 1P09A 3KGPA 5DGJA 2VWNA 3TK5A 2BLWA 4ESTE 2BOHB 2Z9GA 3PLKA 4K1SA 2BY7X 3SNEA 2EEKA 1EJNA 2FS8A 2IPHA 1YCPM 2P3UB 1W2KH 3GOVB 3RXHA 1TOCB 1TX6A 4AZ2B 1O3EA 3V12A 3SJ9A 1O2HA 4BOHA 1C5LH 1GVKB 3ESTA 3LH1A 3M3TA 1K9OE 1XX9A 3MH4A 1O3CA 2GZ7A 2G4TA 2PHBA 1LVMA 2FO9A 4RKJB 2AFQB 3VXEH 1GHBF 1TABE 1T32A 1DXPA 2ZHQH 3ZZBA 5A0BA 3UTUH 4NFFA 5A8YA 2BY5X 1BTUA 5I46H 2DUCA 2O8WA 3O8CA 1EZUC 2BD4A 3LC5A 1YPGH 1GMCF 1HFDA 1Z8JB 2OC7A 1GHAG 1KSNA 2ZU2A 3T26A 1P10A 1Y3YA 3BG4B 4Y10E 2OTVA 4XBCA 2FXRA 3G01A 1NY22 3F68H 3RXPA 4O97A 3A7XA 4WWYA 2FYRA 1C5YB 3A8AA 4ABEA 1F5LA 1K1PA 2JH6D 4YLQH 4HTCH 1ANCA 1K28D 1MBMA 2H9EH 2ILNA 3QUMP 1O3GA 3LGIA 3SN8A 1NFYA 2OCVB 1S6FA 3Q3YA 2D2DA 3DHKH 2F9UA 4M7GA 2FOGA 2BOKA 1PPEE 1GL0E 3SV9A 3UWIA 5GPIB 1AE5A 3NCLA 1J14A 2SGAA 4UONA 1THRH 4FVBA 1EPTA 1IAUA 4WVPE 4X8SH 2PUXB 6GCHG 6CHAB 1Y5BT 1O0DH 2Z9IA 3KL6A 1TE0A 5FAHA 4TWYA 3HGPA 2CF8H 3LGUA 1BCUH 4FUFA 4Z6AH 2XBVA 3M3SA 1BB0B 4FU8A 4VGCC 3JZ1B 3T25A 2FESH 3QLPH 1V2LT 2ZFPH 4OS4A 1NRNH 4JZDH 2A32A 3D62A 2NU3E 2Y82A 3UR9A 4WMDA 1GPZA 4TPIZ 1AZZA 1LHGH 1SFIA 3RMOH 3ZZ6A 3A8CA 1OKXA 3ATMA 1WSSH 3S69A 5GXPA 4MDSA 1M9UA 1QRZA 2D8WA 1HAGE 3SV6A 1C1QA 1SGCA 1UTKA 2ZDLA 4YZUA 3U8OH 3IITA 1FN6A 1PQ8A 2Q1JA 2Z6BD 1NN6A 1Z6JH 1P06A 2V6NA 3ZV9A 1HUTH 1G30B 1P2OA 3K6YA 4BAMB 3LPRA 2VGCB 1L1JA 1X7AC 1ZSKA 1GJDB 1O5GH 1C1UH 1N8OB 4I32A 1BUIA 4MQAA 1T8NA 1C5UA 2WPJS 3A88A 1QGFA 3PWCA 2FEQH 1GBAA 1C5RA 2ZF0H 1QB1A 1T31A 1QIXB 3MH5A 1ELTA 1KXFA 1TONA 1GCDA 2BDYA 4RN6A 2BVXH 1AQ7A 1INCA 4ZKOU 3BTEE 3GDSA 5A2MH 2OBQA 4CH2B 4WXVA 1F0RA 1DXWA 5L2ZH 3P8FA 3S7HB 2H9HA 3UQVA 2ZU5A 1TPPA 1MU8B 1SSXA 4QT8C 4FU7A 1GJ7B 2ZECA 1K1IA 1O3NA 1QL9A 1QTFA 1YGCH 1O2RA 3M37A 4KKDA 1EQ9A 4FXGH 2F91A 1O2XA 3B23B 1VJ9U 1JWTA 2P93A 4K1TA 3TJUA 3UFAA 1TRMA 1FI8A 1EAWA 1FJSA 1TGNA 1Z8GA 3FP8E 2SNWA 4CBNA 1BQYA 3SV7A 3UOUA 1VCPA 4DJZB 1JMOH 1Z8IB 3SNDA 1P9SA 1MAXA 1NZQH 2BLVA 4U01A 2V0BA 2K1QA 3BV9B 1EOJA 4ZXYH 3Q00A 3VPKA 1OYTH 3UNSA 2GGVB 3E91A 4CHAB 1CQQA 2OP9A 1FZZA 2SNVA 3AAVA 3H7TA 5FPTA 4THNH 1OYQA 1MMJN 1WOFA 1T4UH 3MNSA 1EZQA 1TGBA 3ZVEA 1OP0A 1GI7B 1ZTKA 1GHWH 3L3TA 2ZG0H 1LPZB 3H5CB 1DFPA 1P02A 4DVAU 3K9XB 3TK9A 1GBDA 3CP7A 1T7CA 1BHXF 1GBBA 3F6UH 1XXDA 4A6LA 3Q3KA 1HAHH 1JOUB 3H7OA 1QBNA 1QURH 2FOHA 4OGYA 1XUJA 1GJ6A 1S81A 3A7TA 2G4UA 2Y80A 2W7SA 2A7CA 2VB0A 5DP7A 1W13U 1BRAA 1F0TA 4YESB 3LDXH 1V2PT 1GI2A 5J4QA 1O2IA 1HAIH 2ANWA 1EPTB 2W7UA 2KAIA 1GDQA 2VVUA 2VH6A 1IQEA 3C27B 3E3TA 4MPUA 2C8YB 1BMLA 5EOKA 5ESBA 3RXTA 1NS3A 2GCTC 5CHAB 5EPYA 3ZZCA 4D76A 2BMGB 3HKJB 3LT3A 4I8GA 1W11U 1ZOMA 1TOMH 3ZVGA 1AIXH 5FX5A 2YNAA 2A5AA 3PWBA 4B2BA 1JRSA 1HGTH 2FPZA 4ZHLU 2ZQ2A 2OLGA 4CHAC 4OGXA 3F9EA 1TLDA 5AFYH 1DUAA 3RXVA 1L4DA 4DIIH 2QYIA 1OWDA 1ANDA 3OY6U 1TNGA 1C2LA 1P3CA 2F9PA 3LGWA 1TNHA 3E0NB 5ETXA 3BTTE 1C5QA 1Z6EA 1C1WH 3ZVDA 1CGIE 3ELAH 5ABWA 1B0FA 2GD4B 1ELCA 2SGDE 2SGFE 3MO6A 1C1TA 3RU4D 3BTME 1E38B 2C8WB 1C5TA 2R2WU 2Q6GA 2CMYA 1UTMA 3T62A 4ABHA 1OWHA 1ZSLA 2BQWB 3SBKA 1FAXA 1WQSA 5F03A 3QTVH 3O8RA 2Z94A 1C5ZB 1MTSA 1O2MA 4ZKRU 4CBOA 3DA9B 4SGBE 1S82A 2VIOA 1QL7A 4B1TA 2A4QA 2CGAA 1MKXH 1SGFG 1SFQB 1ZTLA 5HMAA 3SU3A 1BBRK 1EPTC 1FIWA 1MTWA 1PQAA 1TFXA 1ZJKA 3VGCC 1YLDA 3RXMA 4MG3A 1MZDA 3RC5A 3BEIB 1KLJH 1ORFA 1H9HE 1P01A 3LOXA 1ZZZA 5FBIA 3RXQA 1DSUA 5A8ZA 3E16B 1MCVA 1GHXH 1OSSA 1SLXB 5EQQA 1GMHF 4IMQA 3TJVA 4CR5A 3HKIB 1BMNH 1TX7A 1O2TA 1W14U 1C5OH 3MOCA 5SGAE 5JBCS 4LZ1H 5B6OA 2BD2A 1C5XB 1E34B 1Y5UT 4JYVH 1GJ9B 3LIWA 3RXFA 1VR1H 3U9AH 1YPHC 2TBSA 1IOEA 1ZGVA 2O8MA 2ZEBA 1BBRE 5E8EH 2GP9B 1V2NT 3BTGE 1WV7H 3PV4A 1AKSB 4DT7B 1KTSB 3E0PB 2ZHWH 1EZSC 2FX4A 3RU4E 3UOPA 1PPGE 1GJCB 2LPRA 5EPNA 3R3GB 2J4IA 4UFGH 1O3MA 1BJVA 2B9LA 4BANB 4ABIA 2BD5A 5DP6A 2PTCE 1HRTH 2B0FA 1AWFH 3PMBB 1O2NA 1C2KA 1TMUH 2QN5T 2UUJB 4YLUA 1UCYK 1P57B 1HAYB 3RXIA 2R0KA 1EX3A 1TWXB 1SGNE 1VITH 1SHHB 3N7OA 4IC5A 1OWKA 1KXBA 3RXAA 1NRSH 1AB9B 1F5RA 3FANA 1P2KA 1NROH 3A87A 1D3QB 4ZHAA 1Y3VA 5EQRA 5L2YH 3SORA 2QCYA 1V2UT 3TU7H 1D3TB 4KTUA 1LO6A 2H5DA 3V7TA 4BTUB 1ELEE 2WPLS 1W7XH 3ZVFA 1L1GA 2OBOA 1UO6A 5ESTE 1MD8A 3TLOA 2FI5E 2BX3A 3PYHA 4AFUA 4I8JA 3RLWH 1O5EH 3Q76A 1NFWA 1HAVB 9ESTA 1H9IE 2G5NA 3P8GA 1O5CB 2UUFB 3P8OA 2G81E 1AZ8A 3O8DA 7GCHF 1AFQC 1YBWA 1QY6A 5L6NH 1FPHH 2YOLA 3PO1C 1ELDE 4INLA 1BBRH 4K1EA 4NCYA 1QJ7B 4B76A 1C1SA 3R0FA 2BZAA 1Y3UA 1NRQH 2GVFA 2ZDKA 4ZKSU 4U30A 2GV6A 1A46H 1TB6H 1XXFA 4XBDA 2DE9A 3ATIA 4XBBA 1DDJA 1K1JA 2LNCA 5C1XA 1O2LA 4A1VA 2A4RA 2Y5HA 2AH4X 1V2VT 1P2NA 1C5SA 4OS6A 1ESTA 1ZHMA 2WYGA 1UJ1A 3TGKE 3TIUA 2XCNA 3UREA 4UDWH 1K1LA 3V13A 2ZHFH 1YPJH 2O8UA 2PW8H 4ZMAH 3CS0A 4E7RG 3A84A 2FLRH 3M5LA 5LGOA 4MNVA 2VWOA 1WTGH 1EATA 4K2YA 4LXBH 1LPGB 3PB1E 4YT7H 1W0YH 1AVGH 2Z9JA 4HI3A 1V2JT 1K2I1 1ZPBA 1K1NA 2ASUB 1MBQA 3FP6E 3QGNB 3ZYEA 2PGQB 2Y5GA 3P17H 3GCOA 5E0GA 2ZFTA 2Y7ZA 1C1NA 1QL8A 1KXAA 2TGTA 3SQHE 1OWJA 3K2UA 2XRCA 1EB1H 2XBYA 3MU5A 3TPIZ 1ZHPA 1UCYH 3ZVCA 2WV5A 3NUMA 2XWAA 4F4OC 2ODPA 1TA2A 4B73A 1GJ5H 1T8OA 2XWBI 3BTQE 4ISHH 5FCRA 3MFJA 2ZDNA 1BA8B 4Y76A 2FOAA 3FZZA 5LPRA 1NU7B 1GBKA 5GCHF 1LPKB 2H9TH 2TIOA 1CO7E 2HGTH 2A31A 3GCTG 5EQSA 2ZGCA 1GBEA 2EA3A 4NA9H 4WF8A 4NIXA 1OP2A 2W5EA 1IQLA 1BMAA 2OUAA 1GHAF 4DG4A 3UPEA 1QBOA 3TGJE 1QJ1B 2ZGJA 1AGJA 3BTDE 1QRXA 2P94A 2PV9B 1V2RT 2XXLA 1A7SA 2GKVE 5A0AE 1C4Y2 1UVUH 2Z9KA 1FUJA 3GCHC 2TRMA 3SNCA 4X2VA 2VIQA 1BZXE 3DT0H 2ZQ1A 3RXCA 1C5MD 3NPSA 3RUOA 1BTPA 1YLCA 3ZZ3A 1Y5AT 3RXBA 5TCAA 1E36B 1UTPA 5DO4H 2CF9H 1J9CH 3V0XA 5HM2A 1CHGA 1ZPCA 1GBLA 5GCHG 2XNIA 1UVTH 1YPLH 2AIPA 6GCHF 3GY8A 3MWIU 1O2GH 4BAQB 2ZGHA 4MNWA 2EI6A 1A0HB 3Q77A 4BTTB 3OX7U 4DY7B 3GYMA 2QXGA 2JETB 3SJKA 3M35A 3MHWU 1A0LA 4JZ1A 4NSYA 1DLEA 3B8JA 3E8LA 1BHXB 5HXFA 4FUEA 1AWHB 1MAYA 1UK2A 5EXNA 2TGPZ 3BG8A 1QB6A 1A3BH 3HK6B 1SGRE 2GT8A 1GBTA 1BTHH 1N1LA 1UHBB 1GBMA 2ZO3H 3FP7E 1DWDH 1GMDG 3ZYDA 1CHOF 2C93B 1FY3A 2BDAA 1O34A 3SUDA 3RMMH 1FAKH 3A89A 2JKHA 2BVSH 3BIUH 2OINA 5F8TA 3RXRA 3RC6A 4CH8B 3UNRA 4AN7A 1Z1JA 4FUDA 3RXGA 2AGGX 1J8AA 1L1NA 5T6DA 1O5AB 5FXLA 5DP4A 4NFEA 2C90B 3ZVAA 1E0FD 2BVRH 1MD7A 3VB3A 4RSPA 3P6ZB 3MNXA 3U1IB 5L30H 2PKAB 4GCHF 1K22H 2FI3E 3I29A 1A4WH 4UEHH 1MKWH 4Y6DA 1AI8H 3OY5U 1VCWA 1T4VH 2WYJA 1PPBH 2XC4A 1THPB 3QN7A 4KGAA 1WCZA 1FDPA 1ARBA 1LVBA 4GUXA 1C2IA 1TAWA 1DLKB 5EG4A 2FOCA 4NGAH 4WMEA 2O9QA 2ZDAH 3E90B 2J38A 1GI8B 3BIVH 1VGCB 1DWEH 1NESE 1O3LA 4CRDA 3U8TH 3M3VA 4AGJA 3OU0A 5T6GA 2ZHEH 1FLEE 2J34A 3ZZ9A 1CHOG 1DM4B 1RXPA 4INHA 1ZRKA 3S9AA 4CRAA 1OPHB 1E35B 2IOTA 1ETSH 3OTJE 8GCHG 2ZTXA 1EJAA 4MNYA 3BG4C 4X1RU 1C5VA 1SLUB 3SJIA 4NIYA 1O36A 2ZWLH 2CJIA 1S84A 1CGHA 2V3OH 1XVMA 3GDUA 1GHVH 3ZZ8A 1P04A 3T27A 4A92A 4BAOB 1JBUH 2FX6A 1GBFA 1MQ5A 1C5WB 4F49A 4H42U 2HWLB 1SHYA 1O37A 2RA3A 4Y0ZE 3S7KB 2ZKSA 2XC0A 2UWOA 2XTTB 2Q6FA 4GCHG 2ZCHP 1L2EA 2I6SA 2HLCA 4FVDA 2QXHA 2Q6DA 2HNTE 1CT4E 3HGNA 3DUXH 3QTOH 3SZNA 1GI9B 5C3NA 3M5OA 5JB9S 2QGRA 3KQDA 1HLTH 1Y59T 2DE8A 2OQUA 3V3MA 1GL1A 3D65E 4LK4A 1OX1A 5TJXA 2Y6TA 1OOKB 3KIDU 3LU9B 6CHAC 4Q7XA 1TRYA 3VB7A 1IQMA 1V2QT 2ZFQH 1P2MA 2FLBH 3W94A 1B7XB 3MU0A 1V2WT 3TH2H 4O9VA 4A7IB 3JZ2B 1LVOA 5FHTA 2BX4A 3SU5A 2ZPQA 2NU0E 2SGEE 1MTVA 3L6PA 3LGYA 5T3HA 5BRRE 1FQ3A 2FDAA 3AVZA 3S0NA 1GBCA 5AVDA 3BTKE 4UE7H 1L4ZA 1WQVH 3SUGA 2TGDA 2ZGBH 1PPHE 1O2WA 4K8BA 1TYNA 1LVYA 1Y8TA 3SGAE 1LKBA 1ETRH 1SGDE 4TWWA 1LHEH 4FUJA 1AKSA 1SMFE 4GVUA 1SGYE 3M36A 5C5OA 1DICA 1QCPA 5A09A 1O3FA 4MVNA 5EXMA 4AORA 4MTBA 1YCPK 3BN9A 4X8UH 3NKKA 2Z3EA 1KLTA 1EAXA 2VGCC 4Y8XA 1DPOA 4XE4A 5FPSA 4UFEH 1N8OC 3U8RH 2NU2E 1NRRH 1A5HA 4FUCA 1PYTD 4B75A 5LH8A 3STJA 1YP9A 2O8TA 2NU1E 4U2WA 1B5GH 3HATH 1JIMA 1A2CH 1FY5A 2UUYA 3QZQA 4I8HA 1C1VH 4JCNA 4AYVB 2WINI 1UVPA 2STAE 2BLQA 1ID5H 4D8NA 3GISB 2BY9X 3ZZ4A 1TPAE 1S0QA 2G51A 2VVCA 4ZROA 3AW0A 4X6MA 1NC6A 5GDSH 2SGPE 2CHAB 2J92A 2QF0A 3DD2H 5A8XA 4CRBA 3M7TA 5K0HA 1TALA 4X6NA 8LPRA 2A2XH 3SW2B 1GJBB 3VXFH 3A83A 1W3CA 1GWAA 1O3AA 1S5SA 1KTTB 1TGSZ 1BTXA 2AERH 1D3DB 1HAVA 1SBWA 2SGQE 3SQEE 4I31A 3MU8A 1OWEA 2WUBA 2XC5A 4NSVA 2FTMA 2FS9A 1L0ZA 1IQFA 1YPEH 4ZUHA 4R0IA 4X2XA 2XW9A 2P59A 1Y3WA 1O32A 3M5NA 4E06H 3RXUA 2GCHG 2VIVA 1HJAB 1O35A 1VZQH 4JK6A 4GHQA 3DFLA 1DT2A 7ESTE 1WBGB 1MCTA 1DOJA 2F9OA 4Q80A 1GBIA 4UFDH 1RD3B 3UR6A 3RXKA 2FOFA 5TCCA 3T2NA 4HFPB 1RGQA 3BTHE 1CBWB 4IS5A 2OXSA 1SQAA 5FBEA 3QGJA 1OS8A 2H1UA 2WV4A 3EE0B 3D49H 2GT7A 3SHCH 2D26C 1T8LA 4DIHH 4K3JA 5IYTA 1J17T 1AE8H 4JMYA 1BTWA 1IHTH 2ALPA 4B71A 4MPWA 4E7NA 2A45B 4GHTA 1RFNA 2CHAC 3BTFE 4R8TB 2C4FH 4TY6A 4A1TA 2V3HH 1TPOA 1DY9A 1ZRBA 5HYOA 2FZZA 2P8OB 5JBAS 2QA9E 1CA8B 3EDXB 1D3PB 3EA9A 3W95A 1QNJA 2M5TA 5CHAC 3ODFA 7KMEH 1PQ5A 4YOIA 1MZAA 1IQNA 1H1BA 2R3UA 1SB1H 1C4V2 3BTWE 3C1KA 4NZLA 3A7ZA 2BXTH 4IMZA 3LJJA 1MTUA 1UK4A 4JZFH 1ZHRA 2OC0A 2P95A 5FX6A 2A4GA 1AUTC 3I77A 1IQGA 3RM2H 1DE7H 1ANEA 3M7QA 1A1RA 1C2EA 5AFZH 3TH4H 4CRCA 4BNRA 2G52A 3SGQE 3SNBA 1C2MA 2BLOA 4AFZA 3RMNH 1V2KT 2P3TB 1ZJDA 2VINA 1RRKA 2A4OA 1ESAA 1D6WA 3UQOA 1C2HA 1HV7A 1ZMLA 1S85A 5BPEA 3WY8A 2J9NA 1A5IA 1O2JA 1GVZA 3RC4A 4MNXA 4X8TH 3GICB 1F0SA 2VU8E 2R3YA 4IN1A 2A2QH 1FV9A 1CU1A 3T29A 1U6QA 5DP8A 3T28A 3K6ZA 1BRBE 1GJ4H 4FUIA 2QXJA 2FIRH 2QF3A 4NA8A 4OS1A 1UTQA 2HNTF 3AASA 4X1PU 3O8BA 2P8OC 3MMGA 4IN2A 4LZ4B 3U69H 2ZGXH 1TBRH 1MTNB 1HBTH 4K69A 1DWCH 1NPMA 5E2PA 3EA7A 5EXLA 1BJUA 1PPCE 4Y7BA 3RMLH 2RG3A 1LQEA 1TNJA 2GZ9A 1FONA 4YO9A 1IQKA 1DY8A 3BEUA 3TJOA 1C4U2 1GBJA 2Y81A 3MH7A 4PROA 4Q7YA 5C67A 3STIA 3KEEA 1EJMA 4AB9A 2ZCKP 4X6PA 3MI4A 1G9IE 1ZMJA 4WH6A 4AB8A 1RS0A 1O2KA 3M61U 4SGAE 1O5FH 3TK6A 1ELGA 4Y79A 4AFSA 2XCFA 1V2TT 2GMTB 1NTPA 2R9PA 4KP0A 2B7DH 3LJOA 1SLWB 2RDLA 1CVWH 1V6DA 1ARCA 5DPAA 3SV8A 1NT1A 1ACBE 1J15A 1BDAA 5E2OA 4ABJA 1UHBA 3KNXA 4RKOB 4LOYH 1G3CA 3E6PH 4IC6A 1G3DA 2VIDA 2W3KA 1ZMNA 2BDHA 2ODQA 1XUIA 5DJ7A 2C8XB 5EGMA 4NA7A 2ZNKH 2VNTA 3RXOA 2FTLE 2OD3B 1O2QA 1HAXB 3A8BA 3VB6A 4FUHA 2F9VA 1OWIA 2BQ6B 3BF6H 4INKA 6LPRA 1AB9C 2ZDVH 1PQ7A 2ZTYA 2PKAA 2PFEA 1QRWA 3ATLA 1RIWB 1SPJA 1Q31A 1SGFA 3GCTF 3RP2A 5HM9A 1SR5C 1OP8A 1GI4A 4I33A 1SQOA 2CN0H 4ABDA 3FVFB 1BTZA 1CT2E 3MO9A 1A0JA 3S9BA 3UWJH 1SC8U 2HRVA 2PR3A 1F92A 3TNSA 3OSYA 1RJXB 4UFFH 2ZFFH 3NK8A 1GDNA 3LC3A 3RXDA 4X8VH 2GMTC 2QC2A 4WY3A 2JH0D 2HALA 4AGKA 2FP7B 1LMWB 4H6SB 3A8DA 2IN2A 3EQ0H 2QAAA 4Z0KA 4J1YA 2EI7A 4NG9H 1EAUA 3ZZ7A 1O2SA 1O3IA 1SL3A 2ZU1A 3NXPA 1O3KA 2PWXA 3DFJA 1YM0A 1C2JA 3QZRA 4X2WA 2F83A 1P05A 2ANMH 1IQJA 1XUHA 4AG1A 1HYLA 1LCYA 5EW1H 1G37A 3QX5H 4YOJA 1GHYH 1HB0B 1UVSH 2AEIH 3T5FH 4BAKB 1HCGA 4Y11E 1A61H 1HXFH 1O30A 3D23A 1KDQA 1O3DA 2AGIX 5E0HA 1K1OA 4I8KA 2QV1A 1GVLA 5LPFA 3GY3A 5EU8A 1UK3A 1QB9A 1G3EA 3GY7A 4ZKNU 4FU9A 1O31A 1V2OT 1P2JA 2THFB 2Z3DA 2J95A 1GMDF 1BIOA 2UUKB 3A7YA 5DK1A 2IJOB 1S83A 5AF9H 2ANKH 1O3HA 1NRPH 4JYUH 7LPRA 2FI4E 4NWLA 1C9TA 2ALVA 2ZU4A 1FXYA 2PGBB 2H5CA 4ZH8A 3PLBA 1BRUP 3VEQB 1QA7A 3ITIA 2Z9LA 1HIAB 3ZZAA 1VITF 2F9NA 4WJG2 1FPCH 2WPHS 4XDEA 1P9UA 3SGBE 5CMXH 4IBLH 2HPPH 1MUEB 2ZI2H 1O2PA 3UIRA 4YTAA 4CRFA 1HDTH 3KF2A 1HAOH 1GJAB 3RXEA 3SUFA 4MLFB 1TNLA 1G2LA 4O03A 3VB4A 1W10U 5C20A 1GI3A 2TPIZ 1A3EH 4VGCB 3SI3H 4AX9H 3NZIA 4UD9H 1QR3E 1H8DH 3GCNA 3IWMA 1FIZA 4HGCA 3BEFB 3MTYA 4FUBA 2AGEX 2B5TB 1TIOA 3EYDA 2CV3A 1HAPH 1C1MA 2WPKS 1F7ZA 3BSQA 1HXEH 2GDDA 5JPMH 2I6QA 8GCHF 5C2ZA 5DP3A 1LQDB 4Y0YE 4D7FA 2G00A 3TJNA 2G55A 4GAWA 5A0CA 3U1JB 1XUKA 1GI5A 3QO6A 1B0EA 1PPZA 2ZA5A 3KCGH 1NU9A 2P16A 3B9FH 8ESTE 4Y7AA 1J16A 1WUNH 1O39A 1VITG 3SU0A 4YM9A 1SGPE 1HAZB 1O2OA 1FY1A 4OS2A 2C3SA 1S0RA 2BDGA 2PTNA 1P8VC 1CT0E 1SLVB 3S9CA 1KYNA 3KN2A 2ZPRA 3M5MA 5FCKA 1NO9H 4XSKU 1KXCA 5C1UA 1XUFA 2BZ6H 2EC9H 5FPYA 5K7RA 1GHBG 3SU2A 2FWWA 1AY6H 3AW1A 3GY4A 3ODDA 1QJ6B 3F9FA 2BB4A 2FM2A 4GSOA 2R2MB 1ABIH 4ZHMU 4NIVA 2W26A 2JETC 4JZIA 4Y71A 1QHRB 3CENA 2ZP0H 2ZFRH 1GMCG 2ZIQH 3SU4A 1FMGA 1TNKA 1RTFB 1EB2A 1ELBA 1KXDA 3EGKH 4H6TA 4BXWA 1UTOA 4BTIB 4NZQA 1YPKH 2NWNA 1H9LB 1QBVH 2VWLA 5EODA 1ZTJA 4O3UA 2XYAA 2Z7FE 1LHCH 4ASHA 1HJ8A 1TGCA 1WAYB 2G8TA 4ABBA 3MNBA 4AG2A 1HPGA 3CS7A 3PM3A 1QQUA 3A82A 4CREA 1KDQB 1IQHA 3ATWA 1AVWA 1MH0A 1UTLM 1O3PB 1EAIA 1JXPA 1Z8RA 2QXIA 1SGQE 2EI8A 1RTLA 5CE1A 1AVXA 1C9PA 4KTSA 3F9GA 3NWUA 4X2YA 1UTNA 8KME2 1C1OA 1ABJH 4OS7A 2HVXA 1Z71A 5I25A 2STBE 2FOEA 1VGCC 3MO3A 2VIPA 1EP6A 3PTNA 3SU6A 3GY2A 3EAJA 1ELVA 4D9RA 1O2YA 3P8NA 1EXFA 1K21H 1P12E 1DX5M 3ENSB 1GGDB 1C5NH 2GZ8A 2H6MA 2R0LA 1O3BA 1P11E 1GCTB 4TPYA 4GLYA 4JK5A 5LPEA 1TRNA 3GDVA 5C5NA 2BXUH 1SOTA 1P2QA 2GCTB 1KY9A 2VH0A 4MPXA 1CGJE 1GDUA 3EA8A 3SV2H 1H8IH 1XVOA 5DKMA 1ZLRA 2BD8A 1C2DA 2TGAA 3VFEA 1MKXK 3TNTA 1FNIA 1DSTA 1WU1A 1YPHE 3LGTA 2GCHF 2ZZUH 4ISLA 2G5VA 4KELA 4IW4E 3LONA 1DITH 4DGJA 1SQTA 5JB8S 4Q7ZA 4ZAEA 1ZR0A 2ZC9H 2OC1A 1TMBH 3A86A 3LH3A 4GPGA 4JZEH 1C2FA 3QDZB 1QA0A 3QWCH 2ANYA 2B8OH 3M7UA 3RU4T 5JDUB 1TA6A 1EUFA 4Q2KA 2PUQH 3FFGA 1CSOE 2BM2A 3FAOA 1O2ZA 2BQ7B 2AMDA 3A81A 2NU4E 5E0JA 1P3EA 1EASA 1SGEE 2ZPSA 1TNIA 2W3IA 3RXSA 3SOSA 3KHVA 4K5ZA 1C5PA 4ABFA 1O2VA 1W12U 1KLIH 3VGCB 1CA0B 1GGDC 1K1MA 4WH8A 5G4BA 3A7VA 4WXIA 1TQ0B 1GCTC 2VJ1A 2YNBA 1SOZA 1AHTH 1JIRA 2ZCLP 1YYY1 1PJPA 4B2AA 3SUEA 1C1PA 4XOJA 4Y8YA 1O3OA 1SVPA 1AMHA 3ATKA 4ZXXH 4X0WU 2FODA 3RXJA 1TBZH 1F5KU 4DCDA 4FUGA 2HNTC 5T6FA 1GBHA 1HNEE 3PROA 1PFXC 1C2GA 1BITA 2F3CE 1PPFE 1V2MT 2GTBA 1Z1IA 2O8LA 1XM1A 2XBXA 5DG6A 1GI1A 1ZPZA 3HPTB 5F8XA 2ULLA 1SI5H 5IDKA 2A7JA 2CXVA 1YCPH 4ISIH 4BAHB 6ESTA 1LHFH 1IQIA 1FY4A 1ELFA 1T8MA 1TQ7B 4AYYB 2AYWA 3UNQA 1G2MA 2A5KA 1D6RA 1GJ8B 4A5TS 1QFKH 2AS9A 1EZXC 3MNCA 1YPMH 4O3TA 1NM6A 2ZTZA 2VVVA 4I7YH 2ZU3A 1CA0C 3K65B 1LDTT 4E05H 1O2UA 4DURA 1TMTH 3P95A 2BDBA 2SFAA 1TPSA 1C1RA 3MU1A 2PKSB 2A1DB 3ZZ5A 1MU6B 4U32A 1UMAH 1NFXA 1H4WA 3E1XB 4D7GA 2ZHDA 1EKBB 4D9QA 1O33A 1HJAC 3TH3H 2PSYA 4X1QU 2GX4A 1DUEA 2BD7A 3TVJB 1FN8A 2BHGA 1E37B 3PMAB 4MPVA 2PLXA 2FMJA 1TX8A 1WYKA 1MQ6A 2JH5D 1CBWC 4DW2U 1LHDH 2FOMB 9LPRA 1LKAA 1XKBC 5GJ4B 3SJ8A 1D9IA 5HGGA 1AN1E 1AFQB 4NIWA 1OXGA 1P2IA 4B2CA 2D1JA 3PO1B 1F2SE 2A5IA 2AMQA 1Z7KA 3F1SB 4AFQA 1BT7A 5F6MA 2J94A 4I8LA 1GG6B 3FZDA 3Q3XA 4KTCA 3RM0H 2BTCE 1LTOA 3PLPA 1ESBA 1ETTH 1CE5A 1KIGH 2A0QB 3U98H 3OYPA 3UY9A 3ZZDA 3SNAA 3A7WA 4XFQA 1SGTA 1RTKA 1ZSJA
chains in the Genus database with same CATH superfamily
1QQ4A 3SHAH 3TGIE 3IG6B 4H4FA 3HK3B 5AHGH 2XBWA 3SO3A 1YC0A 1HIAA 1GMHG 1ELAA 2VWMA 4OS5A 1YKTA 2F9BH 1AFEH 1W8BH 1XMNB 5J4SA 1PYTC 2PKSC 4X6OA 1KXEA 2BDCA 1NBME 1SGIB 1NFUA 1UTJA 5DP9A 3FO8D 4B74A 2J98B 2BDIA 3QK1A 1THSH 2HOBA 4HZHA 2KAIB 2UWPA 2ZDMA 4Y8ZA 1F0UA 4ISOA 3PMJA 3F9HA 2BY6X 3FKSD 5F8ZA 3URDA 1YF4A 1UCYE 3I78A 3AAUA 2Y5FA 1GHZA 3MYWA 1AUJA 3RLYH 3GY6A 3VB5A 5JYIA 2OC8A 4A1XA 1JRTA 1HJ9A 1O5DH 2WPIS 5C1YA 4AOQA 3PMHB 4X1NU 1O3JA 1WTHD 3P70B 1TBQH 4IGDA 2FYQA 1GG6C 4DOQA 2BD3A 1EOLA 1G36A 2WPMS 1N6YA 2QIQA 1UVOA 4YOGA 2FOBA 2VIWA 2AMPA 1O5BB 1MTNC 1A5GH 1VJAU 1DVAH 1DWBH 1S6HA 3KQCA 3A85A 2UWLA 3ZVBA 5GWZA 2A7HA 5EJ1A 5JBTA 3MU4A 1AO5A 2ODYB 3L33A 3PTBA 4TY7A 5PTPA 1BTYA 2GV7A 3SJOA 1GI0A 3ZV8A 5DN6D 3LKWA 3A80A 4K8YA 1Q3XA 1BOQA 2WUCA 1V2ST 3SI4H 1O38A 2P3FH 1Q2WA 4DT4A 1DS2E 3SU1A 1BRCE 2AIQA 1EP5A 1XUGA 1ZYOA 3KYGA 4I86A 7GCHG 1N6XA 3GCHB 3MH6A 3KQBA 4TYDA 1G32B 5JBBS 4YT6H 1FY8E 4K60A 4NWKA 2BD9A 4J2YB 5EIYA 1P0SH 1D4PB 5EW2H 3PRDA 3GYLB 4BXSA 1TGTA 5DP5A 2RCEA 1EFRD 1W0ZU 2K8IA 2LP6A 2OQ5A 1VCQA 3TITA 2V35A 2ZFSA 3WWFA 1GI6A 2ESTE 2OK5A 4CR9A 2BY8X 1Y3XA 1G3BA 1SG8B 2PSXA 1DANH 1AD8H 1AU8A 3UUZA 1V3XA 2RA0A 4CRGA 3GY5A 1BMMH 1XKAC 1ZGIA 4X1SU 5H4IB 3RXLA 1MKWK 2J2UA 1W7GH 4ISNA 3LGVA 5GIBA 2C8ZB 3RDZA 4ABGA 1RIWC 3KQEA 4JYTA 2HPQH 2Y7XA 2Z3CA 2H2ZA 2QY0B 1P03A 3P92A 3URCA 4ABAA 1ANBA 4WMFA 2GDEH 1IHSH 2BYAX 1P09A 3KGPA 5DGJA 4B6FA 2VWNA 3TK5A 2BLWA 4ESTE 2BOHB 2Z9GA 3PLKA 4K1SA 2BY7X 3SNEA 2EEKA 1EJNA 2FS8A 2IPHA 1YCPM 2P3UB 1W2KH 3GOVB 3RXHA 1TOCB 1TX6A 4AZ2B 1O3EA 2IPQX 3V12A 3SJ9A 1O2HA 4BOHA 5IK2D 1C5LH 1GVKB 3ESTA 3LH1A 3M3TA 1K9OE 1XX9A 3MH4A 1O3CA 2GZ7A 2G4TA 2PHBA 1LVMA 2FO9A 4RKJB 2AFQB 3VXEH 1GHBF 1K0HA 1TABE 1T32A 1DXPA 2ZHQH 3ZZBA 5A0BA 3UTUH 4NFFA 3F0OA 5A8YA 2BY5X 1BTUA 5I46H 2DUCA 2O8WA 3O8CA 1EZUC 2BD4A 3LC5A 1YPGH 1GMCF 1HFDA 1Z8JB 2OC7A 1GHAG 1KSNA 2ZU2A 3T26A 1P10A 1Y3YA 3BG4B 4Y10E 2OTVA 4XBCA 2FXRA 3G01A 1NY22 3F68H 3RXPA 4O97A 3A7XA 1H8HD 4WWYA 2FYRA 1C5YB 3A8AA 4ABEA 1F5LA 1K1PA 2JH6D 4Q4LA 1COWD 4HTCH 3EE7A 4YLQH 1ANCA 1K28D 1MBMA 2H9EH 2ILNA 3QUMP 1O3GA 3LGIA 3SN8A 3FN8A 1NFYA 2OCVB 1S6FA 3Q3YA 4ZCNA 2D2DA 3DHKH 2F9UA 4M7GA 2FOGA 2BOKA 3UAIC 1PPEE 1GL0E 3SV9A 4XD7D 3UWIA 5GPIB 1AE5A 3NCLA 1J14A 2SGAA 4UONA 1THRH 4FVBA 1EPTA 1IAUA 4WVPE 4X8SH 2PUXB 6GCHG 6CHAB 1Y5BT 1O0DH 2Z9IA 3KL6A 1TE0A 5C94A 5FAHA 4TWYA 3HGPA 2CF8H 3LGUA 1BCUH 4FUFA 4Z6AH 2XBVA 3M3SA 1BB0B 4FU8A 4P02A 4VGCC 3JZ1B 3T25A 2FESH 3QLPH 1V2LT 2ZFPH 4OS4A 2WSSD 1NRNH 4JZDH 2A32A 3D62A 1E1QD 2NU3E 2Y82A 3UR9A 4WMDA 1GPZA 4TPIZ 1AZZA 1LHGH 1SFIA 3RMOH 3ZZ6A 3A8CA 1OKXA 3ATMA 1WSSH 3S69A 5GXPA 4MDSA 1M9UA 1QRZA 2D8WA 1HAGE 3SV6A 1C1QA 1SGCA 1UTKA 2ZDLA 4YZUA 3U8OH 3IITA 1FN6A 1PQ8A 2Q1JA 2Z6BD 1NN6A 1Z6JH 1P06A 2V6NA 3ZV9A 3OFND 1HUTH 1G30B 1P2OA 3K6YA 4BAMB 3LPRA 2VGCB 1L1JA 1X7AC 1ZSKA 1GJDB 1O5GH 1C1UH 1N8OB 4I32A 1BUIA 4MQAA 1T8NA 1C5UA 2WPJS 3A88A 1QGFA 3PWCA 2FEQH 1GBAA 1C5RA 2ZF0H 1QB1A 2XOKD 1T31A 1QIXB 3MH5A 1ELTA 1KXFA 1TONA 1GCDA 2BDYA 4RN6A 2BVXH 1AQ7A 2L6OA 1INCA 4ZKOU 3BTEE 3GDSA 5A2MH 2OBQA 4CH2B 4WXVA 1F0RA 1DXWA 5L2ZH 3P8FA 3S7HB 2H9HA 3UQVA 2ZU5A 1TPPA 1MU8B 1SSXA 4QT8C 2PP6A 4FU7A 1GJ7B 2ZECA 1K1IA 1O3NA 1QL9A 1QTFA 1YGCH 1O2RA 3M37A 4KKDA 1EQ9A 4FXGH 2F91A 1O2XA 3B23B 1VJ9U 1JWTA 2P93A 4K1TA 3TJUA 3UFAA 1TRMA 1FI8A 1EAWA 1FJSA 1TGNA 1Z8GA 3FP8E 2SNWA 4CBNA 1BQYA 3SV7A 3UOUA 2KR7A 1VCPA 4DJZB 3N7EA 1JMOH 1Z8IB 3SNDA 1P9SA 1MAXA 1NZQH 2BLVA 4U01A 2V0BA 2K1QA 3BV9B 1EOJA 4ZXYH 3Q00A 3VPKA 1OYTH 3UNSA 2GGVB 3E91A 4CHAB 1CQQA 2OP9A 1FZZA 2SNVA 3AAVA 3H7TA 5FPTA 4THNH 1OYQA 1MMJN 1WOFA 3N99A 1T4UH 3MNSA 1EZQA 1TGBA 3ZVEA 1OP0A 1GI7B 1ZTKA 1GHWH 3L3TA 2ZG0H 1LPZB 3H5CB 1DFPA 1P02A 4DVAU 3K9XB 3TK9A 1GBDA 3CP7A 1W0JD 1T7CA 1BHXF 2RFKC 1GBBA 3F6UH 1XXDA 4A6LA 3Q3KA 1HAHH 1JOUB 3H7OA 1QBNA 1QURH 2FOHA 4OGYA 5EJLA 1XUJA 1GJ6A 1S81A 2HLDD 3A7TA 2G4UA 2Y80A 2W7SA 2A7CA 2VB0A 5DP7A 1W13U 1BRAA 1F0TA 4YESB 3LDXH 1V2PT 2J98A 1GI2A 5J4QA 1O2IA 1HAIH 2ANWA 1EPTB 2W7UA 2KAIA 1GDQA 2VVUA 2VH6A 1IQEA 3C27B 3E3TA 4MPUA 2C8YB 1BMLA 5EOKA 5ESBA 3RXTA 4Q63A 1NS3A 2GCTC 4F48B 5CHAB 5EPYA 3ZZCA 4D76A 2BMGB 2KCAA 3HKJB 3LT3A 4I8GA 1W11U 1ZOMA 1TOMH 3ZVGA 1AIXH 5FX5A 2YNAA 2KFWA 2A5AA 3PWBA 4B2BA 5C0TA 1JRSA 1HGTH 2FPZA 4ZHLU 2ZQ2A 1MABB 2OLGA 4CHAC 4OGXA 3F9EA 1TLDA 5AFYH 1DUAA 2F43B 3RXVA 1L4DA 4DIIH 2QYIA 2KX4A 1OWDA 1ANDA 3OY6U 1TNGA 1C2LA 1P3CA 2F9PA 3LGWA 1TNHA 3E0NB 5ETXA 3BTTE 1C5QA 1Z6EA 1C1WH 3ZVDA 1CGIE 3ELAH 5ABWA 1B0FA 2GD4B 4XRNA 3WW7A 1ELCA 2SGDE 2SGFE 3MO6A 1C1TA 3RU4D 3BTME 1E38B 2C8WB 1C5TA 2R2WU 2Q6GA 2CMYA 1UTMA 3T62A 4ABHA 1OWHA 1ZSLA 2BQWB 3SBKA 1FAXA 1WQSA 5F03A 3QTVH 3O8RA 2Z94A 1C5ZB 1MTSA 1O2MA 4ZKRU 4CBOA 3DA9B 4SGBE 1S82A 2AHME 2VIOA 1QL7A 4B1TA 2A4QA 2CGAA 1MKXH 2VBCA 1SGFG 1SFQB 1ZTLA 5HMAA 3SU3A 1BBRK 1EPTC 1FIWA 1MTWA 1PQAA 1TFXA 1ZJKA 3VGCC 1YLDA 3RXMA 4MG3A 1MZDA 5KECA 3RC5A 3BEIB 1KLJH 1ORFA 1H9HE 1P01A 3H09A 1ZZZA 3LOXA 5FBIA 3RXQA 1DSUA 5A8ZA 3E16B 1MCVA 1GHXH 1OSSA 1SLXB 5EQQA 1GMHF 2YMSC 4IMQA 3TJVA 4CR5A 3HKIB 1BMNH 1TX7A 1O2TA 1W14U 1C5OH 3MOCA 5SGAE 5JBCS 4LZ1H 5B6OA 2BD2A 1C5XB 1E34B 1Y5UT 4JYVH 1GJ9B 3LIWA 3RXFA 1VR1H 3U9AH 1YPHC 2TBSA 1IOEA 1ZGVA 2O8MA 2ZEBA 1BBRE 5E8EH 4ACAA 2GP9B 1V2NT 3BTGE 1WV7H 3PV4A 1AKSB 4DT7B 1KTSB 3E0PB 2ZHWH 1EZSC 2FX4A 3RU4E 4RI0A 3UOPA 1PPGE 1GJCB 2LPRA 5EPNA 3R3GB 2J4IA 4UFGH 1O3MA 1BJVA 2B9LA 4BANB 4ABIA 2BD5A 5DP6A 2PTCE 1H8ED 1HRTH 2B0FA 1AWFH 3PMBB 1O2NA 1C2KA 1TMUH 2QN5T 2UUJB 4YLUA 1UCYK 1P57B 1HAYB 3RXIA 2R0KA 2IJD1 1EX3A 1TWXB 1SGNE 1VITH 1SHHB 3N7OA 4IC5A 1OWKA 1OHHD 1KXBA 3RXAA 1NRSH 1AB9B 1F5RA 3FANA 1P2KA 1NROH 3A87A 1D3QB 4ZHAA 1Y3VA 5EQRA 5L2YH 3SORA 2QCYA 1V2UT 3TU7H 1D3TB 4KTUA 1LO6A 2H5DA 3V7TA 4BTUB 2EY4C 1ELEE 2WPLS 1W7XH 3ZVFA 1L1GA 2OBOA 1UO6A 5ESTE 1MD8A 3TLOA 2FI5E 2BX3A 3PYHA 4AFUA 3N7DA 4I8JA 3RLWH 1O5EH 3Q76A 1NFWA 1HAVB 9ESTA 1H9IE 2G5NA 3P8GA 1O5CB 2UUFB 3P8OA 4B6EA 2G81E 1AZ8A 3O8DA 7GCHF 1AFQC 1YBWA 1QY6A 5L6NH 1FPHH 2YOLA 3PO1C 1ELDE 4INLA 1BBRH 4K1EA 4NCYA 1QJ7B 4B76A 1C1SA 3R0FA 2BZAA 1Y3UA 1NRQH 2GVFA 2ZDKA 4HG6A 4ZKSU 4U30A 2GV6A 1A46H 1TB6H 1XXFA 4XBDA 2DE9A 3ATIA 4XBBA 1DDJA 1K1JA 2LNCA 5C1XA 1O2LA 4A1VA 2A4RA 2Y5HA 2AH4X 4FOUC 1V2VT 1P2NA 1C5SA 4OS6A 1ESTA 1ZHMA 2WYGA 1UJ1A 3TGKE 3TIUA 2XCNA 3UREA 4UDWH 1K1LA 3V13A 2ZHFH 1YPJH 2O8UA 2PW8H 4ZMAH 3CS0A 4E7RG 3A84A 2FLRH 3M5LA 5LGOA 4RT0A 4MNVA 2VWOA 1WTGH 1EATA 4K2YA 4LXBH 1LPGB 3PB1E 4YT7H 1W0YH 1AVGH 2Z9JA 4HI3A 1V2JT 1K2I1 1ZPBA 3PV5A 1K1NA 2ASUB 1MBQA 3DCLA 3FP6E 3QGNB 3ZYEA 2PGQB 2Y5GA 3P17H 5DSFA 3GCOA 5E0GA 2ZFTA 2Y7ZA 1C1NA 1QL8A 1KXAA 1FX0B 2TGTA 3SQHE 1OWJA 3K2UA 2XRCA 1EB1H 2XBYA 3MU5A 3TPIZ 1ZHPA 1UCYH 3ZVCA 2WV5A 3NUMA 2XWAA 4F4OC 2ODPA 1TA2A 4B73A 1GJ5H 1T8OA 2XWBI 3BTQE 4ISHH 5FCRA 3MFJA 5HKKD 2ZDNA 1BA8B 4Y76A 2FOAA 3FZZA 5LPRA 1NU7B 1GBKA 5GCHF 1LPKB 2H9TH 5KGOA 2TIOA 3PV2A 1YWUA 1CO7E 2HGTH 2A31A 3GCTG 5EQSA 1W0KD 2KCYA 2ZGCA 1GBEA 2EA3A 3MQKC 4NA9H 4WF8A 1QZ8A 4NIXA 1OP2A 2LELA 2W5EA 1IQLA 1BMAA 2OUAA 1GHAF 4DG4A 3UPEA 1QBOA 3TGJE 1QJ1B 2ZGJA 1AGJA 3BTDE 1QRXA 2P94A 2PV9B 1V2RT 2XXLA 1A7SA 2GKVE 5A0AE 1C4Y2 1UVUH 2Z9KA 1FUJA 3GCHC 2TRMA 3SNCA 4X2VA 2VIQA 1BZXE 3DT0H 2ZQ1A 3RXCA 1C5MD 3NPSA 3UB0A 1BMFD 3RUOA 1BTPA 1YLCA 3ZZ3A 1Y5AT 3RXBA 5TCAA 1E36B 1UTPA 5DO4H 2CF9H 1J9CH 3V0XA 5HM2A 1CHGA 1ZPCA 1GBLA 5GCHG 4AC9A 2XNIA 1UVTH 1YPLH 2AIPA 6GCHF 3GY8A 3MWIU 1O2GH 4BAQB 2ZGHA 4MNWA 1SKYE 2EI6A 1A0HB 3Q77A 4BTTB 3OX7U 4DY7B 3GYMA 2QXGA 2JETB 3SJKA 3M35A 3MHWU 1A0LA 4JZ1A 4NSYA 1DLEA 3B8JA 3E8LA 1BHXB 5HXFA 4FUEA 1AWHB 1MAYA 1UK2A 5EXNA 2TGPZ 3BG8A 1QB6A 1A3BH 3HK6B 1SGRE 2GT8A 1GBTA 1BTHH 1N1LA 1UHBB 1GBMA 2ZO3H 3FP7E 1DWDH 1GMDG 3ZYDA 1CHOF 2C93B 1FY3A 2BDAA 1O34A 3SUDA 3RMMH 1FAKH 3A89A 5HIYA 4Z1MD 2JKHA 2BVSH 3BIUH 2OINA 5F8TA 3RXRA 3RC6A 4CH8B 3UNRA 4AN7A 1Z1JA 4FUDA 3RXGA 2AGGX 1J8AA 1L1NA 5T6DA 1O5AB 5FXLA 5DP4A 4NFEA 2C90B 3ZVAA 1E0FD 2BVRH 3GS9A 1MD7A 3VB3A 4RSPA 3P6ZB 3MNXA 3U1IB 5L30H 2PKAB 4GCHF 1K22H 2FI3E 3I29A 1A4WH 4UEHH 1MKWH 4Y6DA 1AI8H 3OY5U 1VCWA 1T4VH 2WYJA 1PPBH 2XC4A 1THPB 3QN7A 4KGAA 1WCZA 1FDPA 1ARBA 1LVBA 4GUXA 1C2IA 1TAWA 1DLKB 5EG4A 2FOCA 4NGAH 4WMEA 2O9QA 2ZDAH 3E90B 2J38A 1GI8B 3BIVH 1VGCB 1DWEH 1NESE 1O3LA 4CRDA 3U8TH 3M3VA 4AGJA 3OU0A 5T6GA 2ZHEH 1FLEE 2J34A 3ZZ9A 1CHOG 1DM4B 1RXPA 4INHA 1ZRKA 3S9AA 4CRAA 1OPHB 1E35B 2IOTA 1ETSH 3OTJE 8GCHG 2ZTXA 1EJAA 4MNYA 3BG4C 4X1RU 1C5VA 1SLUB 3SJIA 4NIYA 1O36A 2ZWLH 2CJIA 1S84A 1CGHA 2V3OH 1XVMA 3GDUA 1GHVH 2CK3D 3ZZ8A 1P04A 3T27A 4A92A 4BAOB 1JBUH 2FX6A 2J97A 1GBFA 1MQ5A 1C5WB 4F49A 4H42U 2HWLB 1SHYA 1O37A 2RA3A 4Y0ZE 3S7KB 2ZKSA 2XC0A 2UWOA 2XTTB 2Q6FA 4GCHG 2ZCHP 1L2EA 2I6SA 2HLCA 4FVDA 2QXHA 2Q6DA 2HNTE 1CT4E 2YMSD 3DUXH 3HGNA 3QTOH 1GI9B 5F53A 3SZNA 5C3NA 3M5OA 5JB9S 2QGRA 3KQDA 1HLTH 1Y59T 2DE8A 2OQUA 3V3MA 1GL1A 3D65E 4LK4A 1OX1A 5TJXA 2Y6TA 1OOKB 3KIDU 3LU9B 6CHAC 4Q7XA 1TRYA 3VB7A 1IQMA 1V2QT 2ZFQH 1WXRA 1P2MA 2FLBH 3W94A 3WWBA 1B7XB 3MU0A 1V2WT 3TH2H 4O9VA 4A7IB 3JZ2B 1LVOA 5FHTA 2BX4A 3SU5A 2ZPQA 2NU0E 2SGEE 1MTVA 3L6PA 3LGYA 5T3HA 5BRRE 1FQ3A 2FDAA 3AVZA 3S0NA 1GBCA 5AVDA 3BTKE 4UE7H 2KZ4A 1L4ZA 1WQVH 3SUGA 2TGDA 2ZGBH 1PPHE 1O2WA 4K8BA 1TYNA 1LVYA 1Y8TA 3SGAE 1LKBA 1ETRH 2KM0A 1SGDE 4TWWA 1LHEH 4FUJA 1AKSA 1SMFE 4GVUA 1SGYE 3M36A 5C5OA 1DICA 1QCPA 5A09A 1O3FA 4MVNA 5EXMA 4AORA 4MTBA 1YCPK 3BN9A 3OEED 4X8UH 3NKKA 2Z3EA 1KLTA 1EAXA 2VGCC 4Y8XA 1DPOA 4XE4A 5FPSA 4UFEH 1N8OC 3U8RH 2NU2E 1NRRH 1A5HA 4FUCA 1PYTD 4B75A 5LH8A 3STJA 1YP9A 5HIZA 2O8TA 2NU1E 4U2WA 1B5GH 4FETA 3HATH 1JIMA 1A2CH 1FY5A 2UUYA 3QZQA 4I8HA 1C1VH 4JCNA 4AYVB 2WINI 1UVPA 2STAE 5CDFE 2BLQA 1ID5H 4D8NA 3GISB 2BY9X 3ZZ4A 1TPAE 1S0QA 2G51A 2VVCA 4ZROA 3AW0A 4X6MA 1NC6A 5GDSH 2SGPE 2CHAB 2J92A 2QF0A 3DD2H 5A8XA 4CRBA 3M7TA 5K0HA 1TALA 4X6NA 8LPRA 2A2XH 3SW2B 1GJBB 4ACBA 3VXFH 3A83A 1W3CA 1GWAA 1O3AA 1S5SA 3KQ5A 1KTTB 1TGSZ 1BTXA 2AERH 1D3DB 1HAVA 1SBWA 2SGQE 3SQEE 4I31A 3MU8A 1OWEA 2WUBA 2XC5A 4NSVA 2FTMA 4OM9A 2FS9A 1L0ZA 4TT3D 1IQFA 1YPEH 4ZUHA 4R0IA 4X2XA 2XW9A 2F4LA 2P59A 1Y3WA 1O32A 3M5NA 4E06H 3RXUA 2GCHG 2VIVA 1HJAB 1O35A 1VZQH 4JK6A 4GHQA 3DFLA 1DT2A 7ESTE 1WBGB 1MCTA 1DOJA 2F9OA 4Q80A 1GBIA 4UFDH 1RD3B 3UR6A 3RXKA 2FOFA 5TCCA 3T2NA 4HFPB 1RGQA 3BTHE 1CBWB 4IS5A 2J5UA 2OXSA 1SQAA 2JJ1D 2QF5A 1OS8A 2H1UA 3QGJA 5FBEA 2WV4A 3EE0B 3D49H 2GT7A 3F2FA 2D26C 1T8LA 3SHCH 4DIHH 4K3JA 5IYTA 1J17T 1AE8H 4JMYA 1BTWA 1IHTH 2ALPA 4B71A 4MPWA 4E7NA 2A45B 4GHTA 1RFNA 2CHAC 3BTFE 4R8TB 5T1VA 2C4FH 4TY6A 4A1TA 2V3HH 1TPOA 3F2GA 1DY9A 1ZRBA 5HYOA 2FZZA 2P8OB 5JBAS 2QA9E 1CA8B 3EDXB 1D3PB 3EA9A 3SZEA 3W95A 1QNJA 2M5TA 5CHAC 3ODFA 7KMEH 1PQ5A 4YOIA 1MZAA 1IQNA 1H1BA 2R3UA 1SB1H 1C4V2 3BTWE 3C1KA 4NZLA 3A7ZA 2BXTH 4IMZA 3LJJA 1MTUA 1UK4A 4JZFH 1ZHRA 2OC0A 2P95A 5FX6A 2A4GA 1AUTC 3I77A 1IQGA 3RM2H 1DE7H 1ANEA 3M7QA 1A1RA 1C2EA 5AFZH 3TH4H 4CRCA 4BNRA 2G52A 3SGQE 3SNBA 1C2MA 2BLOA 4AFZA 3RMNH 1V2KT 2P3TB 1ZJDA 1NBMD 2VINA 1RRKA 2A4OA 1ESAA 1D6WA 3UQOA 1C2HA 1HV7A 1ZMLA 1S85A 5BPEA 3WY8A 2J9NA 1A5IA 1O2JA 1GVZA 3RC4A 4MNXA 4X8TH 3GICB 1F0SA 3OEHD 2VU8E 2R3YA 4IN1A 2A2QH 1FV9A 1CU1A 5FL7D 3T29A 1U6QA 2KCOA 5C0UA 5DP8A 3T28A 3K6ZA 1BRBE 1GJ4H 4FUIA 2QXJA 2FIRH 2QF3A 4NA8A 4OS1A 1UTQA 2HNTF 3AASA 4X1PU 3O8BA 2P8OC 3MMGA 4IN2A 4LZ4B 3U69H 2ZGXH 1TBRH 1MTNB 1HBTH 4K69A 1DWCH 1NPMA 5E2PA 3EA7A 5EXLA 1BJUA 1PPCE 4Y7BA 3RMLH 2RG3A 1LQEA 1TNJA 2GZ9A 1FONA 4YO9A 1IQKA 1UW7A 1DY8A 3BEUA 3TJOA 1C4U2 1GBJA 2Y81A 3MH7A 4PROA 4Q7YA 5C67A 3STIA 3KEEA 1EJMA 4AB9A 2ZCKP 4X6PA 3MI4A 1G9IE 1ZMJA 4WH6A 4AB8A 3KYFA 1RS0A 1O2KA 3M61U 4SGAE 1O5FH 3TK6A 1ELGA 4Y79A 4AFSA 2XCFA 1V2TT 2GMTB 1NTPA 1VKYA 2R9PA 2B7DH 4KP0A 5KEDA 3LJOA 1SLWB 2RDLA 1CVWH 1V6DA 1ARCA 5DPAA 3SV8A 1NT1A 1ACBE 1J15A 1BDAA 5E2OA 2WV9A 1UHBA 4ABJA 3KNXA 4RKOB 4LOYH 1G3CA 3E6PH 4IC6A 1G3DA 2VIDA 2W3KA 1ZMNA 2BDHA 2ODQA 1XUIA 3OE7D 5DJ7A 2C8XB 5EGMA 4NA7A 2ZNKH 2VNTA 3RXOA 2FTLE 2OD3B 1YLNA 1O2QA 1HAXB 3A8BA 3VB6A 4FUHA 2F9VA 1OWIA 2BQ6B 3BF6H 4INKA 6LPRA 1AB9C 2ZDVH 1PQ7A 2ZTYA 2PKAA 2WHXA 2PFEA 1QRWA 3ATLA 1RIWB 1SPJA 1Q31A 1SGFA 3GCTF 3RP2A 5HM9A 1SR5C 1OP8A 1GI4A 4I33A 1SQOA 2CN0H 4ABDA 3FVFB 1BTZA 1CT2E 3MO9A 1A0JA 2WZQA 1YY3A 3S9BA 3PRBA 3UWJH 1SC8U 2HRVA 2PR3A 1F92A 3TNSA 3OSYA 1RJXB 4UFFH 2ZFFH 3NK8A 1GDNA 3LC3A 4TSFD 3RXDA 4X8VH 2GMTC 2QC2A 4WY3A 2JH0D 2HALA 4AGKA 2FP7B 1LMWB 4H6SB 3A8DA 1WDIA 2IN2A 3EQ0H 2QAAA 4Z0KA 4J1YA 2EI7A 4NG9H 1EAUA 3ZZ7A 1O2SA 1O3IA 3W1EA 1SL3A 2ZU1A 3NXPA 1O3KA 2PWXA 3DFJA 1YM0A 1C2JA 3QZRA 4X2WA 2F83A 1P05A 2ANMH 1IQJA 1XUHA 4AG1A 1HYLA 1LCYA 5EW1H 1G37A 3QX5H 4YOJA 1GHYH 1HB0B 1UVSH 2AEIH 3T5FH 4BAKB 1HCGA 4Y11E 1E79D 1A61H 1HXFH 1O30A 3D23A 1KDQA 1O3DA 2AGIX 5E0HA 1K1OA 4I8KA 2QV1A 1GVLA 4M9FA 5LPFA 3GY3A 5EU8A 1UK3A 1QB9A 1G3EA 3GY7A 4ZKNU 4FU9A 1O31A 1V2OT 1P2JA 2THFB 2Z3DA 2J95A 1GMDF 1BIOA 2UUKB 3A7YA 5DK1A 2IJOB 1S83A 5AF9H 2ANKH 1O3HA 1NRPH 4JYUH 7LPRA 2FI4E 4NWLA 1C9TA 2ALVA 2ZU4A 1FXYA 5CHBA 2PGBB 2H5CA 4ZH8A 3PLBA 1BRUP 3VEQB 2JDID 1QA7A 3ITIA 2Z9LA 1HIAB 3ZZAA 1VITF 2F9NA 4WJG2 1FPCH 2WPHS 4XDEA 5EJZA 1P9UA 3SGBE 5CMXH 4IBLH 2HPPH 1MUEB 2ZI2H 1O2PA 3UIRA 4YTAA 3DSOA 4CRFA 1HDTH 3KF2A 1HAOH 1GJAB 3RXEA 3SUFA 4MLFB 1TNLA 1G2LA 3NRLA 4O03A 3VB4A 1W10U 5C20A 1GI3A 2TPIZ 1A3EH 4VGCB 2KCPA 3SI3H 2QE7D 3NZIA 4UD9H 1QR3E 4AX9H 1H8DH 3GCNA 3IWMA 1FIZA 4HGCA 3BEFB 3MTYA 4FUBA 2AGEX 2B5TB 1TIOA 3EYDA 2CV3A 1HAPH 1C1MA 2WPKS 1F7ZA 3BSQA 1HXEH 2GDDA 5JPMH 1KMHB 2I6QA 3F2HA 5C2ZA 5DP3A 8GCHF 1LQDB 4Y0YE 4D7FA 2G00A 3TJNA 2G55A 4GAWA 5A0CA 3U1JB 1XUKA 1GI5A 3QO6A 1B0EA 1PPZA 2ZA5A 3KCGH 1NU9A 2P16A 3B9FH 8ESTE 4Y7AA 1J16A 1WUNH 1O39A 1VITG 3SU0A 4YM9A 1SGPE 1HAZB 1O2OA 1FY1A 4OS2A 2C3SA 1S0RA 2BDGA 2PTNA 1P8VC 1CT0E 1SLVB 3S9CA 1KYNA 3KN2A 2ZPRA 3M5MA 5FCKA 1NO9H 4XSKU 5GNDA 1KXCA 5C1UA 1XUFA 2BZ6H 2EC9H 5FPYA 5K7RA 1GHBG 3SU2A 2FWWA 1AY6H 3AW1A 3GY4A 3ODDA 1QJ6B 3F9FA 2BB4A 2FM2A 4GSOA 2R2MB 1ABIH 4ZHMU 4NIVA 2W26A 2JETC 4JZIA 2W6ID 3AK5A 4Y71A 1QHRB 3CENA 2ZP0H 3CNRA 2ZFRH 1GMCG 4P00A 2ZIQH 3SU4A 1FMGA 1TNKA 1RTFB 1EB2A 1ELBA 1KXDA 3EGKH 1SQRA 4H6TA 4BXWA 2V7QD 2GJGA 1UTOA 4BTIB 4NZQA 1YPKH 2NWNA 1H9LB 1QBVH 2VWLA 5EODA 1ZTJA 4O3UA 2XYAA 2Z7FE 1LHCH 4ASHA 1HJ8A 1TGCA 1WAYB 2G8TA 5B6LA 4ABBA 4ASUD 3MNBA 4AG2A 1HPGA 2QF4A 3CS7A 3PM3A 1QQUA 3A82A 4CREA 1KDQB 4F55A 1IQHA 3ATWA 1AVWA 1MH0A 1UTLM 1O3PB 1EAIA 1JXPA 1Z8RA 2QXIA 1SGQE 2EI8A 1RTLA 5CE1A 1AVXA 1C9PA 4KTSA 3F9GA 3NWUA 4X2YA 1UTNA 8KME2 1C1OA 1ABJH 4OS7A 2HVXA 1Z71A 5I25A 2STBE 2FOEA 1VGCC 3MO3A 2VIPA 1EP6A 3PTNA 3SU6A 3F0PA 3GY2A 3EAJA 1ELVA 4D9RA 1O2YA 3P8NA 1EXFA 1K21H 1P12E 1DX5M 3ENSB 1GGDB 1C5NH 2GZ8A 2H6MA 2R0LA 1O3BA 1P11E 1GCTB 4TPYA 4GLYA 4JK5A 5LPEA 1TRNA 3GDVA 3SYJA 2BXUH 5C5NA 1SOTA 1P2QA 2GCTB 1KY9A 2VH0A 3F3BA 4MPXA 1CGJE 1GDUA 3EA8A 3SV2H 1H8IH 1XVOA 2K0QA 5DKMA 1ZLRA 2BD8A 1C2DA 2JIZD 2TGAA 3VFEA 1MKXK 3TNTA 1FNIA 1DSTA 1WU1A 1YPHE 3LGTA 2GCHF 2ZZUH 4ISLA 2G5VA 4KELA 4IW4E 3LONA 1DITH 4DGJA 1SQTA 5JB8S 4Q7ZA 4ZAEA 1ZR0A 4RT1A 2ZC9H 2OC1A 1TMBH 3A86A 3LH3A 4GPGA 4JZEH 1C2FA 3QDZB 1QA0A 3QWCH 2ANYA 2B8OH 2XNDD 3M7UA 3RU4T 5JDUB 1TA6A 1EUFA 4Q2KA 2PUQH 3FFGA 1CSOE 2BM2A 3FAOA 1S6LA 1O2ZA 2BQ7B 2AMDA 3A81A 2NU4E 5E0JA 1P3EA 1EASA 1SGEE 2ZPSA 1TNIA 2W3IA 3RXSA 3SOSA 3KHVA 4K5ZA 1C5PA 4ABFA 1O2VA 1W12U 1KLIH 3VGCB 1CA0B 1GGDC 1K1MA 4WH8A 5G4BA 3A7VA 4WXIA 1TQ0B 1GCTC 2VJ1A 2YNBA 1SOZA 1AHTH 1JIRA 2ZCLP 2EQNA 1YYY1 1PJPA 4B2AA 2YMSB 3SUEA 1C1PA 4XOJA 4Y8YA 1O3OA 1SVPA 1AMHA 3ATKA 4ZXXH 4X0WU 2FODA 3RXJA 1TBZH 1F5KU 4DCDA 4FUGA 2HNTC 5T6FA 1GBHA 1HNEE 3PROA 1PFXC 1C2GA 1BITA 2W6JD 3FOAA 2F3CE 1PPFE 1V2MT 2GTBA 1Z1IA 2O8LA 1XM1A 2XBXA 5DG6A 3VG8A 3DSGA 1GI1A 1ZPZA 3HPTB 2M2AA 5F8XA 2ULLA 1SI5H 5IDKA 2A7JA 2CXVA 1YCPH 4ISIH 4BAHB 3U28C 6ESTA 1LHFH 1IQIA 1FY4A 2JJ2D 1ELFA 1T8MA 1TQ7B 4AYYB 2AYWA 3OAAD 3UNQA 1G2MA 2A5KA 3OTPA 4YXWD 1D6RA 1GJ8B 4A5TS 1QFKH 2AS9A 1EZXC 3MNCA 1YPMH 4O3TA 1NM6A 2ZTZA 2VVVA 4I7YH 2L74A 2HVYB 2ZU3A 1CA0C 3K65B 1LDTT 4E05H 1O2UA 4DURA 1TMTH 3DSPA 3P95A 2BDBA 2SFAA 1TPSA 1C1RA 3MU1A 2PKSB 2A1DB 3ZZ5A 1MU6B 4U32A 1UMAH 1NFXA 1H4WA 3E1XB 4D7GA 2ZHDA 1E1RD 1EKBB 4D9QA 1O33A 1HJAC 3TH3H 2PSYA 4X1QU 2GX4A 1DUEA 2BD7A 3TVJB 1FN8A 2V3MA 2BHGA 1E37B 3PMAB 3ZIAD 4MPVA 2PLXA 2FMJA 1TX8A 1WYKA 1MQ6A 2JH5D 1CBWC 4DW2U 1LHDH 2FOMB 9LPRA 1LKAA 2WPDD 1XKBC 5GJ4B 3SJ8A 1D9IA 5HGGA 1AN1E 1AFQB 4NIWA 1OXGA 1P2IA 4B2CA 2D1JA 3PO1B 1F2SE 2A5IA 2AMQA 1Z7KA 3F1SB 4AFQA 1BT7A 5F6MA 2J94A 4I8LA 1GG6B 3FZDA 3Q3XA 4KTCA 3RM0H 2BTCE 1LTOA 3PLPA 5C17A 1ESBA 1ETTH 1CE5A 1KIGH 2A0QB 2RDEA 3U98H 3OYPA 3UY9A 3ZZDA 3SNAA 3A7WA 4XFQA 1SGTA 1RTKA 1ZSJA
chains in the Genus database with same CATH topology
1QQ4A 3SHAH 3TGIE 3IG6B 4H4FA 3HK3B 5AHGH 2XBWA 3SO3A 1YC0A 1HIAA 1GMHG 1ELAA 2VWMA 4OS5A 1YKTA 2F9BH 1AFEH 1W8BH 1XMNB 5J4SA 1PYTC 2PKSC 4X6OA 1KXEA 2BDCA 1SGIB 1NFUA 1UTJA 5DP9A 4B74A 2BDIA 3QK1A 1THSH 2HOBA 4HZHA 2KAIB 2UWPA 2ZDMA 4Y8ZA 1F0UA 4ISOA 3PMJA 3F9HA 2BY6X 5F8ZA 3URDA 1YF4A 1UCYE 3I78A 3AAUA 2Y5FA 1GHZA 3MYWA 1AUJA 3RLYH 3GY6A 3VB5A 5JYIA 2OC8A 4A1XA 1JRTA 1HJ9A 1O5DH 2WPIS 5C1YA 4AOQA 3PMHB 4X1NU 1O3JA 1WTHD 3P70B 1TBQH 4IGDA 2FYQA 1GG6C 4DOQA 2BD3A 1EOLA 1G36A 2WPMS 1N6YA 2QIQA 1UVOA 4YOGA 2FOBA 2VIWA 2AMPA 1O5BB 1MTNC 1A5GH 1VJAU 1DVAH 1DWBH 1S6HA 3KQCA 3A85A 2UWLA 3ZVBA 5GWZA 2A7HA 5JBTA 3MU4A 1AO5A 2ODYB 3L33A 3PTBA 4TY7A 5PTPA 1BTYA 2GV7A 3SJOA 1GI0A 3ZV8A 3LKWA 3A80A 4K8YA 1Q3XA 1BOQA 2WUCA 1V2ST 3SI4H 1O38A 2P3FH 1Q2WA 1DS2E 3SU1A 1BRCE 2AIQA 1EP5A 1XUGA 1ZYOA 7GCHG 1N6XA 3GCHB 3MH6A 3KQBA 4TYDA 1G32B 5JBBS 4YT6H 1FY8E 4K60A 4NWKA 2BD9A 4J2YB 1P0SH 1D4PB 5EW2H 3GYLB 4BXSA 1TGTA 5DP5A 2RCEA 1W0ZU 2OQ5A 1VCQA 3TITA 2V35A 2ZFSA 1GI6A 2ESTE 4CR9A 2BY8X 1Y3XA 1G3BA 1SG8B 2PSXA 1DANH 1AD8H 1AU8A 3UUZA 1V3XA 2RA0A 4CRGA 3GY5A 1BMMH 1XKAC 1ZGIA 4X1SU 5H4IB 3RXLA 1MKWK 2J2UA 1W7GH 4ISNA 3LGVA 5GIBA 2C8ZB 3RDZA 4ABGA 1RIWC 3KQEA 4JYTA 2HPQH 2Y7XA 2Z3CA 2H2ZA 2QY0B 1P03A 3P92A 3URCA 4ABAA 1ANBA 4WMFA 2GDEH 1IHSH 2BYAX 1P09A 3KGPA 5DGJA 2VWNA 3TK5A 2BLWA 4ESTE 2BOHB 2Z9GA 3PLKA 4K1SA 2BY7X 3SNEA 2EEKA 1EJNA 2FS8A 2IPHA 1YCPM 2P3UB 1W2KH 3GOVB 3RXHA 1TOCB 1TX6A 4AZ2B 1O3EA 3V12A 3SJ9A 1O2HA 4BOHA 1C5LH 1GVKB 3ESTA 3LH1A 3M3TA 1K9OE 1XX9A 3MH4A 1O3CA 2GZ7A 2G4TA 2PHBA 1LVMA 2FO9A 4RKJB 2AFQB 3VXEH 1GHBF 1TABE 1T32A 1DXPA 2ZHQH 3ZZBA 5A0BA 3UTUH 4NFFA 5A8YA 2BY5X 1BTUA 5I46H 2DUCA 2O8WA 3O8CA 1EZUC 2BD4A 3LC5A 1YPGH 1GMCF 1HFDA 1Z8JB 2OC7A 1GHAG 1KSNA 2ZU2A 3T26A 1P10A 1Y3YA 3BG4B 4Y10E 2OTVA 4XBCA 2FXRA 3G01A 1NY22 3F68H 3RXPA 4O97A 3A7XA 4WWYA 2FYRA 1C5YB 3A8AA 4ABEA 1F5LA 1K1PA 2JH6D 4YLQH 4HTCH 1ANCA 1K28D 1MBMA 2H9EH 2ILNA 3QUMP 1O3GA 3LGIA 3SN8A 1NFYA 2OCVB 1S6FA 3Q3YA 2D2DA 3DHKH 2F9UA 4M7GA 2FOGA 2BOKA 1PPEE 1GL0E 3SV9A 3UWIA 5GPIB 1AE5A 3NCLA 1J14A 2SGAA 4UONA 1THRH 4FVBA 1EPTA 1IAUA 4WVPE 4X8SH 2PUXB 6GCHG 6CHAB 1Y5BT 1O0DH 2Z9IA 3KL6A 1TE0A 5FAHA 4TWYA 3HGPA 2CF8H 3LGUA 1BCUH 4FUFA 4Z6AH 2XBVA 3M3SA 1BB0B 4FU8A 4VGCC 3JZ1B 3T25A 2FESH 3QLPH 1V2LT 2ZFPH 4OS4A 1NRNH 4JZDH 2A32A 3D62A 2NU3E 2Y82A 3UR9A 4WMDA 1GPZA 4TPIZ 1AZZA 1LHGH 1SFIA 3RMOH 3ZZ6A 3A8CA 1OKXA 3ATMA 1WSSH 3S69A 5GXPA 4MDSA 1M9UA 1QRZA 2D8WA 1HAGE 3SV6A 1C1QA 1SGCA 1UTKA 2ZDLA 4YZUA 3U8OH 3IITA 1FN6A 1PQ8A 2Q1JA 2Z6BD 1NN6A 1Z6JH 1P06A 2V6NA 3ZV9A 1HUTH 1G30B 1P2OA 3K6YA 4BAMB 3LPRA 2VGCB 1L1JA 1X7AC 1ZSKA 1GJDB 1O5GH 1C1UH 1N8OB 4I32A 1BUIA 4MQAA 1T8NA 1C5UA 2WPJS 3A88A 1QGFA 3PWCA 2FEQH 1GBAA 1C5RA 2ZF0H 1QB1A 1T31A 1QIXB 3MH5A 1ELTA 1KXFA 1TONA 1GCDA 2BDYA 4RN6A 2BVXH 1AQ7A 1INCA 4ZKOU 3BTEE 3GDSA 5A2MH 2OBQA 4CH2B 4WXVA 1F0RA 1DXWA 5L2ZH 3P8FA 3S7HB 2H9HA 3UQVA 2ZU5A 1TPPA 1MU8B 1SSXA 4QT8C 4FU7A 1GJ7B 2ZECA 1K1IA 1O3NA 1QL9A 1QTFA 1YGCH 1O2RA 3M37A 4KKDA 1EQ9A 4FXGH 2F91A 1O2XA 3B23B 1VJ9U 1JWTA 2P93A 4K1TA 3TJUA 3UFAA 1TRMA 1FI8A 1EAWA 1FJSA 1TGNA 1Z8GA 3FP8E 2SNWA 4CBNA 1BQYA 3SV7A 3UOUA 1VCPA 4DJZB 1JMOH 1Z8IB 3SNDA 1P9SA 1MAXA 1NZQH 2BLVA 4U01A 2V0BA 2K1QA 3BV9B 1EOJA 4ZXYH 3Q00A 3VPKA 1OYTH 3UNSA 2GGVB 3E91A 4CHAB 1CQQA 2OP9A 1FZZA 2SNVA 3AAVA 3H7TA 5FPTA 4THNH 1OYQA 1MMJN 1WOFA 1T4UH 3MNSA 1EZQA 1TGBA 3ZVEA 1OP0A 1GI7B 1ZTKA 1GHWH 3L3TA 2ZG0H 1LPZB 3H5CB 1DFPA 1P02A 4DVAU 3K9XB 3TK9A 1GBDA 3CP7A 1T7CA 1BHXF 1GBBA 3F6UH 1XXDA 4A6LA 3Q3KA 1HAHH 1JOUB 3H7OA 1QBNA 1QURH 2FOHA 4OGYA 1XUJA 1GJ6A 1S81A 3A7TA 2G4UA 2Y80A 2W7SA 2A7CA 2VB0A 5DP7A 1W13U 1BRAA 1F0TA 4YESB 3LDXH 1V2PT 1GI2A 5J4QA 1O2IA 1HAIH 2ANWA 1EPTB 2W7UA 2KAIA 1GDQA 2VVUA 2VH6A 1IQEA 3C27B 3E3TA 4MPUA 2C8YB 1BMLA 5EOKA 5ESBA 3RXTA 1NS3A 2GCTC 5CHAB 5EPYA 3ZZCA 4D76A 2BMGB 3HKJB 3LT3A 4I8GA 1W11U 1ZOMA 1TOMH 3ZVGA 1AIXH 5FX5A 2YNAA 2A5AA 3PWBA 4B2BA 1JRSA 1HGTH 2FPZA 4ZHLU 2ZQ2A 2OLGA 4CHAC 4OGXA 3F9EA 1TLDA 5AFYH 1DUAA 3RXVA 1L4DA 4DIIH 2QYIA 1OWDA 1ANDA 3OY6U 1TNGA 1C2LA 1P3CA 2F9PA 3LGWA 1TNHA 3E0NB 5ETXA 3BTTE 1C5QA 1Z6EA 1C1WH 3ZVDA 1CGIE 3ELAH 5ABWA 1B0FA 2GD4B 1ELCA 2SGDE 2SGFE 3MO6A 1C1TA 3RU4D 3BTME 1E38B 2C8WB 1C5TA 2R2WU 2Q6GA 2CMYA 1UTMA 3T62A 4ABHA 1OWHA 1ZSLA 2BQWB 3SBKA 1FAXA 1WQSA 5F03A 3QTVH 3O8RA 2Z94A 1C5ZB 1MTSA 1O2MA 4ZKRU 4CBOA 3DA9B 4SGBE 1S82A 2VIOA 1QL7A 4B1TA 2A4QA 2CGAA 1MKXH 1SGFG 1SFQB 1ZTLA 5HMAA 3SU3A 1BBRK 1EPTC 1FIWA 1MTWA 1PQAA 1TFXA 1ZJKA 3VGCC 1YLDA 3RXMA 4MG3A 1MZDA 3RC5A 3BEIB 1KLJH 1ORFA 1H9HE 1P01A 3LOXA 1ZZZA 5FBIA 3RXQA 1DSUA 5A8ZA 3E16B 1MCVA 1GHXH 1OSSA 1SLXB 5EQQA 1GMHF 4IMQA 3TJVA 4CR5A 3HKIB 1BMNH 1TX7A 1O2TA 1W14U 1C5OH 3MOCA 5SGAE 5JBCS 4LZ1H 5B6OA 2BD2A 1C5XB 1E34B 1Y5UT 4JYVH 1GJ9B 3LIWA 3RXFA 1VR1H 3U9AH 1YPHC 2TBSA 1IOEA 1ZGVA 2O8MA 2ZEBA 1BBRE 5E8EH 2GP9B 1V2NT 3BTGE 1WV7H 3PV4A 1AKSB 4DT7B 1KTSB 3E0PB 2ZHWH 1EZSC 2FX4A 3RU4E 3UOPA 1PPGE 1GJCB 2LPRA 5EPNA 3R3GB 2J4IA 4UFGH 1O3MA 1BJVA 2B9LA 4BANB 4ABIA 2BD5A 5DP6A 2PTCE 1HRTH 2B0FA 1AWFH 3PMBB 1O2NA 1C2KA 1TMUH 2QN5T 2UUJB 4YLUA 1UCYK 1P57B 1HAYB 3RXIA 2R0KA 1EX3A 1TWXB 1SGNE 1VITH 1SHHB 3N7OA 4IC5A 1OWKA 1KXBA 3RXAA 1NRSH 1AB9B 1F5RA 3FANA 1P2KA 1NROH 3A87A 1D3QB 4ZHAA 1Y3VA 5EQRA 5L2YH 3SORA 2QCYA 1V2UT 3TU7H 1D3TB 4KTUA 1LO6A 2H5DA 3V7TA 4BTUB 1ELEE 2WPLS 1W7XH 3ZVFA 1L1GA 2OBOA 1UO6A 5ESTE 1MD8A 3TLOA 2FI5E 2BX3A 3PYHA 4AFUA 4I8JA 3RLWH 1O5EH 3Q76A 1NFWA 1HAVB 9ESTA 1H9IE 2G5NA 3P8GA 1O5CB 2UUFB 3P8OA 2G81E 1AZ8A 3O8DA 7GCHF 1AFQC 1YBWA 1QY6A 5L6NH 1FPHH 2YOLA 3PO1C 1ELDE 4INLA 1BBRH 4K1EA 4NCYA 1QJ7B 4B76A 1C1SA 3R0FA 2BZAA 1Y3UA 1NRQH 2GVFA 2ZDKA 4ZKSU 4U30A 2GV6A 1A46H 1TB6H 1XXFA 4XBDA 2DE9A 3ATIA 4XBBA 1DDJA 1K1JA 2LNCA 5C1XA 1O2LA 4A1VA 2A4RA 2Y5HA 2AH4X 1V2VT 1P2NA 1C5SA 4OS6A 1ESTA 1ZHMA 2WYGA 1UJ1A 3TGKE 3TIUA 2XCNA 3UREA 4UDWH 1K1LA 3V13A 2ZHFH 1YPJH 2O8UA 2PW8H 4ZMAH 3CS0A 4E7RG 3A84A 2FLRH 3M5LA 5LGOA 4MNVA 2VWOA 1WTGH 1EATA 4K2YA 4LXBH 1LPGB 3PB1E 4YT7H 1W0YH 1AVGH 2Z9JA 4HI3A 1V2JT 1K2I1 1ZPBA 1K1NA 2ASUB 1MBQA 3FP6E 3QGNB 3ZYEA 2PGQB 2Y5GA 3P17H 3GCOA 5E0GA 2ZFTA 2Y7ZA 1C1NA 1QL8A 1KXAA 2TGTA 3SQHE 1OWJA 3K2UA 2XRCA 1EB1H 2XBYA 3MU5A 3TPIZ 1ZHPA 1UCYH 3ZVCA 2WV5A 3NUMA 2XWAA 4F4OC 2ODPA 1TA2A 4B73A 1GJ5H 1T8OA 2XWBI 3BTQE 4ISHH 5FCRA 3MFJA 2ZDNA 1BA8B 4Y76A 2FOAA 3FZZA 5LPRA 1NU7B 1GBKA 5GCHF 1LPKB 2H9TH 2TIOA 1CO7E 2HGTH 2A31A 3GCTG 5EQSA 2ZGCA 1GBEA 2EA3A 4NA9H 4WF8A 4NIXA 1OP2A 2W5EA 1IQLA 1BMAA 2OUAA 1GHAF 4DG4A 3UPEA 1QBOA 3TGJE 1QJ1B 2ZGJA 1AGJA 3BTDE 1QRXA 2P94A 2PV9B 1V2RT 2XXLA 1A7SA 2GKVE 5A0AE 1C4Y2 1UVUH 2Z9KA 1FUJA 3GCHC 2TRMA 3SNCA 4X2VA 2VIQA 1BZXE 3DT0H 2ZQ1A 3RXCA 1C5MD 3NPSA 3RUOA 1BTPA 1YLCA 3ZZ3A 1Y5AT 3RXBA 5TCAA 1E36B 1UTPA 5DO4H 2CF9H 1J9CH 3V0XA 5HM2A 1CHGA 1ZPCA 1GBLA 5GCHG 2XNIA 1UVTH 1YPLH 2AIPA 6GCHF 3GY8A 3MWIU 1O2GH 4BAQB 2ZGHA 4MNWA 2EI6A 1A0HB 3Q77A 4BTTB 3OX7U 4DY7B 3GYMA 2QXGA 2JETB 3SJKA 3M35A 3MHWU 1A0LA 4JZ1A 4NSYA 1DLEA 3B8JA 3E8LA 1BHXB 5HXFA 4FUEA 1AWHB 1MAYA 1UK2A 5EXNA 2TGPZ 3BG8A 1QB6A 1A3BH 3HK6B 1SGRE 2GT8A 1GBTA 1BTHH 1N1LA 1UHBB 1GBMA 2ZO3H 3FP7E 1DWDH 1GMDG 3ZYDA 1CHOF 2C93B 1FY3A 2BDAA 1O34A 3SUDA 3RMMH 1FAKH 3A89A 2JKHA 2BVSH 3BIUH 2OINA 5F8TA 3RXRA 3RC6A 4CH8B 3UNRA 4AN7A 1Z1JA 4FUDA 3RXGA 2AGGX 1J8AA 1L1NA 5T6DA 1O5AB 5FXLA 5DP4A 4NFEA 2C90B 3ZVAA 1E0FD 2BVRH 1MD7A 3VB3A 4RSPA 3P6ZB 3MNXA 3U1IB 5L30H 2PKAB 4GCHF 1K22H 2FI3E 3I29A 1A4WH 4UEHH 1MKWH 4Y6DA 1AI8H 3OY5U 1VCWA 1T4VH 2WYJA 1PPBH 2XC4A 1THPB 3QN7A 4KGAA 1WCZA 1FDPA 1ARBA 1LVBA 4GUXA 1C2IA 1TAWA 1DLKB 5EG4A 2FOCA 4NGAH 4WMEA 2O9QA 2ZDAH 3E90B 2J38A 1GI8B 3BIVH 1VGCB 1DWEH 1NESE 1O3LA 4CRDA 3U8TH 3M3VA 4AGJA 3OU0A 5T6GA 2ZHEH 1FLEE 2J34A 3ZZ9A 1CHOG 1DM4B 1RXPA 4INHA 1ZRKA 3S9AA 4CRAA 1OPHB 1E35B 2IOTA 1ETSH 3OTJE 8GCHG 2ZTXA 1EJAA 4MNYA 3BG4C 4X1RU 1C5VA 1SLUB 3SJIA 4NIY