1YLDA

Trypsin/bpti complex mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDAGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin II
publication title Partially folded bovine pancreatic trypsin inhibitor analogues attain fully native structures when co-crystallized with S195A rat trypsin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/inhibitor
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yldA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yldA02
4YM9A 3MHWU 2BZAA 3GDVA 4X2VA 1MKXK 3E8LA 2PUQH 1UVSH 2FPZA 2OC0A 1SGNE 5EXMA 9ESTA 3QUMP 4MVNA 1DDJA 1A3BH 1CHOF 1RGQA 1VITF 2HLCA 1KLJH 1ZPZA 5DP3A 1J14A 3EQ0H 2J95A 1CBWB 4HI3A 3ZYEA 4X1QU 2DE9A 3MI4A 3BEIB 1RD3B 1O2TA 1S82A 3KNXA 1NTPA 3CP7A 2BD4A 2PGQB 3CS7A 4DVAU 2HPPH 3P8FA 1TRMA 3RXOA 1T31A 4NCYA 2BD8A 2SGFE 1DWDH 2PKAB 1O5GH 3TGKE 3T27A 3PROA 2XWBI 4DW2U 1TNKA 1SR5C 2Q6GA 1DM4B 2ESTE 1RTFB 5C2ZA 4WXIA 3O8BA 4ZH8A 4FUEA 2HNTE 3MO9A 4H6SB 2Z9LA 4FUIA 4XBBA 1W7XH 1UTJA 2A4GA 3MNSA 3SQHE 1EAUA 1WYKA 1RTKA 4WMFA 5A2MH 3SU2A 3KIDU 2QV1A 1C2EA 1SGTA 2HNTC 3MU4A 2GV7A 2CV3A 2ZFFH 5JPMH 2BY9X 1GI1A 4NIYA 4NFEA 2BX4A 4IS5A 3LGTA 2OQUA 3TIUA 3VB7A 4GUXA 3VB6A 1SB1H 1Z1IA 1CA0C 1AB9C 3GCHC 1TOCB 2F3CE 3QTOH 3VEQB 2FXRA 3LDXH 1BZXE 5H4IB 1NO9H 2ANYA 4K3JA 5HMAA 2ZEBA 5LH8A 1FIWA 2FI5E 1Y5BT 3P70B 5A8ZA 3A82A 1KY9A 1TGTA 3OYPA 1MH0A 4GVUA 1GMDF 3TH3H 3U9AH 2AGIX 1Z6JH 1MD7A 2OXSA 1F2SE 4KKDA 4A92A 2QXGA 2H9HA 4Y76A 1UVOA 1ACBE 2R3YA 1FXYA 1NFYA 1Q2WA 2FI4E 3SU1A 3P95A 2ZFTA 1EUFA 2PKSC 3LC3A 3T62A 2ZNKH 2SGQE 2VGCB 3M5MA 1DWBH 2P3FH 3UOUA 1FNIA 2XBXA 2FOGA 2JH6D 4CRBA 7LPRA 1TNGA 3LONA 3NK8A 1O2KA 1V2UT 2ODPA 2Z3DA 5L30H 3DFJA 1SOTA 3C27B 2BY7X 3UWIA 1GI0A 2XBYA 8LPRA 1K1MA 1ELFA 3MH6A 3EDXB 1CHGA 2UUFB 1G3DA 2H6MA 1TMUH 1HJ8A 1ZMLA 4ESTE 3OSYA 2PHBA 3GDSA 1C1TA 1EZUC 3ATIA 4MG3A 1EPTA 1O2XA 4MPUA 1HAYB 4IW4E 2ZDAH 2BDAA 2BLOA 1BMMH 3BIVH 1HAHH 4U2WA 1FONA 1TFXA 2F9PA 3PYHA 1THRH 2VVUA 3RXJA 5LPRA 1HB0B 1YPHE 3D23A 4X8UH 1AFQB 2H5DA 1OP8A 1UTKA 4XFQA 4Q7XA 1AVGH 4FVBA 1SMFE 1BTHH 1BMLA 1ZPCA 1HCGA 1SLXB 1YPHC 4UFDH 2A7JA 1IQEA 4CRDA 1EB2A 3W95A 4AB8A 3LU9B 2A5KA 4AFQA 1EPTC 1BBRH 1O2YA 5ESTE 3S7KB 1K1NA 1ZJKA 3MNXA 3M37A 1K21H 3E6PH 2ZFRH 2FODA 2ZHFH 1SI5H 1AO5A 4J2YB 2ZHDA 2ZU4A 3QGJA 3VGCC 1YF4A 1OXGA 1NU7B 1MD8A 1UTLM 4TWYA 2B5TB 1MKWK 3SJ8A 3VXFH 1HAIH 2BQ6B 4AX9H 1Q3XA 3BN9A 2BQWB 2AIQA 3UUZA 1HUTH 2WYGA 1UO6A 5C20A 2HPQH 3PLKA 2OD3B 2ZQ1A 5JB9S 1O2IA 1TBQH 3URDA 1FY8E 1QTFA 1LVOA 1LO6A 1O3NA 5AFZH 2J4IA 1WQSA 1GI9B 1A3EH 2G51A 2F9VA 4OS6A 4INLA 1OS8A 3RXBA 3F9HA 1JMOH 1KXCA 3SNDA 2HRVA 2TGPZ 1GG6C 2XRCA 5AF9H 1W0ZU 1AD8H 3ZZ7A 3LKWA 1GJ8B 2OC1A 3TNTA 4A7IB 4X2XA 4AOQA 1G36A 1H1BA 1H8IH 2WUBA 1O38A 4ISIH 2R2MB 1HAVB 1INCA 1PQ8A 1AFEH 1H4WA 1O3FA 1Z8RA 3C1KA 2V3HH 2QCYA 1QGFA 4GCHF 2H1UA 1TPAE 4LXBH 2FX6A 5DK1A 3MU8A 1GBFA 1J15A 4I8JA 7KMEH 1S85A 2BD3A 1E0FD 1KLIH 1MUEB 1C5UA 1YLCA 2I6SA 1P3EA 5C1YA 1QIXB 1ELEE 2UWPA 3A7ZA 3FANA 4WH8A 1DFPA 1FV9A 1ZGVA 4I8GA 2AH4X 1UTOA 4ZXXH 4JK5A 3ZV8A 2AGGX 2VIDA 3VB5A 4Z0KA 1GHAF 3Q00A 2A4OA 4CBOA 2A32A 2BZ6H 5GJ4B 1NFWA 2ZHEH 1CT4E 1MBQA 1GMHF 1OSSA 1TLDA 3ZVDA 3SU4A 1PPCE 1S83A 2FLBH 3BTQE 1NN6A 4AGJA 1O2UA 3A8CA 2WV4A 1KXBA 1GBKA 1HJAB 2GT8A 1XKBC 1ZSJA 1EXFA 1EZQA 3ATLA 2XBVA 2A2QH 1GHWH 2P95A 4OS5A 7GCHG 5G4BA 1T7CA 1Z71A 2CXVA 1IHSH 3M61U 5EGMA 1C5MD 1YCPH 2ZP0H 5DO4H 1LCYA 1D6WA 1MTNC 1VCWA 3QGNB 4IMQA 4OS1A 5B6OA 3SJOA 1ZYOA 4XDEA 1C5VA 3RMNH 1A61H 3BF6H 3H5CB 4AORA 1W12U 1RJXB 2XWAA 1OYTH 1S0RA 4AFZA 3SBKA 1P2KA 4RKJB 3ZZAA 1MAYA 3GY3A 1RTLA 1S81A 1TMTH 2XXLA 3A8BA 1TB6H 3V13A 2Z9KA 4NFFA 3H7TA 1C1OA 2ANKH 4INHA 1QJ1B 3EAJA 3KEEA 1NU9A 5AHGH 5C5NA 3K6ZA 3ZVCA 2O8WA 4INKA 3M7QA 1YCPK 1Z8GA 1G3EA 1C5NH 2VWMA 3M36A 4U32A 4NWKA 1Y59T 2FM2A 3RXAA 2ZPQA 1QL8A 1A5IA 1QL7A 2VIVA 3A83A 1RIWC 2CHAB 1EQ9A 1W8BH 4FXGH 5TJXA 5FCKA 3RMOH 1GCTC 4X8SH 1SQAA 4F49A 1TOMH 1GVZA 1YM0A 4H6TA 1UCYH 3WY8A 2J92A 2GTBA 1T32A 2ZHWH 2GCHF 3EGKH 2EI6A 2JETC 3TH4H 3TK9A 1DWEH 4K60A 2FOHA 3E0PB 2OTVA 8KME2 2PKAA 2GGVB 4MNVA 5IYTA 1C2FA 2A2XH 2BY8X 1DXWA 1ID5H 4WF8A 1D3DB 4CHAC 1Y3WA 2BXUH 1PPZA 1P2QA 2KAIB 1ELVA 2FMJA 1Z6EA 2BY6X 1SLVB 4BAMB 6GCHF 5GDSH 1SSXA 1ABIH 1GCDA 2GCTB 1S6HA 1CBWC 3M3VA 2PSXA 1W2KH 3BEUA 1IQKA 1UCYK 2A5AA 3A86A 1YPGH 1BRCE 1P10A 1T8MA 1GI3A 1TRYA 1BTYA 1O32A 4ZKNU 1RFNA 2V35A 4TPIZ 3SV9A 4X1SU 1ELDE 5L6NH 2VVVA 4ABDA 1DICA 1FY4A 1O3HA 2BX3A 2PFEA 1KXFA 2XC0A 1THPB 1K2I1 3Q3XA 2ZDKA 4CRAA 1ESBA 1SL3A 2GMTC 4MTBA 2FLRH 1J16A 1SGRE 3GY7A 1L4DA 6LPRA 1GPZA 3ENSB 1O31A 4J1YA 5JBBS 4D9RA 3RLYH 1MCTA 1HAOH 1F5LA 2ZGBH 5GCHG 3TJUA 1FAXA 1LVBA 1K1PA 1EASA 1WV7H 1LPKB 1BTWA 1TPPA 3RC5A 2FOFA 1P12E 2AMDA 2J34A 1OWJA 1V2KT 2VIQA 3HGPA 4CR5A 2P59A 1HPGA 1MU6B 3HKIB 3U98H 3GY2A 5DGJA 4PROA 1T8OA 1W10U 3EYDA 1QB1A 2BLVA 4BAOB 1BMAA 5EPYA 4Y0YE 4LK4A 3FAOA 2ZDLA 4AG1A 1XUFA 1MAXA 3MO3A 2B0FA 1KTTB 3MH5A 1TX8A 3RXCA 2P8OC 1AVWA 2O9QA 2XNIA 1C5SA 2Z7FE 4YLQH 1ETTH 5FAHA 1NFUA 2A4QA 3RXGA 4DT7B 3ZVBA 3V3MA 3HATH 1O3PB 2F9UA 1TNLA 4Y0ZE 3UNQA 1JIRA 1O2PA 1P2IA 2SGPE 1LQEA 1DLEA 1IOEA 2ULLA 1HAGE 1F0UA 2ILNA 1HYLA 1QA0A 1XUIA 1C2JA 3GY6A 2Q6DA 5K0HA 2QF0A 1ELBA 3QLPH 2VIPA 4TY6A 4A5TS 1WTHD 1QY6A 2IOTA 4ZHAA 2GZ9A 1O37A 1PFXC 4LOYH 2RCEA 5T6FA 3RXPA 4A1TA 1XUHA 5LPEA 1V2VT 1A0LA 4H42U 1O3AA 2VH0A 1HAZB 1G9IE 1HFDA 2FP7B 3MWIU 1L1GA 1NRQH 2ASUB 2VINA 4HGCA 4JCNA 1AI8H 3KN2A 3BG4B 3DD2H 4IMZA 2AFQB 1KXAA 2V6NA 5C1XA 4JZIA 5FPYA 1C5LH 1N8OB 5CMXH 1GMCG 1C4V2 3U8TH 4BTIB 2OP9A 1BITA 4CH8B 1FAKH 4B75A 2GDEH 1O2HA 2NWNA 4GAWA 3I29A 1TNHA 1G32B 2CN0H 5SGAE 1GBCA 1LTOA 4ZKSU 2FYRA 3P8NA 4FUFA 2VVCA 1D4PB 2C3SA 1BTZA 1TA6A 1TALA 2OC7A 4WJG2 1AZZA 3AAVA 3NKKA 5EODA 4Q80A 1W11U 4KTUA 2TGAA 3MOCA 4ISNA 2SNVA 2A5IA 4Y11E 1O2NA 2BVXH 2ZKSA 4B2AA 3QN7A 3TK6A 3RXUA 1W3CA 4B2CA 1SGQE 3ATKA 3S7HB 3DHKH 5EU8A 1B0EA 2J94A 3CENA 3V7TA 2ALVA 1FY3A 1P05A 1VCQA 2FWWA 2TGTA 2Y7ZA 4Y8ZA 5E0GA 1EJMA 1HDTH 4OGYA 1HAVA 2VH6A 1QHRB 1WQVH 4IC6A 2TGDA 5EQQA 1QRZA 3UIRA 4FUHA 4CREA 2ZHQH 2FTLE 1VCPA 2AYWA 1A0JA 1O5FH 1WAYB 2GT7A 1C2HA 4IGDA 1RS0A 1YPLH 3OTJE 1GBEA 4JZDH 4NGAH 1C2GA 2G81E 1OWIA 1BA8B 3SU5A 1GWAA 4D9QA 1C1RA 1QBVH 3KQDA 1C2LA 3D62A 1DY9A 3SU6A 1X7AC 2R2WU 3GYLB 3RXKA 1TNJA 2W7UA 1GJCB 1TBRH 3H7OA 1S0QA 3EA8A 5HGGA 1Y8TA 4MPWA 2A31A 5EPNA 1QB6A 4B74A 1SG8B 2FTMA 3AAUA 1F92A 1D3TB 1DXPA 3OU0A 4ISHH 3F9EA 3TH2H 1NC6A 3RM2H 4WMDA 3SJKA 3K9XB 4JYUH 1GHZA 1O2RA 5JBCS 3SOSA 1E36B 1JIMA 1NESE 1V2PT 1FQ3A 4DGJA 1GGDC 1P9SA 4VGCC 4X8VH 2B9LA 4ZHLU 1MTWA 1K9OE 2ZCKP 2ZI2H 2A7HA 5DP7A 1M9UA 4YT7H 1SGDE 4GSOA 3L3TA 3LJJA 5K7RA 4OS4A 4I8LA 1TWXB 1WTGH 1SGFA 1AE8H 3RC4A 1HAPH 3TLOA 1EAIA 4ISOA 1ZPBA 2GVFA 1VJ9U 2UWLA 1A2CH 1YPKH 4NZLA 2HOBA 3A80A 2ZWLH 1LDTT 3E91A 4BXWA 8GCHG 4QT8C 1O5BB 3T28A 2CMYA 5J4QA 3RLWH 3KHVA 1GDNA 3QZRA 3B8JA 4K5ZA 4B1TA 2H9TH 1SC8U 3RXHA 2AERH 2H5CA 1DUAA 5E2PA 4E06H 3MFJA 1HJAC 1MQ5A 2C8XB 1V2NT 4FUGA 4KTCA 2BLQA 2G00A 5CHAB 1KYNA 1BJUA 3ZZ6A 2BOKA 4IN1A 5EG4A 2BM2A 3M7TA 3UQOA 1GJDB 1WOFA 1CHOG 1VITG 3FP7E 1D6RA 2FOMB 1O3LA 3S9CA 3D65E 5HYOA 3STJA 2TBSA 3SW2B 1PJPA 1V2TT 1F7ZA 1ZR0A 3ELAH 5I46H 1QURH 3PWCA 1MKWH 6CHAB 1GDUA 1W7GH 1CU1A 1TBZH 4IN2A 4Y10E 3T2NA 1O5EH 4B73A 2Z9GA 1F5KU 3R3GB 4YOIA 1OPHB 1EAXA 3K65B 2ZDNA 3HK3B 2ZQ2A 1Y5AT 1A7SA 1BB0B 2BDIA 1TMBH 5DKMA 1O2MA 1B7XB 1VGCC 3TVJB 3U8RH 2D2DA 4NA9H 4X1RU 1SGCA 1FN8A 2RA0A 1HBTH 4AZ2B 2Z3CA 2ZPSA 2BYAX 5AVDA 5EXNA 1C5RA 2FZZA 2PR3A 2I6QA 4WWYA 1LHEH 4YOJA 3S0NA 2BLWA 3A7WA 5DJ7A 4DCDA 2THFB 1QQ4A 1BIOA 1K28D 3K2UA 1RRKA 1EJAA 2XBWA 1Y3YA 1KLTA 2KAIA 2ZU1A 1TE0A 4K1SA 3GY8A 3NZIA 1O3OA 3SGBE 2FOBA 4MQAA 3KCGH 3DT0H 3Q3KA 3ODDA 2A7CA 3RC6A 3GY5A 4Y8XA 1T4UH 3O8RA 1GMDG 1EP5A 2BDCA 1AY6H 1QJ6B 2CJIA 3L33A 3EA7A 3PMHB 1Q31A 4HFPB 1FDPA 2NU3E 1BBRE 4WXVA 3OX7U 2UUKB 2GDDA 3NXPA 4OS7A 1NPMA 4FUBA 1C9PA 5DP6A 5FX6A 3GISB 3HGNA 1O3BA 1PPFE 3RU4D 2FYQA 2G8TA 3BTME 1QA7A 1JOUB 1UTPA 3HK6B 2GCTC 1O5DH 1H9IE 2ZTZA 3SNCA 2FX4A 3GCTF 2PSYA 1CA0B 1AB9B 3GCHB 2BD5A 1UVUH 4ABJA 2BDHA 1BTXA 2HWLB 1C1MA 4NSYA 4ZUHA 1ELTA 3SUDA 1ZRKA 3OY6U 1GBIA 1NROH 1P09A 1ELGA 4JMYA 1JXPA 2BY5X 3SUEA 1XMNB 4DJZB 2QA9E 3ZZ5A 1K22H 4HTCH 3MU0A 1IQGA 2WPKS 2ZIQH 1V2JT 3LJOA 1C9TA 1EOLA 2OCVB 3UR6A 4X6OA 4DY7B 3KL6A 1O2ZA 2P3TB 1LHCH 4SGAE 5EW1H 2P16A 1KSNA 3P8GA 3SNAA 1PQ5A 4O9VA 3ZV9A 3GOVB 5IDKA 1N6XA 1IHTH 5C5OA 1CO7E 2QAAA 1C1VH 1LVYA 3BIUH 3SI3H 3ITIA 1DS2E 2D8WA 5AFYH 1ESAA 2RG3A 1Z7KA 3HPTB 1KIGH 1XKAC 3B23B 3HKJB 4ABAA 4BXSA 1GDQA 2W26A 2A4RA 3FZZA 2CF9H 5GWZA 4NSVA 3FVFB 2JH5D 4NG9H 1B0FA 1ANEA 1P2MA 1V6DA 4XSKU 3FZDA 2P3UB 3NCLA 4YLUA 2RA3A 1SHHB 2A1DB 1GHBF 3QK1A 1MBMA 1S6FA 2FIRH 2OQ5A 4Y71A 3RU4E 1O5CB 3ZZ4A 3FP6E 2YOLA 4ABFA 1O0DH 4IC5A 5FPTA 4K1EA 4UFEH 4OS2A 1MMJN 3UWJH 4UEHH 2ANWA 3AW0A 3RUOA 3D49H 4TPYA 4IBLH 1GL1A 2A45B 3N7OA 5E8EH 4BAQB 1AQ7A 1RXPA 2WPJS 2LPRA 3BTKE 1WSSH 1C2DA 4O3UA 2Z3EA 3FFGA 3MO6A 1F0RA 5HXFA 1O3EA 2WPMS 2GZ7A 5A0BA 3M3TA 3LGUA 2C8ZB 4I31A 2FOAA 1MTSA 1CT0E 2Y5GA 3GICB 2NU4E 4D7FA 3PTNA 2ZU3A 2VWLA 4NIWA 4JZ1A 3VGCB 1SGEE 1ZSKA 1GJBB 1U6QA 2QXHA 3BG8A 4NA7A 3QZQA 4JYTA 3A8DA 4GCHG 1BQYA 1GI8B 3A88A 2WV5A 1Y3UA 1QBOA 3BTEE 1MU8B 2H9EH 3M3SA 1FMGA 4BTTB 1PQ7A 1GJ6A 1TQ0B 1E35B 1PQAA 1ZHMA 1XUJA 3VFEA 1GHXH 2V3OH 1SQTA 1AHTH 1UJ1A 3LGVA 3A7VA 1EZXC 4YO9A 1HLTH 1V2WT 4Q7YA 2PUXB 5FBEA 1GG6B 2EA3A 3ZZ9A 1P8VC 1ARCA 1O2OA 4XOJA 2STBE 1GHAG 2QC2A 2QYIA 2PW8H 2VIOA 3BTTE 2ZFQH 3TPIZ 3P92A 1GBTA 1C1PA 2R3UA 1SGFG 3ATWA 1GMHG 4X0WU 3GYMA 4X1PU 1VZQH 3KQBA 1EJNA 2WINI 2Y7XA 2R9PA 3M7UA 1YPEH 1SLUB 1L0ZA 3PB1E 3LH3A 4FU7A 1HIAB 1YLDA 4Q2KA 1GI2A 8ESTE 5DPAA 3SQEE 1UCYE 2FOCA 4ZROA 1GBJA 4MPVA 3S9BA 3CS0A 2J2UA 4X2WA 2QIQA 1Y3VA 1P9UA 3LIWA 3V0XA 1SFQB 3A8AA 3T25A 2ZG0H 4GPGA 1TRNA 1KDQB 1MCVA 1OYQA 1P2OA 1YPJH 2VWOA 2PWXA 4O03A 1C1UH 1GJ9B 1C1QA 4DOQA 3AVZA 1TPSA 3UNRA 1FJSA 1ZMNA 3UR9A 1HV7A 3LPRA 4UE7H 1O3DA 1F0TA 3DFLA 3E3TA 3G01A 5LGOA 4Y7BA 4CBNA 3RXVA 3ESTA 1TGCA 3ZZDA 1S5SA 3RMLH 1A0HB 1BRBE 2VB0A 3EE0B 1G3BA 1PPGE 1QB9A 1WUNH 2ZGHA 2P93A 1HXFH 1P2JA 4X8TH 1SFIA 2ANMH 1ELAA 5T6GA 3UQVA 3A87A 4YZUA 2JH0D 4WH6A 5GIBA 1AZ8A 2CF8H 1C2KA 2QGRA 1A5GH 1J8AA 1IQIA 1WU1A 2VGCC 1K1LA 1LKBA 3QDZB 1P03A 3GCNA 4E7RG 3TK5A 3VB4A 2ZGJA 1BT7A 2ZZUH 1Y3XA 1BHXB 4KP0A 2SGEE 4ABBA 5FXLA 5TCAA 4JZFH 2G55A 3URCA 2K1QA 3UNSA 1DITH 4X6MA 1Z8JB 4DG4A 2GCHG 3S69A 1TIOA 1ZHPA 2AGEX 5CE1A 1Z8IB 1F5RA 1OWEA 2FDAA 4B76A 2W3KA 1CSOE 1GBLA 4CR9A 5T6DA 4CRFA 1AIXH 2GZ8A 2DE8A 2WUCA 1AN1E 1IQNA 2FS8A 2AEIH 1ZTLA 2BDYA 3LGWA 4LZ1H 1OOKB 1C5QA 1D3QB 5EW2H 2ZFPH 3RU4T 2WPIS 6GCHG 2G5VA 4LZ4B 1O3GA 5JYIA 1YGCH 3SU0A 4KTSA 2EI7A 2DUCA 3NPSA 1AFQC 1GJ7B 1RIWB 1G2MA 3RP2A 1UTNA 4TYDA 2ZTXA 2XW9A 1UTMA 4WVPE 4ABGA 1T8LA 1QL9A 1HNEE 4A1XA 1EZSC 2J38A 2O8MA 3JZ1B 2O8UA 4AB9A 1TNIA 1EX3A 1C5OH 1HJ9A 4KELA 2JETB 3T26A 1FUJA 1O3KA 1K1OA 5JB8S 1NFXA 3GY4A 2AMQA 2Z94A 1K1JA 4SGBE 2OC8A 4K8BA 4X2YA 2D26C 3SHAH 2Y6TA 5BRRE 5DG6A 3SU3A 2B8OH 1OWHA 3JZ2B 2O8TA 3ZZBA 2ZU2A 4CHAB 4RKOB 3SGAE 1SVPA 1ETSH 4K8YA 2C8WB 1TQ7B 1L1JA 1E38B 3LOXA 2ZO3H 3ZVAA 3LH1A 3QX5H 1BMNH 1G2LA 4ZAEA 1O3JA 2RDLA 1Y5UT 1TGNA 5TCCA 5C3NA 3U8OH 1NM6A 1TGSZ 1PYTD 1P3CA 1SGPE 3SN8A 4JYVH 2PV9B 2GKVE 1P02A 2GX4A 1V2RT 2R0KA 3DA9B 3SV6A 3ZZ3A 4BANB 3ZVGA 2PTCE 1KXDA 2F9OA 2BD9A 3F9GA 4NIVA 2GMTB 1TABE 4H4FA 3E90B 3U1JB 1GBBA 2Q1JA 1G3CA 1O36A 1CE5A 4FVDA 1V2OT 3PMAB 3A7XA 3ZYDA 3F6UH 3SHCH 5F8ZA 3PV4A 3UPEA 1VJAU 4DURA 4Y79A 2G5NA 1GHYH 1MQ6A 2NU1E 1YPMH 1GVKB 2SGDE 1GI7B 3VPKA 3W94A 4AN7A 3QTVH 1O2GH 1QFKH 1E37B 1O5AB 1O39A 2XYAA 4CRCA 1NT1A 3PM3A 3A85A 4MNXA 1N6YA 2JKHA 2NU0E 1QR3E 2ZDMA 4FUCA 2OBOA 1IQJA 3AW1A 2LNCA 3BTWE 4KGAA 2BDGA 3DUXH 1GI5A 1YBWA 1FLEE 1XXFA 2TIOA 2ZPRA 3UFAA 1MTVA 1AKSB 1AWFH 2GP9B 1O2QA 1IQHA 1OP2A 1FZZA 1BOQA 2J9NA 1P01A 1ETRH 5A0CA 1DLKB 3SGQE 3ZZ8A 2P8OB 1LPGB 3FP8E 2M5TA 1XM1A 1G37A 1YKTA 2F83A 3P6ZB 4BOHA 2F9BH 3KF2A 2Z9IA 1P06A 2W7SA 1IAUA 1EB1H 3VXEH 4AYVB 3RXFA 2HALA 3Q76A 5DP5A 1ZMJA 3PMBB 3PO1B 3UTUH 4I7YH 1O2JA 1TX6A 2IN2A 3TGJE 2ZA5A 3OY5U 1C4Y2 2XCNA 1O33A 2UUYA 3B9FH 2C90B 1PYTC 1SLWB 1TAWA 2G4UA 1A4WH 2BD7A 2ZTYA 1UVTH 1AWHB 1J9CH 2A0QB 1C5YB 3SORA 1GI6A 2ODYB 4FUJA 3TJOA 1XVMA 1TA2A 3MH4A 1QNJA 2VIWA 1BRAA 1E34B 4UDWH 1UK4A 5F8TA 1DY8A 1GBMA 1LHDH 1QJ7B 5EOKA 1ZJDA 5JBAS 1N1LA 2FEQH 2BXTH 4ASHA 2BQ7B 4K2YA 1NRSH 3SNEA 1ZLRA 5E2OA 1SGYE 2F9NA 2XC5A 1UK3A 3M5OA 3F68H 4HZHA 4Y8YA 3MTYA 1JWTA 1UHBB 1ZZZA 1SBWA 1DE7H 1GJAB 1CGIE 1D3PB 1BTUA 7GCHF 2Y81A 3O8CA 3GCOA 1BDAA 1H9LB 4I33A 5A8YA 4D8NA 3E0NB 5DP8A 3LGIA 1O3IA 3Q3YA 1V3XA 1UVPA 2QF3A 1XVOA 4U01A 1DSTA 1NS3A 2CHAC 2EEKA 1GBDA 3AASA 4THNH 1K1IA 1UMAH 5F8XA 2HNTF 3S9AA 1LHGH 2ALPA 3T5FH 4BTUB 4K69A 1ZTJA 4BAHB 1LQDB 1GBAA 1AUJA 4BAKB 2BMGB 4NZQA 2XCFA 2C8YB 1A1RA 2C4FH 1GBHA 1BBRK 1XX9A 2ZC9H 1HIAA 2ZCLP 1H8DH 2IPHA 4ZMAH 4ZHMU 4YTAA 5L2YH 5FBIA 5FX5A 4YOGA 3MH7A 4NA8A 3TITA 4JZEH 2H2ZA 3PWBA 4TWWA 2YNAA 4B71A 4D76A 1SGIB 3ZVFA 3U69H 3T29A 1ELCA 1KDQA 1QBNA 4ISLA 1XUGA 4I8KA 2BB4A 4MNWA 3MYWA 3K6YA 2UUJB 3RM0H 5DP4A 3A7TA 3BV9B 1C2MA 4MDSA 5E0HA 3RXQA 1ZRBA 1EOJA 3RXTA 1XUKA 1LVMA 1CVWH 1P57B 3A7YA 1GGDB 4ABIA 1GVLA 2PKSB 2BDBA 4VGCB 1HAXB 2OINA 3VB3A 2WPLS 3SI4H 2QXIA 1HRTH 1LHFH 1O2LA 1O2VA 3ATMA 2R0LA 2TPIZ 1C5TA 1AE5A 1V2ST 2OLGA 3SUFA 1AU8A 2NU2E 1V2MT 4WY3A 3U1IB 5A8XA 5HM9A 1JRTA 4FUDA 4B2BA 4ZKOU 3M35A 1ZSLA 2G4TA 4I8HA 4X6NA 4Y6DA 1EKBB 1MZDA 2VNTA 3PLBA 1HXEH 3PMJA 5EQSA 1WBGB 3UY9A 2OBQA 2Z9JA 1DPOA 4ZXYH 1OWDA 1QRWA 2IJOB 4AFUA 2VU8E 3SNBA 1BJVA 4CH2B 1ANBA 1C1SA 1L1NA 2B7DH 1CQQA 3ZZCA 1WCZA 1L4ZA 1AVXA 2XC4A 2EC9H 4K1TA 5GCHF 2PLXA 1P04A 4XBCA 4UFGH 3UREA 4Z6AH 3GDUA 3MNBA 1DX5M 2GV6A 2W5EA 2WPHS 5J4SA 2ZGXH 1A5HA 3SZNA 3F1SB 3NWUA 9LPRA 3SV2H 2FOEA 3QO6A 1T4VH 2Y5HA 2VWNA 5DP9A 4R8TB 1YP9A 3MU1A 1O35A 1EPTB 1KTSB 2D1JA 5L2ZH 4UFFH 4XBDA 1ZHRA 5BPEA 2P94A 2YNBA 2QN5T 1VGCB 3BTGE 1GHVH 1OP0A 5A0AE 3SV8A 2AIPA 1AUTC 1NRNH 4O3TA 3UOPA 3BG4C 4Y7AA 2G52A 5T3HA 1BCUH 1ZOMA 3M5NA 4UONA 1N8OC 1VITH 3M5LA 3MNCA 4F4OC 1SOZA 1ABJH 3GCTG 1ORFA 1A46H 3RXSA 1TX7A 1OKXA 3PLPA 1TONA 1UTQA 3LC5A 4MPXA 2OUAA 3QWCH 2Q6FA 4A1VA 4M7GA 3RXRA 3TGIE 5A09A 2Z6BD 1C1WH 1QCPA 1PPHE 1HGTH 2QXJA 2V0BA 1OWKA 2Y80A 1C5ZB 1G30B 1C5PA 5FPSA 2FO9A 4DIHH 3P17H 1XXDA 4AG2A 1C5XB 4TY7A 4MLFB 1V2QT 1O2SA 5LPFA 3SUGA 1PPEE 5FCRA 2BVSH 3BSQA 3MMGA 3BTHE 4FU8A 1BRUP 3I78A 3RXEA 4DIIH 3F9FA 1LPZB 2PGBB 2Y5FA 1TYNA 3R0FA 4D7GA 3MU5A 1BTPA 1CGJE 1DSUA 3RXMA 2XTTB 3BEFB 1GMCF 5ABWA 1FPHH 1MZAA 4AGKA 1VR1H 2STAE 3RMMH 2ZECA 1QRXA 1NZQH 5ESBA 2PTNA 2ZGCA 2ZU5A 3BTFE 2SFAA 2AMPA 3RXIA 1DVAH 1P11E 1DT2A 4GHQA 3E16B 2HVXA 1T8NA 1MTUA 3TNSA 3SO3A 4Q7ZA 4YESB 1FIZA 1YCPM 1O3MA 5PTPA 1PPBH 3STIA 3E1XB 4AFSA 1FN6A 5I25A 1CGHA 2W3IA 4WMEA 1W0YH 1F0SA 3A81A 1THSH 1IQFA 1GHBG 4UD9H 4BNRA 3IG6B 3LGYA 4YT6H 3V12A 1AGJA 1ANDA 3IWMA 3KGPA 4E7NA 1IQMA 1AMHA 2EI8A 5ETXA 5F03A 2ZF0H 1GI4A 1C5WB 2BOHB 2BVRH 3SV7A 1AKSA 4MNYA 1J17T 1EAWA 1SHYA 3KQCA 2VJ1A 2ZCHP 1JRSA 4X6PA 1JBUH 1BHXF 5GPIB 2QY0B 5C67A 5GXPA 1KXEA 3RXLA 2WYJA 1O34A 1DANH 2O8LA 6ESTA 4A6LA 1W14U 2HGTH 4AYYB 1P2NA 1Z1JA 4CRGA 3LT3A 5EXLA 1CT2E 1TPOA 1SPJA 1D9IA 1MTNB 1GJ5H 3A84A 2FESH 2UWOA 1OX1A 2Y82A 1NRRH 3A89A 4O97A 4NIXA 2AS9A 4OGXA 5E0JA 4ZKRU 3BTDE 4FU9A 1H9HE 1ZTKA 4NWLA 1DUEA 1B5GH 3Q77A 4GHTA 3SJ9A 1FPCH 1YYY1 5JDUB 1IQLA 1NY22 2FI3E 3EA9A 1FY1A 3L6PA 3TJNA 4RSPA 1FY5A 1P0SH 1DOJA 1O30A 5HM2A 4E05H 7ESTE 2SNWA 2CGAA 2BTCE 5EQRA 1NRPH 3SJIA 3TJVA 5JBTA 2BD2A 3TU7H 3O8DA 1BUIA 5CHAC 2C93B 1DWCH 1UK2A 1CA8B 1QQUA 4U30A 1GL0E 1C4U2 1GJ4H 4RN6A 2GD4B 3PO1C 3KQEA 1SQOA 4ABHA 1ZGIA 1UHBA 1ANCA 1MKXH 2ZDVH 3RXDA 3IITA 2BHGA 4JK6A 4GLYA 6CHAC 1C2IA 3ZVEA 1FI8A 1O3CA 2TRMA 1LMWB 1YC0A 5FHTA 3NUMA 3ODFA 1W13U 4ABEA 2FS9A 4X1NU 2SGAA 1GCTB 5C1UA 8GCHF 1TGBA 1S84A 3PTBA 1EP6A 1C1NA 2ZFSA 3I77A 1LKAA 1L2EA 4I32A 1EATA 4XE4A 1O2WA 1ARBA 3RDZA 4R0IA 2F91A 2ODQA 5F6MA 1V2LT 1ESTA 3P8OA
chains in the Genus database with same CATH superfamily
4YM9A 3MHWU 2BZAA 3GDVA 4X2VA 1MKXK 3E8LA 1YLNA 2PUQH 1UVSH 2YMSC 2FPZA 2OC0A 1SGNE 5EXMA 9ESTA 3QUMP 4MVNA 1DDJA 1A3BH 1CHOF 1RGQA 1VITF 2HLCA 1KLJH 1ZPZA 5DP3A 1J14A 3EQ0H 2J95A 1CBWB 4HI3A 3ZYEA 4M9FA 4X1QU 2DE9A 3MI4A 3BEIB 1RD3B 1O2TA 1S82A 3KNXA 1NTPA 3CP7A 2BD4A 2PGQB 3CS7A 4DVAU 2HPPH 3P8FA 1TRMA 3RXOA 1T31A 4NCYA 2BD8A 2SGFE 1DWDH 2PKAB 1O5GH 3TGKE 3T27A 3PROA 2XWBI 4DW2U 1TNKA 1SR5C 2Q6GA 1DM4B 2ESTE 1RTFB 5C2ZA 4WXIA 3O8BA 4ZH8A 4FUEA 2HNTE 3MO9A 4H6SB 2Z9LA 4FUIA 4XBBA 1W7XH 1UTJA 2KX4A 2A4GA 3MNSA 3SQHE 1EAUA 1WYKA 1RTKA 4WMFA 5A2MH 3SU2A 3N99A 3VG8A 3KIDU 2QV1A 2KFWA 1C2EA 1SGTA 2HNTC 3MU4A 2GV7A 2CV3A 2ZFFH 5JPMH 2BY9X 1GI1A 4NIYA 4NFEA 2BX4A 4IS5A 3LGTA 2OQUA 3TIUA 3VB7A 4GUXA 3VB6A 1SB1H 1Z1IA 1CA0C 1AB9C 3GCHC 1TOCB 2F3CE 3QTOH 3VEQB 2FXRA 3LDXH 1BZXE 5H4IB 1NO9H 2ANYA 4K3JA 5HMAA 2ZEBA 5LH8A 1FIWA 2FI5E 1Y5BT 3P70B 5A8ZA 3A82A 1KY9A 1TGTA 3OYPA 1MH0A 4GVUA 1GMDF 3TH3H 3U9AH 2AGIX 1Z6JH 1MD7A 2L74A 2OXSA 1F2SE 4KKDA 4A92A 2QXGA 2H9HA 4Y76A 1UVOA 1ACBE 2R3YA 1FXYA 1NFYA 1Q2WA 2FI4E 3SU1A 3P95A 2ZFTA 1EUFA 2PKSC 3LC3A 3T62A 2ZNKH 2SGQE 2VGCB 3M5MA 1DWBH 2P3FH 3UOUA 1FNIA 2XBXA 4RT0A 1SQRA 2FOGA 4P02A 2JH6D 1FX0B 4CRBA 7LPRA 1TNGA 3LONA 3NK8A 1O2KA 1V2UT 2ODPA 2Z3DA 5L30H 3DFJA 1SOTA 3C27B 2BY7X 3UWIA 1GI0A 2XBYA 8LPRA 1K1MA 2WPDD 1ELFA 3MH6A 3EDXB 8GCHG 1CHGA 2UUFB 1G3DA 2H6MA 1TMUH 1HJ8A 1ZMLA 4ESTE 3OSYA 2PHBA 4Q4LA 3GDSA 1C1TA 1EZUC 3ATIA 4MG3A 1EPTA 1O2XA 4MPUA 1HAYB 4IW4E 2ZDAH 2BDAA 2BLOA 1BMMH 3BIVH 1HAHH 4U2WA 1FONA 1TFXA 2F43B 2F9PA 3PYHA 1THRH 2VVUA 3RXJA 5LPRA 1HB0B 1YPHE 3D23A 4X8UH 1AFQB 2H5DA 3DSGA 1OP8A 1UTKA 2J98A 4XFQA 4Q7XA 1AVGH 3OTPA 4FVBA 2IPQX 1SMFE 1BTHH 1BMLA 1ZPCA 1HCGA 1SLXB 1YPHC 4UFDH 2A7JA 1IQEA 4CRDA 1EB2A 3W95A 4AB8A 3LU9B 2A5KA 4AFQA 1EPTC 1BBRH 1O2YA 5ESTE 3S7KB 1K1NA 1ZJKA 3MNXA 3M37A 1K21H 3E6PH 2ZFRH 2FODA 2ZHFH 1SI5H 1AO5A 4J2YB 2ZHDA 2ZU4A 3QGJA 3VGCC 1YF4A 1OXGA 1NU7B 1MD8A 1UTLM 4TWYA 2B5TB 1MKWK 3SJ8A 3VXFH 1HAIH 2BQ6B 4AX9H 1Q3XA 3BN9A 2BQWB 2AIQA 2HLDD 3UUZA 1HUTH 2WYGA 1UO6A 5C20A 2HPQH 3F2HA 3PLKA 2OD3B 2ZQ1A 5JB9S 1O2IA 1TBQH 3URDA 1FY8E 1QTFA 1LVOA 1LO6A 1O3NA 1BMFD 5AFZH 2J4IA 1WQSA 1GI9B 1A3EH 2G51A 2F9VA 4OS6A 4INLA 3DSPA 1OS8A 3RXBA 3F9HA 1JMOH 1KXCA 3SNDA 2HRVA 2TGPZ 1GG6C 2XRCA 5AF9H 1W0ZU 1AD8H 3ZZ7A 3LKWA 3KQ5A 1GJ8B 2OC1A 3TNTA 4B6FA 4A7IB 4X2XA 4AOQA 1G36A 1H1BA 1H8IH 5CHBA 2WUBA 1O38A 4ISIH 2R2MB 1HAVB 2KM0A 1INCA 1PQ8A 1AFEH 1H4WA 1O3FA 1Z8RA 3C1KA 2V3HH 2QCYA 1QGFA 2XNDD 3OEHD 4GCHF 2H1UA 1TPAE 4LXBH 2FX6A 3OEED 5DK1A 3MU8A 2GJGA 1GBFA 1J15A 4I8JA 7KMEH 5B6LA 1S85A 3EE7A 3F0OA 2BD3A 5EJ1A 2KCOA 1E0FD 1KLIH 1MUEB 1C5UA 1YLCA 2I6SA 1P3EA 5C1YA 1QIXB 1ELEE 2UWPA 3A7ZA 3FANA 4WH8A 1DFPA 1FV9A 1ZGVA 5F53A 4I8GA 2AH4X 1UTOA 2RFKC 4ZXXH 4JK5A 3ZV8A 2AGGX 2VIDA 3VB5A 4Z0KA 1GHAF 3Q00A 2A4OA 4CBOA 2A32A 2BZ6H 5GJ4B 1NFWA 2ZHEH 1CT4E 1MBQA 1GMHF 1OSSA 1TLDA 3KYGA 3ZVDA 3SU4A 1PPCE 1S83A 2FLBH 3BTQE 1NN6A 4AGJA 1O2UA 3A8CA 5KECA 4Z1MD 2WV4A 1KXBA 1GBKA 1HJAB 2GT8A 1XKBC 1ZSJA 1EXFA 1EZQA 3ATLA 2XBVA 2A2QH 1GHWH 2P95A 4OS5A 7GCHG 5G4BA 1T7CA 2WZQA 1Z71A 2CXVA 1IHSH 1WXRA 3M61U 5EGMA 1C5MD 1YCPH 2ZP0H 5DO4H 1LCYA 1D6WA 1MTNC 1VCWA 3QGNB 4IMQA 4OS1A 5B6OA 3SJOA 1ZYOA 4XDEA 1C5VA 3RMNH 1A61H 3BF6H 3H5CB 4AORA 1W12U 1RJXB 2XWAA 1OYTH 1S0RA 4AFZA 3SBKA 1P2KA 4RKJB 3ZZAA 1MAYA 3GY3A 1RTLA 1S81A 1TMTH 2XXLA 3A8BA 1TB6H 3V13A 2Z9KA 4NFFA 3H7TA 3DCLA 1C1OA 2ANKH 4INHA 1QJ1B 3EAJA 3KEEA 1NU9A 5AHGH 5C5NA 3K6ZA 3ZVCA 2O8WA 4INKA 3M7QA 1W0JD 1YCPK 1Z8GA 1G3EA 1C5NH 2VWMA 3M36A 4U32A 4NWKA 1Y59T 2FM2A 3RXAA 2ZPQA 1QL8A 1A5IA 1QL7A 2VIVA 3A83A 1RIWC 2VBCA 2CHAB 1EQ9A 1W8BH 4FXGH 5TJXA 5FCKA 3RMOH 1GCTC 4X8SH 1SQAA 1UW7A 4F49A 1TOMH 1GVZA 1YM0A 4H6TA 1UCYH 3WY8A 2J92A 2GTBA 1T32A 2ZHWH 2GCHF 3EGKH 2EI6A 2JETC 3TH4H 3TK9A 1DWEH 4K60A 2FOHA 3E0PB 2OTVA 8KME2 2PKAA 2GGVB 3PRBA 4MNVA 5IYTA 1C2FA 2A2XH 2BY8X 1DXWA 1ID5H 4WF8A 1D3DB 4CHAC 1Y3WA 2BXUH 1PPZA 1P2QA 2RDEA 2KAIB 1ELVA 2FMJA 1Z6EA 2V7QD 2BY6X 1SLVB 4BAMB 6GCHF 5GDSH 1SSXA 1ABIH 1GCDA 2GCTB 1S6HA 1CBWC 3M3VA 2PSXA 1W2KH 3BEUA 1IQKA 1UCYK 2A5AA 3A86A 1YPGH 1BRCE 1P10A 1T8MA 1GI3A 1TRYA 1BTYA 1O32A 4ZKNU 1RFNA 2V35A 4TPIZ 3SV9A 4X1SU 1ELDE 5L6NH 2VVVA 4ABDA 1DICA 1FY4A 1O3HA 2BX3A 2PFEA 1KXFA 2XC0A 1THPB 1K2I1 5C0UA 3Q3XA 1K0HA 2ZDKA 4CRAA 1ESBA 1SL3A 2GMTC 4MTBA 2FLRH 1J16A 1SGRE 3GY7A 1L4DA 6LPRA 1GPZA 2KZ4A 3ENSB 1O31A 4J1YA 5JBBS 4D9RA 2PP6A 3RLYH 1MCTA 1HAOH 1F5LA 2ZGBH 5GCHG 3TJUA 1FAXA 1LVBA 1K1PA 1EASA 1WV7H 1LPKB 1BTWA 1TPPA 3RC5A 2FOFA 1P12E 2AMDA 2J34A 3OFND 1OWJA 1V2KT 2VIQA 3HGPA 4CR5A 2P59A 1HPGA 1MU6B 3HKIB 3U98H 3GY2A 5DGJA 4PROA 1T8OA 1W10U 3EYDA 1QB1A 2BLVA 4BAOB 3AK5A 1OHHD 1BMAA 5EPYA 4Y0YE 4FETA 4LK4A 3FAOA 2ZDLA 4AG1A 1XUFA 1MAXA 3MO3A 2B0FA 1KTTB 3MH5A 1TX8A 4RI0A 3RXCA 2P8OC 1AVWA 2O9QA 2XNIA 1C5SA 2Z7FE 4YLQH 1ETTH 5FAHA 1NFUA 2A4QA 3RXGA 4DT7B 3ZVBA 3V3MA 3HATH 1O3PB 2F9UA 1TNLA 4Y0ZE 3UNQA 1JIRA 1O2PA 1P2IA 2SGPE 1LQEA 1DLEA 1W0KD 1IOEA 2ULLA 1HAGE 1F0UA 2ILNA 1HYLA 1QA0A 1XUIA 1C2JA 3GY6A 2Q6DA 5K0HA 2QF0A 1ELBA 3QLPH 2VIPA 4TY6A 4A5TS 5IK2D 1WTHD 1QY6A 2IOTA 4ZHAA 2GZ9A 1O37A 1PFXC 4LOYH 2RCEA 5T6FA 3RXPA 4A1TA 1XUHA 5LPEA 1V2VT 1A0LA 4H42U 1O3AA 2VH0A 1HAZB 1G9IE 1HFDA 2FP7B 3MWIU 1L1GA 1NRQH 2ASUB 2VINA 4HGCA 4JCNA 1AI8H 3KN2A 3OAAD 3BG4B 5EJLA 3DD2H 4IMZA 2AFQB 1KXAA 2V6NA 5C1XA 1YWUA 4JZIA 5FPYA 1C5LH 1N8OB 5CMXH 1GMCG 1C4V2 3U8TH 4BTIB 2OP9A 1BITA 4CH8B 1FAKH 4B75A 2GDEH 1O2HA 2NWNA 4GAWA 3I29A 1TNHA 1G32B 2CN0H 5SGAE 1GBCA 1LTOA 4ZKSU 2FYRA 2JDID 3P8NA 4FUFA 2VVCA 1D4PB 2C3SA 1E79D 1BTZA 1TA6A 1TALA 2OC7A 4WJG2 1AZZA 3AAVA 3NKKA 5EODA 4Q80A 1WDIA 1W11U 4KTUA 2TGAA 3MOCA 4ISNA 2SNVA 2A5IA 3CNRA 4Y11E 1O2NA 2BVXH 2ZKSA 4B2AA 3QN7A 3TK6A 3RXUA 1W3CA 4B2CA 1SGQE 3ATKA 4B6EA 3S7HB 3DHKH 5EU8A 3FO8D 1B0EA 2J94A 3CENA 3V7TA 2ALVA 1FY3A 1P05A 1VCQA 2FWWA 2TGTA 2Y7ZA 4Y8ZA 5E0GA 1EJMA 1HDTH 4OGYA 1HAVA 2VH6A 1QHRB 1WQVH 4IC6A 2TGDA 5EQQA 1QRZA 3UIRA 4FUHA 4CREA 2ZHQH 2FTLE 1VCPA 2AYWA 1A0JA 4FOUC 1O5FH 1WAYB 2GT7A 1C2HA 2KCAA 4IGDA 1RS0A 1YPLH 3OTJE 1GBEA 4JZDH 4NGAH 1C2GA 2G81E 1OWIA 1BA8B 3SU5A 1GWAA 4D9QA 1C1RA 1QBVH 3KQDA 1C2LA 3D62A 1DY9A 3SU6A 1X7AC 2R2WU 3GYLB 3RXKA 1TNJA 2K0QA 2W7UA 1GJCB 1TBRH 3H7OA 1S0QA 3EA8A 5HGGA 1Y8TA 4MPWA 2A31A 5EPNA 2XOKD 1QB6A 4B74A 1SG8B 2FTMA 3AAUA 1F92A 1D3TB 1DXPA 3OU0A 4ISHH 3F9EA 3TH2H 1NC6A 3RM2H 4WMDA 3SJKA 3K9XB 4JYUH 1GHZA 1E1RD 1O2RA 5JBCS 3SOSA 1E36B 1JIMA 1NESE 1V2PT 1FQ3A 4DGJA 5KGOA 1GGDC 1P9SA 5DN6D 4VGCC 4X8VH 2B9LA 4ZHLU 1MTWA 1K9OE 2ZCKP 2ZI2H 2A7HA 5DP7A 1M9UA 4YT7H 1SGDE 4GSOA 3L3TA 3LJJA 5K7RA 4OS4A 4I8LA 1TWXB 1WTGH 1SGFA 1AE8H 2CK3D 3RC4A 1HAPH 3TLOA 1EAIA 4ISOA 1ZPBA 2GVFA 3UB0A 1VJ9U 2UWLA 1A2CH 1YPKH 4NZLA 2HOBA 3A80A 2ZWLH 1LDTT 3E91A 3FOAA 4BXWA 4QT8C 1O5BB 3PV5A 2CMYA 3T28A 5J4QA 3RLWH 3KHVA 1GDNA 3QZRA 3B8JA 4K5ZA 4B1TA 2H9TH 1SC8U 3RXHA 2AERH 2H5CA 1DUAA 5E2PA 4E06H 3MFJA 1HJAC 5GNDA 1MQ5A 2C8XB 1V2NT 2LELA 4FUGA 4KTCA 2BLQA 2G00A 5CHAB 1KYNA 1BJUA 3ZZ6A 2BOKA 4IN1A 5EG4A 2BM2A 3M7TA 3UQOA 1GJDB 1WOFA 1CHOG 1VITG 3FP7E 1D6RA 2FOMB 1O3LA 3S9CA 3D65E 5HYOA 3STJA 2TBSA 3SW2B 1PJPA 1V2TT 1F7ZA 1ZR0A 3ELAH 5I46H 1QURH 3PWCA 1MKWH 4I86A 6CHAB 1GDUA 1W7GH 1CU1A 1TBZH 4IN2A 4Y10E 3T2NA 1O5EH 4B73A 2Z9GA 1F5KU 3R3GB 4YOIA 1OPHB 1EAXA 3K65B 2ZDNA 3HK3B 2ZQ2A 1Y5AT 1A7SA 1BB0B 2BDIA 1TMBH 5DKMA 1O2MA 1B7XB 1VGCC 3TVJB 3U8RH 2D2DA 4NA9H 4X1RU 1SGCA 1FN8A 2RA0A 1HBTH 4AZ2B 2Z3CA 2ZPSA 2BYAX 5AVDA 5EXNA 1C5RA 2FZZA 2PR3A 2I6QA 4WWYA 1LHEH 4YOJA 3S0NA 2BLWA 3A7WA 2KCYA 1E1QD 5DJ7A 4DCDA 2THFB 1QQ4A 1BIOA 1K28D 2EY4C 3K2UA 1RRKA 1EJAA 2XBWA 1Y3YA 1KLTA 2KAIA 2ZU1A 1TE0A 4K1SA 3GY8A 3NZIA 1O3OA 3SGBE 2FOBA 3NRLA 4MQAA 3KCGH 3DT0H 3Q3KA 3ODDA 2A7CA 3N7DA 3RC6A 3GY5A 4Y8XA 1T4UH 3O8RA 1GMDG 1EP5A 2BDCA 1AY6H 1QJ6B 2CJIA 3L33A 3EA7A 3PMHB 1Q31A 3PRDA 4HFPB 1FDPA 2NU3E 1S6LA 1BBRE 4WXVA 3OX7U 2UUKB 2GDDA 3NXPA 4OS7A 1NBMD 1NPMA 4FUBA 1C9PA 5DP6A 5FX6A 3GISB 2F4LA 1O3BA 1PPFE 3HGNA 3RU4D 2FYQA 2G8TA 3BTME 1QA7A 2EQNA 1JOUB 1UTPA 3HK6B 2GCTC 1O5DH 1H9IE 2ZTZA 3SNCA 2FX4A 3GCTF 2PSYA 1CA0B 1AB9B 3GCHB 5C94A 2BD5A 1UVUH 4ABJA 2BDHA 1BTXA 2HWLB 1C1MA 4NSYA 4ZUHA 1ELTA 3SUDA 1ZRKA 3OY6U 1GBIA 1NROH 1P09A 1ELGA 4JMYA 1JXPA 2BY5X 3SUEA 1XMNB 4DJZB 2QA9E 3ZZ5A 1K22H 4HTCH 3MU0A 1IQGA 2WPKS 2ZIQH 1V2JT 3LJOA 1C9TA 1EOLA 2OCVB 3UR6A 4X6OA 4DY7B 3KL6A 1O2ZA 1LHCH 2P3TB 4SGAE 5EW1H 2P16A 1KSNA 3P8GA 3W1EA 3SNAA 3OE7D 1PQ5A 4O9VA 3ZV9A 3GOVB 5IDKA 1N6XA 1IHTH 5C5OA 1CO7E 2QAAA 1C1VH 1LVYA 3BIUH 1YY3A 3SI3H 3ITIA 1DS2E 3N7EA 2D8WA 5AFYH 1ESAA 2RG3A 1Z7KA 3HPTB 1KIGH 1XKAC 3B23B 3HKJB 4ABAA 4BXSA 1GDQA 2W26A 2A4RA 3FZZA 2CF9H 5GWZA 4NSVA 3FVFB 2JH5D 4NG9H 1B0FA 1ANEA 1P2MA 1V6DA 4XSKU 3FZDA 2P3UB 3NCLA 4YLUA 2RA3A 1SHHB 2A1DB 1GHBF 3QK1A 1MBMA 1S6FA 2FIRH 2OQ5A 4Y71A 3RU4E 1O5CB 3ZZ4A 3FP6E 2YOLA 4ABFA 1O0DH 4IC5A 5FPTA 4K1EA 4UFEH 4OS2A 1MMJN 3UWJH 4UEHH 4ZCNA 2ANWA 3AW0A 3RUOA 3D49H 4TPYA 4IBLH 1GL1A 2A45B 3N7OA 5E8EH 4BAQB 1AQ7A 1RXPA 2WPJS 4XRNA 2J5UA 2LPRA 3BTKE 1WSSH 1C2DA 4P00A 4O3UA 2KR7A 2WV9A 2Z3EA 3FFGA 3MO6A 1F0RA 5HXFA 1O3EA 2WPMS 2GZ7A 5A0BA 3M3TA 3LGUA 2C8ZB 4I31A 2FOAA 1MTSA 1CT0E 2Y5GA 3GICB 2NU4E 4D7FA 3PTNA 2ZU3A 2VWLA 4NIWA 4JZ1A 3VGCB 1SGEE 1ZSKA 1GJBB 1U6QA 2QXHA 3BG8A 4NA7A 3QZQA 4JYTA 3A8DA 4GCHG 1BQYA 1GI8B 3A88A 5EIYA 2WV5A 1Y3UA 1QBOA 3BTEE 1MU8B 2H9EH 3M3SA 1FMGA 4BTTB 1PQ7A 1GJ6A 3MQKC 1TQ0B 1E35B 1PQAA 1ZHMA 1XUJA 3VFEA 1GHXH 2V3OH 1SQTA 1QZ8A 1AHTH 1UJ1A 3LGVA 3A7VA 1EZXC 4YO9A 1HLTH 1V2WT 4Q7YA 2PUXB 5FBEA 1GG6B 2EA3A 3ZZ9A 1P8VC 1ARCA 1O2OA 4XOJA 2STBE 1GHAG 2QC2A 2QYIA 2PW8H 2VIOA 3BTTE 2ZFQH 3TPIZ 3P92A 1GBTA 1C1PA 2R3UA 1SGFG 3ATWA 1GMHG 4X0WU 3GYMA 4X1PU 1VZQH 3KQBA 4RT1A 1EJNA 2WINI 2Y7XA 2R9PA 3M7UA 1YPEH 1SLUB 1L0ZA 3PB1E 3LH3A 4FU7A 1HIAB 1YLDA 4Q2KA 1GI2A 8ESTE 5DPAA 3SQEE 1UCYE 2FOCA 4ZROA 1GBJA 4MPVA 3S9BA 3CS0A 2J2UA 4X2WA 2QIQA 1Y3VA 1P9UA 3LIWA 3V0XA 1SFQB 3A8AA 3T25A 3ZIAD 2ZG0H 4GPGA 1TRNA 1KDQB 1MCVA 1OYQA 1P2OA 1YPJH 2VWOA 2PWXA 4O03A 1EFRD 1C1UH 1GJ9B 1C1QA 4DOQA 3AVZA 1TPSA 3UNRA 1FJSA 1ZMNA 3UR9A 1HV7A 3LPRA 4UE7H 1O3DA 1F0TA 3DFLA 3E3TA 3G01A 5LGOA 4AC9A 4Y7BA 4CBNA 3RXVA 3ESTA 1TGCA 3ZZDA 1S5SA 3RMLH 1A0HB 1BRBE 2VB0A 3EE0B 1G3BA 1PPGE 1QB9A 1WUNH 2ZGHA 2P93A 1HXFH 1P2JA 4X8TH 1SFIA 2ANMH 1ELAA 5T6GA 3UQVA 3A87A 4YZUA 2JH0D 4WH6A 5GIBA 1AZ8A 2CF8H 1C2KA 2QGRA 1A5GH 1J8AA 1IQIA 1WU1A 2VGCC 2QE7D 1K1LA 1LKBA 3QDZB 1P03A 3GCNA 4E7RG 3TK5A 1H8HD 3VB4A 2ZGJA 1BT7A 2ZZUH 1Y3XA 1BHXB 4KP0A 2SGEE 4ABBA 5FXLA 5TCAA 4JZFH 2G55A 3URCA 2K1QA 3UNSA 1DITH 4X6MA 1Z8JB 5C17A 4DG4A 2GCHG 3S69A 1TIOA 1ZHPA 2AGEX 5CE1A 1Z8IB 1F5RA 1OWEA 2FDAA 4B76A 2W3KA 1CSOE 1GBLA 4CR9A 2K8IA 5T6DA 4CRFA 4YXWD 1AIXH 5KEDA 2GZ8A 2DE8A 2WUCA 1AN1E 1IQNA 2FS8A 2AEIH 1ZTLA 2BDYA 3LGWA 4LZ1H 1OOKB 1C5QA 1D3QB 5EW2H 2ZFPH 3RU4T 2WPIS 6GCHG 2G5VA 3WW7A 1O3GA 4LZ4B 4XD7D 5JYIA 1YGCH 3SU0A 4KTSA 2EI7A 2DUCA 3NPSA 1AFQC 1GJ7B 1RIWB 1G2MA 3RP2A 1UTNA 4TYDA 2ZTXA 2XW9A 1UTMA 4WVPE 4ABGA 1T8LA 1QL9A 1HNEE 4A1XA 1EZSC 2J38A 2O8MA 3JZ1B 2O8UA 4AB9A 1SKYE 1TNIA 1EX3A 1C5OH 1HJ9A 4KELA 2JETB 3T26A 1FUJA 1O3KA 1K1OA 3PV2A 5JB8S 1NFXA 3GY4A 2AMQA 4OM9A 2Z94A 1K1JA 4SGBE 2OC8A 4K8BA 4X2YA 2D26C 3SHAH 2Y6TA 5BRRE 5DG6A 3SU3A 2B8OH 2M2AA 1OWHA 3JZ2B 2O8TA 3ZZBA 2ZU2A 4CHAB 4RKOB 3SGAE 1SVPA 1ETSH 4K8YA 2C8WB 1TQ7B 1L1JA 1E38B 3LOXA 2ZO3H 3ZVAA 3LH1A 3QX5H 1BMNH 1G2LA 4ZAEA 2OK5A 1O3JA 2RDLA 1Y5UT 1TGNA 5TCCA 5C3NA 3F2GA 3U8OH 1NM6A 1TGSZ 1PYTD 1P3CA 1SGPE 3SN8A 4JYVH 2PV9B 2GKVE 1P02A 2GX4A 4ASUD 1V2RT 2R0KA 3DA9B 3SV6A 3ZZ3A 4BANB 3ZVGA 2PTCE 4TT3D 1KXDA 2F9OA 2BD9A 3F9GA 4NIVA 2GMTB 1TABE 4H4FA 3E90B 3U1JB 1GBBA 2Q1JA 1COWD 1G3CA 1O36A 1CE5A 4FVDA 1V2OT 3PMAB 3A7XA 3ZYDA 3F6UH 3SHCH 5F8ZA 3PV4A 3UPEA 1VJAU 3FKSD 4DURA 4Y79A 2G5NA 1GHYH 1MQ6A 2NU1E 1YPMH 1GVKB 2SGDE 1GI7B 3VPKA 3W94A 4AN7A 3QTVH 1O2GH 1QFKH 1E37B 1O5AB 1O39A 2XYAA 4CRCA 1NT1A 3PM3A 1H8ED 3A85A 4MNXA 1N6YA 2JKHA 2NU0E 5HKKD 1QR3E 2ZDMA 4FUCA 2OBOA 1IQJA 3AW1A 2LNCA 3BTWE 4KGAA 2BDGA 3DUXH 1GI5A 1YBWA 1FLEE 1XXFA 2TIOA 2ZPRA 3UFAA 1MTVA 1AKSB 1AWFH 2GP9B 1O2QA 1IQHA 1OP2A 4Q63A 1FZZA 1BOQA 2J9NA 1P01A 1ETRH 5A0CA 1DLKB 3SGQE 3ZZ8A 2P8OB 1LPGB 3FP8E 2M5TA 1XM1A 1G37A 1YKTA 4F48B 2F83A 3P6ZB 4BOHA 2F9BH 3KF2A 2Z9IA 1P06A 2W7SA 1IAUA 1EB1H 3VXEH 4AYVB 3RXFA 2HALA 3Q76A 5DP5A 1ZMJA 3PMBB 3PO1B 3UTUH 4I7YH 1O2JA 1TX6A 2IN2A 3TGJE 2ZA5A 3OY5U 1C4Y2 1MABB 2XCNA 1O33A 2UUYA 3B9FH 2C90B 1PYTC 1SLWB 1TAWA 2G4UA 1A4WH 2BD7A 2ZTYA 3SZEA 1UVTH 1AWHB 1J9CH 2A0QB 1C5YB 3SORA 1GI6A 2KCPA 2ODYB 4FUJA 3TJOA 1XVMA 1TA2A 3MH4A 1QNJA 2VIWA 1BRAA 1E34B 4UDWH 1UK4A 3U28C 5F8TA 1DY8A 1GBMA 1LHDH 1QJ7B 5EOKA 1ZJDA 5JBAS 1N1LA 2FEQH 2BXTH 4ASHA 2BQ7B 4K2YA 1NRSH 3SNEA 1ZLRA 5E2OA 1SGYE 2F9NA 2XC5A 1UK3A 2V3MA 3M5OA 3F68H 4HZHA 4Y8YA 3MTYA 5C0TA 1JWTA 1UHBB 1ZZZA 5FL7D 1SBWA 1DE7H 1GJAB 1CGIE 2LP6A 1D3PB 1BTUA 7GCHF 2YMSB 2Y81A 3O8CA 3GCOA 1BDAA 1H9LB 3F0PA 4I33A 5A8YA 4D8NA 3E0NB 5DP8A 3LGIA 1O3IA 3Q3YA 1V3XA 1UVPA 2QF3A 1XVOA 4U01A 1DSTA 1NS3A 2CHAC 2EEKA 1GBDA 3AASA 4THNH 1K1IA 1UMAH 5F8XA 2HNTF 3S9AA 1LHGH 2ALPA 3T5FH 4BTUB 5CDFE 4K69A 1ZTJA 2QF4A 1LQDB 1GBAA 1AUJA 4BAHB 4BAKB 2BMGB 4NZQA 2XCFA 2C8YB 1A1RA 2C4FH 1GBHA 1BBRK 1XX9A 2ZC9H 1HIAA 2ZCLP 1H8DH 2IPHA 4ZMAH 4ZHMU 4YTAA 5L2YH 3FN8A 5FBIA 5FX5A 4YOGA 2L6OA 3MH7A 4NA8A 3TITA 4JZEH 1VKYA 2H2ZA 3PWBA 4TWWA 2YNAA 4B71A 4D76A 1SGIB 3ZVFA 3U69H 3T29A 1ELCA 1KDQA 1QBNA 4ISLA 1XUGA 4ACAA 4I8KA 2BB4A 4MNWA 3MYWA 3K6YA 2UUJB 3RM0H 3DSOA 5DP4A 3A7TA 3BV9B 1C2MA 4MDSA 5E0HA 3RXQA 1ZRBA 1EOJA 3RXTA 1XUKA 1LVMA 1CVWH 1P57B 3A7YA 1GGDB 4ABIA 1GVLA 2PKSB 2BDBA 4VGCB 1HAXB 2OINA 3VB3A 2WPLS 3SI4H 2QXIA 1HRTH 1LHFH 1O2LA 1O2VA 3ATMA 2R0LA 2TPIZ 1C5TA 1AE5A 1V2ST 2OLGA 3SUFA 1AU8A 5EJZA 2NU2E 1V2MT 4WY3A 3U1IB 5A8XA 5HM9A 1JRTA 2AHME 4FUDA 4B2BA 4ZKOU 3M35A 1ZSLA 2G4TA 4I8HA 4X6NA 4Y6DA 1EKBB 3GS9A 4F55A 1MZDA 2VNTA 3PLBA 1HXEH 3PMJA 5EQSA 1WBGB 5HIZA 3UY9A 2OBQA 2Z9JA 1DPOA 2JIZD 4ZXYH 1OWDA 1QRWA 2IJOB 4AFUA 2VU8E 3SNBA 1BJVA 4CH2B 1NBME 1ANBA 1C1SA 1L1NA 2B7DH 1CQQA 3ZZCA 1WCZA 1L4ZA 1AVXA 2XC4A 2EC9H 4K1TA 5GCHF 2PLXA 1P04A 4XBCA 4UFGH 3UREA 4Z6AH 3GDUA 3MNBA 1DX5M 2GV6A 2W5EA 2WPHS 5J4SA 2ZGXH 1A5HA 3SZNA 3F1SB 3NWUA 9LPRA 3SV2H 2FOEA 3QO6A 1T4VH 2Y5HA 2VWNA 5DP9A 4R8TB 1YP9A 3MU1A 1O35A 1EPTB 1KTSB 2D1JA 3F3BA 5L2ZH 4UFFH 4XBDA 1ZHRA 5BPEA 2P94A 2J97A 2YNBA 2QN5T 1VGCB 2WSSD 3BTGE 1GHVH 1OP0A 5A0AE 3SV8A 2AIPA 1KMHB 1AUTC 1NRNH 4DT4A 4O3TA 3UOPA 3BG4C 2J98B 4Y7AA 2G52A 5T3HA 1BCUH 1ZOMA 3M5NA 4UONA 1N8OC 1VITH 3M5LA 3MNCA 4F4OC 1SOZA 1ABJH 3GCTG 1ORFA 1A46H 3RXSA 1TX7A 1OKXA 3PLPA 1TONA 1UTQA 3LC5A 4MPXA 2OUAA 3QWCH 2Q6FA 4A1VA 4M7GA 3RXRA 3TGIE 5A09A 2Z6BD 1C1WH 1QCPA 1PPHE 1HGTH 2QXJA 4TSFD 2V0BA 1OWKA 2Y80A 1C5ZB 1G30B 1C5PA 5FPSA 5DSFA 2FO9A 4DIHH 3P17H 1XXDA 4AG2A 1C5XB 4TY7A 4MLFB 1V2QT 1O2SA 5LPFA 3SUGA 1PPEE 5FCRA 2BVSH 3BSQA 3MMGA 3BTHE 4HG6A 4FU8A 1BRUP 3I78A 3RXEA 4DIIH 3F9FA 1LPZB 2PGBB 2Y5FA 1TYNA 3R0FA 4D7GA 3MU5A 1BTPA 1CGJE 1DSUA 3RXMA 2XTTB 3BEFB 1GMCF 5ABWA 1FPHH 1MZAA 4AGKA 1VR1H 2STAE 3RMMH 2ZECA 2HVYB 1QRXA 1NZQH 5ESBA 3SYJA 3UAIC 2PTNA 2ZGCA 2ZU5A 3BTFE 2SFAA 2AMPA 3RXIA 1DVAH 1P11E 2WHXA 1DT2A 4GHQA 3E16B 2HVXA 1T8NA 1MTUA 3TNSA 5HIYA 3SO3A 4Q7ZA 4YESB 1FIZA 1YCPM 1O3MA 5PTPA 1PPBH 3STIA 3E1XB 4AFSA 1FN6A 5I25A 1CGHA 2W3IA 4WMEA 1W0YH 1F0SA 3A81A 1THSH 1IQFA 1GHBG 4UD9H 4BNRA 3IG6B 3LGYA 4YT6H 3V12A 1AGJA 1ANDA 3IWMA 3KGPA 4E7NA 1IQMA 1AMHA 2EI8A 5ETXA 5F03A 2ZF0H 2W6JD 1GI4A 1C5WB 2BOHB 2BVRH 3SV7A 1AKSA 2IJD1 4MNYA 1J17T 1EAWA 1SHYA 3KQCA 2YMSD 2VJ1A 2ZCHP 1JRSA 4X6PA 1JBUH 1BHXF 5GPIB 2QY0B 5C67A 5GXPA 1KXEA 3RXLA 2WYJA 1O34A 2JJ1D 1DANH 2O8LA 6ESTA 4A6LA 1W14U 2HGTH 4AYYB 1P2NA 1Z1JA 5T1VA 4CRGA 3WWFA 3LT3A 5EXLA 1CT2E 1TPOA 1SPJA 1D9IA 1MTNB 1GJ5H 2JJ2D 3A84A 2FESH 2UWOA 1OX1A 2Y82A 1NRRH 3A89A 4O97A 4NIXA 2AS9A 4ACBA 4OGXA 5E0JA 4ZKRU 3BTDE 4FU9A 1H9HE 1ZTKA 4NWLA 1DUEA 1B5GH 3Q77A 4GHTA 3SJ9A 1FPCH 1YYY1 5JDUB 1IQLA 1NY22 2FI3E 3EA9A 1FY1A 3L6PA 3TJNA 4RSPA 1FY5A 1P0SH 1DOJA 1O30A 5HM2A 4E05H 7ESTE 2SNWA 2CGAA 2BTCE 5EQRA 1NRPH 3SJIA 3TJVA 5JBTA 2BD2A 3TU7H 3O8DA 2W6ID 1BUIA 5CHAC 2C93B 1DWCH 1UK2A 1CA8B 1QQUA 4U30A 1GL0E 1C4U2 1GJ4H 4RN6A 2GD4B 3PO1C 3KQEA 1SQOA 4ABHA 1ZGIA 1UHBA 1ANCA 1MKXH 2ZDVH 3RXDA 3IITA 2BHGA 2QF5A 4JK6A 4GLYA 6CHAC 1C2IA 3ZVEA 1FI8A 1O3CA 2TRMA 3F2FA 1LMWB 1YC0A 5FHTA 3WWBA 3NUMA 3ODFA 1W13U 4ABEA 2FS9A 4X1NU 2SGAA 1GCTB 5C1UA 8GCHF 1TGBA 1S84A 3PTBA 3H09A 1EP6A 1C1NA 2ZFSA 3I77A 1LKAA 1L2EA 4I32A 1EATA 4XE4A 1O2WA 1ARBA 3RDZA 4R0IA 2F91A 2ODQA 5F6MA 3KYFA 1V2LT 1ESTA 3P8OA
chains in the Genus database with same CATH topology
4YM9A 3MHWU 2BZAA 3GDVA 4X2VA 1MKXK 3E8LA 2PUQH 1UVSH 2FPZA 2OC0A 1SGNE 5EXMA 9ESTA 3QUMP 4MVNA 1DDJA 1A3BH 1CHOF 1RGQA 1VITF 2HLCA 1KLJH 1ZPZA 5DP3A 1J14A 3EQ0H 2J95A 1CBWB 4HI3A 3ZYEA 4X1QU 2DE9A 3MI4A 3BEIB 1RD3B 1O2TA 1S82A 3KNXA 1NTPA 3CP7A 2BD4A 2PGQB 3CS7A 4DVAU 2HPPH 3P8FA 1TRMA 3RXOA 1T31A 4NCYA 2BD8A 2SGFE 1DWDH 2PKAB 1O5GH 3TGKE 3T27A 3PROA 2XWBI 4DW2U 1TNKA 1SR5C 2Q6GA 1DM4B 2ESTE 1RTFB 5C2ZA 4WXIA 3O8BA 4ZH8A 4FUEA 2HNTE 3MO9A 4H6SB 2Z9LA 4FUIA 4XBBA 1W7XH 1UTJA 2A4GA 3MNSA 3SQHE 1EAUA 1WYKA 1RTKA 4WMFA 5A2MH 3SU2A 3KIDU 2QV1A 1C2EA 1SGTA 2HNTC 3MU4A 2GV7A 2CV3A 2ZFFH 5JPMH 2BY9X 1GI1A 4NIYA 4NFEA 2BX4A 4IS5A 3LGTA 2OQUA 3TIUA 3VB7A 4GUXA 3VB6A 1SB1H 1Z1IA 1CA0C 1AB9C 3GCHC 1TOCB 2F3CE 3QTOH 3VEQB 2FXRA 3LDXH 1BZXE 5H4IB 1NO9H 2ANYA 4K3JA 5HMAA 2ZEBA 5LH8A 1FIWA 2FI5E 1Y5BT 3P70B 5A8ZA 3A82A 1KY9A 1TGTA 3OYPA 1MH0A 4GVUA 1GMDF 3TH3H 3U9AH 2AGIX 1Z6JH 1MD7A 2OXSA 1F2SE 4KKDA 4A92A 2QXGA 2H9HA 4Y76A 1UVOA 1ACBE 2R3YA 1FXYA 1NFYA 1Q2WA 2FI4E 3SU1A 3P95A 2ZFTA 1EUFA 2PKSC 3LC3A 3T62A 2ZNKH 2SGQE 2VGCB 3M5MA 1DWBH 2P3FH 3UOUA 1FNIA 2XBXA 2FOGA 2JH6D 4CRBA 7LPRA 1TNGA 3LONA 3NK8A 1O2KA 1V2UT 2ODPA 2Z3DA 5L30H 3DFJA 1SOTA 3C27B 2BY7X 3UWIA 1GI0A 2XBYA 8LPRA 1K1MA 1ELFA 3MH6A 3EDXB 1CHGA 2UUFB 1G3DA 2H6MA 1TMUH 1HJ8A 1ZMLA 4ESTE 3OSYA 2PHBA 3GDSA 1C1TA 1EZUC 3ATIA 4MG3A 1EPTA 1O2XA 4MPUA 1HAYB 4IW4E 2ZDAH 2BDAA 2BLOA 1BMMH 3BIVH 1HAHH 4U2WA 1FONA 1TFXA 2F9PA 3PYHA 1THRH 2VVUA 3RXJA 5LPRA 1HB0B 1YPHE 3D23A 4X8UH 1AFQB 2H5DA 1OP8A 1UTKA 4XFQA 4Q7XA 1AVGH 4FVBA 1SMFE 1BTHH 1BMLA 1ZPCA 1HCGA 1SLXB 1YPHC 4UFDH 2A7JA 1IQEA 4CRDA 1EB2A 3W95A 4AB8A 3LU9B 2A5KA 4AFQA 1EPTC 1BBRH 1O2YA 5ESTE 3S7KB 1K1NA 1ZJKA 3MNXA 3M37A 1K21H 3E6PH 2ZFRH 2FODA 2ZHFH 1SI5H 1AO5A 4J2YB 2ZHDA 2ZU4A 3QGJA 3VGCC 1YF4A 1OXGA 1NU7B 1MD8A 1UTLM 4TWYA 2B5TB 1MKWK 3SJ8A 3VXFH 1HAIH 2BQ6B 4AX9H 1Q3XA 3BN9A 2BQWB 2AIQA 3UUZA 1HUTH 2WYGA 1UO6A 5C20A 2HPQH 3PLKA 2OD3B 2ZQ1A 5JB9S 1O2IA 1TBQH 3URDA 1FY8E 1QTFA 1LVOA 1LO6A 1O3NA 5AFZH 2J4IA 1WQSA 1GI9B 1A3EH 2G51A 2F9VA 4OS6A 4INLA 1OS8A 3RXBA 3F9HA 1JMOH 1KXCA 3SNDA 2HRVA 2TGPZ 1GG6C 2XRCA 5AF9H 1W0ZU 1AD8H 3ZZ7A 3LKWA 1GJ8B 2OC1A 3TNTA 4A7IB 4X2XA 4AOQA 1G36A 1H1BA 1H8IH 2WUBA 1O38A 4ISIH 2R2MB 1HAVB 1INCA 1PQ8A 1AFEH 1H4WA 1O3FA 1Z8RA 3C1KA 2V3HH 2QCYA 1QGFA 4GCHF 2H1UA 1TPAE 4LXBH 2FX6A 5DK1A 3MU8A 1GBFA 1J15A 4I8JA 7KMEH 1S85A 2BD3A 1E0FD 1KLIH 1MUEB 1C5UA 1YLCA 2I6SA 1P3EA 5C1YA 1QIXB 1ELEE 2UWPA 3A7ZA 3FANA 4WH8A 1DFPA 1FV9A 1ZGVA 4I8GA 2AH4X 1UTOA 4ZXXH 4JK5A 3ZV8A 2AGGX 2VIDA 3VB5A 4Z0KA 1GHAF 3Q00A 2A4OA 4CBOA 2A32A 2BZ6H 5GJ4B 1NFWA 2ZHEH 1CT4E 1MBQA 1GMHF 1OSSA 1TLDA 3ZVDA 3SU4A 1PPCE 1S83A 2FLBH 3BTQE 1NN6A 4AGJA 1O2UA 3A8CA 2WV4A 1KXBA 1GBKA 1HJAB 2GT8A 1XKBC 1ZSJA 1EXFA 1EZQA 3ATLA 2XBVA 2A2QH 1GHWH 2P95A 4OS5A 7GCHG 5G4BA 1T7CA 1Z71A 2CXVA 1IHSH 3M61U 5EGMA 1C5MD 1YCPH 2ZP0H 5DO4H 1LCYA 1D6WA 1MTNC 1VCWA 3QGNB 4IMQA 4OS1A 5B6OA 3SJOA 1ZYOA 4XDEA 1C5VA 3RMNH 1A61H 3BF6H 3H5CB 4AORA 1W12U 1RJXB 2XWAA 1OYTH 1S0RA 4AFZA 3SBKA 1P2KA 4RKJB 3ZZAA 1MAYA 3GY3A 1RTLA 1S81A 1TMTH 2XXLA 3A8BA 1TB6H 3V13A 2Z9KA 4NFFA 3H7TA 1C1OA 2ANKH 4INHA 1QJ1B 3EAJA 3KEEA 1NU9A 5AHGH 5C5NA 3K6ZA 3ZVCA 2O8WA 4INKA 3M7QA 1YCPK 1Z8GA 1G3EA 1C5NH 2VWMA 3M36A 4U32A 4NWKA 1Y59T 2FM2A 3RXAA 2ZPQA 1QL8A 1A5IA 1QL7A 2VIVA 3A83A 1RIWC 2CHAB 1EQ9A 1W8BH 4FXGH 5TJXA 5FCKA 3RMOH 1GCTC 4X8SH 1SQAA 4F49A 1TOMH 1GVZA 1YM0A 4H6TA 1UCYH 3WY8A 2J92A 2GTBA 1T32A 2ZHWH 2GCHF 3EGKH 2EI6A 2JETC 3TH4H 3TK9A 1DWEH 4K60A 2FOHA 3E0PB 2OTVA 8KME2 2PKAA 2GGVB 4MNVA 5IYTA 1C2FA 2A2XH 2BY8X 1DXWA 1ID5H 4WF8A 1D3DB 4CHAC 1Y3WA 2BXUH 1PPZA 1P2QA 2KAIB 1ELVA 2FMJA 1Z6EA 2BY6X 1SLVB 4BAMB 6GCHF 5GDSH 1SSXA 1ABIH 1GCDA 2GCTB 1S6HA 1CBWC 3M3VA 2PSXA 1W2KH 3BEUA 1IQKA 1UCYK 2A5AA 3A86A 1YPGH 1BRCE 1P10A 1T8MA 1GI3A 1TRYA 1BTYA 1O32A 4ZKNU 1RFNA 2V35A 4TPIZ 3SV9A 4X1SU 1ELDE 5L6NH 2VVVA 4ABDA 1DICA 1FY4A 1O3HA 2BX3A 2PFEA 1KXFA 2XC0A 1THPB 1K2I1 3Q3XA 2ZDKA 4CRAA 1ESBA 1SL3A 2GMTC 4MTBA 2FLRH 1J16A 1SGRE 3GY7A 1L4DA 6LPRA 1GPZA 3ENSB 1O31A 4J1YA 5JBBS 4D9RA 3RLYH 1MCTA 1HAOH 1F5LA 2ZGBH 5GCHG 3TJUA 1FAXA 1LVBA 1K1PA 1EASA 1WV7H 1LPKB 1BTWA 1TPPA 3RC5A 2FOFA 1P12E 2AMDA 2J34A 1OWJA 1V2KT 2VIQA 3HGPA 4CR5A 2P59A 1HPGA 1MU6B 3HKIB 3U98H 3GY2A 5DGJA 4PROA 1T8OA 1W10U 3EYDA 1QB1A 2BLVA 4BAOB 1BMAA 5EPYA 4Y0YE 4LK4A 3FAOA 2ZDLA 4AG1A 1XUFA 1MAXA 3MO3A 2B0FA 1KTTB 3MH5A 1TX8A 3RXCA 2P8OC 1AVWA 2O9QA 2XNIA 1C5SA 2Z7FE 4YLQH 1ETTH 5FAHA 1NFUA 2A4QA 3RXGA 4DT7B 3ZVBA 3V3MA 3HATH 1O3PB 2F9UA 1TNLA 4Y0ZE 3UNQA 1JIRA 1O2PA 1P2IA 2SGPE 1LQEA 1DLEA 1IOEA 2ULLA 1HAGE 1F0UA 2ILNA 1HYLA 1QA0A 1XUIA 1C2JA 3GY6A 2Q6DA 5K0HA 2QF0A 1ELBA 3QLPH 2VIPA 4TY6A 4A5TS 1WTHD 1QY6A 2IOTA 4ZHAA 2GZ9A 1O37A 1PFXC 4LOYH 2RCEA 5T6FA 3RXPA 4A1TA 1XUHA 5LPEA 1V2VT 1A0LA 4H42U 1O3AA 2VH0A 1HAZB 1G9IE 1HFDA 2FP7B 3MWIU 1L1GA 1NRQH 2ASUB 2VINA 4HGCA 4JCNA 1AI8H 3KN2A 3BG4B 3DD2H 4IMZA 2AFQB 1KXAA 2V6NA 5C1XA 4JZIA 5FPYA 1C5LH 1N8OB 5CMXH 1GMCG 1C4V2 3U8TH 4BTIB 2OP9A 1BITA 4CH8B 1FAKH 4B75A 2GDEH 1O2HA 2NWNA 4GAWA 3I29A 1TNHA 1G32B 2CN0H 5SGAE 1GBCA 1LTOA 4ZKSU 2FYRA 3P8NA 4FUFA 2VVCA 1D4PB 2C3SA 1BTZA 1TA6A 1TALA 2OC7A 4WJG2 1AZZA 3AAVA 3NKKA 5EODA 4Q80A 1W11U 4KTUA 2TGAA 3MOCA 4ISNA 2SNVA 2A5IA 4Y11E 1O2NA 2BVXH 2ZKSA 4B2AA 3QN7A 3TK6A 3RXUA 1W3CA 4B2CA 1SGQE 3ATKA 3S7HB 3DHKH 5EU8A 1B0EA 2J94A 3CENA 3V7TA 2ALVA 1FY3A 1P05A 1VCQA 2FWWA 2TGTA 2Y7ZA 4Y8ZA 5E0GA 1EJMA 1HDTH 4OGYA 1HAVA 2VH6A 1QHRB 1WQVH 4IC6A 2TGDA 5EQQA 1QRZA 3UIRA 4FUHA 4CREA 2ZHQH 2FTLE 1VCPA 2AYWA 1A0JA 1O5FH 1WAYB 2GT7A 1C2HA 4IGDA 1RS0A 1YPLH 3OTJE 1GBEA 4JZDH 4NGAH 1C2GA 2G81E 1OWIA 1BA8B 3SU5A 1GWAA 4D9QA 1C1RA 1QBVH 3KQDA 1C2LA 3D62A 1DY9A 3SU6A 1X7AC 2R2WU 3GYLB 3RXKA 1TNJA 2W7UA 1GJCB 1TBRH 3H7OA 1S0QA 3EA8A 5HGGA 1Y8TA 4MPWA 2A31A 5EPNA 1QB6A 4B74A 1SG8B 2FTMA 3AAUA 1F92A 1D3TB 1DXPA 3OU0A 4ISHH 3F9EA 3TH2H 1NC6A 3RM2H 4WMDA 3SJKA 3K9XB 4JYUH 1GHZA 1O2RA 5JBCS 3SOSA 1E36B 1JIMA 1NESE 1V2PT 1FQ3A 4DGJA 1GGDC 1P9SA 4VGCC 4X8VH 2B9LA 4ZHLU 1MTWA 1K9OE 2ZCKP 2ZI2H 2A7HA 5DP7A 1M9UA 4YT7H 1SGDE 4GSOA 3L3TA 3LJJA 5K7RA 4OS4A 4I8LA 1TWXB 1WTGH 1SGFA 1AE8H 3RC4A 1HAPH 3TLOA 1EAIA 4ISOA 1ZPBA 2GVFA 1VJ9U 2UWLA 1A2CH 1YPKH 4NZLA 2HOBA 3A80A 2ZWLH 1LDTT 3E91A 4BXWA 8GCHG 4QT8C 1O5BB 3T28A 2CMYA 5J4QA 3RLWH 3KHVA 1GDNA 3QZRA 3B8JA 4K5ZA 4B1TA 2H9TH 1SC8U 3RXHA 2AERH 2H5CA 1DUAA 5E2PA 4E06H 3MFJA 1HJAC 1MQ5A 2C8XB 1V2NT 4FUGA 4KTCA 2BLQA 2G00A 5CHAB 1KYNA 1BJUA 3ZZ6A 2BOKA 4IN1A 5EG4A 2BM2A 3M7TA 3UQOA 1GJDB 1WOFA 1CHOG 1VITG 3FP7E 1D6RA 2FOMB 1O3LA 3S9CA 3D65E 5HYOA 3STJA 2TBSA 3SW2B 1PJPA 1V2TT 1F7ZA 1ZR0A 3ELAH 5I46H 1QURH 3PWCA 1MKWH 6CHAB 1GDUA 1W7GH 1CU1A 1TBZH 4IN2A 4Y10E 3T2NA 1O5EH 4B73A 2Z9GA 1F5KU 3R3GB 4YOIA 1OPHB 1EAXA 3K65B 2ZDNA 3HK3B 2ZQ2A 1Y5AT 1A7SA 1BB0B 2BDIA 1TMBH 5DKMA 1O2MA 1B7XB 1VGCC 3TVJB 3U8RH 2D2DA 4NA9H 4X1RU 1SGCA 1FN8A 2RA0A 1HBTH 4AZ2B 2Z3CA 2ZPSA 2BYAX 5AVDA 5EXNA 1C5RA 2FZZA 2PR3A 2I6QA 4WWYA 1LHEH 4YOJA 3S0NA 2BLWA 3A7WA 5DJ7A 4DCDA 2THFB 1QQ4A 1BIOA 1K28D 3K2UA 1RRKA 1EJAA 2XBWA 1Y3YA 1KLTA 2KAIA 2ZU1A 1TE0A 4K1SA 3GY8A 3NZIA 1O3OA 3SGBE 2FOBA 4MQAA 3KCGH 3DT0H 3Q3KA 3ODDA 2A7CA 3RC6A 3GY5A 4Y8XA 1T4UH 3O8RA 1GMDG 1EP5A 2BDCA 1AY6H 1QJ6B 2CJIA 3L33A 3EA7A 3PMHB 1Q31A 4HFPB 1FDPA 2NU3E 1BBRE 4WXVA 3OX7U 2UUKB 2GDDA 3NXPA 4OS7A 1NPMA 4FUBA 1C9PA 5DP6A 5FX6A 3GISB 3HGNA 1O3BA 1PPFE 3RU4D 2FYQA 2G8TA 3BTME 1QA7A 1JOUB 1UTPA 3HK6B 2GCTC 1O5DH 1H9IE 2ZTZA 3SNCA 2FX4A 3GCTF 2PSYA 1CA0B 1AB9B 3GCHB 2BD5A 1UVUH 4ABJA 2BDHA 1BTXA 2HWLB 1C1MA 4NSYA 4ZUHA 1ELTA 3SUDA 1ZRKA 3OY6U 1GBIA 1NROH 1P09A 1ELGA 4JMYA 1JXPA 2BY5X 3SUEA 1XMNB 4DJZB 2QA9E 3ZZ5A 1K22H 4HTCH 3MU0A 1IQGA 2WPKS 2ZIQH 1V2JT 3LJOA 1C9TA 1EOLA 2OCVB 3UR6A 4X6OA 4DY7B 3KL6A 1O2ZA 2P3TB 1LHCH 4SGAE 5EW1H 2P16A 1KSNA 3P8GA 3SNAA 1PQ5A 4O9VA 3ZV9A 3GOVB 5IDKA 1N6XA 1IHTH 5C5O