1YLDA

Trypsin/bpti complex mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDAGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/inhibitor
molecule keywords Trypsin II
publication title Partially folded bovine pancreatic trypsin inhibitor analogues attain fully native structures when co-crystallized with S195A rat trypsin
pubmed doi rcsb
source organism Rattus norvegicus
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yldA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yldA02
1DLEA 1MTWA 1GJCB 3EA7A 3CP7A 4AFQA 1S84A 1C2FA 2JH5D 3SGBE 2XW9A 3LT3A 1ESBA 1NM6A 1TRMA 2A2QH 1G36A 4FUHA 1YPHE 2OC1A 4CHAC 1O3LA 1HAXB 3G01A 3PROA 4INKA 2EI6A 2NU1E 4K8YA 3KHVA 2GP9B 1C1SA 1AU8A 4BTIB 2FOHA 1HBTH 1EXFA 1O3HA 1UTPA 2A32A 4NSVA 3SJ8A 5TJXA 1LVBA 4OS4A 4JYTA 3ZZ6A 1ELDE 1P57B 1UK2A 1P03A 3FP6E 4HGCA 5CMXH 3UQVA 1KXEA 3SUGA 4Y6DA 1TABE 2BZ6H 1SGTA 5JBBS 3RXBA 5L2ZH 1MU8B 1PPEE 2A31A 4KTCA 4CRCA 1ZMNA 4CRGA 2Y82A 1TBQH 4Y76A 2FIRH 1G3BA 2ZDVH 5L30H 2BDAA 4Y8ZA 1MD7A 2FODA 2B8OH 3BTKE 3PMJA 2Z9IA 5A09A 4CHAB 4I8HA 5E0GA 1EZQA 5AHGH 1EJAA 1AFQC 1P01A 1FY3A 3PTNA 3BTGE 3E1XB 1DFPA 1N6XA 1NY22 2P3TB 2ZPSA 1Z6JH 1EZSC 2TIOA 1V2ST 3HGPA 4JZFH 1U6QA 4RKOB 1YM0A 3TH4H 1D3PB 2YNBA 3QGNB 3ITIA 1O30A 2C8XB 1TPPA 3SNBA 4DGJA 3A8BA 4TPYA 4ISLA 4NZQA 1C2HA 2GKVE 3Q00A 3MO6A 1GDNA 1Y5BT 1JBUH 2PUXB 3A8DA 3KQEA 2R3YA 5EXLA 4YZUA 1GBDA 1GI1A 4BXWA 3I77A 1YP9A 1AZZA 5LPFA 2VINA 1G37A 1MQ6A 1YPHC 1F2SE 1O2TA 4JZEH 4D76A 3EAJA 1Y8TA 5EU8A 1WBGB 1OYQA 1ARCA 2HPPH 3A83A 4AG2A 4B2CA 1XUFA 4ZKOU 1XKBC 2BB4A 4FUBA 1YBWA 2WUBA 1PJPA 2ZG0H 3TH2H 4ABIA 2QXGA 4CR5A 1DXWA 3T28A 1C1TA 1XX9A 1EZUC 2EEKA 2QC2A 2VNTA 2W7UA 2J92A 2SNWA 3E0PB 2OQ5A 4K8BA 2BDCA 3PV4A 2PSXA 3VXEH 1OX1A 1FN6A 4DG4A 3DT0H 5GJ4B 5C1UA 1H9LB 1D6WA 1T4UH 3TK5A 3RXRA 1Q31A 4FUFA 1V2UT 1TMTH 4XOJA 4D9QA 3S0NA 2BX4A 3HPTB 1M9UA 4IC6A 2FPZA 2SGFE 4AFSA 3LGWA 4IBLH 1UTMA 1THRH 3L6PA 3MI4A 2WPKS 5LH8A 4YOGA 1MKWH 2O9QA 1F7ZA 4ZMAH 1CHOF 3SUDA 4ABBA 1L0ZA 1VITF 1DWDH 2BY5X 4YT7H 1Y59T 1G3CA 3SV7A 2F91A 1GJ8B 1RS0A 4BTUB 3GY2A 1O2RA 1EJNA 1A46H 1GBJA 4DVAU 1DSTA 3U8OH 1FIWA 3LJOA 4I8KA 1F5RA 2G55A 2ILNA 3BTDE 3MO3A 3T27A 1HAZB 3SV8A 5J4QA 1BUIA 1XMNB 1NFXA 1BRBE 3VB6A 2ZDLA 1KDQA 2EI8A 1H8IH 2O8LA 1QY6A 1TBRH 1G3DA 1J15A 4ZROA 5HXFA 1P06A 1LKAA 4JZDH 3RXVA 1O3DA 4WXVA 1K1PA 1PPBH 1T8NA 4AYVB 2SGPE 1J14A 1IAUA 4GCHG 1NU7B 5HGGA 1NS3A 1L1NA 2LNCA 1C5QA 1P8VC 1CU1A 1OP8A 2BOKA 2ZCKP 7GCHG 1TA2A 5A0BA 4TY6A 1C1VH 1WTHD 2AFQB 4K5ZA 6CHAC 4BTTB 3LGYA 3LJJA 5FAHA 3A8CA 3AW0A 1TX6A 4NIWA 1ZHMA 2D26C 1LTOA 3TH3H 2BDYA 4YOIA 3FANA 1QTFA 1L4DA 4X2WA 3VGCB 3A7TA 5A8YA 5EXMA 1OWEA 1HNEE 1THSH 1VJAU 2WPLS 2KAIB 2NU4E 3MMGA 1LCYA 1GBMA 1F0TA 3SV2H 1V2WT 4ZUHA 1K28D 1UVPA 4Y71A 1EATA 3SU2A 2AERH 1GBLA 1O5DH 4BANB 1DM4B 1O2JA 1TBZH 3UWIA 1UTLM 1TLDA 1IQHA 2OP9A 3RXTA 1LKBA 2BD5A 2P3UB 3DFJA 6CHAB 1C2KA 2A7HA 2GT8A 1JRSA 4AORA 2FYRA 1VITH 1WOFA 1GBIA 1OXGA 1HAPH 1QJ1B 3MU5A 4UFGH 4A92A 3ZYEA 1CBWC 2W26A 1G2MA 1GHAG 2AIQA 1C2IA 1H9IE 4JYUH 2GZ8A 3LH1A 1NRNH 4FUEA 1C5NH 1JWTA 5DPAA 2XBXA 2CGAA 3M37A 3ELAH 2BDGA 1O2QA 3VFEA 1RTFB 1BRCE 1QRXA 3D23A 1F5LA 3ODDA 1E35B 3EA8A 3E91A 3BN9A 1YPJH 5C2ZA 1Z1IA 1F0SA 1AB9B 2QIQA 1GHBG 2A45B 2IN2A 2GCTB 5F03A 3VEQB 1O2IA 2BVXH 2GMTB 2M5TA 3SU1A 5GXPA 2QXHA 2A4QA 4WJG2 1CBWB 3EGKH 1UTJA 4K69A 3ENSB 1IQLA 1GDQA 3NPSA 1QJ6B 3PTBA 4AFZA 2SGAA 4X1QU 3F9FA 3A88A 3JZ1B 4K3JA 2ZHFH 4MPXA 1GMHF 1P2MA 2Z3CA 2G81E 2Z6BD 1DLKB 3A81A 1ZRBA 2K1QA 1Z7KA 1BTZA 1HAHH 1ZYOA 4THNH 5EG4A 3ZZAA 4BAMB 5ESBA 2VVVA 1EP5A 4A1TA 3KIDU 1WU1A 4Y8XA 1GL1A 1ZSJA 1C2DA 1CA0C 3TK6A 4YOJA 1FIZA 1ID5H 1KSNA 2A7CA 3RM2H 5T6GA 1FY1A 4ZKSU 1GJ6A 5EW2H 3STJA 1CQQA 1SGNE 4X2YA 2J94A 2Y7XA 1Y5UT 4WH8A 1GCDA 1A4WH 4TWYA 4YTAA 3SN8A 1IHSH 1O5EH 4I33A 1TX7A 1NRPH 2VIWA 1KIGH 1MTSA 4DW2U 4BXSA 4KTUA 1TYNA 1O39A 1FY5A 1KY9A 3UR9A 1P9SA 5JB9S 3ATIA 2XC0A 3MNSA 2W7SA 1QBVH 1ZTKA 3TITA 6GCHF 1C2GA 1WUNH 2F9NA 4A7IB 5EGMA 5IYTA 2ZKSA 1IQMA 1SLVB 1C9TA 1O2ZA 2QXIA 3GY8A 1MAYA 1TRNA 1O3NA 1O34A 2OLGA 3GDUA 3MNCA 3K6YA 3KGPA 2A7JA 1BMNH 1XVMA 2SGDE 1V2PT 3SJOA 4I31A 2FI4E 3ZZDA 1QBOA 1EAXA 2WPHS 1W14U 1QJ7B 4UONA 1A1RA 1LHCH 1GBTA 1AN1E 3QTOH 4CRAA 1ANBA 3FZDA 3KQDA 1O33A 1TQ0B 1FY8E 2WINI 3SNDA 3TVJB 2ODPA 2TGDA 3DUXH 1ZZZA 2ZIQH 4ABFA 1KXAA 3H5CB 1GVZA 1PYTC 4K2YA 2PTCE 3L33A 1QHRB 1QB9A 2ZZUH 3DA9B 4X6NA 3ZZ4A 1TPAE 1DPOA 1BCUH 5E8EH 1DUAA 1TNHA 2FOCA 4XFQA 4I8GA 1BTUA 3GCHC 2FX6A 2ASUB 1PYTD 2BHGA 3RXDA 3RU4D 3UNRA 2FX4A 4DCDA 4DOQA 4Y79A 3OYPA 3A84A 1YLCA 2BDIA 4IW4E 3SJIA 2BY6X 2GGVB 3BTFE 4RN6A 1JRTA 1PPZA 5J4SA 1LVYA 2FXRA 1SGDE 4UE7H 4WMFA 1PQAA 1ZHRA 2ZDKA 2VJ1A 4FUIA 4UFDH 3M3VA 1PQ7A 1A5IA 1EAIA 1GHVH 2B5TB 4Q7XA 3AAVA 3FFGA 1YPMH 1DY8A 2ZCLP 3T62A 1HGTH 5JPMH 1QCPA 1Z8JB 3RXJA 2GCHG 1P2NA 1UHBB 1Y3VA 2BD3A 1O2OA 5C20A 3PWCA 4XDEA 2QV1A 3SNCA 2BTCE 1C5SA 3ZZ7A 1RD3B 1S5SA 2H2ZA 2PW8H 4GPGA 1NRRH 1V2TT 3TPIZ 1TGNA 3RMNH 2G8TA 1GPZA 1ELGA 3NUMA 1EPTC 2A4OA 1ANEA 1G2LA 5AFYH 2ZWLH 2EI7A 2OUAA 2ZU2A 1O2XA 2ZNKH 1OPHB 1OYTH 5K7RA 3T25A 1H9HE 4X8TH 1E37B 3CS0A 3M5MA 3RXIA 2VH0A 3TJUA 4I7YH 5FCRA 1SFQB 2H5CA 1MH0A 1HJAC 4H6TA 2HPQH 1VGCC 2AMQA 2ODQA 1P3EA 3P8FA 3RXMA 3SQHE 3TGJE 1NFYA 1TONA 1HB0B 3F68H 1MCVA 5FBEA 4OS7A 1LHGH 3ZZ3A 2GV7A 1HJ8A 1V2LT 4MG3A 2A0QB 1KLTA 4U2WA 8KME2 1XUJA 5DJ7A 2BQ6B 2AH4X 3EDXB 1O2GH 1C5VA 2FTMA 3NWUA 4OS2A 2H1UA 4B71A 4AOQA 3B23B 1DITH 1VZQH 1PPFE 1AE8H 3GDSA 4XBBA 1HJAB 1VGCB 2ZU4A 4CBNA 2CJIA 3B9FH 1IOEA 4AX9H 2NU2E 1CE5A 4UEHH 1MU6B 1D4PB 3RXEA 1T31A 2JH6D 2ZQ2A 1A0JA 1FAKH 1ZPCA 2PV9B 1K1OA 4Q7ZA 3D65E 3L3TA 1P2QA 3RM0H 1BMMH 1W2KH 4AGJA 3O8DA 2QF0A 4X1PU 3RC6A 1VCQA 2ZA5A 2BQ7B 3Q3KA 1CVWH 2FTLE 2A4RA 3SO3A 3A7YA 1W0YH 1KLJH 1V2VT 1GBHA 4MPWA 3UY9A 2FOGA 7ESTE 2J4IA 1C5WB 3SJ9A 5DP8A 1FV9A 4GCHF 3ZYDA 5EQQA 1HAGE 1TGCA 1IQGA 4NFFA 2ZFQH 3WY8A 3QUMP 7GCHF 3RXCA 3R3GB 1YPKH 1E34B 4NG9H 1A2CH 4IN2A 4OS6A 2Z3EA 3M36A 2ZU1A 4FXGH 1TGBA 3A7ZA 1BZXE 1P12E 4DIHH 1W7GH 1ESAA 4IC5A 1EOJA 2Y7ZA 2QN5T 1FAXA 1TGSZ 1O2WA 1J16A 1P9UA 1TOCB 2G00A 1MAXA 1GJ9B 3URDA 3UR6A 1QB6A 4MNWA 2BD4A 2XXLA 4MPUA 1AZ8A 4AN7A 1P2JA 3BEUA 4B1TA 4A1XA 1BBRE 1MUEB 4X8UH 3A7VA 4NA7A 1SSXA 5LPRA 1T8OA 1ZMJA 1SQAA 1QURH 3QWCH 5DP4A 2SNVA 1N8OB 2XNIA 7LPRA 1DVAH 2PTNA 2FP7B 1A7SA 1QQ4A 1ZMLA 5CE1A 3LU9B 3M3TA 2AYWA 3GY3A 2FS9A 3UNQA 1YPEH 4Y8YA 1IHTH 1O2LA 3C27B 3S9BA 1GHAF 3PWBA 2B9LA 3QLPH 2ZTYA 2RA3A 1G32B 5DO4H 4DJZB 3LKWA 1C1OA 3ATKA 3GCTG 3P17H 3K65B 3PLPA 3BTHE 1P09A 2CF9H 5F6MA 3STIA 1SHHB 1S82A 2GT7A 1GI4A 1BRAA 1S0QA 2CXVA 1W0ZU 2PKAA 1HXEH 3O8BA 3FAOA 3HGNA 1GBFA 5E0JA 1HFDA 4MLFB 1O36A 4RKJB 1ELFA 2F9UA 1QL9A 2QF3A 4SGAE 1L2EA 1GHBF 3F9EA 2BMGB 2BXTH 1DX5M 1O3OA 1GMCG 5IDKA 1HV7A 4ABGA 2Q6GA 1HCGA 1UTKA 1SG8B 1AFEH 3QGJA 4ABDA 3NKKA 1WV7H 4DIIH 1HDTH 1BITA 1FJSA 3AW1A 3SV9A 4E7RG 2G4TA 3LOXA 1T4VH 3SW2B 1CT4E 4TPIZ 4X0WU 2QYIA 1GI7B 3QDZB 5FCKA 1MKXK 1OWDA 1W10U 1AIXH 3UIRA 1G9IE 1C5ZB 1DICA 5L6NH 5GIBA 4IMQA 1BMLA 2C4FH 2BDHA 2BOHB 2DUCA 1LPZB 4Z0KA 1YC0A 2OXSA 4CH8B 1S85A 2XCFA 1EB1H 1C5XB 4JCNA 1GJBB 3Q3YA 3W94A 1C1MA 3QZRA 1SLUB 1RGQA 1YCPK 2BZAA 1HXFH 2F9VA 1EB2A 1Y5AT 3A80A 1O32A 3P6ZB 4AB8A 1MMJN 1LMWB 4CREA 1C2JA 6LPRA 2AGIX 3SBKA 1W8BH 1LVOA 2IPHA 3TGKE 3VXFH 1KDQB 5AF9H 2GVFA 1MD8A 3VGCC 5T6DA 2QXJA 1OWKA 3TU7H 2SGQE 3RXKA 5FPSA 1XUGA 5DG6A 2VVCA 4NIYA 1F92A 3CENA 2BD8A 1ANCA 2UWLA 2THFB 1GWAA 3KCGH 1VCWA 1UK4A 1IQIA 1T32A 4UFEH 2CF8H 2W3KA 2RG3A 2WPIS 4OS5A 2STAE 1CO7E 3A8AA 1MZAA 3AASA 2R9PA 3RXAA 1BT7A 3LIWA 2ZPRA 3T29A 1HYLA 1C4V2 2XTTB 1IQNA 1GJ7B 5ESTE 4ZKRU 1AO5A 2C3SA 6ESTA 5GCHG 1DDJA 3ZVDA 2F3CE 2QAAA 3M5OA 2VIVA 1H4WA 2FOAA 2PGQB 1AWFH 1K1IA 3OY5U 2Z9JA 1UTQA 3KN2A 3MU4A 1MCTA 5A0AE 2W5EA 1L4ZA 3A82A 1TB6H 1GI3A 5FPTA 2R3UA 2OC8A 3U1IB 3MH5A 3BTTE 4DT7B 1AB9C 1QGFA 1TNLA 1MKXH 2BVRH 4CRBA 1HAYB 1L1GA 2GCTC 1ACBE 2GMTC 4K1TA 1LPKB 3BF6H 1TMBH 3VB5A 2YOLA 3T2NA 2O8UA 3I78A 1SMFE 1QQUA 3RUOA 8GCHG 1T7CA 2SGEE 1C5PA 1LHDH 2UUYA 4FU7A 3RXUA 2DE9A 3FP8E 2UUFB 1TALA 3UUZA 2FI3E 1SGFA 1K21H 4PROA 1Z8GA 4O03A 4Y7BA 4GHQA 2GCHF 5HMAA 1HAOH 1UCYK 1EJMA 3M35A 1LDTT 1TMUH 3BV9B 1CT0E 2BY8X 1BTWA 1GCTB 3RMMH 4IGDA 5G4BA 2PUQH 1P05A 1DUEA 1B0FA 2FYQA 2TGPZ 2A4GA 5DP3A 1SHYA 3EQ0H 4X6OA 1EX3A 1K9OE 3UTUH 2ZECA 2O8TA 3TJOA 1LHEH 1ZJDA 3C1KA 1ABIH 3EA9A 5FX5A 4FUDA 3LONA 1GMDG 2R2MB 2PWXA 3A7WA 1P10A 3AAUA 3HKJB 4B74A 4GUXA 1K1LA 3ATWA 1P2KA 3PO1C 1AVXA 3CS7A 4Y0YE 4AG1A 3M7QA 3GY7A 3BIVH 4ISOA 4D9RA 1HAVA 1Y3XA 5JDUB 3U8TH 3RU4E 3UQOA 3MWIU 1EP6A 4FVBA 1SGEE 2P93A 1SGCA 1RTKA 3SHAH 4O3TA 4CRDA 2BY9X 2Q6FA 1ZGIA 5EPYA 1ZJKA 4HFPB 2BD7A 4U30A 3TNTA 5JBCS 1C5UA 3URCA 1ZTJA 1FI8A 2WUCA 3MH6A 1P2IA 1AUJA 1LVMA 2VB0A 2H9TH 2Y6TA 3MFJA 5FBIA 2TBSA 1V2JT 1NFWA 3V13A 3PO1B 3SJKA 2ZFFH 4IS5A 3NZIA 3ZV9A 2RCEA 1ZSLA 3MU1A 4MNXA 2P59A 4X2XA 4B73A 3TK9A 3KF2A 2FOMB 1QRZA 1ELEE 1BBRK 9LPRA 1EKBB 1O2PA 8LPRA 1WSSH 2OBQA 2F83A 2RDLA 3BTME 4X1SU 1O3MA 1ZHPA 1D6RA 2C8ZB 1GJAB 3D62A 1FMGA 4X6MA 1GBEA 4NWLA 2BLQA 2ANKH 2HALA 4DY7B 2FMJA 2ZU5A 2IJOB 3P92A 4O3UA 1QRWA 1K2I1 1ZTLA 1BIOA 2G5NA 1PPGE 3GYMA 3S7HB 3RC5A 2BXUH 2HNTE 1QNJA 5ABWA 1O3PB 1A5GH 2OCVB 5A8XA 4FUGA 2OBOA 5GDSH 4YT6H 3RLWH 1C5MD 2HRVA 1BRUP 3LPRA 2WYGA 3RXHA 1ARBA 2F9BH 1DOJA 3LGTA 1V6DA 1C1WH 5DK1A 1FZZA 4MPVA 4Y10E 2WV4A 2ESTE 1NC6A 1O3FA 2ZGJA 4O9VA 3SQEE 1AWHB 1SLWB 1V3XA 3KNXA 5E2PA 3T26A 1SB1H 5EQSA 1GHXH 4KGAA 1BTPA 2VWNA 1HIAA 2UUKB 4A5TS 3P70B 1V2MT 2B0FA 1AKSA 1BTXA 3S69A 4NSYA 1A3EH 2XBVA 3NXPA 4NIXA 2ZDMA 3PMBB 4AB9A 2CV3A 2XBYA 2A5AA 2AS9A 5B6OA 4J2YB 5I25A 2XWBI 5GWZA 1AMHA 1LO6A 3QO6A 1UTNA 1F0RA 1CA8B 2BX3A 2PGBB 3ATMA 4LZ4B 1YPGH 1DT2A 3MU8A 1Y3YA 2TGTA 3E16B 1JIRA 1GJDB 1MZDA 1EZXC 1CGJE 2XRCA 1O2HA 1SPJA 2ANMH 4NZLA 4Z6AH 4M7GA 3FZZA 5EQRA 3W95A 4GLYA 3S9AA 1BBRH 4MVNA 4JZ1A 2HNTC 2FLRH 1BTYA 1AUTC 4X2VA 1CGHA 2PLXA 3GCTF 2XC4A 3A85A 2LPRA 1XKAC 1QBNA 2CN0H 2TGAA 1GHWH 1GG6C 1O3JA 1TNJA 1P11E 2J95A 4AFUA 1O2MA 2P8OC 1BTHH 4I8JA 4F4OC 1V2NT 2HWLB 2VWMA 4LZ1H 1GMCF 2V3HH 5FPYA 3N7OA 1E38B 1C5YB 2XBWA 4D7FA 4XBDA 2ANWA 1HLTH 1A0LA 3K2UA 2J38A 3ZV8A 2VIPA 2P95A 3OU0A 1IQEA 2GDEH 4ISIH 2AMDA 2XWAA 3M7TA 2STBE 1UJ1A 2PFEA 2TRMA 3SU5A 3OX7U 1O2KA 1EASA 2BD2A 1B0EA 5TCCA 1F5KU 1FQ3A 3FVFB 4AYYB 1ELTA 4YO9A 5C3NA 1GG6B 3SI3H 1KLIH 3KQBA 3UWJH 3I29A 1EPTA 5AVDA 4ZHAA 5LPEA 1ELVA 1NT1A 1UCYE 2P8OB 2Y81A 4X1NU 1O0DH 3ZZ5A 3ZZ8A 4ABEA 3GYLB 5LGOA 3LGVA 5C1YA 2VIDA 1NRQH 1AHTH 1V2QT 1O38A 3BG4B 3HATH 1C1PA 1LPGB 1RXPA 2ZTXA 1FDPA 3QTVH 5F8XA 1SOTA 1TQ7B 3PMAB 3JZ2B 4MNYA 1DWCH 4DURA 1C1UH 1N6YA 1XM1A 2HLCA 3BTWE 1ZPZA 3EYDA 1NRSH 1RJXB 3E3TA 2UWOA 3U8RH 4IMZA 2WPMS 1DWBH 1V2OT 2FM2A 4ESTE 1QL8A 1NTPA 1TX8A 1Z71A 3K6ZA 1BJUA 1OOKB 1GHYH 4BNRA 1GHZA 1SFIA 4H6SB 1V2RT 3BTEE 3QK1A 1CSOE 2OQUA 4X6PA 3BEFB 1YLDA 4A6LA 4QT8C 1MTNB 4JYVH 4WMDA 4ASHA 1SGRE 1AQ7A 3TGIE 2D8WA 2Z9KA 5DP5A 1OSSA 1Q2WA 1DS2E 3TLOA 3LH3A 2ODYB 1CHGA 2ZDAH 1CT2E 1S0RA 4X8SH 5L2YH 1N8OC 2P3FH 1NN6A 3MYWA 4ABJA 1IQKA 1WCZA 3UNSA 3S7KB 4I8LA 1MBQA 4H4FA 1OP2A 2JKHA 2ZFRH 1H8DH 2ZHQH 3TNSA 1MTVA 3ATLA 5GCHF 2A5KA 1GJ5H 3VPKA 2FO9A 4RSPA 1J8AA 5DKMA 2NU3E 3V0XA 3ZVCA 3OTJE 4JK5A 2ZGXH 2ANYA 2H9HA 1OP0A 1NROH 2NU0E 1MKWK 1TRYA 4X1RU 5BRRE 4FUJA 4UFFH 2ZFTA 3UREA 3LC3A 1YPLH 4BOHA 3LGIA 2FOEA 4F49A 1Z8RA 1BB0B 1ZOMA 4NFEA 1GJ4H 2ZQ1A 1PPCE 4IN1A 2D2DA 1KTTB 3TJNA 2AGGX 3ZVAA 3ODFA 2PR3A 1BA8B 2Y80A 4GHTA 1FLEE 4AGKA 5PTPA 5A2MH 4ISHH 1SQTA 1TNKA 5FXLA 3ZVGA 3Q77A 8GCHF 1NO9H 1ZLRA 4Y11E 4Q80A 2VU8E 1GVKB 1SGFG 2ZFPH 2UWPA 4BAKB 2H5DA 2C8WB 3SU6A 3RXPA 2ZTZA 2B7DH 1IQFA 3MNXA 1C4Y2 5K0HA 4VGCC 3NCLA 1ESTA 1IQJA 2PKAB 2ZGBH 1AFQB 4BAOB 1HUTH 3HK6B 4XE4A 1AI8H 1P3CA 1P04A 1WYKA 1D3TB 1YYY1 2OTVA 4HI3A 3PMHB 4WF8A 4NA8A 5TCAA 5BPEA 4ABAA 4MQAA 1JOUB 3RXOA 2IOTA 1S6HA 1QL7A 1C1QA 2NWNA 1OWJA 3HKIB 3SNAA 1O2YA 2G5VA 2FS8A 1NFUA 4R0IA 1GMDF 2J2UA 4FU8A 4UD9H 1JIMA 1SLXB 3V7TA 1SGIB 1W11U 5EODA 1UO6A 4B76A 1EAUA 3DHKH 1AD8H 1PPHE 2EA3A 3D49H 3U98H 2HGTH 4LOYH 1TOMH 5CHAC 1ZSKA 1MQ5A 1NESE 4VGCB 3ZZ9A 3VB7A 3V3MA 1LQEA 4Q2KA 1O3KA 1X7AC 1O3EA 4WMEA 4BAQB 3PLBA 2ZC9H 2C90B 3PLKA 1WQVH 2H6MA 2HNTF 3U69H 3F6UH 3K9XB 1TPSA 1UVUH 1W7XH 3LGUA 2GZ9A 1ZRKA 1O5GH 1Q3XA 1OKXA 5EPNA 1Y3WA 3FP7E 1OS8A 3F9GA 3VB4A 4TY7A 1SOZA 1QB1A 1C1RA 4TWWA 1GI0A 4FVDA 1C2EA 1B7XB 3GICB 3IITA 1YKTA 5FX6A 5CHAB 3Q76A 3SUFA 1FY4A 1D3QB 2ZU3A 1KXBA 2QA9E 3MH4A 4ZXYH 2ZF0H 3M5LA 1TA6A 2VH6A 2GTBA 4B2AA 1BHXB 2BLOA 1SGQE 4Q7YA 2GD4B 7KMEH 1TAWA 3P8NA 2VIQA 1PQ8A 4FUCA 3SNEA 1FONA 1GL0E 1SR5C 1TIOA 1UVTH 1XXFA 2Z3DA 1P0SH 4KP0A 2J34A 1K1JA 4GAWA 4Y7AA 3UFAA 4YM9A 2YNAA 2WYJA 3M5NA 2GDDA 2BDBA 2HVXA 4JZIA 8ESTE 3KEEA 2H9EH 1EAWA 2CHAC 4I32A 4SGBE 2ZEBA 1S81A 5C5NA 1J9CH 1GI6A 1CGIE 2ZP0H 3GOVB 1MTUA 1FNIA 3A89A 2A2XH 3M3SA 1O3CA 5HYOA 1OWHA 1DANH 5EOKA 1GVLA 1DY9A 4U32A 2GV6A 1ELAA 2KAIA 1GCTC 1O3BA 1K1MA 1DE7H 1GBKA 2VWLA 3Q3XA 1QIXB 1TNIA 4U01A 3P95A 1JXPA 3QZQA 3DD2H 4YLUA 1O3GA 2Z94A 1GI8B 4LXBH 2OC7A 2CHAB 4OGYA 1D3DB 4HTCH 2BQWB 2WV5A 4CBOA 3ZZCA 1YCPM 3E0NB 1J17T 1O35A 1S83A 4GSOA 1YCPH 1ZGVA 3SI4H 1FPHH 1AY6H 4JK6A 1HJ9A 1KXCA 3RDZA 3E8LA 2OD3B 2GZ7A 1QFKH 1O37A 2ZHEH 1T8MA 5C1XA 4ZH8A 2QY0B 1UVSH 2PKSC 2R0LA 2A5IA 2G52A 3GY6A 3RXFA 3RU4T 1SBWA 3T5FH 4D8NA 5HM9A 3QX5H 1O2SA 3SGAE 1ETRH 1XVOA 4CH2B 4B75A 1EUFA 1XUHA 1ELBA 1FUJA 1B5GH 5JBAS 1AGJA 3RLYH 1Z1JA 3S9CA 3UPEA 2QGRA 2RA0A 5F8TA 3RXLA 1K1NA 4X8VH 2OC0A 3SZNA 1MBMA 4Y0ZE 9ESTA 1UK3A 2Q6DA 1HAVB 3SV6A 3BIUH 5DP7A 3SHCH 1GDUA 2FDAA 2PKSB 3RXSA 1HAIH 2FZZA 3OSYA 2ZI2H 3UOUA 5SGAE 4NA9H 1O5AB 1SQOA 2W3IA 4XBCA 1TWXB 4ZKNU 1A5HA 1O2UA 1FN8A 3GISB 3M7UA 1AVWA 1GI2A 2BD9A 3KL6A 4D7GA 1BQYA 1BMAA 3A87A 1ETSH 3RMOH 2ULLA 4KKDA 1RIWC 1THPB 2ZFSA 1CHOG 1ELCA 1O5FH 1VITG 1EOLA 5T6FA 5FHTA 3GY4A 1AE5A 2FI5E 1NPMA 2ALPA 1C2LA 1F0UA 1TNGA 3PYHA 3SUEA 2FWWA 1D9IA 4LK4A 4J1YA 4NWKA 4MDSA 4NCYA 3DFLA 1SL3A 1WAYB 1Z8IB 4GVUA 3RXGA 1SC8U 3NK8A 4WWYA 1G30B 2AEIH 3H7TA 4H42U 4CR9A 4INLA 3F9HA 5ETXA 2XCNA 3SU0A 4YESB 3H7OA 1DWEH 2ZGCA 2PHBA 3UOPA 1UVOA 2BVSH 1FXYA 2O8MA 2C8YB 1O2NA 1ETTH 5HM2A 1RIWB 4YLQH 4CRFA 1UCYH 2VWOA 4ZAEA 1CA0B 2CMYA 2Y5FA 1O31A 5JB8S 2VGCC 3BG8A 2SFAA 1BHXF 1RTLA 2FLBH 4MTBA 5C67A 4JMYA 1HRTH 3MHWU 3SU3A 2XC5A 3KQCA 5T3HA 2PSYA 5A8ZA 5JYIA 3RXQA 2BYAX 3GDVA 3SGQE 1Z6EA 2F9PA 2R0KA 1C5OH 1GGDC 3PM3A 5GPIB 1QR3E 3IWMA 1RRKA 1JMOH 1N1LA 1C5TA 3QN7A 1K22H 4OS1A 3ZVFA 1KXDA 2D1JA 3EE0B 3O8CA 5JBTA 1TGTA 2G4UA 2A1DB 3MOCA 2Z9LA 1E36B 4TYDA 4K60A 4UDWH 4WY3A 1V2KT 2VGCB 1W12U 1KTSB 1BJVA 2J9NA 1O3AA 1HIAB 3MO9A 2ZCHP 5E2OA 4ISNA 2ZGHA 3RP2A 3GCOA 1AKSB 2GX4A 2QCYA 3AVZA 2ZO3H 3IG6B 3BTQE 4ZHLU 1C1NA 2OINA 1VJ9U 2V3OH 1NU9A 5E0HA 1GGDB 1BDAA 1XUKA 2BLVA 1C2MA 1XXDA 2FOFA 1XUIA 4AZ2B 1O5CB 1AVGH 1H1BA 2ZDNA 3E6PH 3U1JB 1A61H 1C5LH 3A7XA 4E06H 3P8OA 3VB3A 2AIPA 5A0CA 2BM2A 1LHFH 3TJVA 1S6FA 1TE0A 3MTYA 1FPCH 1SI5H 3GCHB 1UHBA 2ALVA 1RFNA 2BLWA 2C93B 1KXFA 2ZHWH 3GCNA 3RC4A 3ZVEA 1KYNA 3ZZBA 2FESH 4E7NA 5DP9A 4ZXXH 1A3BH 1P02A 4K1SA 1DXPA 2R2WU 3LC5A 2FEQH 5DGJA 4INHA 4OGXA 2Z7FE 1UMAH 1L1JA 4ZHMU 1GI9B 1O5BB 1P2OA 3P8GA 5AFZH 5C5OA 2VIOA 1YGCH 2DE8A 4ABHA 1ORFA 2Y5GA 2ZHDA 5F8ZA 4WH6A 3E90B 3R0FA 1ZR0A 1T8LA 2FOBA 3HK3B 2P16A 1NZQH 1SGPE 5I46H 2JETC 2HOBA 1ANDA 4HZHA 3F1SB 3SORA 1ABJH 3BG4C 1Y3UA 1WTGH 3GY5A 1VCPA 4KELA 2VVUA 4WXIA 2I6SA 3SOSA 1EQ9A 1LQDB 3MNBA 1DSUA 1E0FD 1WQSA 1GMHG 2ZPQA 3MH7A 3V12A 1QA0A 4KTSA 2BY7X 3LDXH 5H4IB 1PQ5A 1A0HB 4MNVA 4WVPE 2AMPA 3O8RA 4K1EA 1QA7A 1BOQA 1C4U2 1W13U 2V35A 4R8TB 2P94A 1SGYE 1O3IA 3ESTA 4NIVA 1G3EA 2Y5HA 1C9PA 1W3CA 1MTNC 3A86A 1EPTB 4XSKU 3OY6U 2AGEX 2JETB 1VR1H 2Z9GA 3B8JA 4B2BA 3RMLH 5EW1H 1O2VA 2TPIZ 1OWIA 3PB1E 3ZVBA 3U9AH 1GBBA 1SVPA 1TPOA 2WPJS 2XYAA 1GBCA 2Q1JA 1C5RA 3TIUA 4E05H 1GBAA 6GCHG 3MU0A 3M61U 4BAHB 2JH0D 1HPGA 2G51A 4A1VA 5EXNA 5DP6A 1YF4A 1UTOA 1TFXA 2I6QA 3BEIB 2V6NA 4NGAH 2EC9H 1PFXC 3BSQA 2O8WA 2UUJB 4O97A 1ZPBA 2F9OA 2V0BA 1INCA 4FU9A 3SU4A 1GI5A
chains in the Genus database with same CATH superfamily
1DLEA 1MTWA 1GJCB 2JIZD 3CP7A 3EA7A 4AFQA 1S84A 1C2FA 2JH5D 3SGBE 2XW9A 3LT3A 1ESBA 1NM6A 1TRMA 2A2QH 1G36A 4FUHA 1YPHE 2OC1A 4CHAC 1O3LA 1HAXB 3G01A 3PROA 4INKA 2EI6A 2NU1E 4K8YA 3KHVA 2GP9B 2EQNA 1C1SA 1AU8A 4BTIB 2FOHA 1HBTH 1EXFA 1O3HA 1UTPA 2A32A 4NSVA 5T1VA 3SJ8A 5TJXA 1LVBA 4OS4A 4JYTA 3ZZ6A 1ELDE 1P57B 1UK2A 1P03A 3FP6E 4HGCA 5CMXH 1NBME 3UQVA 1KXEA 3SUGA 4Y6DA 1TABE 2BZ6H 1SGTA 5JBBS 3RXBA 5L2ZH 1MU8B 1BMFD 1PPEE 2A31A 4KTCA 4CRCA 1ZMNA 4CRGA 2Y82A 1TBQH 4Y76A 2FIRH 1G3BA 2ZDVH 3F3BA 5L30H 2KCPA 2BDAA 4Y8ZA 1MD7A 5EJ1A 2FODA 2B8OH 3BTKE 3PMJA 2Z9IA 5A09A 4CHAB 4I8HA 5E0GA 1EZQA 5AHGH 1EJAA 1AFQC 1P01A 1FY3A 3F2FA 3PTNA 3BTGE 3E1XB 1DFPA 1N6XA 1NY22 2P3TB 2ZPSA 1Z6JH 1EZSC 2TIOA 1V2ST 2WZQA 3HGPA 4JZFH 1U6QA 4RKOB 1YM0A 3TH4H 1D3PB 2YNBA 3QGNB 2J97A 1YWUA 1O30A 2C8XB 1TPPA 3ITIA 3SNBA 2J98B 4DGJA 3A8BA 4TPYA 4ISLA 4NZQA 1C2HA 1E1QD 2GKVE 3Q00A 3MO6A 3EE7A 1GDNA 1Y5BT 1JBUH 2PUXB 3A8DA 3KQEA 2R3YA 5EXLA 3FO8D 4YZUA 1GBDA 1GI1A 1SQRA 4BXWA 3I77A 1YP9A 1AZZA 5LPFA 2VINA 1G37A 1MQ6A 1YPHC 5B6LA 1F2SE 1O2TA 4JZEH 4D76A 3DCLA 3EAJA 1Y8TA 5EU8A 1WBGB 1OYQA 1ARCA 2HPPH 3A83A 4AG2A 4B2CA 1XUFA 4ZKOU 1XKBC 2BB4A 4FUBA 1YBWA 2WUBA 1PJPA 2ZG0H 3TH2H 4ABIA 2QXGA 4CR5A 1DXWA 4ZCNA 3T28A 3SZEA 1C1TA 1XX9A 1EZUC 2EEKA 2QC2A 2VNTA 2W7UA 2J92A 2SNWA 3E0PB 2OQ5A 4K8BA 2BDCA 3PV4A 2PSXA 3VXEH 1OX1A 1FN6A 4DG4A 3DT0H 5GJ4B 5C1UA 1H9LB 1D6WA 1T4UH 3TK5A 3RXRA 1Q31A 4FUFA 1V2UT 1TMTH 4XOJA 4D9QA 3S0NA 2BX4A 3HPTB 1M9UA 3PV2A 4IC6A 2FPZA 2SGFE 4AFSA 3LGWA 4IBLH 1UTMA 1THRH 3L6PA 3MI4A 2WPKS 5LH8A 4YOGA 1MKWH 2O9QA 1F7ZA 4ZMAH 1CHOF 3SUDA 4ABBA 1L0ZA 1VITF 1DWDH 2BY5X 4YT7H 1Y59T 1G3CA 3SV7A 2F91A 1GJ8B 1RS0A 4BTUB 3GY2A 2HVYB 1O2RA 2GJGA 1EJNA 1A46H 1GBJA 4DVAU 1DSTA 3U8OH 1FIWA 3LJOA 4I8KA 1F5RA 2G55A 2ILNA 3BTDE 3MO3A 3T27A 1HAZB 3SV8A 4XD7D 5J4QA 1UW7A 1BUIA 1XMNB 1NFXA 1BRBE 3VB6A 2M2AA 2ZDLA 1KDQA 2EI8A 1H8IH 2O8LA 1QY6A 1TBRH 1G3DA 1J15A 4ZROA 5HXFA 1P06A 1LKAA 4JZDH 3RXVA 1O3DA 3OEHD 4WXVA 1K1PA 1YY3A 1PPBH 3AK5A 1T8NA 4AYVB 2SGPE 1J14A 2LP6A 1IAUA 4GCHG 1NU7B 5HGGA 1NS3A 1L1NA 2LNCA 1C5QA 1P8VC 3NRLA 1CU1A 1OP8A 2BOKA 2ZCKP 7GCHG 1TA2A 5A0BA 4TY6A 1C1VH 1WTHD 2AFQB 4K5ZA 6CHAC 1COWD 4BTTB 3LGYA 3LJJA 5FAHA 3A8CA 3AW0A 1TX6A 4NIWA 1ZHMA 2D26C 1LTOA 3TH3H 2BDYA 4YOIA 3FANA 2W6ID 1QTFA 1L4DA 4X2WA 3VGCB 3A7TA 5A8YA 5EXMA 2JJ1D 2K8IA 1OWEA 1HNEE 1THSH 1VJAU 2WPLS 2KAIB 2NU4E 3MMGA 1LCYA 1GBMA 1F0TA 3SV2H 1V2WT 4ZUHA 1K28D 1UVPA 4Y71A 1EATA 3SU2A 2AERH 1GBLA 1O5DH 4BANB 1DM4B 1O2JA 1TBZH 3UWIA 1UTLM 1TLDA 1IQHA 2OP9A 3RXTA 1LKBA 2BD5A 2P3UB 3DFJA 6CHAB 1C2KA 2A7HA 2GT8A 1JRSA 2F43B 4AORA 2FYRA 1VITH 1WOFA 3F2HA 1GBIA 1OXGA 1HAPH 1QJ1B 3MU5A 4UFGH 4A92A 5C17A 2KZ4A 3ZYEA 1CBWC 2W26A 1G2MA 1GHAG 2AIQA 1C2IA 1H9IE 4JYUH 2GZ8A 3LH1A 1NRNH 3KYGA 2QE7D 5HIZA 4FUEA 3W1EA 1C5NH 1JWTA 5DPAA 2XBXA 2CGAA 3F2GA 3M37A 3ELAH 2BDGA 1O2QA 3VFEA 1RTFB 1BRCE 1QRXA 3D23A 1F5LA 3ODDA 1E35B 3EA8A 5KECA 3E91A 3BN9A 4F55A 1YPJH 5C2ZA 5EIYA 1Z1IA 1F0SA 1AB9B 2QIQA 2KX4A 1GHBG 2A45B 2IN2A 2GCTB 5F03A 3VEQB 1O2IA 2BVXH 2GMTB 2M5TA 3SU1A 5GXPA 2QXHA 2A4QA 1E1RD 4WJG2 2W6JD 1CBWB 3EGKH 1UTJA 4K69A 3ENSB 1IQLA 1GDQA 3F0OA 3NPSA 1QJ6B 3PTBA 4AFZA 2SGAA 4X1QU 4OM9A 3F9FA 3A88A 3JZ1B 4K3JA 2ZHFH 4MPXA 1GMHF 1P2MA 2Z3CA 2G81E 2Z6BD 1DLKB 2XOKD 3A81A 1ZRBA 2K1QA 1Z7KA 1BTZA 1HAHH 1ZYOA 4THNH 5EG4A 3ZZAA 4BAMB 5ESBA 2VVVA 1EP5A 4A1TA 3KIDU 4B6EA 1WU1A 4Y8XA 1GL1A 1ZSJA 1C2DA 1CA0C 3TK6A 4YOJA 1FIZA 1ID5H 1KSNA 2A7CA 3RM2H 5T6GA 1FY1A 4ZKSU 1GJ6A 5EW2H 3STJA 1CQQA 1SGNE 4X2YA 2J94A 2Y7XA 1Y5UT 4WH8A 1GCDA 1A4WH 4TWYA 4YTAA 3SN8A 1IHSH 1O5EH 4I33A 1TX7A 1NRPH 2VIWA 1KIGH 1MTSA 5DN6D 4DW2U 4BXSA 4KTUA 1TYNA 1O39A 1FY5A 1KY9A 3UR9A 1P9SA 5JB9S 3ATIA 2XC0A 3MNSA 2W7SA 2KCOA 1QBVH 1ZTKA 3TITA 6GCHF 1C2GA 1WUNH 2F9NA 4A7IB 5EGMA 5IYTA 2ZKSA 1IQMA 1SLVB 1C9TA 1O2ZA 2QXIA 3GY8A 1MAYA 1TRNA 1O3NA 1O34A 2OLGA 3GDUA 3MNCA 3K6YA 3KGPA 2A7JA 1BMNH 1XVMA 2SGDE 1V2PT 3SJOA 4I31A 2FI4E 3ZZDA 1QBOA 1EAXA 2KCAA 2WPHS 1W14U 1QJ7B 4UONA 1A1RA 1LHCH 1GBTA 1AN1E 3QTOH 4CRAA 1ANBA 3FZDA 3KQDA 1O33A 1TQ0B 1FY8E 2WINI 3SNDA 3TVJB 2ODPA 2TGDA 3N7DA 3DUXH 1ZZZA 2ZIQH 4ABFA 1KXAA 3H5CB 1GVZA 1PYTC 4K2YA 2PTCE 3L33A 1QHRB 1QB9A 2ZZUH 3DA9B 4X6NA 3ZZ4A 1TPAE 1DPOA 1BCUH 5E8EH 2LELA 1DUAA 1TNHA 2FOCA 4XFQA 4I8GA 1BTUA 3GCHC 2FX6A 2ASUB 1PYTD 2BHGA 3RXDA 3RU4D 3UNRA 2FX4A 4DCDA 4DOQA 4Y79A 3OYPA 3A84A 1YLCA 2BDIA 4IW4E 3SJIA 2BY6X 2GGVB 3BTFE 4RN6A 1JRTA 1PPZA 2K0QA 5J4SA 1LVYA 2FXRA 1SGDE 4UE7H 4WMFA 1PQAA 1ZHRA 2ZDKA 2VJ1A 4FUIA 4UFDH 4XRNA 3M3VA 1PQ7A 1A5IA 1EAIA 1GHVH 2B5TB 4Q7XA 3AAVA 3FFGA 1YPMH 1DY8A 2ZCLP 3T62A 1HGTH 5JPMH 1QCPA 1Z8JB 3RXJA 2GCHG 1P2NA 1UHBB 1Y3VA 5C3NA 2BD3A 1O2OA 5C20A 3PWCA 4XDEA 2QV1A 3SNCA 2BTCE 1C5SA 3ZZ7A 1RD3B 1S5SA 2H2ZA 1E79D 2PW8H 4GPGA 1NRRH 1V2TT 3TPIZ 1TGNA 3RMNH 2G8TA 1GPZA 1ELGA 3NUMA 1EPTC 2A4OA 1ANEA 1G2LA 5AFYH 5CDFE 2ZWLH 2EI7A 2OUAA 2ZU2A 1O2XA 2ZNKH 1OPHB 1OYTH 3FN8A 5K7RA 3T25A 1H9HE 4X8TH 1E37B 3CS0A 3M5MA 3RXIA 2VH0A 3TJUA 4I7YH 5FCRA 1SFQB 2H5CA 1MH0A 1HJAC 4H6TA 2HPQH 1VGCC 2AMQA 2ODQA 1P3EA 3P8FA 3RXMA 3SQHE 3TGJE 1NFYA 1TONA 1HB0B 3F68H 1MCVA 5FBEA 4OS7A 1LHGH 3ZZ3A 2GV7A 1HJ8A 1V2LT 4MG3A 2A0QB 1KLTA 3WW7A 4U2WA 8KME2 1XUJA 5DJ7A 2BQ6B 2AH4X 3EDXB 1O2GH 1C5VA 2FTMA 3NWUA 4OS2A 2H1UA 4B71A 4AOQA 3B23B 1DITH 1VZQH 1PPFE 1AE8H 3GDSA 4XBBA 1HJAB 1VGCB 2ZU4A 4CBNA 2CJIA 3B9FH 1IOEA 4AX9H 2NU2E 1CE5A 4UEHH 1MU6B 1D4PB 3RXEA 1T31A 4RT0A 2JH6D 2ZQ2A 1A0JA 1FAKH 1ZPCA 2PV9B 1K1OA 4Q7ZA 3D65E 3L3TA 1P2QA 3RM0H 1BMMH 1W2KH 4AGJA 3O8DA 2QF0A 4X1PU 3RC6A 1VCQA 2ZA5A 2BQ7B 3Q3KA 1CVWH 2FTLE 2A4RA 3SO3A 3A7YA 1W0YH 1KLJH 1V2VT 1GBHA 4MPWA 3UY9A 2FOGA 7ESTE 2J4IA 1C5WB 3SJ9A 5DP8A 1FV9A 4GCHF 3ZYDA 5EQQA 1HAGE 1TGCA 1IQGA 4NFFA 2ZFQH 3WY8A 3QUMP 7GCHF 3RXCA 3R3GB 1YPKH 1E34B 4NG9H 2KCYA 1A2CH 4IN2A 4OS6A 2Z3EA 3M36A 2ZU1A 4FXGH 1TGBA 3A7ZA 1BZXE 1P12E 4ACBA 4DIHH 1W7GH 1ESAA 2AHME 4IC5A 1EOJA 2Y7ZA 2QN5T 1FAXA 1TGSZ 1O2WA 1J16A 1P9UA 1TOCB 2G00A 1MAXA 1GJ9B 3URDA 3UR6A 2RFKC 4Q63A 1QB6A 4MNWA 2BD4A 2XXLA 4MPUA 1AZ8A 4AN7A 1P2JA 3BEUA 4B1TA 4A1XA 1BBRE 1MUEB 3OTPA 4X8UH 3A7VA 4NA7A 1SSXA 5LPRA 1T8OA 1ZMJA 1SQAA 1QURH 3QWCH 5DP4A 2SNVA 1N8OB 2XNIA 7LPRA 1DVAH 2PTNA 2FP7B 1A7SA 1QQ4A 1ZMLA 5CE1A 3LU9B 3M3TA 2AYWA 3GY3A 2FS9A 3UNQA 1YPEH 5F53A 4Y8YA 1IHTH 1O2LA 3C27B 2L74A 3S9BA 1GHAF 4YXWD 3PWBA 2B9LA 3QLPH 3H09A 2ZTYA 2RA3A 1G32B 5DO4H 4DJZB 3LKWA 1C1OA 3ATKA 3GCTG 3P17H 3K65B 3PLPA 3BTHE 1P09A 2CF9H 5F6MA 3STIA 1SHHB 1S82A 2GT7A 1GI4A 1BRAA 1S0QA 2CXVA 1W0ZU 2PKAA 1HXEH 3KYFA 3O8BA 3FAOA 3HGNA 1GBFA 5E0JA 1HFDA 4MLFB 1O36A 4RKJB 1ELFA 2F9UA 1QL9A 4RT1A 2QF3A 4SGAE 1L2EA 1GHBF 3F9EA 2BMGB 2BXTH 1DX5M 1O3OA 3OEED 1GMCG 5IDKA 1HV7A 4ABGA 2Q6GA 1HCGA 1UTKA 1SG8B 1AFEH 3QGJA 4ABDA 3NKKA 1WV7H 4DIIH 1HDTH 1BITA 1FJSA 3AW1A 1WXRA 3SV9A 4E7RG 2G4TA 3LOXA 1T4VH 3SW2B 1CT4E 4TPIZ 4X0WU 2QYIA 5DSFA 1GI7B 3QDZB 5FCKA 1MKXK 1OWDA 1W10U 1AIXH 3UIRA 1G9IE 1C5ZB 1DICA 5L6NH 5GIBA 4IMQA 1BMLA 2C4FH 2BDHA 2BOHB 3OE7D 2DUCA 1LPZB 4Z0KA 1YC0A 2OXSA 4CH8B 1S85A 2XCFA 1EB1H 1C5XB 4JCNA 1GJBB 3Q3YA 3W94A 1C1MA 3QZRA 1SLUB 1RGQA 1YCPK 2BZAA 1HXFH 2F9VA 1EB2A 1Y5AT 3A80A 1O32A 3P6ZB 2JJ2D 4AB8A 1KMHB 1MMJN 1LMWB 4CREA 1C2JA 6LPRA 2AGIX 3DSPA 3SBKA 1W8BH 1LVOA 2IPHA 3TGKE 3VXFH 1KDQB 5AF9H 2GVFA 1MD8A 3VGCC 5T6DA 2QXJA 1OWKA 3TU7H 2SGQE 3RXKA 5FPSA 1XUGA 5DG6A 2VVCA 4NIYA 1F92A 3CENA 2BD8A 1ANCA 2UWLA 2THFB 1GWAA 3KCGH 1VCWA 1UK4A 1IQIA 1T32A 4UFEH 2CF8H 2W3KA 2RG3A 2WPIS 3PRBA 4OS5A 2STAE 1CO7E 3A8AA 5C0UA 1MZAA 3AASA 2IJD1 5EJZA 5KGOA 2R9PA 3RXAA 1BT7A 3LIWA 2ZPRA 3T29A 1HYLA 1C4V2 2XTTB 1IQNA 1GJ7B 5ESTE 4ZKRU 1AO5A 2C3SA 6ESTA 5GCHG 1DDJA 3ZVDA 2F3CE 2QAAA 3M5OA 3CNRA 2VIVA 1H4WA 2FOAA 2PGQB 1AWFH 1K1IA 3OY5U 2Z9JA 1UTQA 3KN2A 3MU4A 1MCTA 5A0AE 2W5EA 1L4ZA 3A82A 1TB6H 1GI3A 5FPTA 2R3UA 2OC8A 3U1IB 3MH5A 3BTTE 4DT7B 1AB9C 1QGFA 1TNLA 1MKXH 2BVRH 4CRBA 1HAYB 1L1GA 4P00A 2GCTC 1ACBE 2GMTC 4K1TA 1LPKB 3BF6H 1TMBH 3VB5A 2HLDD 2YOLA 3T2NA 2O8UA 3I78A 1SMFE 1QQUA 2RDEA 3RUOA 8GCHG 1T7CA 2SGEE 1C5PA 1LHDH 2UUYA 4FU7A 3RXUA 2DE9A 3FP8E 2UUFB 1TALA 3UUZA 2FI3E 1SGFA 1K21H 4PROA 1Z8GA 4O03A 4Y7BA 4GHQA 2GCHF 5HMAA 1HAOH 1UCYK 1EJMA 3M35A 1LDTT 1TMUH 3BV9B 1CT0E 2BY8X 1BTWA 1GCTB 3RMMH 4IGDA 5G4BA 2PUQH 2CK3D 1P05A 1DUEA 1B0FA 2FYQA 3FKSD 2TGPZ 5CHBA 2A4GA 5DP3A 1SHYA 3EQ0H 4X6OA 1EX3A 1K9OE 5KEDA 3ZIAD 3UTUH 2ZECA 2O8TA 3TJOA 1LHEH 1ZJDA 3C1KA 1ABIH 3EA9A 5FX5A 4FUDA 3LONA 1GMDG 2R2MB 2PWXA 3A7WA 1P10A 3AAUA 3HKJB 4B74A 4GUXA 1K1LA 4TT3D 3ATWA 1P2KA 3PO1C 1AVXA 3CS7A 4Y0YE 4AG1A 3M7QA 5GNDA 3GY7A 3BIVH 4ISOA 4D9RA 1HAVA 1Y3XA 5JDUB 3U8TH 3RU4E 3UQOA 3MWIU 1EP6A 4FVBA 1SGEE 2P93A 1SGCA 1RTKA 3SHAH 4O3TA 4CRDA 2BY9X 2Q6FA 1ZGIA 5EPYA 1ZJKA 4HFPB 2BD7A 4U30A 3TNTA 5JBCS 1C5UA 3URCA 1ZTJA 1FI8A 2J5UA 2WUCA 3MH6A 1P2IA 1AUJA 1LVMA 2VB0A 2H9TH 2Y6TA 3MFJA 5FBIA 2TBSA 1V2JT 1NFWA 3V13A 3PO1B 3SJKA 2ZFFH 4IS5A 3NZIA 3ZV9A 2RCEA 1ZSLA 3MU1A 4MNXA 2P59A 4X2XA 4B73A 3TK9A 3KF2A 2FOMB 1YLNA 1QRZA 1ELEE 1BBRK 9LPRA 1EKBB 1O2PA 8LPRA 1WSSH 2OBQA 2F83A 2RDLA 3BTME 4X1SU 1O3MA 4DT4A 1ZHPA 1D6RA 2C8ZB 1GJAB 3D62A 1FMGA 4X6MA 1GBEA 4NWLA 2BLQA 2ANKH 2HALA 4DY7B 2FMJA 2ZU5A 2IJOB 3P92A 4O3UA 1QRWA 1K2I1 1ZTLA 1BIOA 2G5NA 1PPGE 3GYMA 3S7HB 3RC5A 2BXUH 2HNTE 1QNJA 5ABWA 3DSGA 1O3PB 1A5GH 1S6LA 2OCVB 5A8XA 4FUGA 2OBOA 5GDSH 4YT6H 3RLWH 1C5MD 2HRVA 1BRUP 3LPRA 2WYGA 3RXHA 1ARBA 2F9BH 1DOJA 3LGTA 1V6DA 3MQKC 2IPQX 1C1WH 5DK1A 1FZZA 4MPVA 4Y10E 2WV4A 2ESTE 1NC6A 1O3FA 2ZGJA 4O9VA 3SQEE 1AWHB 1SLWB 1V3XA 3KNXA 5E2PA 3T26A 1SB1H 5EQSA 1GHXH 4KGAA 1BTPA 2VWNA 1HIAA 2UUKB 4A5TS 3P70B 1V2MT 2B0FA 1AKSA 1BTXA 3S69A 4NSYA 1A3EH 2XBVA 3NXPA 4NIXA 3U28C 2ZDMA 3PMBB 1VKYA 4AB9A 2CV3A 2XBYA 2A5AA 5HKKD 2AS9A 5B6OA 4J2YB 4M9FA 5I25A 2XWBI 5GWZA 1AMHA 1LO6A 3QO6A 1UTNA 1F0RA 1CA8B 2BX3A 2PGBB 3ATMA 4LZ4B 1YPGH 1DT2A 3MU8A 1Y3YA 5EJLA 2TGTA 3E16B 1JIRA 1GJDB 1MZDA 1EZXC 1CGJE 2XRCA 1O2HA 1SPJA 2ANMH 4NZLA 4Z6AH 4M7GA 1K0HA 3FZZA 5EQRA 3W95A 4GLYA 3S9AA 1BBRH 4MVNA 4JZ1A 2HNTC 2FLRH 3KQ5A 1BTYA 1AUTC 4X2VA 1CGHA 2PLXA 3GCTF 2XC4A 3A85A 2LPRA 1XKAC 1QBNA 2CN0H 2TGAA 1GHWH 1GG6C 1O3JA 1TNJA 1P11E 1W0JD 2J95A 4AFUA 1O2MA 2P8OC 1BTHH 4I8JA 4F4OC 3FOAA 1V2NT 2HWLB 2VWMA 4LZ1H 1GMCF 2V3HH 5FPYA 3N7OA 1E38B 1C5YB 2XBWA 4D7FA 4XBDA 2ANWA 1HLTH 1A0LA 3K2UA 2J38A 3ZV8A 2VIPA 5C94A 2P95A 3OU0A 1IQEA 2GDEH 4ISIH 2AMDA 2XWAA 3M7TA 2STBE 1UJ1A 2PFEA 2TRMA 3SU5A 3OX7U 4RI0A 1O2KA 1EASA 2BD2A 1B0EA 5TCCA 1F5KU 1FQ3A 3FVFB 4AYYB 1ELTA 4YO9A 3OFND 1GG6B 2QF4A 1KLIH 3KQBA 3SI3H 3UWJH 3I29A 1EPTA 5AVDA 4ZHAA 5LPEA 1ELVA 1NT1A 1UCYE 2P8OB 2Y81A 4X1NU 1O0DH 3ZZ5A 3ZZ8A 4ABEA 3GYLB 5LGOA 3LGVA 5C1YA 2VIDA 1NRQH 1AHTH 1V2QT 1O38A 3BG4B 3HATH 1C1PA 1LPGB 2V3MA 1RXPA 2ZTXA 1FDPA 3QTVH 5F8XA 1SOTA 1TQ7B 3PMAB 3JZ2B 4MNYA 1DWCH 4DURA 1C1UH 1N6YA 1OHHD 1XM1A 2HLCA 3BTWE 1ZPZA 2XNDD 1NRSH 3EYDA 1RJXB 2F4LA 3E3TA 2UWOA 3U8RH 4IMZA 2WPMS 1DWBH 1V2OT 2FM2A 4ESTE 1QL8A 1NTPA 1TX8A 1Z71A 3K6ZA 1BJUA 1OOKB 1GHYH 4BNRA 1GHZA 1SFIA 4H6SB 1V2RT 2KM0A 3BTEE 3QK1A 1CSOE 2OQUA 4X6PA 3BEFB 1YLDA 4A6LA 4QT8C 1MTNB 4JYVH 4WMDA 3SYJA 4ASHA 1SGRE 1AQ7A 3TGIE 2QF5A 2D8WA 2Z9KA 5DP5A 1OSSA 1Q2WA 1DS2E 3TLOA 3LH3A 2ODYB 1CHGA 2ZDAH 1CT2E 1S0RA 4X8SH 5L2YH 3GS9A 1N8OC 2P3FH 1NN6A 3MYWA 4ABJA 1IQKA 1WCZA 3UNSA 3S7KB 4I8LA 1MBQA 4H4FA 1OP2A 2JKHA 2ZFRH 1H8DH 2ZHQH 3TNSA 1MTVA 3ATLA 5GCHF 2A5KA 5HIYA 1GJ5H 3VPKA 2FO9A 4RSPA 1J8AA 5DKMA 2NU3E 3V0XA 3ZVCA 3OTJE 4JK5A 2ZGXH 2ANYA 2H9HA 1OP0A 1NROH 2KFWA 2NU0E 1MKWK 1TRYA 4X1RU 5BRRE 4FUJA 4UFFH 2ZFTA 3UREA 3LC3A 1YPLH 4BOHA 3LGIA 2FOEA 4F49A 1Z8RA 1BB0B 1ZOMA 4NFEA 1GJ4H 2ZQ1A 1PPCE 4IN1A 2D2DA 1KTTB 3TJNA 2AGGX 3ZVAA 3ODFA 2PR3A 1BA8B 2Y80A 4GHTA 1FLEE 4AGKA 5PTPA 5A2MH 2J98A 4ISHH 1SQTA 1TNKA 5FXLA 3ZVGA 3Q77A 8GCHF 1NO9H 1ZLRA 4Y11E 4Q80A 2V7QD 2VU8E 1GVKB 1SGFG 2ZFPH 1W0KD 2UWPA 4BAKB 2H5DA 2C8WB 3SU6A 3OAAD 3RXPA 2ZTZA 2B7DH 1IQFA 3MNXA 1C4Y2 2YMSC 5K0HA 4VGCC 4B6FA 3NCLA 1ESTA 1IQJA 2PKAB 2ZGBH 1AFQB 4BAOB 1HUTH 3HK6B 4XE4A 1AI8H 1P3CA 2YMSD 1P04A 1WYKA 1D3TB 1YYY1 2OTVA 4HI3A 2OK5A 4AC9A 3PMHB 4WF8A 4NA8A 5TCAA 5BPEA 4ABAA 4MQAA 1JOUB 3RXOA 2IOTA 1S6HA 1QL7A 1C1QA 2NWNA 1OWJA 3HKIB 3SNAA 1O2YA 2G5VA 2FS8A 1NFUA 4R0IA 4F48B 1GMDF 2J2UA 4FU8A 4UD9H 1JIMA 1SLXB 3V7TA 1SGIB 1W11U 2KR7A 5EODA 4ASUD 1UO6A 4B76A 1EAUA 3DHKH 1AD8H 1PPHE 2EA3A 3D49H 3U98H 2HGTH 2YMSB 4LOYH 1TOMH 5CHAC 1ZSKA 1MQ5A 1NESE 1NBMD 4VGCB 3ZZ9A 3VB7A 3V3MA 1LQEA 4Q2KA 1O3KA 1X7AC 1O3EA 4WMEA 4BAQB 3PLBA 2ZC9H 2C90B 3PLKA 1WQVH 2H6MA 2HNTF 3U69H 3F6UH 3K9XB 1TPSA 3N7EA 1UVUH 1W7XH 3LGUA 2GZ9A 1ZRKA 1O5GH 1Q3XA 1OKXA 5EPNA 1Y3WA 3FP7E 1OS8A 3F9GA 3VB4A 4TY7A 1SOZA 1QB1A 1C1RA 4TWWA 1GI0A 4FVDA 1SKYE 1C2EA 1B7XB 3GICB 3IITA 1YKTA 5FX6A 5CHAB 3Q76A 3SUFA 1FY4A 1D3QB 2ZU3A 1KXBA 2QA9E 3UB0A 3MH4A 4ZXYH 2ZF0H 3M5LA 1TA6A 2VH6A 4FETA 2GTBA 4I86A 4B2AA 1BHXB 2BLOA 1SGQE 4Q7YA 2GD4B 4FOUC 1TAWA 7KMEH 3P8NA 2VIQA 1PQ8A 4FUCA 3SNEA 1FONA 1GL0E 1SR5C 1TIOA 1UVTH 1XXFA 2Z3DA 1P0SH 4KP0A 2J34A 1K1JA 2VBCA 4GAWA 4Y7AA 3UFAA 1H8ED 4YM9A 2YNAA 2WYJA 3M5NA 2GDDA 2BDBA 2HVXA 4JZIA 8ESTE 3KEEA 2H9EH 1EAWA 2CHAC 4I32A 4SGBE 2ZEBA 1S81A 5C5NA 1J9CH 2WSSD 1GI6A 1CGIE 2ZP0H 3GOVB 1MTUA 1FNIA 3A89A 2A2XH 3M3SA 1O3CA 5HYOA 4ACAA 1OWHA 1DANH 5EOKA 1GVLA 1DY9A 4U32A 2GV6A 1ELAA 2KAIA 1GCTC 1O3BA 1K1MA 1DE7H 1GBKA 2VWLA 3Q3XA 1QIXB 1TNIA 4HG6A 4U01A 3P95A 1JXPA 3QZQA 3DD2H 4YLUA 1O3GA 2Z94A 1GI8B 4LXBH 2JDID 2OC7A 2CHAB 4OGYA 1D3DB 4HTCH 2BQWB 2WV5A 4CBOA 3ZZCA 1YCPM 2L6OA 3E0NB 1J17T 1O35A 1S83A 4GSOA 1YCPH 1ZGVA 3F0PA 3SI4H 1FPHH 1AY6H 4JK6A 1HJ9A 1KXCA 3RDZA 3E8LA 2OD3B 2WPDD 2GZ7A 1QFKH 1O37A 2ZHEH 1T8MA 5C1XA 4ZH8A 2QY0B 1UVSH 2PKSC 2R0LA 2A5IA 2G52A 3GY6A 3RXFA 3RU4T 1SBWA 3T5FH 4D8NA 5HM9A 3QX5H 1O2SA 3SGAE 1ETRH 1XVOA 4CH2B 4B75A 1EUFA 1XUHA 1ELBA 1MABB 2WHXA 1FUJA 1B5GH 5JBAS 1AGJA 3RLYH 1Z1JA 3S9CA 3UPEA 2QGRA 2RA0A 5F8TA 3RXLA 1K1NA 4X8VH 2OC0A 3SZNA 1MBMA 4Y0ZE 9ESTA 1UK3A 2Q6DA 1HAVB 3SV6A 3BIUH 5DP7A 3SHCH 1GDUA 2FDAA 2PKSB 3RXSA 1HAIH 2FZZA 3OSYA 2ZI2H 3UOUA 5SGAE 4NA9H 1O5AB 1SQOA 2W3IA 4XBCA 1TWXB 4ZKNU 1A5HA 1O2UA 1FN8A 3GISB 3M7UA 1AVWA 1GI2A 2BD9A 3KL6A 4D7GA 1BQYA 1BMAA 3A87A 1ETSH 3RMOH 2ULLA 4KKDA 1RIWC 1THPB 2ZFSA 1CHOG 1ELCA 1O5FH 1VITG 1EOLA 5T6FA 1FX0B 5FHTA 3GY4A 1AE5A 2FI5E 1NPMA 2ALPA 1C2LA 1F0UA 1TNGA 3PYHA 3SUEA 2FWWA 4Q4LA 1D9IA 4LK4A 4J1YA 4NWKA 4MDSA 4NCYA 3DFLA 1SL3A 1WAYB 1Z8IB 4GVUA 3RXGA 1SC8U 3NK8A 4WWYA 1G30B 2AEIH 3H7TA 4H42U 4CR9A 4INLA 3F9HA 5ETXA 2XCNA 3SU0A 4YESB 3H7OA 1DWEH 2ZGCA 2PHBA 3UOPA 1UVOA 2BVSH 1FXYA 2O8MA 2C8YB 1O2NA 1ETTH 5HM2A 1RIWB 4YLQH 4CRFA 1UCYH 2VWOA 4ZAEA 1CA0B 2CMYA 2Y5FA 1O31A 2EY4C 5JB8S 2VGCC 5C0TA 3BG8A 2SFAA 1BHXF 1RTLA 2FLBH 4MTBA 5C67A 4JMYA 1HRTH 3MHWU 3SU3A 2XC5A 3KQCA 5T3HA 2PSYA 5A8ZA 5JYIA 3RXQA 2BYAX 3GDVA 3SGQE 1Z6EA 2F9PA 1WDIA 2R0KA 1C5OH 1GGDC 3PM3A 5GPIB 1QR3E 3IWMA 1RRKA 5IK2D 1JMOH 1N1LA 1C5TA 3QN7A 1K22H 4OS1A 3ZVFA 1KXDA 2D1JA 3EE0B 3O8CA 5JBTA 1TGTA 2G4UA 2A1DB 3MOCA 2Z9LA 1E36B 4TYDA 4K60A 4UDWH 4WY3A 1V2KT 2VGCB 1W12U 1KTSB 1BJVA 2J9NA 1O3AA 1HIAB 3MO9A 2ZCHP 5E2OA 4ISNA 2ZGHA 3RP2A 3GCOA 1AKSB 2GX4A 2QCYA 3AVZA 2ZO3H 3IG6B 3BTQE 4ZHLU 1C1NA 2OINA 2WV9A 1VJ9U 2V3OH 1NU9A 5E0HA 1GGDB 1BDAA 1XUKA 2BLVA 1C2MA 1XXDA 2FOFA 1XUIA 4AZ2B 1O5CB 1AVGH 1H1BA 2ZDNA 3E6PH 3U1JB 1A61H 1C5LH 3A7XA 4E06H 3WWBA 3P8OA 3VB3A 2AIPA 5A0CA 1QZ8A 2BM2A 1LHFH 3TJVA 3DSOA 1S6FA 1TE0A 3MTYA 1FPCH 1SI5H 3GCHB 1UHBA 2ALVA 1RFNA 2BLWA 2C93B 1KXFA 2ZHWH 3GCNA 3RC4A 3ZVEA 1KYNA 3ZZBA 2FESH 4E7NA 5DP9A 4ZXXH 1A3BH 1P02A 4K1SA 1DXPA 2R2WU 3LC5A 2FEQH 5DGJA 4INHA 4OGXA 2Z7FE 1UMAH 1L1JA 4ZHMU 1GI9B 1O5BB 1P2OA 3P8GA 5AFZH 5C5OA 2VIOA 1YGCH 2DE8A 4ABHA 1ORFA 2Y5GA 2ZHDA 5F8ZA 4WH6A 3E90B 3R0FA 1ZR0A 1T8LA 2FOBA 3HK3B 2P16A 1NZQH 1SGPE 3VG8A 5I46H 2JETC 1EFRD 1ANDA 2HOBA 3F1SB 4HZHA 3SORA 1ABJH 3BG4C 1Y3UA 1WTGH 3GY5A 1VCPA 4KELA 2VVUA 4WXIA 2I6SA 3SOSA 1EQ9A 1LQDB 3MNBA 1DSUA 1E0FD 1WQSA 1GMHG 2ZPQA 3MH7A 4P02A 1H8HD 5FL7D 3V12A 3N99A 1QA0A 4KTSA 2BY7X 3LDXH 5H4IB 1PQ5A 1A0HB 4MNVA 4WVPE 2AMPA 3WWFA 3O8RA 4K1EA 1QA7A 1BOQA 1C4U2 1W13U 4TSFD 2V35A 4R8TB 2P94A 1SGYE 3UAIC 1O3IA 3ESTA 4NIVA 1G3EA 2Y5HA 1C9PA 1W3CA 1MTNC 3A86A 1EPTB 4XSKU 3OY6U 2AGEX 2JETB 1VR1H 2Z9GA 3B8JA 4B2BA 3RMLH 5EW1H 1O2VA 2TPIZ 1OWIA 4Z1MD 3PB1E 3ZVBA 3U9AH 1GBBA 1SVPA 1TPOA 2WPJS 2XYAA 1GBCA 2Q1JA 1C5RA 2PP6A 3TIUA 4E05H 1GBAA 6GCHG 3MU0A 3M61U 4BAHB 2JH0D 1HPGA 2G51A 4A1VA 5EXNA 5DP6A 1YF4A 1UTOA 3PV5A 1TFXA 2I6QA 3BEIB 2V6NA 4NGAH 2EC9H 1PFXC 3BSQA 2O8WA 2UUJB 4O97A 1ZPBA 2F9OA 3PRDA 2V0BA 1INCA 4FU9A 3SU4A 1GI5A
chains in the Genus database with same CATH topology
1DLEA 1MTWA 1GJCB 3EA7A 3CP7A 4AFQA 1S84A 1C2FA 2JH5D 3SGBE 2XW9A 3LT3A 1ESBA 1NM6A 1TRMA 2A2QH 1G36A 4FUHA 1YPHE 2OC1A 4CHAC 1O3LA 1HAXB 3G01A 3PROA 4INKA 2EI6A 2NU1E 4K8YA 3KHVA 2GP9B 1C1SA 1AU8A 4BTIB 2FOHA 1HBTH 1EXFA 1O3HA 1UTPA 2A32A 4NSVA 3SJ8A 5TJXA 1LVBA 4OS4A 4JYTA 3ZZ6A 1ELDE 1P57B 1UK2A 1P03A 3FP6E 4HGCA 5CMXH 3UQVA 1KXEA 3SUGA 4Y6DA 1TABE 2BZ6H 1SGTA 5JBBS 3RXBA 5L2ZH 1MU8B 1PPEE 2A31A 4KTCA 4CRCA 1ZMNA 4CRGA 2Y82A 1TBQH 4Y76A 2FIRH 1G3BA 2ZDVH 5L30H 2BDAA 4Y8ZA 1MD7A 2FODA 2B8OH 3BTKE 3PMJA 2Z9IA 5A09A 4CHAB 4I8HA 5E0GA 1EZQA 5AHGH 1EJAA 1AFQC 1P01A 1FY3A 3PTNA 3BTGE 3E1XB 1DFPA 1N6XA 1NY22 2P3TB 2ZPSA 1Z6JH 1EZSC 2TIOA 1V2ST 3HGPA 4JZFH 1U6QA 4RKOB 1YM0A 3TH4H 1D3PB 2YNBA 3QGNB 3ITIA 1O30A 2C8XB 1TPPA 3SNBA 4DGJA 3A8BA 4TPYA 4ISLA 4NZQA 1C2HA 2GKVE 3Q00A 3MO6A 1GDNA 1Y5BT 1JBUH 2PUXB 3A8DA 3KQEA 2R3YA 5EXLA 4YZUA 1GBDA 1GI1A 4BXWA 3I77A 1YP9A 1AZZA 5LPFA 2VINA 1G37A 1MQ6A 1YPHC 1F2SE 1O2TA 4JZEH 4D76A 3EAJA 1Y8TA 5EU8A 1WBGB 1OYQA 1ARCA 2HPPH 3A83A 4AG2A 4B2CA 1XUFA 4ZKOU 1XKBC 2BB4A 4FUBA 1YBWA 2WUBA 1PJPA 2ZG0H 3TH2H 4ABIA 2QXGA 4CR5A 1DXWA 3T28A 1C1TA 1XX9A 1EZUC 2EEKA 2QC2A 2VNTA 2W7UA 2J92A 2SNWA 3E0PB 2OQ5A 4K8BA 2BDCA 3PV4A 2PSXA 3VXEH 1OX1A 1FN6A 4DG4A 3DT0H 5GJ4B 5C1UA 1H9LB 1D6WA 1T4UH 3TK5A 3RXRA 1Q31A 4FUFA 1V2UT 1TMTH 4XOJA 4D9QA 3S0NA 2BX4A 3HPTB 1M9UA 4IC6A 2FPZA 2SGFE 4AFSA 3LGWA 4IBLH 1UTMA 1THRH 3L6PA 3MI4A 2WPKS 5LH8A 4YOGA 1MKWH 2O9QA 1F7ZA 4ZMAH 1CHOF 3SUDA 4ABBA 1L0ZA 1VITF 1DWDH 2BY5X 4YT7H 1Y59T 1G3CA 3SV7A 2F91A 1GJ8B 1RS0A 4BTUB 3GY2A 1O2RA 1EJNA 1A46H 1GBJA 4DVAU 1DSTA 3U8OH 1FIWA 3LJOA 4I8KA 1F5RA 2G55A 2ILNA 3BTDE 3MO3A 3T27A 1HAZB 3SV8A 5J4QA 1BUIA 1XMNB 1NFXA 1BRBE 3VB6A 2ZDLA 1KDQA 2EI8A 1H8IH 2O8LA 1QY6A 1TBRH 1G3DA 1J15A 4ZROA 5HXFA 1P06A 1LKAA 4JZDH 3RXVA 1O3DA 4WXVA 1K1PA 1PPBH 1T8NA 4AYVB 2SGPE 1J14A 1IAUA 4GCHG 1NU7B 5HGGA 1NS3A 1L1NA 2LNCA 1C5QA 1P8VC 1CU1A 1OP8A 2BOKA 2ZCKP 7GCHG 1TA2A 5A0BA 4TY6A 1C1VH 1WTHD 2AFQB 4K5ZA 6CHAC 4BTTB 3LGYA 3LJJA 5FAHA 3A8CA 3AW0A 1TX6A 4NIWA 1ZHMA 2D26C 1LTOA 3TH3H 2BDYA 4YOIA 3FANA 1QTFA 1L4DA 4X2WA 3VGCB 3A7TA 5A8YA 5EXMA 1OWEA 1HNEE 1THSH 1VJAU 2WPLS 2KAIB 2NU4E 3MMGA 1LCYA 1GBMA 1F0TA 3SV2H 1V2WT 4ZUHA 1K28D 1UVPA 4Y71A 1EATA 3SU2A 2AERH 1GBLA 1O5DH 4BANB 1DM4B 1O2JA 1TBZH 3UWIA 1UTLM 1TLDA 1IQHA 2OP9A 3RXTA 1LKBA 2BD5A 2P3UB 3DFJA 6CHAB 1C2KA 2A7HA 2GT8A 1JRSA 4AORA 2FYRA 1VITH 1WOFA 1GBIA 1OXGA 1HAPH 1QJ1B 3MU5A 4UFGH 4A92A 3ZYEA 1CBWC 2W26A 1G2MA 1GHAG 2AIQA 1C2IA 1H9IE 4JYUH 2GZ8A 3LH1A 1NRNH 4FUEA 1C5NH 1JWTA 5DPAA 2XBXA 2CGAA 3M37A 3ELAH 2BDGA 1O2QA 3VFEA 1RTFB 1BRCE 1QRXA 3D23A 1F5LA 3ODDA 1E35B 3EA8A 3E91A 3BN9A 1YPJH 5C2ZA 1Z1IA 1F0SA 1AB9B 2QIQA 1GHBG 2A45B 2IN2A 2GCTB 5F03A 3VEQB 1O2IA 2BVXH 2GMTB 2M5TA 3SU1A 5GXPA 2QXHA 2A4QA 4WJG2 1CBWB 3EGKH 1UTJA 4K69A 3ENSB 1IQLA 1GDQA 3NPSA 1QJ6B 3PTBA 4AFZA 2SGAA 4X1QU 3F9FA 3A88A 3JZ1B 4K3JA 2ZHFH 4MPXA 1GMHF 1P2MA 2Z3CA 2G81E 2Z6BD 1DLKB 3A81A 1ZRBA 2K1QA 1Z7KA 1BTZA 1HAHH 1ZYOA 4THNH 5EG4A 3ZZAA 4BAMB 5ESBA 2VVVA 1EP5A 4A1TA 3KIDU 1WU1A 4Y8XA 1GL1A 1ZSJA 1C2DA 1CA0C 3TK6A 4YOJA 1FIZA 1ID5H 1KSNA 2A7CA 3RM2H 5T6GA 1FY1A 4ZKSU 1GJ6A 5EW2H 3STJA 1CQQA 1SGNE 4X2YA 2J94A 2Y7XA 1Y5UT 4WH8A 1GCDA 1A4WH 4TWYA 4YTAA 3SN8A 1IHSH 1O5EH 4I33A 1TX7A 1NRPH 2VIWA 1KIGH 1MTSA 4DW2U 4BXSA 4KTUA 1TYNA 1O39A 1FY5A 1KY9A 3UR9A 1P9SA 5JB9S 3ATIA 2XC0A 3MNSA 2W7SA 1QBVH 1ZTKA 3TITA 6GCHF 1C2GA 1WUNH 2F9NA 4A7IB 5EGMA 5IYTA 2ZKSA 1IQMA 1SLVB 1C9TA 1O2ZA 2QXIA 3GY8A 1MAYA 1TRNA 1O3NA 1O34A 2OLGA 3GDUA 3MNCA 3K6YA 3KGPA 2A7JA 1BMNH 1XVMA 2SGDE 1V2PT 3SJOA 4I31A 2FI4E 3ZZDA 1QBOA 1EAXA 2WPHS 1W14U 1QJ7B 4UONA 1A1RA 1LHCH 1GBTA 1AN1E 3QTOH 4CRAA 1ANBA 3FZDA 3KQDA 1O33A 1TQ0B 1FY8E 2WINI 3SNDA 3TVJB 2ODPA 2TGDA 3DUXH 1ZZZA 2ZIQH 4ABFA 1KXAA 3H5CB 1GVZA 1PYTC 4K2YA 2PTCE 3L33A 1QHRB 1QB9A 2ZZUH 3DA9B 4X6NA 3ZZ4A 1TPAE 1DPOA 1BCUH 5E8EH 1DUAA 1TNHA 2FOCA 4XFQA 4I8GA 1BTUA 3GCHC 2FX6A 2ASUB 1PYTD 2BHGA 3RXDA 3RU4D 3UNRA 2FX4A 4DCDA 4DOQA 4Y79A 3OYPA 3A84A 1YLCA 2BDIA 4IW4E 3SJIA 2BY6X 2GGVB 3BTFE 4RN6A 1JRTA 1PPZA 5J4SA 1LVYA 2FXRA 1SGDE 4UE7H 4WMFA 1PQAA 1ZHRA 2ZDKA 2VJ1A 4FUIA 4UFDH 3M3VA 1PQ7A 1A5IA 1EAIA 1GHVH 2B5TB 4Q7XA 3AAVA 3FFGA 1YPMH 1DY8A 2ZCLP 3T62A 1HGTH 5JPMH 1QCPA 1Z8JB 3RXJA 2GCHG 1P2NA 1UHBB 1Y3VA 2BD3A 1O2OA 5C20A 3PWCA 4XDEA 2QV1A 3SNCA 2BTCE 1C5SA 3ZZ7A 1RD3B 1S5SA 2H2ZA 2PW8H 4GPGA 1NRRH 1V2TT 3TPIZ 1TGNA 3RMNH 2G8TA 1GPZA 1ELGA 3NUMA 1EPTC 2A4OA 1ANEA 1G2LA 5AFYH 2ZWLH 2EI7A 2OUAA 2ZU2A 1O2XA 2ZNKH 1OPHB 1OYTH 5K7RA 3T25A 1H9HE 4X8TH 1E37B 3CS0A 3M5MA 3RXIA 2VH0A 3TJUA 4I7YH 5FCRA 1SFQB 2H5CA 1MH0A 1HJAC 4H6TA 2HPQH 1VGCC 2AMQA 2ODQA 1P3EA 3P8FA 3RXMA 3SQHE 3TGJE 1NFYA 1TONA 1HB0B 3F68H 1MCVA 5FBEA 4OS7A 1LHGH 3ZZ3A 2GV7A 1HJ8A 1V2LT 4MG3A 2A0QB 1KLTA 4U2WA 8KME2 1XUJA 5DJ7A 2BQ6B 2AH4X 3EDXB 1O2GH 1C5VA 2FTMA 3NWUA 4OS2A 2H1UA 4B71A 4AOQA 3B23B 1DITH 1VZQH 1PPFE 1AE8H 3GDSA 4XBBA 1HJAB 1VGCB 2ZU4A 4CBNA 2CJIA 3B9FH 1IOEA 4AX9H 2NU2E 1CE5A 4UEHH 1MU6B 1D4PB 3RXEA 1T31A 2JH6D 2ZQ2A 1A0JA 1FAKH 1ZPCA 2PV9B 1K1OA 4Q7ZA 3D65E 3L3TA 1P2QA 3RM0H 1BMMH 1W2KH 4AGJA 3O8DA 2QF0A 4X1PU 3RC6A 1VCQA 2ZA5A 2BQ7B 3Q3KA 1CVWH 2FTLE 2A4RA 3SO3A 3A7YA 1W0YH 1KLJH 1V2VT 1GBHA 4MPWA 3UY9A 2FOGA 7ESTE 2J4IA 1C5WB 3SJ9A 5DP8A 1FV9A 4GCHF 3ZYDA 5EQQA 1HAGE 1TGCA 1IQGA 4NFFA 2ZFQH 3WY8A 3QUMP 7GCHF 3RXCA 3R3GB 1YPKH 1E34B 4NG9H 1A2CH 4IN2A 4OS6A 2Z3EA 3M36A 2ZU1A 4FXGH 1TGBA 3A7ZA 1BZXE 1P12E 4DIHH 1W7GH 1ESAA 4IC5A 1EOJA 2Y7ZA 2QN5T 1FAXA 1TGSZ 1O2WA 1J16A 1P9UA 1TOCB 2G00A 1MAXA 1GJ9B 3URDA 3UR6A 1QB6A 4MNWA 2BD4A 2XXLA 4MPUA 1AZ8A 4AN7A 1P2JA 3BEUA 4B1TA 4A1XA 1BBRE 1MUEB 4X8UH 3A7VA 4NA7A 1SSXA 5LPRA 1T8OA 1ZMJA 1SQAA 1QURH 3QWCH 5DP4A 2SNVA 1N8OB 2XNIA 7LPRA 1DVAH 2PTNA 2FP7B 1A7SA 1QQ4A 1ZMLA 5CE1A 3LU9B 3M3TA 2AYWA 3GY3A 2FS9A 3UNQA 1YPEH 4Y8YA 1IHTH 1O2LA 3C27B 3S9BA 1GHAF 3PWBA 2B9LA 3QLPH 2ZTYA 2RA3A 1G32B 5DO4H 4DJZB 3LKWA 1C1OA 3ATKA 3GCTG 3P17H 3K65B 3PLPA 3BTHE 1P09A 2CF9H 5F6MA 3STIA 1SHHB 1S82A 2GT7A 1GI4A 1BRAA 1S0QA 2CXVA 1W0ZU 2PKAA 1HXEH 3O8BA 3FAOA 3HGNA 1GBFA 5E0JA 1HFDA 4MLFB 1O36A 4RKJB 1ELFA 2F9UA 1QL9A 2QF3A 4SGAE 1L2EA 1GHBF 3F9EA 2BMGB 2BXTH 1DX5M 1O3OA 1GMCG 5IDKA 1HV7A 4ABGA 2Q6GA 1HCGA 1UTKA 1SG8B 1AFEH 3QGJA 4ABDA 3NKKA 1WV7H 4DIIH 1HDTH 1BITA 1FJSA 3AW1A 3SV9A 4E7RG 2G4TA 3LOXA 1T4VH 3SW2B 1CT4E 4TPIZ 4X0WU 2QYIA 1GI7B 3QDZB 5FCKA 1MKXK 1OWDA 1W10U 1AIXH 3UIRA 1G9IE 1C5ZB 1DICA 5L6NH 5GIBA 4IMQA 1BMLA 2C4FH 2BDHA 2BOHB 2DUCA 1LPZB 4Z0KA 1YC0A 2OXSA 4CH8B 1S85A 2XCFA 1EB1H 1C5XB 4JCNA 1GJBB 3Q3YA 3W94A 1C1MA 3QZRA 1SLUB 1RGQA 1YCPK 2BZAA 1HXFH 2F9VA 1EB2A 1Y5AT 3A80A 1O32A 3P6ZB 4AB8A 1MMJN 1LMWB 4CREA 1C2JA 6LPRA 2AGIX 3SBKA 1W8BH 1LVOA 2IPHA 3TGKE 3VXFH 1KDQB 5AF9H 2GVFA 1MD8A 3VGCC 5T6DA 2QXJA 1OWKA 3TU7H 2SGQE 3RXKA 5FPSA 1XUGA 5DG6A 2VVCA 4NIYA 1F92A 3CENA 2BD8A 1ANCA 2UWLA 2THFB 1GWAA 3KCGH 1VCWA 1UK4A 1IQIA 1T32A 4UFEH 2CF8H 2W3KA 2RG3A 2WPIS 4OS5A 2STAE 1CO7E 3A8AA 1MZAA 3AASA 2R9PA 3RXAA 1BT7A 3LIWA 2ZPRA 3T29A 1HYLA 1C4V2 2XTTB 1IQNA 1GJ7B 5ESTE 4ZKRU 1AO5A 2C3SA 6ESTA 5GCHG 1DDJA 3ZVDA 2F3CE 2QAAA 3M5OA 2VIVA 1H4WA 2FOAA 2PGQB 1AWFH 1K1IA 3OY5U 2Z9JA 1UTQA 3KN2A 3MU4A 1MCTA 5A0AE 2W5EA 1L4ZA 3A82A 1TB6H 1GI3A 5FPTA 2R3UA 2OC8A 3U1IB 3MH5A 3BTTE 4DT7B 1AB9C 1QGFA 1TNLA 1MKXH 2BVRH 4CRBA 1HAYB 1L1GA 2GCTC 1ACBE 2GMTC 4K1TA 1LPKB 3BF6H 1TMBH 3VB5A 2YOLA 3T2NA 2O8UA 3I78A 1SMFE 1QQUA 3RUOA 8GCHG 1T7CA 2SGEE 1C5PA 1LHDH 2UUYA 4FU7A 3RXUA 2DE9A 3FP8E 2UUFB 1TALA 3UUZA 2FI3E 1SGFA 1K21H 4PROA 1Z8GA 4O03A 4Y7BA 4GHQA 2GCHF 5HMAA 1HAOH 1UCYK 1EJMA 3M35A 1LDTT 1TMUH 3BV9B 1CT0E 2BY8X 1BTWA 1GCTB 3RMMH 4IGDA 5G4BA 2PUQH 1P05A 1DUEA 1B0FA 2FYQA 2TGPZ 2A4GA 5DP3A 1SHYA 3EQ0H 4X6OA 1EX3A 1K9OE 3UTUH 2ZECA 2O8TA 3TJOA 1LHEH 1ZJDA 3C1KA 1ABIH 3EA9A 5FX5A 4FUDA 3LONA 1GMDG 2R2MB 2PWXA 3A7WA 1P10A 3AAUA 3HKJB