3SNDA

Crystal structure of sars coronavirus main protease complexed with ac-estlq-h (cocrystallization)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptide aldehyde inhibitors challenge the substrate specificity of the SARS-coronavirus main protease.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
total genus 88
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3sndA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sndA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sndA02
4GVUA 4X8UH 2AEIH 3GCNA 2PKSB 4Y7BA 1SL3A 8LPRA 3PWCA 4X2VA 2F9NA 1Y8TA 1BQYA 1O3OA 1HAOH 2XRCA 1QNJA 5C20A 3SJKA 2RDLA 1XXDA 2Z6BD 1K2I1 6CHAB 2C8YB 1HAGE 5A8YA 2BMGB 2V3OH 3UR6A 3URCA 1GG6C 3RDZA 4GCHF 1UVOA 3VGCB 1L1GA 2XWAA 1E37B 2BX3A 1FY3A 2H2ZA 4X2YA 1ZSJA 3ZZ6A 3ZZ5A 5L6NH 1W12U 1FY4A 1KXBA 1P04A 1UTMA 3ESTA 1YYY1 2TPIZ 1W0YH 1ZMNA 5FX6A 4IN1A 5F8TA 3SUGA 1HAYB 1QBNA 1ETSH 1TX6A 1EAUA 1C5NH 1GI6A 1TABE 2O8MA 1OYQA 1K1JA 3T26A 3GICB 4FVBA 1ELCA 2ZEBA 4AB9A 2GZ7A 4UFDH 4XOJA 1AI8H 3ATKA 3BTQE 2BD2A 3UNSA 4DGJA 3AAVA 3F9EA 2A4OA 1Z8GA 4IS5A 1SGFA 2BZ6H 2QF0A 4X8TH 3RU4D 1XXFA 2V6NA 4ABDA 3VGCC 2VH6A 4OS5A 1Z8JB 3RXDA 5H4IB 3STJA 1GMDG 2GP9B 3EA9A 1YBWA 5C1UA 5A09A 7ESTE 3EDXB 2CMYA 2A7HA 3N7OA 1DSUA 8GCHF 4OGXA 1FPCH 4Q7XA 3BG4C 2ZGXH 5T6FA 1G37A 2ZWLH 3E0PB 1V2RT 1DANH 1S0QA 1EASA 6LPRA 2BY6X 4YOJA 1C5SA 1H4WA 1XUJA 1AD8H 2SGDE 2R2MB 3RXTA 3A80A 1O5FH 2B7DH 2WPLS 3H7OA 4X1PU 5TJXA 4MTBA 3S9AA 1AKSA 1GI3A 1NS3A 1A61H 1QY6A 1GBKA 2J92A 4B74A 1RIWC 1OP8A 3LPRA 1UTLM 4MNVA 4D7GA 3MU5A 2IOTA 1QRWA 1RD3B 1K9OE 4I7YH 3UY9A 5DP8A 1TOMH 1QRXA 2JETC 5CHAC 4IMQA 2ZGJA 3BTDE 1GHZA 2P94A 4IN2A 4D8NA 5AF9H 1SLWB 1P57B 2PUQH 1P3CA 5FBEA 1C1WH 3MHWU 1RRKA 1ZMJA 3PMHB 4X6PA 3PLPA 1GDNA 1O2MA 1FN6A 2GV7A 1C5YB 1P03A 1SR5C 4I8LA 5E0GA 1TRMA 1ESBA 2C8WB 5L2ZH 5DKMA 1S83A 1BHXB 1XUHA 1GHBG 1VZQH 1KDQB 1Z8RA 1H9HE 1O2QA 5JBTA 5C1YA 5DJ7A 3FZZA 3UUZA 2D8WA 1SQAA 6GCHG 5DPAA 3FFGA 3SI3H 1FDPA 1FXYA 1IOEA 2P16A 3SU3A 4X6OA 1MUEB 1G36A 5GJ4B 3RXGA 2GDEH 2ZDAH 2F9UA 3I78A 4ZUHA 1IQGA 5ESBA 2KAIB 4ISLA 1NROH 1P2QA 1GI8B 3ZYDA 1ZMLA 2XTTB 4NA8A 4MNXA 2XBVA 3LC3A 2G4UA 4E06H 1Y3XA 4YTAA 5E0HA 2A5KA 4M7GA 1AFQC 1YP9A 3QK1A 1ARCA 3KGPA 4UONA 2AIPA 2BD8A 1T32A 4IBLH 4CH2B 2O8LA 2FZZA 1EJAA 2ANYA 1GHAF 4R8TB 4CRCA 3Q77A 2W7UA 2PKAB 2F9VA 1ZJKA 2ZF0H 2OCVB 3MOCA 4AX9H 1DWCH 1Y5UT 1KTTB 1TGSZ 3GDUA 1QIXB 3M36A 3FZDA 5L30H 4I8HA 2AYWA 1O0DH 2HRVA 2J9NA 2BD7A 2QGRA 1UTPA 5FPTA 1BIOA 1AQ7A 2ZGHA 1C1RA 3RXHA 1YPGH 1B7XB 1K1IA 3F9GA 1G3CA 4X2XA 1GMHG 2ZGBH 1P01A 3K6ZA 3A7TA 2GCTB 1PPGE 1MTSA 3RMOH 3V7TA 2FYQA 1O2LA 3GY4A 3Q3YA 1YGCH 1K28D 4B2CA 1AZZA 1A4WH 2SGAA 1W7GH 1GI9B 4AFQA 4NSYA 2CN0H 1RS0A 4OGYA 4R0IA 1YPEH 4AG2A 4YT7H 1C2HA 1J15A 1BTUA 1G3EA 1ZR0A 3MU4A 3EBNA 2ZHWH 1D3DB 2OC7A 2RA0A 5T6GA 1K1LA 2TGAA 1WAYB 4Q7ZA 1N1LA 1AN1E 1GL1A 1O37A 4AORA 1ZTLA 4Z6AH 1LVBA 1SOTA 1BMAA 4UE7H 1C2FA 1MAXA 4FU9A 4ZROA 3SV9A 2G4TA 1W13U 5PTPA 3U9AH 5J4QA 5HMAA 1MKXH 2QF3A 2TRMA 1SLUB 1V2PT 3U8RH 1GL0E 4VGCB 1O2JA 3MU1A 3TH2H 2CJIA 3A8AA 1S6FA 1XX9A 2FDAA 3A7YA 1BMNH 2BD3A 3M7QA 1YLDA 1UTNA 4K8YA 3LGUA 3ZVFA 2ZO3H 1HLTH 3SW2B 3AAUA 1RJXB 4YOGA 1NN6A 3GYMA 3MO9A 4X0WU 1GJAB 1AB9C 3QZQA 5JB8S 3GY2A 1TNKA 1G32B 1HJAC 1AY6H 2GCHF 4TY7A 5IDKA 1Z6JH 4A1VA 2EC9H 3UR9A 1CGIE 1QB9A 3RXRA 4BOHA 1TOCB 3RXUA 4IGDA 1HAPH 1GMDF 1P0SH 1WYKA 2BB4A 2FI3E 2K1QA 3D62A 3BTTE 3QO6A 3UOUA 1TGNA 3GISB 2ZFPH 3QLPH 3DT0H 3O8DA 4ZKNU 2Y5HA 5GCHG 2FPZA 1UVTH 2BLOA 2OP9A 1PQ7A 5A0CA 3GDVA 2ZCLP 2VH0A 2AMDA 5FBIA 1TX7A 4CH8B 2TBSA 4YT6H 2P95A 1MKXK 5F8ZA 1A46H 1O3NA 1YPLH 2QIQA 2W7SA 3MYWA 2I6SA 1OSSA 4YLQH 3UOPA 1BRCE 2UWPA 2A5IA 4TWYA 1OP0A 1GBIA 5K7RA 2ZU5A 4Y11E 2WPMS 2ULLA 4GCHG 1CA0B 2WYGA 1KTSB 3MTYA 3ZZ9A 4DCDA 1V2WT 3UWJH 2VIOA 4JZIA 5AHGH 4NFEA 1CHOF 3ZVGA 1KYNA 4BTIB 1S6HA 3TJVA 1G9IE 1KIGH 1SGDE 1HIAA 1SGYE 3BTHE 2P93A 2P3UB 3RXVA 2A4GA 4ISNA 1C9TA 2GCTC 3PV4A 3E0NB 3M7UA 1MBQA 1ZLRA 4JK5A 1FPHH 4AGJA 1THSH 1O5DH 3BTGE 1SGIB 1IQFA 2BY9X 3DFLA 3GOVB 2V35A 3MU0A 3SV7A 1MTUA 2BQ6B 3URDA 3GY5A 1CBWB 1C5UA 5EPNA 3SBKA 3M37A 3M5NA 3SQHE 4U2WA 2G51A 1YPHE 1K22H 3LGTA 1DXWA 3F68H 4K1EA 3ZZ7A 4AZ2B 3TJNA 4OS6A 5B6OA 3BG4B 1TGCA 1C9PA 2VJ1A 2F9OA 1DPOA 1WUNH 2Y81A 4CRGA 1WCZA 2O9QA 2VWNA 1YCPM 1BJVA 4NG9H 1BHXF 2D1JA 4NFFA 1T8OA 4X2WA 3B23B 1S0RA 1GDUA 2C3SA 1C5VA 4K2YA 1QFKH 3NPSA 1P3EA 1GBAA 1C5XB 2EEKA 1Y5BT 2AS9A 3Q3XA 4RKOB 3ZZAA 1BMMH 1UO6A 4NWLA 3EE0B 2R3YA 4E7RG 1QA0A 1HBTH 4I33A 4BXWA 3VB5A 1EAIA 1BT7A 3JZ2B 1GJCB 2QA9E 3A81A 1XUIA 1HJ9A 2BLQA 3SQEE 3UQOA 2BX4A 5I46H 5FHTA 4UEHH 4K1SA 3KIDU 5EQRA 4BAMB 1O3GA 3RLYH 3P6ZB 3L33A 1O39A 1ELVA 1NFWA 1ZHPA 1TWXB 3ATWA 2YNBA 1L2EA 1TB6H 4PROA 4WXIA 1DX5M 1LMWB 1AGJA 1ZJDA 2R2WU 2H5CA 1V3XA 1EP5A 1AWFH 1EOLA 1P2NA 3V13A 2F91A 5C5NA 2BDCA 5ESTE 3O8BA 1EB2A 3RXKA 3A7ZA 3LGVA 1C5ZB 2ZCHP 3GY3A 2VIWA 2H9HA 1HB0B 3I29A 1QJ6B 5FCRA 3TK5A 3SNCA 2BDGA 5LPRA 2XBXA 4Q80A 1IQKA 1FY5A 4NIYA 4BAHB 2A1DB 3M5OA 1V2JT 3UREA 1N8OC 2BQ7B 1AWHB 1C5TA 3M3TA 3ZVBA 5AVDA 4DOQA 4AFSA 1ZYOA 1KXDA 3OY6U 1ELEE 1UTQA 3SGQE 4X6NA 3AASA 4GHTA 4IW4E 2QCYA 4YESB 1DFPA 2ZU3A 2XYAA 1P2MA 2DE8A 5GPIB 2HOBA 1HAVB 3H7TA 4GHQA 1LQDB 4DJZB 3M35A 3E6PH 1SPJA 4TPIZ 3PMAB 1JXPA 2PFEA 3K9XB 3ZZBA 5EQSA 4YO9A 2FIRH 1PYTD 2LIZA 3ZV9A 1FN8A 1JRSA 4DIHH 4BTTB 3DA9B 3UTUH 1ZPCA 1UCYK 3U8TH 1IHTH 4CRDA 1MKWK 3P8NA 2FOBA 1F0RA 1TGTA 4FUGA 1DY9A 2FS9A 1UK3A 1Y3UA 5DP4A 3UPEA 4CBNA 1GBLA 2Y5FA 2OTVA 1KLTA 2PSYA 3QN7A 1AMHA 3KL6A 1E36B 1W10U 3KHVA 4NIXA 2QC2A 3A87A 1MTNC 4MPUA 1K1NA 1NFYA 1H1BA 1K1OA 3RMMH 4I32A 1JIRA 3A7WA 5JDUB 2ANWA 3TIUA 1SB1H 2BY8X 2FLBH 2ZDLA 4JZDH 1GHBF 4OS4A 3STIA 3Q00A 1D9IA 1CGJE 1ZTKA 4NIVA 3W95A 1GBBA 2ODQA 3KN2A 5FCKA 4NWKA 1O2TA 1MTVA 1ZHRA 3F6UH 1GBJA 1B0FA 2XNIA 1UMAH 1ZSKA 2AH4X 3ZVEA 2A32A 4JZ1A 4O03A 1TX8A 5DO4H 3RXEA 1O2VA 1F0UA 2W5EA 1UTKA 2BHGA 2Q6GA 2XBWA 1W11U 1C2EA 3A8DA 2G81E 1MBMA 1TONA 5E2PA 4INLA 2R3UA 4FXGH 1AHTH 1TRYA 2ZFFH 4X1QU 2FMJA 4A7IB 1C4Y2 9ESTA 2BVSH 4KGAA 4ZKSU 4MNYA 1O2OA 1TYNA 2BY7X 1AIXH 1TMBH 1OWJA 1PQ8A 1ZOMA 2BDBA 2R0KA 2OXSA 2ZGCA 1QHRB 2J95A 1P10A 3TJOA 1BTZA 4NGAH 1O2IA 3GY6A 1KDQA 4YM9A 1ZRKA 1ZTJA 1P12E 1Y3VA 4SGBE 1XUKA 3RXBA 2EI8A 3VB7A 1P11E 3BTME 1UCYE 4Y0YE 1L1JA 3GY7A 3LH1A 1RTFB 2Z3CA 1WBGB 2ZZUH 1ABIH 5HM9A 4JK6A 2UUJB 5LGOA 5EU8A 1PFXC 1UVUH 1YPKH 3DD2H 1EP6A 2WPIS 1Q31A 1EJNA 1O2XA 3B8JA 3PO1B 1ABJH 1OP2A 5E8EH 3HKIB 4WMFA 2UWLA 1IQNA 1GBDA 1ZRBA 2NWNA 4GSOA 3SO3A 3GCHC 3M3SA 2TGTA 1L4ZA 1O2RA 5TCCA 3PTNA 1NU9A 2FYRA 3B9FH 2B5TB 1DITH 2AGEX 1C2GA 1C2JA 5IYTA 3E1XB 2H9TH 4KP0A 4Y6DA 4B2BA 4JYTA 1ANEA 2QXIA 2VWLA 1MQ5A 1ZZZA 2ILNA 3R0FA 3ATLA 5EXNA 4ZHLU 2Z3DA 1P06A 1ETRH 1VJAU 1O3DA 3BEIB 1F5KU 3D23A 1P8VC 1SGNE 1VGCB 4KKDA 3LGIA 5C5OA 1BB0B 1Q2WA 1J14A 2BDHA 2OLGA 2CGAA 2HPPH 4RKJB 1G3BA 4ZXXH 2JH0D 1O38A 4HFPB 1TMTH 2H1UA 3PLKA 3HK3B 3SNDA 1FMGA 1P02A 1DSTA 4ZKRU 3SU1A 2VVVA 1YF4A 1JOUB 1C1UH 2C90B 4MG3A 5FX5A 5EXLA 4WVPE 1TNLA 1W14U 4Y8YA 5A2MH 1QURH 1DM4B 1C1NA 3MNBA 2LPRA 1O2SA 1HJ8A 3RU4T 2H9EH 1OKXA 1MMJN 2Z7FE 1RFNA 2ZKSA 5ABWA 1O35A 2Z9JA 2WV5A 4A6LA 1SC8U 1VCQA 5K0HA 2JKHA 1IQEA 3DUXH 4ABEA 3FVFB 3MMGA 2GD4B 1C2KA 5A0AE 1XUGA 1TNGA 4UFEH 4Y79A 2J34A 1WU1A 2M5TA 3C1KA 3OU0A 5FAHA 2B0FA 2R9PA 4NZLA 5LPEA 2G52A 2AMPA 4TY6A 1LHCH 1HDTH 1SGTA 2ZTYA 3SORA 3SN8A 3S9CA 1TQ7B 2F83A 8ESTE 3T5FH 3RUOA 3MU8A 1NU7B 2PGQB 3OSYA 4NSVA 1LQEA 4TWWA 1WOFA 1BA8B 1WTGH 2PKSC 4HZHA 1TIOA 1A3EH 3PTBA 1XMNB 2H6MA 2W3KA 1UCYH 3RXCA 1UTOA 5SGAE 1U6QA 1SLVB 5LH8A 3MWIU 3E3TA 1MKWH 3TNTA 1KXCA 8GCHG 1RGQA 4MPVA 2J94A 2ZA5A 3E91A 1C5LH 1E38B 4SGAE 3A8BA 1BDAA 1C1QA 1V2ST 2BYAX 2EI7A 1MTWA 2YOLA 2BQWB 4UFGH 1INCA 1OXGA 2JH6D 2SGPE 1AUTC 1IHSH 3IWMA 2WV4A 3A85A 2ALVA 1HAZB 2Q6FA 4DIIH 3ZVDA 4GUXA 1LHDH 1NY22 3ZZ3A 2WPJS 1C1TA 3AW1A 1WSSH 3K2UA 1SQOA 1ELTA 4GPGA 1O3IA 3M61U 2GZ9A 3UWIA 2NU1E 1O30A 1P2JA 4X6MA 3P92A 3IG6B 2ODPA 1F92A 1GCDA 3SHCH 1L4DA 2GT7A 1A0HB 1ETTH 2NU0E 4VGCC 1T4UH 4Y7AA 3HGPA 1LCYA 2PSXA 2FM2A 2UUKB 1NFXA 1E34B 1ACBE 2ZPRA 2XC0A 1GI1A 1HXEH 3CS0A 3SU0A 4DY7B 1C1VH 3TLOA 2Y82A 2TGDA 2VB0A 2FP7B 1EXFA 3QGNB 3TPIZ 2ZDNA 1AO5A 2PGBB 1GJBB 5GWZA 2XCFA 4MNWA 4MQAA 5I25A 4FUHA 1AVWA 1MQ6A 3U8OH 1QB6A 3Q76A 2HNTC 2BOKA 1EZXC 3RC5A 4ZAEA 3PLBA 4LOYH 1GG6B 1J16A 4XBBA 1IAUA 3CS7A 3RC6A 2ZPSA 1GJ6A 1ZSLA 2PTCE 1JBUH 3A89A 1UTJA 3BN9A 1PYTC 4DURA 2GZ8A 1VITH 1MH0A 1ZHMA 2ZTZA 1C2DA 1TGBA 2VVCA 4K3JA 4ZXYH 2ZQ2A 1SMFE 1O5GH 5DG6A 1ID5H 1P2OA 3S7KB 4Y71A 3TJUA 5AFYH 3BIUH 1UVSH 2WPHS 2P8OC 3D49H 1S81A 1GCTC 1HGTH 1QTFA 2AERH 3SGAE 4Y0ZE 1BTXA 1HV7A 1T31A 2ZFSA 2XXLA 1A0JA 1GI4A 3S9BA 1VCWA 4JYVH 1VR1H 1NO9H 4K1TA 1BMLA 4X8SH 4F4OC 4JMYA 1GBTA 4NA7A 2C8ZB 1OPHB 3O8RA 2BOHB 4IC6A 3GYLB 5T3HA 3HGNA 2VWMA 1C5PA 1TNHA 2FO9A 3SUDA 4Q2KA 2VIDA 1QJ7B 5JBAS 2SNVA 2HPQH 1BRAA 1GHYH 2AIQA 3NWUA 1G2LA 2O8TA 1TFXA 1TE0A 1O3BA 2H5DA 2I6QA 2K7XA 1SFQB 3RM2H 1YKTA 3WY8A 3BEUA 4LXBH 1F0SA 1O32A 3FANA 2XC4A 1EX3A 3MH5A 5EODA 1SOZA 1CHOG 1CVWH 4INKA 2P8OB 3MNCA 1S84A 4MVNA 1H9LB 1B0EA 2FOCA 1EOJA 4B71A 3TU7H 1GBMA 3W94A 4CHAC 4J2YB 4QT8C 4OS1A 3AVZA 4A1XA 4FUEA 1D6WA 5FXLA 4FUFA 2BLVA 2ASUB 3RXSA 1TNJA 3SJ8A 1TRNA 2FLRH 3V0XA 3RP2A 3LONA 3M5MA 1HJAB 2ZP0H 1TQ0B 1NRQH 3RXPA 1ANCA 2ZQ1A 4Z0KA 2PLXA 5HYOA 2F9PA 1OWIA 1TBRH 3LJOA 1SQTA 1BTHH 4WH8A 5JBBS 4LZ4B 3RXAA 1KXAA 1LPZB 4O3UA 2ZFTA 3ODFA 1UVPA 2OBOA 3UNQA 2QN5T 1O2WA 2DUCA 2GMTC 2Y6TA 2AMQA 4HGCA 1GJ9B 3NKKA 2R0LA 4BXSA 7GCHF 3VPKA 1J8AA 1W7XH 2P59A 1O5EH 2UUFB 1BUIA 3P8OA 2GT8A 1E0FD 3O8CA 2OINA 1NFUA 4H6TA 2FOHA 2RA3A 2GDDA 2VINA 1XVOA 1Z71A 1UK4A 2PR3A 4FUDA 1D3PB 4FUIA 3A83A 3SNAA 1CA8B 2ANMH 1Y5AT 1PPHE 3TNSA 2GCHG 1K1PA 2F3CE 1O2NA 4AFZA 2WYJA 1V2KT 1KSNA 1TA6A 1O2YA 2IJOB 1JMOH 2A4QA 2ZC9H 3EQ0H 1FNIA 1GHWH 1CHGA 2V0BA 2QXGA 2VVUA 2Y7ZA 2ZU1A 3K6YA 1MU8B 3M7TA 2FTLE 1V6DA 1EB1H 2PKAA 1EATA 3TK6A 1J17T 1F0TA 1W8BH 4AFUA 1T4VH 3ZZDA 3AW0A 1K1MA 4XFQA 1ZPZA 3S0NA 2ZHEH 2XCNA 1A1RA 1FLEE 3GY8A 1SGRE 1TPSA 2AGIX 3KEEA 3TITA 5EXMA 3SI4H 3FP7E 1Z6EA 3ZVCA 4B73A 4CHAB 1BJUA 5FPSA 2FI5E 1UJ1A 2J4IA 4O9VA 4ISIH 1C5RA 2G8TA 3UFAA 3PMJA 3QGJA 3SV8A 4LZ1H 1UK2A 1FZZA 1GI0A 4WF8A 3KNXA 2ZFQH 2HNTF 1O33A 1XM1A 2PV9B 1KY9A 1YC0A 3MNSA 4CR9A 1NZQH 4OS2A 1RXPA 2HGTH 1L0ZA 5A8XA 1AKSB 3BTKE 4XBCA 2D2DA 2BD9A 4KTUA 1CBWC 2FOFA 6ESTA 2ODYB 3RXOA 2WPKS 2WUCA 3KQCA 2Y5GA 3BTFE 3SUFA 1IQJA 4AG1A 6GCHF 4F49A 1NRNH 1O3PB 4A1TA 4ESTE 1ELFA 1XUFA 2FODA 3T62A 3VEQB 2Z9KA 3A82A 3NXPA 4BAQB 4Q7YA 1TALA 3SUEA 5GXPA 1Y59T 1GGDC 3LGYA 3H5CB 2VNTA 5AFZH 3F9HA 2QXHA 1QR3E 2VGCC 1A7SA 1ARBA 1NTPA 1C5MD 1SVPA 5HGGA 2B8OH 3KQEA 1NRSH 1AE5A 1S5SA 1NESE 2ZIQH 4B1TA 5HM2A 3SJ9A 2A7CA 4FU7A 3L6PA 3SV6A 1TLDA 1GBEA 1QL8A 2A5AA 2FXRA 2ZU4A 4JCNA 1HUTH 5EW2H 2VWOA 4XDEA 1DLEA 1BOQA 1IQIA 1QQ4A 1ELGA 5TCAA 5F03A 4CBOA 3RMNH 4JYUH 1GI2A 3ZVAA 2NU4E 3RXIA 3LC5A 3ITIA 2HVXA 1SGCA 1DDJA 3SZNA 3RXFA 2RG3A 4UDWH 1DS2E 1CT2E 1OS8A 1FONA 1O31A 1O2KA 3MO6A 4BANB 1LVYA 4TYDA 5ETXA 2JETB 2THFB 3HPTB 2ZHFH 1BCUH 2EI6A 1V2NT 1YM0A 2ALPA 3SU5A 5DP7A 3CENA 1GJ7B 5BPEA 2VIQA 1IQHA 1PPBH 3FP6E 4B76A 1HAHH 4X1SU 2A2XH 1NT1A 3QZRA 4DT7B 1O3EA 4ZH8A 2WUBA 1C1MA 3NZIA 1K21H 2PW8H 1WV7H 3P70B 1BBRK 1O5AB 2ZI2H 2TIOA 3PM3A 1LHFH 1LVMA 1VCPA 5GDSH 1GMHF 1LO6A 1QQUA 4IMZA 3U1IB 1KLIH 1NC6A 2ANKH 4DW2U 1D3TB 2FOAA 1QCPA 2SGEE 1V2UT 4XBDA 1ORFA 3M5LA 5CHAB 3BTWE 4ZHMU 2F9BH 2A0QB 5DP9A 5DP3A 3QWCH 4GAWA 2Y80A 1VGCC 1WTHD 2FTMA 4ASHA 1GPZA 1HXFH 1TBZH 2W26A 4I31A 1EAWA 1B5GH 2A7JA 4Y8XA 2BM2A 1TMUH 3SJIA 1TA2A 4AYVB 3BG8A 4TPYA 3LT3A 1T8NA 1BBRE 4UD9H 1ANDA 4XSKU 2BDYA 1GVLA 2Q1JA 5F8XA 2Q6DA 2ZHDA 2CF8H 4FUJA 1O3FA 5JB9S 4E05H 1DXPA 4MLFB 3BF6H 5E0JA 3MO3A 1EJMA 3P95A 1DUAA 1FY1A 1D3QB 4YOIA 1LPKB 3A8CA 1MCTA 2TGPZ 3PYHA 2P3TB 1GBHA 3R3GB 1GI7B 1O5BB 4X1NU 1HRTH 2STBE 2UWOA 1O3LA 1LTOA 3PWBA 4BTUB 1AB9B 1SHHB 3A88A 3UQVA 4WH6A 1H9IE 3RMLH 3GCOA 5CE1A 1Z8IB 1XVMA 2CF9H 3OX7U 3FP8E 1T8MA 2SFAA 3MNXA 1TPPA 3GCTG 3A7VA 1Z7KA 2FI4E 1TBQH 2STAE 4FU8A 1KXEA 2OUAA 1C5QA 5DP6A 1DICA 1BRUP 2BD5A 1GJ4H 3V3MA 3MH4A 3A86A 1EZSC 4CRFA 1UHBB 4K69A 1OWDA 3T2NA 1X7AC 1AE8H 3LKWA 4JZEH 1W3CA 1D4PB 5EW1H 2BVXH 2FESH 4JZFH 4WJG2 2G55A 3SNEA 1XKBC 1GMCG 5FPYA 2O8WA 5EGMA 2A45B 3VXEH 3EYDA 2ZDVH 2KAIA 2BZAA 3HKJB 5C67A 2BXUH 3P17H 2DE9A 1PJPA 1EQ9A 4AN7A 1CE5A 3SJOA 1FV9A 1OOKB 3KCGH 2FWWA 1YPJH 1GDQA 1BITA 1C5WB 1E35B 1F2SE 4A5TS 4B75A 7LPRA 1S82A 1EPTA 5G4BA 1GBFA 5BRRE 1Z1JA 1O2HA 1GGDB 1JRTA 1LHGH 1A3BH 3LU9B 1FAKH 2Z9IA 2CHAC 3ATMA 4AYYB 4HI3A 1AVXA 1O34A 4IC5A 1IQMA 3T29A 2ZG0H 3C27B 1GI5A 3BEFB 2A4RA 1PPCE 4ZHAA 5HXFA 1CO7E 2OQ5A 2BXTH 3BIVH 3SV2H 4D7FA 3RLWH 4GLYA 2EA3A 1C5OH 1F5LA 4RSPA 5C3NA 3NUMA 4WWYA 8KME2 3DFJA 1KXFA 5T6DA 2VIVA 2HWLB 1G3DA 1ELAA 3DHKH 1GCTB 4WMDA 3P8GA 4H6SB 3P8FA 2QYIA 1UHBA 3RU4E 1VITG 1FIWA 3EA7A 3SU6A 3BTEE 5L2YH 2XBYA 1HYLA 4ABIA 6CHAC 1NRRH 2OC1A 1YCPK 3OTJE 4O3TA 3VXFH 3UIRA 4CRAA 3VB3A 1LKBA 3I77A 1O2PA 1THRH 5LPFA 3TGIE 4J1YA 5JYIA 1P2KA 3M3VA 2B9LA 3ELAH 2AFQB 1KLJH 1OWEA 3V12A 1NM6A 4I8GA 1H8DH 1P05A 4NZQA 1CSOE 3F1SB 3ZYEA 3KQBA 1P9SA 4H42U 1WQVH 2C93B 1BTPA 1C1PA 2PTNA 3A84A 1RTLA 4I8KA 1CQQA 3ZZ4A 1V2VT 3E8LA 3HATH 4CR5A 3ZV8A 1YLCA 1V2TT 3RXMA 1EAXA 1O2UA 1O3AA 5EPYA 4CREA 2FOGA 2OD3B 1LKAA 1HCGA 5A8ZA 1C2LA 3BV9B 1CT0E 3QTVH 3EGKH 1F5RA 1EZUC 1ELBA 2ZDKA 4KTCA 1QGFA 1V2MT 2P3FH 3L3TA 1AZ8A 1Q3XA 3ZZCA 1DUEA 1FUJA 2QY0B 1OWHA 1YCPH 1HAXB 1GWAA 3MI4A 4ABHA 1DOJA 1OYTH 1MU6B 1EPTC 3E16B 4LK4A 4HTCH 2ZCKP 1O3JA 2CHAB 4INHA 3RXLA 2SNWA 1MD7A 2Y7XA 1EKBB 4ISOA 1GVZA 2Z9GA 5EQQA 1O3KA 4U30A 1O5CB 2ZDMA 4UFFH 3TH4H 2J38A 5C1XA 1MTNB 4O97A 2QXJA 4ABGA 4ZKOU 1AU8A 1SBWA 4ABFA 1SGPE 2YNAA 1N6XA 1CA0C 2XC5A 4D76A 1O2GH 2WINI 4H4FA 1O3HA 3SHAH 3S7HB 1LHEH 2V3HH 4Y8ZA 3UNRA 5EOKA 3LH3A 4AB8A 1IQLA 4BNRA 1WQSA 1MZDA 2VGCB 5E2OA 1V2LT 1C4V2 3SU2A 1SGQE 3S69A 3EAJA 3SGBE 2PWXA 1C1SA 1S85A 1GMCF 1P09A 1T7CA 1JWTA 1EZQA 3QTOH 3QX5H 2RCEA 2GVFA 1QA7A 2OQUA 3MFJA 1DWDH 2BLWA 4WXVA 1Z1IA 1C2MA 2G5VA 2FS8A 3BSQA 4CRBA 4AOQA 1CU1A 3ZZ8A 1QJ1B 1SGEE 1DE7H 1DT2A 1ESTA 3T28A 2ZECA 1LVOA 2OC8A 2ZHQH 1FAXA 3ATIA 1PQ5A 3FAOA 1MAYA 1GJ5H 3HK6B 4K60A 4A92A 1AUJA 5GIBA 2FOMB 1SHYA 2Z94A 1LPGB 3U98H 4BAKB 3TH3H 3PO1C 3KF2A 2ZFRH 3Q3KA 1GJ8B 4D9QA 1PQAA 1TPAE 2LNCA 1GBCA 4FVDA 2Z3EA 1LDTT 4MPWA 3OY5U 1SFIA 3KQDA 2GGVB 2Z9LA 3K65B 1QBVH 1DLKB 3F9FA 1ANBA 3LDXH 5DK1A 1ELDE 3GCTF 2BDIA 3G01A 5F6MA 3LJJA 1AVGH 1G2MA 1NPMA 3TK9A 1GHAG 5DP5A 1QRZA 5A0BA 3VB4A 3TVJB 1BTYA 1HFDA 1MD8A 2PHBA 2ZU2A 2A2QH 5JBCS 1GHVH 1BBRH 4ABBA 3LIWA 2J2UA 1HAIH 3OYPA 1Y3WA 3RC4A 2JH5D 4DVAU 5C2ZA 2CXVA 1QL9A 2QAAA 2IPHA 5GCHF 2VIPA 1EPTB 3GCHB 3RXQA 2FX6A 4ZMAH 2D26C 1TNIA 1ZGIA 2ZNKH 2HNTE 3QUMP 1A5IA 1TAWA 4OS7A 3SU4A 2FOEA 1OWKA 2O8UA 1BTWA 4NA9H 3SNBA 2PUXB 2G5NA 2BVRH 3EA8A 1ESAA 1L1NA 2SGQE 4K5ZA 4KELA 2GTBA 2NU3E 1C4U2 1SG8B 3PROA 1A2CH 3VFEA 1DWEH 1W2KH 2ESTE 1YPMH 4ISHH 5DGJA 2AGGX 2HALA 1V2OT 3CP7A 1GVKB 1N6YA 5EG4A 1QL7A 4KTSA 4U01A 1V2QT 4AGKA 1FJSA 1O3CA 4X8VH 2W3IA 1H8IH 5JPMH 1MCVA 1YPHC 4FUBA 4DG4A 3ODDA 1O2ZA 3NK8A 1HNEE 2FEQH 2A31A 4I8JA 3T25A 1SI5H 2HLCA 4YZUA 1VJ9U 3IITA 1G30B 1HPGA 9LPRA 1FY8E 4RN6A 1D6RA 2G00A 4NCYA 1CGHA 1MZAA 1OX1A 2CV3A 1VITF 1EUFA 3GDSA 1NRPH 1SGFG 1A5HA 3VB6A 1C2IA 1RIWB 1AFEH 1QB1A 1N8OB 4U32A 4ABAA 2IN2A 2GKVE 3E90B 3RXJA 1FIZA 2BTCE 1HIAB 4X1RU 1A0LA 3RM0H 2XWBI 3A7XA 1SSXA 1PPZA 1M9UA 7KMEH 2OC0A 2BDAA 2BY5X 3TGKE 4ABJA 3NCLA 4WY3A 5J4SA 1DWBH 3SOSA 1T8LA 5CMXH 1XKAC 1PPEE 3JZ1B 1DY8A 4WMEA 2ZTXA 1PPFE 3ENSB 3PB1E 1BZXE 4Y76A 3QDZB 3U1JB 1W0ZU 2NU2E 3D65E 2GV6A 1CT4E 2C4FH 1P2IA 1F7ZA 4THNH 1O36A 2ZPQA 2GX4A 3U69H 4D9RA 4MDSA 1GJDB 1RTKA 1SLXB 1Y3YA 1ZGVA 7GCHG 2C8XB 2GMTB 1ZPBA 4YLUA 3T27A 3LOXA 2XW9A 2QV1A 4Y10E 1O3MA 4XE4A 3PMBB 1FQ3A 1TPOA 1P9UA 4FUCA 1BRBE 4BAOB 2UUYA 1DVAH 1A5GH 1FI8A 2OBQA 2BD4A 1J9CH 3TGJE 1HAVA 4E7NA 2SGFE 1JIMA 2VU8E 4NIWA 2FX4A 3MH6A 4K8BA 1QBOA 1GHXH 3LGWA 3MH7A 1AFQB 1THPB 4MPXA 4B2AA 1C1OA
chains in the Genus database with same CATH superfamily
4GVUA 4X8UH 2AEIH 4Q4LA 3GCNA 2PKSB 4Y7BA 1SL3A 8LPRA 3PWCA 4X2VA 2F9NA 1Y8TA 1BQYA 3AK5A 1O3OA 1HAOH 2XRCA 1QNJA 5C20A 3SJKA 3N7DA 2RDLA 1XXDA 2Z6BD 1K2I1 6CHAB 2C8YB 1HAGE 4B6FA 5A8YA 2BMGB 2V3OH 3UR6A 3URCA 1GG6C 5EJ1A 4B6EA 3RDZA 5CDFE 4GCHF 1UVOA 3VGCB 2EQNA 1L1GA 2XWAA 1E37B 2BX3A 1FY3A 2H2ZA 4X2YA 1ZSJA 3ZZ6A 3ZZ5A 5L6NH 1W12U 1FY4A 1KXBA 1P04A 1UTMA 3ESTA 1YYY1 2TPIZ 4DT4A 1W0YH 1ZMNA 5FX6A 4IN1A 5F8TA 3SUGA 1HAYB 1QBNA 1ETSH 3OEED 1TX6A 1EAUA 1C5NH 1GI6A 1TABE 2O8MA 1OYQA 1K1JA 2LP6A 3T26A 3GICB 4FVBA 1ELCA 2ZEBA 3OTPA 4AB9A 2GZ7A 4UFDH 4XOJA 1AI8H 3ATKA 3BTQE 2BD2A 3UNSA 5KEDA 4DGJA 3AAVA 3F9EA 4XD7D 2A4OA 1Z8GA 4IS5A 1SGFA 2BZ6H 2QF0A 4X8TH 3RU4D 1XXFA 2V6NA 4ABDA 3VGCC 2KM0A 2VH6A 4OS5A 1Z8JB 3RXDA 5H4IB 3STJA 1GMDG 2GP9B 3EA9A 1YBWA 5C1UA 5A09A 7ESTE 3EDXB 2CMYA 2A7HA 3N7OA 2QE7D 1DSUA 8GCHF 4OGXA 2KCPA 1FPCH 4Q7XA 3BG4C 2ZGXH 5T6FA 1G37A 2ZWLH 3E0PB 1V2RT 1DANH 1S0QA 2HVYB 1EASA 6LPRA 2BY6X 4YOJA 1C5SA 2KCAA 1H4WA 1XUJA 1AD8H 2SGDE 2R2MB 3RXTA 3A80A 1O5FH 2B7DH 2WPLS 3H7OA 4RT1A 2LELA 4X1PU 5TJXA 4MTBA 3S9AA 1AKSA 1GI3A 1NS3A 1A61H 5T1VA 1QY6A 1GBKA 2J92A 4B74A 1RIWC 1OP8A 3LPRA 1UTLM 4MNVA 4D7GA 4RT0A 3MU5A 2IOTA 1QRWA 1RD3B 1K9OE 4I7YH 3UY9A 5DP8A 4HG6A 1TOMH 1QRXA 2JETC 5CHAC 4IMQA 2ZGJA 3BTDE 1GHZA 2P94A 4IN2A 4D8NA 5AF9H 3PV5A 1SLWB 1P57B 2PUQH 1P3CA 5FBEA 1C1WH 3MHWU 1RRKA 1ZMJA 3PMHB 4X6PA 4FOUC 3PLPA 1GDNA 1O2MA 1FN6A 2GV7A 1C5YB 1P03A 1SR5C 4I8LA 5E0GA 1TRMA 2KFWA 1ESBA 2C8WB 3F0OA 5L2ZH 1NBME 5DKMA 1S83A 1BHXB 1XUHA 1GHBG 1VZQH 1KDQB 1Z8RA 1H9HE 1O2QA 5JBTA 5C1YA 5DJ7A 3FZZA 2OK5A 3UUZA 2D8WA 1SQAA 6GCHG 2J98B 5DPAA 3FFGA 3SI3H 1FDPA 1FXYA 1IOEA 2P16A 3SU3A 4X6OA 1MUEB 1G36A 5GJ4B 3RXGA 2GDEH 2ZDAH 2F9UA 3I78A 4ZUHA 1IQGA 5ESBA 2KAIB 4ISLA 1NROH 1P2QA 1GI8B 3ZYDA 1ZMLA 2XTTB 4NA8A 4MNXA 2XBVA 3LC3A 2G4UA 4E06H 1OHHD 1Y3XA 4YTAA 5E0HA 2A5KA 4M7GA 1AFQC 1YP9A 3QK1A 1ARCA 3KGPA 4UONA 2AIPA 2BD8A 1T32A 4IBLH 4CH2B 2O8LA 2FZZA 1EJAA 2ANYA 1GHAF 4R8TB 4CRCA 3Q77A 2W7UA 2PKAB 2F9VA 1ZJKA 2ZF0H 2OCVB 3MOCA 4AX9H 1DWCH 1Y5UT 2KR7A 1KTTB 1TGSZ 3GDUA 1QIXB 3M36A 3FZDA 5L30H 4I8HA 2AYWA 1O0DH 2HRVA 3N7EA 2J9NA 2BD7A 2QGRA 1UTPA 5FPTA 1BIOA 1AQ7A 2ZGHA 1C1RA 3RXHA 1YPGH 1B7XB 1K1IA 3F9GA 1G3CA 4X2XA 1GMHG 2ZGBH 1P01A 3K6ZA 3A7TA 2GCTB 1PPGE 1MTSA 3RMOH 3V7TA 1QZ8A 2FYQA 1O2LA 3GY4A 3FN8A 3Q3YA 1YGCH 1K28D 4B2CA 1AZZA 1A4WH 2SGAA 1W7GH 2WPDD 1GI9B 4AFQA 4NSYA 2CN0H 1RS0A 4OGYA 4R0IA 1YPEH 4AG2A 4YT7H 3UAIC 1C2HA 1J15A 1BTUA 1G3EA 1ZR0A 3MU4A 3EBNA 2ZHWH 1D3DB 2OC7A 2RA0A 5T6GA 5C0UA 1K1LA 2TGAA 1WAYB 4Q7ZA 1N1LA 1AN1E 1GL1A 1O37A 4AORA 1ZTLA 4Z6AH 1LVBA 1SOTA 1BMAA 4UE7H 1C2FA 1MAXA 4FU9A 4ZROA 3SV9A 2G4TA 1W13U 5PTPA 3U9AH 5J4QA 5HMAA 1MKXH 2QF3A 2TRMA 1SLUB 1V2PT 3U8RH 3OAAD 1GL0E 4VGCB 3PRDA 1O2JA 3MU1A 3TH2H 2CJIA 3A8AA 1S6FA 1XX9A 2FDAA 3A7YA 1BMNH 2BD3A 3M7QA 1YLDA 1UTNA 5FL7D 4K8YA 3LGUA 3ZVFA 2ZO3H 1HLTH 3SW2B 3AAUA 1RJXB 4YOGA 1NN6A 3GYMA 3MO9A 4X0WU 1GJAB 1AB9C 3QZQA 5JB8S 3GY2A 1TNKA 1G32B 1HJAC 1AY6H 2GCHF 4TY7A 5IDKA 1Z6JH 4A1VA 2EC9H 3UR9A 1CGIE 1QB9A 3RXRA 4BOHA 1TOCB 3RXUA 4IGDA 2JJ2D 1HAPH 1GMDF 1FX0B 1P0SH 1WYKA 2BB4A 2FI3E 2JJ1D 2K1QA 3D62A 3BTTE 3QO6A 3UOUA 1TGNA 3GISB 2ZFPH 3QLPH 3DT0H 3O8DA 4ZKNU 2Y5HA 5GCHG 2FPZA 1UVTH 2BLOA 2OP9A 1PQ7A 5A0CA 3GDVA 2ZCLP 2VH0A 2AMDA 5FBIA 1TX7A 4CH8B 2TBSA 4YT6H 2P95A 1MKXK 5F8ZA 1A46H 1O3NA 1YPLH 2QIQA 2W7SA 3MYWA 2I6SA 1OSSA 4YLQH 3UOPA 1BRCE 2UWPA 2A5IA 4TWYA 1OP0A 1GBIA 5GNDA 5K7RA 2ZU5A 4Y11E 2WPMS 2ULLA 4GCHG 1CA0B 2WYGA 1KTSB 3MTYA 3ZZ9A 4DCDA 1V2WT 3UWJH 2VIOA 4JZIA 5AHGH 2WSSD 4NFEA 1CHOF 3ZVGA 1KYNA 4BTIB 1S6HA 3TJVA 1G9IE 1KIGH 1SGDE 1HIAA 1SGYE 3BTHE 2P93A 2P3UB 3RXVA 2A4GA 4ISNA 1C9TA 2GCTC 3PV4A 3E0NB 3M7UA 1MBQA 1ZLRA 4JK5A 1FPHH 4AGJA 1THSH 3MQKC 1O5DH 3BTGE 1SGIB 1IQFA 2BY9X 3DFLA 3GOVB 2V35A 3MU0A 3SV7A 1MTUA 2BQ6B 3URDA 3GY5A 1CBWB 1C5UA 5EPNA 3SBKA 3M37A 3M5NA 3SQHE 4U2WA 2G51A 1YPHE 1K22H 3LGTA 4M9FA 1DXWA 3F68H 4K1EA 3ZZ7A 4AZ2B 3TJNA 4OS6A 5B6OA 3BG4B 1TGCA 1C9PA 2VJ1A 2F9OA 2V7QD 1DPOA 1WUNH 2Y81A 1YLNA 4CRGA 1WCZA 2O9QA 2VWNA 1YCPM 1BJVA 4NG9H 1BHXF 2D1JA 4NFFA 1T8OA 4X2WA 3B23B 5F53A 1S0RA 1GDUA 2C3SA 1C5VA 4K2YA 1QFKH 3NPSA 1P3EA 2QF5A 1GBAA 1C5XB 2EEKA 1Y5BT 2AS9A 3Q3XA 4ZCNA 4RKOB 3ZZAA 1BMMH 1UO6A 5C0TA 4NWLA 3EE0B 2R3YA 4E7RG 1QA0A 1HBTH 4I33A 4BXWA 3VB5A 1EAIA 1BT7A 3JZ2B 1GJCB 2QA9E 3A81A 1XUIA 1HJ9A 2BLQA 3SQEE 3UQOA 2BX4A 5I46H 5FHTA 4UEHH 4K1SA 3KIDU 5EQRA 4BAMB 1O3GA 3RLYH 3P6ZB 3L33A 4FETA 1O39A 1ELVA 1NFWA 1ZHPA 1TWXB 3ATWA 2YNBA 1L2EA 1TB6H 4PROA 4WXIA 2JIZD 1DX5M 1LMWB 1AGJA 1ZJDA 2R2WU 2H5CA 1V3XA 1EP5A 1AWFH 1EOLA 1P2NA 3V13A 2F91A 5C5NA 2BDCA 5ESTE 3O8BA 1EB2A 3RXKA 3A7ZA 3LGVA 1C5ZB 2ZCHP 3GY3A 2VIWA 2H9HA 1HB0B 3I29A 1QJ6B 5FCRA 5KGOA 3TK5A 3SNCA 2BDGA 5LPRA 2XBXA 4Q80A 1IQKA 1FY5A 4NIYA 4BAHB 2A1DB 3M5OA 1V2JT 3UREA 1N8OC 2BQ7B 1AWHB 1C5TA 3M3TA 3ZVBA 5AVDA 4DOQA 4AFSA 1ZYOA 1KXDA 3OY6U 1ELEE 1UTQA 1WXRA 3SGQE 4X6NA 3AASA 4GHTA 4IW4E 2QCYA 4YESB 1DFPA 2ZU3A 2XYAA 1P2MA 2DE8A 4XRNA 5GPIB 2HOBA 1HAVB 3H7TA 4GHQA 1LQDB 4DJZB 3M35A 3E6PH 1SPJA 4TPIZ 3PMAB 1JXPA 2PFEA 2W6ID 3K9XB 3ZZBA 5EQSA 4YO9A 2FIRH 1PYTD 2LIZA 3ZV9A 1FN8A 1JRSA 4DIHH 4BTTB 3DA9B 3UTUH 1ZPCA 1UCYK 3U8TH 1IHTH 4CRDA 1MKWK 3P8NA 1MABB 2FOBA 4ACAA 4Z1MD 1F0RA 1TGTA 4FUGA 1DY9A 2FS9A 1UK3A 1Y3UA 5DP4A 3UPEA 4CBNA 1GBLA 2Y5FA 2OTVA 1KLTA 2PSYA 3PV2A 3QN7A 1AMHA 3KL6A 1E36B 1W10U 3KHVA 3F3BA 4NIXA 2QC2A 3A87A 2PP6A 1MTNC 2XOKD 4MPUA 1K1NA 1NFYA 1H1BA 1K1OA 3RMMH 4I32A 1K0HA 1JIRA 2K0QA 3A7WA 1NBMD 2ANWA 5JDUB 3TIUA 1SB1H 2BY8X 2FLBH 2ZDLA 4JZDH 2J97A 1GHBF 4OS4A 3STIA 3Q00A 1D9IA 1CGJE 1ZTKA 4NIVA 3W95A 1GBBA 2ODQA 3KN2A 5FCKA 4NWKA 1O2TA 1MTVA 1ZHRA 3F6UH 1GBJA 1B0FA 2XNIA 1UMAH 1ZSKA 2AH4X 3ZVEA 2A32A 4JZ1A 4O03A 1TX8A 5DO4H 3RXEA 1O2VA 1F0UA 2W5EA 1UTKA 2BHGA 2Q6GA 2XBWA 1W11U 1C2EA 3A8DA 2G81E 1MBMA 1TONA 5E2PA 4INLA 2R3UA 4FXGH 1AHTH 1TRYA 2ZFFH 4X1QU 2FMJA 4A7IB 1C4Y2 9ESTA 2BVSH 4KGAA 4ZKSU 4MNYA 1O2OA 1TYNA 2BY7X 1AIXH 1TMBH 1OWJA 1PQ8A 1ZOMA 2BDBA 2R0KA 2OXSA 2ZGCA 1QHRB 2J95A 1P10A 3TJOA 1BTZA 4NGAH 1O2IA 3GY6A 1KDQA 4YM9A 1ZRKA 1ZTJA 1P12E 1Y3VA 4SGBE 1XUKA 3RXBA 2EI8A 3VB7A 1P11E 3BTME 1UCYE 4Y0YE 1L1JA 3GY7A 3LH1A 1RTFB 2Z3CA 1WBGB 2ZZUH 1ABIH 5HM9A 4JK6A 2UUJB 5LGOA 5EU8A 1PFXC 2M2AA 1UVUH 1YPKH 3DD2H 1EP6A 2WPIS 1Q31A 2RDEA 1EJNA 1O2XA 3F2FA 3B8JA 3PO1B 1ABJH 1SKYE 1OP2A 5E8EH 3HKIB 4WMFA 2UWLA 1IQNA 1GBDA 1ZRBA 2NWNA 4GSOA 3SO3A 3GCHC 3M3SA 2W6JD 2TGTA 1L4ZA 1O2RA 1SQRA 5TCCA 3PTNA 1NU9A 2FYRA 3B9FH 2B5TB 1DITH 2AGEX 1C2GA 1C2JA 5IYTA 3E1XB 2H9TH 4KP0A 4Y6DA 4B2BA 4JYTA 1ANEA 2QXIA 2VWLA 1MQ5A 1ZZZA 2ILNA 3R0FA 3ATLA 5EXNA 4ZHLU 2Z3DA 1P06A 1ETRH 1VJAU 1O3DA 3BEIB 1F5KU 3D23A 1P8VC 1SGNE 1VGCB 4KKDA 3LGIA 5C5OA 2V3MA 1BB0B 1Q2WA 1J14A 2BDHA 2OLGA 2CGAA 2HPPH 4RKJB 1G3BA 4ZXXH 2JH0D 1O38A 4HFPB 1TMTH 2H1UA 3PLKA 3HK3B 3SNDA 1FMGA 1P02A 1DSTA 4ZKRU 3SU1A 2VVVA 1YF4A 1JOUB 1C1UH 2C90B 4MG3A 5FX5A 5EXLA 4WVPE 1TNLA 1W14U 4Y8YA 5A2MH 1QURH 1DM4B 1C1NA 3MNBA 2LPRA 1O2SA 1HJ8A 3RU4T 2H9EH 1OKXA 1MMJN 2Z7FE 1RFNA 2ZKSA 5ABWA 1O35A 2Z9JA 2WV5A 4A6LA 1SC8U 1VCQA 5K0HA 2JKHA 1IQEA 3DUXH 4ABEA 3FVFB 3MMGA 2GD4B 1C2KA 5A0AE 1XUGA 1TNGA 4UFEH 4Y79A 2J34A 1WU1A 2M5TA 3C1KA 3OU0A 5FAHA 2B0FA 2R9PA 4NZLA 5LPEA 2G52A 2AMPA 4TY6A 1LHCH 1HDTH 1SGTA 2ZTYA 3SORA 3SN8A 3S9CA 1TQ7B 2F83A 8ESTE 3T5FH 3RUOA 3MU8A 1NU7B 2PGQB 3OSYA 4NSVA 1LQEA 4TWWA 1WOFA 1BA8B 5EIYA 1WTGH 2PKSC 4HZHA 1TIOA 1A3EH 3PTBA 1XMNB 2H6MA 2W3KA 1UCYH 3RXCA 1UTOA 5SGAE 1U6QA 1SLVB 5LH8A 3MWIU 3E3TA 1MKWH 3TNTA 1KXCA 8GCHG 1RGQA 4MPVA 2J94A 2ZA5A 3E91A 1C5LH 3ZIAD 1E38B 4SGAE 3A8BA 1BDAA 1C1QA 1V2ST 2BYAX 2EI7A 1MTWA 2YOLA 2BQWB 4UFGH 1INCA 1OXGA 2JH6D 2SGPE 1AUTC 1IHSH 3IWMA 2WV4A 3A85A 2KZ4A 2ALVA 2KX4A 1HAZB 2Q6FA 4DIIH 3ZVDA 4GUXA 1LHDH 1NY22 3ZZ3A 2WPJS 1C1TA 3AW1A 1WSSH 3K2UA 1SQOA 1ELTA 4GPGA 5HIYA 1O3IA 3M61U 2GZ9A 3UWIA 2NU1E 1O30A 1P2JA 4TSFD 3P92A 4X6MA 3IG6B 2ODPA 3W1EA 1F92A 1GCDA 3SHCH 1L4DA 2GT7A 1A0HB 1ETTH 2NU0E 4VGCC 1T4UH 4Y7AA 3HGPA 1LCYA 2PSXA 2FM2A 2UUKB 1NFXA 1E34B 1ACBE 2ZPRA 2XC0A 3KYFA 3OFND 1GI1A 1HXEH 3CS0A 3SU0A 4DY7B 1C1VH 3TLOA 2Y82A 2TGDA 2VB0A 1YWUA 2FP7B 1EXFA 3QGNB 3TPIZ 2ZDNA 1AO5A 1GJBB 5GWZA 2PGBB 2XCFA 4MNWA 4MQAA 5I25A 4FUHA 1AVWA 4TT3D 1MQ6A 3U8OH 1QB6A 3Q76A 2HNTC 2BOKA 1EZXC 3RC5A 4ZAEA 3PLBA 4LOYH 1GG6B 1J16A 4XBBA 1IAUA 3CS7A 3RC6A 2ZPSA 1GJ6A 1ZSLA 2PTCE 1JBUH 3A89A 1UTJA 3BN9A 1PYTC 4DURA 2GZ8A 1VITH 1MH0A 2F4LA 1ZHMA 2ZTZA 1C2DA 1TGBA 2VVCA 4K3JA 4ZXYH 2ZQ2A 1SMFE 1O5GH 5DG6A 1ID5H 1P2OA 3S7KB 4Y71A 3TJUA 5AFYH 3BIUH 1UVSH 2WPHS 2P8OC 3D49H 1S81A 1GCTC 1HGTH 1QTFA 2AERH 3SGAE 4Q63A 4Y0ZE 1BTXA 1HV7A 1T31A 2ZFSA 2XXLA 1A0JA 1GI4A 3S9BA 1VCWA 4JYVH 1VR1H 1NO9H 2IJD1 4K1TA 1BMLA 4X8SH 4F4OC 4JMYA 1GBTA 4NA7A 2C8ZB 1W0JD 1OPHB 3O8RA 2BOHB 4IC6A 3GYLB 2L6OA 5T3HA 3HGNA 2VWMA 1C5PA 5EJLA 1TNHA 2FO9A 3SUDA 4Q2KA 2VIDA 1QJ7B 5JBAS 2SNVA 2HPQH 1BRAA 1GHYH 2AIQA 3NWUA 1G2LA 1S6LA 1TFXA 2O8TA 1TE0A 1O3BA 2H5DA 2I6QA 2K8IA 2K7XA 1SFQB 3RM2H 1YKTA 3WY8A 3BEUA 4LXBH 3F0PA 1F0SA 1O32A 3FANA 2XC4A 1EX3A 3MH5A 5EODA 1SOZA 1CHOG 1CVWH 4INKA 2P8OB 3MNCA 1S84A 3OEHD 4MVNA 1H9LB 1B0EA 2FOCA 1EOJA 4B71A 3GS9A 3TU7H 1GBMA 3W94A 4CHAC 4J2YB 2GJGA 4QT8C 4OS1A 3AVZA 4A1XA 4FUEA 1D6WA 3N99A 5FXLA 4FUFA 4I86A 2BLVA 1KMHB 5KECA 5DN6D 2ASUB 3RXSA 1TNJA 3SJ8A 1TRNA 2FLRH 3V0XA 5DSFA 3RP2A 3LONA 3M5MA 1HJAB 2ZP0H 1TQ0B 1NRQH 3RXPA 1ANCA 2ZQ1A 4Z0KA 2PLXA 5HYOA 2F9PA 1OWIA 1TBRH 3KQ5A 3NRLA 3DSPA 3LJOA 1SQTA 1BTHH 4WH8A 5JBBS 4LZ4B 3RXAA 1KXAA 1LPZB 4O3UA 2ZFTA 5B6LA 3ODFA 1UVPA 2OBOA 3UNQA 2QN5T 1O2WA 2DUCA 2GMTC 2Y6TA 2AMQA 4HGCA 1GJ9B 3UB0A 3NKKA 2R0LA 4BXSA 7GCHF 3VPKA 1J8AA 1W7XH 2P59A 1O5EH 2UUFB 4ACBA 1BUIA 3P8OA 2GT8A 1E0FD 3O8CA 2OINA 1NFUA 3DCLA 4H6TA 2FOHA 2RA3A 2GDDA 2VINA 1XVOA 1Z71A 1UK4A 2PR3A 4FUDA 1D3PB 4FUIA 3A83A 3SNAA 1CA8B 2ANMH 2VBCA 1Y5AT 1PPHE 3TNSA 2GCHG 1K1PA 2F3CE 1O2NA 4AFZA 3DSGA 2WYJA 1V2KT 1KSNA 1TA6A 1O2YA 2IJOB 1JMOH 2A4QA 2ZC9H 3EQ0H 1FNIA 1GHWH 1CHGA 2V0BA 2QXGA 2VVUA 2Y7ZA 2ZU1A 3K6YA 1MU8B 3M7TA 2FTLE 1V6DA 1EB1H 2PKAA 1EATA 3TK6A 1J17T 1F0TA 1W8BH 4AFUA 1T4VH 3ZZDA 3AW0A 1K1MA 4P00A 4XFQA 1ZPZA 3S0NA 2ZHEH 2XCNA 2KCOA 1A1RA 1FLEE 5C94A 3GY8A 1SGRE 1TPSA 2AGIX 3KEEA 3TITA 5EXMA 3SI4H 3FP7E 1Z6EA 3ZVCA 4B73A 4CHAB 1BJUA 5FPSA 2FI5E 1UJ1A 1E79D 2J4IA 4O9VA 4ISIH 1C5RA 2G8TA 3UFAA 3PMJA 3QGJA 3SV8A 4LZ1H 1UK2A 1FZZA 1GI0A 4WF8A 3KNXA 2ZFQH 2HNTF 1O33A 1XM1A 2PV9B 1KY9A 1YC0A 3MNSA 4CR9A 1NZQH 4ASUD 4OS2A 1RXPA 2HGTH 1YY3A 1L0ZA 2CK3D 5A8XA 1AKSB 3BTKE 4P02A 2D2DA 4XBCA 2BD9A 5HKKD 4KTUA 1CBWC 2FOFA 6ESTA 2ODYB 3RXOA 2WPKS 2WUCA 3KQCA 2Y5GA 3BTFE 3SUFA 1IQJA 4AG1A 6GCHF 4F49A 1NRNH 2XNDD 1O3PB 4A1TA 4ESTE 1ELFA 1XUFA 2FODA 3T62A 3VEQB 2Z9KA 3A82A 3NXPA 4BAQB 4Q7YA 1TALA 3SUEA 5GXPA 1Y59T 1GGDC 3LGYA 3H5CB 2VNTA 5AFZH 3F9HA 2QXHA 1QR3E 2VGCC 1A7SA 1ARBA 1NTPA 1C5MD 1SVPA 5HGGA 2B8OH 3KQEA 1NRSH 1AE5A 1S5SA 1NESE 2ZIQH 4B1TA 5HM2A 3SJ9A 2A7CA 4FU7A 2J98A 3L6PA 3SV6A 1TLDA 1GBEA 3WWBA 1QL8A 2A5AA 2FXRA 2ZU4A 4JCNA 1HUTH 5EW2H 2VWOA 4XDEA 1DLEA 1BOQA 1IQIA 1QQ4A 1ELGA 5TCAA 5F03A 4CBOA 3RMNH 4JYUH 1GI2A 3ZVAA 2NU4E 1BMFD 3RXIA 3LC5A 3ITIA 2HVXA 1SGCA 1DDJA 3SZNA 3RXFA 2RG3A 4UDWH 1DS2E 1CT2E 1OS8A 1FONA 1O31A 1O2KA 3MO6A 4BANB 1LVYA 4TYDA 2AHME 5ETXA 2JETB 2THFB 3HPTB 2ZHFH 1BCUH 2EI6A 4AC9A 1V2NT 1YM0A 2ALPA 3SU5A 5DP7A 3CENA 1GJ7B 5BPEA 2VIQA 1IQHA 1PPBH 3FP6E 4B76A 1HAHH 4X1SU 2A2XH 1NT1A 3QZRA 4DT7B 1O3EA 4ZH8A 2WUBA 1C1MA 3NZIA 1K21H 2PW8H 1WV7H 3P70B 1BBRK 1O5AB 2ZI2H 2TIOA 3PM3A 1LHFH 1LVMA 1VCPA 5GDSH 1GMHF 1LO6A 1QQUA 4IMZA 3U1IB 1KLIH 5C17A 1NC6A 2ANKH 4DW2U 1D3TB 2FOAA 1QCPA 2SGEE 1V2UT 4XBDA 1ORFA 3M5LA 5CHAB 3BTWE 4ZHMU 2F9BH 2A0QB 5DP9A 5DP3A 3QWCH 4GAWA 2Y80A 1VGCC 1WTHD 2FTMA 4ASHA 1GPZA 1HXFH 1TBZH 2W26A 4I31A 1EFRD 1EAWA 1B5GH 2A7JA 4Y8XA 2BM2A 1TMUH 3SJIA 1TA2A 4AYVB 3BG8A 4TPYA 3LT3A 1T8NA 1BBRE 4UD9H 1ANDA 4XSKU 2BDYA 1GVLA 2Q1JA 5F8XA 2Q6DA 2ZHDA 2CF8H 4FUJA 1O3FA 5JB9S 4E05H 1DXPA 4MLFB 3BF6H 5E0JA 3MO3A 1EJMA 2J5UA 3P95A 1DUAA 1FY1A 1D3QB 2EY4C 4YOIA 1LPKB 3A8CA 1MCTA 2TGPZ 3PYHA 2P3TB 1GBHA 3R3GB 1GI7B 3DSOA 1O5BB 4X1NU 1HRTH 2STBE 2UWOA 1O3LA 1LTOA 3PWBA 4BTUB 1AB9B 1SHHB 3A88A 3UQVA 4WH6A 1H9IE 3RMLH 3GCOA 5CE1A 4OM9A 1Z8IB 1XVMA 2CF9H 3OX7U 3FP8E 1T8MA 2SFAA 3MNXA 1TPPA 3GCTG 3A7VA 1Z7KA 2FI4E 1TBQH 2STAE 4FU8A 1KXEA 2OUAA 1C5QA 5DP6A 1DICA 1BRUP 2BD5A 1GJ4H 3V3MA 3MH4A 3A86A 1EZSC 4CRFA 3H09A 1UHBB 4K69A 1OWDA 3T2NA 1X7AC 1AE8H 3LKWA 4JZEH 1W3CA 2HLDD 3OE7D 1D4PB 5EW1H 2BVXH 2FESH 5EJZA 4JZFH 4WJG2 2G55A 3SNEA 1XKBC 1GMCG 5FPYA 2O8WA 5EGMA 2A45B 3VXEH 1E1QD 3EYDA 2ZDVH 2KAIA 2BZAA 3HKJB 5C67A 2BXUH 3P17H 2DE9A 1PJPA 1EQ9A 4AN7A 1CE5A 3SJOA 1FV9A 1OOKB 3KCGH 4F48B 2FWWA 1YPJH 1GDQA 1BITA 1C5WB 1E35B 1F2SE 2WZQA 4A5TS 4B75A 1S82A 7LPRA 1EPTA 5G4BA 1GBFA 5BRRE 1Z1JA 1O2HA 1COWD 1GGDB 1JRTA 1LHGH 1A3BH 3LU9B 1FAKH 2Z9IA 2CHAC 3ATMA 4AYYB 4HI3A 3FOAA 1AVXA 2KCYA 1O34A 4IC5A 1IQMA 3T29A 2ZG0H 3C27B 1GI5A 3BEFB 2A4RA 1PPCE 4ZHAA 5HXFA 1CO7E 2OQ5A 2BXTH 3BIVH 3SV2H 1W0KD 3RLWH 4D7FA 4GLYA 2EA3A 1C5OH 1F5LA 4RSPA 5C3NA 3NUMA 4WWYA 8KME2 3DFJA 1KXFA 5T6DA 2VIVA 2HWLB 1G3DA 1ELAA 3DHKH 1GCTB 2RFKC 4WMDA 3P8GA 4H6SB 3P8FA 2QYIA 1UHBA 3RU4E 1VITG 1FIWA 3EA7A 3SU6A 3BTEE 5L2YH 2XBYA 1HYLA 4ABIA 6CHAC 1NRRH 2OC1A 1YCPK 2L74A 3OTJE 4O3TA 3VXFH 3UIRA 4CRAA 3VB3A 1LKBA 3I77A 1O2PA 1THRH 3F2HA 5LPFA 3TGIE 4J1YA 5JYIA 1P2KA 3M3VA 2B9LA 3ELAH 2AFQB 3SYJA 1KLJH 1OWEA 3V12A 1NM6A 4I8GA 1H8DH 1P05A 4NZQA 1CSOE 3F1SB 3ZYEA 3KQBA 1P9SA 4H42U 1WQVH 2C93B 1BTPA 1C1PA 3CNRA 2PTNA 3A84A 1RTLA 4I8KA 1CQQA 3ZZ4A 1V2VT 3E8LA 3HATH 4CR5A 3ZV8A 1YLCA 1V2TT 3RXMA 1EAXA 1O2UA 1O3AA 5EPYA 4CREA 2FOGA 2OD3B 2JDID 1LKAA 1HCGA 5A8ZA 1C2LA 3BV9B 1CT0E 3QTVH 3EGKH 1F5RA 1EZUC 1ELBA 2ZDKA 4KTCA 3U28C 1QGFA 1V2MT 2P3FH 3L3TA 1AZ8A 1Q3XA 3ZZCA 1DUEA 1FUJA 2QY0B 1OWHA 1YCPH 1HAXB 1GWAA 3MI4A 4ABHA 1DOJA 1OYTH 1MU6B 1EPTC 3E16B 4LK4A 4HTCH 2ZCKP 1O3JA 2CHAB 4INHA 3RXLA 2SNWA 1MD7A 2Y7XA 1EKBB 4ISOA 1GVZA 2Z9GA 5EQQA 1O3KA 4U30A 1O5CB 2ZDMA 4UFFH 3TH4H 2J38A 5C1XA 1MTNB 4O97A 2QXJA 4ABGA 4ZKOU 1AU8A 1SBWA 4ABFA 1SGPE 2YNAA 1N6XA 1CA0C 2XC5A 4D76A 1O2GH 2WINI 4H4FA 1O3HA 3SHAH 3S7HB 1LHEH 2V3HH 4Y8ZA 3UNRA 5EOKA 3LH3A 4AB8A 1IQLA 4BNRA 1WQSA 2F43B 1MZDA 2VGCB 5E2OA 1V2LT 1C4V2 3SU2A 1SGQE 3S69A 3EAJA 3SGBE 2PWXA 1C1SA 1S85A 1GMCF 1P09A 1T7CA 1JWTA 1EZQA 3QTOH 3QX5H 2RCEA 2GVFA 1QA7A 2OQUA 3MFJA 1DWDH 2BLWA 4WXVA 1Z1IA 1C2MA 2G5VA 2FS8A 3BSQA 4CRBA 4AOQA 1VKYA 1CU1A 3ZZ8A 1QJ1B 1SGEE 1DE7H 1DT2A 1ESTA 3T28A 2ZECA 1LVOA 2OC8A 2ZHQH 1FAXA 3ATIA 1PQ5A 3EE7A 3FAOA 1MAYA 1GJ5H 3HK6B 4K60A 4A92A 1AUJA 5GIBA 2FOMB 1SHYA 2Z94A 1LPGB 3U98H 4BAKB 4F55A 3TH3H 3PO1C 3KF2A 2ZFRH 3Q3KA 1GJ8B 4D9QA 1PQAA 1TPAE 2LNCA 1GBCA 4FVDA 2Z3EA 2YMSB 1LDTT 4MPWA 3OY5U 1SFIA 3KQDA 2GGVB 2Z9LA 3K65B 1QBVH 1DLKB 3F9FA 1ANBA 3LDXH 5DK1A 1ELDE 3GCTF 3F2GA 2BDIA 3G01A 5IK2D 5F6MA 3LJJA 1AVGH 2WHXA 1G2MA 1NPMA 3TK9A 1GHAG 5DP5A 1QRZA 2IPQX 5HIZA 5A0BA 3VB4A 3TVJB 1BTYA 3KYGA 1HFDA 1MD8A 2PHBA 2ZU2A 2A2QH 5JBCS 1GHVH 1BBRH 4ABBA 3LIWA 4YXWD 2J2UA 1HAIH 3OYPA 1Y3WA 3RC4A 3VG8A 2JH5D 4DVAU 5C2ZA 2CXVA 1E1RD 1QL9A 2QAAA 2IPHA 5GCHF 2VIPA 1EPTB 3GCHB 3RXQA 2FX6A 4ZMAH 2D26C 1TNIA 1ZGIA 2ZNKH 2HNTE 3QUMP 1A5IA 1TAWA 4OS7A 3SU4A 2FOEA 1OWKA 2O8UA 1BTWA 4NA9H 3SNBA 2PUXB 2G5NA 2BVRH 3EA8A 1ESAA 1H8HD 1L1NA 2SGQE 4K5ZA 4KELA 2GTBA 2NU3E 1C4U2 1SG8B 3PROA 1H8ED 1A2CH 3VFEA 1DWEH 1W2KH 2ESTE 1YPMH 4ISHH 5DGJA 2AGGX 2YMSD 2HALA 1V2OT 3CP7A 1GVKB 1N6YA 5EG4A 1QL7A 3FKSD 4KTSA 4U01A 2WV9A 1V2QT 4AGKA 1FJSA 1O3CA 4X8VH 2W3IA 1H8IH 5JPMH 1MCVA 1YPHC 4FUBA 4DG4A 3ODDA 1O2ZA 3NK8A 1HNEE 2FEQH 2A31A 4I8JA 3T25A 1SI5H 2HLCA 4YZUA 1VJ9U 3IITA 1G30B 1HPGA 9LPRA 1FY8E 4RN6A 1D6RA 2G00A 4NCYA 1CGHA 1MZAA 1OX1A 2CV3A 1VITF 1EUFA 3GDSA 1NRPH 1UW7A 1SGFG 1A5HA 3VB6A 1C2IA 1RIWB 1AFEH 1QB1A 1N8OB 4U32A 4ABAA 2IN2A 2GKVE 3E90B 3RXJA 1FIZA 2BTCE 1HIAB 4X1RU 1A0LA 3RM0H 2YMSC 2XWBI 3A7XA 1SSXA 1PPZA 1M9UA 1WDIA 7KMEH 2OC0A 2BDAA 2BY5X 3TGKE 4ABJA 3NCLA 4WY3A 5J4SA 1DWBH 3SOSA 3WWFA 1T8LA 5CMXH 1XKAC 1PPEE 3JZ1B 1DY8A 4WMEA 2ZTXA 1PPFE 3ENSB 3PB1E 1BZXE 4Y76A 3QDZB 3U1JB 1W0ZU 2NU2E 3D65E 2GV6A 1CT4E 2C4FH 1P2IA 1F7ZA 4THNH 1O36A 2ZPQA 2GX4A 3U69H 3SZEA 4D9RA 4MDSA 1GJDB 1RTKA 1SLXB 1Y3YA 1ZGVA 4RI0A 7GCHG 3FO8D 2C8XB 2GMTB 1ZPBA 4YLUA 3T27A 3LOXA 2XW9A 2QV1A 4Y10E 1O3MA 4XE4A 3PMBB 1FQ3A 5CHBA 1TPOA 1P9UA 4FUCA 1BRBE 4BAOB 2UUYA 1DVAH 1A5GH 1FI8A 2OBQA 2BD4A 3PRBA 1J9CH 3TGJE 1HAVA 4E7NA 2SGFE 1JIMA 2VU8E 4NIWA 2FX4A 3MH6A 4K8BA 1QBOA 1GHXH 3LGWA 3MH7A 1AFQB 1THPB 4MPXA 2QF4A 4B2AA 3WW7A 1C1OA
chains in the Genus database with same CATH topology
4GVUA 4X8UH 2AEIH 3GCNA 2PKSB 4Y7BA 1SL3A 8LPRA 3PWCA 4X2VA 2F9NA 1Y8TA 1BQYA 1O3OA 1HAOH 2XRCA 1QNJA 5C20A 3SJKA 2RDLA 1XXDA 2Z6BD 1K2I1 6CHAB 2C8YB 1HAGE 5A8YA 2BMGB 2V3OH 3UR6A 3URCA 1GG6C 3RDZA 4GCHF 1UVOA 3VGCB 1L1GA 2XWAA 1E37B 2BX3A 1FY3A 2H2ZA 4X2YA 1ZSJA 3ZZ6A 3ZZ5A 5L6NH 1W12U 1FY4A 1KXBA 1P04A 1UTMA 3ESTA 1YYY1 2TPIZ 1W0YH 1ZMNA 5FX6A 4IN1A 5F8TA 3SUGA 1HAYB 1QBNA 1ETSH 1TX6A 1EAUA 1C5NH 1GI6A 1TABE 2O8MA 1OYQA 1K1JA 3T26A 3GICB 4FVBA 1ELCA 2ZEBA 4AB9A 2GZ7A 4UFDH 4XOJA 1AI8H 3ATKA 3BTQE 2BD2A 3UNSA 4DGJA 3AAVA 3F9EA 2A4OA 1Z8GA 4IS5A 1SGFA 2BZ6H 2QF0A 4X8TH 3RU4D 1XXFA 2V6NA 4ABDA 3VGCC 2VH6A 4OS5A 1Z8JB 3RXDA 5H4IB 3STJA 1GMDG 2GP9B 3EA9A 1YBWA 5C1UA 5A09A 7ESTE 3EDXB 2CMYA 2A7HA 3N7OA 1DSUA 8GCHF 4OGXA 1FPCH 4Q7XA 3BG4C 2ZGXH 5T6FA 1G37A 2ZWLH 3E0PB 1V2RT 1DANH 1S0QA 1EASA 6LPRA 2BY6X 4YOJA 1C5SA 1H4WA 1XUJA 1AD8H 2SGDE 2R2MB 3RXTA 3A80A 1O5FH 2B7DH 2WPLS 3H7OA 4X1PU 5TJXA 4MTBA 3S9AA 1AKSA 1GI3A 1NS3A 1A61H 1QY6A 1GBKA 2J92A 4B74A 1RIWC 1OP8A 3LPRA 1UTLM 4MNVA 4D7GA 3MU5A 2IOTA 1QRWA 1RD3B 1K9OE 4I7YH 3UY9A 5DP8A 1TOMH 1QRXA 2JETC 5CHAC 4IMQA 2ZGJA 3BTDE 1GHZA 2P94A 4IN2A 4D8NA 5AF9H 1SLWB 1P57B 2PUQH 1P3CA 5FBEA 1C1WH 3MHWU 1RRKA 1ZMJA 3PMHB 4X6PA 3PLPA 1GDNA 1O2MA 1FN6A 2GV7A 1C5YB 1P03A 1SR5C 4I8LA 5E0GA 1TRMA 1ESBA 2C8WB 5L2ZH 5DKMA 1S83A 1BHXB 1XUHA 1GHBG 1VZQH 1KDQB 1Z8RA 1H9HE 1O2QA 5JBTA 5C1YA 5DJ7A 3FZZA 3UUZA 2D8WA 1SQAA 6GCHG 5DPAA 3FFGA 3SI3H 1FDPA 1FXYA 1IOEA 2P16A 3SU3A 4X6OA 1MUEB 1G36A 5GJ4B 3RXGA 2GDEH 2ZDAH 2F9UA 3I78A 4ZUHA 1IQGA 5ESBA 2KAIB 4ISLA 1NROH 1P2QA 1GI8B 3ZYDA 1ZMLA 2XTTB 4NA8A 4MNXA 2XBVA 3LC3A 2G4UA 4E06H 1Y3XA 4YTAA 5E0HA 2A5KA 4M7GA 1AFQC 1YP9A 3QK1A 1ARCA 3KGPA 4UONA 2AIPA 2BD8A 1T32A 4IBLH 4CH2B 2O8LA 2FZZA 1EJAA 2ANYA 1GHAF 4R8TB 4CRCA 3Q77A 2W7UA 2PKAB 2F9VA 1ZJKA 2ZF0H 2OCVB 3MOCA 4AX9H 1DWCH 1Y5UT 1KTTB 1TGSZ 3GDUA 1QIXB 3M36A 3FZDA 5L30H 4I8HA 2AYWA 1O0DH 2HRVA 2J9NA 2BD7A 2QGRA 1UTPA 5FPTA 1BIOA 1AQ7A 2ZGHA 1C1RA 3RXHA 1YPGH 1B7XB 1K1IA 3F9GA 1G3CA 4X2XA 1GMHG 2ZGBH 1P01A 3K6ZA 3A7TA 2GCTB 1PPGE 1MTSA 3RMOH 3V7TA 2FYQA 1O2LA 3GY4A 3Q3YA 1YGCH 1K28D 4B2CA 1AZZA 1A4WH 2SGAA 1W7GH 1GI9B 4AFQA 4NSYA 2CN0H 1RS0A 4OGYA 4R0IA 1YPEH 4AG2A 4YT7H 1C2HA 1J15A 1BTUA 1G3EA 1ZR0A 3MU4A 3EBNA 2ZHWH 1D3DB 2OC7A 2RA0A 5T6GA 1K1LA 2TGAA 1WAYB 4Q7ZA 1N1LA 1AN1E 1GL1A 1O37A 4AORA 1ZTLA 4Z6AH 1LVBA 1SOTA 1BMAA 4UE7H 1C2FA 1MAXA 4FU9A 4ZROA 3SV9A 2G4TA 1W13U 5PTPA 3U9AH 5J4QA 5HMAA 1MKXH 2QF3A 2TRMA 1SLUB 1V2PT 3U8RH 1GL0E 4VGCB 1O2JA 3MU1A 3TH2H 2CJIA 3A8AA 1S6FA 1XX9A 2FDAA 3A7YA 1BMNH 2BD3A 3M7QA 1YLDA 1UTNA 4K8YA 3LGUA 3ZVFA 2ZO3H 1HLTH 3SW2B 3AAUA 1RJXB 4YOGA 1NN6A 3GYMA 3MO9A 4X0WU 1GJAB 1AB9C 3QZQA 5JB8S 3GY2A 1TNKA 1G32B 1HJAC 1AY6H 2GCHF 4TY7A 5IDKA 1Z6JH 4A1VA 2EC9H 3UR9A 1CGIE 1QB9A 3RXRA 4BOHA 1TOCB 3RXUA 4IGDA 1HAPH 1GMDF 1P0SH 1WYKA 2BB4A 2FI3E 2K1QA 3D62A 3BTTE 3QO6A 3UOUA 1TGNA 3GISB 2ZFPH 3QLPH 3DT0H 3O8DA 4ZKNU 2Y5HA 5GCHG 2FPZA 1UVTH 2BLOA 2OP9A 1PQ7A 5A0CA 3GDVA 2ZCLP 2VH0A 2AMDA 5FBIA 1TX7A 4CH8B 2TBSA 4YT6H 2P95A 1MKXK 5F8ZA 1A46H 1O3NA 1YPLH 2QIQA 2W7SA 3MYWA 2I6SA 1OSSA 4YLQH 3UOPA 1BRCE 2UWPA 2A5IA 4TWYA 1OP0A 1GBIA 5K7RA 2ZU5A 4Y11E 2WPMS 2ULLA 4GCHG 1CA0B 2WYGA 1KTSB 3MTYA 3ZZ9A 4DCDA 1V2WT 3UWJH 2VIOA 4JZIA 5AHGH 4NFEA 1CHOF 3ZVGA 1KYNA 4BTIB 1S6HA 3TJVA 1G9IE 1KIGH 1SGDE 1HIAA 1SGYE 3BTHE 2P93A 2P3UB 3RXVA 2A4GA 4ISNA 1C9TA 2GCTC 3PV4A 3E0NB 3M7UA 1MBQA 1ZLRA 4JK5A 1FPHH 4AGJA 1THSH 1O5DH 3BTGE 1SGIB 1IQFA 2BY9X 3DFLA 3GOVB 2V35A 3MU0A 3SV7A 1MTUA 2BQ6B 3URDA 3GY5A 1CBWB 1C5UA 5EPNA 3SBKA 3M37A 3M5NA 3SQHE 4U2WA 2G51A 1YPHE 1K22H 3LGTA 1DXWA 3F68H 4K1EA 3ZZ7A 4AZ2B 3TJNA 4OS6A 5B6OA 3BG4B 1TGCA 1C9PA 2VJ1A 2F9OA 1DPOA 1WUNH 2Y81A 4CRGA 1WCZA 2O9QA 2VWNA 1YCPM 1BJVA 4NG9H 1BHXF 2D1JA 4NFFA 1T8OA 4X2WA 3B23B 1S0RA 1GDUA 2C3SA 1C5VA 4K2YA 1QFKH 3NPSA 1P3EA 1GBAA 1C5XB 2EEKA 1Y5BT 2AS9A 3Q3XA 4RKOB 3ZZAA 1BMMH 1UO6A 4NWLA 3EE0B 2R3YA 4E7RG 1QA0A 1HBTH 4I33A 4BXWA 3VB5A 1EAIA 1BT7A 3JZ2B 1GJCB 2QA9E 3A81A 1XUIA 1HJ9A 2BLQA 3SQEE 3UQOA 2BX4A 5I46H 5FHTA 4UEHH 4K1SA 3KIDU 5EQRA 4BAMB 1O3GA 3RLYH 3P6ZB 3L33A 1O39A 1ELVA 1NFWA 1ZHPA 1TWXB 3ATWA 2YNBA 1L2EA 1TB6H 4PROA 4WXIA 1DX5M 1LMWB 1AGJA 1ZJDA 2R2WU 2H5CA 1V3XA 1EP5A 1AWFH 1EOLA 1P2NA 3V13A 2F91A 5C5NA 2BDCA 5ESTE 3O8BA 1EB2A 3RXKA 3A7ZA 3LGVA 1C5ZB 2ZCHP 3GY3A 2VIWA 2H9HA 1HB0B 3I29A 1QJ6B 5FCRA 3TK5A 3SNCA 2BDGA 5LPRA 2XBXA 4Q80A 1IQKA 1FY5A 4NIYA 4BAHB 2A1DB 3M5OA 1V2JT 3UREA 1N8OC 2BQ7B 1AWHB 1C5TA 3M3TA 3ZVBA 5AVDA 4DOQA 4AFSA 1ZYOA 1KXDA 3OY6U 1ELEE 1UTQA 3SGQE 4X6NA 3AASA 4GHTA 4IW4E 2QCYA 4YESB 1DFPA 2ZU3A 2XYAA 1P2MA 2DE8A 5GPIB 2HOBA 1HAVB 3H7TA 4GHQA 1LQDB 4DJZB 3M35A 3E6PH 1SPJA 4TPIZ 3PMAB 1JXPA 2PFEA 3K9XB 3ZZBA 5EQSA 4YO9A 2FIRH 1PYTD 2LIZA 3ZV9A 1FN8A 1JRSA 4DIHH 4BTTB 3DA9B 3UTUH 1ZPCA 1UCYK 3U8TH 1IHTH 4CRDA 1MKWK 3P8NA 2FOBA 1F0RA 1TGTA 4FUGA 1DY9A 2FS9A 1UK3A 1Y3UA 5DP4A 3UPEA 4CBNA 1GBLA 2Y5FA 2OTVA 1KLTA 2PSYA 3QN7A 1AMHA 3KL6A 1E36B 1W10U 3KHVA 4NIXA 2QC2A 3A87A 1MTNC 4MPUA 1K1NA 1NFYA 1H1BA 1K1OA 3RMMH 4I32A 1JIRA 3A7WA 5JDUB 2ANWA 3TIUA 1SB1H 2BY8X 2FLBH 2ZDLA 4JZDH 1GHBF 4OS4A 3STIA 3Q00A 1D9IA 1CGJE 1ZTKA 4NIVA 3W95A 1GBBA 2ODQA 3KN2A 5FCKA 4NWKA 1O2TA 1MTVA 1ZHRA 3F6UH 1GBJA 1B0FA 2XNIA 1UMAH 1ZSKA 2AH4X 3ZVEA 2A32A 4JZ1A 4O03A 1TX8A 5DO4H 3RXEA 1O2VA 1F0UA 2W5EA 1UTKA 2BHGA 2Q6GA 2XBWA 1W11U 1C2EA 3A8DA 2G81E 1MBMA 1TONA 5E2PA 4INLA 2R3UA 4FXGH 1AHTH 1TRYA 2ZFFH 4X1QU 2FMJA 4A7IB 1C4Y2 9ESTA 2BVSH 4KGAA 4ZKSU 4MNYA 1O2OA 1TYNA 2BY7X 1AIXH 1TMBH 1OWJA 1PQ8A 1ZOMA 2BDBA 2R0KA 2OXSA 2ZGCA 1QHRB 2J95A 1P10A 3TJOA 1BTZA 4NGAH 1O2IA 3GY6A 1KDQA 4YM9A 1ZRKA 1ZTJA 1P12E 1Y3VA 4SGBE 1XUKA 3RXBA 2EI8A 3VB7A 1P11E 3BTME 1UCYE 4Y0YE 1L1JA 3GY7A 3LH1A 1RTFB 2Z3CA 1WBGB 2ZZUH 1ABIH 5HM9A 4JK6A 2UUJB 5LGOA 5EU8A 1PFXC 1UVUH 1YPKH 3DD2H 1EP6A 2WPIS 1Q31A 1EJNA 1O2XA 3B8JA 3PO1B 1ABJH 1OP2A 5E8EH 3HKIB 4WMFA 2UWLA 1IQNA 1GBDA 1ZRBA 2NWNA 4GSOA 3SO3A 3GCHC 3M3SA 2TGTA 1L4ZA 1O2RA 5TCCA 3PTNA 1NU9A 2FYRA 3B9FH 2B5TB 1DITH 2AGEX 1C2GA 1C2JA 5IYTA 3E1XB 2H9TH 4KP0A 4Y6DA 4B2BA 4JYTA 1ANEA 2QXIA 2VWLA 1MQ5A 1ZZZA 2ILNA 3R0FA 3ATLA 5EXNA 4ZHLU 2Z3DA 1P06A 1ETRH 1VJAU 1O3DA 3BEIB 1F5KU 3D23A 1P8VC 1SGNE 1VGCB 4KKDA 3LGIA 5C5OA 1BB0B 1Q2WA 1J14A 2BDHA 2OLGA 2CGAA 2HPPH 4RKJB 1G3BA 4ZXXH 2JH0D 1O38A 4HFPB 1TMTH 2H1UA 3PLKA 3HK3B 3SNDA 1FMGA 1P02A 1DSTA 4ZKRU 3SU1A 2VVVA 1YF4A 1JOUB 1C1UH 2C90B 4MG3A 5FX5A 5EXLA 4WVPE 1TNLA 1W14U 4Y8YA 5A2MH 1QURH 1DM4B 1C1NA 3MNBA 2LPRA 1O2SA 1HJ8A 3RU4T 2H9EH 1OKXA 1MMJN 2Z7FE 1RFNA 2ZKSA 5ABWA 1O35A 2Z9JA 2WV5A 4A6LA 1SC8U 1VCQA 5K0HA 2JKHA 1IQEA 3DUXH 4ABEA 3FVFB 3MMGA 2GD4B 1C2KA 5A0AE 1XUGA 1TNGA 4UFEH 4Y79A 2J34A 1WU1A 2M5TA 3C1KA 3OU0A 5FAHA 2B0FA 2R9PA 4NZLA 5LPEA 2G52A 2AMPA 4TY6A 1LHCH 1HDTH 1SGTA 2ZTYA 3SORA 3SN8A 3S9CA 1TQ7B 2F83A 8ESTE 3T5FH 3RUOA 3MU8A 1NU7B 2PGQB 3OSYA 4NSVA 1LQEA 4TWWA 1WOFA 1BA8B 1WTGH 2PKSC 4HZHA 1TIOA 1A3EH 3PTBA 1XMNB 2H6MA 2W3KA 1UCYH 3RXCA 1UTOA 5SGAE 1U6QA 1SLVB 5LH8A 3MWIU 3E3TA 1MKWH 3TNTA 1KXCA 8GCHG 1RGQA 4MPVA 2J94A 2ZA5A 3E91A 1C5LH 1E38B 4SGAE 3A8BA 1BDAA 1C1QA 1V2ST 2BYAX 2EI7A 1MTWA 2YOLA 2BQWB 4UFGH 1INCA 1OXGA 2JH6D 2SGPE 1AUTC 1IHSH 3IWMA 2WV4A 3A85A 2ALVA 1HAZB 2Q6FA 4DIIH 3ZVDA 4GUXA 1LHDH 1NY22 3ZZ3A 2WPJS 1C1TA 3AW1A 1WSSH 3K2UA 1SQOA 1ELTA 4GPGA 1O3IA 3M61U 2GZ9A 3UWIA 2NU1E 1O30A 1P2JA 4X6MA 3P92A 3IG6B 2ODPA 1F92A 1GCDA 3SHCH 1L4DA 2GT7A 1A0HB 1ETTH 2NU0E 4VGCC 1T4UH 4Y7AA 3HGPA 1LCYA 2PSXA 2FM2A 2UUKB 1NFXA 1E34B 1ACBE 2ZPRA 2XC0A 1GI1A 1HXEH 3CS0A 3SU0A 4DY7B 1C1VH 3TLOA 2Y82A 2TGDA 2VB0A 2FP7B 1EXFA 3QGNB 3TPIZ 2ZDNA 1AO5A 2PGBB 1GJBB 5GWZA 2XCFA 4MNWA 4MQAA 5I25A 4FUHA 1AVWA 1MQ6A 3U8OH 1QB6A 3Q76A 2HNTC 2BOKA 1EZXC 3RC5A 4ZAEA 3PLBA 4LOYH 1GG6B 1J16A 4XBBA 1IAUA 3CS7A 3RC6A 2ZPSA 1GJ6A 1ZSLA