3SNDA

Crystal structure of sars coronavirus main protease complexed with ac-estlq-h (cocrystallization)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptide aldehyde inhibitors challenge the substrate specificity of the SARS-coronavirus main protease.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
total genus 88
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3sndA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sndA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sndA02
2ZGHA 1FN8A 3UPEA 4YM9A 1ELBA 6CHAB 2QGRA 4FU8A 2VVCA 1OKXA 1YPHE 3TK6A 1G30B 2CGAA 1LVOA 1TOMH 3BG4B 2F9UA 2ZPRA 3MH7A 4OS4A 1S0RA 2TBSA 4B1TA 5FBIA 2FXRA 3TNSA 1P09A 3ATWA 3PROA 5LGOA 1QB6A 1D9IA 2ANWA 4H4FA 2R2WU 1Z6EA 1AFQC 5ETXA 1C1NA 2A7HA 2GZ9A 4ABBA 3TH4H 4ZKOU 2THFB 2W26A 2C8XB 4NA9H 1TRNA 1W2KH 1VITF 1LDTT 2WPLS 1GCTB 2R0KA 2HNTE 1FV9A 2IJOB 3TK5A 1XKBC 3QZQA 3BEUA 4I32A 2FOEA 2ZCKP 5C3NA 3M7TA 3P95A 3UWJH 1S85A 2YNBA 1PJPA 3BTEE 1GBKA 1CHOG 1SBWA 1F2SE 1D4PB 1G2LA 1DWEH 3I29A 1SC8U 3DHKH 4AB9A 3SNCA 1GJAB 4AORA 1S5SA 1EUFA 1HJ9A 3NUMA 5CMXH 5TCAA 1Y3VA 1YLCA 2ANMH 2GDEH 1C4U2 5AF9H 1NZQH 3A8DA 5EGMA 2C4FH 3RXPA 4X2YA 4X6MA 2BXUH 4JZEH 3SUFA 2OQ5A 1VCQA 4TPYA 1SHYA 1H9IE 5IDKA 4ZUHA 1CQQA 1SMFE 1VITG 3PM3A 4Y6DA 4I8KA 2QN5T 1UK3A 1YPEH 2G5VA 2V0BA 1MTVA 1P3EA 1RTKA 3ATKA 2H5CA 3MNXA 3KHVA 2Z9JA 2ZO3H 4CRAA 4X1PU 4TY6A 5DP7A 1P01A 2IN2A 5DP3A 2R2MB 1SQAA 5E0HA 3E90B 3M35A 1YPJH 3TLOA 4AYVB 2C93B 4Y0ZE 2QIQA 1KXDA 3O8CA 1RS0A 4UFGH 3SNEA 3GCTG 1K1IA 2TGPZ 1C1RA 1O3CA 1P04A 1HUTH 3MH4A 1GBDA 3D62A 2XTTB 2BX3A 1OWKA 1UCYE 2RA0A 2XXLA 4DT7B 3OX7U 3EA9A 3TGKE 1ZPZA 4CBNA 2F9NA 2OC1A 2A4RA 3A7VA 2Z9IA 5EW2H 1P2MA 2QY0B 1GHAF 1GDUA 5F03A 1SG8B 1BRBE 3ZVBA 1CVWH 1ZHMA 1PYTD 3LPRA 2Y82A 1YKTA 4H6TA 1O2IA 1ESAA 5FPSA 1VGCC 1DXPA 1KY9A 3KL6A 1O2ZA 1TA2A 2HLCA 3QN7A 3S9AA 5E8EH 1O2LA 3FFGA 3L6PA 3SBKA 1A1RA 1SGNE 1ZPBA 1MMJN 1NY22 2FOMB 1ZZZA 1BT7A 2WUCA 5DPAA 3E3TA 1TMBH 3O8DA 5A8XA 1C5MD 3EBNA 1RXPA 1RJXB 2P94A 1UTOA 5F8ZA 1VCWA 3SUDA 1HAGE 1TLDA 1NRSH 3SGBE 3SU1A 5DK1A 2GZ8A 1TB6H 1TGCA 6CHAC 1CBWC 1QRZA 5EU8A 1BTZA 3STJA 1O30A 1ELVA 4XSKU 2CF8H 3GCHB 1KLJH 1LKAA 1LHEH 3F68H 4DVAU 1EPTC 1HAPH 3BTME 1ZJKA 3TJNA 4NIWA 3MO6A 2J94A 2BVXH 4TPIZ 1LKBA 3L33A 8KME2 6GCHF 1GVZA 1LPKB 3EAJA 1CT2E 3GCOA 5E0JA 2FLBH 2BVRH 3TJVA 1C2FA 1KYNA 1S83A 1RTLA 1BDAA 4U30A 2BVSH 4Y8XA 2OXSA 4MTBA 3V13A 3EGKH 4DW2U 5E2OA 1W11U 1THSH 4NIYA 3BTWE 4Y76A 1DOJA 3FP6E 4B73A 2ZU5A 1THRH 2AMDA 1NC6A 2VIQA 3ZVDA 1NU9A 1UHBB 2Q1JA 5L2YH 1F0UA 4GCHF 1YBWA 3T29A 1AVWA 1P3CA 1DUAA 4CREA 3NZIA 5T6GA 1FPCH 1C2EA 2ZDMA 5EXLA 4NZLA 2FEQH 1GHBF 1V2TT 3M5LA 2JH5D 1P0SH 3M3TA 1CA8B 3Q77A 2XYAA 1TYNA 1KLIH 4FUIA 1QQUA 1O5CB 9ESTA 1GJ4H 4D8NA 2PKSB 2VVVA 4MPXA 1C5SA 1E0FD 3MU5A 3GICB 3U69H 4I7YH 1GI7B 3SZNA 5DGJA 3RXDA 1BRUP 2ZDNA 2GTBA 1DANH 1NRPH 3SUEA 1C5QA 1CGIE 1C5LH 3RXAA 1XUFA 1L1NA 1SGFG 1EJAA 3TJUA 4CHAB 2BY5X 3HATH 4XE4A 1MTUA 1T4UH 2BQ7B 1GPZA 3KGPA 2BLQA 3UFAA 4DURA 2Z6BD 1BRAA 3ESTA 1A61H 3MU4A 4MQAA 3ZZBA 3PWCA 4XFQA 1NRQH 2W5EA 1AMHA 1O3NA 3ZZ8A 1AVGH 2JETB 3A87A 2AMPA 1O2UA 2H5DA 1LHFH 5GCHG 2XC5A 1RIWB 2CF9H 1L0ZA 5FPTA 4GLYA 1D3PB 4A7IB 1O3KA 1ELGA 2WINI 4I8JA 4F4OC 1GBIA 3E0PB 3LGIA 3TNTA 2A45B 2BB4A 1TBQH 3MO3A 1GVKB 1P2QA 4BAQB 2Z94A 2XBVA 1G3DA 1F92A 1A46H 1BBRK 2A0QB 1IQKA 2ZWLH 2F83A 1FZZA 4ZKSU 3F9HA 1O2XA 3OYPA 3QGNB 4FUBA 3SQEE 3TH2H 2FDAA 1ZJDA 1E35B 3VXFH 2AYWA 1BJUA 1F0RA 4DOQA 4CRBA 5B6OA 3OU0A 1GHAG 4FUCA 1W7XH 1P2IA 2C8WB 3LGTA 2WPKS 1AI8H 3LU9B 1ANEA 3BSQA 4NSVA 1O3BA 3A88A 4AN7A 1P2KA 1U6QA 3RXFA 4CR9A 1P06A 1SI5H 5K7RA 3LONA 2BD8A 3LH3A 5FX6A 1HAVB 2O8UA 3M3SA 1NT1A 1TNJA 4K69A 1AIXH 2Y7XA 3EDXB 4E05H 4ESTE 1FMGA 1C5PA 1MZAA 4WMEA 1EB1H 4ZROA 3GCTF 2CMYA 1GMCG 1TGBA 1G3CA 1SPJA 1O2TA 4AOQA 1FLEE 3S9CA 1NROH 1T31A 2O8LA 1HLTH 1ETRH 2OBOA 4K2YA 2FI3E 1P9UA 3RXQA 2EA3A 2TPIZ 1BOQA 1GI5A 3QUMP 2A4GA 4BAKB 1OWIA 2SGAA 1A2CH 4B75A 1G32B 4RSPA 1WTHD 2XCNA 2C3SA 2K7XA 1SLWB 2V3OH 1BTPA 2Y81A 5F8XA 1FY4A 3LGYA 3RM0H 1GHWH 3UY9A 5A0AE 1WQSA 2ZG0H 4NA8A 2RCEA 4K8BA 1HAZB 4TWYA 4YT6H 2ZU4A 1BITA 1P2OA 4BTTB 1H9HE 1GHZA 2A2XH 3RLWH 1C1SA 2QXJA 2A32A 3A82A 1AUJA 4YO9A 4RKJB 1JRTA 2ZQ1A 1SGFA 1YPKH 4JMYA 2G4UA 4IC6A 3RXKA 8LPRA 7GCHG 3O8RA 2ZF0H 5JB9S 4XOJA 3RMNH 3BN9A 1CT4E 1IOEA 4K1EA 1MQ6A 1P02A 1IQNA 3N7OA 1MAYA 3E1XB 2XCFA 1RGQA 1O2PA 1KTSB 1GBEA 3ZZ5A 5GPIB 1FI8A 3LGUA 2JH0D 4IBLH 2WPJS 3D23A 5GJ4B 2GT8A 3KQEA 1O2JA 1Q3XA 1UTQA 3IWMA 1C1PA 3AW0A 3VB4A 1C2KA 2B7DH 2BY7X 1QGFA 2NU3E 2Y5FA 1V2JT 3SU4A 2ALVA 4I8LA 2SGPE 3VB7A 1YPLH 4UEHH 2O8WA 1ID5H 3QLPH 3A86A 3ZVGA 3FANA 1AB9B 1ESBA 1YF4A 3MI4A 2DE8A 2XWBI 3PYHA 1ABIH 4B71A 3CS0A 1O3LA 4JK6A 1KXAA 2BD4A 3UR9A 4AZ2B 2FOGA 1IQLA 1SGRE 3A7XA 1Y59T 1HAIH 1GHBG 1YYY1 5AHGH 1Q2WA 1SGIB 6GCHG 1ARCA 2FZZA 2BZAA 1GBLA 3RMMH 1NFUA 1OOKB 1EX3A 1IHTH 1OWHA 2ZFFH 3FAOA 1NFWA 2UWOA 1MH0A 3RM2H 1IQEA 1Q31A 4X1NU 1QRWA 2G55A 1VJ9U 1O2MA 1LHGH 4FU7A 2FOBA 2ZFTA 4BAMB 1MZDA 5CHAC 3OY6U 1QURH 3BTKE 1T8OA 1TPSA 2A1DB 5I25A 4JZDH 3TGJE 4AYYB 2P3UB 2FOAA 3SU5A 1AD8H 1OWEA 2ILNA 1BTYA 4YTAA 2C8ZB 3P92A 1PQ5A 1W0ZU 3AW1A 2IOTA 3M61U 5C1UA 1WUNH 1RFNA 1FXYA 1MU6B 3U9AH 7KMEH 1DY8A 1OXGA 1EASA 1UK4A 1SQTA 2J92A 4D7GA 5FHTA 1Y5AT 9LPRA 8GCHG 3LJOA 3E16B 4YZUA 2ZKSA 1HAVA 4MPUA 2OBQA 1A5HA 3KQBA 1Y3XA 1YCPM 1Z1JA 2EI6A 2G81E 4SGAE 4WH8A 2V3HH 2ZPSA 4UDWH 4HFPB 4JCNA 2SGEE 2SGDE 4IS5A 2W3IA 1D6RA 2EC9H 4BAHB 3B8JA 3DFJA 3EA8A 1DWDH 3VFEA 1V2LT 3KIDU 4HGCA 2AERH 2VIWA 2NU1E 1H1BA 2BDBA 4MG3A 1FY8E 1GJ8B 3MNSA 4KKDA 2WPIS 1V2QT 3C27B 1UCYK 1TPPA 2WPMS 3V0XA 4SGBE 2FOFA 4X8VH 4I8GA 1EAUA 1SSXA 2PGBB 1DXWA 2OCVB 1O3FA 2P95A 2PUXB 4NA7A 5T6FA 4CRFA 1EB2A 1F5LA 5LH8A 1XUGA 1GHVH 1MCTA 1RIWC 3PO1B 1PPEE 2VINA 3ODFA 5C67A 3UWIA 2XC0A 4MNXA 2AGIX 1TBRH 3UOUA 2H9EH 3SNBA 2P3FH 1O32A 3LKWA 1LQDB 1AUTC 5C20A 3K2UA 1N8OB 2WV4A 3RXMA 1QFKH 3BG4C 1FAKH 3R0FA 1UVOA 3PLBA 2HNTC 2BTCE 1VJAU 1BTUA 2BXTH 3EA7A 4ZKRU 1O2WA 1CA0C 1OP0A 1EZSC 4D9QA 1EQ9A 5C1YA 3MU1A 4D9RA 2ZCHP 1HJAC 4MLFB 3VXEH 3BTFE 1AN1E 1BMNH 1EP6A 1DLKB 3F9FA 3T26A 1GG6B 2PSYA 2D1JA 1EKBB 1FIWA 1GL1A 2R3UA 3A7TA 1W13U 4I8HA 1GHYH 1C4Y2 4U32A 2A7CA 3GY5A 2P93A 4Y10E 3RU4T 1BJVA 2PTCE 1OYQA 1GVLA 4O3TA 1Z8RA 3T62A 1AZ8A 3JZ2B 2LNCA 3LIWA 1UTPA 1GG6C 1GJ6A 1XVOA 2UUKB 2P3TB 1ZGIA 2F91A 1K1NA 3JZ1B 5F8TA 1QY6A 2HPQH 1BB0B 1ZYOA 4IMZA 4CRDA 1C2DA 1IQGA 1H8IH 1KDQA 2OC7A 2G4TA 4ABHA 3BTGE 1V2VT 1AWHB 1TNGA 1DE7H 2ZQ2A 5GWZA 5DJ7A 2QXIA 5BRRE 3K6ZA 3AVZA 1FPHH 1LPZB 5ESBA 4BTUB 3H5CB 4R0IA 3Q00A 5GCHF 2PKAB 4BNRA 1O2KA 1ZTKA 2FI5E 5ABWA 3T2NA 3STIA 4DGJA 2FOCA 6ESTA 2TGDA 1AKSA 1LPGB 4K3JA 3E6PH 1O2GH 1AKSB 4GHTA 1HYLA 1JBUH 1ANDA 3GDVA 1XUIA 2VVUA 1ZPCA 4ZHLU 1FDPA 1F0TA 1Z8IB 1IQFA 3MTYA 1O35A 4QT8C 5GXPA 1T8LA 2GCTB 2H2ZA 2Z3DA 1NRNH 3RC5A 1ETTH 1IQHA 1SOTA 1ELCA 2FWWA 1C2GA 3SUGA 3R3GB 5JDUB 3HKJB 4ZXXH 1P8VC 4UFDH 1CHGA 3NXPA 4H6SB 2F9OA 3ZZAA 5A8ZA 2ZFQH 1T7CA 4ABGA 1WV7H 3SU0A 5JBAS 1G9IE 2PSXA 4JZ1A 1VR1H 1TONA 1C1VH 4ABFA 1GMHG 1SLUB 4ABAA 2Y80A 2NU0E 1NESE 1O3JA 1FY5A 1GGDC 4OGXA 1DSUA 3SGQE 1WAYB 3GYMA 4GPGA 4FU9A 1K22H 3RXGA 4ABEA 3S0NA 2VB0A 5EQSA 3KNXA 1TRMA 1SGTA 3ENSB 1UVPA 1K1OA 3LC5A 6LPRA 3RXHA 5CHAB 1BQYA 1W7GH 1C5XB 1V2OT 1QBVH 2V6NA 1C5WB 3RLYH 3GY4A 3NKKA 1HAXB 1L4ZA 3SGAE 4FXGH 3RXEA 2A5IA 1UHBA 1XVMA 2B8OH 2QA9E 4UD9H 1O0DH 1DPOA 1K28D 5JB8S 1EAWA 1ESTA 2XBYA 1KLTA 4AFQA 1JXPA 4GAWA 4TYDA 2GD4B 3M36A 1JIMA 1ZHPA 2HPPH 3K9XB 1GBMA 2R0LA 2VNTA 3MNBA 1GGDB 1YCPH 3PTBA 2BDCA 1BIOA 2Y5GA 4BOHA 1EZXC 1TNKA 1O5BB 2STAE 5A09A 4KGAA 3V3MA 3NWUA 4AGKA 2NWNA 4JYVH 1K9OE 3V7TA 4AG1A 2BOHB 1ORFA 4M7GA 2CV3A 1KXCA 4NIVA 4MPVA 3RXUA 5A0BA 3T5FH 3VGCC 4K1TA 1SGEE 3U8TH 2Z9GA 3SI3H 5DP5A 1GBCA 2FS9A 3V12A 2OP9A 2I6QA 1QL7A 2V35A 1SB1H 3S69A 1C1QA 3KQCA 1MBQA 2P8OB 1TGSZ 3SJIA 4DJZB 3HKIB 1HAOH 1O2HA 3MYWA 1V2WT 3F1SB 5TJXA 1LMWB 3KN2A 4FUDA 1W0YH 2FOHA 2O8TA 4XBCA 4ZMAH 4Y8YA 1O39A 3EE0B 2XBWA 3MNCA 1C1WH 1F0SA 5EOKA 4NCYA 3W94A 2GP9B 2A5KA 1P9SA 1AWFH 1ZMLA 3A84A 1C5ZB 2QCYA 1P12E 1W14U 5JYIA 3A8AA 1CHOF 1SGQE 3TJOA 4ZKNU 3Q3YA 1O5DH 1DICA 3S9BA 3A85A 4XDEA 5L30H 2BY6X 2VGCC 3HPTB 3ATMA 5E2PA 1GBTA 4NSYA 2QXGA 2BYAX 1WYKA 2WYJA 2J38A 2TIOA 1V6DA 1J15A 4RN6A 1ZSJA 2A4QA 2ZC9H 3RXVA 1O3HA 2J9NA 1SOZA 4LOYH 1O33A 1MD8A 1TOCB 2H6MA 1QBOA 1W10U 1MUEB 3I77A 3SHCH 3Q76A 4YOIA 1A3EH 1HIAA 2VIOA 1O31A 2QF0A 4TY7A 3RMLH 4BTIB 2F3CE 1ZGVA 1FJSA 4GHQA 2G00A 3A7ZA 1HJ8A 4AG2A 5JBCS 2OQUA 1QHRB 3BIUH 4ABDA 1TX6A 4CBOA 4JZFH 4BANB 1AGJA 1OP2A 3ITIA 1GJ9B 1HJAB 3NK8A 1B0FA 1MD7A 1ZTLA 3MU0A 3SW2B 3UTUH 3UOPA 1GBAA 2QC2A 1ZSLA 3MU8A 4X6PA 2ANYA 1TA6A 1C1OA 2VH0A 1HB0B 1B5GH 2W7SA 1SLXB 1UTNA 3ZZ6A 1MCVA 1G36A 1NTPA 2A4OA 3P17H 2PHBA 2YOLA 3SNAA 4Y7BA 1J8AA 2EI8A 2I6SA 1V2KT 1QCPA 1GI0A 1LHCH 3HGNA 1Z1IA 3QTVH 2BDAA 3ZVEA 3T25A 1V2NT 2BD7A 4K1SA 1F5RA 2HVXA 5DP9A 1AQ7A 2SGQE 3QZRA 1GMDG 2BDIA 2EEKA 3ZZDA 1C1TA 3BTDE 2GCTC 5C2ZA 3PO1C 2BY8X 3T28A 1P2JA 4INHA 4LZ1H 2Q6DA 1O3GA 2TGAA 1FIZA 2XC4A 3A7YA 3SJKA 4A6LA 3PMBB 2GZ7A 3ZV8A 1GBJA 3LH1A 2TRMA 4FVDA 1HCGA 4FUEA 4Z6AH 2RDLA 2ZHWH 2VWLA 1KDQB 2BDGA 3CS7A 4ISOA 3MWIU 1EOLA 1ZMNA 1C1MA 2YNAA 1SR5C 3VGCB 3U8OH 4NGAH 4MNWA 4K60A 2C8YB 1TGTA 1XM1A 2WPHS 4CHAC 1OPHB 1MKXK 4UE7H 2AIQA 1SGCA 2GDDA 5CE1A 1DY9A 1PQ7A 2ZTXA 1UVUH 2VIDA 3URDA 3ZVFA 1D6WA 1LVMA 3RC6A 1GI2A 3S7KB 1PYTC 1X7AC 3GY7A 2FESH 1GMCF 5HYOA 2FTLE 3QGJA 2OUAA 3KEEA 1BMAA 1NS3A 4F49A 2XBXA 3UNSA 4ABJA 1DWBH 4U2WA 3GOVB 3ATIA 3AASA 3SI4H 2D2DA 2ZHDA 2BM2A 5HMAA 3SJ9A 1WTGH 1OWDA 2BQWB 4ZHAA 2GVFA 5T6DA 2C90B 4JZIA 2PGQB 1WQVH 2HGTH 1UTLM 5EQQA 3BTHE 3ATLA 4IMQA 1K1LA 4R8TB 1A5IA 3ZYEA 3IG6B 1H8DH 4UONA 1HNEE 1LTOA 1LQEA 3SN8A 4Y11E 4O97A 4D7FA 2BLWA 3CP7A 2K1QA 1EZQA 1O38A 3AAVA 4WH6A 7LPRA 2PWXA 1MTSA 3SOSA 5JBTA 1LVYA 5FX5A 1C2MA 1C2HA 2HRVA 2PLXA 3BTQE 1IQMA 4LZ4B 2P8OC 2BMGB 4Y71A 1A0HB 1DS2E 1HXFH 2KAIA 1NM6A 4VGCC 4KTCA 2Q6GA 1AE5A 2ZU1A 1XUKA 4A5TS 4Q2KA 1MKXH 1C1UH 1PPFE 1NU7B 1KXEA 1Z7KA 1JWTA 2ZTYA 3Q3KA 1P57B 3LJJA 1Z6JH 1FUJA 3DA9B 4LK4A 1C4V2 1BZXE 2ZGJA 2AMQA 2QV1A 4ZAEA 2ZECA 3B9FH 4YLQH 4DG4A 2ZDAH 3A8BA 5FCKA 1GDQA 1MKWH 3HK6B 1UTJA 4Y0YE 2CHAC 2A7JA 2NU2E 2UUJB 1A5GH 5DKMA 2PKAA 4DIIH 2PV9B 5GDSH 4WXIA 3EYDA 2BHGA 1CSOE 2HWLB 4CRGA 5A0CA 4JYTA 1FNIA 4HZHA 3RXBA 3GYLB 1F5KU 1ACBE 4I31A 2F9VA 1Y3YA 1S6FA 1EAIA 1PPBH 2ZU2A 2D26C 1W8BH 3RXJA 1IHSH 1GHXH 1WSSH 3SJ8A 2OC8A 3VB5A 1HAHH 1A0JA 1B0EA 1BHXF 2PFEA 2VIPA 1HRTH 1UMAH 3RXOA 1C5RA 2ODQA 3A83A 4ISNA 2SNVA 1RD3B 1AY6H 3SJOA 3KCGH 1SVPA 2QAAA 4FUFA 1NO9H 4O3UA 1GMHF 1JIRA 1Y5UT 1HBTH 1O3PB 1T8MA 2ASUB 1TPAE 3SORA 3TU7H 3SV6A 1HXEH 4MDSA 1G3BA 4NG9H 1MKWK 1MTWA 3GCHC 1BTXA 1C5VA 1LVBA 4X2XA 2OLGA 3UQOA 3T27A 1AFEH 1O2SA 1INCA 1YP9A 2H9TH 2ZEBA 3PV4A 2ESTE 4X8UH 1TPOA 1SLVB 1VZQH 1RTFB 1V2PT 3ZYDA 3PTNA 1TE0A 5L2ZH 1EATA 4ASHA 1ANCA 1GBHA 1FY1A 2ZFPH 3PWBA 2TGTA 3RC4A 3TPIZ 4KP0A 3BG8A 4XBDA 1QA7A 2ANKH 1V2RT 3P6ZB 4NWLA 4ZXYH 1TX7A 1EOJA 1GI3A 1T4VH 2A5AA 2M5TA 4YOJA 2W7UA 3S7HB 2FLRH 2RG3A 1SGYE 1GI1A 2ZGBH 2B5TB 3QK1A 2ZHFH 3FZDA 3PMAB 3MH5A 3ZZ3A 1LO6A 1JMOH 3P8FA 1G3EA 2B9LA 4WJG2 3ZZ4A 2BLOA 1IAUA 1BBRE 2G8TA 1QJ1B 1GJ7B 1O2QA 4Z0KA 4AFUA 5A8YA 1EJNA 4NZQA 1GMDF 1SL3A 5F6MA 1XXDA 3UR6A 3F9GA 2AH4X 4IC5A 1ZHRA 4AGJA 3A7WA 5E0GA 1CGJE 3MHWU 4J2YB 4WMFA 2GGVB 1CE5A 1YPMH 2BD3A 2ODYB 5EQRA 2VWNA 4INLA 3WY8A 1CO7E 1P2NA 5AFZH 3W95A 1P03A 3E91A 3HGPA 3MOCA 1SGDE 3BEFB 1ZR0A 2O9QA 2GCHF 3TK9A 1CBWB 3P8NA 3RP2A 4GSOA 1W12U 1S0QA 1GI9B 1DFPA 3SU3A 1ZLRA 3TGIE 1EAXA 3LT3A 5JBBS 4HTCH 1E36B 3QWCH 2F9PA 1S84A 5DP6A 3RXCA 1DUEA 2BDYA 1WCZA 3GDUA 1P11E 2ULLA 1LCYA 1QL8A 2CXVA 2SGFE 4WMDA 1ZTJA 2R9PA 3F6UH 3UNQA 1J16A 1V2UT 2J34A 1DSTA 2Q6FA 1DITH 1OWJA 2EI7A 1YPGH 2FX4A 3QDZB 3M3VA 3MFJA 1E34B 5HM9A 3UQVA 1VCPA 2XW9A 4AFSA 5EODA 4A1TA 4FUHA 4X8SH 3I78A 3E8LA 1YLDA 2P16A 4B76A 4FVBA 4ISLA 3GISB 3SV7A 2CJIA 2O8MA 4I33A 1TWXB 2GMTC 3PMJA 2ZP0H 3RUOA 1DT2A 4MVNA 3FZZA 1XKAC 1BCUH 1V2MT 2Y6TA 4FUGA 4OS5A 1TGNA 1D3DB 2GX4A 5AVDA 1PPHE 1XUHA 4VGCB 3MH6A 4X1SU 1N6XA 1E38B 1QR3E 1P05A 1T8NA 1Y8TA 5GIBA 4OS1A 3ZZ7A 3SU6A 1AZZA 1GI6A 4THNH 4X8TH 3RXRA 2Z3CA 1PQ8A 4FUJA 1V3XA 1ELEE 5ESTE 4WWYA 1G2MA 1ANBA 1C5OH 1C5UA 4BXWA 2ZDVH 1HGTH 1M9UA 4H42U 3K6YA 1UTKA 4LXBH 2JETC 2VGCB 1RRKA 1IQIA 3PB1E 3QX5H 3A8CA 5C5OA 1G37A 5BPEA 2D8WA 2ZPQA 3PLKA 1L1GA 2FI4E 1C5YB 3OY5U 5FBEA 1PQAA 1OX1A 1HV7A 4OGYA 4XBBA 1F7ZA 1C2IA 3VB3A 1UO6A 3SU2A 4OS2A 2FS8A 1H9LB 3LDXH 1C9PA 1O34A 1OS8A 1XUJA 4DCDA 3H7OA 4U01A 3A80A 1GJDB 3M5MA 1C5TA 1GCDA 1O2RA 3UUZA 2DE9A 4K5ZA 2SNWA 5DG6A 3M37A 1O5AB 4A1VA 3NCLA 4BXSA 3A81A 1K1MA 2VJ1A 3M5OA 2G51A 1TMUH 2ZGCA 3M5NA 2G52A 1O3AA 3SQHE 4INKA 1BMLA 1NN6A 2HNTF 1FQ3A 3TVJB 4Y79A 3BTTE 1VGCB 2RA3A 3RDZA 2P59A 5FAHA 2QYIA 1CU1A 3DT0H 4CH8B 3GDSA 5DP8A 3FP8E 4ZH8A 3GCNA 4WXVA 1TALA 1O3EA 3GY6A 5AFYH 1ABJH 1S81A 3ZZ9A 5LPFA 4UFFH 2BY9X 3CENA 3BIVH 3ODDA 5PTPA 3LC3A 1THPB 4ZHMU 3SO3A 1MQ5A 5I46H 1WOFA 1CT0E 2IPHA 4NFFA 1EJMA 1BRCE 3P8GA 2QF3A 2UUFB 5EXNA 1GJ5H 2BDHA 1AE8H 3GY2A 2GKVE 3OSYA 4X1RU 1MU8B 2ZFSA 3QTOH 1AFQB 2AGGX 2KAIB 2Z7FE 4O03A 5FPYA 1L4DA 3VB6A 1TNIA 2AEIH 3RXTA 1V2ST 1O37A 4MPWA 1O2YA 4Q7XA 3U1IB 4AFZA 4NIXA 4KTUA 2AFQB 2J95A 4X2WA 3M7UA 1QA0A 1SGPE 2AS9A 1SFIA 3TH3H 1ETSH 1C2JA 3SV2H 4ISIH 5HM2A 4B2BA 1CA0B 1AVXA 1O36A 2ODPA 1K1JA 5FCRA 2R3YA 2GMTB 4Q7ZA 2G5NA 4K8YA 2Z3EA 2HOBA 1HDTH 4BAOB 1TRYA 1YM0A 1A0LA 3A89A 1BTWA 3ZV9A 3GY8A 1ZSKA 3FVFB 1EPTB 3B23B 3OTJE 2BQ6B 3RMOH 5T3HA 2FM2A 1K21H 1QB1A 1MAXA 2UWPA 3KQDA 1K2I1 2FMJA 2VWMA 5JPMH 1UJ1A 1HAYB 3VEQB 2GT7A 1PPZA 2XWAA 1GJBB 1TABE 1BMMH 1Y3UA 2DUCA 1KIGH 1QB9A 2PUQH 1UCYH 4WY3A 3ZVCA 7ESTE 4B2AA 3P8OA 3G01A 3DD2H 4X2VA 1T32A 1GCTC 5J4QA 1GBBA 2HALA 2UUYA 1GDNA 5EPNA 1JRSA 1GWAA 4YESB 1QBNA 2ZI2H 5L6NH 3TIUA 2J2UA 1Z71A 1O3OA 1XX9A 2SFAA 4CRCA 4B74A 2F9BH 5LPEA 2GV6A 3BV9B 1EXFA 1TNHA 3D65E 1AU8A 3LGWA 1O3IA 1QJ7B 1N1LA 1YPHC 1YCPK 1SHHB 1NFYA 2JKHA 3UREA 2FYQA 4X1QU 3RU4D 1H4WA 3MMGA 2BX4A 3AAUA 4E7NA 1O5EH 1DLEA 2FODA 3U8RH 4Q7YA 4AX9H 1BBRH 1C2LA 3L3TA 2UWLA 1BTHH 4PROA 2ZU3A 1D3QB 1AO5A 1B7XB 1KTTB 1ZRBA 4IW4E 1OYTH 2FPZA 1O2VA 1GI4A 4GVUA 2NU4E 5EG4A 4HI3A 2PKSC 2ZDKA 3U1JB 1TNLA 5C5NA 4JYUH 1K1PA 1FN6A 3M7QA 3URCA 3TITA 3SV9A 1O2OA 1BUIA 1O2NA 3UNRA 1MTNB 1TAWA 1XXFA 1P10A 3SV8A 1MBMA 5EXMA 5SGAE 1DDJA 1QL9A 5J4SA 3F9EA 3RXSA 2VWOA 4YOGA 3LOXA 1TQ0B 4X6NA 4WVPE 1J14A 1TMTH 1HPGA 2FTMA 2BD2A 2A31A 2ZCLP 4RKOB 5DO4H 3D49H 2Z9LA 1ELFA 2AIPA 2OTVA 5G4BA 5HXFA 1N6YA 2ALPA 3DUXH 4IN2A 1HIAB 5TCCA 1BHXB 1NPMA 1QQ4A 1L2EA 3RXLA 1GL0E 1S82A 1D3TB 1OP8A 2VH6A 5C1XA 1KSNA 2PW8H 1Y3WA 3FP7E 5IYTA 1NRRH 2PR3A 2LPRA 1ELTA 3VPKA 2STBE 1QRXA 1WBGB 1ARBA 1LHDH 1UK2A 1AB9C 4YLUA 2ZA5A 5EW1H 1J9CH 1O3DA 5DP4A 1TIOA 2PTNA 2BOKA 3MO9A 2H9HA 1TX8A 3Q3XA 1UTMA 1DVAH 1NFXA 4CH2B 2W3KA 2ZFRH 4IN1A 2Y7ZA 1FY3A 1XMNB 1O5FH 1A3BH 2H1UA 4MNVA 2QXHA 1A4WH 2ZIQH 3K65B 2ZTZA 1O3MA 1ELDE 2CN0H 1SQOA 2WYGA 4A92A 1DM4B 4Y8ZA 1L1JA 4X6OA 1S6HA 3E0NB 4Q80A 2ZZUH 1DX5M 2XRCA 4ISHH 2FYRA 4O9VA 1IQJA 1FAXA 2Y5HA 2ZHEH 3U98H 1GJCB 1ZOMA 4D76A 2WV5A 3SHAH 1C9TA 3DFLA 4WF8A 5FXLA 3BF6H 1TBZH 3RU4E 1CGHA 3ZZCA 4E06H 1FONA 3UIRA 4DIHH 3H7TA 4GUXA 4CR5A 2CHAB 1GBFA 1HFDA 3SNDA 2FIRH 2ZDLA 4KELA 4NWKA 2XNIA 1GI8B 1C5NH 1JOUB 3KF2A 4IGDA 2OC0A 8GCHF 2FX6A 4ABIA 5EPYA 4AB8A 1DWCH 1KXFA 1PFXC 1Z8JB 1O5GH 1YGCH 1ZRKA 3QO6A 2J4IA 4A1XA 1N8OC 3ZVAA 4E7RG 5HGGA 1EPTA 2BD9A 1BA8B 1UVSH 3GY3A 4J1YA 3BEIB 2GCHG 3EQ0H 2JH6D 1ZMJA 3HK3B 1TQ7B 1YC0A 1EP5A 4OS7A 3PMHB 3PLPA 2Z9KA 4UFEH 1ELAA 2OINA 1J17T 2WUBA 2LIZA 4B2CA 3RXIA 5H4IB 3IITA 4NFEA 4DY7B 3O8BA 1QJ6B 2VIVA 1SFQB 1QNJA 8ESTE 1W3CA 1Y5BT 4MNYA 2BLVA 1MTNC 3ELAH 3NPSA 3P70B 2AGEX 5LPRA 1A7SA 5A2MH 2B0FA 2ZNKH 4YT7H 5K0HA 1WU1A 3C1KA 4OS6A 2BD5A 1PPCE 2VU8E 4GCHG 1Z8GA 1AHTH 1OSSA 3LGVA 2A2QH 2GV7A 7GCHF 1E37B 1QIXB 1KXBA 4X0WU 2FO9A 1QTFA 2ZHQH 4TWWA 2OD3B 1UVTH 2BZ6H 4KTSA 1EZUC 1TFXA 4Y7AA 4JK5A 1PPGE 2FP7B 2ZGXH 1VITH
chains in the Genus database with same CATH superfamily
2ZGHA 1FN8A 3UPEA 4YM9A 1ELBA 6CHAB 2QGRA 4FU8A 2VVCA 1OKXA 1YPHE 3TK6A 1G30B 2CGAA 1LVOA 1TOMH 3BG4B 2F9UA 2ZPRA 3MH7A 4OS4A 1S0RA 2TBSA 4B1TA 5FBIA 2FXRA 3TNSA 1P09A 3ATWA 3N7DA 3PROA 5LGOA 1QB6A 1D9IA 2ANWA 4H4FA 2R2WU 1Z6EA 3MQKC 1AFQC 5ETXA 1C1NA 2A7HA 2GZ9A 4ABBA 3TH4H 4ZKOU 2THFB 2W26A 2C8XB 4NA9H 1TRNA 5B6LA 1W2KH 1VITF 1LDTT 2WPLS 1GCTB 2R0KA 3FKSD 2HNTE 1FV9A 2IJOB 3TK5A 1XKBC 3QZQA 3BEUA 4I32A 2FOEA 2ZCKP 5C3NA 3M7TA 3P95A 3UWJH 1S85A 2YNBA 1H8ED 1PJPA 3BTEE 1GBKA 1CHOG 1SBWA 1F2SE 1D4PB 1G2LA 1DWEH 3I29A 1SC8U 3DHKH 4AB9A 3OTPA 3SNCA 1GJAB 4AORA 1S5SA 1EUFA 1HJ9A 3NUMA 5CMXH 5TCAA 1Y3VA 1YLCA 1EFRD 2ANMH 2GDEH 1C4U2 5AF9H 1NZQH 3A8DA 5EGMA 2C4FH 3RXPA 4X2YA 4X6MA 2BXUH 4JZEH 3SUFA 2OQ5A 1VCQA 4TPYA 5CDFE 1SHYA 1H9IE 5IDKA 4ZUHA 1CQQA 1SMFE 1VITG 3PM3A 4Y6DA 4I8KA 2QN5T 1UK3A 1YPEH 2G5VA 2V0BA 4P02A 1MTVA 1P3EA 1RTKA 2KM0A 2H5CA 3ATKA 3MNXA 3KHVA 2Z9JA 2ZO3H 4CRAA 4X1PU 4TY6A 5DP7A 1P01A 2IN2A 5DP3A 2R2MB 1SQAA 5E0HA 3E90B 3M35A 1YPJH 3TLOA 4AYVB 2C93B 4Y0ZE 3PV5A 5C94A 2QIQA 1KXDA 3O8CA 1RS0A 3ZIAD 4UFGH 3SNEA 3GCTG 1K1IA 2TGPZ 1C1RA 1O3CA 1P04A 1HUTH 3MH4A 1GBDA 3D62A 2XTTB 2BX3A 1OWKA 1UCYE 2RA0A 2XXLA 4DT7B 3OX7U 3EA9A 3TGKE 1ZPZA 4CBNA 2F9NA 2OC1A 2A4RA 3A7VA 2Z9IA 5EW2H 1P2MA 2QY0B 1GHAF 1GDUA 5F03A 1SG8B 4ACAA 1BRBE 3ZVBA 1CVWH 1ZHMA 1PYTD 3LPRA 2Y82A 1YKTA 4H6TA 4YXWD 1O2IA 1ESAA 5FPSA 1VGCC 1DXPA 1KY9A 3KL6A 1O2ZA 1TA2A 2HLCA 3QN7A 3S9AA 5E8EH 1O2LA 3FFGA 3L6PA 3SBKA 3OEED 1A1RA 1SGNE 1ZPBA 1MMJN 2JDID 1NY22 2FOMB 1ZZZA 1BT7A 2WUCA 5DPAA 3E3TA 2VBCA 1TMBH 3O8DA 5A8XA 1YY3A 1C5MD 3EBNA 1RXPA 1RJXB 2P94A 1UTOA 5F8ZA 1VCWA 3SUDA 1HAGE 1TLDA 1NRSH 3SGBE 3SU1A 5DK1A 2GZ8A 1TB6H 1TGCA 6CHAC 1CBWC 1QRZA 5EU8A 1BTZA 3STJA 1O30A 3OAAD 1ELVA 4XSKU 2CF8H 3GCHB 1KLJH 1LKAA 1LHEH 3F68H 4DVAU 1EPTC 1HAPH 3BTME 1ZJKA 3TJNA 4NIWA 3MO6A 2J94A 2BVXH 4TPIZ 1LKBA 3L33A 8KME2 6GCHF 1GVZA 1LPKB 2JJ1D 3EAJA 1CT2E 3GCOA 5E0JA 2FLBH 2BVRH 3TJVA 1C2FA 1KYNA 3NRLA 1S83A 3F0OA 1RTLA 1BDAA 4U30A 2BVSH 4Y8XA 2OXSA 4MTBA 3V13A 3EGKH 4DW2U 5E2OA 1W11U 1THSH 4NIYA 3BTWE 4Y76A 1DOJA 3FP6E 4B73A 2ZU5A 1THRH 2AMDA 1NC6A 2VIQA 3ZVDA 1NU9A 5C0TA 1UHBB 2Q1JA 5L2YH 1F0UA 4GCHF 1YBWA 3T29A 1AVWA 1P3CA 1DUAA 4CREA 3F2GA 3NZIA 5T6GA 1FPCH 1C2EA 2ZDMA 3PRDA 5EXLA 4NZLA 2FEQH 1GHBF 1V2TT 2PP6A 2KCPA 3M5LA 2JH5D 1P0SH 3M3TA 1CA8B 3Q77A 3WWFA 2XYAA 1TYNA 1KLIH 4FUIA 1QQUA 1O5CB 9ESTA 1GJ4H 4D8NA 2PKSB 2VVVA 4MPXA 1C5SA 3SYJA 1E0FD 3MU5A 3GICB 3U69H 4I7YH 1GI7B 3SZNA 5DGJA 3RXDA 1BRUP 2ZDNA 2GTBA 1DANH 1NRPH 3SUEA 1C5QA 3DSPA 1CGIE 1C5LH 3RXAA 1XUFA 1L1NA 1SGFG 1EJAA 3TJUA 4CHAB 2BY5X 3HATH 4XE4A 1MTUA 1T4UH 2BQ7B 2KZ4A 1GPZA 3KGPA 2BLQA 3UFAA 4DURA 2Z6BD 1BRAA 3ESTA 1A61H 3MU4A 4MQAA 3ZZBA 3PWCA 4XFQA 1NRQH 2W5EA 1AMHA 1O3NA 3ZZ8A 4F55A 1AVGH 2JETB 3A87A 2AMPA 1O2UA 2H5DA 1LHFH 5GCHG 2XC5A 1RIWB 2CF9H 1L0ZA 5FPTA 4GLYA 1D3PB 3CNRA 4A7IB 1O3KA 1ELGA 2WINI 4I8JA 4F4OC 1GBIA 3E0PB 3LGIA 3TNTA 2A45B 2BB4A 1TBQH 3MO3A 1WXRA 1GVKB 1P2QA 4BAQB 2Z94A 2XBVA 1G3DA 1F92A 1A46H 1BBRK 2A0QB 2QF4A 1UW7A 1IQKA 2ZWLH 2F83A 1FZZA 4ZKSU 3F9HA 1O2XA 3OYPA 3QGNB 4FUBA 3SQEE 3TH2H 2FDAA 1ZJDA 1E35B 3VXFH 2AYWA 1BJUA 1F0RA 4DOQA 4CRBA 5B6OA 3OU0A 1GHAG 4FUCA 1W7XH 1P2IA 2C8WB 3LGTA 2WPKS 1AI8H 3LU9B 1ANEA 3BSQA 4NSVA 3DSGA 1O3BA 3A88A 4AN7A 1P2KA 1U6QA 3RXFA 4CR9A 1P06A 1SI5H 5K7RA 3LONA 2BD8A 3LH3A 5EJZA 2CK3D 2K0QA 5FX6A 1HAVB 2O8UA 3M3SA 1NT1A 1TNJA 4K69A 1AIXH 2Y7XA 3EDXB 4E05H 4ESTE 1FMGA 1C5PA 1MZAA 4WMEA 1EB1H 4ZROA 3GCTF 2CMYA 1GMCG 1TGBA 1G3CA 1SPJA 3F2HA 1O2TA 4AOQA 1FLEE 3S9CA 1NROH 1T31A 4RT1A 2O8LA 1HLTH 1ETRH 2OBOA 4K2YA 2FI3E 1P9UA 3RXQA 2EA3A 2TPIZ 1BOQA 1GI5A 3QUMP 2A4GA 4BAKB 1OWIA 2SGAA 1A2CH 4B75A 1G32B 4RSPA 1WTHD 2XCNA 2C3SA 2K7XA 1SLWB 2V3OH 1BTPA 2Y81A 5F8XA 1FY4A 3LGYA 3RM0H 1GHWH 3UY9A 5KGOA 5A0AE 1WQSA 2ZG0H 4P00A 4NA8A 2RCEA 4K8BA 1HAZB 4TWYA 4YT6H 2ZU4A 1BITA 1P2OA 4BTTB 1H9HE 1GHZA 2A2XH 3RLWH 1C1SA 2QXJA 2A32A 3A82A 1AUJA 4YO9A 4RKJB 1JRTA 2ZQ1A 1SGFA 1YPKH 4JMYA 2G4UA 4IC6A 3RXKA 8LPRA 7GCHG 3O8RA 2ZF0H 4Q4LA 5JB9S 4XOJA 3RMNH 3BN9A 1CT4E 1IOEA 4K1EA 1MQ6A 1P02A 1IQNA 3N7OA 1MAYA 3E1XB 2XCFA 1RGQA 1O2PA 1KTSB 1GBEA 3ZZ5A 5GPIB 1FI8A 3LGUA 2JH0D 3N7EA 4IBLH 2WPJS 3D23A 5GJ4B 2GT8A 3KQEA 1O2JA 1Q3XA 1UTQA 3IWMA 1C1PA 3AW0A 3VB4A 1C2KA 2B7DH 2BY7X 1QGFA 2NU3E 2Y5FA 1V2JT 3SU4A 2ALVA 4I8LA 2SGPE 3VB7A 1YPLH 4UEHH 5C0UA 2O8WA 1ID5H 2WPDD 3A86A 3ZVGA 3QLPH 3FANA 1AB9B 1ESBA 1YF4A 3MI4A 2DE8A 2XWBI 3PYHA 1ABIH 4B71A 3CS0A 1O3LA 4JK6A 1KXAA 5EJ1A 2BD4A 3UR9A 3OE7D 4AZ2B 2FOGA 1IQLA 1SGRE 3A7XA 1Y59T 1HAIH 1GHBG 1YYY1 5AHGH 1Q2WA 1SGIB 6GCHG 3OFND 1ARCA 2FZZA 2BZAA 1GBLA 2YMSD 1NFUA 3RMMH 2RFKC 1OOKB 1EX3A 1IHTH 1OWHA 2ZFFH 3FAOA 1NFWA 2UWOA 1MH0A 1NBMD 3RM2H 1IQEA 1Q31A 4X1NU 1QRWA 2G55A 1VJ9U 1O2MA 1LHGH 4FU7A 2FOBA 2ZFTA 4BAMB 1MZDA 5CHAC 3OY6U 1QURH 3BTKE 1T8OA 1TPSA 2A1DB 5I25A 4JZDH 3TGJE 4AYYB 2P3UB 2FOAA 3SU5A 1AD8H 1OWEA 2ILNA 1BTYA 4YTAA 2C8ZB 3P92A 1PQ5A 1W0ZU 3AW1A 2RDEA 2IOTA 3M61U 5C1UA 1WUNH 1RFNA 1FXYA 1MU6B 3U9AH 7KMEH 1DY8A 1OXGA 1EASA 1UK4A 1SQTA 2J92A 4D7GA 5FHTA 1Y5AT 9LPRA 8GCHG 3LJOA 3E16B 4YZUA 2ZKSA 1HAVA 4MPUA 2OBQA 1A5HA 3KQBA 1Y3XA 1YCPM 1Z1JA 2EI6A 2G81E 4SGAE 4WH8A 2V3HH 2ZPSA 4UDWH 4HFPB 4JCNA 2SGEE 2SGDE 4IS5A 2W3IA 1D6RA 2EC9H 4BAHB 3WWBA 3B8JA 3DFJA 3EA8A 1DWDH 3VFEA 1V2LT 1E79D 3KIDU 4HGCA 2AHME 2AERH 2VIWA 2NU1E 1H1BA 2BDBA 5GNDA 4MG3A 1FY8E 1COWD 1GJ8B 3MNSA 4KKDA 2WPIS 1V2QT 3C27B 1UCYK 1TPPA 2WPMS 3V0XA 4SGBE 2LP6A 2FOFA 4X8VH 4I8GA 1EAUA 1SSXA 2PGBB 1DXWA 2OCVB 1O3FA 2P95A 2PUXB 4NA7A 5T6FA 4CRFA 1EB2A 1F5LA 4TT3D 5LH8A 1XUGA 1GHVH 1MCTA 1RIWC 3PO1B 1PPEE 2VINA 3ODFA 5C67A 3UWIA 2XC0A 4MNXA 2AGIX 1TBRH 3UOUA 2H9EH 3SNBA 2P3FH 1O32A 3LKWA 1LQDB 1AUTC 5C20A 3K2UA 1N8OB 2WV4A 1KMHB 3RXMA 4F48B 1QFKH 3BG4C 1FAKH 2KCAA 3R0FA 1UVOA 3PLBA 2HNTC 2BTCE 1VJAU 1BTUA 2BXTH 3EA7A 4FETA 4ZKRU 1O2WA 1CA0C 1OP0A 1EZSC 4D9QA 3UB0A 1WDIA 1EQ9A 5C1YA 3MU1A 4D9RA 2ZCHP 1HJAC 4MLFB 3VXEH 3BTFE 1AN1E 1BMNH 2WV9A 1EP6A 1DLKB 3F9FA 3T26A 1GG6B 2PSYA 2D1JA 1EKBB 1FIWA 1GL1A 2R3UA 3A7TA 1W13U 4I8HA 1GHYH 1C4Y2 4U32A 2A7CA 3GY5A 2P93A 4Y10E 3RU4T 1BJVA 2PTCE 1OYQA 1GVLA 4O3TA 1Z8RA 3T62A 1AZ8A 3JZ2B 2LNCA 2L74A 3LIWA 1UTPA 1GG6C 1GJ6A 1XVOA 2JIZD 2UUKB 2P3TB 1ZGIA 2F91A 1K1NA 3JZ1B 5F8TA 1QY6A 2HPQH 1BB0B 1ZYOA 4IMZA 4CRDA 2IJD1 1C2DA 1IQGA 1H8IH 1KDQA 2OC7A 2G4TA 4ABHA 3BTGE 1V2VT 1AWHB 1TNGA 1DE7H 2ZQ2A 5GWZA 5DJ7A 2QXIA 5BRRE 3K6ZA 3AVZA 1FPHH 1LPZB 5ESBA 4BTUB 3H5CB 4R0IA 3Q00A 5GCHF 2PKAB 4BNRA 1O2KA 1ZTKA 2FI5E 5ABWA 3T2NA 3STIA 4DGJA 2FOCA 6ESTA 2TGDA 1AKSA 4B6EA 1LPGB 4K3JA 3E6PH 1SKYE 1O2GH 1AKSB 4GHTA 1HYLA 1JBUH 1ANDA 3GDVA 1XUIA 2VVUA 1ZPCA 5DSFA 4ZHLU 1FDPA 1F0TA 1Z8IB 1IQFA 3MTYA 1O35A 4QT8C 5GXPA 1T8LA 2GCTB 2H2ZA 2Z3DA 1NRNH 3RC5A 1ETTH 1IQHA 1SOTA 1ELCA 2FWWA 1C2GA 3SUGA 3R3GB 5JDUB 3HKJB 4ZXXH 1P8VC 4UFDH 4RI0A 1CHGA 3NXPA 4H6SB 2F9OA 3H09A 3ZZAA 5A8ZA 2ZFQH 1T7CA 4ABGA 1WV7H 1YLNA 3SU0A 5JBAS 1G9IE 2PSXA 4JZ1A 1VR1H 1TONA 1C1VH 4ABFA 5KEDA 1GMHG 4ZCNA 1SLUB 4ABAA 2Y80A 2NU0E 1NESE 1O3JA 1FY5A 2LELA 1GGDC 4OGXA 1DSUA 3SGQE 1WAYB 3GYMA 4GPGA 4FU9A 1K22H 3RXGA 4ABEA 3S0NA 2VB0A 5EQSA 3KNXA 1TRMA 1SGTA 3ENSB 1UVPA 1K1OA 3LC5A 3F3BA 6LPRA 3RXHA 5CHAB 5T1VA 1BQYA 1W7GH 1C5XB 1V2OT 1QBVH 2V6NA 1C5WB 3RLYH 4HG6A 3GY4A 3NKKA 1HAXB 1L4ZA 3SGAE 4FXGH 3RXEA 2A5IA 1UHBA 1XVMA 2B8OH 2QA9E 2EY4C 3OEHD 4UD9H 1O0DH 4TSFD 1DPOA 1K28D 5JB8S 1EAWA 4ACBA 1ESTA 2XBYA 1KLTA 4AFQA 1JXPA 4GAWA 4TYDA 3WW7A 2GD4B 3M36A 1JIMA 1ZHPA 2HPPH 3K9XB 1GBMA 2R0LA 2VNTA 3MNBA 1GGDB 1VKYA 1YCPH 3PTBA 2L6OA 2BDCA 1BIOA 2Y5GA 4BOHA 1EZXC 1TNKA 1O5BB 2STAE 5A09A 4KGAA 3V3MA 3NWUA 4AGKA 2NWNA 4JYVH 1K9OE 3V7TA 4AG1A 2BOHB 2KCYA 1ORFA 4M7GA 2CV3A 1KXCA 4NIVA 4MPVA 3RXUA 5A0BA 3T5FH 3VGCC 4K1TA 1SGEE 3U8TH 2Z9GA 3SI3H 5DP5A 1GBCA 2IPQX 2FS9A 3V12A 2OP9A 2I6QA 1QL7A 2V35A 1SB1H 3S69A 1C1QA 3KQCA 1MBQA 2P8OB 1TGSZ 3SJIA 4DJZB 3KQ5A 3HKIB 1HAOH 1O2HA 3MYWA 1V2WT 3F1SB 5TJXA 1LMWB 3KN2A 4FUDA 1W0YH 2FOHA 2F43B 2O8TA 4XBCA 4ZMAH 4Y8YA 1O39A 3EE0B 2XBWA 5DN6D 3MNCA 1C1WH 3F2FA 1F0SA 5EOKA 4NCYA 3W94A 2GP9B 2A5KA 1P9SA 1AWFH 1ZMLA 3A84A 1C5ZB 2QCYA 1P12E 1W14U 5JYIA 3A8AA 1CHOF 1SGQE 3TJOA 4ZKNU 2M2AA 3Q3YA 1O5DH 1DICA 3S9BA 3A85A 4XDEA 5L30H 2BY6X 2VGCC 3HPTB 4DT4A 3ATMA 5E2PA 4Z1MD 1GBTA 4NSYA 2QXGA 2BYAX 1WYKA 4XD7D 2WYJA 2J38A 2TIOA 1V6DA 1J15A 4RN6A 1ZSJA 2A4QA 2ZC9H 3RXVA 1O3HA 2J9NA 1SOZA 4LOYH 1O33A 1MD8A 1TOCB 2H6MA 1QBOA 1W10U 1MUEB 3I77A 3SHCH 3Q76A 4YOIA 1A3EH 1HIAA 2VIOA 1O31A 2QF0A 4TY7A 3RMLH 4BTIB 2F3CE 1ZGVA 1FJSA 4GHQA 2G00A 3A7ZA 1HJ8A 4AG2A 5JBCS 1K0HA 2QF5A 2OQUA 1QHRB 3BIUH 4M9FA 4ABDA 1TX6A 4CBOA 4JZFH 4BANB 1AGJA 1OP2A 3ITIA 1GJ9B 1HJAB 3NK8A 4XRNA 1B0FA 2XNDD 1MD7A 1ZTLA 3MU0A 3SW2B 3UTUH 3UOPA 3N99A 1GBAA 2QC2A 1ZSLA 3MU8A 4X6PA 2ANYA 1TA6A 1C1OA 2VH0A 1HB0B 1B5GH 2W7SA 1SLXB 1UTNA 3ZZ6A 1MCVA 1G36A 1NTPA 2A4OA 3P17H 2PHBA 2YOLA 3SNAA 4Y7BA 1J8AA 2EI8A 2I6SA 1V2KT 1QCPA 1GI0A 1LHCH 3HGNA 1Z1IA 3QTVH 2BDAA 3ZVEA 3T25A 1V2NT 3W1EA 2BD7A 4K1SA 1F5RA 2HVXA 5DP9A 1AQ7A 2SGQE 3QZRA 1GMDG 2BDIA 2EEKA 3ZZDA 1C1TA 3BTDE 2GCTC 5C2ZA 3PO1C 2BY8X 3T28A 1P2JA 4INHA 4LZ1H 2Q6DA 1O3GA 2TGAA 1FIZA 2WSSD 2XC4A 3A7YA 3SJKA 4A6LA 3PMBB 2GZ7A 3ZV8A 1GBJA 3LH1A 5HKKD 2TRMA 4FVDA 1HCGA 4FUEA 4Z6AH 2RDLA 2ZHWH 2VWLA 1KDQB 2BDGA 3CS7A 4ISOA 3MWIU 1EOLA 1ZMNA 1C1MA 3EE7A 2YNAA 1SR5C 3VGCB 3U8OH 1BMFD 4NGAH 4MNWA 4K60A 2C8YB 1TGTA 1XM1A 2WPHS 4CHAC 1OPHB 1MKXK 4UE7H 1S6LA 2AIQA 1SGCA 2GDDA 5CE1A 1DY9A 1PQ7A 4Q63A 2ZTXA 1UVUH 2VIDA 3URDA 4RT0A 3ZVFA 1D6WA 1LVMA 5EJLA 1GI2A 3RC6A 3S7KB 1PYTC 1X7AC 3GY7A 2FESH 1GMCF 5HYOA 2FTLE 3QGJA 2OUAA 3KEEA 1BMAA 1NS3A 4F49A 2XBXA 3UNSA 4ABJA 1DWBH 4U2WA 3GOVB 3ATIA 3AASA 1MABB 3SI4H 2D2DA 2ZHDA 2BM2A 5HMAA 3SJ9A 1WTGH 1OWDA 2BQWB 4ZHAA 2GVFA 5T6DA 2C90B 4JZIA 2PGQB 1WQVH 2HGTH 1UTLM 2KX4A 3BTHE 3ATLA 4IMQA 5EQQA 1K1LA 4R8TB 1A5IA 3ZYEA 3IG6B 1H8DH 4UONA 1HNEE 1LTOA 1LQEA 3SN8A 4Y11E 4O97A 4D7FA 2BLWA 3CP7A 2K1QA 1EZQA 1O38A 3AAVA 4WH6A 7LPRA 2PWXA 1MTSA 3SOSA 5JBTA 1LVYA 5FX5A 1C2MA 1C2HA 2HRVA 2PLXA 3BTQE 1IQMA 4LZ4B 2P8OC 3DSOA 2BMGB 4Y71A 1A0HB 1DS2E 1HXFH 2KAIA 1NM6A 4VGCC 4KTCA 2Q6GA 1AE5A 2ZU1A 3SZEA 1XUKA 3FN8A 4A5TS 4Q2KA 1MKXH 1C1UH 1PPFE 1NU7B 5HIZA 1KXEA 1Z7KA 1JWTA 2ZTYA 3Q3KA 1P57B 3LJJA 1Z6JH 1FUJA 3DA9B 4LK4A 1C4V2 1BZXE 2ZGJA 2AMQA 2QV1A 4ZAEA 5EIYA 2ZECA 3B9FH 4YLQH 4DG4A 2ZDAH 3A8BA 5FCKA 1GDQA 1MKWH 3HK6B 1UTJA 4Y0YE 2CHAC 2A7JA 2NU2E 2UUJB 1A5GH 5DKMA 2PKAA 4DIIH 3PV2A 2PV9B 5GDSH 4WXIA 3EYDA 2BHGA 1CSOE 2HWLB 4CRGA 5A0CA 2KCOA 4JYTA 1FNIA 4HZHA 3RXBA 3GYLB 1F5KU 1ACBE 4I31A 2F9VA 1Y3YA 1S6FA 1EAIA 1PPBH 2ZU2A 2D26C 1W8BH 3RXJA 1IHSH 1GHXH 1WSSH 3SJ8A 2OC8A 3VB5A 1HAHH 1A0JA 1B0EA 1BHXF 2PFEA 2VIPA 1HRTH 1UMAH 1W0KD 3RXOA 1C5RA 2ODQA 3A83A 4ISNA 2SNVA 1RD3B 1AY6H 3SJOA 3KCGH 1SVPA 2QAAA 4FUFA 1NO9H 4I86A 4O3UA 1GMHF 3KYGA 1JIRA 1Y5UT 1HBTH 1O3PB 1T8MA 5KECA 2V7QD 2ASUB 1TPAE 3SORA 3TU7H 1E1QD 1HXEH 3SV6A 4MDSA 1G3BA 4NG9H 1H8HD 1MKWK 1MTWA 3GCHC 1BTXA 1C5VA 1LVBA 4X2XA 2OLGA 3UQOA 3T27A 1AFEH 1O2SA 1INCA 1YP9A 2H9TH 2ZEBA 3PV4A 2ESTE 4X8UH 1TPOA 1SLVB 4AC9A 1VZQH 1RTFB 5C17A 1V2PT 3ZYDA 3PTNA 1TE0A 5L2ZH 1EATA 4ASHA 1ANCA 1GBHA 1FY1A 2ZFPH 3PWBA 2TGTA 3RC4A 3TPIZ 4KP0A 3BG8A 4XBDA 1QA7A 2ANKH 1V2RT 3P6ZB 4NWLA 4ZXYH 1TX7A 1EOJA 1GI3A 1T4VH 2A5AA 2M5TA 4YOJA 2W7UA 3S7HB 2FLRH 2RG3A 1SGYE 1GI1A 2ZGBH 2B5TB 3QK1A 2ZHFH 3FZDA 3PMAB 3MH5A 3ZZ3A 1LO6A 1JMOH 3P8FA 1G3EA 2B9LA 4WJG2 3ZZ4A 2BLOA 1IAUA 1BBRE 2G8TA 1QJ1B 1GJ7B 1O2QA 4Z0KA 4AFUA 2GJGA 1EJNA 5A8YA 4NZQA 1GMDF 1SL3A 5F6MA 1XXDA 3UR6A 3F9GA 2AH4X 4IC5A 1ZHRA 4AGJA 3A7WA 5E0GA 1CGJE 2J98B 3MHWU 4J2YB 4WMFA 2F4LA 2GGVB 1CE5A 1YPMH 2BD3A 2ODYB 5EQRA 2VWNA 4INLA 3WY8A 1CO7E 1P2NA 5AFZH 3W95A 1P03A 3E91A 3HGPA 3MOCA 1SGDE 3BEFB 2QE7D 1ZR0A 2O9QA 2W6JD 2GCHF 3TK9A 1CBWB 3P8NA 3RP2A 4GSOA 1W12U 1S0QA 1GI9B 3VG8A 1DFPA 3SU3A 1ZLRA 3TGIE 1EAXA 3LT3A 5JBBS 4HTCH 1E36B 2XOKD 3QWCH 2F9PA 1S84A 5DP6A 3RXCA 3FO8D 1DUEA 2BDYA 1WCZA 3GDUA 1P11E 2ULLA 2YMSB 3PRBA 1LCYA 1QL8A 2CXVA 2SGFE 4WMDA 1ZTJA 2R9PA 3F6UH 5IK2D 3UNQA 1J16A 1V2UT 2J34A 1DSTA 2Q6FA 1DITH 1OWJA 2EI7A 1YPGH 2FX4A 3QDZB 3M3VA 3MFJA 1E34B 5HM9A 3UQVA 1VCPA 2XW9A 4AFSA 2HLDD 5EODA 4A1TA 4FUHA 2K8IA 2WZQA 4X8SH 3I78A 3E8LA 1YLDA 2P16A 4B76A 4FVBA 4ISLA 3GISB 3SV7A 2CJIA 2O8MA 4I33A 1TWXB 2GMTC 3PMJA 2ZP0H 3RUOA 1DT2A 4MVNA 3FZZA 1XKAC 1BCUH 1V2MT 2Y6TA 4FUGA 4OS5A 1TGNA 1D3DB 2GX4A 5AVDA 1PPHE 1XUHA 3AK5A 4VGCB 1FX0B 3MH6A 4X1SU 1N6XA 1E38B 1QR3E 1P05A 1T8NA 1Y8TA 5GIBA 4OS1A 3ZZ7A 3SU6A 1AZZA 1GI6A 4THNH 4X8TH 3RXRA 2Z3CA 1PQ8A 4FUJA 1V3XA 1ELEE 5ESTE 4WWYA 1G2MA 1ANBA 1C5OH 1C5UA 4BXWA 2ZDVH 1HGTH 1M9UA 4H42U 3K6YA 1UTKA 4LXBH 2JETC 2VGCB 1RRKA 1IQIA 3PB1E 3QX5H 3A8CA 5C5OA 1G37A 5BPEA 2D8WA 2ZPQA 3PLKA 1L1GA 2FI4E 1C5YB 3OY5U 5FBEA 1PQAA 1OX1A 1HV7A 4OGYA 4XBBA 1F7ZA 1C2IA 3VB3A 1UO6A 3SU2A 4OS2A 2FS8A 1H9LB 3LDXH 1C9PA 1O34A 1OS8A 1XUJA 4DCDA 3H7OA 4U01A 3A80A 1GJDB 3M5MA 1C5TA 1GCDA 2EQNA 1O2RA 3UUZA 2DE9A 2YMSC 4K5ZA 2SNWA 5DG6A 3M37A 1O5AB 4A1VA 5FL7D 3NCLA 4BXSA 3A81A 1K1MA 2VJ1A 3M5OA 2G51A 1TMUH 2ZGCA 3M5NA 2G52A 1O3AA 2JJ2D 3SQHE 4INKA 1BMLA 1NN6A 2HNTF 1FQ3A 3TVJB 3F0PA 4Y79A 3BTTE 1VGCB 2RA3A 3RDZA 2P59A 4ASUD 5FAHA 2WHXA 2QYIA 1CU1A 3DT0H 4CH8B 3GDSA 5DP8A 3FP8E 4ZH8A 3GCNA 4WXVA 1TALA 1O3EA 3GY6A 5AFYH 1ABJH 1S81A 3ZZ9A 5LPFA 4UFFH 2BY9X 3CENA 3BIVH 3ODDA 5PTPA 3LC3A 1THPB 4ZHMU 3SO3A 1MQ5A 5I46H 1WOFA 1CT0E 1E1RD 2IPHA 4NFFA 1BRCE 1EJMA 3P8GA 2QF3A 2UUFB 5EXNA 2V3MA 1GJ5H 2BDHA 1AE8H 3GY2A 2GKVE 3OSYA 4X1RU 1MU8B 2ZFSA 3QTOH 1AFQB 2AGGX 2KAIB 2Z7FE 4O03A 5FPYA 1L4DA 3VB6A 1W0JD 1TNIA 2AEIH 3RXTA 1V2ST 1O37A 4MPWA 1O2YA 4Q7XA 3U1IB 4AFZA 4NIXA 4KTUA 2AFQB 2J95A 4X2WA 3M7UA 1QA0A 1SGPE 2AS9A 1SFIA 3TH3H 1QZ8A 1ETSH 1C2JA 3SV2H 4ISIH 5HM2A 4B2BA 1CA0B 1AVXA 1O36A 2ODPA 1K1JA 5FCRA 2R3YA 2GMTB 4Q7ZA 2G5NA 2W6ID 4K8YA 2Z3EA 2HOBA 1HDTH 4BAOB 1TRYA 1YM0A 2HVYB 1A0LA 3A89A 1BTWA 3ZV9A 3GY8A 1ZSKA 3FVFB 1EPTB 3B23B 3OTJE 2BQ6B 3RMOH 5T3HA 2FM2A 1K21H 1QB1A 1MAXA 1YWUA 2UWPA 3KQDA 1K2I1 2FMJA 2VWMA 5JPMH 1UJ1A 1HAYB 3VEQB 2GT7A 1PPZA 2XWAA 1GJBB 1TABE 1BMMH 1Y3UA 2DUCA 1KIGH 1QB9A 2PUQH 1UCYH 4WY3A 2KFWA 3ZVCA 7ESTE 4B2AA 3P8OA 3G01A 3DD2H 4X2VA 1T32A 1GCTC 5J4QA 1GBBA 2HALA 2UUYA 1GDNA 5EPNA 1JRSA 1GWAA 4YESB 1QBNA 2ZI2H 5L6NH 3FOAA 3TIUA 2J2UA 1Z71A 2OK5A 1O3OA 1XX9A 2SFAA 4CRCA 4B74A 2F9BH 5LPEA 2GV6A 3BV9B 1EXFA 1TNHA 3D65E 5F53A 1AU8A 3LGWA 1O3IA 1QJ7B 1N1LA 1YPHC 1YCPK 1SHHB 1NFYA 2JKHA 3UREA 2FYQA 4X1QU 3RU4D 1H4WA 3MMGA 2BX4A 3AAUA 4E7NA 1O5EH 1DLEA 2FODA 3U8RH 4Q7YA 4AX9H 1BBRH 1C2LA 3L3TA 2UWLA 1BTHH 4PROA 2ZU3A 1D3QB 1AO5A 1B7XB 2J5UA 1KTTB 1ZRBA 4IW4E 1OYTH 2FPZA 1O2VA 1GI4A 4GVUA 2NU4E 5EG4A 4HI3A 2PKSC 2ZDKA 3U1JB 1TNLA 5C5NA 4JYUH 1K1PA 1FN6A 3M7QA 5HIYA 3URCA 3TITA 3SV9A 1O2OA 1BUIA 1O2NA 3UNRA 1MTNB 1TAWA 1XXFA 1P10A 3SV8A 1MBMA 5EXMA 5SGAE 1DDJA 1QL9A 5J4SA 1OHHD 3F9EA 2KR7A 4FOUC 3RXSA 2VWOA 4YOGA 3GS9A 3LOXA 1TQ0B 4X6NA 4WVPE 1J14A 1TMTH 1HPGA 2FTMA 2BD2A 2A31A 2ZCLP 3KYFA 4RKOB 5DO4H 3D49H 2Z9LA 1ELFA 2AIPA 2OTVA 5G4BA 5HXFA 1N6YA 2ALPA 3DUXH 4IN2A 1HIAB 5TCCA 1BHXB 1NPMA 1QQ4A 1L2EA 3RXLA 1GL0E 1S82A 1D3TB 1OP8A 2VH6A 5C1XA 1KSNA 2PW8H 1Y3WA 3FP7E 5IYTA 1NRRH 2PR3A 2LPRA 1ELTA 3VPKA 1QRXA 2STBE 1WBGB 1ARBA 1LHDH 1UK2A 1AB9C 4YLUA 2ZA5A 5EW1H 1J9CH 1O3DA 5DP4A 1TIOA 2PTNA 2BOKA 3MO9A 2H9HA 1TX8A 3Q3XA 1UTMA 1DVAH 1NFXA 4CH2B 2W3KA 2ZFRH 4IN1A 2Y7ZA 1FY3A 1XMNB 1O5FH 1A3BH 2H1UA 3DCLA 1NBME 4MNVA 2QXHA 1A4WH 2ZIQH 3K65B 2ZTZA 1O3MA 1ELDE 2CN0H 1SQOA 2WYGA 4A92A 3U28C 1DM4B 4Y8ZA 1L1JA 4X6OA 5CHBA 1S6HA 3E0NB 4Q80A 2ZZUH 1DX5M 2XRCA 4ISHH 2FYRA 4O9VA 1IQJA 1FAXA 2Y5HA 2ZHEH 3U98H 1GJCB 1ZOMA 4D76A 2WV5A 3SHAH 1C9TA 3DFLA 4WF8A 5FXLA 3BF6H 1TBZH 3RU4E 1CGHA 3ZZCA 4E06H 1FONA 3UIRA 4DIHH 3H7TA 4GUXA 4CR5A 2CHAB 1GBFA 1HFDA 3SNDA 2FIRH 2ZDLA 4KELA 4NWKA 2XNIA 1GI8B 1C5NH 1JOUB 3KF2A 4IGDA 2OC0A 8GCHF 2FX6A 4ABIA 5EPYA 4AB8A 2J98A 1DWCH 1KXFA 4OM9A 1PFXC 1Z8JB 1O5GH 1YGCH 1ZRKA 3QO6A 2J4IA 4A1XA 1N8OC 3ZVAA 4E7RG 5HGGA 1EPTA 2BD9A 1BA8B 1UVSH 3GY3A 4J1YA 3BEIB 2GCHG 3EQ0H 2JH6D 1ZMJA 3HK3B 1TQ7B 1YC0A 1EP5A 4OS7A 3PMHB 3PLPA 2Z9KA 4UFEH 1ELAA 2OINA 3UAIC 1J17T 2WUBA 2LIZA 4B2CA 3RXIA 4B6FA 5H4IB 3IITA 4NFEA 4DY7B 3O8BA 1QJ6B 2VIVA 1SFQB 1QNJA 8ESTE 1W3CA 1Y5BT 4MNYA 2BLVA 1MTNC 3ELAH 3NPSA 3P70B 2AGEX 5LPRA 1A7SA 5A2MH 2B0FA 2ZNKH 4YT7H 5K0HA 1WU1A 3C1KA 4OS6A 2BD5A 1PPCE 2VU8E 4GCHG 1Z8GA 1AHTH 1OSSA 3LGVA 2A2QH 2GV7A 7GCHF 1E37B 1QIXB 1KXBA 4X0WU 2FO9A 1QTFA 2ZHQH 4TWWA 2OD3B 1SQRA 1UVTH 2BZ6H 4KTSA 1EZUC 1TFXA 4Y7AA 4JK5A 1PPGE 2FP7B 2ZGXH 2J97A 1VITH
chains in the Genus database with same CATH topology
2ZGHA 1FN8A 3UPEA 4YM9A 1ELBA 6CHAB 2QGRA 4FU8A 2VVCA 1OKXA 1YPHE 3TK6A 1G30B 2CGAA 1LVOA 1TOMH 3BG4B 2F9UA 2ZPRA 3MH7A 4OS4A 1S0RA 2TBSA 4B1TA 5FBIA 2FXRA 3TNSA 1P09A 3ATWA 3PROA 5LGOA 1QB6A 1D9IA 2ANWA 4H4FA 2R2WU 1Z6EA 1AFQC 5ETXA 1C1NA 2A7HA 2GZ9A 4ABBA 3TH4H 4ZKOU 2THFB 2W26A 2C8XB 4NA9H 1TRNA 1W2KH 1VITF 1LDTT 2WPLS 1GCTB 2R0KA 2HNTE 1FV9A 2IJOB 3TK5A 1XKBC 3QZQA 3BEUA 4I32A 2FOEA 2ZCKP 5C3NA 3M7TA 3P95A 3UWJH 1S85A 2YNBA 1PJPA 3BTEE 1GBKA 1CHOG 1SBWA 1F2SE 1D4PB 1G2LA 1DWEH 3I29A 1SC8U 3DHKH 4AB9A 3SNCA 1GJAB 4AORA 1S5SA 1EUFA 1HJ9A 3NUMA 5CMXH 5TCAA 1Y3VA 1YLCA 2ANMH 2GDEH 1C4U2 5AF9H 1NZQH 3A8DA 5EGMA 2C4FH 3RXPA 4X2YA 4X6MA 2BXUH 4JZEH 3SUFA 2OQ5A 1VCQA 4TPYA 1SHYA 1H9IE 5IDKA 4ZUHA 1CQQA 1SMFE 1VITG 3PM3A 4Y6DA 4I8KA 2QN5T 1UK3A 1YPEH 2G5VA 2V0BA 1MTVA 1P3EA 1RTKA 3ATKA 2H5CA 3MNXA 3KHVA 2Z9JA 2ZO3H 4CRAA 4X1PU 4TY6A 5DP7A 1P01A 2IN2A 5DP3A 2R2MB 1SQAA 5E0HA 3E90B 3M35A 1YPJH 3TLOA 4AYVB 2C93B 4Y0ZE 2QIQA 1KXDA 3O8CA 1RS0A 4UFGH 3SNEA 3GCTG 1K1IA 2TGPZ 1C1RA 1O3CA 1P04A 1HUTH 3MH4A 1GBDA 3D62A 2XTTB 2BX3A 1OWKA 1UCYE 2RA0A 2XXLA 4DT7B 3OX7U 3EA9A 3TGKE 1ZPZA 4CBNA 2F9NA 2OC1A 2A4RA 3A7VA 2Z9IA 5EW2H 1P2MA 2QY0B 1GHAF 1GDUA 5F03A 1SG8B 1BRBE 3ZVBA 1CVWH 1ZHMA 1PYTD 3LPRA 2Y82A 1YKTA 4H6TA 1O2IA 1ESAA 5FPSA 1VGCC 1DXPA 1KY9A 3KL6A 1O2ZA 1TA2A 2HLCA 3QN7A 3S9AA 5E8EH 1O2LA 3FFGA 3L6PA 3SBKA 1A1RA 1SGNE 1ZPBA 1MMJN 1NY22 2FOMB 1ZZZA 1BT7A 2WUCA 5DPAA 3E3TA 1TMBH 3O8DA 5A8XA 1C5MD 3EBNA 1RXPA 1RJXB 2P94A 1UTOA 5F8ZA 1VCWA 3SUDA 1HAGE 1TLDA 1NRSH 3SGBE 3SU1A 5DK1A 2GZ8A 1TB6H 1TGCA 6CHAC 1CBWC 1QRZA 5EU8A 1BTZA 3STJA 1O30A 1ELVA 4XSKU 2CF8H 3GCHB 1KLJH 1LKAA 1LHEH 3F68H 4DVAU 1EPTC 1HAPH 3BTME 1ZJKA 3TJNA 4NIWA 3MO6A 2J94A 2BVXH 4TPIZ 1LKBA 3L33A 8KME2 6GCHF 1GVZA 1LPKB 3EAJA 1CT2E 3GCOA 5E0JA 2FLBH 2BVRH 3TJVA 1C2FA 1KYNA 1S83A 1RTLA 1BDAA 4U30A 2BVSH 4Y8XA 2OXSA 4MTBA 3V13A 3EGKH 4DW2U 5E2OA 1W11U 1THSH 4NIYA 3BTWE 4Y76A 1DOJA 3FP6E 4B73A 2ZU5A 1THRH 2AMDA 1NC6A 2VIQA 3ZVDA 1NU9A 1UHBB 2Q1JA 5L2YH 1F0UA 4GCHF 1YBWA 3T29A 1AVWA 1P3CA 1DUAA 4CREA 3NZIA 5T6GA 1FPCH 1C2EA 2ZDMA 5EXLA 4NZLA 2FEQH 1GHBF 1V2TT 3M5LA 2JH5D 1P0SH 3M3TA 1CA8B 3Q77A 2XYAA 1TYNA 1KLIH 4FUIA 1QQUA 1O5CB 9ESTA 1GJ4H 4D8NA 2PKSB 2VVVA 4MPXA 1C5SA 1E0FD 3MU5A 3GICB 3U69H 4I7YH 1GI7B 3SZNA 5DGJA 3RXDA 1BRUP 2ZDNA 2GTBA 1DANH 1NRPH 3SUEA 1C5QA 1CGIE 1C5LH 3RXAA 1XUFA 1L1NA 1SGFG 1EJAA 3TJUA 4CHAB 2BY5X 3HATH 4XE4A 1MTUA 1T4UH 2BQ7B 1GPZA 3KGPA 2BLQA 3UFAA 4DURA 2Z6BD 1BRAA 3ESTA 1A61H 3MU4A 4MQAA 3ZZBA 3PWCA 4XFQA 1NRQH 2W5EA 1AMHA 1O3NA 3ZZ8A 1AVGH 2JETB 3A87A 2AMPA 1O2UA 2H5DA 1LHFH 5GCHG 2XC5A 1RIWB 2CF9H 1L0ZA 5FPTA 4GLYA 1D3PB 4A7IB 1O3KA 1ELGA 2WINI 4I8JA 4F4OC 1GBIA 3E0PB 3LGIA 3TNTA 2A45B 2BB4A 1TBQH 3MO3A 1GVKB 1P2QA 4BAQB 2Z94A 2XBVA 1G3DA 1F92A 1A46H 1BBRK 2A0QB 1IQKA 2ZWLH 2F83A 1FZZA 4ZKSU 3F9HA 1O2XA 3OYPA 3QGNB 4FUBA 3SQEE 3TH2H 2FDAA 1ZJDA 1E35B 3VXFH 2AYWA 1BJUA 1F0RA 4DOQA 4CRBA 5B6OA 3OU0A 1GHAG 4FUCA 1W7XH 1P2IA 2C8WB 3LGTA 2WPKS 1AI8H 3LU9B 1ANEA 3BSQA 4NSVA 1O3BA 3A88A 4AN7A 1P2KA 1U6QA 3RXFA 4CR9A 1P06A 1SI5H 5K7RA 3LONA 2BD8A 3LH3A 5FX6A 1HAVB 2O8UA 3M3SA 1NT1A 1TNJA 4K69A 1AIXH 2Y7XA 3EDXB 4E05H 4ESTE 1FMGA 1C5PA 1MZAA 4WMEA 1EB1H 4ZROA 3GCTF 2CMYA 1GMCG 1TGBA 1G3CA 1SPJA 1O2TA 4AOQA 1FLEE 3S9CA 1NROH 1T31A 2O8LA 1HLTH 1ETRH 2OBOA 4K2YA 2FI3E 1P9UA 3RXQA 2EA3A 2TPIZ 1BOQA 1GI5A 3QUMP 2A4GA 4BAKB 1OWIA 2SGAA 1A2CH 4B75A 1G32B 4RSPA 1WTHD 2XCNA 2C3SA 2K7XA 1SLWB 2V3OH 1BTPA 2Y81A 5F8XA 1FY4A 3LGYA 3RM0H 1GHWH 3UY9A 5A0AE 1WQSA 2ZG0H 4NA8A 2RCEA 4K8BA 1HAZB 4TWYA 4YT6H 2ZU4A 1BITA 1P2OA 4BTTB 1H9HE 1GHZA 2A2XH 3RLWH 1C1SA 2QXJA 2A32A 3A82A 1AUJA 4YO9A 4RKJB 1JRTA 2ZQ1A 1SGFA 1YPKH 4JMYA 2G4UA 4IC6A 3RXKA 8LPRA 7GCHG 3O8RA 2ZF0H 5JB9S 4XOJA 3RMNH 3BN9A 1CT4E 1IOEA 4K1EA 1MQ6A 1P02A 1IQNA 3N7OA 1MAYA 3E1XB 2XCFA 1RGQA 1O2PA 1KTSB 1GBEA 3ZZ5A 5GPIB 1FI8A 3LGUA 2JH0D 4IBLH 2WPJS 3D23A 5GJ4B 2GT8A 3KQEA 1O2JA 1Q3XA 1UTQA 3IWMA 1C1PA 3AW0A 3VB4A 1C2KA 2B7DH 2BY7X 1QGFA 2NU3E 2Y5FA 1V2JT 3SU4A 2ALVA 4I8LA 2SGPE 3VB7A 1YPLH 4UEHH 2O8WA 1ID5H 3QLPH 3A86A 3ZVGA 3FANA 1AB9B 1ESBA 1YF4A 3MI4A 2DE8A 2XWBI 3PYHA 1ABIH 4B71A 3CS0A 1O3LA 4JK6A 1KXAA 2BD4A 3UR9A 4AZ2B 2FOGA 1IQLA 1SGRE 3A7XA 1Y59T 1HAIH 1GHBG 1YYY1 5AHGH 1Q2WA 1SGIB 6GCHG 1ARCA 2FZZA 2BZAA 1GBLA 3RMMH 1NFUA 1OOKB 1EX3A 1IHTH 1OWHA 2ZFFH 3FAOA 1NFWA 2UWOA 1MH0A 3RM2H 1IQEA 1Q31A 4X1NU 1QRWA 2G55A 1VJ9U 1O2MA 1LHGH 4FU7A 2FOBA 2ZFTA 4BAMB 1MZDA 5CHAC 3OY6U 1QURH 3BTKE 1T8OA 1TPSA 2A1DB 5I25A 4JZDH 3TGJE 4AYYB 2P3UB 2FOAA 3SU5A 1AD8H 1OWEA 2ILNA 1BTYA 4YTAA 2C8ZB 3P92A 1PQ5A 1W0ZU 3AW1A 2IOTA 3M61U 5C1UA 1WUNH 1RFNA 1FXYA 1MU6B 3U9AH 7KMEH 1DY8A 1OXGA 1EASA 1UK4A 1SQTA 2J92A 4D7GA 5FHTA 1Y5AT 9LPRA 8GCHG 3LJOA 3E16B 4YZUA 2ZKSA 1HAVA 4MPUA 2OBQA 1A5HA 3KQBA 1Y3XA 1YCPM 1Z1JA 2EI6A 2G81E 4SGAE 4WH8A 2V3HH 2ZPSA 4UDWH 4HFPB 4JCNA 2SGEE 2SGDE 4IS5A 2W3IA 1D6RA 2EC9H 4BAHB 3B8JA 3DFJA 3EA8A 1DWDH 3VFEA 1V2LT 3KIDU 4HGCA 2AERH 2VIWA 2NU1E 1H1BA 2BDBA 4MG3A 1FY8E 1GJ8B 3MNSA 4KKDA 2WPIS 1V2QT 3C27B 1UCYK 1TPPA 2WPMS 3V0XA 4SGBE 2FOFA 4X8VH 4I8GA 1EAUA 1SSXA 2PGBB 1DXWA 2OCVB 1O3FA 2P95A 2PUXB 4NA7A 5T6FA 4CRFA 1EB2A 1F5LA 5LH8A 1XUGA 1GHVH 1MCTA 1RIWC 3PO1B 1PPEE 2VINA 3ODFA 5C67A 3UWIA 2XC0A 4MNXA 2AGIX 1TBRH 3UOUA 2H9EH 3SNBA 2P3FH 1O32A 3LKWA 1LQDB 1AUTC 5C20A 3K2UA 1N8OB 2WV4A 3RXMA 1QFKH 3BG4C 1FAKH 3R0FA 1UVOA 3PLBA 2HNTC 2BTCE 1VJAU 1BTUA 2BXTH 3EA7A 4ZKRU 1O2WA 1CA0C 1OP0A 1EZSC 4D9QA 1EQ9A 5C1YA 3MU1A 4D9RA 2ZCHP 1HJAC 4MLFB 3VXEH 3BTFE 1AN1E 1BMNH 1EP6A 1DLKB 3F9FA 3T26A 1GG6B 2PSYA 2D1JA 1EKBB 1FIWA 1GL1A 2R3UA 3A7TA 1W13U 4I8HA 1GHYH 1C4Y2 4U32A 2A7CA 3GY5A 2P93A 4Y10E 3RU4T 1BJVA 2PTCE 1OYQA 1GVLA 4O3TA 1Z8RA 3T62A 1AZ8A 3JZ2B 2LNCA 3LIWA 1UTPA 1GG6C 1GJ6A 1XVOA 2UUKB 2P3TB 1ZGIA 2F91A 1K1NA 3JZ1B 5F8TA 1QY6A 2HPQH 1BB0B 1ZYOA 4IMZA 4CRDA 1C2DA 1IQGA 1H8IH 1KDQA 2OC7A 2G4TA 4ABHA 3BTGE 1V2VT 1AWHB 1TNGA 1DE7H 2ZQ2A 5GWZA 5DJ7A 2QXIA 5BRRE 3K6ZA 3AVZA 1FPHH 1LPZB 5ESBA 4BTUB 3H5CB 4R0IA 3Q00A 5GCHF 2PKAB 4BNRA 1O2KA 1ZTKA 2FI5E 5ABWA 3T2NA 3STIA 4DGJA 2FOCA 6ESTA 2TGDA 1AKSA 1LPGB 4K3JA 3E6PH 1O2GH 1AKSB 4GHTA 1HYLA 1JBUH 1ANDA 3GDVA 1XUIA 2VVUA 1ZPCA 4ZHLU 1FDPA 1F0TA 1Z8IB 1IQFA 3MTYA 1O35A 4QT8C 5GXPA 1T8LA 2GCTB 2H2ZA 2Z3DA 1NRNH 3RC5A 1ETTH 1IQHA 1SOTA 1ELCA 2FWWA 1C2GA 3SUGA 3R3GB 5JDUB 3HKJB 4ZXXH 1P8VC 4UFDH 1CHGA 3NXPA 4H6SB 2F9OA 3ZZAA 5A8ZA 2ZFQH 1T7CA 4ABGA 1WV7H 3SU0A 5JBAS 1G9IE 2PSXA 4JZ1A 1VR1H 1TONA 1C1VH 4ABFA 1GMHG 1SLUB 4ABAA 2Y80A 2NU0E 1NESE 1O3JA 1FY5A 1GGDC 4OGXA 1DSUA 3SGQE 1WAYB 3GYMA 4GPGA 4FU9A 1K22H 3RXGA 4ABEA 3S0NA 2VB0A 5EQSA 3KNXA 1TRMA 1SGTA 3ENSB 1UVPA 1K1OA 3LC5A 6LPRA 3RXHA 5CHAB 1BQYA 1W7GH 1C5XB 1V2OT 1QBVH 2V6NA 1C5WB 3RLYH 3GY4A 3NKKA 1HAXB 1L4ZA 3SGAE 4FXGH 3RXEA 2A5IA 1UHBA 1XVMA 2B8OH 2QA9E 4UD9H 1O0DH 1DPOA 1K28D 5JB8S 1EAWA 1ESTA 2XBYA 1KLTA 4AFQA 1JXPA 4GAWA 4TYDA 2GD4B 3M36A 1JIMA 1ZHPA 2HPPH 3K9XB 1GBMA 2R0LA 2VNTA 3MNBA 1GGDB 1YCPH 3PTBA 2BDCA 1BIOA 2Y5GA 4BOHA 1EZXC 1TNKA 1O5BB 2STAE 5A09A 4KGAA 3V3MA 3NWUA 4AGKA 2NWNA 4JYVH 1K9OE 3V7TA 4AG1A 2BOHB 1ORFA 4M7GA 2CV3A 1KXCA 4NIVA 4MPVA 3RXUA 5A0BA 3T5FH 3VGCC 4K1TA 1SGEE 3U8TH 2Z9GA 3SI3H 5DP5A 1GBCA 2FS9A 3V12A 2OP9A 2I6QA 1QL7A 2V35A 1SB1H 3S69A 1C1QA 3KQCA 1MBQA 2P8OB 1TGSZ 3SJIA 4DJZB 3HKIB 1HAOH 1O2HA 3MYWA 1V2WT 3F1SB 5TJXA 1LMWB 3KN2A 4FUDA 1W0YH 2FOHA 2O8TA 4XBCA 4ZMAH 4Y8YA 1O39A 3EE0B 2XBWA 3MNCA 1C1WH 1F0SA 5EOKA 4NCYA 3W94A 2GP9B 2A5KA 1P9SA 1AWFH 1ZMLA 3A84A 1C5ZB 2QCYA 1P12E 1W14U 5JYIA 3A8AA 1CHOF 1SGQE 3TJOA 4ZKNU 3Q3YA 1O5DH 1DICA 3S9BA 3A85A 4XDEA 5L30H 2BY6X 2VGCC 3HPTB 3ATMA 5E2PA 1GBTA 4NSYA 2QXGA 2BYAX 1WYKA 2WYJA 2J38A 2TIOA 1V6DA 1J15A 4RN6A 1ZSJA 2A4QA 2ZC9H 3RXVA 1O3HA 2J9NA 1SOZA 4LOYH 1O33A 1MD8A 1TOCB 2H6MA 1QBOA 1W10U 1MUEB