3SNDA

Crystal structure of sars coronavirus main protease complexed with ac-estlq-h (cocrystallization)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Peptide aldehyde inhibitors challenge the substrate specificity of the SARS-coronavirus main protease.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 88
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3sndA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sndA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sndA02
1GI2A 1VGCC 4KKDA 1K1MA 1FZZA 1YF4A 4YM9A 5AF9H 3E90B 1IHTH 1O0DH 1O2XA 5EGMA 3MH7A 1TOCB 1QL9A 1F0SA 1MTWA 1A61H 4H42U 3BTHE 1THPB 2BD2A 1ZPBA 4MLFB 1KTTB 3RXSA 1UTQA 2G5NA 4LOYH 3URCA 4Y8ZA 1YPKH 1SQAA 2OP9A 1TX6A 2F9VA 2TGPZ 1UTPA 2ZO3H 3QTOH 3E0PB 4R8TB 3T5FH 2I6SA 5A2MH 1EZSC 4FUJA 4ZMAH 1O2MA 2ANKH 3KN2A 2HPPH 2GCHF 5HGGA 2CHAC 2H5CA 1TGNA 4B1TA 2GZ7A 1GMHG 1BRBE 4INKA 2GCTB 2QY0B 3SU0A 4B75A 1ZMNA 2QF0A 1NS3A 3U1IB 1BMAA 4AFZA 3UFAA 2PUXB 3R0FA 2VIQA 1V2QT 1W7XH 1SC8U 3IITA 3RXGA 3M5OA 2SNWA 2Y7ZA 1YCPK 3AAUA 4AB8A 1P9UA 4U30A 1THRH 1XUFA 1KXCA 3UPEA 1BZXE 3RXFA 1Y5UT 1ABJH 1GJDB 3TNTA 4CR5A 3PTBA 1SFIA 3BN9A 1QY6A 2Z9KA 2ANYA 2UWPA 2Y80A 2SGFE 3MU5A 1Z8JB 1L1JA 3QZRA 1CHOG 3BTQE 3SU1A 4ABAA 4X8UH 4GHQA 5DP9A 5A0CA 5DPAA 5EXMA 4YOGA 4SGBE 1OP8A 2QXIA 2GD4B 3KHVA 3FP8E 2JETB 2UUKB 4O3UA 1JIMA 1ZSJA 1QRWA 3SNAA 1HB0B 4FUDA 4NZLA 3BF6H 4B73A 2BOHB 2A31A 2VNTA 1NU9A 1GJCB 1RRKA 1QA0A 2FI4E 2EC9H 1DM4B 1PJPA 1WOFA 3VB3A 1GCDA 2BVSH 3MH4A 2R2MB 5A8ZA 1NFXA 4XOJA 3BIUH 1BDAA 1EPTB 1S5SA 1V2MT 1AU8A 5F8ZA 4BXSA 1BTXA 1BBRH 3SJ8A 3QX5H 1E0FD 1TAWA 3TPIZ 1G37A 1N8OC 5G4BA 5HXFA 5K0HA 2A5IA 7GCHF 1BHXF 5J4QA 1Y3UA 3RXOA 1GGDC 2P93A 3V3MA 3KIDU 1C5RA 3O8CA 3RMLH 2V3OH 3ATKA 1FNIA 5LPFA 3NUMA 2VVCA 4X6PA 2O8LA 1GCTB 3M3VA 1CT4E 1LVBA 1KXAA 1QTFA 2H9EH 1EZXC 4DCDA 2P3TB 3SQHE 3H7OA 3NZIA 4X1QU 4XFQA 3UQVA 1YPGH 2VVVA 3EE0B 1HAYB 4NIVA 1KLTA 2WUCA 2ZHEH 3FP7E 3SGQE 1LMWB 1SGTA 2HRVA 3R3GB 5E2OA 1H9IE 1FY4A 2J92A 1GVZA 1UK2A 4D7FA 1W13U 1QRXA 5EG4A 1P2JA 1J8AA 2PKAA 2ZFFH 1S0RA 2W26A 5B6OA 1KY9A 1P3CA 1UVOA 1ZYOA 4K69A 4AFQA 3ATWA 1N1LA 1O2WA 3A82A 1KXBA 5GIBA 4YT7H 4ISIH 2ZQ1A 1KLIH 3BG8A 1GBJA 4D7GA 2QGRA 1QBNA 2QV1A 5K7RA 4GSOA 5C3NA 1ZRKA 2WYGA 2QXHA 2HGTH 1V2ST 1SQOA 1GBKA 4Q7YA 1FUJA 1AGJA 1O2SA 1SLWB 3BTKE 1YPJH 1A7SA 1ZJDA 1L1GA 1NRRH 1FY8E 2FI5E 2FTLE 4BAHB 1HFDA 3OU0A 1HIAB 1OWIA 1GI8B 1O31A 4ZH8A 1P09A 4KTSA 3T62A 3ZVDA 4J1YA 1EATA 3S7KB 3O8BA 1PPHE 3RXMA 3DT0H 1BMNH 2ZDNA 5JYIA 1WTHD 2GGVB 4RN6A 1A3EH 1GL0E 1V2UT 1V2VT 3RUOA 1FDPA 3JZ2B 4XBBA 3SU4A 2Z94A 3LT3A 1VR1H 4NFEA 5DP8A 1B7XB 1M9UA 1TPPA 3SV8A 4YOJA 1XVMA 3PWBA 3MU8A 4UFEH 3LIWA 1GBDA 1UO6A 1O39A 1A0JA 3VB7A 3AW0A 1HXFH 2Z7FE 1MKWK 3PWCA 2H5DA 1C5OH 1ZHMA 1QB6A 2BZAA 2BQ7B 3V12A 1Y8TA 2RG3A 4NGAH 2FLBH 1MMJN 1DLEA 2A4QA 2BYAX 2ILNA 5DG6A 1S82A 1XUKA 3HK6B 3T2NA 1DUEA 3A80A 2Z6BD 4Y71A 1AUTC 1FAKH 2OTVA 3U8OH 1FPHH 2FX4A 3P8OA 4FVDA 5JB9S 2F91A 3F6UH 4TY6A 4Y10E 3MYWA 1DWCH 2FOAA 1XXFA 1VJAU 3GY7A 1JBUH 4NWKA 1MTNB 3SU6A 4MPUA 2Z9IA 1HYLA 3BSQA 2W3IA 1NRPH 1ELCA 3BTME 2ZHQH 3SJOA 1AY6H 4WXVA 3LDXH 4BTTB 1SGFG 1GHBF 1HCGA 1P3EA 3UOUA 5DGJA 1A5IA 2ZPQA 1E37B 5DP4A 1UJ1A 2GZ8A 4ZKNU 2EI7A 1AB9B 2ZFQH 1D9IA 3M36A 5JPMH 1P2MA 2FLRH 1D3DB 2EI6A 1W0ZU 3L6PA 4DY7B 4ZHMU 4J2YB 1CA0B 1HJAC 5AFZH 4RSPA 1RD3B 4M7GA 3T25A 2ZDVH 1C1RA 3FZDA 1GI9B 2XBYA 1QFKH 1LHDH 1GJ4H 5L6NH 3GY8A 2FYQA 2ZCKP 2B7DH 3S7HB 1ZGIA 1MTSA 1UTKA 3D49H 4NIYA 2CJIA 2P8OC 1N6XA 4ZAEA 2H2ZA 1RJXB 1TOMH 4WJG2 5AVDA 1TA6A 5FCKA 2WPJS 4O9VA 3HK3B 4B2AA 2RA3A 1VCQA 4CHAC 5EPNA 3SUFA 3M5LA 1H4WA 1HBTH 3TK9A 5A8XA 1O37A 3DFLA 4JK5A 1O3LA 4K3JA 1TBZH 2CF9H 4WMFA 1NC6A 1KXFA 2HLCA 3GISB 3MO9A 2AMDA 4WMEA 1HDTH 3UOPA 1WU1A 1YYY1 3ITIA 5AHGH 1TQ0B 4DW2U 1G2MA 4WMDA 1TIOA 3A85A 4DIHH 1INCA 4TWYA 1EXFA 5T6GA 2EI8A 3TU7H 1TGCA 1GMCG 1ZPCA 1F5RA 1KXDA 4GLYA 4LK4A 3GDSA 5IDKA 2BVXH 3SN8A 2OXSA 3PYHA 5T6DA 4OGYA 4MPXA 1QJ7B 2FOCA 4X1SU 3ZV8A 2K7XA 2FX6A 1NU7B 2ZECA 1O2TA 2ZKSA 4JZEH 1CA8B 1LPGB 4ISNA 3U69H 1HUTH 3TGJE 2J34A 1LHFH 1P04A 4UONA 5GPIB 1P11E 3GYLB 3ZZAA 1NROH 3RC5A 1AHTH 3QTVH 4X0WU 3SNCA 1NT1A 5FXLA 1UHBB 2C4FH 3KF2A 1YM0A 1V2KT 3BEUA 5FAHA 1YP9A 1NY22 1THSH 1BRAA 1ZPZA 2ZU5A 1ARCA 5LH8A 1ANEA 2R2WU 2A2XH 1GBAA 5C1XA 3GY2A 1DWDH 2D26C 1BRUP 3DUXH 1V2WT 1OKXA 3NK8A 3QGJA 1TABE 1QB1A 2ZGCA 3PO1B 1K22H 3GDUA 1HNEE 2FOMB 1Z6EA 4CH2B 6LPRA 2XW9A 3UIRA 1AZZA 4ABBA 1O2KA 1O2RA 1TRYA 2C8WB 1A5HA 1JXPA 2SGPE 2PFEA 4BANB 1GMDF 1FONA 6CHAB 1KDQA 3BG4C 3I78A 3QWCH 5DP7A 4K8BA 1J16A 3A86A 4CRDA 4NZQA 3UWJH 1O3CA 4ISHH 2ZDKA 2WPMS 5I25A 2ZG0H 2W7SA 1FXYA 2AEIH 2UUJB 4U32A 2YNAA 2BDYA 1ARBA 1O32A 2FS8A 3PTNA 1QNJA 1GJ5H 3VXFH 1C2GA 3BIVH 1TX7A 3RDZA 5C5NA 1PQAA 1T8NA 1ZOMA 2FP7B 3DA9B 3ATIA 1L4ZA 2P59A 2KAIA 5ETXA 2BY9X 1BRCE 1P2NA 1IQKA 3TGIE 4CRFA 1DANH 4NG9H 3GY3A 1WQSA 1FQ3A 2VB0A 3K9XB 2HNTE 1DX5M 2ANMH 1C5ZB 4KGAA 5EQRA 1Z8GA 1O3NA 3C1KA 3EGKH 4CRGA 6ESTA 3SHCH 2ZGHA 2FI3E 5EOKA 3T29A 1KIGH 3SGAE 8GCHF 3PMBB 4B74A 1LO6A 1Q3XA 2PKSC 4TYDA 4OS7A 4ABDA 1B5GH 1SGYE 4O03A 4X6OA 2PW8H 1QL7A 4AYYB 3KQDA 2XBVA 4BAOB 1BBRK 3RMOH 5F8XA 1CHGA 1O2LA 1HAPH 1KSNA 4BXWA 2ZDAH 2OBQA 3QO6A 1CE5A 1V2OT 3ZZ3A 2VWOA 2BX4A 2FM2A 3GCTG 3TH4H 4WF8A 2QAAA 3A8DA 1SGRE 2CN0H 2UWLA 8ESTE 3A7ZA 3MNCA 3RMMH 3E6PH 3MI4A 2VINA 2FOHA 1P03A 2BDIA 4I8LA 4ZKRU 2TPIZ 1MAXA 4MNWA 1EB1H 4RKJB 1EQ9A 3VEQB 4I8KA 3WY8A 2C8XB 5HM9A 2THFB 2STAE 3EDXB 3TK6A 1B0FA 2QIQA 2OQ5A 5DP6A 1PYTC 1GDQA 3BTDE 4VGCC 1GMHF 5FHTA 2A4GA 3HKIB 4NA9H 1PPBH 1BTPA 2EEKA 1PFXC 3RMNH 1OP0A 3MO6A 1SLUB 3P8GA 2ZFSA 3I77A 3BV9B 4A5TS 1EASA 3KQEA 1Z1JA 1UVUH 3A87A 3VB5A 2ZNKH 4X8VH 1C1MA 4UFDH 1RIWB 1YLCA 2AIQA 3B23B 4X6NA 3Q3XA 2FODA 3SJIA 1GI0A 1LQEA 1LVOA 2XNIA 2FS9A 2GCTC 2IJOB 1O2OA 1EX3A 4WWYA 5C1YA 4JK6A 3T28A 1ANDA 1GG6B 4PROA 3DD2H 1IQLA 4A1TA 4XBCA 3NXPA 2P16A 1O2GH 3GY4A 5FBEA 5J4SA 1T4UH 3MNXA 1OYTH 1CHOF 1ESTA 1W10U 4E7RG 4FU7A 1P57B 4ZHLU 4FUGA 4I8JA 1P12E 2Q6GA 3SUDA 2CHAB 5SGAE 2XRCA 5L2ZH 1C5VA 3G01A 2F9NA 1BTWA 1YPMH 3BEFB 4HGCA 4HZHA 2Z9JA 4A6LA 1EZUC 3SO3A 2C93B 2OC7A 2R0LA 4Y0YE 1O35A 4FUFA 1UCYK 4OGXA 4XDEA 1HAVB 3RXVA 2C3SA 1LVYA 2VIDA 1SGDE 4H6SB 2FO9A 2JETC 3HGPA 1L4DA 3N7OA 1GBHA 1U6QA 2GCHG 1O5BB 1NFYA 2ZPSA 1OOKB 4ISLA 2VIPA 1TGTA 2LPRA 3TH2H 5GCHG 2GT7A 1D6WA 3FVFB 1ACBE 1CT2E 3NKKA 1VCPA 1ELGA 3LU9B 1FIZA 2BB4A 2F9PA 5EW1H 3SZNA 1ELAA 1Q31A 4FUCA 1ESAA 4U2WA 1O36A 2XCNA 2BDBA 3W94A 2Q6FA 2A5KA 1NPMA 3AASA 1IQEA 4XE4A 1CQQA 3O8DA 3BTGE 2DE9A 3LGTA 1L0ZA 1WTGH 4FUEA 1P10A 3P8FA 3STIA 3C27B 3HGNA 4X2VA 1TMUH 4IBLH 1LHGH 1SL3A 1AVGH 3CS0A 5HYOA 5E0JA 3ZVEA 1HXEH 1DPOA 1AMHA 5DP3A 3M37A 1O2UA 3M5MA 3QLPH 2JH5D 3MWIU 2BXUH 1C9PA 4IGDA 5GJ4B 1GVKB 1C1OA 1F5LA 3MNBA 1CBWB 1C5PA 1F0UA 1FLEE 1P02A 1UTJA 1TNJA 4FU8A 4DG4A 2P3UB 5TJXA 3RU4T 1RXPA 1GPZA 1K1JA 3PROA 1ELEE 1MZDA 1AFQB 3K65B 5LPRA 3ZV9A 4JZDH 4CREA 5C20A 2WPIS 1DICA 1TPOA 4X1PU 5E2PA 1HPGA 3RXLA 1GJ9B 1N8OB 2ZCLP 1O2PA 1BT7A 1EAWA 2BQ6B 4OS5A 2LNCA 3HATH 1MKXK 3SNDA 2WV4A 2I6QA 2RCEA 1JWTA 1QB9A 2GKVE 5H4IB 1ANCA 1T32A 2UUYA 1FN6A 4D9QA 4UDWH 1TRMA 4DT7B 2OD3B 3ZZ9A 2VJ1A 1O2NA 2XCFA 1W3CA 2XC0A 2BX3A 1CSOE 5FBIA 1G3DA 2ZWLH 1P05A 1EKBB 2IPHA 3GCOA 2SGAA 3PMHB 1T31A 4JZFH 3SU5A 5GXPA 4CBOA 4ZXXH 3QK1A 2JKHA 2ZZUH 1MU6B 1GJBB 4UFFH 5E0HA 3KQBA 1MTUA 1O2QA 2PGQB 2FXRA 2ZHWH 1RTFB 3TLOA 3V13A 2GDDA 1DITH 1MAYA 1O5DH 3ODFA 1KYNA 2G81E 1DXWA 3U8RH 4YLUA 3BTEE 2HNTF 3ZYEA 3CENA 1A5GH 1GHXH 2ESTE 3LGWA 4A92A 1RTLA 1DSUA 1SHHB 2GZ9A 1DFPA 1O3FA 4ABJA 1AKSB 1UTMA 3MTYA 3UY9A 1C9TA 2DUCA 1SSXA 1YPLH 5I46H 4NCYA 4NFFA 3LGYA 3O8RA 2BDCA 3RLWH 1PPFE 5T6FA 4BOHA 1BOQA 5EXLA 2SGQE 4IS5A 1W12U 5ESTE 5JB8S 2FZZA 2OINA 1KXEA 1GI7B 3LC5A 6GCHG 3SU3A 1C5LH 1O3PB 1GBCA 4R0IA 4AB9A 3RM2H 4Y0ZE 1YCPH 2WPKS 1O3GA 1AD8H 2J2UA 3RXCA 3EBNA 5EXNA 1BMLA 1LKAA 1C1QA 1AO5A 3BTWE 1ELBA 1TWXB 2OBOA 4DVAU 1MTNC 2SNVA 2H9TH 5E0GA 1QBVH 1SMFE 3MU4A 1O5GH 1H8IH 1TMTH 1CO7E 4UEHH 5JBCS 3SV9A 2ZU3A 4NSYA 4OS1A 5EU8A 2AIPA 1TGSZ 1IQHA 1KDQB 4X8SH 3K6YA 1GDUA 2AMPA 2TBSA 2GMTC 1ESBA 3LGVA 2ZU4A 2ODQA 3LC3A 1SOTA 2XC4A 5BPEA 3LJOA 1C4U2 3Q76A 1D6RA 2WINI 2XBXA 1LTOA 1AB9C 3P92A 1GBIA 4FXGH 1MQ6A 4MTBA 3RXQA 1QL8A 1O2JA 4ZXYH 1RS0A 5FPTA 1TNIA 1PPCE 3Q3KA 1AQ7A 2WPHS 3PLPA 1TB6H 3AAVA 4Z6AH 2XWAA 1TMBH 3AW1A 1ZGVA 1EAUA 1ZZZA 3OY5U 1C2JA 3E8LA 1OP2A 1V2RT 1SB1H 3RXDA 1GWAA 1Z71A 1PQ7A 3P8NA 2VWMA 3UR6A 5LPEA 7LPRA 2Y81A 3LONA 1C5MD 1C4V2 1A2CH 2ZQ2A 1QR3E 1F7ZA 1A0LA 1G3CA 3M7TA 4INLA 1GMCF 1EPTA 3ZZ4A 5BRRE 1SBWA 2R3UA 4I8GA 7KMEH 1V2NT 3LH1A 2G52A 4FU9A 1GBFA 1YPEH 5TCAA 4E06H 2F9UA 2XYAA 4HFPB 2XXLA 5IYTA 2ZA5A 1D3QB 1JIRA 1BMMH 2FYRA 2A4OA 1BITA 2BDGA 1QHRB 4MQAA 5EPYA 5ABWA 3ATMA 4CRAA 1NESE 1XVOA 2P8OB 2G5VA 1E35B 5FPSA 4X1RU 4AX9H 2QA9E 1GHZA 1Z7KA 1WYKA 1S0QA 3M7UA 3MO3A 5T3HA 3GDVA 2XTTB 4CHAB 4AYVB 4WH8A 4X8TH 3PMJA 3S9AA 4Y7AA 2XC5A 1T8OA 2A7CA 3HKJB 1O5FH 2A0QB 4GCHG 5E8EH 2P94A 2Y5FA 1P8VC 2QXGA 1BA8B 2A5AA 2GV6A 4A1VA 1ID5H 3A89A 5DJ7A 5CHAC 2J94A 1V2LT 1UMAH 3F1SB 1DXPA 1PQ5A 3URDA 2AMQA 1O3JA 1H9LB 3MOCA 1SQTA 4ZROA 1OS8A 3BEIB 2OC8A 4LZ4B 4Z0KA 1RGQA 1TA2A 2FPZA 2C8ZB 2R0KA 4KELA 3ZVGA 1YBWA 4Y8YA 1SGQE 1T8LA 5F8TA 2K1QA 4ABEA 4BNRA 1O30A 3M5NA 1HIAA 1LPZB 2J38A 1MBMA 1HAXB 3RXEA 4UD9H 1PPZA 2PHBA 3U9AH 2BLQA 2FOEA 3A8AA 2QC2A 3Q77A 2ZFPH 1BUIA 3FANA 4CH8B 1W7GH 1UTOA 3OX7U 1FI8A 1DSTA 1K21H 4X6MA 1MKWH 2A4RA 1C4Y2 1GJ7B 2TGTA 1GJ6A 3E16B 4F4OC 2NU2E 2VGCC 2QCYA 4GVUA 3ZZ5A 5JBAS 1UVTH 4AG2A 1A1RA 2A7HA 2NU4E 3CP7A 2CMYA 4IW4E 4BTIB 4H6TA 2OCVB 1EP6A 2HNTC 3PLKA 5AFYH 2STBE 3LGIA 1DY9A 3LH3A 1Z1IA 2Y82A 1O3BA 1AN1E 2ZPRA 1JMOH 2AERH 4XBDA 1FY5A 4AG1A 4MVNA 4WVPE 5C67A 9LPRA 1S84A 1C2FA 3A81A 4X1NU 1EUFA 1S6FA 3BTTE 3FZZA 1ZMJA 2BD3A 1ABIH 2GDEH 1AFEH 1Y5BT 3OTJE 2AGIX 3NCLA 1S85A 2GVFA 1DUAA 4JYTA 1BIOA 1WCZA 4QT8C 4RKOB 2ZFRH 4H4FA 4D9RA 4OS2A 4NIXA 1O3HA 1BQYA 3A88A 1C5TA 1IQJA 1PPGE 4K60A 2JH0D 3SOSA 3VGCC 3P6ZB 1XMNB 1GHWH 3E91A 2A32A 1QJ1B 3GCTF 3FFGA 1OWEA 4GUXA 4AFSA 3UR9A 2OC1A 2VWLA 3SJKA 5CMXH 1IQGA 4Q7XA 5HMAA 4AZ2B 4AGKA 1AE5A 3UNSA 4ZUHA 5DK1A 1O3EA 4OS6A 5JDUB 4LZ1H 4YT6H 1YPHE 2FOGA 2PR3A 1GBLA 4GPGA 1AUJA 3A7TA 3GY5A 3ESTA 3VB4A 1ETRH 7ESTE 3QGNB 2ZGBH 3ELAH 1SGIB 3RXJA 2F3CE 1JRSA 1GHAG 2O8WA 1ORFA 1OWHA 1H9HE 4IMZA 1VITG 1TALA 2FDAA 1SPJA 3GCHC 4IMQA 1L1NA 2BY5X 2PKSB 3RM0H 1ZSLA 3RXRA 1BBRE 2BZ6H 4ZKSU 2AGEX 2CGAA 3SI4H 4UE7H 3PLBA 2NU3E 3A7YA 3CS7A 1MZAA 3PV4A 1YKTA 2P3FH 3VXEH 1C5XB 4IC6A 2PKAB 2G51A 1TFXA 4D76A 1D3PB 1OSSA 4GHTA 4ABGA 4CRBA 2BMGB 1D4PB 1N6YA 3EA8A 1O5CB 2PTCE 3Q3YA 4Y7BA 1HV7A 2Z9LA 1C5WB 2ZTYA 4K1SA 3IG6B 2OUAA 3ZZ8A 1UVSH 1RIWC 3PB1E 1A0HB 1J17T 2PSXA 1S81A 2ZDLA 1HJ9A 2FESH 1FPCH 8KME2 1E34B 2XWBI 2NU1E 1K1LA 4AORA 4X2YA 1O2ZA 3P17H 3UREA 1DE7H 2V35A 4DJZB 2H9HA 1OWJA 1XM1A 1VGCB 3M7QA 2RDLA 1GG6C 3SORA 5PTPA 1ELTA 1TONA 1C5NH 2OC0A 2HOBA 1C5YB 3GICB 3L3TA 4TWWA 2YNBA 1O3OA 1P2KA 4VGCB 1ZSKA 4WY3A 2WYJA 4ABFA 1AE8H 3RC4A 1QJ6B 4FUHA 1GBMA 1HGTH 2W7UA 3T27A 1C1SA 1DVAH 1UHBA 4ABIA 1O3KA 3GOVB 2ZCHP 5A0BA 5GCHF 1ZTKA 1W14U 1H8DH 1S6HA 1Y59T 2OLGA 3K6ZA 3KEEA 3EQ0H 1K1NA 1BTYA 1SOZA 2YOLA 1CGHA 1O3DA 2Y5HA 4B2CA 2BD4A 1AIXH 2GP9B 1F0TA 3MH6A 2BD5A 1P9SA 3LKWA 3PM3A 4Q2KA 4GAWA 1QQ4A 4ZKOU 5EQQA 3F9GA 1IQNA 3H5CB 1LVMA 1MH0A 2AYWA 5LGOA 3M61U 2A45B 1IQIA 1W8BH 1IQFA 4FUBA 5EODA 1SGEE 1C1TA 2VWNA 3P95A 1Q2WA 1C1NA 1SHYA 3MH5A 5C5OA 4K8YA 1ELFA 1Y3YA 4Y76A 1T4VH 4NSVA 1WAYB 1AI8H 2ZF0H 1FJSA 1GI4A 3OSYA 5C2ZA 3SV6A 1BTHH 1NRSH 2PWXA 2TGDA 4KTUA 1UCYE 4AGJA 2ALVA 1Y3XA 2ZEBA 1AWHB 2BY6X 3D65E 4Y6DA 1A4WH 1CT0E 1O2IA 3RXIA 2VH0A 4ISOA 3RXPA 1LHEH 1ZTLA 4B76A 3E1XB 4NWLA 5TCCA 1ETSH 1GHVH 1AVWA 1TNKA 2IOTA 1F2SE 3MU1A 1OYQA 3F9EA 3UNRA 1EPTC 3Q00A 1O3IA 4A7IB 1D3TB 2GT8A 1JOUB 4B71A 1GI5A 1G32B 2TGAA 1ZHPA 3F68H 1WSSH 3AVZA 2D2DA 3F9FA 1C2IA 1JRTA 2ZP0H 3DFJA 4AN7A 1DDJA 1CBWC 3OYPA 4K5ZA 4X2WA 2H6MA 3ZZ7A 1TGBA 1EJAA 1MQ5A 1B0EA 1FMGA 5GDSH 1GCTC 1AFQC 1SGFA 2J9NA 4K2YA 2O8UA 3RC6A 4CRCA 1NFWA 4A1XA 3LOXA 2EA3A 5FCRA 2J95A 1ZJKA 1GDNA 2O8MA 1YCPM 2GX4A 2ZFTA 3S9CA 1IAUA 1TYNA 3M3SA 1J14A 1XUHA 1V2TT 4CR9A 1K1OA 2G8TA 4IC5A 3RXHA 2OQUA 1EOJA 3GCNA 2G4TA 1W11U 2LIZA 3UWIA 4E05H 2M5TA 1GL1A 1AZ8A 2RA0A 3ZVCA 3TK5A 2VU8E 1GGDB 1Z6JH 2ZU1A 1ANBA 3LPRA 1C2EA 3A8CA 1SLVB 4BAKB 1NN6A 1XX9A 4MPWA 2HALA 3M35A 1GI6A 3B9FH 1T8MA 4JYUH 4AOQA 5HM2A 2BVRH 1H1BA 1EAIA 1ZHRA 1K1PA 2Z9GA 2UWOA 7GCHG 3UNQA 1ZMLA 1HAIH 4WH6A 1IOEA 2V6NA 2ODPA 2VH6A 1F0RA 4MNXA 3MMGA 1ELDE 1CU1A 4AFUA 4DIIH 1C2HA 1FV9A 4ZHAA 4F49A 4ESTE 1MUEB 2Z3DA 1DT2A 6GCHF 1Y5AT 2BLOA 4K1EA 3EYDA 1HJ8A 1FY3A 3I29A 3UQOA 3GYMA 2ZC9H 1LQDB 5FX5A 3VFEA 3RXKA 1O2VA 1RFNA 4FUIA 1WBGB 3MU0A 2PSYA 1C5QA 3W95A 5C1UA 1SGNE 2BOKA 1TQ7B 4HTCH 2D1JA 3PMAB 5L30H 2H1UA 1TRNA 3SJ9A 1K9OE 3RU4D 3UUZA 3ZYDA 1RTKA 2AH4X 3RLYH 2NU0E 1SGPE 3SUGA 1LPKB 1YGCH 4THNH 2ZHDA 4XSKU 1DS2E 1E36B 1C5UA 1V6DA 2JH6D 4U01A 2FEQH 4NA7A 3U1JB 1QA7A 2BLVA 4FVBA 3SQEE 2O9QA 3TH3H 2ALPA 2BDHA 3K2UA 4INHA 3L33A 5JBTA 1VJ9U 1C5SA 4DURA 2R9PA 2BY8X 4ASHA 5EW2H 1UTLM 1O5AB 2PGBB 1C1UH 1FY1A 1QGFA 4X2XA 2FMJA 1EB2A 4MDSA 1UCYH 3ATLA 2UUFB 4JZ1A 1J9CH 4HI3A 4Y8XA 1HAHH 3KNXA 3M3TA 5DP5A 3RXTA 1MTVA 4SGAE 4KTCA 3ZVFA 2BTCE 1Y3WA 2TRMA 4Q7ZA 3UTUH 2V0BA 2A7JA 2ZI2H 1FIWA 4TPIZ 1HAVA 1E38B 1S83A 2Y5GA 1ZLRA 1ZR0A 2VIOA 2ZHFH 2W5EA 3RXBA 2PV9B 3RP2A 1CA0C 2KAIB 1DWBH 1F5KU 3SV7A 2O8TA 1G3BA 1OPHB 3E3TA 2FIRH 2QF3A 2GMTB 3ODDA 3ZZDA 4O3TA 2Z3EA 4I33A 1EZQA 2A1DB 1HRTH 1C2DA 2B0FA 1LHCH 3SNEA 4LXBH 4MG3A 1O2YA 1XXDA 2ZGXH 4O97A 1TNLA 3S0NA 4I31A 2BD7A 1G2LA 4BTUB 2HVXA 3P70B 3A7WA 2WPLS 4CBNA 4IN2A 3H7TA 3A8BA 2BXTH 4B2BA 1GHBG 3T26A 3SGBE 4D8NA 1HJAB 1NZQH 3RXAA 1C1PA 8LPRA 3U8TH 1MCVA 2WUBA 4GCHF 3STJA 3MHWU 3SU2A 2VIVA 3S69A 2PLXA 4JCNA 2FWWA 1C1WH 1NRNH 5F6MA 3OY6U 1NFUA 1FN8A 1YC0A 2G55A 1O33A 2F9BH 1CVWH 1MKXH 1AWFH 1F92A 3SV2H 1OWDA 1QQUA 3KQCA 3NPSA 4Y11E 1CGIE 1NRQH 1P2IA 1W0YH 3A84A 1O34A 1WQVH 1TE0A 3S9BA 1C1VH 4TY7A 1TPSA 1CGJE 1SLXB 4OS4A 1C2LA 1DY8A 1GJ8B 1VCWA 9ESTA 2AGGX 1A3BH 2QYIA 1EJMA 1O5EH 3A83A 3A7XA 5F03A 2B9LA 2QN5T 3D62A 1HAGE 3ZZCA 3SHAH 3TGKE 4WXIA 1BCUH 1P2OA 2G00A 1VITH 3SNBA 3ZVBA 1T7CA 4KP0A 1VZQH 1GHYH 1PQ8A 4MNYA 2Y7XA 4I8HA 1XKAC 3TJUA 1GBBA 2W3KA 3FAOA 1GI1A 2AS9A 3V0XA 1AVXA 2VVUA 4YTAA 1L2EA 1NM6A 1EP5A 3BTFE 1G30B 1P01A 5A09A 4UFGH 4Q80A 1BHXB 5A8YA 2ZIQH 3IWMA 4YO9A 3B8JA 4I7YH 5CHAB 1NO9H 1BTUA 1SGCA 1GBTA 1KTSB 1SR5C 1EOLA 1MBQA 2F9OA 5JBBS 4IN1A 1PYTD 2V3HH 3KGPA 1BB0B 3ZZ6A 3PO1C 3ZZBA 1TLDA 3RU4E 1V2JT 1AKSA 1WUNH 1QIXB 1ELVA 5L2YH 1O2HA 3JZ1B 2SGDE 4JMYA 3A7VA 1X7AC 2QXJA 2Q6DA 4E7NA 1XKBC 4MNVA 6CHAC 1OWKA 1XUIA 1G9IE 3TJOA 2P95A 1TNHA 1NTPA 1HLTH 5A0AE 3KL6A 3HPTB 4K1TA 3SUEA 1OXGA 2DE8A 2ZTXA 4BAMB 2CV3A 2A2QH 1Z8IB 4Y79A 3VPKA 2BM2A 1P0SH 3EA9A 2ZDMA 1SI5H 3RXUA 3TIUA 1YLDA 3ZVAA 2FOFA 3KCGH 4TPYA 3E0NB 3EA7A 5DO4H 1C2KA 2XBWA 1GVLA 1A46H 2Y6TA 4NIWA 2BD9A 2BLWA 2VGCB 5CE1A 4YZUA 3TNSA 2BDAA 1LCYA 3QZQA 5FPYA 2F83A 1EAXA 2B8OH 2C90B 2BHGA 2ASUB 1LKBA 4MPVA 1PPEE 3NWUA 2D8WA 1SVPA 1YPHC 1O3AA 2BQWB 2C8YB 1MU8B 1K28D 2CF8H 2ULLA 1SG8B 1EJNA 4YESB 4BAQB 1P2QA 1C2MA 3BG4B 2ZGJA 2BY7X 3D23A 4YLQH 1V2PT 2HWLB 1XUJA 1LDTT 2PUQH 1MD8A 2B5TB 2AFQB 3V7TA 1GJAB 1WV7H 2G4UA 1Z8RA 3ENSB 3U98H 1O3MA 4I32A 2ZTZA 3TVJB 5EQSA 3F9HA 2ZU2A 1GHAF 3SBKA 4DGJA 1GMDG 4DOQA 1VITF 1QCPA 1HAZB 1TBRH 5DKMA 3SW2B 1V3XA 3LGUA 2SGEE 2Q1JA 1FAXA 1OX1A 2CXVA 1G3EA 1UK4A 2SFAA 2FTMA 2VIWA 2R3YA 3QUMP 3EAJA 1QRZA 2BD8A 3GY6A 4ABHA 5ESBA 2ODYB 2TIOA 1TNGA 1ZTJA 3MNSA 1HAOH 1GBEA 2HPQH 1UTNA 1BJUA 1DLKB 2WV5A 3VGCB 1K1IA 1IQMA 4NA8A 1G36A 1UVPA 3SI3H 1QURH 3VB6A 1MD7A 1O38A 2FOBA 3QN7A 1TBQH 1BTZA 2Z3CA 1ETTH 4JYVH 1QBOA 3FP6E 1Y3VA 2IN2A 1J15A 2J4IA 4JZIA 2GV7A 3QDZB 1SFQB 1KLJH 1TPAE 1TX8A 1BJVA 3MFJA 4YOIA 2GTBA 3TITA 1W2KH 1P06A 2PTNA 3TJNA 8GCHG 1UK3A 3TJVA 1MCTA 5GWZA 1K2I1 1GI3A 2ANWA 3DHKH 3LJJA 5FX6A 1ZRBA 3GCHB 1XUGA 2NWNA 1IHSH 1DOJA 1DWEH
chains in the Genus database with same CATH superfamily
1GI2A 1VGCC 4KKDA 1K1MA 1FZZA 1YF4A 4YM9A 5AF9H 3E90B 3NRLA 1IHTH 1O0DH 1O2XA 5EGMA 3MH7A 1TOCB 1QL9A 1F0SA 1MTWA 1A61H 4H42U 3BTHE 1THPB 2BD2A 1ZPBA 4MLFB 2GJGA 1KTTB 3RXSA 1UTQA 2G5NA 4LOYH 3URCA 4Y8ZA 1YPKH 1SQAA 2OP9A 1TX6A 2F9VA 2TGPZ 1UTPA 2ZO3H 3QTOH 3E0PB 4R8TB 4TSFD 3T5FH 2I6SA 5A2MH 2F4LA 1EZSC 5HKKD 4FUJA 3DSPA 4ZMAH 1O2MA 2ANKH 3KN2A 2HPPH 2GCHF 1KMHB 5HGGA 2CHAC 2H5CA 1TGNA 3F2FA 3N99A 4B1TA 2GZ7A 2V7QD 1GMHG 1BRBE 4INKA 2GCTB 2QY0B 3SU0A 4B75A 1ZMNA 2EQNA 1NS3A 2PP6A 2QF0A 3U1IB 3F0OA 1BMAA 4AFZA 3UFAA 2PUXB 3R0FA 2VIQA 1V2QT 1W7XH 1SC8U 3IITA 3RXGA 3M5OA 2SNWA 2Y7ZA 1YCPK 3AAUA 2HLDD 4AB8A 1P9UA 4U30A 1THRH 1XUFA 1KXCA 3UPEA 2AHME 1BZXE 4RT1A 3RXFA 3WWFA 1Y5UT 1ABJH 1GJDB 2J98B 3TNTA 4CR5A 3PTBA 1SFIA 3BN9A 1QY6A 2Z9KA 2ANYA 2UWPA 2Y80A 2SGFE 3MU5A 1Z8JB 1L1JA 3QZRA 1CHOG 3BTQE 3SU1A 4ABAA 4X8UH 4GHQA 5DP9A 5A0CA 5DPAA 5EXMA 4YOGA 4SGBE 1OP8A 2QXIA 2GD4B 3KHVA 3FP8E 2JETB 2UUKB 4O3UA 1JIMA 1ZSJA 4ZCNA 1QRWA 3SNAA 1HB0B 4FUDA 4NZLA 3BF6H 4B73A 2BOHB 2A31A 1H8ED 2VNTA 3UAIC 1NU9A 1GJCB 1RRKA 1QA0A 2FI4E 2EC9H 2RFKC 1DM4B 1PJPA 1WOFA 1FX0B 3VB3A 1WXRA 1GCDA 2BVSH 3MH4A 2R2MB 5A8ZA 1NFXA 4XOJA 3BIUH 1BDAA 1EPTB 3FOAA 1S5SA 1V2MT 1AU8A 5F8ZA 4BXSA 1BTXA 1BBRH 3SJ8A 3QX5H 1E0FD 1TAWA 3TPIZ 1G37A 1N8OC 5G4BA 5HXFA 5K0HA 2A5IA 7GCHF 1BHXF 5J4QA 1Y3UA 3RXOA 1GGDC 2P93A 3V3MA 3KIDU 1C5RA 3O8CA 3RMLH 2V3OH 3ATKA 1FNIA 3OEED 3NUMA 2VVCA 4X6PA 5LPFA 2O8LA 1GCTB 3M3VA 1CT4E 1LVBA 1KXAA 1QTFA 2H9EH 1EZXC 4DCDA 2P3TB 3SQHE 3H7OA 3NZIA 4X1QU 4XFQA 3UQVA 1YPGH 2VVVA 3EE0B 1HAYB 4NIVA 1KLTA 2WUCA 4RT0A 1NBMD 2ZHEH 3FP7E 3SGQE 1LMWB 1SGTA 2HRVA 3R3GB 5E2OA 1H9IE 1FY4A 5EJZA 2J92A 1GVZA 1UK2A 4D7FA 1W13U 1QRXA 5EG4A 1P2JA 1J8AA 2PKAA 2ZFFH 1S0RA 5C94A 2W26A 5B6OA 1KY9A 1P3CA 1UVOA 1ZYOA 4K69A 4AFQA 3ATWA 1N1LA 1O2WA 3A82A 1KXBA 5GIBA 4YT7H 4ISIH 2ZQ1A 1KLIH 3BG8A 1GBJA 4D7GA 2QGRA 1QBNA 2QV1A 5K7RA 4GSOA 5C3NA 1ZRKA 2WYGA 2QXHA 2HGTH 1V2ST 1SQOA 1GBKA 4Q7YA 1FUJA 3F3BA 1AGJA 1O2SA 1SLWB 3BTKE 1YPJH 1A7SA 1ZJDA 1L1GA 1NRRH 1FY8E 2FI5E 2FTLE 4BAHB 1HFDA 3OU0A 1HIAB 1OWIA 1GI8B 1O31A 4ZH8A 1P09A 4KTSA 3T62A 3ZVDA 4J1YA 1EATA 3S7KB 3O8BA 1PPHE 3RXMA 3DT0H 1BMNH 2ZDNA 5JYIA 1WTHD 2GGVB 4RN6A 1A3EH 1GL0E 2JJ1D 1V2UT 1V2VT 3RUOA 1FDPA 3JZ2B 4XBBA 3SU4A 2Z94A 3LT3A 1VR1H 4NFEA 5DP8A 1B7XB 1M9UA 1TPPA 3PRDA 3SV8A 4YOJA 4ACBA 1XVMA 3PWBA 3MU8A 4UFEH 3LIWA 1GBDA 1UO6A 5C0TA 1O39A 1A0JA 3OE7D 3VB7A 3AW0A 1HXFH 2Z7FE 1MKWK 3PWCA 2H5DA 1C5OH 1ZHMA 1QB6A 2BZAA 2BQ7B 3V12A 1Y8TA 2RG3A 4NGAH 2FLBH 1MMJN 1DLEA 2A4QA 2BYAX 2ILNA 5DG6A 1S82A 1XUKA 3HK6B 3T2NA 1DUEA 3A80A 2Z6BD 4Y71A 1AUTC 1FAKH 2OTVA 3U8OH 1FPHH 2FX4A 3P8OA 4FVDA 5JB9S 2F91A 3F6UH 4TY6A 4FETA 4Y10E 3MYWA 1DWCH 2FOAA 1XXFA 1VJAU 3GY7A 5GNDA 1JBUH 4NWKA 1MTNB 3SU6A 4MPUA 2Z9IA 1HYLA 4YXWD 3BSQA 2W3IA 1NRPH 1ELCA 3BTME 2ZHQH 3SJOA 1AY6H 4WXVA 3LDXH 4BTTB 1SGFG 1GHBF 1HCGA 1P3EA 3OTPA 3UOUA 5DGJA 1A5IA 2ZPQA 1E37B 5DP4A 1UJ1A 2GZ8A 4ZKNU 2EI7A 1S6LA 1AB9B 2ZFQH 1D9IA 3M36A 5JPMH 1P2MA 2FLRH 1D3DB 2EI6A 2V3MA 1W0ZU 3L6PA 4DY7B 4ZHMU 4J2YB 1CA0B 1HJAC 5AFZH 4RSPA 5HIYA 1RD3B 4M7GA 3T25A 2ZDVH 1C1RA 2LP6A 2HVYB 3FZDA 1GI9B 2XBYA 1QFKH 1LHDH 1GJ4H 5L6NH 3GY8A 2FYQA 2ZCKP 2B7DH 3S7HB 1ZGIA 1MTSA 1UTKA 3D49H 4NIYA 2CJIA 2P8OC 1N6XA 4ZAEA 2H2ZA 1RJXB 1TOMH 4WJG2 5AVDA 2KZ4A 1TA6A 5FCKA 2WPJS 4O9VA 3HK3B 4B2AA 2RA3A 1VCQA 4CHAC 5EPNA 3SUFA 3M5LA 1H4WA 1HBTH 3TK9A 5A8XA 1O37A 2KM0A 3DFLA 1O3LA 4JK5A 4K3JA 1TBZH 2CF9H 5FL7D 1QZ8A 4WMFA 1NC6A 1KXFA 2HLCA 3GISB 3MO9A 2AMDA 4WMEA 1HDTH 3UOPA 1WU1A 1YYY1 3ITIA 5AHGH 1TQ0B 4DW2U 1G2MA 4WMDA 1TIOA 3A85A 1SQRA 4DIHH 1INCA 4TWYA 1MABB 1EXFA 5T6GA 2EI8A 3TU7H 1TGCA 1GMCG 1ZPCA 1F5RA 1NBME 1KXDA 4GLYA 4LK4A 3GDSA 4AC9A 5IDKA 2BVXH 3SN8A 2OXSA 3PYHA 5T6DA 4OGYA 4MPXA 1QJ7B 2FOCA 4X1SU 5KGOA 3ZV8A 2K7XA 2FX6A 1NU7B 2ZECA 3MQKC 1O2TA 2ZKSA 4JZEH 1CA8B 1LPGB 4ISNA 3U69H 1HUTH 3TGJE 2J34A 1LHFH 1P04A 4UONA 5GPIB 1P11E 3GYLB 3ZZAA 1NROH 2IJD1 1AHTH 3RC5A 2KR7A 3QTVH 4X0WU 3SNCA 1NT1A 5FXLA 1UHBB 2C4FH 3KF2A 1YM0A 1V2KT 3BEUA 5FAHA 1YP9A 3FN8A 1NY22 1THSH 1BRAA 1ZPZA 2ZU5A 1ARCA 5LH8A 1ANEA 2R2WU 2A2XH 1GBAA 5C1XA 3GY2A 1DWDH 2D26C 1BRUP 3DUXH 1V2WT 1OKXA 3NK8A 3QGJA 1TABE 1QB1A 2ZGCA 3PO1B 1K22H 3GDUA 1HNEE 2FOMB 1Z6EA 4CH2B 6LPRA 2XW9A 3UIRA 1YY3A 1AZZA 4ABBA 1O2KA 1O2RA 1TRYA 2C8WB 1A5HA 1JXPA 2OK5A 2SGPE 2PFEA 4BANB 1GMDF 1FONA 6CHAB 1KDQA 3BG4C 3I78A 3QWCH 5DP7A 4K8BA 1J16A 3A86A 4CRDA 4NZQA 3UWJH 1O3CA 4ISHH 2ZDKA 2WPMS 5I25A 2ZG0H 2W7SA 1FXYA 2AEIH 2UUJB 4U32A 2YNAA 2BDYA 1ARBA 1O32A 2FS8A 3PTNA 1QNJA 1GJ5H 3VXFH 1C2GA 3BIVH 1TX7A 3RDZA 5C5NA 1PQAA 1T8NA 1ZOMA 2FP7B 3DA9B 3ATIA 1L4ZA 2P59A 2KAIA 5ETXA 2BY9X 1BRCE 1P2NA 1IQKA 3TGIE 4CRFA 1DANH 4NG9H 3GY3A 1WQSA 1FQ3A 2VB0A 3K9XB 2HNTE 1DX5M 2ANMH 1C5ZB 4KGAA 5EQRA 1Z8GA 1O3NA 3C1KA 3EGKH 4CRGA 6ESTA 3SHCH 4Z1MD 2ZGHA 2FI3E 5KEDA 5EOKA 3T29A 1KIGH 4OM9A 3SGAE 4B6EA 8GCHF 3PMBB 4B74A 1H8HD 1LO6A 1Q3XA 2PKSC 4TYDA 4OS7A 3FKSD 4XD7D 4ABDA 1B5GH 1SGYE 4O03A 4X6OA 2PW8H 1QL7A 4AYYB 3KQDA 2XBVA 4BAOB 1BBRK 3RMOH 5F8XA 1CHGA 2XOKD 1O2LA 1HAPH 1KSNA 4BXWA 2ZDAH 2OBQA 3QO6A 1CE5A 1V2OT 3ZZ3A 2VWOA 2BX4A 2FM2A 3GCTG 3TH4H 2K8IA 4WF8A 2QAAA 3A8DA 1SGRE 2CN0H 2QF5A 2UWLA 8ESTE 3A7ZA 3MNCA 3RMMH 3E6PH 3MI4A 2VINA 2FOHA 1P03A 2BDIA 4I8LA 4ZKRU 2TPIZ 1MAXA 4MNWA 1EB1H 4RKJB 1EQ9A 3VEQB 4I8KA 3WY8A 2C8XB 3WWBA 5HM9A 2THFB 2STAE 3EDXB 3TK6A 1B0FA 2QIQA 2OQ5A 5DP6A 1PYTC 1GDQA 3BTDE 4XRNA 4VGCC 1GMHF 5FHTA 2A4GA 3HKIB 4NA9H 1PPBH 1BTPA 2EEKA 1PFXC 3RMNH 1OP0A 3MO6A 1SLUB 3P8GA 2ZFSA 3I77A 3BV9B 4A5TS 1EASA 3KQEA 1Z1JA 1UVUH 3A87A 3VB5A 2ZNKH 4X8VH 1C1MA 4UFDH 1RIWB 1YLCA 2AIQA 3B23B 4X6NA 3Q3XA 2FODA 3SJIA 1GI0A 1LQEA 1LVOA 2XNIA 2FS9A 2GCTC 2IJOB 1O2OA 1EX3A 4WWYA 3CNRA 5C1YA 4JK6A 3T28A 1K0HA 1ANDA 1GG6B 4PROA 3DD2H 1IQLA 4A1TA 4XBCA 3NXPA 2P16A 1O2GH 3GY4A 5FBEA 5J4SA 5CHBA 1T4UH 3MNXA 1OYTH 1BMFD 1CHOF 1ESTA 1W10U 2KCPA 4E7RG 4FU7A 1P57B 4ZHLU 4FUGA 4I8JA 1P12E 2Q6GA 3SUDA 2CHAB 5SGAE 2XRCA 5L2ZH 1C5VA 3G01A 2F9NA 1BTWA 1YPMH 3BEFB 4HGCA 4HZHA 3W1EA 1W0JD 2Z9JA 4A6LA 1EZUC 3SO3A 3AK5A 2C93B 2OC7A 2R0LA 4Y0YE 1O35A 4FUFA 4ASUD 1UCYK 4OGXA 4XDEA 1HAVB 3RXVA 2C3SA 1LVYA 2VIDA 1SGDE 4H6SB 2FO9A 2JETC 3HGPA 1L4DA 3N7OA 1GBHA 1U6QA 2GCHG 1O5BB 1NFYA 2J5UA 2ZPSA 1OOKB 4ISLA 2VIPA 1TGTA 2LPRA 3TH2H 5GCHG 2GT7A 1D6WA 3FVFB 1ACBE 1CT2E 3NKKA 1VCPA 1ELGA 3LU9B 1FIZA 2BB4A 2F9PA 5EW1H 3SZNA 1ELAA 1Q31A 4FUCA 1ESAA 4U2WA 1O36A 2XCNA 2BDBA 3W94A 2Q6FA 2A5KA 1NPMA 3AASA 1IQEA 4XE4A 1CQQA 3O8DA 3BTGE 2DE9A 3LGTA 2WHXA 1L0ZA 1WTGH 4FUEA 1P10A 3P8FA 3STIA 3C27B 3HGNA 4X2VA 1TMUH 4IBLH 1LHGH 1SL3A 1AVGH 3CS0A 5HYOA 5E0JA 3ZVEA 1HXEH 1VKYA 2WV9A 1DPOA 1AMHA 5DP3A 3M37A 1O2UA 3M5MA 3QLPH 2JH5D 3MWIU 2JIZD 2BXUH 1C9PA 4IGDA 5GJ4B 1GVKB 1C1OA 1F5LA 3MNBA 1CBWB 1C5PA 1F0UA 1FLEE 1P02A 1UTJA 1TNJA 4FU8A 4DG4A 2P3UB 2WZQA 5TJXA 3RU4T 1RXPA 1GPZA 1K1JA 3PROA 1ELEE 1MZDA 1AFQB 3KYGA 3K65B 5LPRA 3ZV9A 4JZDH 2JDID 4CREA 5C20A 2WPIS 1DICA 1TPOA 4X1PU 5E2PA 1HPGA 3RXLA 1GJ9B 1N8OB 2ZCLP 1O2PA 1BT7A 1EAWA 2BQ6B 4OS5A 5EIYA 2LNCA 3HATH 1MKXK 3SNDA 2WV4A 2I6QA 2RCEA 1JWTA 1QB9A 2GKVE 5H4IB 1ANCA 1T32A 2UUYA 1FN6A 4D9QA 4UDWH 1TRMA 4DT7B 1E1QD 2OD3B 3ZZ9A 2VJ1A 1O2NA 2XCFA 1W3CA 2XC0A 2BX3A 1CSOE 5FBIA 1G3DA 2ZWLH 1P05A 1EKBB 2IPHA 3GCOA 2SGAA 3PMHB 1T31A 4JZFH 3SU5A 5GXPA 4CBOA 2KFWA 4ZXXH 3QK1A 2JKHA 2ZZUH 4RI0A 1MU6B 1GJBB 1OHHD 4UFFH 5E0HA 3KQBA 1MTUA 1O2QA 2PGQB 2FXRA 2ZHWH 1RTFB 3TLOA 3V13A 4I86A 2GDDA 1DITH 1MAYA 1O5DH 3ODFA 1KYNA 2G81E 1DXWA 3U8RH 4YLUA 3BTEE 2HNTF 3ZYEA 3CENA 1A5GH 1GHXH 2ESTE 3LGWA 4A92A 1RTLA 1DSUA 5CDFE 1SHHB 2GZ9A 1DFPA 3DSGA 1O3FA 4ABJA 1AKSB 1UTMA 3MTYA 3UY9A 1C9TA 2DUCA 1SSXA 1YPLH 5I46H 4NCYA 4NFFA 3LGYA 3O8RA 2BDCA 3RLWH 1PPFE 5T6FA 4BOHA 1BOQA 5EXLA 4P02A 2SGQE 4IS5A 1W12U 5ESTE 5JB8S 2FZZA 2OINA 1KXEA 1GI7B 3LC5A 6GCHG 3SU3A 1C5LH 1O3PB 1GBCA 4R0IA 4AB9A 3RM2H 4Y0ZE 1YCPH 2WPKS 1O3GA 1AD8H 2J2UA 3RXCA 3EBNA 5EXNA 1BMLA 1LKAA 1C1QA 1AO5A 3BTWE 1ELBA 1TWXB 3VG8A 2OBOA 4DVAU 4DT4A 1MTNC 2SNVA 2H9TH 5E0GA 1QBVH 1SMFE 3MU4A 1O5GH 1H8IH 1TMTH 1CO7E 4UEHH 5JBCS 3SV9A 2ZU3A 4NSYA 4OS1A 5EU8A 2AIPA 1TGSZ 1IQHA 1KDQB 4X8SH 3K6YA 1GDUA 2AMPA 2TBSA 2GMTC 1ESBA 3LGVA 2ZU4A 2ODQA 3LC3A 1SOTA 2XC4A 5BPEA 2J98A 3LJOA 1C4U2 3Q76A 1D6RA 2WINI 2XBXA 1LTOA 1AB9C 3P92A 1GBIA 4FXGH 1MQ6A 4MTBA 3RXQA 1QL8A 1O2JA 4ZXYH 1RS0A 5FPTA 1TNIA 1PPCE 3Q3KA 1AQ7A 3SYJA 2WPHS 3PLPA 1TB6H 3AAVA 4Z6AH 2XWAA 1TMBH 3AW1A 1ZGVA 1EAUA 1ZZZA 3OY5U 1C2JA 3E8LA 1OP2A 1V2RT 1SB1H 3RXDA 1GWAA 1Z71A 1PQ7A 3P8NA 2VWMA 3UR6A 5LPEA 7LPRA 2Y81A 3LONA 1C5MD 1C4V2 1A2CH 2ZQ2A 3DSOA 5DSFA 1QR3E 1F7ZA 1A0LA 1G3CA 3M7TA 4INLA 1GMCF 1EPTA 3ZZ4A 5BRRE 1SBWA 2R3UA 4I8GA 7KMEH 1V2NT 3LH1A 2G52A 4FU9A 1GBFA 1YPEH 5TCAA 4E06H 2F9UA 2XYAA 4HFPB 2XXLA 5IYTA 2ZA5A 1D3QB 1JIRA 1BMMH 2IPQX 2FYRA 2A4OA 1BITA 2BDGA 1QHRB 4MQAA 5EPYA 5ABWA 3ATMA 4CRAA 1NESE 1XVOA 2P8OB 2G5VA 1E35B 5FPSA 4X1RU 4AX9H 2QA9E 1GHZA 1Z7KA 1WYKA 1S0QA 3M7UA 3MO3A 3OAAD 5T3HA 3GDVA 2XTTB 4CHAB 4AYVB 4WH8A 4X8TH 3PMJA 3S9AA 4Y7AA 2XC5A 1T8OA 2A7CA 3HKJB 1O5FH 2A0QB 4GCHG 5E8EH 2P94A 2Y5FA 1P8VC 2QXGA 1BA8B 2A5AA 2GV6A 4A1VA 1ID5H 3A89A 5DJ7A 5CHAC 2J94A 1V2LT 1UMAH 3F1SB 1DXPA 1PQ5A 3URDA 2AMQA 1O3JA 1H9LB 3MOCA 1SQTA 4ZROA 1OS8A 3BEIB 2OC8A 4LZ4B 4Z0KA 1RGQA 1TA2A 2FPZA 2C8ZB 2R0KA 4KELA 3ZVGA 1YBWA 4Y8YA 1SGQE 1T8LA 5F8TA 2K1QA 4ABEA 4BNRA 1O30A 3M5NA 1HIAA 1LPZB 2J38A 1MBMA 1HAXB 3RXEA 4UD9H 1PPZA 2PHBA 3U9AH 2BLQA 2FOEA 3A8AA 2QC2A 3Q77A 2ZFPH 1BUIA 3FANA 4CH8B 1W7GH 1UTOA 3OX7U 3PV2A 1FI8A 1DSTA 1K21H 4X6MA 1MKWH 2A4RA 1C4Y2 1GJ7B 1E79D 2TGTA 1GJ6A 3E16B 4F4OC 2NU2E 2VGCC 2QCYA 4GVUA 1W0KD 5EJLA 3ZZ5A 5JBAS 1UVTH 2QE7D 4AG2A 1A1RA 2A7HA 2NU4E 3CP7A 2CMYA 4IW4E 4BTIB 1YLNA 4H6TA 2OCVB 1EP6A 2HNTC 3PLKA 5AFYH 2STBE 3LGIA 1DY9A 3LH3A 1Z1IA 2Y82A 1O3BA 1AN1E 2ZPRA 1JMOH 2AERH 4XBDA 1FY5A 4AG1A 4MVNA 4WVPE 5C67A 9LPRA 1S84A 1C2FA 3A81A 4X1NU 3WW7A 1EUFA 1S6FA 3BTTE 3FZZA 1ZMJA 2BD3A 1ABIH 2GDEH 1AFEH 1Y5BT 3OTJE 1YWUA 2AGIX 3GS9A 3NCLA 2YMSC 1S85A 2GVFA 1DUAA 3F2GA 4JYTA 1BIOA 2JJ2D 1WCZA 4QT8C 4RKOB 2ZFRH 2RDEA 4H4FA 3SZEA 4D9RA 4OS2A 4NIXA 1O3HA 1BQYA 3A88A 1C5TA 1IQJA 2CK3D 1PPGE 2M2AA 4K60A 2JH0D 3SOSA 3VGCC 3P6ZB 1XMNB 1GHWH 3E91A 2A32A 1QJ1B 3GCTF 3FFGA 1OWEA 4GUXA 4AFSA 3UR9A 2OC1A 2VWLA 3SJKA 5CMXH 1IQGA 4Q7XA 5HMAA 4AZ2B 4AGKA 1AE5A 3UNSA 4ZUHA 5DK1A 2F43B 1O3EA 2KCYA 5IK2D 4OS6A 5JDUB 4LZ1H 4YT6H 1YPHE 2FOGA 2PR3A 1GBLA 4GPGA 1AUJA 3A7TA 3GY5A 3FO8D 3ESTA 3VB4A 1ETRH 7ESTE 3QGNB 2ZGBH 3ELAH 1SGIB 3RXJA 2F3CE 1JRSA 1GHAG 2O8WA 1ORFA 1OWHA 1H9HE 4IMZA 1VITG 1TALA 2FDAA 1SPJA 3GCHC 4IMQA 1L1NA 2BY5X 2PKSB 3RM0H 1ZSLA 3RXRA 1BBRE 2BZ6H 4ZKSU 2AGEX 2CGAA 3SI4H 4UE7H 3PLBA 2NU3E 3A7YA 3CS7A 1MZAA 3PV4A 1YKTA 2P3FH 3VXEH 1C5XB 4IC6A 2PKAB 2G51A 1TFXA 4D76A 1D3PB 1OSSA 4GHTA 4ABGA 4CRBA 2BMGB 1D4PB 1SKYE 1N6YA 3EA8A 1O5CB 2PTCE 3Q3YA 4Y7BA 1HV7A 2Z9LA 1C5WB 2ZTYA 4K1SA 3IG6B 2OUAA 3ZZ8A 1UVSH 1RIWC 3PB1E 1A0HB 1J17T 2PSXA 1S81A 2ZDLA 1HJ9A 2FESH 1FPCH 8KME2 1E34B 2XWBI 2NU1E 1K1LA 2KCOA 3PV5A 4AORA 4X2YA 1O2ZA 3P17H 3UREA 1DE7H 2V35A 4DJZB 2H9HA 2KCAA 1OWJA 1XM1A 1VGCB 3M7QA 2RDLA 1GG6C 3SORA 5PTPA 1ELTA 1TONA 1C5NH 2OC0A 2HOBA 1C5YB 3GICB 3L3TA 2L74A 4TWWA 2YNBA 1O3OA 1P2KA 4VGCB 1ZSKA 4WY3A 2WYJA 4ABFA 1AE8H 3RC4A 1QJ6B 4F48B 4FUHA 1GBMA 1HGTH 2W7UA 3T27A 1C1SA 1DVAH 1UHBA 4ABIA 1O3KA 3GOVB 2ZCHP 5A0BA 5GCHF 1ZTKA 1W14U 1COWD 1H8DH 1S6HA 1Y59T 2OLGA 3K6ZA 3KEEA 3EQ0H 1K1NA 1BTYA 1SOZA 2YOLA 1CGHA 1O3DA 2Y5HA 4B2CA 2BD4A 1AIXH 2GP9B 1F0TA 3MH6A 2BD5A 3UB0A 1P9SA 3LKWA 3PM3A 4Q2KA 4GAWA 1QQ4A 4ZKOU 5EQQA 3F9GA 1IQNA 3H5CB 1LVMA 1MH0A 2AYWA 5LGOA 3M61U 2A45B 1IQIA 1W8BH 1IQFA 4FUBA 5EODA 1SGEE 1C1TA 2VWNA 3P95A 1Q2WA 1C1NA 1SHYA 3MH5A 5C5OA 4K8YA 1ELFA 1Y3YA 4Y76A 1T4VH 4NSVA 1WAYB 1AI8H 4P00A 2ZF0H 1FJSA 3H09A 1GI4A 3OSYA 2K0QA 5C2ZA 3SV6A 1BTHH 1NRSH 2PWXA 2TGDA 4KTUA 1UCYE 4AGJA 2ALVA 1Y3XA 2ZEBA 1AWHB 2BY6X 3D65E 2WPDD 4Y6DA 1A4WH 1CT0E 1O2IA 3RXIA 2VH0A 4ISOA 3RXPA 1LHEH 1ZTLA 4B76A 3E1XB 4NWLA 5TCCA 1ETSH 1GHVH 1AVWA 1TNKA 2IOTA 1F2SE 3MU1A 1OYQA 3F9EA 3UNRA 1EPTC 3N7DA 3Q00A 1O3IA 4A7IB 1D3TB 2GT8A 1JOUB 4B71A 1GI5A 1G32B 2TGAA 1ZHPA 3F68H 1WSSH 3KYFA 3AVZA 2D2DA 3F9FA 1C2IA 1JRTA 2ZP0H 3DFJA 4AN7A 1DDJA 1CBWC 3OYPA 4K5ZA 2XNDD 4X2WA 2H6MA 3ZZ7A 1TGBA 1EJAA 1MQ5A 1B0EA 1FMGA 5GDSH 1GCTC 1AFQC 1SGFA 2J9NA 4K2YA 2O8UA 3RC6A 4CRCA 1NFWA 4A1XA 3LOXA 2EA3A 5FCRA 2J95A 1ZJKA 1GDNA 2O8MA 1YCPM 2GX4A 2ZFTA 3S9CA 1IAUA 1TYNA 3M3SA 1J14A 1XUHA 1V2TT 4CR9A 1K1OA 2G8TA 4IC5A 3RXHA 2OQUA 1EOJA 2W6JD 3GCNA 2G4TA 1W11U 2LIZA 3UWIA 4E05H 2M5TA 1GL1A 1AZ8A 2RA0A 3ZVCA 3TK5A 5HIZA 2VU8E 1GGDB 1Z6JH 2ZU1A 1ANBA 3LPRA 1C2EA 3A8CA 1SLVB 4BAKB 1NN6A 1XX9A 4MPWA 2HALA 3M35A 1GI6A 3B9FH 1T8MA 4JYUH 4AOQA 5HM2A 2BVRH 1H1BA 1EAIA 1ZHRA 1K1PA 2Z9GA 2UWOA 7GCHG 3UNQA 1ZMLA 1HAIH 4WH6A 1IOEA 2V6NA 2ODPA 2VH6A 1F0RA 4MNXA 3MMGA 1ELDE 1CU1A 4AFUA 4DIIH 1C2HA 1FV9A 4ZHAA 4F49A 4ESTE 1MUEB 2Z3DA 1DT2A 6GCHF 1Y5AT 2BLOA 4K1EA 3EYDA 1HJ8A 1FY3A 3I29A 3UQOA 3GYMA 2ZC9H 1LQDB 5FX5A 3VFEA 3RXKA 1O2VA 1RFNA 4FUIA 1WBGB 3MU0A 2PSYA 1C5QA 3W95A 5C1UA 1SGNE 2BOKA 3F2HA 1TQ7B 4HTCH 2D1JA 3PMAB 5L30H 2H1UA 1TRNA 3SJ9A 1K9OE 3RU4D 3UUZA 3ZYDA 1RTKA 2AH4X 3RLYH 2NU0E 1SGPE 3SUGA 1LPKB 1YGCH 1E1RD 4THNH 2ZHDA 4XSKU 1DS2E 1E36B 1C5UA 1V6DA 2JH6D 4U01A 2FEQH 4NA7A 3U1JB 1QA7A 2BLVA 4FVBA 1EFRD 3SQEE 2O9QA 3TH3H 2ALPA 2BDHA 3K2UA 4INHA 3L33A 5JBTA 1VJ9U 1C5SA 4Q63A 3OFND 4DURA 2R9PA 2BY8X 4ASHA 5EW2H 1UTLM 1O5AB 2PGBB 1C1UH 1FY1A 1QGFA 4X2XA 2FMJA 2LELA 1EB2A 4MDSA 1UCYH 3EE7A 3ATLA 2J97A 2UUFB 4JZ1A 1J9CH 4HI3A 4Y8XA 1HAHH 3KNXA 3M3TA 5DP5A 3RXTA 1MTVA 4SGAE 4KTCA 3ZVFA 2BTCE 1Y3WA 2TRMA 4Q7ZA 3UTUH 2V0BA 2A7JA 2QF4A 2ZI2H 1FIWA 4TPIZ 1HAVA 1E38B 3ZIAD 1S83A 2Y5GA 1ZLRA 1ZR0A 2VIOA 2ZHFH 2W5EA 3RXBA 2PV9B 3RP2A 1CA0C 2KAIB 1DWBH 1F5KU 3SV7A 2O8TA 1G3BA 1OPHB 3N7EA 3E3TA 2FIRH 2QF3A 2GMTB 3ODDA 3ZZDA 4O3TA 2Z3EA 4I33A 1EZQA 2A1DB 1HRTH 1C2DA 2B0FA 1LHCH 3SNEA 4LXBH 4MG3A 1O2YA 1XXDA 2ZGXH 4O97A 1TNLA 4ACAA 4I31A 3S0NA 2BD7A 1G2LA 4BTUB 2HVXA 3P70B 3A7WA 2WPLS 1WDIA 4CBNA 1UW7A 2WSSD 4IN2A 3H7TA 3A8BA 2BXTH 4M9FA 4B2BA 1GHBG 3T26A 3SGBE 4D8NA 1HJAB 1NZQH 3RXAA 1C1PA 8LPRA 3U8TH 1MCVA 2WUBA 2YMSD 4GCHF 3STJA 4HG6A 3MHWU 3DCLA 2VIVA 3S69A 3SU2A 2PLXA 4JCNA 2FWWA 1C1WH 1NRNH 5F6MA 3OY6U 1NFUA 1FN8A 2L6OA 1YC0A 2G55A 4TT3D 1O33A 2F9BH 1CVWH 1MKXH 1AWFH 1F92A 3SV2H 5DN6D 1OWDA 1QQUA 3KQCA 3NPSA 4Y11E 1CGIE 1NRQH 1P2IA 1W0YH 3A84A 1O34A 1WQVH 2EY4C 1TE0A 5KECA 3OEHD 3S9BA 1C1VH 4TY7A 1TPSA 1CGJE 1SLXB 4OS4A 1C2LA 1DY8A 4Q4LA 1GJ8B 1VCWA 9ESTA 2AGGX 1A3BH 2QYIA 1EJMA 1O5EH 3A83A 3A7XA 5F03A 3U28C 2B9LA 2QN5T 5B6LA 3D62A 1HAGE 3ZZCA 3SHAH 3TGKE 4WXIA 1BCUH 1P2OA 2G00A 1VITH 3SNBA 3ZVBA 1T7CA 4KP0A 1VZQH 1GHYH 1PQ8A 4MNYA 2Y7XA 4I8HA 1XKAC 3TJUA 1GBBA 2W3KA 3FAOA 1GI1A 2AS9A 3V0XA 1AVXA 2VVUA 4YTAA 1L2EA 1NM6A 1EP5A 3BTFE 1G30B 1P01A 5A09A 4UFGH 4Q80A 1BHXB 5A8YA 2ZIQH 3IWMA 4YO9A 3B8JA 4I7YH 5CHAB 1NO9H 1BTUA 1SGCA 1GBTA 1KTSB 1SR5C 1EOLA 1MBQA 2F9OA 5JBBS 4IN1A 1PYTD 2V3HH 3KGPA 1BB0B 3ZZ6A 3PO1C 3ZZBA 1TLDA 3RU4E 1V2JT 1AKSA 1WUNH 1QIXB 1ELVA 5L2YH 1O2HA 3JZ1B 2SGDE 4JMYA 3A7VA 1X7AC 2QXJA 2Q6DA 4E7NA 1XKBC 4MNVA 3KQ5A 6CHAC 4FOUC 1OWKA 1XUIA 1G9IE 3TJOA 2P95A 1TNHA 3PRBA 1NTPA 1HLTH 5A0AE 3KL6A 3HPTB 4K1TA 3SUEA 1OXGA 2DE8A 2ZTXA 4BAMB 2CV3A 2A2QH 1Z8IB 4Y79A 3VPKA 2BM2A 1P0SH 3EA9A 2ZDMA 1SI5H 3RXUA 3TIUA 1YLDA 3ZVAA 2FOFA 3KCGH 4TPYA 3E0NB 3EA7A 5DO4H 1C2KA 2XBWA 1GVLA 1A46H 2Y6TA 4NIWA 2BD9A 2BLWA 2VGCB 5CE1A 4YZUA 3TNSA 2BDAA 1LCYA 3QZQA 5FPYA 2F83A 1EAXA 2B8OH 2C90B 2BHGA 2ASUB 1LKBA 4MPVA 1PPEE 3NWUA 2D8WA 1SVPA 1YPHC 1O3AA 2BQWB 2C8YB 4B6FA 1MU8B 1K28D 2CF8H 2ULLA 1SG8B 1EJNA 4YESB 4BAQB 1P2QA 5F53A 1C2MA 3BG4B 2ZGJA 2BY7X 3D23A 4YLQH 1V2PT 2HWLB 1XUJA 1LDTT 2PUQH 1MD8A 2B5TB 2AFQB 3V7TA 1GJAB 1WV7H 2G4UA 1Z8RA 3ENSB 3U98H 1O3MA 4I32A 2ZTZA 3TVJB 5EQSA 3F9HA 2ZU2A 1GHAF 3SBKA 4DGJA 1GMDG 4DOQA 1VITF 1QCPA 1HAZB 1TBRH 5DKMA 3SW2B 1V3XA 3LGUA 2SGEE 2Q1JA 2W6ID 1FAXA 1OX1A 2YMSB 5C17A 2CXVA 1G3EA 1UK4A 2SFAA 2FTMA 2VIWA 2R3YA 3QUMP 3EAJA 1QRZA 2BD8A 3GY6A 4ABHA 5C0UA 5ESBA 2ODYB 2TIOA 1TNGA 1ZTJA 3MNSA 1HAOH 1GBEA 2HPQH 1UTNA 1BJUA 1DLKB 2WV5A 3VGCB 1K1IA 1IQMA 4NA8A 1G36A 1UVPA 3SI3H 1QURH 3VB6A 1MD7A 1O38A 2FOBA 3F0PA 1TBQH 3QN7A 2KX4A 1BTZA 2Z3CA 1ETTH 4JYVH 1QBOA 5EJ1A 3FP6E 1Y3VA 2IN2A 1J15A 2J4IA 4JZIA 2GV7A 4F55A 3QDZB 1SFQB 1KLJH 1TPAE 1TX8A 1BJVA 5T1VA 3MFJA 4YOIA 2GTBA 3TITA 1W2KH 1P06A 2PTNA 3TJNA 8GCHG 1UK3A 3TJVA 1MCTA 5GWZA 1K2I1 1GI3A 2ANWA 3DHKH 3LJJA 5FX6A 1ZRBA 2VBCA 3GCHB 1XUGA 2NWNA 1IHSH 1DOJA 1DWEH
chains in the Genus database with same CATH topology
1GI2A 1VGCC 4KKDA 1K1MA 1FZZA 1YF4A 4YM9A 5AF9H 3E90B 1IHTH 1O0DH 1O2XA 5EGMA 3MH7A 1TOCB 1QL9A 1F0SA 1MTWA 1A61H 4H42U 3BTHE 1THPB 2BD2A 1ZPBA 4MLFB 1KTTB 3RXSA 1UTQA 2G5NA 4LOYH 3URCA 4Y8ZA 1YPKH 1SQAA 2OP9A 1TX6A 2F9VA 2TGPZ 1UTPA 2ZO3H 3QTOH 3E0PB 4R8TB 3T5FH 2I6SA 5A2MH 1EZSC 4FUJA 4ZMAH 1O2MA 2ANKH 3KN2A 2HPPH 2GCHF 5HGGA 2CHAC 2H5CA 1TGNA 4B1TA 2GZ7A 1GMHG 1BRBE 4INKA 2GCTB 2QY0B 3SU0A 4B75A 1ZMNA 2QF0A 1NS3A 3U1IB 1BMAA 4AFZA 3UFAA 2PUXB 3R0FA 2VIQA 1V2QT 1W7XH 1SC8U 3IITA 3RXGA 3M5OA 2SNWA 2Y7ZA 1YCPK 3AAUA 4AB8A 1P9UA 4U30A 1THRH 1XUFA 1KXCA 3UPEA 1BZXE 3RXFA 1Y5UT 1ABJH 1GJDB 3TNTA 4CR5A 3PTBA 1SFIA 3BN9A 1QY6A 2Z9KA 2ANYA 2UWPA 2Y80A 2SGFE 3MU5A 1Z8JB 1L1JA 3QZRA 1CHOG 3BTQE 3SU1A 4ABAA 4X8UH 4GHQA 5DP9A 5A0CA 5DPAA 5EXMA 4YOGA 4SGBE 1OP8A 2QXIA 2GD4B 3KHVA 3FP8E 2JETB 2UUKB 4O3UA 1JIMA 1ZSJA 1QRWA 3SNAA 1HB0B 4FUDA 4NZLA 3BF6H 4B73A 2BOHB 2A31A 2VNTA 1NU9A 1GJCB 1RRKA 1QA0A 2FI4E 2EC9H 1DM4B 1PJPA 1WOFA 3VB3A 1GCDA 2BVSH 3MH4A 2R2MB 5A8ZA 1NFXA 4XOJA 3BIUH 1BDAA 1EPTB 1S5SA 1V2MT 1AU8A 5F8ZA 4BXSA 1BTXA 1BBRH 3SJ8A 3QX5H 1E0FD 1TAWA 3TPIZ 1G37A 1N8OC 5G4BA 5HXFA 5K0HA 2A5IA 7GCHF 1BHXF 5J4QA 1Y3UA 3RXOA 1GGDC 2P93A 3V3MA 3KIDU 1C5RA 3O8CA 3RMLH 2V3OH 3ATKA 1FNIA 5LPFA 3NUMA 2VVCA 4X6PA 2O8LA 1GCTB 3M3VA 1CT4E 1LVBA 1KXAA 1QTFA 2H9EH 1EZXC 4DCDA 2P3TB 3SQHE 3H7OA 3NZIA 4X1QU 4XFQA 3UQVA 1YPGH 2VVVA 3EE0B 1HAYB 4NIVA 1KLTA 2WUCA 2ZHEH 3FP7E 3SGQE 1LMWB 1SGTA 2HRVA 3R3GB 5E2OA 1H9IE 1FY4A 2J92A 1GVZA 1UK2A 4D7FA 1W13U 1QRXA 5EG4A 1P2JA 1J8AA 2PKAA 2ZFFH 1S0RA 2W26A 5B6OA 1KY9A 1P3CA 1UVOA 1ZYOA 4K69A 4AFQA 3ATWA 1N1LA 1O2WA 3A82A 1KXBA 5GIBA 4YT7H 4ISIH 2ZQ1A 1KLIH 3BG8A 1GBJA 4D7GA 2QGRA 1QBNA 2QV1A 5K7RA 4GSOA 5C3NA 1ZRKA 2WYGA 2QXHA 2HGTH 1V2ST 1SQOA 1GBKA 4Q7YA 1FUJA 1AGJA 1O2SA 1SLWB 3BTKE 1YPJH 1A7SA 1ZJDA 1L1GA 1NRRH 1FY8E 2FI5E 2FTLE 4BAHB 1HFDA 3OU0A 1HIAB 1OWIA 1GI8B 1O31A 4ZH8A 1P09A 4KTSA 3T62A 3ZVDA 4J1YA 1EATA 3S7KB 3O8BA 1PPHE 3RXMA 3DT0H 1BMNH 2ZDNA 5JYIA 1WTHD 2GGVB 4RN6A 1A3EH 1GL0E 1V2UT 1V2VT 3RUOA 1FDPA 3JZ2B 4XBBA 3SU4A 2Z94A 3LT3A 1VR1H 4NFEA 5DP8A 1B7XB 1M9UA 1TPPA 3SV8A 4YOJA 1XVMA 3PWBA 3MU8A 4UFEH 3LIWA 1GBDA 1UO6A 1O39A 1A0JA 3VB7A 3AW0A 1HXFH 2Z7FE 1MKWK 3PWCA 2H5DA 1C5OH 1ZHMA 1QB6A 2BZAA 2BQ7B 3V12A 1Y8TA 2RG3A 4NGAH 2FLBH 1MMJN 1DLEA 2A4QA 2BYAX 2ILNA 5DG6A 1S82A 1XUKA 3HK6B 3T2NA 1DUEA 3A80A 2Z6BD 4Y71A 1AUTC 1FAKH 2OTVA 3U8OH 1FPHH 2FX4A 3P8OA 4FVDA 5JB9S 2F91A 3F6UH 4TY6A 4Y10E 3MYWA 1DWCH 2FOAA 1XXFA 1VJAU 3GY7A 1JBUH 4NWKA 1MTNB 3SU6A 4MPUA 2Z9IA 1HYLA 3BSQA 2W3IA 1NRPH 1ELCA 3BTME 2ZHQH 3SJOA 1AY6H 4WXVA 3LDXH 4BTTB 1SGFG 1GHBF 1HCGA 1P3EA 3UOUA 5DGJA 1A5IA 2ZPQA 1E37B 5DP4A 1UJ1A 2GZ8A 4ZKNU 2EI7A 1AB9B 2ZFQH 1D9IA 3M36A 5JPMH 1P2MA 2FLRH 1D3DB 2EI6A 1W0ZU 3L6PA 4DY7B 4ZHMU 4J2YB 1CA0B 1HJAC 5AFZH 4RSPA 1RD3B 4M7GA 3T25A 2ZDVH 1C1RA 3FZDA 1GI9B 2XBYA 1QFKH 1LHDH 1GJ4H 5L6NH 3GY8A 2FYQA 2ZCKP 2B7DH 3S7HB 1ZGIA 1MTSA 1UTKA 3D49H 4NIYA 2CJIA 2P8OC 1N6XA 4ZAEA 2H2ZA 1RJXB 1TOMH 4WJG2 5AVDA 1TA6A 5FCKA 2WPJS 4O9VA 3HK3B 4B2AA 2RA3A 1VCQA 4CHAC 5EPNA 3SUFA 3M5LA 1H4WA 1HBTH 3TK9A 5A8XA 1O37A 3DFLA 4JK5A 1O3LA 4K3JA 1TBZH 2CF9H 4WMFA 1NC6A 1KXFA 2HLCA 3GISB 3MO9A 2AMDA 4WMEA 1HDTH 3UOPA 1WU1A 1YYY1 3ITIA 5AHGH 1TQ0B 4DW2U 1G2MA 4WMDA 1TIOA 3A85A 4DIHH 1INCA 4TWYA 1EXFA 5T6GA 2EI8A 3TU7H 1TGCA 1GMCG 1ZPCA 1F5RA 1KXDA 4GLYA 4LK4A 3GDSA 5IDKA 2BVXH 3SN8A 2OXSA 3PYHA 5T6DA 4OGYA 4MPXA 1QJ7B 2FOCA 4X1SU 3ZV8A 2K7XA 2FX6A 1NU7B 2ZECA 1O2TA 2ZKSA 4JZEH 1CA8B 1LPGB 4ISNA 3U69H 1HUTH 3TGJE 2J34A 1LHFH 1P04A 4UONA 5GPIB 1P11E 3GYLB 3ZZAA 1NROH 3RC5A 1AHTH 3QTVH 4X0WU 3SNCA 1NT1A 5FXLA 1UHBB 2C4FH 3KF2A 1YM0A 1V2KT 3BEUA 5FAHA 1YP9A 1NY22 1THSH 1BRAA 1ZPZA 2ZU5A 1ARCA 5LH8A 1ANEA 2R2WU 2A2XH 1GBAA 5C1XA 3GY2A 1DWDH 2D26C 1BRUP 3DUXH 1V2WT 1OKXA 3NK8A 3QGJA 1TABE 1QB1A 2ZGCA 3PO1B 1K22H 3GDUA 1HNEE 2FOMB 1Z6EA 4CH2B 6LPRA 2XW9A 3UIRA 1AZZA 4ABBA 1O2KA 1O2RA 1TRYA 2C8WB 1A5HA 1JXPA 2SGPE 2PFEA 4BANB 1GMDF 1FONA 6CHAB 1KDQA 3BG4C 3I78A 3QWCH 5DP7A 4K8BA 1J16A 3A86A 4CRDA 4NZQA 3UWJH 1O3CA 4ISHH 2ZDKA 2WPMS 5I25A 2ZG0H 2W7SA 1FXYA 2AEIH 2UUJB 4U32A 2YNAA 2BDYA 1ARBA 1O32A 2FS8A 3PTNA 1QNJA 1GJ5H 3VXFH 1C2GA 3BIVH 1TX7A 3RDZA 5C5NA 1PQAA 1T8NA 1ZOMA 2FP7B 3DA9B 3ATIA 1L4ZA 2P59A 2KAIA 5ETXA 2BY9X 1BRCE 1P2NA 1IQKA 3TGIE 4CRFA 1DANH 4NG9H 3GY3A 1WQSA 1FQ3A 2VB0A 3K9XB 2HNTE 1DX5M 2ANMH 1C5ZB 4KGAA 5EQRA 1Z8GA 1O3NA 3C1KA 3EGKH 4CRGA 6ESTA 3SHCH 2ZGHA 2FI3E 5EOKA 3T29A 1KIGH 3SGAE 8GCHF 3PMBB 4B74A 1LO6A 1Q3XA 2PKSC 4TYDA 4OS7A 4ABDA 1B5GH 1SGYE 4O03A 4X6OA 2PW8H 1QL7A 4AYYB 3KQDA 2XBVA 4BAOB 1BBRK 3RMOH 5F8XA 1CHGA 1O2LA 1HAPH 1KSNA 4BXWA 2ZDAH 2OBQA 3QO6A 1CE5A 1V2OT 3ZZ3A 2VWOA 2BX4A 2FM2A 3GCTG 3TH4H 4WF8A 2QAAA 3A8DA 1SGRE 2CN0H 2UWLA 8ESTE 3A7ZA 3MNCA 3RMMH 3E6PH 3MI4A 2VINA 2FOHA 1P03A 2BDIA 4I8LA 4ZKRU 2TPIZ 1MAXA 4MNWA 1EB1H 4RKJB 1EQ9A 3VEQB 4I8KA 3WY8A 2C8XB 5HM9A 2THFB 2STAE 3EDXB 3TK6A 1B0FA 2QIQA 2OQ5A 5DP6A 1PYTC 1GDQA 3BTDE 4VGCC 1GMHF 5FHTA 2A4GA 3HKIB 4NA9H 1PPBH 1BTPA 2EEKA 1PFXC 3RMNH 1OP0A 3MO6A 1SLUB 3P8GA 2ZFSA 3I77A 3BV9B 4A5TS 1EASA 3KQEA 1Z1JA 1UVUH 3A87A 3VB5A 2ZNKH 4X8VH 1C1MA 4UFDH 1RIWB 1YLCA 2AIQA 3B23B 4X6NA 3Q3XA 2FODA 3SJIA 1GI0A 1LQEA 1LVOA 2XNIA 2FS9A 2GCTC 2IJOB 1O2OA 1EX3A 4WWYA 5C1YA 4JK6A 3T28A 1ANDA 1GG6B 4PROA 3DD2H 1IQLA 4A1TA 4XBCA 3NXPA 2P16A 1O2GH 3GY4A 5FBEA 5J4SA 1T4UH 3MNXA 1OYTH 1CHOF 1ESTA 1W10U 4E7RG 4FU7A 1P57B 4ZHLU 4FUGA 4I8JA 1P12E 2Q6GA 3SUDA 2CHAB 5SGAE 2XRCA 5L2ZH 1C5VA 3G01A 2F9NA 1BTWA 1YPMH 3BEFB 4HGCA 4HZHA 2Z9JA 4A6LA 1EZUC 3SO3A 2C93B 2OC7A 2R0LA 4Y0YE 1O35A 4FUFA 1UCYK 4OGXA 4XDEA 1HAVB 3RXVA 2C3SA 1LVYA 2VIDA 1SGDE 4H6SB 2FO9A 2JETC 3HGPA 1L4DA 3N7OA 1GBHA 1U6QA 2GCHG 1O5BB 1NFYA 2ZPSA 1OOKB 4ISLA 2VIPA 1TGTA 2LPRA 3TH2H 5GCHG 2GT7A 1D6WA 3FVFB 1ACBE 1CT2E 3NKKA 1VCPA 1ELGA 3LU9B 1FIZA 2BB4A 2F9PA 5EW1H 3SZNA 1ELAA 1Q31A 4FUCA 1ESAA 4U2WA 1O36A 2XCNA 2BDBA 3W94A 2Q6FA 2A5KA 1NPMA 3AASA 1IQEA 4XE4A 1CQQA 3O8DA 3BTGE 2DE9A 3LGTA 1L0ZA 1WTGH 4FUEA 1P10A 3P8FA 3STIA 3C27B 3HGNA 4X2VA 1TMUH 4IBLH 1LHGH 1SL3A 1AVGH 3CS0A 5HYOA 5E0JA 3ZVEA 1HXEH 1DPOA 1AMHA 5DP3A 3M37A 1O2UA 3M5MA 3QLPH 2JH5D 3MWIU 2BXUH 1C9PA 4IGDA 5GJ4B 1GVKB 1C1OA 1F5LA 3MNBA 1CBWB 1C5PA 1F0UA 1FLEE 1P02A 1UTJA 1TNJA 4FU8A 4DG4A 2P3UB 5TJXA 3RU4T 1RXPA 1GPZA 1K1JA 3PROA 1ELEE 1MZDA 1AFQB 3K65B 5LPRA 3ZV9A 4JZDH 4CREA 5C20A 2WPIS 1DICA 1TPOA 4X1PU 5E2PA 1HPGA 3RXLA 1GJ9B 1N8OB 2ZCLP 1O2PA 1BT7A 1EAWA 2BQ6B 4OS5A 2LNCA 3HATH 1MKXK 3SNDA 2WV4A 2I6QA 2RCEA 1JWTA 1QB9A 2GKVE 5H4IB 1ANCA 1T32A 2UUYA 1FN6A 4D9QA 4UDWH 1TRMA 4DT7B 2OD3B 3ZZ9A 2VJ1A 1O2NA 2XCFA 1W3CA 2XC0A 2BX3A 1CSOE 5FBIA 1G3DA 2ZWLH 1P05A 1EKBB 2IPHA 3GCOA 2SGAA 3PMHB 1T31A 4JZFH 3SU5A 5GXPA 4CBOA 4ZXXH 3QK1A 2JKHA 2ZZUH 1MU6B 1GJBB 4UFFH 5E0HA 3KQBA 1MTUA 1O2QA 2PGQB 2FXRA 2ZHWH 1RTFB 3TLOA 3V13A 2GDDA 1DITH 1MAYA 1O5DH 3ODFA 1KYNA 2G81E 1DXWA 3U8RH 4YLUA 3BTEE 2HNTF 3ZYEA 3CENA 1A5GH 1GHXH 2ESTE 3LGWA 4A92A 1RTLA 1DSUA 1SHHB 2GZ9A 1DFPA 1O3FA 4ABJA 1AKSB 1UTMA 3MTYA 3UY9A 1C9TA 2DUCA 1SSXA 1YPLH 5I46H 4NCYA 4NFFA 3LGYA 3O8RA 2BDCA 3RLWH 1PPFE 5T6FA 4BOHA 1BOQA 5EXLA 2SGQE 4IS5A 1W12U 5ESTE 5JB8S 2FZZA 2OINA 1KXEA 1GI7B 3LC5A 6GCHG 3SU3A 1C5LH 1O3PB 1GBCA 4R0IA 4AB9A 3RM2H 4Y0ZE 1YCPH 2WPKS 1O3GA 1AD8H 2J2UA 3RXCA 3EBNA 5EXNA 1BMLA 1LKAA 1C1QA 1AO5A 3BTWE 1ELBA 1TWXB 2OBOA 4DVAU 1MTNC 2SNVA 2H9TH 5E0GA 1QBVH 1SMFE 3MU4A 1O5GH 1H8IH 1TMTH 1CO7E 4UEHH 5JBCS 3SV9A 2ZU3A 4NSYA 4OS1A 5EU8A 2AIPA 1TGSZ 1IQHA 1KDQB 4X8SH 3K6YA 1GDUA 2AMPA 2TBSA 2GMTC 1ESBA 3LGVA 2ZU4A 2ODQA 3LC3A 1SOTA 2XC4A 5BPEA 3LJOA 1C4U2 3Q76A 1D6RA 2WINI 2XBXA 1LTOA 1AB9C 3P92A 1GBIA 4FXGH 1MQ6A 4MTBA 3RXQA 1QL8A 1O2JA 4ZXYH 1RS0A 5FPTA 1TNIA 1PPCE 3Q3KA 1AQ7A 2WPHS 3PLPA 1TB6H 3AAVA 4Z6AH 2XWAA 1TMBH 3AW1A 1ZGVA 1EAUA