3SNDA

Crystal structure of sars coronavirus main protease complexed with ac-estlq-h (cocrystallization)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptide aldehyde inhibitors challenge the substrate specificity of the SARS-coronavirus main protease.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
total genus 88
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3sndA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sndA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sndA02
4LK4A 1V2UT 2ZIQH 1ZTKA 1FV9A 2O8TA 1GHXH 4AFQA 3OU0A 6LPRA 1TMTH 1S0QA 1RTFB 1WUNH 3NZIA 1ELCA 2PR3A 3EE0B 3K9XB 3VXFH 1EPTB 1C5UA 4DURA 2ZZUH 1INCA 4BANB 1HIAA 2B7DH 1HJAC 2DE9A 3LH3A 2WPMS 3TH3H 1KXEA 4NA7A 1S5SA 4DIHH 3BTKE 4MNXA 3U98H 4KELA 3UFAA 1QBNA 3PTNA 1RFNA 2Y5GA 2FXRA 1BZXE 1F2SE 1MAYA 1EJNA 1IQGA 3CS0A 1GBCA 1IQJA 1SQAA 1MD7A 1AVWA 2LIZA 1FPHH 4LOYH 2Y7ZA 2AFQB 5HXFA 4IS5A 1MQ6A 2NWNA 3QO6A 1AWFH 3ELAH 3B8JA 1IQLA 1T7CA 3GY6A 2K7XA 4MPUA 6CHAB 2A45B 1A0LA 3GDSA 1O3PB 1QGFA 1C1OA 1H4WA 4I8GA 3ZZDA 5H4IB 2BDIA 1O2IA 4A1VA 8ESTE 5LH8A 1EAXA 4K8YA 8GCHG 1EATA 2ZGXH 4WH8A 1VGCC 1YC0A 1O2RA 1NFYA 5E0JA 3RU4T 3F6UH 1AHTH 1EX3A 1A61H 1O2MA 1P02A 2ZHFH 3A7XA 2OUAA 2PUXB 1P03A 5FBIA 1NZQH 3BTDE 2W7SA 3FP6E 1KIGH 2ZG0H 1HCGA 1Q31A 3PB1E 2WPKS 2VVCA 3RXMA 3FZZA 2NU1E 2ANMH 1O5GH 1GHZA 1AE8H 2Z3EA 1GL0E 1WQSA 1YPKH 4ASHA 4FUHA 1LMWB 1EAIA 2SGPE 1CT4E 5LPEA 1W8BH 5A8ZA 2BDGA 2XRCA 1PPBH 2JH0D 3RLWH 4THNH 1C1PA 3RUOA 2JH6D 2FS8A 4CH2B 2THFB 2V3OH 2ULLA 2O8LA 4X1QU 1SVPA 3AW0A 4KTUA 4NFFA 1NFWA 3BF6H 2VIWA 3E3TA 4AG2A 4FUBA 2K1QA 2CGAA 1PQAA 3SGBE 2FEQH 1C5SA 2FODA 1C5LH 2A1DB 1VGCB 1O2PA 1C1UH 3GOVB 2J95A 2VIQA 1SMFE 4BOHA 2BX4A 2XWBI 1P09A 5G4BA 1Z1JA 3HATH 2OQUA 1QB6A 1HIAB 5C2ZA 1P2OA 1ARCA 2FI3E 2BQ7B 2GKVE 2NU0E 3BIUH 3DHKH 2PW8H 1BJUA 2FOAA 2ODPA 1NU9A 1O3LA 3UPEA 2ZFSA 1P57B 1ZR0A 3L3TA 4I32A 1F92A 1ETSH 1NY22 3ZVDA 3M61U 3MWIU 1XM1A 1A3EH 2QXJA 3KEEA 3ESTA 1ACBE 2XBVA 4AGJA 4DG4A 1DOJA 3MU4A 2SNVA 1DWBH 1T8OA 3ZZ8A 2ZCKP 1FLEE 3N7OA 1AE5A 3SZNA 4GVUA 1ZZZA 1Z6JH 1CGHA 1LHCH 4INKA 3T29A 1D3PB 1P9UA 2C93B 3P8GA 2RA3A 2EA3A 1ANDA 4ISHH 1O2OA 2SGEE 3ZZ9A 3SHCH 1E37B 1A5GH 1DXPA 1THPB 4DT7B 1DXWA 5T6FA 4I8JA 3ODFA 1V2PT 1QRXA 4H4FA 2GZ9A 2XYAA 3H5CB 3SO3A 1JBUH 1G3DA 4GCHG 1P3EA 1EZQA 1O36A 1LPZB 1UCYE 4UFDH 1SLUB 1GPZA 1P2MA 3LJJA 1TNHA 4YO9A 1O3EA 1N8OB 1ZMJA 2VGCC 4K1SA 3UUZA 1K1NA 3U8OH 2GZ7A 2ZTYA 1SR5C 1ZJKA 3IG6B 2CV3A 3RXTA 1TX6A 5AF9H 3LT3A 4AYYB 2BLWA 1ZTJA 3SGAE 1O3AA 4TPIZ 3UWJH 1MZDA 2GT7A 5JBTA 4BAKB 2F9VA 4OS5A 1HAXB 1HJ9A 3NK8A 2J94A 2RA0A 3MH6A 1P11E 1O3GA 5LGOA 1UK4A 1QB9A 5DP4A 3TJUA 2VINA 2ZHQH 1THRH 4INLA 1C2LA 3U69H 2FZZA 1JXPA 4NIXA 4ZKOU 1AB9B 2BB4A 2P8OB 2P3UB 1XKBC 4XFQA 3NWUA 4DJZB 3ZYDA 3A81A 3A8CA 5C20A 5JBAS 1BMNH 4A7IB 2ZFPH 4JYTA 1ESAA 2BD3A 3LOXA 1FI8A 1VJAU 2CMYA 1MTUA 1GJ6A 3F9FA 1GBIA 4JYVH 4AFZA 5F6MA 4IGDA 1CQQA 1SGDE 2FOHA 3DUXH 3QZQA 1F0UA 4Y0YE 1RGQA 1FY1A 4X8SH 3TIUA 1JOUB 3VB5A 4Z6AH 1O2SA 3FP7E 1KLTA 2BD4A 1UO6A 1YGCH 1EOJA 2R0LA 3BEUA 1HJAB 1C5NH 1ZHRA 5FX5A 2A5KA 4ZXYH 1O0DH 4PROA 3P70B 1TB6H 2BDHA 1MD8A 3F9EA 3F9HA 2ZHWH 4X6MA 3LC5A 1GI2A 5F8TA 3M3VA 1EB1H 2FOBA 5LPRA 1BTHH 1QHRB 7GCHG 1B0FA 3KNXA 3SU0A 1ZMLA 1MTNB 5K7RA 2HLCA 2BXUH 1EP5A 2GDEH 1VR1H 3P8FA 1AUJA 3F68H 2YOLA 5A2MH 4DGJA 1LTOA 3M35A 2AERH 4H6TA 3MHWU 3RDZA 1Y5AT 1W7GH 2WINI 3TJOA 4B74A 1C1MA 2Y5HA 1C5VA 5IDKA 2W26A 2F83A 1J9CH 1ARBA 1CHOF 1CA0C 1GJ7B 4JYUH 2GV7A 3SNDA 2TGTA 1K1IA 2G55A 1GJ9B 1DSUA 3GY4A 2BY6X 1OWIA 2IJOB 1CA0B 1SGCA 4XBCA 1WCZA 4BAQB 2BD8A 5AVDA 1GMHG 1BHXF 1AY6H 2GTBA 4X0WU 1ZSJA 2QAAA 1GVLA 1W7XH 2R2MB 1SHHB 1WAYB 1GI7B 1GJCB 3GCHB 3A7VA 3Q76A 1CE5A 4I7YH 1NC6A 2OBQA 4Y8YA 1TRYA 1AZZA 4ABEA 3TK6A 4NIVA 2A32A 4YOGA 2VWLA 4MPXA 1E0FD 1HJ8A 4ABJA 3MMGA 5JDUB 1HAVB 5AFYH 3BN9A 2PTCE 1GDUA 1SB1H 4ABFA 1ZPCA 2PHBA 3O8BA 2WYJA 3BEFB 3GYMA 1C5TA 5GPIB 1FY5A 1O2UA 1O5FH 7ESTE 7LPRA 4NSYA 4X1NU 1VZQH 2BVXH 3GICB 3FZDA 5FBEA 3M36A 2PTNA 3M5MA 1XVMA 1D3TB 5FXLA 1O2KA 4Q7ZA 1EJMA 1QB1A 1GCDA 1F5LA 1HDTH 1SHYA 1C2EA 1GI1A 1Y8TA 2BQ6B 2FM2A 3ZZ3A 1BQYA 2WYGA 4DIIH 1OP2A 1G2MA 1BTYA 1ELTA 2I6QA 3P92A 1QBOA 1YF4A 2ZDKA 4D7FA 4MPWA 2BM2A 3RXHA 4HTCH 4HFPB 3E8LA 3SUGA 1V6DA 5C1XA 1FXYA 2PGBB 3PO1C 4NA8A 3ZVCA 5GIBA 2BDAA 1GWAA 3AASA 3RXJA 5DG6A 4I8HA 2FESH 3SHAH 3NUMA 2OD3B 1O38A 1TBZH 1C9TA 1VCWA 1VCPA 3IITA 1H9HE 4NZQA 4D8NA 2QGRA 1UK2A 2BX3A 1EQ9A 4NFEA 4YLUA 4WY3A 1MTSA 1QJ1B 1FJSA 1K28D 3CP7A 1XXDA 4K3JA 3H7OA 4R0IA 1K1PA 1L1GA 1P10A 4F49A 4RSPA 3FANA 3KL6A 3S7HB 5JBCS 4OS4A 2F91A 1LO6A 4YZUA 5DK1A 1YPJH 4WMDA 4ABDA 4ZXXH 3NCLA 1TPAE 1QJ7B 1OWKA 3GCTF 1AUTC 1Y5UT 2QCYA 1UVOA 2V35A 5CHAC 4ISIH 1Z6EA 1GJ5H 1F5KU 2RCEA 3EBNA 3PLPA 4RKJB 4YOIA 3VXEH 3ZZCA 1GMCF 3QGJA 4FVDA 3SV2H 2FP7B 2Y81A 1Y3WA 5HGGA 5L2ZH 4NWLA 1SGQE 1P3CA 2SNWA 3KQEA 1LHDH 2C8XB 4TWYA 2FS9A 3SI3H 2KAIB 3RXIA 1A5HA 3A84A 2AGIX 3Q3YA 1DM4B 1O5AB 2P3TB 3GDUA 1HLTH 5J4QA 3WY8A 1CHGA 4JZ1A 3UWIA 2AS9A 2SGDE 2O8WA 1IQNA 1GJDB 1O34A 2W7UA 5ESBA 4HI3A 1GMDF 1MMJN 2QY0B 2HPQH 3BTTE 1HXEH 3A88A 2Y82A 4TPYA 1XVOA 4UFGH 1AB9C 1S0RA 3EQ0H 1EJAA 2BLQA 1O2WA 1NPMA 1SQOA 3SJOA 1W0YH 1P8VC 3TLOA 2XBXA 2ALVA 2A4GA 4NIWA 2P94A 1UVPA 4OS6A 1YYY1 3EYDA 1HBTH 3PO1B 1HRTH 1GI3A 2AEIH 4IC5A 2YNAA 1ETTH 1OYTH 1TFXA 1IQFA 2VWNA 1O3BA 1FZZA 3MO6A 1S82A 2STAE 3UQOA 1V2MT 3DA9B 2STBE 3QWCH 2CXVA 4AZ2B 1L1JA 3V3MA 1UTLM 1SGYE 1HAOH 1MKXH 2G4TA 2FOGA 1KXBA 1LDTT 1AI8H 1BRAA 3VEQB 4WWYA 2ANKH 2P59A 2Y5FA 4Y10E 1HNEE 1IHSH 1TGSZ 1KXCA 2ZPSA 1QCPA 2ZGJA 1CU1A 4LZ1H 3FFGA 1S81A 2XTTB 4FUCA 1AFQC 3ZV9A 4XBDA 1C2HA 2ZFQH 1C2KA 1V2RT 1UTQA 4X2YA 1JIRA 5BRRE 2FOEA 4JK5A 5HM9A 3LDXH 1L1NA 1SFIA 1EZXC 2QV1A 3QDZB 1ZPZA 2GGVB 2ZCHP 5CMXH 1YCPH 2HNTE 2XBWA 2ZPQA 3VPKA 3UNRA 1UHBA 3L33A 1DX5M 1LVOA 1C1SA 1TNKA 3OYPA 1SGIB 1C1VH 1B7XB 1YCPM 2UUKB 1ZTLA 2XCNA 5GJ4B 1PPCE 1TGCA 2OC7A 2UWLA 5A8YA 2F3CE 4GLYA 1C1QA 2J4IA 3QK1A 2WPHS 3NPSA 3K6ZA 2D26C 1HYLA 1EOLA 3GISB 4B73A 1WBGB 5EG4A 1O2JA 1P12E 2ZFTA 5A09A 1GJAB 2ZFFH 3K2UA 3RC4A 1GJBB 2A0QB 3STIA 5EQQA 4JZEH 1H9IE 1BBRK 4X6NA 1DLEA 3EDXB 3AW1A 2H1UA 1UVTH 5A0AE 6CHAC 3B9FH 3V13A 2FO9A 1NRQH 5A0BA 1G37A 3GY2A 4ABGA 1O3KA 4CRAA 1CO7E 2BLOA 3Q00A 5JYIA 2YNBA 2ZWLH 5HM2A 5EW1H 2CHAB 1EAWA 1ELFA 4VGCB 1GBFA 1Z8RA 3ZZ5A 2OLGA 1ELVA 1FONA 1PFXC 1TQ0B 2HWLB 2LPRA 3LGUA 3RU4E 1QQ4A 2BDBA 3TNTA 2EEKA 3HKJB 1ZHPA 1ZMNA 1C5XB 2UUYA 5JBBS 1O3CA 1WV7H 4ZAEA 3MO9A 4I8LA 1AFEH 1K2I1 1FDPA 1P04A 2Z9LA 5I25A 2HRVA 4X8VH 3GCHC 3M3SA 3HPTB 1KXAA 1C5WB 1SGPE 3SU4A 4TWWA 1GBJA 1XUHA 1A7SA 1C5ZB 3RLYH 1Z8JB 3KF2A 3V0XA 3MOCA 1C2JA 1PQ5A 2BVRH 1E38B 1MH0A 2W3IA 3HK6B 4MNYA 3HKIB 3BTHE 1S85A 3E0NB 3E16B 5C1YA 1TPSA 4B1TA 4CRDA 1TPOA 3CENA 4GHQA 4KKDA 2Z94A 1LHGH 4NGAH 4FUGA 3PWCA 1HAHH 1L0ZA 2BDCA 1O2TA 3VGCB 1IQIA 4BAHB 2WUCA 1LHFH 2IPHA 3NXPA 4O3UA 1ABJH 3HK3B 1SLVB 4A1XA 1BHXB 1GHVH 3NKKA 3SV8A 2SGFE 1EXFA 3GYLB 1TYNA 3HGPA 1TX7A 2C8YB 3UREA 1GMHF 1XXFA 2V6NA 2R3UA 3SORA 2G5NA 2J2UA 4F4OC 1RS0A 1NRPH 2ZNKH 4NIYA 4BAOB 3A8AA 2G4UA 1DY9A 3A7TA 2WUBA 2FOFA 1AKSB 2BZ6H 3MH5A 3ZYEA 5HYOA 1MKXK 1GBTA 2EC9H 2PLXA 2GDDA 3P8OA 3SUEA 3UR6A 1T4UH 4LXBH 1C4V2 2G5VA 2G51A 2QIQA 4JMYA 1GBAA 5EXLA 2A5IA 1IHTH 2ZDVH 2WV5A 5CE1A 1O2NA 3UR9A 4FU9A 7GCHF 1H8IH 3RXQA 3SI4H 4OS2A 1TA2A 5L30H 2Z9JA 4CRBA 3VB4A 2M5TA 2GZ8A 3BTEE 4GSOA 3URDA 2FDAA 1C5PA 1SLWB 2BXTH 1SC8U 1B0EA 4IMQA 5C3NA 1PJPA 1G9IE 1YPHC 1OWEA 3PMJA 3O8RA 1BIOA 1W0ZU 4ESTE 1GI5A 3MNBA 2EI6A 4BNRA 2FWWA 3SNCA 5FX6A 3BSQA 2P95A 1YLCA 4A6LA 4IC6A 2OXSA 1TGNA 3RXPA 1TMBH 1SGRE 3S9CA 5J4SA 1Z7KA 2UWOA 3I29A 2PSYA 1SPJA 1IQEA 5EODA 4AYVB 2Y7XA 2BQWB 4UEHH 2F9NA 1LVYA 2ZDAH 2VGCB 1AMHA 1UVSH 2HVXA 1EASA 1JMOH 4QT8C 3S9AA 3QUMP 4CREA 2B0FA 1U6QA 2ZKSA 1O2QA 1TGBA 5JB9S 3A82A 2VIOA 4UFEH 1V2KT 1AVGH 1K1OA 4DW2U 3UOPA 2EI8A 5DP3A 1KXDA 1P2KA 1D4PB 2B5TB 5PTPA 1QNJA 3MNCA 3HGNA 2P8OC 2AH4X 5BPEA 2GCTB 4CR9A 1LQDB 2ZU1A 3SJKA 1B5GH 4UFFH 5A0CA 1IOEA 1XKAC 3KN2A 1UTPA 1FNIA 2VVUA 1TRNA 4AGKA 2XC5A 1BTZA 1PPFE 3SBKA 1FN6A 1W3CA 1D3DB 2GVFA 2ZGHA 1UK3A 2R3YA 5CHAB 1YPEH 4MTBA 2J38A 3SN8A 2PKSB 1F7ZA 2C3SA 2H2ZA 2PV9B 1BJVA 5FCKA 3SU1A 3TJVA 1MTWA 1ZRBA 1OOKB 1C9PA 4MPVA 1ZSLA 1BTPA 5EPYA 1TNGA 5GWZA 1ANBA 2O8MA 1DSTA 1UTOA 2ZDMA 1Y3VA 4GCHF 2H9EH 3D23A 1GHBG 2FLBH 4H42U 5F8XA 4D7GA 4FXGH 3BG8A 4Y8ZA 4SGAE 4K69A 5T6GA 1GVKB 4K8BA 1OWJA 3EA9A 3S9BA 3DFJA 1GI9B 3RC5A 1TAWA 2FX4A 1GI6A 4CHAC 3GY5A 3T25A 2IN2A 1LPKB 3RMOH 1MTNC 5T6DA 5JB8S 4ISOA 5AHGH 3IWMA 3A8DA 2OTVA 1UTNA 3T5FH 4MNWA 1BRBE 1HAZB 4NSVA 4O97A 2FMJA 1A46H 2A4OA 3A83A 3A87A 1C2GA 2Z9IA 4FVBA 3RXVA 1BTUA 3CS7A 1HPGA 4MNVA 2JKHA 2B8OH 1KTTB 2Z3CA 1BA8B 3F9GA 1TLDA 2TIOA 3E1XB 3S69A 1BRCE 3UNSA 1K9OE 4NCYA 1BITA 1T32A 1FUJA 2H9HA 1GBDA 2W3KA 2ZDLA 3STJA 4LZ4B 2HALA 5FCRA 3SU6A 2BOHB 1WQVH 1QFKH 5FAHA 1SQTA 1FY4A 1BRUP 4XSKU 2ANYA 4AX9H 2Z9GA 2V3HH 5EXNA 3TU7H 4YT7H 2NU3E 5LPFA 1NRRH 1FMGA 5EGMA 1C5QA 2ZU2A 4KGAA 1LVBA 2VH6A 2ZF0H 1GMDG 4D9QA 1GI8B 4YOJA 1NESE 2GMTC 3FAOA 4NA9H 4Q2KA 1G3CA 5JPMH 3M3TA 2SGQE 4ISNA 1GBBA 5EQRA 2OINA 2XC4A 2QXHA 4MG3A 4X2XA 1AFQB 1D9IA 2F9OA 1BMAA 1TIOA 2A7HA 5EW2H 1KXFA 1K1LA 1TONA 3A7YA 2TBSA 2CF9H 2H9TH 1QQUA 2ZC9H 3PTBA 1FIWA 1ZYOA 1K1JA 1UJ1A 3D62A 5DP7A 2XNIA 4K2YA 1UTJA 4J1YA 1GMCG 3E6PH 1IQMA 4E05H 1HGTH 1S6HA 4VGCC 3SV7A 2QF3A 2AMQA 4U32A 1NRSH 3URCA 1O3OA 1ZJDA 1O5EH 4OGYA 1C5OH 3GCTG 1ESBA 4JZFH 3LIWA 4Y0ZE 1DITH 1EAUA 3GY8A 4RKOB 5FHTA 8GCHF 5SGAE 3GCOA 2AGGX 1W12U 2B9LA 1BBRH 1NROH 1O2LA 4Y6DA 3QLPH 1J8AA 1JRTA 1KY9A 2ZHEH 1F0SA 1O2XA 2ZGCA 2NU2E 5EPNA 3Q3KA 1QURH 3R0FA 1W10U 1O32A 2G81E 3MFJA 2J9NA 1O3IA 1HB0B 3VB3A 1G2LA 4WXIA 1GG6C 1BCUH 4CH8B 1OX1A 1D3QB 1THSH 3RM2H 1QBVH 3A89A 1AN1E 1BTXA 1X7AC 1G3EA 1ELBA 2PSXA 4YM9A 2ZI2H 2A7CA 3Q77A 1DVAH 1L4ZA 2OCVB 1CT2E 1P05A 1XMNB 1K1MA 1OXGA 1KYNA 2Z9KA 1OS8A 1TX8A 4B2CA 1C4U2 1P2QA 2VIPA 3Q3XA 4AORA 3JZ2B 2Q1JA 3ZZ4A 1N8OC 4X2WA 2ZECA 1YLDA 1XX9A 3LGWA 1P01A 1RIWB 4GUXA 1MU8B 4XOJA 2BYAX 1ZGVA 3U1IB 3C27B 1CSOE 1G3BA 1PYTD 3ZZ7A 1MAXA 3GDVA 3EGKH 2ZU4A 1NFXA 8KME2 1AVXA 1SL3A 3ZZ6A 1WTHD 2XXLA 1T31A 2Z3DA 3GCNA 1CGIE 1ELDE 4AB9A 1W13U 1MKWK 3SGQE 4D76A 4ZKSU 1C5YB 4KP0A 2JH5D 2ZQ2A 4JZIA 4H6SB 4TY7A 5EQSA 1OWDA 3LGTA 4Q80A 1O33A 3EAJA 3KIDU 4ZKRU 3TK9A 2W5EA 3ATIA 1XUKA 2BZAA 4CHAB 1YM0A 5GXPA 4GHTA 1MKWH 5C5OA 1O2GH 1DUAA 2A7JA 2HGTH 4IMZA 1XUFA 4TYDA 4YT6H 1C2IA 2BD5A 2VIVA 1A0HB 2J92A 1O3MA 2ZA5A 4X6PA 2WPLS 3SUFA 3RP2A 3AAUA 1Y3YA 1DWCH 1O3FA 1ELAA 2BD9A 2FOMB 1NFUA 3KQCA 1SOTA 2A5AA 3E0PB 1LPGB 1AQ7A 4WVPE 2UWPA 3SJIA 5ABWA 2OC1A 1AWHB 1E36B 2OC8A 2WPJS 1CGJE 1OWHA 3DFLA 2ZCLP 3MI4A 2A4RA 3ZVFA 3SJ9A 3RXSA 1MCVA 1SGTA 1BBRE 1N6YA 2ODYB 1NRNH 3A86A 1CHOG 1UCYH 3U9AH 1RTLA 4UD9H 3RMMH 2BTCE 4U01A 4BAMB 1NN6A 2TRMA 4FUJA 1C1TA 1AIXH 1TOMH 2BD7A 1A5IA 3P6ZB 1V2NT 4Y76A 2ZQ1A 3LJOA 4K5ZA 1EP6A 4JK6A 4OS1A 3RMNH 2G52A 3TGJE 2P16A 2D1JA 3UTUH 2G8TA 4ZHLU 4Y79A 3RXFA 3ZZAA 1H1BA 1TBRH 3RMLH 2PKAA 4CBNA 1TWXB 4Y7BA 3LC3A 5E8EH 4ISLA 2BDYA 3RXOA 1RJXB 1GCTC 2H5DA 1GGDC 1RIWC 1JRSA 2FI4E 4CRFA 1C5MD 4A92A 1N1LA 4HGCA 2ZPRA 1AO5A 1TOCB 3U1JB 1O3HA 3SV9A 1J15A 1BB0B 1G32B 1WYKA 2BY5X 1ELEE 3OY6U 1SSXA 4Y71A 5B6OA 1LKAA 1ZHMA 1Z8GA 1ANEA 1DE7H 1TPPA 3ENSB 3M7QA 1DLKB 1J17T 2VB0A 2BHGA 1QIXB 3V7TA 5DP9A 3AVZA 2QXIA 1LCYA 1F5RA 1CBWB 4K1EA 1EZSC 9LPRA 1GVZA 1P2IA 3W94A 1BT7A 1YPHE 2Y80A 3RXLA 2QN5T 1DWDH 4Y7AA 3RXKA 5GDSH 4ABAA 1DPOA 3LPRA 3TGKE 2J34A 8LPRA 5DPAA 1Z8IB 5TCAA 3GY7A 3KHVA 2FYQA 1QTFA 4AB8A 1DY8A 3QZRA 1DWEH 2XBYA 1L4DA 3V12A 3TH4H 3BTQE 4FUEA 5DKMA 3W95A 1DFPA 1HXFH 3U8RH 3FVFB 1DUEA 3M7UA 1T8NA 4WXVA 1MBQA 1Q2WA 3ZZBA 2C8ZB 4NG9H 2HOBA 1V2LT 1BTWA 2F9PA 4Z0KA 4JZDH 1SGNE 1UTKA 1ZPBA 1AD8H 4FUIA 1P2JA 1EPTC 3R3GB 1GHYH 1O5BB 1M9UA 1L2EA 1V2WT 2FOCA 2Q6FA 1OYQA 5FPTA 4TY6A 1C1WH 2UUFB 3SW2B 4U30A 1HAPH 1TRMA 1ID5H 3E90B 2OP9A 4ZUHA 4B76A 3LH1A 5L2YH 2BOKA 4AG1A 1NT1A 3SQHE 1ANCA 1D6WA 2CJIA 4JCNA 3MU1A 4RN6A 1SOZA 2QF0A 4R8TB 3BIVH 2VVVA 3ZVBA 3TJNA 2EI7A 1Y3UA 1V2JT 2O9QA 5FPSA 5E2PA 1CT0E 3M5OA 4IW4E 1OKXA 4A1TA 2V0BA 4CR5A 1QL8A 1A4WH 4X1SU 1HAIH 3DT0H 2G00A 1P9SA 1W11U 3KCGH 1MUEB 1OSSA 3VFEA 1O2HA 2GV6A 4BXSA 4X1PU 1V2VT 1C1NA 5DGJA 1IQHA 5F03A 3O8CA 2Y6TA 2I6SA 3ODDA 1NO9H 3QGNB 3VGCC 1RXPA 4ZMAH 1TNLA 2SGAA 4DOQA 1SGEE 5E0GA 1MCTA 1FPCH 4X1RU 1UMAH 1UVUH 1PPEE 3ATLA 3OTJE 3H7TA 5ESTE 1QA0A 2AGEX 4KTCA 3A7WA 2FX6A 1CBWC 5F8ZA 1ZGIA 3RM0H 2PKAB 3TPIZ 2A4QA 3OX7U 3UIRA 1T8MA 1O30A 4B71A 2VJ1A 5T3HA 3RXGA 1C4Y2 1QJ6B 3RU4D 3RXCA 4MLFB 4I8KA 1HV7A 1VCQA 4HZHA 3S7KB 1WTGH 1BMLA 2RG3A 4Q7YA 5TCCA 2P3FH 4XE4A 1S84A 1EKBB 3BG4B 3QTVH 4Q7XA 3RXUA 4IN1A 4IBLH 1BMMH 1PPZA 2ZEBA 3T27A 2FI5E 1SBWA 2VIDA 6GCHF 4WH6A 1MTVA 1PQ7A 3SQEE 1T8LA 3TVJB 4D9RA 3UQVA 1ABIH 2A2QH 4BXWA 7KMEH 2ZO3H 1VITF 1MZAA 2OBOA 4MQAA 3G01A 2HPPH 1H9LB 3PMHB 2Z6BD 3MO3A 3ITIA 2FPZA 2RDLA 4A5TS 3VB7A 1LHEH 3BV9B 3KQDA 2VU8E 1JIMA 1A2CH 2R2WU 3TNSA 5ETXA 1RTKA 3SU2A 2BY9X 4ZHMU 2ILNA 4FUFA 2BY7X 4BTTB 1RRKA 2HNTC 1KTSB 4GPGA 3A8BA 1KDQA 2QXGA 2ZU5A 3A7ZA 1C2FA 1P2NA 1PPHE 3A80A 1WSSH 3BTGE 4WJG2 4YLQH 3KQBA 4FU7A 4E06H 4WMFA 2XC0A 1GBLA 2VWMA 2BD2A 4B2AA 1GG6B 1XUJA 1EB2A 2DE8A 1PQ8A 4ABBA 1K21H 2ZDNA 4DVAU 2JETC 2PUQH 3RXAA 3VB6A 3T2NA 4K1TA 1TABE 1O2ZA 1AZ8A 1H8DH 3GY3A 1TA6A 4WF8A 4X6OA 1UCYK 3F1SB 2PFEA 1GHAG 4X8UH 1HAGE 2AIPA 5DO4H 1ZRKA 4WMEA 1C2MA 4I31A 3PV4A 1GBMA 2FYRA 2F9BH 2GCTC 5C5NA 1E34B 2HNTF 2ZHDA 4M7GA 2FLRH 1GHWH 2H6MA 1IAUA 4FU8A 1GGDB 3RXRA 3TGIE 3LU9B 4ZH8A 3M7TA 1MU6B 1C5RA 4ABHA 4B2BA 3B23B 3D49H 2GCHF 1AKSA 1SLXB 2TGDA 3L6PA 5DP5A 1DS2E 1A1RA 9ESTA 1QRWA 4FUDA 3QTOH 1QRZA 1P0SH 3RC6A 4NWKA 2QC2A 1QR3E 4CBOA 4I33A 1O3NA 2ZTZA 1Z71A 4AFSA 3OY5U 5DJ7A 4ABIA 3TITA 2GCHG 1EZUC 1NS3A 2ALPA 5GCHG 2H5CA 1Y5BT 2TPIZ 3MNSA 3LGVA 5EOKA 1E35B 1N6XA 2SFAA 2ZP0H 1Y59T 1OP0A 1KLIH 3M37A 1YPMH 3MYWA 3QX5H 1WU1A 1DANH 2ODQA 1FQ3A 2UUJB 3PLBA 1QY6A 1QL9A 1GHAF 4KTSA 3TH2H 2GT8A 3SJ8A 1F0RA 3MU0A 1CA8B 2LNCA 1PPGE 4AN7A 1GJ4H 3LONA 1V2QT 2Q6GA 1G36A 4UE7H 5EXMA 3LGIA 2GX4A 1ETRH 1LKBA 2GD4B 1GCTB 3OSYA 3D65E 3PWBA 1BOQA 4J2YB 1F0TA 1KLJH 2TGPZ 3ZV8A 1V3XA 1UHBB 2FTMA 2AIQA 3PYHA 2ANWA 4BTIB 1EUFA 3PM3A 1TGTA 2C90B 3ZVGA 3BTME 1TNIA 4B75A 2ASUB 3T62A 1GJ8B 3BEIB 1BUIA 2DUCA 4BTUB 3EA7A 2AMDA 3RXEA 2WPIS 2JETB 4AFUA 4X2VA 3QN7A 3PLKA 1HAVA 1GBEA 2Z7FE 3A85A 1TQ7B 1SI5H 3ATWA 1K22H 2BLVA 5E0HA 3SV6A 1TMUH 2QA9E 3SUDA 4X8TH 4DCDA 4YTAA 1SG8B 4XDEA 1Q3XA 1ESTA 1LQEA 1C2DA 2R9PA 4Y11E 1FY8E 3ZVEA 4MDSA 1YPGH 4OS7A 1VITG 1PYTC 1HAYB 1QL7A 5C67A 1GBHA 1FAKH 5IYTA 2PWXA 3I77A 6GCHG 1QA7A 1TALA 1EPTA 1O2VA 1YCPK 3SU3A 1BDAA 3SNEA 2XW9A 4O3TA 3ATMA 3ATKA 1TNJA 2VH0A 2C8WB 1TE0A 1ZOMA 2QYIA 1DT2A 2A2XH 1G30B 4E7RG 4CRCA 1XUIA 4UONA 2ZTXA 2ZU3A 1V2OT 4YESB 1GBKA 4OGXA 2XCFA 1GI4A 1DDJA 3TK5A 3P8NA 1YBWA 2Q6DA 4NZLA 4DY7B 5I46H 1GDNA 4AOQA 1C1RA 1NTPA 1TBQH 2FIRH 5C1UA 2CN0H 1GL1A 5HMAA 3UNQA 1A3BH 1ZLRA 1FN8A 2D2DA 4INHA 1O31A 2F9UA 2BMGB 4Y8XA 3P95A 2IOTA 1UTMA 3K6YA 3BG4C 1LVMA 4UDWH 1A0JA 3LGYA 3LKWA 3M5LA 4ZKNU 1SGFG 3MH7A 1CVWH 1AU8A 3FP8E 1W14U 4XBBA 3P17H 2ZGBH 2P93A 2KAIA 2O8UA 1T4VH 1D6RA 3SNBA 1FIZA 2CHAC 3EA8A 1OPHB 1ZSKA 3S0NA 4ZROA 1V2ST 3MTYA 3O8DA 3T28A 1ORFA 6ESTA 1YP9A 4U2WA 2C4FH 2OQ5A 2A31A 1ELGA 2GP9B 1YPLH 2AYWA 1GI0A 2NU4E 1O5DH 5K0HA 3UY9A 3UOUA 1GHBF 1NM6A 2ZFRH 1VJ9U 1MQ5A 2ESTE 4GAWA 1O3JA 4SGBE 1P06A 3E91A 3PMAB 5TJXA 1J14A 2PKSC 4CRGA 1HFDA 1O35A 1V2TT 3SU5A 5EU8A 2CF8H 1O39A 1O37A 3I78A 2OC0A 2VNTA 1SGFA 3AAVA 2AMPA 2BVSH 3RXDA 3BTFE 5FPYA 3U8TH 1JWTA 1O2YA 1AGJA 3BTWE 1SFQB 3PMBB 4E7NA 2BY8X 5AFZH 4ZHAA 1O5CB 1KSNA 3MU8A 5A8XA 1RD3B 2VWOA 2TGAA 5L6NH 1DICA 1W2KH 1FY3A 3MU5A 2R0KA 3C1KA 1WOFA 2D8WA 3SOSA 5E2OA 1S6FA 1O3DA 3DD2H 3MNXA 4O9VA 3PROA 1GDQA 4K60A 2XWAA 3MH4A 2WV4A 3M5NA 2GMTB 1VITH 3KGPA 3RXBA 3SNAA 1NU7B 1XUGA 5DP6A 1Y3XA 3K65B 4IN2A 1HUTH 1S83A 1YKTA 4O03A 1KDQB 2FTLE 1FAXA 2PGQB 1OP8A 5DP8A 5GCHF 3JZ1B 3ZVAA 1Z1IA 3T26A 1J16A 4MVNA 1MBMA 1IQKA
chains in the Genus database with same CATH superfamily
4LK4A 1V2UT 2ZIQH 1ZTKA 1FV9A 2O8TA 1GHXH 4AFQA 3OU0A 6LPRA 2M2AA 1TMTH 1S0QA 1RTFB 4XRNA 1WUNH 3NZIA 1ELCA 2PR3A 3EE0B 3K9XB 3VXFH 1EPTB 1C5UA 4DURA 2ZZUH 1INCA 4BANB 1HIAA 2B7DH 1HJAC 2DE9A 3LH3A 2WPMS 3TH3H 1KXEA 4NA7A 1S5SA 4DIHH 3BTKE 4MNXA 3U98H 4KELA 3UFAA 1QBNA 3PTNA 1RFNA 2Y5GA 2FXRA 1BZXE 1F2SE 1MAYA 5F53A 1EJNA 1IQGA 3CS0A 1GBCA 1IQJA 1SQAA 2QF4A 1MD7A 1AVWA 4Q4LA 2LIZA 1FPHH 4LOYH 2Y7ZA 2AFQB 3MQKC 5HXFA 4IS5A 1MQ6A 2NWNA 3QO6A 1AWFH 3CNRA 3ELAH 3B8JA 1IQLA 1T7CA 3GY6A 2K7XA 4MPUA 6CHAB 2A45B 1A0LA 3GDSA 1O3PB 1QGFA 1C1OA 1H4WA 4I8GA 3ZZDA 5H4IB 2BDIA 1O2IA 1SQRA 4A1VA 8ESTE 5LH8A 1EAXA 4K8YA 8GCHG 1EATA 2ZGXH 4WH8A 1VGCC 1YC0A 1O2RA 1NFYA 5E0JA 3RU4T 3F6UH 1AHTH 1EX3A 1A61H 3AK5A 1O2MA 1P02A 2ZHFH 3A7XA 2OUAA 2PUXB 1P03A 2XNDD 5FBIA 1NZQH 1SKYE 3BTDE 2W7SA 3FP6E 1KIGH 2ZG0H 1HCGA 1Q31A 3PB1E 2WPKS 2VVCA 3RXMA 3FZZA 2NU1E 2ANMH 1O5GH 1GHZA 5EIYA 1AE8H 2Z3EA 1GL0E 1WQSA 1YPKH 4ASHA 4FUHA 3UAIC 1LMWB 1EAIA 2SGPE 1CT4E 5LPEA 1W8BH 5A8ZA 2BDGA 2XRCA 1PPBH 2L6OA 2JH0D 3RLWH 4THNH 1C1PA 3RUOA 2JJ1D 2JH6D 2FS8A 4CH2B 2THFB 2V3OH 2ULLA 2O8LA 4X1QU 1S6LA 1SVPA 3AW0A 4KTUA 4NFFA 1NFWA 3BF6H 2VIWA 3E3TA 2WSSD 4AG2A 4FUBA 2K1QA 2CGAA 1PQAA 1UW7A 3SGBE 2FEQH 1C5SA 2FODA 1C5LH 2A1DB 1VGCB 1O2PA 2VBCA 1C1UH 3GOVB 2J95A 3GS9A 2VIQA 1SMFE 4BOHA 2BX4A 2XWBI 1P09A 5G4BA 1Z1JA 3HATH 2OQUA 1KMHB 1QB6A 1HIAB 5C2ZA 1P2OA 1ARCA 2FI3E 2BQ7B 2GKVE 2NU0E 3BIUH 3DHKH 2PW8H 1BJUA 2FOAA 2ODPA 1NU9A 1O3LA 3UPEA 2ZFSA 1P57B 1ZR0A 3L3TA 4I32A 5DSFA 1F92A 1ETSH 1NY22 3ZVDA 3M61U 3MWIU 1XM1A 1A3EH 2QXJA 3KEEA 3ESTA 1ACBE 2XBVA 4AGJA 4DG4A 1DOJA 2J97A 3MU4A 2SNVA 1DWBH 1T8OA 3ZZ8A 2ZCKP 1FLEE 3N7OA 1AE5A 3SZNA 4GVUA 1ZZZA 1Z6JH 1CGHA 1LHCH 4INKA 3T29A 1D3PB 1P9UA 2C93B 3P8GA 2RA3A 2EA3A 1ANDA 4ISHH 1O2OA 2SGEE 3ZZ9A 3SHCH 1E37B 1A5GH 1DXPA 1THPB 4DT7B 1DXWA 2WHXA 4I8JA 5T6FA 3ODFA 1V2PT 1QRXA 4H4FA 2GZ9A 2XYAA 3H5CB 3SO3A 1JBUH 1G3DA 4GCHG 1P3EA 1EZQA 1O36A 1LPZB 1UCYE 4UFDH 1SLUB 1GPZA 1P2MA 3LJJA 1TNHA 4YO9A 1O3EA 1N8OB 1ZMJA 2VGCC 4K1SA 3UUZA 1K1NA 3U8OH 2GZ7A 2ZTYA 1SR5C 1ZJKA 3IG6B 2CV3A 3RXTA 1TX6A 5AF9H 3LT3A 4AYYB 2BLWA 1ZTJA 3SGAE 1O3AA 4TPIZ 3UWJH 1MZDA 2GT7A 5JBTA 4BAKB 2F9VA 4OS5A 1HAXB 1HJ9A 3NK8A 2J94A 2RA0A 3MH6A 1P11E 1O3GA 1E1RD 5LGOA 2KFWA 1UK4A 1QB9A 5DP4A 3TJUA 2VINA 2ZHQH 1THRH 4INLA 1C2LA 3U69H 2FZZA 1JXPA 4NIXA 4ZKOU 1AB9B 2BB4A 2P8OB 4B6EA 2P3UB 1XKBC 1COWD 4XFQA 3NWUA 2KCYA 4DJZB 3ZYDA 3A81A 3A8CA 5C20A 3N7EA 5JBAS 1BMNH 4A7IB 2LP6A 2WPDD 2ZFPH 4JYTA 1ESAA 2BD3A 3LOXA 1FI8A 1VJAU 2CMYA 1MTUA 1GJ6A 3F9FA 1GBIA 4JYVH 4AFZA 5F6MA 4IGDA 1CQQA 1SGDE 2FOHA 3DUXH 3QZQA 1F0UA 4Y0YE 1RGQA 1FY1A 3WWBA 2CK3D 4X8SH 3TIUA 1JOUB 3VB5A 4Z6AH 1O2SA 3FP7E 1KLTA 2BD4A 1UO6A 1YGCH 1EOJA 2R0LA 2IPQX 3BEUA 1HJAB 1C5NH 1ZHRA 5FX5A 2A5KA 4ZXYH 1O0DH 4PROA 3P70B 1TB6H 2BDHA 1MD8A 3F9EA 3F9HA 1WXRA 2ZHWH 4X6MA 3PRBA 3LC5A 1GI2A 5F8TA 3M3VA 1EB1H 2FOBA 5LPRA 1BTHH 1QHRB 7GCHG 1B0FA 3KNXA 3SU0A 1ZMLA 1MTNB 5K7RA 2HLCA 2BXUH 1EP5A 2GDEH 1VR1H 3P8FA 1AUJA 3F68H 2YOLA 5A2MH 4DGJA 1LTOA 1QZ8A 3M35A 2AERH 1YLNA 4H6TA 3MHWU 3RDZA 1Y5AT 1W7GH 2WINI 5C0UA 3TJOA 4B74A 1C1MA 2Y5HA 1C5VA 5IDKA 2W26A 2F83A 1J9CH 1ARBA 1CHOF 1CA0C 1GJ7B 4JYUH 2GV7A 3SNDA 2TGTA 1K1IA 2G55A 1GJ9B 1DSUA 3GY4A 2JJ2D 2BY6X 1OWIA 5GNDA 2IJOB 1CA0B 1SGCA 4XBCA 1WCZA 4BAQB 2BD8A 5AVDA 1GMHG 4RT0A 1BHXF 1AY6H 2GTBA 4X0WU 1ZSJA 2QAAA 1GVLA 1W7XH 2R2MB 2KM0A 1SHHB 1WAYB 1GI7B 1GJCB 3GCHB 3A7VA 3Q76A 4FOUC 1CE5A 4I7YH 4HG6A 1NC6A 2OBQA 4Y8YA 1TRYA 1AZZA 4ABEA 3TK6A 4NIVA 2A32A 4YOGA 2VWLA 4MPXA 1E0FD 1HJ8A 4ABJA 3MMGA 3F0OA 5JDUB 1HAVB 5AFYH 3BN9A 2PTCE 1GDUA 1SB1H 4ABFA 1ZPCA 2PHBA 3O8BA 2WYJA 3BEFB 3GYMA 1C5TA 5GPIB 1FY5A 1O2UA 1O5FH 7ESTE 7LPRA 4NSYA 4X1NU 1VZQH 2BVXH 3GICB 3FZDA 5FBEA 3M36A 2PTNA 3M5MA 1XVMA 1D3TB 5FXLA 1O2KA 4Q7ZA 1EJMA 1QB1A 1GCDA 1F5LA 1HDTH 1SHYA 1C2EA 1GI1A 1Y8TA 2BQ6B 2FM2A 4RI0A 3ZZ3A 1BQYA 2WYGA 4DIIH 1OP2A 1G2MA 1BTYA 1ELTA 2I6QA 3P92A 1QBOA 1YF4A 2ZDKA 4D7FA 4MPWA 2BM2A 3RXHA 4HTCH 4HFPB 3E8LA 3SUGA 1V6DA 5C1XA 1FXYA 2PGBB 3PO1C 4NA8A 3ZVCA 5GIBA 2BDAA 1GWAA 3AASA 3RXJA 4ACBA 1OHHD 5DG6A 4I8HA 2FESH 5CHBA 3SHAH 3NUMA 2OD3B 1O38A 1TBZH 1C9TA 1VCWA 3VG8A 1VCPA 3IITA 1H9HE 4NZQA 4D8NA 5B6LA 2QGRA 1UK2A 2BX3A 1EQ9A 4NFEA 4YLUA 4WY3A 1MTSA 1QJ1B 1FJSA 1K28D 3CP7A 1XXDA 1EFRD 4K3JA 3H7OA 4R0IA 1K1PA 5HIZA 3DSOA 1L1GA 1P10A 4F49A 4RSPA 3FANA 3KL6A 3S7HB 5JBCS 4OS4A 2F91A 1LO6A 3FO8D 4YZUA 5EJZA 5DK1A 1YPJH 4WMDA 4ABDA 4ZXXH 3NCLA 1TPAE 1QJ7B 1OWKA 3GCTF 1AUTC 1Y5UT 2QCYA 1UVOA 2V35A 5CHAC 4ISIH 1Z6EA 1GJ5H 1F5KU 2RCEA 3EBNA 3PLPA 4RKJB 4YOIA 3VXEH 3ZZCA 1GMCF 3QGJA 4FVDA 3SV2H 2FP7B 2Y81A 1Y3WA 5HGGA 5L2ZH 4NWLA 1SGQE 1P3CA 2SNWA 3KQEA 1LHDH 2C8XB 4TWYA 2FS9A 3SI3H 2KAIB 3RXIA 1A5HA 3A84A 2AGIX 3Q3YA 1DM4B 1O5AB 2P3TB 3GDUA 1HLTH 5J4QA 3OEHD 3WY8A 1CHGA 4JZ1A 3UWIA 2JIZD 5KECA 2AS9A 2SGDE 2O8WA 1IQNA 1GJDB 1O34A 2W7UA 5ESBA 4HI3A 1GMDF 1MMJN 2QY0B 2HPQH 3BTTE 1HXEH 3A88A 2Y82A 4TPYA 1XVOA 4UFGH 1AB9C 1S0RA 3EQ0H 1EJAA 1YY3A 2BLQA 1O2WA 1NPMA 1SQOA 3SJOA 1W0YH 1P8VC 3TLOA 2XBXA 2ALVA 2A4GA 4NIWA 2P94A 1UVPA 4OS6A 1YYY1 3EYDA 1HBTH 3PO1B 1HRTH 1GI3A 2AEIH 4IC5A 2YNAA 1ETTH 1OYTH 1TFXA 1IQFA 2VWNA 1O3BA 1FZZA 3MO6A 1S82A 2STAE 2F43B 3UQOA 1V2MT 3DA9B 2STBE 3QWCH 2CXVA 4AZ2B 1L1JA 3V3MA 1UTLM 1SGYE 1HAOH 1MKXH 2G4TA 2FOGA 1KXBA 1LDTT 1AI8H 1BRAA 5EJ1A 3VEQB 4WWYA 4I86A 2ANKH 2P59A 2Y5FA 4Y10E 3PV5A 1HNEE 1IHSH 1TGSZ 1KXCA 2ZPSA 1QCPA 2ZGJA 1CU1A 4LZ1H 3FFGA 1S81A 2XTTB 5DN6D 4FUCA 1AFQC 3ZV9A 4XBDA 1C2HA 2ZFQH 1C2KA 1V2RT 1UTQA 4X2YA 1JIRA 5BRRE 2FOEA 4JK5A 5HM9A 3LDXH 1L1NA 1SFIA 1EZXC 2QV1A 3QDZB 1ZPZA 2GGVB 2ZCHP 5CMXH 1YCPH 2HNTE 2XBWA 2ZPQA 3VPKA 3UNRA 1UHBA 3L33A 1DX5M 1LVOA 1C1SA 1TNKA 3OYPA 1SGIB 1C1VH 1B7XB 1YCPM 2UUKB 1ZTLA 2XCNA 5GJ4B 1PPCE 1TGCA 2OC7A 2UWLA 5A8YA 2F3CE 4GLYA 1C1QA 2J4IA 3QK1A 2WPHS 3NPSA 3K6ZA 2D26C 1HYLA 1EOLA 3GISB 4B73A 1WBGB 5EG4A 1O2JA 1P12E 2ZFTA 5A09A 1GJAB 2ZFFH 3K2UA 3RC4A 1GJBB 2A0QB 3STIA 5EQQA 4JZEH 1H9IE 1BBRK 4X6NA 1DLEA 3EDXB 3AW1A 1E1QD 2H1UA 1UVTH 5A0AE 6CHAC 3B9FH 3V13A 2FO9A 1NRQH 5A0BA 1G37A 3GY2A 4ABGA 1O3KA 4CRAA 1CO7E 2BLOA 3Q00A 5JYIA 2YNBA 2ZWLH 5HM2A 5EW1H 2CHAB 1EAWA 1ELFA 4VGCB 1GBFA 1Z8RA 3ZZ5A 2OLGA 1ELVA 1FONA 1PFXC 1TQ0B 2HWLB 2LPRA 3LGUA 3RU4E 1QQ4A 2BDBA 3TNTA 2EEKA 3HKJB 1ZHPA 1ZMNA 1C5XB 2UUYA 5JBBS 1O3CA 1WV7H 4ZAEA 3MO9A 4I8LA 1AFEH 1K2I1 1FDPA 1P04A 2Z9LA 5I25A 2HRVA 4X8VH 3GCHC 3M3SA 3HPTB 1KXAA 1C5WB 1SGPE 3SU4A 4TWWA 1GBJA 1XUHA 1A7SA 1C5ZB 3RLYH 1Z8JB 3KF2A 3V0XA 3MOCA 1C2JA 1PQ5A 2BVRH 1E38B 1MH0A 2W3IA 3HK6B 4MNYA 3HKIB 3BTHE 1S85A 3E0NB 3E16B 5C1YA 1TPSA 4Z1MD 4B1TA 4CRDA 2HLDD 1TPOA 2J98B 3CENA 4GHQA 4KKDA 2Z94A 1LHGH 4NGAH 4FUGA 3PWCA 1HAHH 1L0ZA 2BDCA 1O2TA 3VGCB 1IQIA 4BAHB 2WUCA 1WDIA 1LHFH 2IPHA 3NXPA 4O3UA 1ABJH 3HK3B 1SLVB 4A1XA 1BHXB 1GHVH 3NKKA 3SV8A 2SGFE 1EXFA 3GYLB 1TYNA 3HGPA 1TX7A 2C8YB 3UREA 1GMHF 2KZ4A 1XXFA 2V6NA 2EY4C 2R3UA 3SORA 2AHME 2G5NA 2J2UA 4F4OC 1RS0A 1NRPH 2ZNKH 4NIYA 4BAOB 3PRDA 3A8AA 2G4UA 1DY9A 3A7TA 2WUBA 3SYJA 2FOFA 3UB0A 1AKSB 2BZ6H 3MH5A 3ZYEA 5HYOA 1MKXK 1GBTA 2EC9H 2PLXA 2GDDA 3P8OA 3SUEA 3UR6A 3FOAA 1T4UH 2V7QD 4Q63A 5KEDA 2RFKC 4LXBH 1C4V2 2G5VA 2G51A 2QIQA 4JMYA 1GBAA 5EXLA 4P00A 2A5IA 1IHTH 2ZDVH 2WV5A 5CE1A 1O2NA 3UR9A 3KYGA 4FU9A 7GCHF 1H8IH 3RXQA 3SI4H 4OS2A 1TA2A 5L30H 2Z9JA 4CRBA 3VB4A 2M5TA 2GZ8A 2HVYB 2W6ID 2XOKD 3BTEE 2FDAA 1C5PA 1SLWB 2BXTH 4GSOA 3URDA 1SC8U 1B0EA 4IMQA 5C3NA 1PJPA 1G9IE 1YPHC 1OWEA 3PMJA 3O8RA 1BIOA 1W0ZU 4ESTE 1GI5A 3MNBA 2EI6A 4BNRA 2FWWA 3SNCA 5FX6A 3BSQA 2P95A 1YLCA 4A6LA 4IC6A 2OXSA 1TGNA 3RXPA 1TMBH 1SGRE 3S9CA 5J4SA 1Z7KA 2UWOA 3I29A 2PSYA 1SPJA 1IQEA 5EODA 4AYVB 2Y7XA 2BQWB 4UEHH 2F9NA 1LVYA 2ZDAH 2VGCB 1AMHA 1UVSH 2HVXA 1EASA 1JMOH 4QT8C 3S9AA 3QUMP 4CREA 2B0FA 1U6QA 2ZKSA 1O2QA 1TGBA 2KCAA 5JB9S 3A82A 3DSGA 2VIOA 4UFEH 1V2KT 1AVGH 1K1OA 4DW2U 5CDFE 3UOPA 2EI8A 5DP3A 1KXDA 1P2KA 1D4PB 2B5TB 5PTPA 1QNJA 3MNCA 3HGNA 2P8OC 2AH4X 5BPEA 2GCTB 4CR9A 4P02A 1LQDB 2ZU1A 3SJKA 1B5GH 4UFFH 5A0CA 1IOEA 1XKAC 3KN2A 1UTPA 1FNIA 2VVUA 3F2FA 1TRNA 4AGKA 2XC5A 1BTZA 1PPFE 3SBKA 1FN6A 1W3CA 1D3DB 2GVFA 2ZGHA 1UK3A 2R3YA 5CHAB 1YPEH 4MTBA 2J38A 3SN8A 2PKSB 1F7ZA 2C3SA 2H2ZA 2PV9B 1BJVA 5FCKA 3SU1A 3TJVA 1MTWA 1ZRBA 1OOKB 1C9PA 4MPVA 1ZSLA 1BTPA 2QE7D 1TNGA 5EPYA 5GWZA 1ANBA 2O8MA 1DSTA 1UTOA 2ZDMA 1Y3VA 4GCHF 2H9EH 3D23A 1GHBG 2FLBH 4H42U 5F8XA 4D7GA 4FXGH 3BG8A 4Y8ZA 4SGAE 2YMSD 4K69A 5T6GA 1GVKB 4K8BA 1OWJA 3EA9A 3S9BA 3DFJA 1GI9B 3RC5A 1TAWA 2FX4A 1GI6A 4CHAC 3GY5A 3T25A 2IN2A 1LPKB 3RMOH 1MTNC 5T6DA 5JB8S 4ISOA 5AHGH 3IWMA 3OAAD 3A8DA 3NRLA 2OTVA 1UTNA 3T5FH 4MNWA 1BRBE 1HAZB 4NSVA 4O97A 2FMJA 1A46H 2A4OA 3A83A 3A87A 1C2GA 1BMFD 2Z9IA 4AC9A 1VKYA 4FVBA 3RXVA 1BTUA 4OM9A 3CS7A 1HPGA 4MNVA 2JKHA 2B8OH 1KTTB 2LELA 2Z3CA 1BA8B 3F9GA 1TLDA 2TIOA 3E1XB 3S69A 1BRCE 3UNSA 1K9OE 4NCYA 1BITA 1T32A 1FUJA 2H9HA 1GBDA 2W3KA 2ZDLA 3STJA 4LZ4B 2HALA 5FCRA 3SU6A 2BOHB 1WQVH 1QFKH 5FAHA 1SQTA 1FY4A 1BRUP 4XSKU 2ANYA 4AX9H 2Z9GA 2V3HH 5EXNA 3TU7H 4YT7H 2NU3E 5LPFA 1NRRH 1FMGA 5EGMA 1C5QA 2ZU2A 4KGAA 1LVBA 2VH6A 2ZF0H 1GMDG 3OE7D 4D9QA 4YXWD 1GI8B 4YOJA 1NESE 2GMTC 3FAOA 4NA9H 3PV2A 1G3CA 4Q2KA 5JPMH 3M3TA 2SGQE 4ISNA 1GBBA 5EQRA 2OINA 2XC4A 2QXHA 4MG3A 4X2XA 1AFQB 1D9IA 2F9OA 1BMAA 1TIOA 2A7HA 5EW2H 1KXFA 1K1LA 1TONA 2KR7A 3A7YA 2TBSA 2CF9H 2H9TH 1QQUA 2ZC9H 3PTBA 1FIWA 1ZYOA 1K1JA 1UJ1A 3D62A 5DP7A 2XNIA 4K2YA 1UTJA 4J1YA 1GMCG 3E6PH 1IQMA 4E05H 1HGTH 1S6HA 4VGCC 3SV7A 4TSFD 2QF3A 2AMQA 4U32A 1NRSH 3URCA 1O3OA 1ZJDA 1O5EH 4OGYA 1C5OH 3GCTG 1ESBA 4JZFH 3LIWA 4Y0ZE 1DITH 1EAUA 1MABB 3DSPA 3GY8A 4RKOB 5FHTA 8GCHF 5SGAE 3GCOA 2AGGX 1W12U 2B9LA 1BBRH 1NROH 1O2LA 4Y6DA 3QLPH 1J8AA 1JRTA 4XD7D 1KY9A 1E79D 4B6FA 2ZHEH 1F0SA 1O2XA 2ZGCA 2NU2E 5EPNA 3Q3KA 1QURH 2WZQA 1W10U 3R0FA 1O32A 2G81E 3MFJA 2J9NA 1O3IA 1HB0B 3VB3A 1G2LA 4WXIA 1GG6C 1BCUH 4CH8B 1OX1A 1D3QB 1THSH 3RM2H 1QBVH 3A89A 1AN1E 1BTXA 1X7AC 1G3EA 1ELBA 2PSXA 4YM9A 2ZI2H 2A7CA 2IJD1 3Q77A 1DVAH 1L4ZA 2OCVB 1CT2E 3H09A 1P05A 1XMNB 1K1MA 1OXGA 1KYNA 2Z9KA 1OS8A 1TX8A 4B2CA 1C4U2 1P2QA 2VIPA 3Q3XA 4AORA 3JZ2B 2Q1JA 3F0PA 3ZZ4A 1N8OC 4X2WA 2ZECA 1YLDA 1XX9A 3LGWA 1P01A 1RIWB 4GUXA 1MU8B 4XOJA 2BYAX 1ZGVA 3U1IB 3C27B 1CSOE 1G3BA 1PYTD 3ZZ7A 1MAXA 3GDVA 4FETA 3EGKH 2ZU4A 1NFXA 8KME2 4ACAA 1AVXA 1SL3A 3ZZ6A 1WTHD 2V3MA 2XXLA 1T31A 2Z3DA 3GCNA 1CGIE 1ELDE 2L74A 4AB9A 1W13U 1MKWK 3SGQE 4D76A 4ZKSU 1C5YB 4KP0A 2JH5D 2ZQ2A 4JZIA 4H6SB 4TY7A 5EQSA 1OWDA 3LGTA 4Q80A 1O33A 3ZIAD 3EAJA 3KIDU 4ZKRU 3TK9A 2W5EA 3ATIA 1XUKA 2BZAA 4CHAB 1YM0A 5GXPA 4GHTA 1MKWH 5C5OA 1O2GH 1DUAA 2A7JA 2HGTH 4IMZA 1XUFA 4TYDA 4YT6H 1C2IA 2BD5A 2VIVA 1A0HB 2J92A 1O3MA 2ZA5A 4X6PA 3SZEA 2WPLS 3SUFA 3RP2A 3AAUA 1Y3YA 1DWCH 1O3FA 1ELAA 2BD9A 3DCLA 2FOMB 1NFUA 3KQCA 1SOTA 2A5AA 3E0PB 1LPGB 1AQ7A 4WVPE 2UWPA 3SJIA 5ABWA 2OC1A 1AWHB 1E36B 2OC8A 2WPJS 1CGJE 1OWHA 3DFLA 2ZCLP 5C0TA 3MI4A 2A4RA 3ZVFA 3SJ9A 4F48B 3RXSA 1MCVA 1SGTA 1BBRE 2J5UA 1N6YA 2ODYB 1NRNH 3N99A 3A86A 1CHOG 1UCYH 3U9AH 1RTLA 4UD9H 3RMMH 2BTCE 4U01A 4BAMB 1NN6A 2TRMA 4FUJA 1C1TA 1AIXH 1TOMH 2BD7A 1A5IA 3P6ZB 1V2NT 4Y76A 2ZQ1A 3LJOA 4K5ZA 1EP6A 4JK6A 4OS1A 3RMNH 2G52A 2RDEA 3TGJE 2P16A 2D1JA 3UTUH 2G8TA 4ZHLU 4Y79A 3RXFA 3ZZAA 1H1BA 1TBRH 5EJLA 2PKAA 3RMLH 4CBNA 1TWXB 3KQ5A 4Y7BA 3LC3A 5E8EH 4ISLA 2BDYA 3RXOA 1RJXB 1GCTC 2H5DA 1GGDC 1RIWC 1JRSA 2FI4E 4CRFA 1C5MD 4A92A 1N1LA 4HGCA 2ZPRA 1AO5A 2K8IA 1TOCB 3U1JB 1O3HA 3SV9A 1J15A 1BB0B 1G32B 1WYKA 2BY5X 1ELEE 3OY6U 1SSXA 4Y71A 5B6OA 1LKAA 1ZHMA 1Z8GA 1ANEA 2OK5A 1DE7H 1TPPA 3ENSB 3M7QA 1DLKB 1J17T 2VB0A 2BHGA 1QIXB 3V7TA 5DP9A 3AVZA 2QXIA 1LCYA 1F5RA 1CBWB 4K1EA 1EZSC 9LPRA 1GVZA 1P2IA 3W94A 1BT7A 1YPHE 2Y80A 3RXLA 1DWDH 2QN5T 4Y7AA 3RXKA 5GDSH 4ABAA 1DPOA 3LPRA 3TGKE 2J34A 8LPRA 5DPAA 1Z8IB 5TCAA 3GY7A 3KHVA 2FYQA 1QTFA 4AB8A 1DY8A 2EQNA 3QZRA 1DWEH 2XBYA 1L4DA 3V12A 3TH4H 3BTQE 4FUEA 5DKMA 3W95A 1DFPA 1HXFH 3U8RH 3FVFB 1DUEA 3M7UA 1T8NA 4WXVA 1MBQA 1Q2WA 3ZZBA 2C8ZB 4NG9H 2HOBA 1V2LT 1BTWA 2F9PA 4Z0KA 4JZDH 1SGNE 1UTKA 1ZPBA 1AD8H 4FUIA 1P2JA 1EPTC 3R3GB 1GHYH 1H8HD 1O5BB 1M9UA 1L2EA 1V2WT 2FOCA 2Q6FA 1OYQA 5FPTA 4TY6A 1C1WH 2UUFB 3SW2B 4U30A 1NBMD 1HAPH 1TRMA 1ID5H 3E90B 2OP9A 4ZUHA 4B76A 3LH1A 5L2YH 2BOKA 4AG1A 1NT1A 3SQHE 1ANCA 1D6WA 2CJIA 4JCNA 3MU1A 4RN6A 1SOZA 2QF0A 4R8TB 3BIVH 2VVVA 3ZVBA 3TJNA 1YWUA 2EI7A 1Y3UA 1V2JT 2O9QA 5FPSA 5E2PA 1CT0E 3M5OA 4IW4E 1OKXA 2QF5A 4A1TA 2V0BA 4CR5A 1QL8A 1A4WH 4X1SU 1HAIH 3DT0H 2G00A 5FL7D 1P9SA 1W11U 3KCGH 1MUEB 1OSSA 3VFEA 1H8ED 1O2HA 2GV6A 4BXSA 4X1PU 3WW7A 1V2VT 1C1NA 5DGJA 1IQHA 5F03A 3O8CA 2Y6TA 2I6SA 1W0KD 3ODDA 1NO9H 3QGNB 3FKSD 3VGCC 1RXPA 4ZMAH 1TNLA 2SGAA 4DOQA 1SGEE 2JDID 5E0GA 1MCTA 1FPCH 4X1RU 1UMAH 1UVUH 1PPEE 3ATLA 3OTJE 3H7TA 5ESTE 1QA0A 2AGEX 4KTCA 3A7WA 2FX6A 1CBWC 5F8ZA 1ZGIA 3RM0H 2PKAB 3TPIZ 2A4QA 3OX7U 3UIRA 1T8MA 1O30A 4B71A 2VJ1A 5T3HA 3RXGA 2W6JD 1C4Y2 1QJ6B 3RU4D 3RXCA 4MLFB 4DT4A 4I8KA 1HV7A 1K0HA 1VCQA 4HZHA 3S7KB 1WTGH 1BMLA 2RG3A 4Q7YA 5TCCA 2P3FH 4XE4A 1S84A 1EKBB 3BG4B 3QTVH 4Q7XA 3RXUA 4IN1A 4IBLH 1BMMH 1PPZA 2ZEBA 3T27A 2FI5E 1SBWA 2VIDA 6GCHF 4WH6A 1MTVA 1PQ7A 3SQEE 1T8LA 3TVJB 4D9RA 3UQVA 1ABIH 2A2QH 4BXWA 7KMEH 2ZO3H 1VITF 1MZAA 2OBOA 4MQAA 3G01A 2HPPH 1H9LB 3PMHB 2Z6BD 5IK2D 3MO3A 3ITIA 2FPZA 2RDLA 4A5TS 3VB7A 1LHEH 3BV9B 3KQDA 2VU8E 1JIMA 1A2CH 2R2WU 3TNSA 2PP6A 5ETXA 4F55A 1RTKA 3SU2A 2BY9X 4ZHMU 2ILNA 4FUFA 2BY7X 4BTTB 1RRKA 2HNTC 1KTSB 4GPGA 3A8BA 1KDQA 2ZU5A 2QXGA 3A7ZA 1C2FA 1P2NA 1PPHE 3A80A 1WSSH 3BTGE 4WJG2 4YLQH 3KQBA 4FU7A 4E06H 4WMFA 2XC0A 1GBLA 2VWMA 2BD2A 4B2AA 1GG6B 1XUJA 1EB2A 2DE8A 1PQ8A 4ABBA 1K21H 2ZDNA 2K0QA 5HIYA 4DVAU 2JETC 2PUQH 5C17A 3RXAA 3VB6A 3T2NA 4K1TA 1TABE 1O2ZA 1AZ8A 1H8DH 3OFND 3GY3A 1TA6A 2YMSB 4WF8A 4X6OA 1UCYK 3F1SB 2PFEA 1GHAG 4X8UH 1HAGE 2AIPA 5DO4H 1ZRKA 4WMEA 1C2MA 4I31A 3PV4A 5T1VA 1GBMA 2FYRA 2F9BH 2GCTC 5C5NA 1E34B 2HNTF 2ZHDA 4M7GA 2FLRH 1GHWH 2H6MA 1IAUA 4FU8A 1GGDB 3RXRA 3TGIE 3LU9B 4ZH8A 3M7TA 1MU6B 1C5RA 4ABHA 4B2BA 3B23B 3D49H 2GCHF 1AKSA 1SLXB 2TGDA 3L6PA 5DP5A 1DS2E 1A1RA 9ESTA 1QRWA 4FUDA 3QTOH 1QRZA 1P0SH 3RC6A 4NWKA 2QC2A 1QR3E 4CBOA 4I33A 1O3NA 2ZTZA 1Z71A 4AFSA 3OY5U 5DJ7A 4ABIA 1W0JD 3TITA 2GCHG 1EZUC 1NS3A 2ALPA 5GCHG 5C94A 2H5CA 1Y5BT 2TPIZ 3MNSA 3LGVA 5EOKA 1E35B 4M9FA 1N6XA 2SFAA 2ZP0H 1Y59T 1OP0A 1KLIH 3M37A 1YPMH 3MYWA 3QX5H 1WU1A 1DANH 2ODQA 1FQ3A 2UUJB 3PLBA 1QY6A 3F2GA 1QL9A 1GHAF 4KTSA 3TH2H 2GT8A 3SJ8A 1F0RA 3MU0A 1CA8B 2LNCA 1PPGE 4AN7A 1GJ4H 3LONA 1V2QT 2Q6GA 1G36A 4UE7H 5EXMA 3LGIA 2GX4A 1ETRH 1LKBA 2GD4B 1GCTB 3OSYA 3D65E 3PWBA 1BOQA 4J2YB 1F0TA 1KLJH 3EE7A 2TGPZ 3ZV8A 1V3XA 1UHBB 2FTMA 2AIQA 3PYHA 2ANWA 4BTIB 1EUFA 3PM3A 1TGTA 2KCPA 2C90B 3ZVGA 3BTME 1TNIA 4B75A 2ASUB 3T62A 1GJ8B 3BEIB 1BUIA 2DUCA 4BTUB 3EA7A 2AMDA 3RXEA 2WPIS 2JETB 4AFUA 4X2VA 3QN7A 3PLKA 1HAVA 1GBEA 2Z7FE 3A85A 1TQ7B 2YMSC 1SI5H 3ATWA 1K22H 2BLVA 5E0HA 3SV6A 2WV9A 1TMUH 2QA9E 3SUDA 4X8TH 4TT3D 4DCDA 4YTAA 3OEED 1SG8B 4XDEA 1Q3XA 1ESTA 1LQEA 1C2DA 2R9PA 4Y11E 1FY8E 3ZVEA 4MDSA 1YPGH 4OS7A 1VITG 1PYTC 1HAYB 1QL7A 5C67A 1GBHA 1FAKH 5IYTA 2PWXA 3I77A 6GCHG 1QA7A 1TALA 1EPTA 1O2VA 1YCPK 3SU3A 1BDAA 3SNEA 2KCOA 2XW9A 4O3TA 3ATMA 3ATKA 1TNJA 2VH0A 2C8WB 1TE0A 5KGOA 1ZOMA 2QYIA 1DT2A 2F4LA 2A2XH 1G30B 4E7RG 4CRCA 1XUIA 3F3BA 2ZTXA 2ZU3A 1V2OT 4YESB 4UONA 1GBKA 3OTPA 4OGXA 2XCFA 1GI4A 1DDJA 3TK5A 3P8NA 1YBWA 2Q6DA 4NZLA 4DY7B 5I46H 1GDNA 4AOQA 1C1RA 1NTPA 1TBQH 2FIRH 3U28C 5C1UA 2CN0H 4ASUD 1GL1A 5HMAA 3UNQA 1A3BH 1ZLRA 1FN8A 2D2DA 4INHA 2KX4A 1O31A 2J98A 2F9UA 2BMGB 4Y8XA 3P95A 2IOTA 1UTMA 3K6YA 3BG4C 3WWFA 1LVMA 4UDWH 1A0JA 3LGYA 3LKWA 3N7DA 3M5LA 4ZKNU 1SGFG 3MH7A 1CVWH 1AU8A 3FP8E 1W14U 4XBBA 3P17H 2ZGBH 2P93A 2KAIA 2O8UA 1T4VH 3FN8A 1D6RA 3SNBA 1FIZA 2CHAC 3EA8A 1OPHB 1ZSKA 3S0NA 4ZROA 1V2ST 3MTYA 3O8DA 3T28A 1ORFA 6ESTA 1YP9A 4U2WA 2C4FH 2OQ5A 2A31A 1ELGA 2GP9B 3KYFA 1YPLH 2AYWA 1GI0A 2GJGA 1O5DH 2NU4E 5K0HA 3UY9A 3UOUA 1GHBF 1NM6A 2ZFRH 1VJ9U 1MQ5A 2ESTE 4GAWA 1O3JA 4SGBE 3W1EA 1P06A 3E91A 3PMAB 5TJXA 1J14A 2PKSC 4CRGA 1HFDA 1O35A 1V2TT 4RT1A 5EU8A 3SU5A 2CF8H 1O39A 1O37A 3I78A 2OC0A 2VNTA 1SGFA 3AAVA 2AMPA 2BVSH 3RXDA 3BTFE 5FPYA 3U8TH 1JWTA 1O2YA 1AGJA 3BTWE 1SFQB 3PMBB 4E7NA 4ZCNA 2BY8X 5AFZH 4ZHAA 1O5CB 1KSNA 3MU8A 5A8XA 1RD3B 2VWOA 2TGAA 5L6NH 1DICA 1W2KH 1FY3A 3MU5A 2R0KA 3C1KA 1WOFA 1NBME 1FX0B 2D8WA 3SOSA 5E2OA 1S6FA 1O3DA 3DD2H 3MNXA 4O9VA 3PROA 1GDQA 4K60A 2XWAA 3MH4A 2WV4A 3M5NA 2GMTB 1VITH 3KGPA 3RXBA 3SNAA 1NU7B 1XUGA 5DP6A 3F2HA 1Y3XA 3K65B 4IN2A 1HUTH 1S83A 1YKTA 4O03A 1KDQB 2FTLE 1FAXA 2PGQB 1OP8A 5HKKD 5DP8A 5GCHF 3JZ1B 3ZVAA 1Z1IA 3T26A 1J16A 4MVNA 1MBMA 1IQKA
chains in the Genus database with same CATH topology
4LK4A 1V2UT 2ZIQH 1ZTKA 1FV9A 2O8TA 1GHXH 4AFQA 3OU0A 6LPRA 1TMTH 1S0QA 1RTFB 1WUNH 3NZIA 1ELCA 2PR3A 3EE0B 3K9XB 3VXFH 1EPTB 1C5UA 4DURA 2ZZUH 1INCA 4BANB 1HIAA 2B7DH 1HJAC 2DE9A 3LH3A 2WPMS 3TH3H 1KXEA 4NA7A 1S5SA 4DIHH 3BTKE 4MNXA 3U98H 4KELA 3UFAA 1QBNA 3PTNA 1RFNA 2Y5GA 2FXRA 1BZXE 1F2SE 1MAYA 1EJNA 1IQGA 3CS0A 1GBCA 1IQJA 1SQAA 1MD7A 1AVWA 2LIZA 1FPHH 4LOYH 2Y7ZA 2AFQB 5HXFA 4IS5A 1MQ6A 2NWNA 3QO6A 1AWFH 3ELAH 3B8JA 1IQLA 1T7CA 3GY6A 2K7XA 4MPUA 6CHAB 2A45B 1A0LA 3GDSA 1O3PB 1QGFA 1C1OA 1H4WA 4I8GA 3ZZDA 5H4IB 2BDIA 1O2IA 4A1VA 8ESTE 5LH8A 1EAXA 4K8YA 8GCHG 1EATA 2ZGXH 4WH8A 1VGCC 1YC0A 1O2RA 1NFYA 5E0JA 3RU4T 3F6UH 1AHTH 1EX3A 1A61H 1O2MA 1P02A 2ZHFH 3A7XA 2OUAA 2PUXB 1P03A 5FBIA 1NZQH 3BTDE 2W7SA 3FP6E 1KIGH 2ZG0H 1HCGA 1Q31A 3PB1E 2WPKS 2VVCA 3RXMA 3FZZA 2NU1E 2ANMH 1O5GH 1GHZA 1AE8H 2Z3EA 1GL0E 1WQSA 1YPKH 4ASHA 4FUHA 1LMWB 1EAIA 2SGPE 1CT4E 5LPEA 1W8BH 5A8ZA 2BDGA 2XRCA 1PPBH 2JH0D 3RLWH 4THNH 1C1PA 3RUOA 2JH6D 2FS8A 4CH2B 2THFB 2V3OH 2ULLA 2O8LA 4X1QU 1SVPA 3AW0A 4KTUA 4NFFA 1NFWA 3BF6H 2VIWA 3E3TA 4AG2A 4FUBA 2K1QA 2CGAA 1PQAA 3SGBE 2FEQH 1C5SA 2FODA 1C5LH 2A1DB 1VGCB 1O2PA 1C1UH 3GOVB 2J95A 2VIQA 1SMFE 4BOHA 2BX4A 2XWBI 1P09A 5G4BA 1Z1JA 3HATH 2OQUA 1QB6A 1HIAB 5C2ZA 1P2OA 1ARCA 2FI3E 2BQ7B 2GKVE 2NU0E 3BIUH 3DHKH 2PW8H 1BJUA 2FOAA 2ODPA 1NU9A 1O3LA 3UPEA 2ZFSA 1P57B 1ZR0A 3L3TA 4I32A 1F92A 1ETSH 1NY22 3ZVDA 3M61U 3MWIU 1XM1A 1A3EH 2QXJA 3KEEA 3ESTA 1ACBE 2XBVA 4AGJA 4DG4A 1DOJA 3MU4A 2SNVA 1DWBH 1T8OA 3ZZ8A 2ZCKP 1FLEE 3N7OA 1AE5A 3SZNA 4GVUA 1ZZZA 1Z6JH 1CGHA 1LHCH 4INKA 3T29A 1D3PB 1P9UA 2C93B 3P8GA 2RA3A 2EA3A 1ANDA 4ISHH 1O2OA 2SGEE 3ZZ9A 3SHCH 1E37B 1A5GH 1DXPA 1THPB 4DT7B 1DXWA 5T6FA 4I8JA 3ODFA 1V2PT 1QRXA 4H4FA 2GZ9A 2XYAA 3H5CB 3SO3A 1JBUH 1G3DA 4GCHG 1P3EA 1EZQA 1O36A 1LPZB 1UCYE 4UFDH 1SLUB 1GPZA 1P2MA 3LJJA 1TNHA 4YO9A 1O3EA 1N8OB 1ZMJA 2VGCC 4K1SA 3UUZA 1K1NA 3U8OH 2GZ7A 2ZTYA 1SR5C 1ZJKA 3IG6B 2CV3A 3RXTA 1TX6A 5AF9H 3LT3A 4AYYB 2BLWA 1ZTJA 3SGAE 1O3AA 4TPIZ 3UWJH 1MZDA 2GT7A 5JBTA 4BAKB 2F9VA 4OS5A 1HAXB 1HJ9A 3NK8A 2J94A 2RA0A 3MH6A 1P11E 1O3GA 5LGOA 1UK4A 1QB9A 5DP4A 3TJUA 2VINA 2ZHQH 1THRH 4INLA 1C2LA 3U69H 2FZZA 1JXPA 4NIXA 4ZKOU 1AB9B 2BB4A 2P8OB 2P3UB 1XKBC 4XFQA 3NWUA 4DJZB 3ZYDA 3A81A 3A8CA 5C20A 5JBAS 1BMNH 4A7IB 2ZFPH 4JYTA 1ESAA 2BD3A 3LOXA 1FI8A 1VJAU 2CMYA 1MTUA 1GJ6A 3F9FA 1GBIA 4JYVH 4AFZA 5F6MA 4IGDA 1CQQA 1SGDE 2FOHA 3DUXH 3QZQA 1F0UA 4Y0YE 1RGQA 1FY1A 4X8SH 3TIUA 1JOUB 3VB5A 4Z6AH 1O2SA 3FP7E 1KLTA 2BD4A 1UO6A 1YGCH 1EOJA 2R0LA 3BEUA 1HJAB 1C5NH 1ZHRA 5FX5A 2A5KA 4ZXYH 1O0DH 4PROA 3P70B 1TB6H 2BDHA 1MD8A 3F9EA 3F9HA 2ZHWH 4X6MA 3LC5A 1GI2A 5F8TA 3M3VA 1EB1H 2FOBA 5LPRA 1BTHH 1QHRB 7GCHG 1B0FA 3KNXA 3SU0A 1ZMLA 1MTNB 5K7RA 2HLCA 2BXUH 1EP5A 2GDEH 1VR1H 3P8FA 1AUJA 3F68H 2YOLA 5A2MH 4DGJA 1LTOA 3M35A 2AERH 4H6TA 3MHWU 3RDZA 1Y5AT 1W7GH 2WINI 3TJOA 4B74A 1C1MA 2Y5HA 1C5VA 5IDKA 2W26A 2F83A 1J9CH 1ARBA 1CHOF 1CA0C 1GJ7B 4JYUH 2GV7A 3SNDA 2TGTA 1K1IA 2G55A 1GJ9B 1DSUA 3GY4A 2BY6X 1OWIA 2IJOB 1CA0B 1SGCA 4XBCA 1WCZA 4BAQB 2BD8A 5AVDA 1GMHG 1BHXF 1AY6H 2GTBA 4X0WU 1ZSJA 2QAAA 1GVLA 1W7XH 2R2MB 1SHHB 1WAYB 1GI7B 1GJCB 3GCHB 3A7VA 3Q76A 1CE5A 4I7YH 1NC6A 2OBQA 4Y8YA 1TRYA 1AZZA 4ABEA 3TK6A 4NIVA 2A32A 4YOGA 2VWLA 4MPXA 1E0FD 1HJ8A 4ABJA 3MMGA 5JDUB 1HAVB 5AFYH 3BN9A 2PTCE 1GDUA 1SB1H 4ABFA 1ZPCA 2PHBA 3O8BA 2WYJA 3BEFB 3GYMA 1C5TA 5GPIB 1FY5A 1O2UA 1O5FH 7ESTE 7LPRA 4NSYA 4X1NU 1VZQH 2BVXH 3GICB 3FZDA 5FBEA 3M36A 2PTNA 3M5MA 1XVMA 1D3TB 5FXLA 1O2KA 4Q7ZA 1EJMA 1QB1A 1GCDA 1F5LA 1HDTH 1SHYA 1C2EA 1GI1A 1Y8TA 2BQ6B 2FM2A 3ZZ3A 1BQYA 2WYGA 4DIIH 1OP2A 1G2MA 1BTYA 1ELTA 2I6QA 3P92A 1QBOA 1YF4A 2ZDKA 4D7FA 4MPWA 2BM2A 3RXHA 4HTCH 4HFPB 3E8LA 3SUGA 1V6DA 5C1XA 1FXYA 2PGBB 3PO1C 4NA8A 3ZVCA 5GIBA 2BDAA 1GWAA 3AASA 3RXJA 5DG6A 4I8HA 2FESH 3SHAH 3NUMA 2OD3B 1O38A 1TBZH 1C9TA 1VCWA 1VCPA 3IITA 1H9HE 4NZQA 4D8NA 2QGRA 1UK2A 2BX3A 1EQ9A 4NFEA 4YLUA 4WY3A 1MTSA 1QJ1B 1FJSA 1K28D 3CP7A 1XXDA 4K3JA 3H7OA 4R0IA 1K1PA 1L1GA 1P10A 4F49A 4RSPA 3FANA 3KL6A 3S7HB 5JBCS 4OS4A 2F91A 1LO6A 4YZUA 5DK1A 1YPJH 4WMDA 4ABDA 4ZXXH 3NCLA 1TPAE 1QJ7B 1OWKA 3GCTF 1AUTC 1Y5UT 2QCYA 1UVOA 2V35A 5CHAC 4ISIH 1Z6EA 1GJ5H 1F5KU 2RCEA 3EBNA 3PLPA 4RKJB 4YOIA 3VXEH 3ZZCA 1GMCF 3QGJA 4FVDA 3SV2H 2FP7B 2Y81A 1Y3WA 5HGGA 5L2ZH 4NWLA 1SGQE 1P3CA 2SNWA 3KQEA 1LHDH 2C8XB 4TWYA 2FS9A 3SI3H 2KAIB 3RXIA 1A5HA 3A84A 2AGIX 3Q3YA 1DM4B 1O5AB 2P3TB 3GDUA 1HLTH 5J4QA 3WY8A 1CHGA 4JZ1A 3UWIA 2AS9A 2SGDE 2O8WA 1IQNA 1GJDB 1O34A 2W7UA 5ESBA 4HI3A 1GMDF 1MMJN 2QY0B 2HPQH 3BTTE 1HXEH 3A88A 2Y82A 4TPYA 1XVOA 4UFGH 1AB9C 1S0RA 3EQ0H 1EJAA 2BLQA 1O2WA 1NPMA 1SQOA 3SJOA 1W0YH 1P8VC 3TLOA 2XBXA 2ALVA 2A4GA 4NIWA 2P94A 1UVPA 4OS6A 1YYY1 3EYDA 1HBTH 3PO1B 1HRTH 1GI3A 2AEIH 4IC5A 2YNAA 1ETTH 1OYTH 1TFXA 1IQFA 2VWNA 1O3BA 1FZZA 3MO6A 1S82A 2STAE 3UQOA 1V2MT 3DA9B 2STBE 3QWCH 2CXVA 4AZ2B 1L1JA 3V3MA 1UTLM 1SGYE 1HAOH 1MKXH 2G4TA 2FOGA 1KXBA 1LDTT 1AI8H 1BRAA 3VEQB 4WWYA 2ANKH 2P59A 2Y5FA 4Y10E 1HNEE 1IHSH 1TGSZ 1KXCA 2ZPSA 1QCPA 2ZGJA 1CU1A 4LZ1H 3FFGA 1S81A 2XTTB 4FUCA 1AFQC 3ZV9A 4XBDA 1C2HA 2ZFQH 1C2KA 1V2RT 1UTQA 4X2YA 1JIRA 5BRRE 2FOEA 4JK5A 5HM9A 3LDXH 1L1NA 1SFIA 1EZXC 2QV1A 3QDZB 1ZPZA 2GGVB 2ZCHP 5CMXH 1YCPH 2HNTE 2XBWA 2ZPQA 3VPKA 3UNRA 1UHBA 3L33A 1DX5M 1LVOA 1C1SA 1TNKA 3OYPA 1SGIB 1C1VH 1B7XB 1YCPM 2UUKB 1ZTLA 2XCNA 5GJ4B 1PPCE 1TGCA 2OC7A 2UWLA 5A8YA 2F3CE 4GLYA 1C1QA 2J4IA 3QK1A 2WPHS 3NPSA 3K6ZA 2D26C 1HYLA 1EOLA 3GISB 4B73A 1WBGB 5EG4A 1O2JA 1P12E 2ZFTA 5A09A 1GJAB 2ZFFH 3K2UA 3RC4A 1GJBB 2A0QB 3STIA 5EQQA 4JZEH 1H9IE 1BBRK 4X6NA 1DLEA 3EDXB 3AW1A 2H1UA 1UVTH 5A0AE 6CHAC 3B9FH 3V13A 2FO9A 1NRQH 5A0BA 1G37A 3GY2A 4ABGA 1O3KA 4CRAA 1CO7E 2BLOA 3Q00A 5JYIA 2YNBA 2ZWLH 5HM2A 5EW1H 2CHAB 1EAWA 1ELFA 4VGCB 1GBFA 1Z8RA 3ZZ5A 2OLGA 1ELVA 1FONA 1PFXC 1TQ0B 2HWLB 2LPRA 3LGUA 3RU4E 1QQ4A 2BDBA 3TNTA 2EEKA 3HKJB 1ZHPA 1ZMNA 1C5XB 2UUYA 5JBBS 1O3CA 1WV7H 4ZAEA 3MO9A 4I8LA 1AFEH 1K2I1 1FDPA 1P04A 2Z9LA 5I25A 2HRVA 4X8VH 3GCHC 3M3SA 3HPTB 1KXAA 1C5WB 1SGPE 3SU4A 4TWWA 1GBJA 1XUHA 1A7SA 1C5ZB 3RLYH 1Z8JB 3KF2A 3V0XA 3MOCA 1C2JA 1PQ5A 2BVRH 1E38B 1MH0A 2W3IA 3HK6B 4MNYA 3HKIB 3BTHE 1S85A 3E0NB 3E16B 5C1YA 1TPSA 4B1TA 4CRDA 1TPOA 3CENA 4GHQA 4KKDA 2Z94A 1LHGH 4NGAH 4FUGA 3PWCA 1HAHH 1L0ZA 2BDCA 1O2TA 3VGCB 1IQIA 4BAHB 2WUCA 1LHFH 2IPHA 3NXPA 4O3UA 1ABJH 3HK3B 1SLVB 4A1XA 1BHXB 1GHVH 3NKKA 3SV8A 2SGFE 1EXFA 3GYLB 1TYNA 3HGPA 1TX7A 2C8YB 3UREA 1GMHF 1XXFA 2V6NA 2R3UA 3SORA 2G5NA 2J2UA 4F4OC 1RS0A 1NRPH 2ZNKH 4NIYA 4BAOB 3A8AA 2G4UA 1DY9A 3A7TA 2WUBA 2FOFA 1AKSB 2BZ6H 3MH5A 3ZYEA 5HYOA 1MKXK 1GBTA 2EC9H 2PLXA 2GDDA 3P8OA 3SUEA 3UR6A 1T4UH 4LXBH 1C4V2 2G5VA 2G51A 2QIQA 4JMYA 1GBAA 5EXLA 2A5IA 1IHTH 2ZDVH 2WV5A 5CE1A 1O2NA 3UR9A 4FU9A 7GCHF 1H8IH 3RXQA 3SI4H 4OS2A 1TA2A 5L30H 2Z9JA 4CRBA 3VB4A 2M5TA 2GZ8A 3BTEE 4GSOA 3URDA 2FDAA 1C5PA 1SLWB 2BXTH 1SC8U 1B0EA 4IMQA 5C3NA 1PJPA 1G9IE 1YPHC 1OWEA 3PMJA 3O8RA 1BIOA 1W0ZU 4ESTE 1GI5A 3MNBA 2EI6A 4BNRA 2FWWA 3SNCA 5FX6A 3BSQA 2P95A 1YLCA 4A6LA 4IC6A 2OXSA 1TGNA 3RXPA 1TMBH 1SGRE 3S9CA 5J4SA 1Z7KA 2UWOA 3I29A 2PSYA 1SPJA 1IQEA 5EODA 4AYVB 2Y7XA 2BQWB 4UEHH 2F9NA 1LVYA 2ZDAH 2VGCB 1AMHA 1UVSH 2HVXA 1EASA 1JMOH 4QT8C 3S9AA 3QUMP 4CREA 2B0FA 1U6QA 2ZKSA 1O2QA 1TGBA 5JB9S 3A82A 2VIOA 4UFEH 1V2KT 1AVGH 1K1OA 4DW2U 3UOPA 2EI8A 5DP3A 1KXDA 1P2KA 1D4PB 2B5TB 5PTPA 1QNJA 3MNCA 3HGNA 2P8OC 2AH4X 5BPEA 2GCTB 4CR9A 1LQDB 2ZU1A 3SJKA 1B5GH 4UFFH 5A0CA 1IOEA 1XKAC 3KN2A 1UTPA 1FNIA 2VVUA 1TRNA 4AGKA 2XC5A 1BTZA 1PPFE 3SBKA 1FN6A 1W3CA 1D3DB 2GVFA 2ZGHA 1UK3A 2R3YA 5CHAB 1YPEH 4MTBA 2J38A 3SN8A 2PKSB 1F7ZA 2C3SA 2H2ZA 2PV9B 1BJVA 5FCKA 3SU1A 3TJVA 1MTWA 1ZRBA 1OOKB 1C9PA 4MPVA 1ZSLA 1BTPA 5EPYA 1TNGA 5GWZA 1ANBA 2O8MA 1DSTA 1UTOA 2ZDMA 1Y3VA 4GCHF 2H9EH 3D23A 1GHBG 2FLBH 4H42U 5F8XA 4D7GA 4FXGH 3BG8A 4Y8ZA