1QR3E

Structure of porcine pancreatic elastase in complex with fr901277, a novel macrocyclic inhibitor of elastases at 1.6 angstrom resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE 1
publication title Structure of porcine pancreatic elastase complexed with FR901277, a novel macrocyclic inhibitor of elastases, at 1.6 A resolution.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1999-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qr3E02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qr3E01
1XVOA 2OUAA 1O2TA 2AERH 4MTBA 4YT6H 4CRDA 4IN1A 9LPRA 1FPHH 4UFDH 3DUXH 4ISOA 4ABBA 2OQ5A 6GCHG 1SGFG 2OTVA 5EG4A 1DS2E 1MU6B 1S0RA 2J34A 4JZDH 5DG6A 1O2OA 5JPMH 1Z8GA 1MQ5A 3U8RH 3RXJA 4XOJA 1CHGA 1O3FA 4IC5A 1FMGA 1QTFA 1HNEE 1GBBA 1E36B 1KDQB 4JCNA 1FONA 4K8BA 4XSKU 2VIWA 3TIUA 4IC6A 1T4UH 3OYPA 4X8TH 2G00A 2Q6DA 1RTLA 2FLBH 3C1KA 1UTJA 4MQAA 1RXPA 1L1GA 3HKIB 3UR9A 1ESAA 1BHXF 1SGFA 2A5AA 2PWXA 3B9FH 1NFXA 1C2HA 1O3AA 4GAWA 4YO9A 1C1MA 2DUCA 1V6DA 2BOKA 3TJNA 1QQUA 4TY6A 2C3SA 2PUXB 1TGCA 2QYIA 4O03A 3RP2A 4JZFH 4AB8A 2BMGB 1O39A 2B7DH 3URDA 3KEEA 2WPKS 5DP9A 1FDPA 1U6QA 1GHZA 1ZOMA 2M5TA 2VVCA 1IQNA 1OOKB 2BVXH 3NKKA 3P17H 3QUMP 1PPBH 2ZGXH 1EPTA 1VZQH 2F9NA 1OSSA 2RDLA 1P2KA 2ESTE 4DT7B 2V3HH 3PTBA 3Q76A 1TB6H 2ZTZA 2VJ1A 1HIAA 3FP8E 2ALVA 4BOHA 3AW1A 2G5VA 2FLRH 5J4QA 2J95A 1IOEA 3E8LA 2YNAA 4WWYA 3BG8A 2GDEH 4X1QU 4Y7AA 1KTSB 3F9GA 3TVJB 2STBE 1H8DH 1GI1A 1GBJA 3ZVBA 5HM9A 1UHBA 2HPPH 3SUGA 1O3HA 2IN2A 2PKSB 1C2DA 2QIQA 2Y6TA 1QBNA 4F49A 1W7GH 3SV7A 3TH2H 4FUBA 4KP0A 1DXWA 5FPTA 1GBKA 1P12E 2GV7A 3PMJA 5I46H 4ISIH 2FDAA 1C4V2 1SMFE 2SGFE 5JBTA 5EW2H 1AB9C 2WPJS 4I8GA 1TOCB 5A8YA 1NRRH 1C5RA 2ZGHA 1GVKB 4BANB 1SLUB 4FUJA 2OINA 1AU8A 2WPMS 2HVXA 3KL6A 1O2NA 1RRKA 2C4FH 4TWWA 1NESE 1LQEA 2XC0A 5TCAA 1TAWA 5GCHG 2W3IA 3LGTA 3LU9B 1BZXE 4CRCA 4MPVA 2FEQH 1PJPA 3ZV9A 4DIIH 1PQAA 2AGGX 3QN7A 2VH0A 2A4GA 3VGCC 1V2WT 2LNCA 2CF8H 3BTTE 1SOTA 1EP6A 1F5KU 1TGBA 1O31A 1SHHB 4CRGA 3VB4A 3A7TA 3E0PB 3SUDA 3S9AA 1VCQA 4KELA 1HXFH 1Q2WA 4AG1A 1G32B 4ASHA 1LKBA 4K60A 3T26A 4VGCC 1G36A 1YKTA 5A0BA 7GCHF 1O2MA 1OWKA 4DY7B 1C4Y2 1JIMA 2ZHFH 1ZLRA 4IBLH 1TNGA 3I77A 2TGTA 2ZO3H 3Q3YA 1GHBF 3L6PA 2ZU5A 2ZFTA 2EI8A 1GMDG 5C20A 1O34A 1SVPA 3GOVB 3ZZBA 1K1IA 1SGCA 1EZQA 3RU4T 1KTTB 3KQDA 3TU7H 4YT7H 2PGBB 1A2CH 4TYDA 1TQ0B 1CT4E 1PYTD 5BRRE 2THFB 2ZECA 3EA7A 1C1TA 1ANBA 1P3CA 2GMTB 1PPCE 4UEHH 1PFXC 1LQDB 1QHRB 1DSTA 2YNBA 1O3LA 1GBTA 1MBQA 4CHAB 1D6WA 4PROA 2BLOA 5JBCS 1C5XB 2KAIB 2NU3E 2WYGA 1Q31A 5H4IB 2BQWB 3UNRA 1CGHA 1QBOA 1QGFA 3CS0A 1C5LH 1HAGE 3DT0H 1VITF 3T5FH 1ELCA 1A1RA 2OCVB 3UTUH 3DFJA 1QB9A 3T29A 1O3GA 4K1TA 3TGJE 2Z3CA 3BTDE 2ZWLH 1UVOA 1V2NT 1C5VA 2IOTA 3A7ZA 3W94A 2TIOA 2HGTH 5L2YH 2P8OC 1W11U 3E0NB 2FO9A 3BV9B 1QRZA 3SJKA 1NPMA 5C5NA 1HYLA 3DFLA 1SHYA 1P10A 2HWLB 4SGBE 3T28A 1XX9A 2ANKH 1CU1A 2F9UA 3E16B 3MTYA 1AMHA 4XE4A 1C1SA 3BEFB 2Q1JA 2ZPQA 1GVZA 1LHEH 1TQ7B 1OWDA 2FOMB 1IQEA 1MD8A 2Y80A 1KXAA 1F0TA 1IQHA 1A46H 1ELAA 3ZVFA 1Y8TA 3RUOA 1WQVH 2SFAA 1EAIA 1EX3A 1SGTA 2J9NA 3FZDA 3A89A 1K28D 1GI7B 2FESH 3GDVA 2BY6X 1BITA 2W7SA 3MYWA 4UD9H 5DP6A 3FP7E 1UVPA 1L4ZA 1SG8B 3G01A 3U69H 2Y5FA 1LPZB 1KLTA 1Z6EA 1TLDA 5AFYH 1TNJA 1N6YA 1V2RT 2VWLA 1QA7A 1BMMH 1SSXA 4OS2A 1FLEE 2A7CA 1ZRBA 2W26A 5GWZA 1G3DA 3SGBE 3SNCA 1FJSA 1HAOH 3RC4A 1GHVH 1A5GH 2B8OH 3SN8A 2Z7FE 2QY0B 1O36A 3MWIU 2AS9A 5EPYA 2ZFFH 4ABIA 1W13U 4KTUA 1O2GH 1SQTA 2R9PA 2Y5HA 2Z6BD 2GGVB 2VVUA 5CHAC 3SJOA 2EA3A 3GY8A 5T6GA 1HAIH 4ABJA 3BG4C 5EOKA 2QAAA 3UOPA 3TJOA 5EXLA 2ZDLA 3TK9A 1V3XA 1BTWA 4O3TA 4CH8B 1LVBA 4CR9A 5A8ZA 2OD3B 3F6UH 1GMHG 4OGYA 1ZHMA 1CE5A 1Y3XA 1SGEE 3HK3B 4GCHG 1YM0A 4QT8C 1S85A 2ZZUH 4E05H 1XKBC 4WMEA 1W10U 4MPWA 1ZJKA 3UPEA 2BLVA 1AD8H 3SU4A 3GCHC 1ELDE 1UTMA 4X8SH 2PR3A 6GCHF 2A4RA 2P3UB 4CBNA 2HPQH 2ZGCA 5A8XA 3LC3A 2XBVA 1P02A 4Y7BA 1SPJA 2AIPA 4D7GA 1BUIA 4WY3A 1GMCG 1JOUB 1Y5AT 1UTKA 3RXBA 1GBFA 3NXPA 2A2XH 3GY7A 4LZ4B 1SOZA 1Z1IA 5ESTE 1XUIA 1O2XA 4XBDA 4ZROA 3O8RA 3RXUA 1C2JA 1LHCH 2FWWA 5T6DA 1J8AA 1MTNC 1C5PA 4NIXA 1PQ8A 2OXSA 1AIXH 1GHWH 1GHAF 3TJUA 2BD4A 1UO6A 1AGJA 3KQBA 5ESBA 1T8LA 2G5NA 4FVBA 2DE9A 1INCA 1XUJA 3A81A 4WMFA 2ANYA 1NRSH 2SNVA 4FU9A 3IITA 1BMLA 1ANDA 1IHTH 1SGQE 1QNJA 1AZ8A 1OWJA 2BDIA 3LDXH 4FXGH 4YLUA 4MVNA 2P3TB 1KDQA 2D26C 4A5TS 1A4WH 2BY8X 1V2TT 1W3CA 2F9PA 2UWOA 1BMAA 3E91A 4YOGA 3RXFA 2G52A 3ZYDA 4FUFA 1DUEA 2BQ7B 4MNYA 2ODYB 3MU8A 1XKAC 2F9OA 2GV6A 1CQQA 1OX1A 1H4WA 3SNAA 8GCHG 3BTEE 2BY5X 1NM6A 5F03A 1FY3A 2AMQA 4I8JA 1ACBE 1ETTH 5DKMA 4YLQH 2AYWA 1P2MA 1W0YH 1GWAA 1TBZH 2XBWA 3SU2A 1LHGH 3SW2B 1DWBH 2NU0E 3PLPA 3SUFA 4HFPB 1QCPA 3SGQE 1C5TA 2OC0A 4B71A 3ZZAA 1HCGA 1ZRKA 4FUCA 1KXFA 3QDZB 4YOIA 4TPIZ 3RXRA 4FVDA 3SUEA 3QX5H 3ZZDA 4UFGH 3A80A 5FXLA 1D3QB 1BRBE 2Z3EA 5K0HA 1NFYA 3ZZCA 2R3UA 2FM2A 4IS5A 1GCTC 5BPEA 1WOFA 9ESTA 2H2ZA 4Y0ZE 5IDKA 1VCPA 1TRMA 1B0EA 3FZZA 4ISNA 1GJ9B 3IG6B 4IMZA 5GCHF 2ZCHP 2ZTYA 2QA9E 1XUFA 5F8ZA 3EDXB 1O3BA 3JZ1B 1TMUH 2CXVA 3RMNH 4CH2B 1D9IA 1BT7A 2NU4E 1NFUA 4B2AA 1CO7E 3V12A 1TYNA 3OTJE 1K1JA 2BDAA 1BJUA 3RXOA 1Y5UT 1K1PA 2BD5A 1BDAA 1O2VA 1FI8A 3K2UA 1E34B 4X8UH 4K1EA 4BTTB 4IN2A 1EJNA 1YPKH 3RMMH 1NROH 2ZHQH 2VIDA 3T27A 1BBRE 1GJ4H 1HB0B 4WH8A 4ZXXH 1TA6A 3A8AA 3GICB 1LMWB 3LC5A 1O35A 1F92A 3UR6A 1TONA 1VITH 2A32A 1O3OA 1UTPA 1HAPH 1DT2A 3WY8A 1UTNA 3S9BA 2BHGA 1XVMA 1CT0E 2FOEA 2P3FH 1HRTH 2BVSH 1W12U 1DUAA 2H9EH 3R3GB 1A0LA 2BDYA 3SU6A 2FS9A 3GCTF 3U8OH 1NS3A 4CRBA 1O5BB 1MAYA 5JBAS 1HAHH 1OP8A 2GCHF 3U1IB 1YCPH 2G55A 3TNTA 5LPRA 5EQQA 1GDQA 3SHAH 3UUZA 3FVFB 1JWTA 3MHWU 1NTPA 1EB2A 4RKJB 2EEKA 4DW2U 3LIWA 4FUEA 1YPHE 1QR3E 3LOXA 3SNDA 2GZ8A 1DPOA 4X6OA 4CRAA 4I32A 1CA8B 4D9RA 1DOJA 1DWCH 2BXUH 1EOJA 1O37A 2H5CA 4D76A 1ORFA 1GGDB 4GLYA 2GTBA 1K9OE 1RIWC 4NZQA 1NY22 1IQFA 1LVMA 2FYQA 2WPLS 2CF9H 3KN2A 4ABFA 1EAWA 3QLPH 5E2OA 3TNSA 3B8JA 1IHSH 5HM2A 4Y11E 2QN5T 2JETB 1VGCC 4BAQB 1CHOF 4WXVA 1MTWA 5DO4H 1C2KA 1FN8A 1JRTA 1O5DH 3RC6A 3RMOH 4O97A 2KAIA 3GISB 3SV2H 1GI0A 3LPRA 1GBIA 3MNCA 3KIDU 3SU5A 1J17T 1C1PA 1GI6A 1NZQH 1MKXK 2Z9JA 3RM0H 2ZGJA 3NZIA 1SLXB 1QRWA 4JYTA 1HV7A 1SB1H 2A2QH 4OGXA 1KSNA 4K1SA 4LXBH 3LH3A 5TJXA 1QBVH 4BAKB 2TGAA 1YCPK 2IJOB 3TLOA 5LPEA 1YCPM 1V2OT 4WXIA 3ZZ7A 3QTOH 1AVXA 2WV5A 5JDUB 6CHAB 1UCYE 2D1JA 1G3EA 4JMYA 1TPOA 1Z1JA 1AVGH 1DANH 2BLWA 1C1VH 1QY6A 3PMAB 3RDZA 2UUJB 2VH6A 2HLCA 4AFUA 4INKA 1MTSA 2OP9A 2SGQE 3QZRA 1UTQA 1O2IA 4Y8XA 4E7RG 3ATWA 4I8KA 2FZZA 1TNHA 3RLWH 2FODA 3RXCA 3O8BA 3OY5U 1HJ8A 3HATH 3DD2H 1Z6JH 1GBEA 1MU8B 5TCCA 3A85A 1P05A 1S6HA 2C8XB 2H5DA 5HXFA 1GJAB 4FUIA 2XW9A 1LO6A 3MMGA 1DICA 2ZFRH 1XXFA 1UVSH 4XBBA 3ATIA 3MU5A 4B73A 4JZEH 2ZF0H 3EYDA 5EODA 3RMLH 3EAJA 1O2LA 1GHXH 1TX8A 4AFZA 5EPNA 4LOYH 1NFWA 3D49H 5CE1A 4AYYB 1QL8A 5PTPA 5I25A 4WMDA 1C2MA 3T2NA 1Y3YA 2OBOA 2AH4X 2RCEA 3F9FA 1BTZA 3NPSA 1FUJA 1TMBH 2JKHA 1AKSB 1SGYE 4NWLA 1IQKA 3ELAH 1A3BH 3JZ2B 1QB1A 4A6LA 3D62A 4TWYA 2J38A 3P8GA 1D3TB 1ZMJA 1BB0B 4ZMAH 3SV9A 1RTKA 1YLCA 2BD7A 1WUNH 2FPZA 1AZZA 1LTOA 3A84A 1C9PA 1C9TA 2CV3A 3LGYA 3P95A 3K6ZA 5EQSA 2OBQA 2FYRA 1BA8B 1P57B 1O5AB 2UUFB 3ZZ4A 8LPRA 4HTCH 3PWCA 1ELEE 1YPEH 4BXSA 1YLDA 1A5IA 2Y81A 2ZCLP 3PO1C 3ATMA 1GJ8B 2B0FA 2XC5A 3QO6A 3TJVA 2R2MB 2G81E 4X2VA 1UVTH 3AASA 2J94A 2VGCC 5DJ7A 3BTME 1DFPA 3L33A 1G3BA 1BRAA 4DJZB 3UQVA 4BAHB 2XBYA 4MPXA 2FXRA 3GCNA 3HGNA 4Y79A 2WPIS 1THSH 1L2EA 1AHTH 1AN1E 3OY6U 2Z9IA 1O33A 1NRNH 1EPTC 1MTVA 1ZSKA 2BQ6B 2XCNA 1AB9B 1HDTH 4B76A 1PPGE 5EXNA 1QJ1B 2P16A 5AVDA 3ZVCA 3UWIA 1C4U2 2CN0H 1AFQC 1EQ9A 1GJ7B 3TPIZ 4XFQA 1BTUA 1T8MA 1GCDA 1LVYA 4MNWA 1J14A 2O8TA 1BMNH 1F7ZA 5G4BA 1K21H 4WH6A 1Z8JB 4AN7A 1NN6A 4U32A 3U98H 2TBSA 1S81A 2Z9GA 4KTSA 2ZIQH 4AFSA 4CR5A 8GCHF 1UTLM 3RU4D 1AQ7A 2QXHA 2BDHA 1V2UT 2BVRH 3A7YA 3VGCB 1Y3WA 1T8NA 3M5NA 1TALA 3M7TA 5FHTA 5C1UA 1GDNA 4HI3A 2GD4B 2ZA5A 3PLBA 2XWBI 1WSSH 3VXEH 1PPZA 1ZPCA 2UUYA 4B75A 4M7GA 1ELVA 1IQGA 2FMJA 2ZG0H 1NT1A 1FQ3A 1WTGH 1GI8B 1E37B 2RA3A 3M61U 4WVPE 4DG4A 2A5KA 2BTCE 4VGCB 4X0WU 1QIXB 1SFQB 3ZYEA 1ZPZA 1J9CH 3TGKE 1HAYB 1O3KA 1YPHC 1N8OC 4TY7A 3I29A 2AMPA 2XNIA 2OLGA 1C2IA 1V2KT 3ZZ3A 1DXPA 1EJMA 2BZAA 1SGDE 2BX4A 4Y8ZA 2FOHA 1MZDA 1V2ST 1O2QA 5FPYA 1CBWC 1M9UA 4FU8A 2FIRH 1W0ZU 1NC6A 1PQ5A 3T25A 1XM1A 2V6NA 2XCFA 1L1JA 4NSYA 1P9UA 1TBRH 4K5ZA 1UTOA 1LPKB 3LT3A 1AI8H 2ZP0H 2AGIX 3MU1A 2ZFPH 1XXDA 1GI5A 1V2VT 1CSOE 1QRXA 2ZU2A 3RU4E 3PB1E 1QURH 1C2FA 4DVAU 1EAUA 1EKBB 2Y82A 5FX5A 5GXPA 1DITH 3A8DA 3SI4H 5DP4A 3PM3A 1O3IA 1O5GH 2HNTE 4Y8YA 5FBIA 7ESTE 1ZTKA 2QF3A 4MNXA 1HJAC 4X2XA 1KXBA 1SQOA 2FX6A 5L6NH 4X8VH 1ZPBA 1C2GA 4UFEH 1F0RA 7LPRA 4X1NU 2ANMH 2P8OB 1JIRA 1ZTLA 2WV4A 1A3EH 2BDBA 2R0LA 2R0KA 2WUBA 2Z94A 1KIGH 3H7TA 1S84A 3UIRA 2XC4A 3LGIA 3VB5A 1DLKB 4ZAEA 2C8ZB 2BD2A 1B5GH 2BY9X 1GHYH 5GPIB 3BIVH 5HMAA 2OC1A 3P70B 1TPSA 1WQSA 3GY3A 1NRQH 3UNSA 3BTQE 1BJVA 1BOQA 1Q3XA 1FZZA 1IQMA 4ABHA 2H9HA 2R2WU 1WBGB 3ZZ9A 3M3SA 1TNKA 3H7OA 4MDSA 5E0JA 1IAUA 1FAXA 1HAVB 1VCWA 1W7XH 3TH4H 2B5TB 3A83A 4BNRA 4TPYA 2FOGA 1C5OH 1O2WA 2GCTC 1O3JA 1ZGVA 1TOMH 4I8HA 2VVVA 5DP3A 3GY4A 1S5SA 3MNBA 1OYTH 3SOSA 1Y5BT 4J2YB 1AY6H 2PV9B 5DP5A 1MUEB 2FX4A 4CRFA 3MH5A 1GBDA 5IYTA 4RN6A 4NG9H 1A0JA 1EUFA 1ZHPA 2CHAC 3VFEA 5EXMA 1ELTA 1A0HB 1C5QA 1N6XA 1OWHA 3RM2H 1TWXB 3LJOA 5C1XA 2HALA 1O2JA 3KCGH 5L2ZH 3SU0A 4MLFB 1GVLA 4NWKA 3OSYA 1G9IE 3KF2A 5GJ4B 3UQOA 3ZZ6A 1ABJH 2A7HA 1C5MD 3ZVAA 1S82A 3BG4B 1GG6C 2A4OA 3UY9A 4JYVH 4WJG2 1O2UA 1P2OA 1E35B 1MMJN 3A82A 3M36A 7GCHG 3K65B 2NWNA 1D4PB 3T62A 3LGUA 1O2RA 3VB7A 4NIWA 2A5IA 2WPHS 1GHBG 3AVZA 2YOLA 5JBBS 2G51A 1P3EA 2RG3A 1GDUA 3RXEA 2BDCA 3SI3H 4B2CA 1YC0A 3TK5A 3GY6A 1ARCA 1ZGIA 4JZ1A 2PLXA 3GY5A 1O2HA 5AF9H 3O8CA 1BTHH 1GJCB 2OC7A 3GCHB 4NA9H 3CS7A 2ZCKP 2F9VA 4OS4A 3STIA 4H4FA 1V2PT 1KY9A 1CA0C 1YP9A 3QGJA 2ZKSA 3U8TH 1HUTH 3TITA 1K1LA 4Y6DA 3UREA 4DURA 1AO5A 1GI3A 4NCYA 1K1OA 1K1NA 2BY7X 5DP8A 1LPGB 2VNTA 1P01A 1VITG 1J16A 3A7WA 3A86A 1P04A 2J2UA 3K6YA 1LHFH 5F8XA 5A09A 2BDGA 3BEIB 1MTNB 2ZHDA 1BIOA 3QTVH 1QL9A 1EZXC 3V7TA 1GJDB 1EZSC 1S6FA 2BXTH 1V2MT 3ITIA 1ZMNA 1YF4A 1P09A 4Y71A 1AWHB 2F9BH 1SFIA 1QJ7B 3SJ9A 3SJIA 1OWEA 2ZHWH 4I31A 3MI4A 1CVWH 3NK8A 1FY1A 3MO9A 4HZHA 1THPB 3MNSA 5EGMA 4AOQA 1GBAA 3S9CA 1O3DA 3F9EA 1C1OA 4J1YA 1BHXB 1EB1H 1MD7A 3M7UA 1O2ZA 2QXGA 3SV6A 3SNBA 3GCOA 1YYY1 2PW8H 2AGEX 3PYHA 3F9HA 3A8CA 1MKWH 1X7AC 1IQIA 3P8NA 4U2WA 1KXCA 5GDSH 1Z71A 4ZKNU 1AKSA 1XMNB 5DP7A 3RXPA 2FTMA 2PHBA 3BTWE 1SLVB 1OYQA 1GMDF 3H5CB 1C5NH 1TE0A 1TPPA 1GJBB 3FFGA 1FN6A 2SNWA 3FP6E 1PYTC 1FAKH 4E06H 2UUKB 1F0SA 1MKXH 1TMTH 1V2JT 2GT7A 1T4VH 1TPAE 3QWCH 3BTGE 1UVUH 1GCTB 2QXIA 1C2LA 1LKAA 1ELFA 2PKAB 1F0UA 2W7UA 4OS7A 1BTYA 3NWUA 1ZSLA 3RXVA 3A7VA 4INLA 1YBWA 1GBHA 1ETRH 1FPCH 2V35A 1L4DA 1SC8U 2F3CE 1NU7B 2HNTC 4LK4A 3SNEA 1ESBA 4O9VA 2ZHEH 1MBMA 1RFNA 2H6MA 3PWBA 1WU1A 1DWEH 2TPIZ 1SL3A 2A1DB 2PSYA 1FY8E 2C8WB 1WTHD 4NIYA 3ZZ5A 4K3JA 2CGAA 1DSUA 1EP5A 1EXFA 2D2DA 6CHAC 3W95A 3KNXA 1TFXA 1G2MA 2H9TH 2ZFQH 1MKWK 4ISLA 3SU3A 3EE0B 1NU9A 4YTAA 4H42U 4AYVB 1GJ6A 1UMAH 1TGTA 4AZ2B 2BZ6H 1EAXA 3BSQA 3SO3A 1CT2E 1KXDA 3ZV8A 4ZHAA 3SHCH 1LDTT 4B74A 1QFKH 4BAOB 1FIWA 5C5OA 3ATKA 3RXMA 1Z8RA 4ABEA 2PKSC 4GUXA 3ATLA 2XTTB 4X2WA 3STJA 2LPRA 1P03A 1D3PB 2G8TA 2XWAA 3V13A 4KKDA 3MOCA 4A1XA 1PPHE 4DCDA 2VIVA 4DOQA 3URCA 4YM9A 4DGJA 1THRH 1AUJA 1O3NA 1UK4A 2SGEE 5CMXH 1GHAG 3I78A 3N7OA 2DE8A 1A5HA 1HJ9A 1Y3VA 1H9HE 1HAZB 1A61H 4UE7H 1FV9A 5LH8A 2FI3E 1O3EA 1BCUH 1CGJE 1ABIH 4FUDA 5EU8A 3TK6A 3EQ0H 1L1NA 8ESTE 1YPLH 1GI9B 4ABDA 1ZZZA 1E0FD 3MH7A 3TGIE 2ZTXA 2EI7A 1RIWB 3UWJH 3RXLA 1EJAA 5FBEA 2Y7XA 3NUMA 1HGTH 3SGAE 1GPZA 1RJXB 1F5RA 4NIVA 1IQJA 1HAXB 2EC9H 1IQLA 2VINA 1VGCB 2Z9LA 4JZIA 1LCYA 5FPSA 3MU0A 3UNQA 1JBUH 2P95A 1MCVA 2UWLA 2BLQA 1UK3A 2XBXA 3BF6H 1AWFH 1GBCA 1W14U 3UOUA 3S0NA 1FIZA 3SJ8A 2F83A 2ZQ2A 2P94A 2P59A 3MO6A 1GMHF 1VR1H 1OWIA 1C5WB 3RXQA 3S69A 5FX6A 2JH5D 1WAYB 1ZHRA 2VB0A 4GCHF 3U9AH 3M37A 2ODQA 4MNVA 2GKVE 4D9QA 1ELGA 3AW0A 2VIOA 5E2PA 4HGCA 1BBRH 1H9IE 2QXJA 2AEIH 1SLWB 2C93B 1ZMLA 3VPKA 2GMTC 4AORA 1MCTA 3RXKA 3F68H 1XUKA 5LGOA 1O38A 1W2KH 3M3VA 4ZKSU 4OS6A 4CHAC 1GMCF 4U30A 4ZXYH 4YESB 3SBKA 2R3YA 5DGJA 1H1BA 5L30H 2A0QB 3CENA 3QZQA 4U01A 3RXSA 1EZUC 2TGDA 7KMEH 4MG3A 3LJJA 3E90B 1PQ7A 3FAOA 1SR5C 2AFQB 3C27B 3RXHA 1CGIE 3D65E 3LONA 5DK1A 1OP0A 5B6OA 5C1YA 4KGAA 4GPGA 1HAVA 3AAVA 4MPUA 4FU7A 3E3TA 2FP7B 4K2YA 2BD9A 3RXGA 3PMHB 3D23A 1TNLA 3Q3KA 2CJIA 1PPFE 1SI5H 1H8IH 1S83A 3E1XB 1D6RA 1DY8A 1C1NA 3HGPA 5T3HA 1SBWA 2IPHA 1A7SA 2HNTF 2VIQA 1XUHA 2OQUA 4ZUHA 5J4SA 1G37A 1F5LA 2H1UA 2CMYA 1O5FH 2JH6D 3F1SB 2SGDE 2PFEA 4KTCA 1G30B 1OKXA 3GCTG 1P2QA 3HK6B 3P6ZB 3MFJA 3GYLB 5LPFA 1MZAA 2ZDAH 2VWNA 1BBRK 1KXEA 1HBTH 2BD3A 2GCHG 4NSVA 3Q3XA 1P11E 4ZKRU 1P8VC 5K7RA 3ODFA 1TRNA 2BYAX 2Q6FA 1O3CA 3SQEE 1C1QA 4X1RU 3RXAA 2QC2A 1UJ1A 2FI5E 1DVAH 2Y5GA 3GYMA 4I7YH 4A1TA 1ZJDA 4XDEA 1QQ4A 3PO1B 4ZHMU 1KLJH 1B7XB 3SU1A 3M5LA 1P2JA 2VGCB 3LKWA 2I6SA 2G4UA 4AGJA 4OS5A 2ZDMA 3P8FA 3QGNB 2WINI 4I33A 1C5UA 3P92A 4R8TB 1QL7A 4GSOA 1DM4B 4NZLA 4BXWA 1AE5A 1JMOH 2XXLA 1UCYH 1EOLA 1CHOG 4D7FA 1ETSH 1MAXA 4H6TA 4B2BA 1EPTB 1LHDH 3GDUA 4IMQA 4WF8A 3ZVDA 1V2LT 3DHKH 1ZSJA 5C2ZA 4AB9A 4FUGA 4Q80A 1SGIB 1O2PA 1RGQA 1SGNE 1AFQB 2ALPA 4JK5A 1T8OA 3PMBB 1O2YA 1HIAB 1XUGA 1K22H 1WYKA 1AUTC 4Z6AH 2F91A 3VB3A 1E38B 1HPGA 1SGRE 4Z0KA 1Z8IB 2HRVA 4UDWH 2ZDNA 3CP7A 3U1JB 1UHBB 1O5EH 1WCZA 2ZU4A 2O8WA 1EATA 2K1QA 1ZTJA 3L3TA 2GP9B 2O8UA 2STAE 4UONA 2ZEBA 4CBOA 2BM2A 3NCLA 2C8YB 1TA2A 2Q6GA 3SV8A 4ZKOU 2A4QA 1DWDH 2ASUB 1TBQH 1AVWA 2Z3DA 2FOFA 4RKOB 2A7JA 3S7HB 3Q77A 1Y59T 2XYAA 2O8MA 4SGAE 1GL0E 3O8DA 2TRMA 1T7CA 3BN9A 2FOBA 8KME2 1K1MA 2UWPA 2C90B 1Z7KA 4UFFH 1P2IA 1YPMH 1DY9A 4ABGA 3KQEA 3M7QA 4A92A 5ETXA 3DA9B 1P0SH 1C5ZB 2ZNKH 4NFEA 3LH1A 3SORA 1QA0A 1F2SE 4X6NA 3RC5A 6LPRA 1N8OB 1D3DB 1ANEA 1SQAA 3BEUA 5AFZH 4ISHH 2FS8A 1KLIH 3MH6A 1UCYK 4ZH8A 1RS0A 5JB8S 3E6PH 1DDJA 1EASA 4NFFA 1YGCH 4OS1A 4JK6A 1ELBA 1CBWB 5E0GA 4E7NA 2BD8A 4ZHLU 1C1RA 1VJ9U 3MU4A 1GBLA 3A8BA 3HPTB 3VEQB 1TABE 1RD3B 1ZR0A 2ZGBH 2PTCE 3PROA 2QV1A 2B9LA 1ZYOA 2AMDA 2ILNA 3FANA 5HYOA 3A88A 1V2QT 1C5YB 3LGVA 4LZ1H 1Y3UA 1K2I1 4AFQA 3ODDA 3Q00A 2PKAA 2I6QA 3GDSA 5E0HA 1QB6A 1TIOA 4ABAA 3QK1A 2SGPE 1H9LB 2NU1E 3HKJB 4R0IA 1O2KA 4Q7XA 3ZVGA 1G2LA 4I8LA 1N1LA 1O0DH 1HJAB 1C2EA 1TX7A 2GX4A 5A0AE 5C67A 3M3TA 2ODPA 2P93A 3KHVA 4H6SB 2FTLE 5CHAB 1AFEH 2ZU1A 4JYUH 3PV4A 2EI6A 1KYNA 4XBCA 1P06A 4K8YA 1MTUA 2HOBA 2VWMA 3BTFE 3EGKH 2GDDA 3BTKE 3ZVEA 2BOHB 5EW1H 5HGGA 4Y10E 1NO9H 1OPHB 5F8TA 3SZNA 3RXTA 4BAMB 4BTUB 4GVUA 1GL1A 4YOJA 1FXYA 2O9QA 1DE7H 1BTPA 5ABWA 3RLYH 2GZ9A 3A7XA 2WUCA 1FY5A 5JB9S 6ESTA 1L0ZA 1SGPE 3S7KB 1WV7H 5GIBA 1BRUP 4ESTE 2ZQ1A 4F4OC 2ZPRA 3M5OA 1ANCA 4A1VA 2GCTB 1O2SA 2PTNA 2SGAA 3RXIA 1JRSA 1O30A 5AHGH 2BX3A 1OS8A 4X2YA 2WYJA 2Z9KA 2VIPA 4IW4E 3KGPA 4Q2KA 2VU8E 1MH0A 2TGPZ 1O5CB 1J15A 4A7IB 2VWOA 2ZDKA 5A0CA 2CHAB 4B1TA 4INHA 3V3MA 1PPEE 3MO3A 1B0FA 1YPGH 1GI4A 2W3KA 1YPJH 3LGWA 2W5EA 3EA8A 1T32A 1P9SA 1G3CA 2XRCA 3BTHE 2GT8A 5C3NA 2ZI2H 2O8LA 3KQCA 2ANWA 3GY2A 3PTNA 5E8EH 5T6FA 1TGSZ 4AGKA 1GG6B 5SGAE 4GHTA 3V0XA 5JYIA 1O32A 1OXGA 2V3OH 2AIQA 3VXFH 2GZ7A 4NA8A 1DX5M 3ENSB 3OX7U 2ZC9H 2ZU3A 4Y76A 1T31A 2BB4A 1FY4A 1BQYA 2RA0A 5FCKA 2GVFA 4FUHA 4BTIB 1ARBA 4AX9H 3TH3H 1AE8H 3MNXA 2ZFSA 1TX6A 2FI4E 4X6PA 1BTXA 2A31A 1UK2A 4DIHH 1TGNA 3UFAA 2NU2E 1CA0B 1O3PB 2QCYA 3OU0A 4CREA 2FOAA 1S0QA 3BIUH 1C5SA 1GGDC 1OP2A 3MH4A 4Q7ZA 2QGRA 4YZUA 1MQ6A 1GI2A 2PGQB 3K9XB 1C1UH 1BRCE 2JETC 1GJ5H 3B23B 2G4TA 1ESTA 5FAHA 1HFDA 1FNIA 5F6MA 3M35A 1O3MA 4O3UA 5EQRA 1P2NA 2PUQH 4GHQA 2D8WA 4K69A 5FCRA 2Y7ZA 4X1PU 3IWMA 1HXEH 1JXPA 4NGAH 2JH0D 4AG2A 4THNH 2ZPSA 1TRYA 2ULLA 1HLTH 1TNIA 4RSPA 3P8OA 1DLEA 4IGDA 1W8BH 5A2MH 3M5MA 1C1WH 2QF0A 4X6MA 3EA9A 4Q7YA 4X1SU 2PSXA 1GBMA 3PLKA 3AAUA 3RXDA 2A45B 3SQHE 3ESTA 1VJAU 1NRPH 1RTFB 4D8NA 2J92A 1ID5H 3A87A 2FOCA 3ZZ8A 2ZDVH 2OC8A 2V0BA 4NA7A 1LVOA 3VB6A 2J4IA 1QJ6B 4Y0YE 3R0FA 5DPAA
chains in the Genus database with same CATH superfamily
1XVOA 2OUAA 1O2TA 2AERH 4MTBA 4YT6H 4CRDA 4IN1A 9LPRA 1FPHH 4UFDH 3DUXH 4ISOA 4ABBA 2OQ5A 6GCHG 2IPQX 5HKKD 1SGFG 2OTVA 5EG4A 1DS2E 1MU6B 1S0RA 2J34A 4JZDH 5DG6A 1O2OA 5JPMH 1Z8GA 1MQ5A 3U8RH 3RXJA 4XOJA 1CHGA 1O3FA 4IC5A 1FMGA 1QTFA 1HNEE 1GBBA 1E36B 1KDQB 4JCNA 1FONA 4K8BA 4XSKU 2VIWA 3TIUA 4IC6A 1T4UH 3FOAA 3OYPA 4X8TH 2G00A 2Q6DA 1RTLA 2FLBH 3C1KA 1UTJA 4MQAA 1RXPA 1L1GA 3HKIB 3UR9A 1ESAA 1BHXF 1SGFA 2A5AA 2PWXA 3B9FH 3PRDA 1NFXA 1C2HA 1O3AA 4GAWA 1E1RD 1C1MA 4YO9A 5EJ1A 3DCLA 2DUCA 1V6DA 2BOKA 3TJNA 1QQUA 4TY6A 2C3SA 2PUXB 1TGCA 2WSSD 2QYIA 4O03A 3RP2A 4JZFH 4AB8A 2BMGB 1O39A 2B7DH 3URDA 3KEEA 2WPKS 5DP9A 1FDPA 1U6QA 1GHZA 1ZOMA 2M5TA 2VVCA 3H09A 1IQNA 1OOKB 1S6LA 2BVXH 3NKKA 3P17H 3QUMP 1PPBH 2ZGXH 1EPTA 1VZQH 2F9NA 1OSSA 2RDLA 1P2KA 2ESTE 4DT7B 2V3HH 3PTBA 3Q76A 1TB6H 2ZTZA 2VJ1A 1HIAA 3FP8E 2ALVA 4BOHA 3AW1A 2G5VA 2FLRH 5J4QA 2J95A 1IOEA 3E8LA 2YNAA 4WWYA 3BG8A 2GDEH 4X1QU 4Y7AA 1KTSB 3F9GA 3TVJB 2STBE 1H8DH 1GI1A 1GBJA 3ZVBA 5HM9A 1UHBA 2HPPH 3SUGA 1O3HA 2IN2A 2PKSB 1C2DA 2QIQA 2Y6TA 1QBNA 4F49A 1W7GH 3SV7A 3TH2H 2YMSC 4FUBA 4KP0A 1DXWA 3PRBA 5FPTA 1GBKA 1P12E 2GV7A 3PMJA 5I46H 4ISIH 2FDAA 1C4V2 1SMFE 2SGFE 5JBTA 5EW2H 1FX0B 1AB9C 2WPJS 4I8GA 1TOCB 5A8YA 1NRRH 1C5RA 2ZGHA 1GVKB 4M9FA 4BANB 1SLUB 4FUJA 2OINA 1AU8A 2K8IA 2WPMS 2HVXA 3KL6A 1O2NA 1RRKA 2C4FH 4TWWA 1NESE 1LQEA 2XC0A 5TCAA 1TAWA 5GCHG 2W3IA 3LGTA 3LU9B 1W0JD 1BZXE 4CRCA 4MPVA 2FEQH 1PJPA 3ZV9A 4DIIH 1PQAA 2AGGX 3QN7A 2VH0A 2A4GA 3VGCC 1V2WT 2LNCA 2CF8H 3BTTE 1SOTA 1EP6A 1F5KU 4B6FA 1TGBA 1O31A 1SHHB 3EE7A 4CRGA 3VB4A 3A7TA 3E0PB 3SUDA 3S9AA 1VCQA 2QF5A 4KELA 2RFKC 1HXFH 5C17A 1Q2WA 4AG1A 1G32B 4ASHA 1LKBA 4K60A 3T26A 4VGCC 1G36A 1YKTA 5A0BA 7GCHF 1O2MA 1OWKA 4DY7B 1C4Y2 1JIMA 2ZHFH 1ZLRA 4IBLH 4B6EA 1TNGA 3I77A 2TGTA 2ZO3H 3Q3YA 1GHBF 3L6PA 2ZU5A 2ZFTA 2EI8A 1GMDG 5C20A 1O34A 1SVPA 3GOVB 3ZZBA 1K1IA 4AC9A 1SGCA 1EZQA 3RU4T 1KTTB 3KQDA 3TU7H 4YT7H 4ACBA 2PGBB 1A2CH 4TYDA 4XD7D 1TQ0B 1CT4E 1PYTD 5BRRE 2THFB 2ZECA 3EA7A 1C1TA 1ANBA 1P3CA 2GMTB 1PPCE 4UEHH 1PFXC 1LQDB 1QHRB 1DSTA 2YNBA 1O3LA 2KR7A 1GBTA 1MBQA 4CHAB 1D6WA 4PROA 2BLOA 5JBCS 1C5XB 2KAIB 2NU3E 2WYGA 1Q31A 5H4IB 2BQWB 3UNRA 1CGHA 1QBOA 1QGFA 4HG6A 3CS0A 1C5LH 1HAGE 3DT0H 1VITF 3T5FH 1E1QD 1ELCA 1A1RA 4TSFD 2OCVB 2KCAA 3UTUH 3DFJA 1QB9A 3T29A 1O3GA 4K1TA 3TGJE 2Z3CA 5DN6D 3BTDE 2ZWLH 1UVOA 1V2NT 1C5VA 2IOTA 3A7ZA 3W94A 2TIOA 2HGTH 5L2YH 2P8OC 1W11U 3E0NB 2FO9A 3BV9B 1QRZA 3SJKA 1NPMA 5C5NA 1HYLA 3DFLA 1SHYA 1P10A 2HWLB 4SGBE 3T28A 3KYFA 1XX9A 2ANKH 1CU1A 2F9UA 3E16B 3MTYA 1AMHA 1YWUA 4XE4A 4ZCNA 3W1EA 1C1SA 3BEFB 2Q1JA 2ZPQA 1GVZA 1LHEH 1TQ7B 1OWDA 2FOMB 1IQEA 1MD8A 2Y80A 1KXAA 1F0TA 1IQHA 1A46H 1ELAA 3ZVFA 1Y8TA 3RUOA 1WQVH 2SFAA 1EAIA 1EX3A 1SGTA 2J9NA 3FZDA 3A89A 1K28D 1GI7B 2FESH 3GDVA 2BY6X 1BITA 2W7SA 3MYWA 4UD9H 5DP6A 3FP7E 2KZ4A 1UVPA 1L4ZA 1SG8B 3G01A 3U69H 2Y5FA 1W0KD 1LPZB 1KLTA 1Z6EA 1TLDA 3F2HA 5AFYH 1TNJA 1N6YA 1V2RT 2VWLA 4RT0A 2KX4A 1QA7A 1BMMH 1SSXA 4OS2A 1FLEE 2A7CA 5C94A 1ZRBA 2W26A 5GWZA 2QF4A 2HVYB 1G3DA 3SGBE 3SNCA 1FJSA 1HAOH 3RC4A 2JJ1D 1GHVH 1A5GH 2B8OH 3SN8A 2WPDD 2Z7FE 2QY0B 1O36A 3MWIU 2AS9A 5EJLA 2ZFFH 1SKYE 5EPYA 3F0OA 4ABIA 1W13U 4KTUA 1O2GH 4F55A 1SQTA 2R9PA 2Y5HA 2Z6BD 2GGVB 2VVUA 5CHAC 3SJOA 2EA3A 3GY8A 5T6GA 1HAIH 4ABJA 3BG4C 5EOKA 2QAAA 3UOPA 3TJOA 5EXLA 2ZDLA 3F2FA 3TK9A 1V3XA 1BTWA 4O3TA 4CH8B 1LVBA 4CR9A 5A8ZA 2OD3B 3F6UH 1GMHG 4OGYA 1ZHMA 1CE5A 1Y3XA 1SGEE 3HK3B 4GCHG 1YM0A 4QT8C 1S85A 2ZZUH 4E05H 1XKBC 4WMEA 1W10U 4MPWA 1ZJKA 3UPEA 3DSGA 2BLVA 1AD8H 3SU4A 3GCHC 1ELDE 1UTMA 4X8SH 2PR3A 6GCHF 2A4RA 2P3UB 4CBNA 2HPQH 2ZGCA 5A8XA 3LC3A 2XBVA 1P02A 4Y7BA 1SPJA 2AIPA 4D7GA 1BUIA 4WY3A 1GMCG 1JOUB 1Y5AT 1UTKA 3RXBA 1GBFA 3NXPA 2A2XH 3GY7A 4LZ4B 1SOZA 1Z1IA 5ESTE 1XUIA 1O2XA 4XBDA 4ZROA 3O8RA 3RXUA 1C2JA 1LHCH 2FWWA 5T6DA 1J8AA 1MTNC 1C5PA 4NIXA 1PQ8A 2OXSA 1AIXH 1GHWH 1GHAF 3TJUA 2BD4A 1UO6A 1AGJA 3KQBA 5ESBA 1T8LA 2G5NA 4FVBA 2DE9A 1INCA 1XUJA 3A81A 4WMFA 2ANYA 1NRSH 2SNVA 4FU9A 3IITA 1BMLA 1ANDA 1IHTH 1SGQE 1QNJA 1AZ8A 1OWJA 2BDIA 3LDXH 4FXGH 4YLUA 4MVNA 2P3TB 1KDQA 2D26C 4A5TS 1A4WH 2BY8X 1V2TT 1W3CA 2F9PA 2UWOA 1BMAA 3E91A 4YOGA 3RXFA 2G52A 3ZYDA 4FUFA 1DUEA 2BQ7B 4MNYA 2ODYB 3MU8A 1XKAC 2F9OA 2GV6A 1CQQA 1OX1A 1H4WA 3SNAA 8GCHG 3BTEE 2BY5X 1NM6A 5F03A 1FY3A 2AMQA 4I8JA 1ACBE 1ETTH 5DKMA 4YLQH 2AYWA 1P2MA 1W0YH 1GWAA 1TBZH 2XBWA 3SU2A 2JIZD 1LHGH 3SW2B 1DWBH 2NU0E 3PLPA 3SUFA 4HFPB 1QCPA 3SGQE 1C5TA 2OC0A 1YY3A 4B71A 3ZZAA 1HCGA 1ZRKA 4FUCA 1KXFA 3QDZB 4YOIA 4TPIZ 3RXRA 4FVDA 3SUEA 3QX5H 3ZZDA 4UFGH 3A80A 5FXLA 3U28C 1D3QB 1BRBE 2Z3EA 5K0HA 1NFYA 3ZZCA 2R3UA 2FM2A 4IS5A 1GCTC 5BPEA 1WOFA 9ESTA 2H2ZA 4Y0ZE 5IDKA 1VCPA 1TRMA 1B0EA 3FZZA 4ISNA 1GJ9B 3IG6B 4IMZA 5GCHF 1QZ8A 2ZCHP 2ZTYA 2QA9E 1XUFA 5F8ZA 3EDXB 1E79D 1O3BA 3JZ1B 1TMUH 2CXVA 3KYGA 3RMNH 4CH2B 1D9IA 5C0UA 2F43B 1BT7A 2NU4E 1NFUA 4B2AA 1CO7E 3V12A 1TYNA 3OTJE 1K1JA 2BDAA 1BJUA 3RXOA 1Y5UT 1K1PA 2BD5A 1BDAA 1O2VA 1FI8A 3FKSD 3K2UA 1E34B 4X8UH 4K1EA 4BTTB 4IN2A 1EJNA 1YPKH 3RMMH 1NROH 2ZHQH 2VIDA 3T27A 1BBRE 1GJ4H 1HB0B 4WH8A 4ZXXH 1TA6A 4FOUC 3A8AA 2GJGA 3GICB 1LMWB 3LC5A 1O35A 2J97A 1F92A 2KCYA 3UR6A 1TONA 1VITH 2A32A 1O3OA 1UTPA 1HAPH 1DT2A 2LP6A 3WY8A 1UTNA 3S9BA 2BHGA 3KQ5A 1XVMA 1CT0E 2FOEA 2P3FH 1HRTH 2BVSH 2WZQA 4I86A 1W12U 1DUAA 2H9EH 3R3GB 1A0LA 2BDYA 3GS9A 3SU6A 2FS9A 3GCTF 3U8OH 1NS3A 4CRBA 1O5BB 1MAYA 5JBAS 1HAHH 1OP8A 2GCHF 3U1IB 1YCPH 2G55A 3TNTA 5LPRA 5EQQA 1GDQA 3SHAH 3UUZA 3FVFB 1JWTA 3MHWU 1NTPA 1EB2A 4RKJB 2EEKA 4DW2U 3LIWA 4FUEA 1YPHE 1QR3E 3LOXA 3SNDA 2GZ8A 1DPOA 3ZIAD 4X6OA 4CRAA 4I32A 1CA8B 4D9RA 1DOJA 1DWCH 2BXUH 1EOJA 1O37A 2H5CA 4D76A 1ORFA 3OFND 1GGDB 4GLYA 5C0TA 2GTBA 1K9OE 1RIWC 4NZQA 1NY22 1IQFA 1LVMA 2FYQA 2WPLS 2CF9H 3KN2A 4ABFA 1EAWA 3QLPH 5E2OA 3TNSA 3B8JA 1IHSH 5HM2A 4Y11E 2QN5T 3PV5A 3WW7A 2JETB 1VGCC 4BAQB 1CHOF 4WXVA 1MTWA 5DO4H 1C2KA 1FN8A 1JRTA 1O5DH 3RC6A 3RMOH 4O97A 2KAIA 3GISB 3SV2H 1GI0A 3LPRA 1GBIA 3MNCA 3KIDU 3OAAD 2LELA 1J17T 3SU5A 1C1PA 1GI6A 1NZQH 2KM0A 1EFRD 1MKXK 2Z9JA 3RM0H 2ZGJA 3NZIA 1SLXB 1QRWA 4JYTA 1HV7A 1SB1H 2A2QH 4OGXA 1KSNA 4K1SA 4LXBH 3LH3A 5TJXA 1QBVH 4BAKB 2TGAA 1YCPK 2IJOB 3TLOA 5LPEA 5HIZA 1YCPM 1V2OT 4WXIA 3ZZ7A 3QTOH 1AVXA 2WV5A 5JDUB 6CHAB 1UCYE 2D1JA 1G3EA 3UAIC 4JMYA 1TPOA 1Z1JA 1AVGH 1DANH 2BLWA 1C1VH 1QY6A 3PMAB 3RDZA 2UUJB 2J98B 2VH6A 2HLCA 4AFUA 4INKA 1MTSA 2OP9A 2SGQE 3QZRA 1UTQA 1O2IA 4Y8XA 4E7RG 3ATWA 4I8KA 2FZZA 1TNHA 3RLWH 2FODA 3RXCA 3O8BA 3OY5U 1HJ8A 3HATH 3DD2H 1Z6JH 1GBEA 1MU8B 5TCCA 3A85A 1P05A 1S6HA 2C8XB 2H5DA 5HXFA 1GJAB 4FUIA 2XW9A 1LO6A 3MMGA 1DICA 2ZFRH 1XXFA 1UVSH 4XBBA 3ATIA 3MU5A 4B73A 4JZEH 2ZF0H 3EYDA 5EODA 3RMLH 3EAJA 1O2LA 1GHXH 1TX8A 4AFZA 5EPNA 4LOYH 1NFWA 3D49H 1KMHB 5CE1A 4AYYB 1QL8A 5DSFA 5PTPA 5I25A 4WMDA 2J5UA 1C2MA 3T2NA 1Y3YA 1MABB 2OBOA 2AH4X 2RCEA 3F9FA 1BTZA 3NPSA 1FUJA 1TMBH 2JKHA 1AKSB 1SGYE 4NWLA 1IQKA 3ELAH 1A3BH 3JZ2B 1QB1A 4A6LA 3D62A 4TWYA 2J38A 3P8GA 1D3TB 1ZMJA 1BB0B 4ZMAH 3SV9A 1RTKA 1YLCA 2BD7A 1WUNH 2FPZA 1AZZA 4DT4A 1LTOA 3A84A 1C9PA 1C9TA 2CV3A 3LGYA 3P95A 3K6ZA 5EQSA 2V7QD 3MQKC 2OBQA 2FYRA 1BA8B 1P57B 1O5AB 2UUFB 3ZZ4A 8LPRA 4HTCH 3PWCA 1ELEE 1YPEH 4BXSA 1YLDA 1A5IA 3OE7D 2Y81A 2ZCLP 3PO1C 3ATMA 1GJ8B 2B0FA 2XC5A 3QO6A 3TJVA 2R2MB 2G81E 4X2VA 1UVTH 3AASA 2J94A 2VGCC 5DJ7A 3BTME 1DFPA 3L33A 1G3BA 1BRAA 4DJZB 3UQVA 4BAHB 2XBYA 4MPXA 2FXRA 3GCNA 3HGNA 4Y79A 2WPIS 1THSH 1L2EA 1AHTH 1AN1E 3OY6U 2Z9IA 1O33A 2KFWA 1UW7A 1NRNH 1EPTC 1MTVA 1YLNA 1ZSKA 2BQ6B 2XCNA 1AB9B 1HDTH 1NBMD 4B76A 1PPGE 5EXNA 1QJ1B 2P16A 5AVDA 3ZVCA 3UWIA 1C4U2 2CN0H 1AFQC 1EQ9A 1GJ7B 3TPIZ 4XFQA 1BTUA 1T8MA 1GCDA 1LVYA 4MNWA 1J14A 2O8TA 1BMNH 1F7ZA 5G4BA 1K21H 3DSPA 4WH6A 1Z8JB 4AN7A 1NN6A 4U32A 3U98H 2VBCA 2TBSA 1S81A 2Z9GA 4KTSA 1VKYA 2ZIQH 4AFSA 4CR5A 8GCHF 1UTLM 3RU4D 1AQ7A 2QXHA 2BDHA 1V2UT 2BVRH 3A7YA 3VGCB 1Y3WA 1T8NA 3M5NA 1TALA 3M7TA 5FHTA 5C1UA 1GDNA 4HI3A 2GD4B 2ZA5A 2KCPA 3PLBA 2XWBI 1WSSH 3VXEH 1PPZA 1ZPCA 2UUYA 4B75A 4M7GA 1ELVA 1IQGA 2FMJA 2ZG0H 1NT1A 2AHME 1FQ3A 1WTGH 1GI8B 1E37B 2RA3A 3M61U 4WVPE 4DG4A 2A5KA 2BTCE 4VGCB 4X0WU 1QIXB 1SFQB 3ZYEA 4YXWD 1ZPZA 1J9CH 3TGKE 1HAYB 1O3KA 4Z1MD 1YPHC 1N8OC 4TY7A 3I29A 2AMPA 4XRNA 4RI0A 2XNIA 2OLGA 1C2IA 1V2KT 3ZZ3A 1DXPA 1EJMA 2BZAA 1SGDE 2BX4A 2W6ID 4Y8ZA 2FOHA 1MZDA 1NBME 1V2ST 1O2QA 5FPYA 2F4LA 1CBWC 1M9UA 4FU8A 2FIRH 5HIYA 1W0ZU 1NC6A 1PQ5A 3T25A 1XM1A 2V6NA 2XCFA 1L1JA 4NSYA 1P9UA 1TBRH 4K5ZA 1UTOA 1LPKB 3LT3A 1AI8H 2ZP0H 2AGIX 3MU1A 2PP6A 2ZFPH 1XXDA 1GI5A 1V2VT 1COWD 1CSOE 1QRXA 2ZU2A 3RU4E 3PB1E 1QURH 1C2FA 3PV2A 4DVAU 1EAUA 5KEDA 1EKBB 2Y82A 5FX5A 5GXPA 1DITH 3A8DA 3SI4H 5DP4A 3F3BA 3FN8A 3PM3A 1O3IA 1O5GH 2HNTE 4Y8YA 5FBIA 7ESTE 1ZTKA 2QF3A 4MNXA 1K0HA 1HJAC 4X2XA 1KXBA 1SQOA 2FX6A 5L6NH 4X8VH 1ZPBA 1C2GA 4UFEH 1F0RA 7LPRA 4X1NU 4RT1A 2ANMH 1JIRA 1ZTLA 2P8OB 2WV4A 1A3EH 2BDBA 2R0LA 2R0KA 2WUBA 2Z94A 1KIGH 3H7TA 1S84A 3UIRA 2XC4A 3LGIA 3VB5A 1DLKB 4ZAEA 2C8ZB 2BD2A 4P02A 1B5GH 3WWFA 2BY9X 1GHYH 5GPIB 3BIVH 5HMAA 2OC1A 3P70B 1TPSA 1WQSA 3GY3A 1NRQH 3N7DA 2RDEA 3UNSA 3BTQE 1BJVA 1BOQA 1Q3XA 1FZZA 1IQMA 1OHHD 4ABHA 2H9HA 2R2WU 1WBGB 3ZZ9A 3M3SA 1TNKA 3H7OA 4MDSA 5E0JA 1IAUA 1FAXA 1HAVB 1VCWA 1W7XH 3TH4H 2B5TB 3A83A 4BNRA 4TPYA 2FOGA 1C5OH 1O2WA 2GCTC 1O3JA 1ZGVA 1TOMH 4I8HA 2VVVA 5DP3A 3GY4A 1S5SA 3F2GA 1OYTH 3MNBA 3SOSA 1Y5BT 4J2YB 1AY6H 2PV9B 5DP5A 1MUEB 2FX4A 4CRFA 3MH5A 1GBDA 5IYTA 4RN6A 5IK2D 4NG9H 1A0JA 1EUFA 1ZHPA 2CHAC 3VFEA 5EXMA 1ELTA 1A0HB 1C5QA 1N6XA 1OWHA 3WWBA 3RM2H 1TWXB 3LJOA 5C1XA 2HALA 1O2JA 3KCGH 5L2ZH 3SU0A 4MLFB 1GVLA 4NWKA 3OSYA 1G9IE 3KF2A 5GJ4B 3UQOA 3ZZ6A 2QE7D 1ABJH 2A7HA 1C5MD 2K0QA 1S82A 3ZVAA 3BG4B 1GG6C 2A4OA 3UY9A 4JYVH 4WJG2 1O2UA 1P2OA 1E35B 1MMJN 3A82A 3M36A 7GCHG 3K65B 2NWNA 1D4PB 3T62A 3LGUA 1O2RA 3VB7A 4NIWA 2A5IA 3SZEA 2WPHS 1GHBG 3AVZA 2YOLA 5CHBA 5JBBS 2G51A 1P3EA 2RG3A 1GDUA 3RXEA 2BDCA 3SI3H 4B2CA 1YC0A 3TK5A 3AK5A 3GY6A 1ARCA 1ZGIA 4JZ1A 2PLXA 3GY5A 1O2HA 5AF9H 3O8CA 1BTHH 1GJCB 2OC7A 3GCHB 4NA9H 3CS7A 2ZCKP 2F9VA 4OS4A 3STIA 4H4FA 1V2PT 1KY9A 1CA0C 1YP9A 3QGJA 2ZKSA 3U8TH 1HUTH 3TITA 1K1LA 4Y6DA 3UREA 4DURA 1AO5A 1GI3A 4NCYA 1K1OA 1K1NA 2BY7X 5DP8A 1LPGB 2VNTA 1P01A 1VITG 1J16A 3A7WA 3A86A 3N99A 1P04A 2J2UA 2L74A 3K6YA 1LHFH 5F8XA 5A09A 2BDGA 3BEIB 1MTNB 2ZHDA 2J98A 2V3MA 1BIOA 3QTVH 1QL9A 1EZXC 3V7TA 1GJDB 1EZSC 1S6FA 2BXTH 1V2MT 3ITIA 1ZMNA 1YF4A 1P09A 4Y71A 1AWHB 2F9BH 1SFIA 1QJ7B 3SJ9A 3SJIA 1OWEA 2ZHWH 4I31A 3MI4A 1CVWH 3NK8A 1FY1A 3MO9A 4HZHA 1THPB 3MNSA 5EGMA 4AOQA 1GBAA 2EQNA 1O3DA 3S9CA 3F9EA 1C1OA 4J1YA 1BHXB 1EB1H 1MD7A 3M7UA 1O2ZA 2QXGA 3SV6A 3SNBA 3GCOA 1YYY1 2PW8H 2AGEX 4FETA 3PYHA 3F9HA 3A8CA 1MKWH 1X7AC 1IQIA 3P8NA 4U2WA 1KXCA 5GDSH 1Z71A 4ZKNU 2EY4C 1AKSA 1XMNB 5DP7A 3RXPA 2FTMA 2PHBA 3BTWE 1SLVB 1OYQA 1GMDF 3H5CB 1C5NH 1TE0A 1TPPA 3DSOA 1GJBB 3FFGA 1FN6A 2SNWA 3FP6E 1PYTC 1FAKH 4E06H 2UUKB 1F0SA 1MKXH 1TMTH 1V2JT 3UB0A 2GT7A 1T4VH 1TPAE 3QWCH 5KGOA 3BTGE 5EIYA 1UVUH 1GCTB 2QXIA 1C2LA 1LKAA 1ELFA 2PKAB 1F0UA 2W7UA 4OS7A 1BTYA 3NWUA 1ZSLA 4OM9A 3RXVA 3A7VA 4INLA 1YBWA 1GBHA 1ETRH 1FPCH 2V35A 1L4DA 1SC8U 2F3CE 1NU7B 2HNTC 4Q4LA 4LK4A 3SNEA 1ESBA 4O9VA 2ZHEH 1MBMA 1RFNA 2H6MA 3PWBA 1WU1A 1DWEH 2TPIZ 1SL3A 2A1DB 2PSYA 1FY8E 2C8WB 1WTHD 4NIYA 3ZZ5A 4K3JA 2CGAA 1DSUA 1EP5A 1EXFA 2D2DA 6CHAC 3W95A 3KNXA 4P00A 1TFXA 1G2MA 2H9TH 2ZFQH 1MKWK 4ISLA 3SU3A 3EE0B 1NU9A 4YTAA 4H42U 4AYVB 1GJ6A 1UMAH 1TGTA 4AZ2B 2BZ6H 1EAXA 3BSQA 3SO3A 1CT2E 1KXDA 3ZV8A 4ZHAA 3SHCH 1LDTT 4B74A 1QFKH 4BAOB 1FIWA 5C5OA 3ATKA 3RXMA 1Z8RA 4ABEA 2PKSC 4GUXA 3ATLA 2XTTB 4X2WA 3STJA 2LPRA 1P03A 4Q63A 1D3PB 2G8TA 2XWAA 5CDFE 3V13A 4KKDA 3MOCA 4A1XA 1PPHE 4DCDA 2VIVA 4DOQA 3URCA 4YM9A 4DGJA 1THRH 1AUJA 1O3NA 1UK4A 2SGEE 5CMXH 1GHAG 3I78A 3N7OA 2DE8A 1A5HA 1HJ9A 1Y3VA 1H9HE 5EJZA 1HAZB 1A61H 4UE7H 1FV9A 5LH8A 2FI3E 1O3EA 1BCUH 1CGJE 1ABIH 4FUDA 5EU8A 3TK6A 3EQ0H 1L1NA 8ESTE 1YPLH 1GI9B 4ABDA 1ZZZA 1E0FD 3MH7A 3TGIE 2ZTXA 2EI7A 1RIWB 3UWJH 3RXLA 1EJAA 5FBEA 2Y7XA 3NUMA 1HGTH 3SGAE 1GPZA 1RJXB 2XNDD 1F5RA 4NIVA 1IQJA 1HAXB 2EC9H 1IQLA 2VINA 1VGCB 2Z9LA 4JZIA 1LCYA 5FPSA 3MU0A 3UNQA 1JBUH 2P95A 1MCVA 2UWLA 2BLQA 1UK3A 2XBXA 3BF6H 1AWFH 1GBCA 1W14U 3UOUA 3S0NA 1FIZA 3SJ8A 2F83A 2ZQ2A 2P94A 2P59A 3MO6A 1GMHF 1VR1H 1OWIA 1C5WB 3RXQA 3S69A 5FX6A 2JH5D 1WAYB 1ZHRA 2VB0A 2W6JD 4GCHF 3U9AH 3M37A 2ODQA 4MNVA 2L6OA 2GKVE 4D9QA 1ELGA 3AW0A 2VIOA 5E2PA 3NRLA 4HGCA 1BBRH 1H9IE 4ASUD 2QXJA 3FO8D 2AEIH 1SLWB 2C93B 1ZMLA 3VPKA 2GMTC 4AORA 1MCTA 3RXKA 3F68H 1XUKA 5LGOA 1O38A 1W2KH 3M3VA 4ZKSU 4OS6A 4CHAC 1GMCF 4U30A 4ZXYH 4YESB 3SBKA 2R3YA 5DGJA 1H1BA 5L30H 2A0QB 3CENA 3QZQA 4U01A 3RXSA 1EZUC 2TGDA 7KMEH 4MG3A 3LJJA 3E90B 1PQ7A 3FAOA 1SR5C 2AFQB 3C27B 3RXHA 1CGIE 3D65E 3LONA 5DK1A 2XOKD 1OP0A 5B6OA 5C1YA 4KGAA 4GPGA 1HAVA 3AAVA 4MPUA 4FU7A 3E3TA 3SYJA 2FP7B 4K2YA 2BD9A 3RXGA 2YMSB 3PMHB 3D23A 1TNLA 3Q3KA 2CJIA 1PPFE 2CK3D 5KECA 1SI5H 1H8IH 1S83A 3E1XB 1D6RA 1DY8A 1C1NA 3HGPA 5T3HA 1SBWA 2IPHA 1A7SA 2HNTF 2VIQA 1XUHA 2OQUA 4ZUHA 5J4SA 1G37A 1F5LA 2H1UA 2CMYA 1O5FH 2JH6D 3F1SB 2SGDE 2PFEA 4KTCA 1G30B 1OKXA 3GCTG 1P2QA 3HK6B 3P6ZB 3MFJA 3GYLB 5LPFA 1MZAA 2ZDAH 2VWNA 1BBRK 1KXEA 1HBTH 2BD3A 2GCHG 4NSVA 3Q3XA 1P11E 4ZKRU 1P8VC 5K7RA 3ODFA 2OK5A 1TRNA 2BYAX 2Q6FA 1O3CA 3SQEE 1C1QA 4X1RU 3RXAA 2QC2A 1UJ1A 2FI5E 1DVAH 2Y5GA 3GYMA 4I7YH 4A1TA 1ZJDA 4XDEA 1QQ4A 3PO1B 4ZHMU 1KLJH 1B7XB 3SU1A 5GNDA 3M5LA 1P2JA 2VGCB 3LKWA 2I6SA 2G4UA 4AGJA 4OS5A 2ZDMA 3P8FA 3QGNB 5F53A 2WINI 4I33A 1C5UA 3P92A 4R8TB 1QL7A 4GSOA 1DM4B 4NZLA 4BXWA 1AE5A 1JMOH 2XXLA 1UCYH 1EOLA 1CHOG 2M2AA 1ETSH 1MAXA 4H6TA 4B2BA 1EPTB 1LHDH 3GDUA 4D7FA 1H8HD 4IMQA 4WF8A 3ZVDA 1V2LT 3DHKH 1ZSJA 3OEHD 4AB9A 5C2ZA 4FUGA 4Q80A 5B6LA 1SGIB 1O2PA 1RGQA 1SGNE 1AFQB 2ALPA 4JK5A 1T8OA 3PMBB 1O2YA 1HIAB 1XUGA 1K22H 1WYKA 1AUTC 4Z6AH 2F91A 3VB3A 1E38B 1HPGA 1SGRE 4Z0KA 1Z8IB 2HRVA 4UDWH 2ZDNA 2WV9A 3CP7A 3U1JB 1UHBB 1O5EH 1WCZA 2ZU4A 2O8WA 2KCOA 1EATA 2K1QA 1ZTJA 3L3TA 2GP9B 2O8UA 2STAE 4UONA 2ZEBA 4CBOA 2BM2A 3NCLA 2C8YB 1SQRA 1TA2A 2Q6GA 3SV8A 4ZKOU 2A4QA 1DWDH 2ASUB 1TBQH 1AVWA 2Z3DA 2FOFA 4RKOB 2A7JA 3S7HB 3Q77A 1Y59T 2XYAA 2O8MA 4SGAE 1GL0E 3O8DA 2TRMA 1T7CA 3BN9A 5FL7D 2FOBA 8KME2 1K1MA 2UWPA 2C90B 1Z7KA 4UFFH 1P2IA 1YPMH 1DY9A 4ABGA 3KQEA 3M7QA 4A92A 5ETXA 3DA9B 1P0SH 1C5ZB 2ZNKH 4NFEA 3LH1A 3SORA 3VG8A 1QA0A 1F2SE 4X6NA 3RC5A 6LPRA 1N8OB 1D3DB 1ANEA 1SQAA 3BEUA 5AFZH 4ISHH 2FS8A 1KLIH 2IJD1 1UCYK 3MH6A 3CNRA 4ZH8A 1RS0A 5JB8S 3E6PH 1DDJA 1EASA 4NFFA 1YGCH 4OS1A 4JK6A 1ELBA 1CBWB 2YMSD 5E0GA 2HLDD 4E7NA 2BD8A 4ZHLU 1C1RA 1VJ9U 3MU4A 1GBLA 3A8BA 3HPTB 3VEQB 1TABE 1RD3B 1ZR0A 2ZGBH 2PTCE 3PROA 2QV1A 2B9LA 1ZYOA 2AMDA 2ILNA 3FANA 5HYOA 3A88A 1V2QT 1C5YB 3LGVA 4LZ1H 1Y3UA 1K2I1 3N7EA 4AFQA 3ODDA 3Q00A 2PKAA 2I6QA 3GDSA 5E0HA 4F48B 1QB6A 1TIOA 4ABAA 3QK1A 2SGPE 1H9LB 2NU1E 3HKJB 4R0IA 1O2KA 4Q7XA 3ZVGA 4ACAA 5T1VA 1G2LA 4I8LA 1N1LA 1O0DH 1HJAB 1C2EA 1TX7A 2GX4A 5A0AE 5C67A 3M3TA 2ODPA 2P93A 3KHVA 4H6SB 2FTLE 5CHAB 1AFEH 2ZU1A 4JYUH 3PV4A 2EI6A 1KYNA 4XBCA 1P06A 4K8YA 1MTUA 2HOBA 2VWMA 3BTFE 3EGKH 2GDDA 3BTKE 3ZVEA 2BOHB 5EW1H 3OEED 5HGGA 4Y10E 1NO9H 1OPHB 5F8TA 3SZNA 3RXTA 4BAMB 4BTUB 4GVUA 1GL1A 4YOJA 1FXYA 2O9QA 4TT3D 1DE7H 1BTPA 5ABWA 3RLYH 2GZ9A 3A7XA 1BMFD 2WUCA 1FY5A 5JB9S 6ESTA 1L0ZA 1SGPE 3S7KB 1WV7H 5GIBA 1BRUP 4ESTE 2ZQ1A 4F4OC 2ZPRA 3M5OA 1ANCA 4A1VA 2GCTB 1O2SA 2PTNA 2SGAA 3RXIA 1JRSA 1O30A 5AHGH 2BX3A 1OS8A 4X2YA 2WYJA 2Z9KA 2VIPA 4IW4E 3KGPA 4Q2KA 2VU8E 1MH0A 2TGPZ 1O5CB 1J15A 4A7IB 2VWOA 2ZDKA 5A0CA 2CHAB 4B1TA 4INHA 3V3MA 1PPEE 3MO3A 1B0FA 1YPGH 2JJ2D 1GI4A 2W3KA 1YPJH 3LGWA 2W5EA 3EA8A 1T32A 1P9SA 1G3CA 2XRCA 3BTHE 2GT8A 5C3NA 2ZI2H 2O8LA 3KQCA 2ANWA 3GY2A 3PTNA 5E8EH 5T6FA 1TGSZ 4AGKA 1GG6B 5SGAE 4GHTA 3V0XA 5JYIA 1O32A 1OXGA 2V3OH 2AIQA 3VXFH 2GZ7A 4NA8A 1DX5M 3ENSB 3OX7U 2ZC9H 2ZU3A 4Y76A 3OTPA 1T31A 2BB4A 1FY4A 1BQYA 2RA0A 5FCKA 2GVFA 4FUHA 4BTIB 1ARBA 4AX9H 3TH3H 1AE8H 3MNXA 3F0PA 2ZFSA 1TX6A 2FI4E 1H8ED 4X6PA 1BTXA 2A31A 1UK2A 4DIHH 1TGNA 3UFAA 2NU2E 1CA0B 2WHXA 1O3PB 2QCYA 3OU0A 1WXRA 4CREA 2FOAA 1S0QA 3BIUH 1C5SA 1GGDC 1OP2A 3MH4A 4Q7ZA 2QGRA 4YZUA 1MQ6A 1GI2A 2PGQB 3K9XB 1C1UH 1BRCE 2JETC 1GJ5H 3B23B 2G4TA 1ESTA 5FAHA 1HFDA 1FNIA 5F6MA 3M35A 1O3MA 4O3UA 5EQRA 1P2NA 2PUQH 4GHQA 2D8WA 4K69A 5FCRA 2Y7ZA 4X1PU 3IWMA 1HXEH 1JXPA 4NGAH 2JH0D 4AG2A 4THNH 2ZPSA 1WDIA 1TRYA 2ULLA 1HLTH 1TNIA 4RSPA 3P8OA 1DLEA 4IGDA 1W8BH 5A2MH 3M5MA 1C1WH 2QF0A 4X6MA 3EA9A 4Q7YA 4X1SU 2PSXA 1GBMA 3PLKA 3AAUA 3RXDA 2JDID 2A45B 3SQHE 3ESTA 1VJAU 1NRPH 1RTFB 4D8NA 2J92A 1ID5H 3A87A 2FOCA 3ZZ8A 2ZDVH 2OC8A 2V0BA 4NA7A 1LVOA 3VB6A 2J4IA 1QJ6B 4Y0YE 3R0FA 5DPAA
chains in the Genus database with same CATH topology
1XVOA 2OUAA 1O2TA 2AERH 4MTBA 4YT6H 4CRDA 4IN1A 9LPRA 1FPHH 4UFDH 3DUXH 4ISOA 4ABBA 2OQ5A 6GCHG 1SGFG 2OTVA 5EG4A 1DS2E 1MU6B 1S0RA 2J34A 4JZDH 5DG6A 1O2OA 5JPMH 1Z8GA 1MQ5A 3U8RH 3RXJA 4XOJA 1CHGA 1O3FA 4IC5A 1FMGA 1QTFA 1HNEE 1GBBA 1E36B 1KDQB 4JCNA 1FONA 4K8BA 4XSKU 2VIWA 3TIUA 4IC6A 1T4UH 3OYPA 4X8TH 2G00A 2Q6DA 1RTLA 2FLBH 3C1KA 1UTJA 4MQAA 1RXPA 1L1GA 3HKIB 3UR9A 1ESAA 1BHXF 1SGFA 2A5AA 2PWXA 3B9FH 1NFXA 1C2HA 1O3AA 4GAWA 4YO9A 1C1MA 2DUCA 1V6DA 2BOKA 3TJNA 1QQUA 4TY6A 2C3SA 2PUXB 1TGCA 2QYIA 4O03A 3RP2A 4JZFH 4AB8A 2BMGB 1O39A 2B7DH 3URDA 3KEEA 2WPKS 5DP9A 1FDPA 1U6QA 1GHZA 1ZOMA 2M5TA 2VVCA 1IQNA 1OOKB 2BVXH 3NKKA 3P17H 3QUMP 1PPBH 2ZGXH 1EPTA 1VZQH 2F9NA 1OSSA 2RDLA 1P2KA 2ESTE 4DT7B 2V3HH 3PTBA 3Q76A 1TB6H 2ZTZA 2VJ1A 1HIAA 3FP8E 2ALVA 4BOHA 3AW1A 2G5VA 2FLRH 5J4QA 2J95A 1IOEA 3E8LA 2YNAA 4WWYA 3BG8A 2GDEH 4X1QU 4Y7AA 1KTSB 3F9GA 3TVJB 2STBE 1H8DH 1GI1A 1GBJA 3ZVBA 5HM9A 1UHBA 2HPPH 3SUGA 1O3HA 2IN2A 2PKSB 1C2DA 2QIQA 2Y6TA 1QBNA 4F49A 1W7GH 3SV7A 3TH2H 4FUBA 4KP0A 1DXWA 5FPTA 1GBKA 1P12E 2GV7A 3PMJA 5I46H 4ISIH 2FDAA 1C4V2 1SMFE 2SGFE 5JBTA 5EW2H 1AB9C 2WPJS 4I8GA 1TOCB 5A8YA 1NRRH 1C5RA 2ZGHA 1GVKB 4BANB 1SLUB 4FUJA 2OINA 1AU8A 2WPMS 2HVXA 3KL6A 1O2NA 1RRKA 2C4FH 4TWWA 1NESE 1LQEA 2XC0A 5TCAA 1TAWA 5GCHG 2W3IA 3LGTA 3LU9B 1BZXE 4CRCA 4MPVA 2FEQH 1PJPA 3ZV9A 4DIIH 1PQAA 2AGGX 3QN7A 2VH0A 2A4GA 3VGCC 1V2WT 2LNCA 2CF8H 3BTTE 1SOTA 1EP6A 1F5KU 1TGBA 1O31A 1SHHB 4CRGA 3VB4A 3A7TA 3E0PB 3SUDA 3S9AA 1VCQA 4KELA 1HXFH 1Q2WA 4AG1A 1G32B 4ASHA 1LKBA 4K60A 3T26A 4VGCC 1G36A 1YKTA 5A0BA 7GCHF 1O2MA 1OWKA 4DY7B 1C4Y2 1JIMA 2ZHFH 1ZLRA 4IBLH 1TNGA 3I77A 2TGTA 2ZO3H 3Q3YA 1GHBF 3L6PA 2ZU5A 2ZFTA 2EI8A 1GMDG 5C20A 1O34A 1SVPA 3GOVB 3ZZBA 1K1IA 1SGCA 1EZQA 3RU4T 1KTTB 3KQDA 3TU7H 4YT7H 2PGBB 1A2CH 4TYDA 1TQ0B 1CT4E 1PYTD 5BRRE 2THFB 2ZECA 3EA7A 1C1TA 1ANBA 1P3CA 2GMTB 1PPCE 4UEHH 1PFXC 1LQDB 1QHRB 1DSTA 2YNBA 1O3LA 1GBTA 1MBQA 4CHAB 1D6WA 4PROA 2BLOA 5JBCS 1C5XB 2KAIB 2NU3E 2WYGA 1Q31A 5H4IB 2BQWB 3UNRA 1CGHA 1QBOA 1QGFA 3CS0A 1C5LH 1HAGE 3DT0H 1VITF 3T5FH 1ELCA 1A1RA 2OCVB 3UTUH 3DFJA 1QB9A 3T29A 1O3GA 4K1TA 3TGJE 2Z3CA 3BTDE 2ZWLH 1UVOA 1V2NT 1C5VA 2IOTA 3A7ZA 3W94A 2TIOA 2HGTH 5L2YH 2P8OC 1W11U 3E0NB 2FO9A 3BV9B 1QRZA 3SJKA 1NPMA 5C5NA 1HYLA 3DFLA 1SHYA 1P10A 2HWLB 4SGBE 3T28A 1XX9A 2ANKH 1CU1A 2F9UA 3E16B 3MTYA 1AMHA 4XE4A 1C1SA 3BEFB 2Q1JA 2ZPQA 1GVZA 1LHEH 1TQ7B 1OWDA 2FOMB 1IQEA 1MD8A 2Y80A 1KXAA 1F0TA 1IQHA 1A46H 1ELAA 3ZVFA 1Y8TA 3RUOA 1WQVH 2SFAA 1EAIA 1EX3A 1SGTA 2J9NA 3FZDA 3A89A 1K28D 1GI7B 2FESH 3GDVA 2BY6X 1BITA 2W7SA 3MYWA 4UD9H 5DP6A 3FP7E 1UVPA 1L4ZA 1SG8B 3G01A 3U69H 2Y5FA 1LPZB 1KLTA 1Z6EA 1TLDA 5AFYH 1TNJA 1N6YA 1V2RT 2VWLA 1QA7A 1BMMH 1SSXA 4OS2A 1FLEE 2A7CA 1ZRBA 2W26A 5GWZA 1G3DA 3SGBE 3SNCA 1FJSA 1HAOH 3RC4A 1GHVH 1A5GH 2B8OH 3SN8A 2Z7FE 2QY0B 1O36A 3MWIU 2AS9A 5EPYA 2ZFFH 4ABIA 1W13U 4KTUA 1O2GH 1SQTA 2R9PA 2Y5HA 2Z6BD 2GGVB 2VVUA 5CHAC 3SJOA 2EA3A 3GY8A 5T6GA 1HAIH 4ABJA 3BG4C 5EOKA 2QAAA 3UOPA 3TJOA 5EXLA 2ZDLA 3TK9A 1V3XA 1BTWA 4O3TA 4CH8B 1LVBA 4CR9A 5A8ZA 2OD3B 3F6UH 1GMHG 4OGYA 1ZHMA 1CE5A 1Y3XA 1SGEE 3HK3B 4GCHG 1YM0A 4QT8C 1S85A 2ZZUH 4E05H 1XKBC 4WMEA 1W10U 4MPWA 1ZJKA 3UPEA 2BLVA 1AD8H 3SU4A 3GCHC 1ELDE 1UTMA 4X8SH 2PR3A 6GCHF 2A4RA 2P3UB 4CBNA 2HPQH 2ZGCA 5A8XA 3LC3A 2XBVA 1P02A 4Y7BA 1SPJA 2AIPA 4D7GA 1BUIA 4WY3A 1GMCG 1JOUB 1Y5AT 1UTKA 3RXBA 1GBFA 3NXPA 2A2XH 3GY7A 4LZ4B 1SOZA 1Z1IA 5ESTE 1XUIA 1O2XA 4XBDA 4ZROA 3O8RA 3RXUA 1C2JA 1LHCH 2FWWA 5T6DA 1J8AA 1MTNC 1C5PA 4NIXA 1PQ8A 2OXSA 1AIXH 1GHWH 1GHAF 3TJUA 2BD4A 1UO6A 1AGJA 3KQBA 5ESBA 1T8LA 2G5NA 4FVBA 2DE9A 1INCA 1XUJA 3A81A 4WMFA 2ANYA 1NRSH 2SNVA 4FU9A 3IITA 1BMLA 1ANDA 1IHTH 1SGQE 1QNJA 1AZ8A 1OWJA 2BDIA 3LDXH 4FXGH 4YLUA 4MVNA 2P3TB 1KDQA 2D26C 4A5TS 1A4WH 2BY8X 1V2TT 1W3CA 2F9PA 2UWOA 1BMAA 3E91A 4YOGA 3RXFA 2G52A 3ZYDA 4FUFA 1DUEA 2BQ7B 4MNYA 2ODYB 3MU8A 1XKAC 2F9OA 2GV6A 1CQQA 1OX1A 1H4WA 3SNAA 8GCHG 3BTEE 2BY5X 1NM6A 5F03A 1FY3A 2AMQA 4I8JA 1ACBE 1ETTH 5DKMA 4YLQH 2AYWA 1P2MA 1W0YH 1GWAA 1TBZH 2XBWA 3SU2A 1LHGH 3SW2B 1DWBH 2NU0E 3PLPA 3SUFA 4HFPB 1QCPA 3SGQE 1C5TA 2OC0A 4B71A 3ZZAA 1HCGA 1ZRKA 4FUCA 1KXFA 3QDZB 4YOIA 4TPIZ 3RXRA 4FVDA 3SUEA 3QX5H 3ZZDA 4UFGH 3A80A 5FXLA 1D3QB 1BRBE 2Z3EA 5K0HA 1NFYA 3ZZCA 2R3UA 2FM2A 4IS5A 1GCTC 5BPEA 1WOFA 9ESTA 2H2ZA 4Y0ZE 5IDKA 1VCPA 1TRMA 1B0EA 3FZZA 4ISNA 1GJ9B 3IG6B 4IMZA 5GCHF 2ZCHP 2ZTYA 2QA9E 1XUFA 5F8ZA 3EDXB 1O3BA 3JZ1B 1TMUH 2CXVA 3RMNH 4CH2B 1D9IA 1BT7A 2NU4E 1NFUA 4B2AA 1CO7E 3V12A 1TYNA 3OTJE 1K1JA 2BDAA 1BJUA 3RXOA 1Y5UT 1K1PA 2BD5A 1BDAA 1O2VA 1FI8A 3K2UA 1E34B 4X8UH 4K1EA 4BTTB 4IN2A 1EJNA 1YPKH 3RMMH 1NROH 2ZHQH 2VIDA 3T27A 1BBRE 1GJ4H 1HB0B 4WH8A 4ZXXH 1TA6A 3A8AA 3GICB 1LMWB 3LC5A 1O35A 1F92A 3UR6A 1TONA 1VITH 2A32A 1O3OA 1UTPA 1HAPH 1DT2A 3WY8A 1UTNA 3S9BA 2BHGA 1XVMA 1CT0E 2FOEA 2P3FH 1HRTH 2BVSH 1W12U 1DUAA 2H9EH 3R3GB 1A0LA 2BDYA 3SU6A 2FS9A 3GCTF 3U8OH 1NS3A 4CRBA 1O5BB 1MAYA 5JBAS 1HAHH 1OP8A 2GCHF 3U1IB 1YCPH 2G55A 3TNTA 5LPRA 5EQQA 1GDQA 3SHAH 3UUZA 3FVFB 1JWTA 3MHWU 1NTPA 1EB2A 4RKJB 2EEKA 4DW2U 3LIWA 4FUEA 1YPHE 1QR3E 3LOXA 3SNDA 2GZ8A 1DPOA 4X6OA 4CRAA 4I32A 1CA8B 4D9RA 1DOJA 1DWCH 2BXUH 1EOJA 1O37A 2H5CA 4D76A 1ORFA 1GGDB 4GLYA 2GTBA 1K9OE 1RIWC 4NZQA 1NY22 1IQFA 1LVMA 2FYQA 2WPLS 2CF9H 3KN2A 4ABFA 1EAWA 3QLPH 5E2OA 3TNSA 3B8JA 1IHSH 5HM2A 4Y11E 2QN5T 2JETB 1VGCC 4BAQB 1CHOF 4WXVA 1MTWA 5DO4H 1C2KA 1FN8A 1JRTA 1O5DH 3RC6A 3RMOH 4O97A 2KAIA 3GISB 3SV2H 1GI0A 3LPRA 1GBIA 3MNCA 3KIDU 3SU5A 1J17T 1C1PA 1GI6A 1NZQH 1MKXK 2Z9JA 3RM0H 2ZGJA 3NZIA 1SLXB 1QRWA 4JYTA 1HV7A 1SB1H 2A2QH 4OGXA 1KSNA 4K1SA 4LXBH 3LH3A 5TJXA 1QBVH 4BAKB 2TGAA 1YCPK 2IJOB 3TLOA 5LPEA 1YCPM 1V2OT 4WXIA 3ZZ7A 3QTOH 1AVXA 2WV5A 5JDUB 6CHAB 1UCYE 2D1JA 1G3EA 4JMYA 1TPOA 1Z1JA 1AVGH 1DANH 2BLWA 1C1VH 1QY6A 3PMAB 3RDZA 2UUJB 2VH6A 2HLCA 4AFUA 4INKA 1MTSA 2OP9A 2SGQE 3QZRA 1UTQA 1O2IA 4Y8XA 4E7RG 3ATWA 4I8KA 2FZZA 1TNHA 3RLWH 2FODA 3RXCA 3O8BA 3OY5U 1HJ8A 3HATH 3DD2H 1Z6JH 1GBEA 1MU8B 5TCCA 3A85A 1P05A 1S6HA 2C8XB 2H5DA 5HXFA 1GJAB 4FUIA 2XW9A 1LO6A 3MMGA 1DICA 2ZFRH 1XXFA 1UVSH 4XBBA 3ATIA 3MU5A 4B73A 4JZEH 2ZF0H 3EYDA 5EODA 3RMLH 3EAJA 1O2LA 1GHXH 1TX8A 4AFZA 5EPNA 4LOYH 1NFWA 3D49H 5CE1A 4AYYB 1QL8A 5PTPA 5I25A 4WMDA 1C2MA 3T2NA 1Y3YA 2OBOA 2AH4X 2RCEA 3F9FA 1BTZA 3NPSA 1FUJA 1TMBH 2JKHA 1AKSB 1SGYE 4NWLA 1IQKA 3ELAH 1A3BH 3JZ2B 1QB1A 4A6LA 3D62A 4TWYA 2J38A 3P8GA 1D3TB 1ZMJA 1BB0B 4ZMAH 3SV9A 1RTKA 1YLCA 2BD7A 1WUNH 2FPZA 1AZZA 1LTOA 3A84A 1C9PA 1C9TA 2CV3A 3LGYA 3P95A 3K6ZA 5EQSA 2OBQA 2FYRA 1BA8B 1P57B 1O5AB 2UUFB 3ZZ4A 8LPRA 4HTCH 3PWCA 1ELEE 1YPEH 4BXSA 1YLDA 1A5IA 2Y81A 2ZCLP 3PO1C 3ATMA 1GJ8B 2B0FA 2XC5A 3QO6A 3TJVA 2R2MB 2G81E 4X2VA 1UVTH 3AASA 2J94A 2VGCC 5DJ7A 3BTME 1DFPA 3L33A 1G3BA 1BRAA 4DJZB 3UQVA 4BAHB 2XBYA 4MPXA 2FXRA 3GCNA 3HGNA 4Y79A 2WPIS 1THSH 1L2EA 1AHTH 1AN1E 3OY6U 2Z9IA 1O33A 1NRNH 1EPTC 1MTVA 1ZSKA 2BQ6B 2XCNA 1AB9B 1HDTH 4B76A 1PPGE 5EXNA 1QJ1B 2P16A 5AVDA 3ZVCA 3UWIA 1C4U2 2CN0H 1AFQC 1EQ9A 1GJ7B 3TPIZ 4XFQA 1BTUA 1T8MA 1GCDA 1LVYA 4MNWA 1J14A 2O8TA 1BMNH 1F7ZA 5G4BA 1K21H 4WH6A 1Z8JB 4AN7A 1NN6A 4U32A 3U98H 2TBSA 1S81A 2Z9GA 4KTSA 2ZIQH 4AFSA 4CR5A 8GCHF 1UTLM 3RU4D 1AQ7A 2QXHA 2BDHA 1V2UT 2BVRH 3A7YA 3VGCB 1Y3WA 1T8NA 3M5NA 1TALA 3M7TA 5FHTA 5C1UA 1GDNA 4HI3A 2GD4B 2ZA5A 3PLBA 2XWBI 1WSSH 3VXEH 1PPZA 1ZPCA 2UUYA 4B75A 4M7GA 1ELVA 1IQGA 2FMJA 2ZG0H 1NT1A 1FQ3A 1WTGH 1GI8B 1E37B 2RA3A 3M61U 4WVPE 4DG4A 2A5KA 2BTCE 4VGCB 4X0WU 1QIXB 1SFQB 3ZYEA 1ZPZA 1J9CH 3TGKE 1HAYB 1O3KA 1YPHC 1N8OC 4TY7A 3I29A 2AMPA 2XNIA 2OLGA 1C2IA 1V2KT 3ZZ3A 1DXPA 1EJMA 2BZAA 1SGDE 2BX4A 4Y8ZA 2FOHA 1MZDA 1V2ST 1O2QA 5FPYA 1CBWC 1M9UA 4FU8A 2FIRH 1W0ZU 1NC6A 1PQ5A 3T25A 1XM1A 2V6NA 2XCFA 1L1JA 4NSYA 1P9UA 1TBRH 4K5ZA 1UTOA 1LPKB 3LT3A 1AI8H 2ZP0H 2AGIX 3MU1A 2ZFPH 1XXDA 1GI5A 1V2VT 1CSOE 1QRXA 2ZU2A 3RU4E 3PB1E 1QURH 1C2FA 4DVAU 1EAUA