1QR3E

Structure of porcine pancreatic elastase in complex with fr901277, a novel macrocyclic inhibitor of elastases at 1.6 angstrom resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE 1
publication title Structure of porcine pancreatic elastase complexed with FR901277, a novel macrocyclic inhibitor of elastases, at 1.6 A resolution.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1999-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qr3E02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qr3E01
1OWHA 5ABWA 1NROH 3HPTB 2ZGBH 1GGDB 1ZJKA 3BTWE 3W95A 1HAPH 1UVSH 1DFPA 1NRRH 2JH5D 1WCZA 1SQAA 4GCHG 4I31A 1INCA 2HGTH 3TLOA 2J92A 4K3JA 1HAYB 1YM0A 3HK3B 4A1XA 2HRVA 4JZFH 3FAOA 1IHSH 1QBVH 3T5FH 2UWOA 1CHOF 1SGIB 6GCHF 1Z6EA 4X6PA 2ANWA 4NIYA 3AVZA 1C2FA 4Y11E 5DP8A 1NFUA 1GJDB 2ULLA 2PKSC 2ZTYA 3LOXA 1YPEH 4LOYH 1AN1E 1HNEE 1C2MA 1EUFA 3RMNH 1BMLA 4B2CA 1GG6B 4K1EA 2G81E 4DY7B 1GJ6A 5EW2H 1O3NA 3BTGE 3BTME 3RXPA 1UTOA 2THFB 3PB1E 3TPIZ 2GZ9A 4AFZA 3ZZDA 3OY5U 1A0HB 2FX4A 3BG4C 1O3AA 5E0GA 4AGJA 5C67A 1A1RA 5C1UA 1A3EH 1S81A 1GHWH 2AGIX 2ZI2H 3SGQE 1TABE 3SUEA 1D6WA 1YPHC 2VIDA 4OS7A 2AERH 2AGGX 1TOMH 1QJ6B 4BAHB 1C9PA 2SGEE 3SV9A 1F0UA 1HJAC 1LQEA 1LPZB 2FO9A 3PO1B 1PPZA 1OSSA 3A7YA 1ZTJA 2QXGA 1DOJA 3UPEA 1NC6A 4CRGA 1H9LB 3OYPA 3SU1A 1E37B 1K1NA 3UY9A 4ISHH 3E16B 4ZAEA 3H7OA 1HAGE 2OUAA 4CBNA 2A7HA 1TFXA 1GVZA 1TYNA 2ZG0H 3BIUH 2ZZUH 5HM9A 5L2ZH 2VH0A 4YO9A 1UCYK 1FY4A 1HAVB 2OD3B 4A6LA 1LHDH 2BDBA 3TU7H 1RTLA 1UK4A 1HJ8A 3I29A 3BTTE 1AUJA 3GCOA 1Y3VA 1HAOH 1KXFA 5A8XA 1O3FA 4ABEA 4FUDA 3KL6A 4O9VA 3GDVA 4ASHA 4Y0YE 4H42U 3E90B 1K22H 4AFQA 2G55A 1O2VA 1GHBF 3FFGA 1SOZA 4TY6A 4AYYB 3P8NA 1D3QB 2OXSA 2ZNKH 1C5TA 4ABAA 3SHCH 2OQUA 1C1SA 2Z94A 3BEFB 5DK1A 1ELTA 1F0TA 3RXGA 1AQ7A 1ZSKA 4K1TA 1O3GA 1G2MA 3UOPA 2BD3A 1G3EA 1PPEE 4Y10E 1RD3B 5DG6A 1C2EA 1EZUC 3RXFA 1CHGA 2TRMA 3T26A 1L4ZA 1SGFA 1K1JA 2PGBB 5LGOA 2GKVE 1O2TA 4FU8A 1JBUH 1C5MD 3MO9A 8KME2 3GCTG 1TX6A 1EOJA 2BQ7B 1K1MA 3RXAA 1TQ7B 4IN2A 4FU7A 2QXHA 4GAWA 2A5KA 1G3BA 5C3NA 4NZLA 1B7XB 3QO6A 3MYWA 3MU4A 1RS0A 1N8OC 3F6UH 2H9HA 2QGRA 4GLYA 2Y6TA 1NO9H 3ATLA 3P6ZB 3EQ0H 3TK9A 1P2OA 2BMGB 2CJIA 8LPRA 1RIWB 1VGCB 2ZCHP 2AYWA 1OP8A 4I32A 1BJUA 2H5DA 4Y76A 3SJKA 3ZZ6A 1QRXA 2QCYA 1BUIA 1LDTT 1CVWH 4JYUH 2BLWA 2A32A 2XTTB 1UVUH 1YYY1 2JETB 2BHGA 2Y5GA 3T62A 1CBWB 5A0CA 7KMEH 1KTTB 1FY8E 2BY6X 3D65E 3BEUA 1EPTA 1OX1A 3RU4T 4LK4A 1PJPA 4IW4E 4LZ1H 4D9QA 1YCPK 1O3KA 4LXBH 1EP6A 1JIRA 2P3FH 1AU8A 3ITIA 4DVAU 2PWXA 3UTUH 1ZPZA 4A1VA 1OWIA 1WBGB 2BDIA 1MBMA 1UTPA 2EC9H 1MTVA 3GY6A 2VWNA 3MU0A 1BB0B 1V2QT 1MZDA 4X6OA 1TLDA 2FESH 2XW9A 3OTJE 2GCHG 1QIXB 5J4QA 3K65B 1OS8A 2PV9B 3T2NA 1CQQA 1EX3A 1LKBA 4AGKA 2VVCA 3RXCA 4RN6A 2SNWA 4B76A 4B71A 4F49A 1O2MA 2VVVA 2BDYA 1O2YA 2CV3A 1ANDA 2J94A 3IG6B 1D9IA 1HUTH 3E3TA 3PLKA 5T6DA 1EAXA 1GDUA 1GCTB 2ESTE 3TVJB 2FI4E 2EI8A 1VZQH 2VIOA 1G30B 1THSH 4RSPA 2NU1E 3RC4A 1XX9A 1S85A 5H4IB 5EODA 3VEQB 3S69A 3KHVA 3RLYH 1EAUA 1F5RA 4XFQA 2EEKA 3RC6A 3M3SA 2O8MA 2O8UA 5A8YA 1GHZA 5E0JA 3TGIE 5FPTA 2ZDNA 4ABFA 1SLUB 1SGYE 4X2VA 2HNTC 4KELA 1WQSA 1QCPA 1DE7H 2ZU1A 5DP9A 2GD4B 2ZDLA 3SQEE 3VXFH 1P8VC 3TGKE 3SNEA 2PKAA 2W7SA 3K6ZA 3EYDA 1O37A 1Z6JH 3M5NA 4JYVH 3E8LA 1CT4E 1HXEH 2ZFSA 3PMAB 1GVLA 2XRCA 4E7NA 4FU9A 1GJ4H 3A87A 2FODA 1ZGIA 1D4PB 3P95A 4Y6DA 1HYLA 2J2UA 3P70B 5BPEA 5DP7A 1Z1JA 2V3OH 5G4BA 7LPRA 1F92A 1NZQH 1UMAH 1ZZZA 3GYLB 4UD9H 1MAXA 4X2XA 2F9OA 2ZDMA 3LJJA 4TWWA 1O2OA 2XC0A 1MD7A 1M9UA 2SGQE 4WH6A 3K6YA 2PSXA 1ACBE 1NRSH 1O3LA 1Q2WA 4Y0ZE 4MNXA 1DXWA 3NZIA 1GWAA 2GCTC 1BIOA 2ODYB 2ZHQH 1FJSA 1S82A 1V2ST 2ZCLP 3STIA 5TCCA 3SJ8A 2CF8H 2A0QB 5F8XA 5GDSH 1G2LA 2P8OC 1AIXH 1F0RA 3UUZA 1UVTH 3GY8A 1NFWA 1OKXA 3T29A 1L4DA 1HAXB 1S6HA 1F5KU 4WWYA 3HATH 3TJUA 4NA7A 4A92A 2AMQA 3SUDA 3BTDE 1JMOH 2V3HH 2GT8A 3UREA 1P2QA 5FBIA 3GOVB 1C5XB 2FI5E 3GICB 1TE0A 1NN6A 1BRBE 4ZXYH 2H9TH 1GJ9B 1GBJA 1UTJA 2BLVA 1V2VT 3ELAH 1MCTA 1P3EA 4TPIZ 4D76A 4Y8ZA 4HTCH 2GMTB 4XBBA 2CHAC 3I77A 1VCPA 3V13A 1GI7B 7GCHG 2ZEBA 4AZ2B 1BHXF 4UFGH 6CHAC 3S9BA 2BLQA 1Z71A 1O2KA 2LPRA 4BTUB 1AZZA 1ELCA 2O9QA 3HKJB 3M7UA 4Q7XA 2AMDA 1UTQA 1O3HA 1Y8TA 2AEIH 5AF9H 1SQTA 1IOEA 1EPTB 1WOFA 1CGJE 3FP7E 2ZHFH 1TPPA 2ZECA 1T31A 4ABIA 1FQ3A 4JZ1A 1C2IA 5JB8S 2BD4A 2VWOA 3PLPA 1IQFA 1GBIA 4X1PU 2W5EA 4YM9A 2UWLA 3E91A 1O2SA 1O3PB 1GBHA 1BQYA 1DSUA 1WTGH 3B9FH 4KGAA 2RG3A 2G5NA 2I6SA 1P2IA 1SHYA 1CU1A 4CH2B 3D49H 2UUKB 4Y71A 1XVMA 2DUCA 3HGPA 3MNXA 2FOGA 1GBKA 2A7JA 3MH4A 1GBAA 1TQ0B 1GI9B 2BD5A 1IQKA 3ZYEA 7ESTE 1PPGE 1BDAA 1W8BH 4AX9H 1W12U 5ESTE 2ZQ1A 1TRMA 1YPGH 3ZYDA 4UDWH 4UFFH 1AB9C 4ZKSU 5EPYA 1O35A 1D3TB 1E36B 3GCHB 3LJOA 3M36A 2BOHB 1LPGB 2D26C 1O2JA 2TGTA 1GHVH 1EQ9A 4YESB 1XUFA 1Z1IA 1MTNC 3E0NB 1D3PB 3W94A 3STJA 3ZZ4A 2A2QH 2YOLA 2ZPSA 4ABDA 1LCYA 1GMDF 4BAMB 2ZO3H 1ETTH 1G3DA 2A7CA 3BTFE 3MMGA 2SFAA 2Z6BD 4FUFA 4B1TA 2V35A 2NU4E 4UONA 3SN8A 3LONA 3QTVH 3Q76A 1GJ7B 3LC3A 2QN5T 2HPPH 4CREA 2PKAB 4NIXA 1UK2A 3ZZAA 2D8WA 1G32B 1MBQA 2WPHS 2VINA 4NSYA 2Q6DA 1DWBH 1QURH 2A1DB 1Z8RA 3FZZA 4I8KA 3V0XA 1TX8A 8GCHF 3RU4E 4O97A 4K8BA 1ZOMA 4XBCA 4BTIB 1C4V2 1QJ1B 1ORFA 1ELGA 2A4GA 1C5QA 2EI7A 3SBKA 4AG1A 5T6GA 2BD9A 3L6PA 3RDZA 2ZP0H 3TH4H 5JYIA 3UNQA 4LZ4B 1C2JA 2BDCA 1NFYA 4FVDA 5JBAS 3GISB 1QB9A 1GDNA 2IOTA 1SMFE 2K1QA 1JRSA 1TALA 2M5TA 3EA7A 3NWUA 1P03A 2PSYA 2QYIA 3MNCA 2AS9A 3GY4A 4NA9H 1LHFH 3IITA 2BLOA 1Y3YA 4B2AA 4ISIH 5CE1A 2VIWA 3AAUA 4H6TA 2FPZA 1VITG 1O3OA 2FTMA 3QLPH 1SGFG 1KXCA 4NZQA 1D6RA 1C2LA 3DD2H 1EATA 2Y81A 3F9FA 3GDSA 4RKJB 1XMNB 3H7TA 4X2WA 1FY1A 1SGPE 1YC0A 1UTMA 2ZIQH 3HK6B 4ZHMU 1QRZA 4NSVA 1QTFA 1GMCF 3AW0A 3KN2A 2ZHDA 9ESTA 1N6XA 3SV2H 1AFQC 2GV7A 1YPJH 1GBEA 3VGCC 4CRAA 1O2NA 2BDHA 4NG9H 2C8ZB 4Q80A 2Q6GA 4CHAC 4JZDH 5C1XA 2A2XH 2BX3A 3MI4A 3ZVCA 2F9NA 1ANEA 1HCGA 1SL3A 1W14U 2FS8A 1HAHH 3S7HB 1C1MA 5GXPA 2H5CA 3FZDA 4JYTA 5FXLA 1N6YA 1TRYA 2R0LA 1GHAF 1GI3A 2BXTH 3Q3XA 3RXJA 1PFXC 1DITH 3TNSA 4SGAE 1EZSC 2F9VA 1J17T 1E35B 1C1QA 1DUEA 2FOMB 3QTOH 1GGDC 2PUXB 3MH7A 1ABIH 1KXEA 2W7UA 4WY3A 1SR5C 1O2HA 3G01A 1C5OH 1BRCE 2ASUB 1ZPCA 3SU0A 1TA6A 3A7VA 1O34A 3S0NA 1V2OT 1GHBG 3MU8A 3C27B 1YF4A 3MNBA 5AVDA 1W0ZU 1A0JA 3RXQA 2Z9JA 3CS7A 3O8DA 1HBTH 1DXPA 5JBTA 1DT2A 3BF6H 1F2SE 5EPNA 3E6PH 1TIOA 1Y3WA 1J15A 2FS9A 1PQAA 1GG6C 5AHGH 4FUJA 1BRAA 2PHBA 3FVFB 3A84A 4OS6A 1NRPH 1P2NA 1C2HA 2XCNA 3LGIA 1AO5A 3PMJA 3RMOH 3S9CA 1TPAE 5EG4A 4ZHAA 4ABJA 2EA3A 3A8BA 4JK5A 1WU1A 1V2MT 2R2MB 3M35A 4GCHF 1F5LA 1T32A 2VU8E 4X1RU 1KLJH 2UWPA 1BHXB 1FUJA 1MQ6A 5GIBA 4OS5A 1C2DA 3LU9B 3DFLA 3UQOA 2DE9A 2QIQA 2P93A 4ZKNU 4ABHA 1JOUB 1O3CA 2J34A 2W3IA 5C20A 1S0QA 2FXRA 2NU2E 4R8TB 2VIQA 4OGXA 1CT0E 1MCVA 1F7ZA 3RM2H 3PO1C 2ILNA 4ZH8A 2BD7A 4KKDA 4M7GA 1FIWA 1O39A 3KQCA 1O2GH 3UQVA 2ZDAH 2Z3DA 1C1PA 3LGWA 4MPXA 1BTHH 1WYKA 4A7IB 1ZR0A 1GI6A 1AE5A 1ZSLA 1IQMA 2A4OA 3RMLH 5FBEA 3N7OA 1TMTH 2BX4A 1LPKB 1TGTA 2G00A 1L2EA 2XC4A 4U01A 1Z7KA 6ESTA 5LH8A 1YPHE 4O3UA 1TBZH 4J1YA 1VCWA 2VGCC 3GDUA 1GMHG 3RMMH 1FONA 3ATKA 1S84A 4KP0A 4XDEA 3CP7A 5TCAA 3RM0H 3SJIA 1NY22 4DCDA 4XE4A 4DW2U 1P12E 4WVPE 1P05A 2BZ6H 2VIPA 1IQEA 3RLWH 3U1IB 3VB4A 1K1OA 3A89A 1KLTA 1O3BA 3O8BA 3VFEA 1EXFA 3LDXH 1P11E 3ZZ9A 3P8FA 3SV7A 2OQ5A 1NFXA 1UJ1A 2HVXA 1O3IA 4IC6A 2J9NA 1A7SA 1IQNA 1P10A 3RXUA 4JCNA 4IS5A 2H6MA 2FEQH 2WYGA 4CBOA 1YGCH 1TB6H 2RA0A 1GI0A 3RXSA 2OC0A 1HXFH 1A5GH 2FLBH 4BXWA 1C4U2 1ZRBA 1MKWH 1YPMH 1ABJH 3RXLA 4MTBA 2Y7XA 1FY5A 2QC2A 3R3GB 3E1XB 3EE0B 2OC8A 2ZGCA 3O8RA 1GBFA 3U98H 2ZCKP 1V2WT 3KNXA 5EQRA 2BY7X 1QQ4A 1JWTA 1QL9A 2PUQH 4NGAH 1AD8H 1P2KA 3RXIA 4AORA 4I33A 5GPIB 1O3MA 1K28D 1TAWA 2GDDA 1ESTA 2JETC 2ODQA 2G4TA 1YBWA 1CBWC 1C9TA 1HDTH 2FIRH 3QZRA 4HGCA 4TPYA 3SHAH 2BB4A 2SGAA 1HFDA 1P09A 1GI1A 1O5BB 1SSXA 2A5IA 1BCUH 1O2QA 4YLUA 3RXBA 5JB9S 3RXRA 1L1JA 3RXTA 3QN7A 1WAYB 1TGBA 4ABBA 3T28A 3CENA 1X7AC 1LMWB 2ZQ2A 5L2YH 3FANA 4J2YB 3R0FA 1Z8IB 2OBQA 4X2YA 1S83A 1BTZA 1PPFE 5GCHF 4R0IA 2A45B 3NPSA 1BZXE 1SGNE 1KTSB 4ZUHA 3TJNA 1Y5UT 3QWCH 4A1TA 4E7RG 2BDGA 1GCDA 1DWDH 1QFKH 1O5EH 5I25A 1FN8A 1IQGA 1TRNA 1C4Y2 3SNCA 1RJXB 4FUBA 1FAXA 4VGCC 1YLDA 3KQEA 1AMHA 5A8ZA 5IYTA 2FOBA 2Z9GA 5F03A 1GI5A 4X1QU 3U8RH 1MTUA 5FCRA 3UR6A 1VCQA 2FZZA 3I78A 4CR5A 1WUNH 5C1YA 2GZ7A 1SOTA 4DG4A 2IJOB 1C2KA 3VB3A 3SU2A 1GCTC 1NPMA 1ZTLA 1TPOA 5A0AE 4B75A 2P16A 2XNIA 2ANYA 1FPHH 1LVMA 1TA2A 3Q77A 1A5HA 2GCHF 1C5SA 2XXLA 5LPRA 4OS4A 5ETXA 5CMXH 1V2NT 3SU6A 3RP2A 2F9UA 2OLGA 2AIPA 1OYTH 1W7GH 1V2RT 1Y5AT 3LC5A 4TYDA 3F9EA 1E34B 2D2DA 1TNLA 4BAOB 1V2KT 4Y7BA 3MOCA 2FOFA 2G8TA 3U69H 1GJBB 1THPB 1QL8A 5EXLA 4CH8B 1KSNA 3SV8A 1O3DA 2QV1A 1WSSH 2PW8H 1GDQA 1AFEH 1UVPA 1V2PT 3M61U 1NESE 1HLTH 1G36A 3LGTA 1BTPA 1THRH 2Z9LA 3MWIU 5JDUB 2VNTA 3VB5A 4X0WU 2ZU3A 4X8VH 3E0PB 3SORA 1O5GH 2ZGHA 2GT7A 2P94A 1IQLA 2HNTE 4AB8A 1O5FH 2AIQA 4AB9A 4BNRA 4CRBA 2A5AA 4DJZB 1PPBH 3A7XA 1T4VH 1LVBA 1BITA 2F9PA 2UUYA 1W7XH 1DLEA 2WPIS 1VITH 2FP7B 1SLXB 1RTFB 3RXOA 1MUEB 5J4SA 4CR9A 1C1UH 1EZQA 2VH6A 2P3UB 1YPKH 3ZVEA 2SGFE 1SGDE 3RXHA 2ZU2A 1AWHB 3M37A 4ESTE 1OYQA 2V6NA 3RUOA 2ZTXA 4FUCA 1LKAA 2FI3E 1CA8B 1C2GA 1ESAA 2C93B 3HKIB 1C5LH 1HRTH 2J95A 2BQ6B 3VPKA 2GVFA 4MNYA 2WINI 4BOHA 1HIAA 2GMTC 3BTEE 4NCYA 2AFQB 2TGAA 3MO6A 4NWKA 4X1NU 4X6NA 1JXPA 4YTAA 3ZV9A 2H2ZA 5EXNA 3U8OH 2CF9H 2WV5A 2BYAX 3TH3H 1XUJA 4YOGA 8GCHG 5JBCS 2ZDKA 4WMFA 3GY2A 5FAHA 1O2WA 2VWLA 1DVAH 1QY6A 1EPTC 3L33A 1OXGA 1CA0C 1OWEA 2AMPA 2VWMA 3SGBE 3SUGA 1EASA 4Q7ZA 1Q31A 2CMYA 2SGDE 3DT0H 3M3VA 4FUGA 1TNGA 1O31A 1OWDA 2FOAA 3A82A 5GWZA 1H9HE 3S9AA 1AKSB 2VVUA 1SGEE 1GJCB 3V7TA 2ZKSA 2EI6A 4GHQA 5EGMA 2BD8A 2H1UA 4BXSA 4U32A 3UIRA 2BVXH 4A5TS 1O38A 5SGAE 1T8MA 2F9BH 3A80A 7GCHF 2GZ8A 2TGPZ 3EDXB 4JK6A 5T3HA 1VJ9U 1C1TA 3A7ZA 1MKWK 1P2JA 5I46H 1UTKA 3KQDA 1AHTH 3GCNA 2FTLE 2BD2A 1OWJA 1HB0B 5DKMA 1FN6A 4Y8YA 4MPUA 4YOIA 1C5RA 3GY3A 5IDKA 1DY9A 1DSTA 1Z8JB 3U9AH 5FX5A 4I7YH 3GCHC 4DIHH 1HPGA 5JBBS 1C5ZB 1GHXH 1S0RA 2C90B 1TBQH 3MFJA 1BA8B 1K2I1 2FOCA 4K60A 4O03A 2C4FH 4ZKOU 1Y3UA 1PPHE 2WPLS 5K0HA 1H8IH 5AFYH 1XM1A 1PYTD 3BEIB 1DY8A 4H6SB 4AN7A 2Y82A 1LHCH 4HI3A 5HGGA 3NK8A 2Z3CA 1P06A 3URCA 1CHOG 1CT2E 2G51A 6GCHG 1OWKA 3NUMA 1T4UH 1KYNA 3QGJA 1AI8H 1T7CA 3RXMA 1DICA 3F68H 3JZ1B 1O2UA 2ZFTA 3A85A 1EAIA 2QXJA 5CHAC 1Y3XA 1ZHMA 1A5IA 1K1PA 3LT3A 1MU8B 1Z8GA 2OTVA 1TBRH 3GY5A 3NCLA 1QGFA 3BIVH 1QL7A 4UFEH 5DP5A 3TJOA 3UR9A 3SZNA 3V12A 3BN9A 5EOKA 1W13U 2HNTF 1O36A 4WXIA 4ISNA 3ZV8A 1V2UT 2P3TB 4CRCA 5FX6A 3QX5H 2IPHA 1T8OA 3DHKH 1SLWB 1SB1H 1IHTH 3KEEA 3LPRA 2HPQH 1C5PA 3VGCB 1DS2E 2QY0B 1W0YH 2JH6D 1A2CH 1IQHA 1GI8B 4B2BA 5E2PA 4FUHA 2VB0A 5F8ZA 1GBBA 4E06H 5B6OA 1GBDA 1MAYA 2PKSB 2WV4A 1MZAA 2XCFA 4DGJA 1P9SA 1AGJA 4YT6H 3PTBA 2BZAA 4KTUA 1XKAC 3DUXH 1GI4A 2BOKA 2R3UA 3OSYA 5HXFA 3TIUA 2GGVB 3RU4D 1KIGH 4SGBE 1IQJA 2F83A 3CS0A 4X8TH 1C1OA 1TGSZ 1ELDE 1GBTA 4AG2A 4AYVB 2QA9E 2HWLB 3ZZ3A 1ELBA 4X8SH 2BQWB 1P9UA 2ZTZA 4I8LA 4H4FA 5F6MA 1Y5BT 1TWXB 3BG4B 5TJXA 4YOJA 1ZHPA 1O5DH 1BBRH 3P8GA 4IMQA 3RXDA 2ZU5A 3ENSB 2STAE 5C5NA 2SNVA 1O2ZA 3DFJA 4DIIH 1J8AA 3SW2B 4TWYA 3KIDU 4ABGA 2FWWA 1HIAB 3BTHE 2OINA 2XBXA 1WQVH 1MTWA 2P95A 1QBNA 1V2LT 1FV9A 1IAUA 1HJAB 2PTCE 2P59A 6LPRA 4UE7H 3UOUA 1RRKA 2I6QA 2WPJS 2AGEX 1FIZA 1VJAU 3BSQA 5C2ZA 1AWFH 4BANB 2SGPE 3TK5A 3AASA 1K1IA 1EB1H 2FOEA 3VB7A 2B9LA 1QBOA 3PM3A 1XUKA 1MU6B 2RDLA 1TNIA 4U30A 1VITF 2V0BA 3BG8A 1C5VA 1MH0A 1TGNA 4Q7YA 1RGQA 3PV4A 3ZVFA 1ZMLA 4K8YA 2BVSH 1BTWA 2OBOA 1SLVB 2BTCE 4TY7A 1DLKB 3ODDA 1H9IE 3LH3A 1O33A 3SI4H 3A7WA 1UHBA 2GX4A 3P8OA 3KQBA 1W3CA 3A86A 4X1SU 1NT1A 4KTSA 4ZMAH 1A3BH 4INLA 3ZZCA 1O30A 4FUEA 1O2LA 4JZEH 4IC5A 3QK1A 1LVOA 3C1KA 1BBRE 3SI3H 1G37A 1SGQE 2TIOA 1TOCB 1L1NA 3ZVBA 2O8TA 1XXFA 4BAQB 3PMHB 3QGNB 1A0LA 1ANBA 1BRUP 1W2KH 4MPWA 3D23A 1C5WB 3SV6A 2PLXA 1ZMNA 1H8DH 4NIVA 4Y7AA 1XKBC 2GV6A 4O3TA 5L30H 4D7FA 2KAIB 2FX6A 2HOBA 1JRTA 3F1SB 2VGCB 1K9OE 1C1VH 4Z0KA 1ZPBA 9LPRA 2XBYA 4CRFA 2ZU4A 1ZMJA 1LQDB 4IGDA 2PTNA 1QB6A 5DJ7A 3F9GA 3M7TA 2C3SA 1YP9A 2A31A 2ZFPH 1PQ7A 4ZHLU 3SO3A 1C1WH 5HMAA 2BXUH 1TNKA 1C5YB 4GUXA 1SFQB 3BTKE 1MKXH 1N8OB 4DT7B 1A46H 1H4WA 3T25A 3GYMA 1O5CB 1E38B 3A8CA 1HV7A 1SGTA 4AFSA 1DANH 1ZTKA 1ELVA 4JZIA 3H5CB 2XWBI 4XOJA 1TX7A 1P01A 4NWLA 1ZHRA 2Y5HA 1AVXA 2QAAA 2GP9B 1GBLA 2AH4X 3HGNA 1B5GH 1V2JT 3TH2H 8ESTE 2FM2A 1ETSH 4FVBA 3GY7A 1AZ8A 4F4OC 2YNBA 4K1SA 4MG3A 2WYJA 1B0FA 1DPOA 3MHWU 2Z7FE 3NKKA 1BMNH 1XUGA 4ISLA 4YZUA 5DPAA 1HAIH 1NU7B 2ZF0H 4D8NA 1P3CA 1KDQB 1HAZB 1AVWA 1CGHA 3SJ9A 4GHTA 5PTPA 1ID5H 3TJVA 3A8AA 3A8DA 1ELEE 1C5UA 1UTLM 4Y79A 3UWJH 1V6DA 1MTSA 2PGQB 1O3JA 3OU0A 5GCHG 4E05H 1BTUA 1FPCH 5A2MH 5AFZH 2ZHEH 3RXKA 3ZZ7A 2ZFFH 2R2WU 3M5MA 1LTOA 2B5TB 2Y7ZA 3VXEH 1O3EA 2Q1JA 1O5AB 1FLEE 4XSKU 5C5OA 1QA0A 4WXVA 2OC1A 4CRDA 1P57B 3SUFA 4DURA 1GHYH 4BTTB 1RIWC 1VGCC 5E0HA 3ZZ8A 1YKTA 2RA3A 2B0FA 1MQ5A 1GMHF 2G52A 3AW1A 2QF0A 2F3CE 1LHEH 3GCTF 4ZROA 2ZGXH 2B8OH 1EB2A 4OGYA 3LH1A 4B73A 3MTYA 4MVNA 1UTNA 1V2TT 2YNAA 5EQSA 4ZXXH 3B23B 3OY6U 3MU1A 4WJG2 2HALA 3TNTA 4WH8A 1KXAA 1YPLH 2ALPA 1OOKB 4VGCB 3JZ2B 1AKSA 3O8CA 4K69A 1LHGH 1ARBA 3LGUA 4Q2KA 3K9XB 1Q3XA 2FMJA 1UHBB 1FZZA 2ZFRH 5EXMA 2QXIA 2A4QA 3ATMA 1EP5A 4QT8C 2XYAA 5EQQA 3PMBB 2NU0E 1Y59T 1MMJN 3LKWA 1FMGA 1E0FD 4Y8XA 3UNRA 4K5ZA 4B74A 1CGIE 1ELFA 3PTNA 2NU3E 4MQAA 3PLBA 4I8GA 3S7KB 4IMZA 4X8UH 1DWEH 2R3YA 3KGPA 1OP2A 2WUBA 1BBRK 2H9EH 1L1GA 1TMUH 1AVGH 4K2YA 1NU9A 1J9CH 3M7QA 5HYOA 1AUTC 3U8TH 1N1LA 1EOLA 1U6QA 3T27A 2GCTB 3ESTA 4MNWA 1KY9A 3U1JB 5K7RA 3MH6A 2J4IA 1ZJDA 1UO6A 1RTKA 4GPGA 2P8OB 1O32A 1QHRB 1V3XA 2ALVA 1EJNA 3QDZB 4THNH 3ODFA 4I8HA 1AY6H 1QB1A 1BJVA 1XUHA 3SU4A 5FCKA 1AE8H 2BM2A 4WMDA 3LIWA 2PR3A 1ELAA 5L6NH 1SFIA 1ZRKA 4HZHA 5GJ4B 1OPHB 5FPYA 5EW1H 1J16A 1NTPA 1IQIA 1SG8B 1ZYOA 1KXDA 2NWNA 2PFEA 4UFDH 1TNHA 3D62A 1P04A 1L0ZA 2XC5A 3SJOA 5T6FA 3PWCA 1TPSA 1H1BA 2C8YB 2BY9X 2JKHA 2CHAB 4JMYA 1ZGVA 3ATWA 3WY8A 6CHAB 1DWCH 3M3TA 3SOSA 3EA8A 3SU5A 5F8TA 3Q00A 1W10U 1S6FA 5HM2A 1K1LA 3M5LA 3RXVA 1PYTC 4IBLH 3SU3A 3EGKH 3SQHE 1FY3A 2ANMH 3NXPA 4INKA 3IWMA 2GDEH 1QNJA 2VIVA 1SBWA 1C1RA 1TNJA 2G4UA 3SNBA 1HJ9A 2FLRH 4GVUA 2XWAA 2CXVA 2IN2A 3QUMP 2WPMS 2GTBA 1F0SA 3ZVAA 2C8WB 1NM6A 2BVRH 4MDSA 2Z3EA 3ZZBA 1GJ8B 3FP8E 1SC8U 3DA9B 4XBDA 1D3DB 1BTXA 3A83A 2OP9A 2OC7A 1QA7A 3LGVA 2JH0D 1GMDG 2FYRA 3PYHA 3Q3YA 5FHTA 5A0BA 1GPZA 1JIMA 1ANCA 3KCGH 4YT7H 1AB9B 1TMBH 1SGCA 2R0KA 1CA0B 2XBVA 1BMMH 2Y5FA 3MH5A 1SVPA 1MKXK 3SNAA 1T8LA 1UCYH 1SPJA 4ISOA 1CE5A 2ANKH 5LPEA 2W26A 1DDJA 3L3TA 2STBE 4NFFA 2Y80A 4AOQA 2ZGJA 4FUIA 4Z6AH 1ESBA 3PWBA 5FPSA 2FYQA 1OP0A 4PROA 2HLCA 4WMEA 1G9IE 2TBSA 1MTNB 2ZFQH 3RC5A 1NS3A 1YCPM 2O8LA 1SGRE 1RFNA 1EJAA 2ZDVH 3RXEA 1GL1A 2BDAA 1B0EA 2Z9KA 5ESBA 2C8XB 1GBCA 1GL0E 2DE8A 1O2XA 3F9HA 4MNVA 2BY8X 1DM4B 4DOQA 3A88A 1PQ5A 4FXGH 2W3KA 1DX5M 1MD8A 1XUIA 1CO7E 5DGJA 5E2OA 1K21H 1TGCA 1GI2A 2TPIZ 1O0DH 2A4RA 5E8EH 2B7DH 1QQUA 2XBWA 1J14A 1NRNH 1PPCE 1FAKH 4HFPB 4U2WA 1ZLRA 1ZSJA 2FDAA 1SQOA 2ZPQA 4X6MA 5LPFA 4IN1A 1GVKB 1HGTH 4MPVA 2O8WA 2ZHWH 1RXPA 5DO4H 4UEHH 3UFAA 2ZA5A 1EKBB 1GBMA 1BTYA 1P02A 3UNSA 3VB6A 1A61H 1FNIA 1DUAA 1UCYE 3SNDA 1P2MA 2CGAA 2F91A 2ZPRA 3MO3A 1EJMA 1A4WH 2WUCA 5A09A 1HAVA 1WV7H 2BY5X 2TGDA 3P92A 3V3MA 4I8JA 1GJAB 3Q3KA 4OS2A 3EA9A 3SGAE 3PROA 2KAIA 1QJ7B 3UWIA 1GMCG 3BTQE 3KF2A 5CHAB 3B8JA 3A7TA 3QZQA 4MLFB 1KLIH 2D1JA 1FDPA 2Z9IA 1BOQA 3K2UA 3TGJE 1O2RA 1LO6A 5EU8A 1FXYA 1FI8A 1G3CA 2QF3A 2G5VA 5DP6A 4WF8A 2LNCA 3MU5A 4KTCA 1ARCA 5JPMH 4BAKB 1UK3A 2OCVB 3ZVDA 3P17H 1SI5H 1YCPH 1VR1H 2J38A 2UUJB 1O2IA 4NFEA 2FOHA 2CN0H 1BMAA 1GHAG 1BT7A 3BV9B 4GSOA 1EZXC 1QR3E 5BRRE 1T8NA 3ZVGA 1UVOA 3OX7U 1QRWA 1PQ8A 1S5SA 4NIWA 3ATIA 3TITA 3AAVA 4D9RA 4RKOB 5DP3A 1AFQB 3FP6E 1TONA 2ZC9H 5DP4A 4CHAB 1NRQH 2ZWLH 1O2PA 3MNSA 1ETRH 1LVYA 1KXBA 3ZZ5A 1EAWA 1XVOA 4INHA 3TK6A 4ZKRU 1SHHB 1GJ5H 2R9PA 4AFUA 1W11U 1YLCA 4D7GA 3M5OA 1C1NA 2VJ1A 1CSOE 2WPKS 2RCEA 3LGYA 4OS1A 1P0SH 2Q6FA 3EAJA 1C5NH 2UUFB 4YLQH 3URDA 1KDQA 3A81A 2ODPA 1XXDA 4NA8A 1WTHD
chains in the Genus database with same CATH superfamily
1OWHA 4F48B 5ABWA 3PRBA 1NROH 3F0OA 3HPTB 2ZGBH 1GGDB 1ZJKA 3BTWE 3W95A 1HAPH 1UVSH 4TT3D 1DFPA 1NRRH 2JH5D 1WCZA 1SQAA 4GCHG 4I31A 1INCA 2HGTH 3TLOA 2J92A 4K3JA 1HAYB 1YM0A 3HK3B 4A1XA 1COWD 2HRVA 4JZFH 3FAOA 1IHSH 1QBVH 3T5FH 2UWOA 1CHOF 1SGIB 6GCHF 1Z6EA 4X6PA 2ANWA 4NIYA 3AVZA 3F2GA 1C2FA 4Y11E 5DP8A 1NFUA 1GJDB 2ULLA 2PKSC 2ZTYA 3LOXA 1YPEH 4LOYH 1AN1E 1HNEE 1C2MA 1EUFA 3RMNH 1BMLA 4B2CA 1GG6B 4K1EA 2G81E 4DY7B 1GJ6A 5EW2H 1O3NA 3BTGE 3BTME 3RXPA 1UTOA 2THFB 3PB1E 4YXWD 3TPIZ 2GZ9A 4AFZA 3ZZDA 3AK5A 3OY5U 1A0HB 2FX4A 2AHME 3BG4C 1O3AA 5E0GA 4AGJA 5C67A 1A1RA 5C1UA 1A3EH 1S81A 1GHWH 2AGIX 2ZI2H 3SGQE 1TABE 3SUEA 1D6WA 1YPHC 2VIDA 4OS7A 2AERH 2AGGX 1TOMH 1QJ6B 4BAHB 1C9PA 2SGEE 3SV9A 1F0UA 1HJAC 1LQEA 1LPZB 2FO9A 3PO1B 4B6EA 1PPZA 1OSSA 2V3MA 3A7YA 1ZTJA 2QXGA 1DOJA 3UPEA 1NC6A 4CRGA 1H9LB 3OYPA 3SU1A 1E37B 1K1NA 3UY9A 4ISHH 3E16B 4ZAEA 3H7OA 1HAGE 2OUAA 4CBNA 2A7HA 1TFXA 1GVZA 3FKSD 1TYNA 4XRNA 2ZG0H 3BIUH 2ZZUH 5HM9A 5L2ZH 2VH0A 4YO9A 1UCYK 1FY4A 1HAVB 2OD3B 4A6LA 1LHDH 2BDBA 3TU7H 1RTLA 1UK4A 1HJ8A 3I29A 3BTTE 1AUJA 3GCOA 1Y3VA 3FN8A 5C0TA 1HAOH 1KXFA 5A8XA 1O3FA 4ABEA 4FUDA 3KL6A 4O9VA 3GDVA 4ASHA 4Y0YE 4H42U 3E90B 1K22H 4AFQA 2G55A 5IK2D 1O2VA 1E1QD 1GHBF 3FFGA 1SOZA 4TY6A 4AYYB 3P8NA 1D3QB 2OXSA 2ZNKH 1C5TA 4ABAA 2WPDD 3SHCH 2OQUA 1C1SA 2Z94A 4ACBA 3BEFB 5DK1A 1ELTA 1F0TA 3RXGA 1AQ7A 1ZSKA 4K1TA 1O3GA 1G2MA 4P00A 3UOPA 2BD3A 1G3EA 1PPEE 4Y10E 1RD3B 5DG6A 1C2EA 1EZUC 3RXFA 1CHGA 2TRMA 3T26A 1L4ZA 1SGFA 1K1JA 2PGBB 1QZ8A 5LGOA 2GKVE 1O2TA 4FU8A 1JBUH 1C5MD 3MO9A 8KME2 3GCTG 1TX6A 1EOJA 2BQ7B 1K1MA 3RXAA 1TQ7B 4IN2A 4FU7A 2QXHA 4GAWA 2A5KA 1G3BA 5C3NA 4NZLA 1B7XB 3MQKC 1K0HA 3QO6A 2KM0A 3MU4A 3MYWA 1RS0A 1N8OC 3F6UH 2H9HA 2QGRA 4GLYA 2Y6TA 1NO9H 3ATLA 3P6ZB 3EQ0H 3TK9A 1P2OA 2BMGB 2CJIA 8LPRA 1RIWB 1VGCB 2ZCHP 2AYWA 1OP8A 4I32A 1BJUA 2H5DA 4Y76A 3SJKA 3ZZ6A 1QRXA 2QCYA 1BUIA 2OK5A 1LDTT 1CVWH 4JYUH 2BLWA 3N99A 2A32A 2XTTB 1UVUH 1YYY1 2JETB 2BHGA 2Y5GA 3T62A 1CBWB 5A0CA 7KMEH 1KTTB 1FY8E 2BY6X 3D65E 3BEUA 1EPTA 1OX1A 3RU4T 4LK4A 1PJPA 4IW4E 4LZ1H 4D9QA 1YCPK 1O3KA 4LXBH 1EP6A 1JIRA 2P3FH 1AU8A 3ITIA 4DVAU 2PWXA 3UTUH 1ZPZA 4A1VA 1OWIA 1WBGB 2BDIA 1MBMA 1UTPA 2EC9H 1MTVA 1S6LA 3GY6A 2VWNA 3MU0A 1BB0B 1V2QT 5C17A 1MZDA 4X6OA 1TLDA 2FESH 2XW9A 3OTJE 2GCHG 1QIXB 5J4QA 3K65B 1OS8A 2PV9B 3T2NA 1CQQA 1EX3A 1LKBA 4AGKA 2VVCA 3RXCA 4RN6A 2SNWA 4B76A 4B71A 2WSSD 4F49A 1O2MA 2VVVA 2BDYA 1O2YA 2CV3A 1ANDA 2J94A 3IG6B 1D9IA 2QF5A 1HUTH 3E3TA 3PLKA 5T6DA 1EAXA 1GDUA 1GCTB 2ESTE 3GS9A 3TVJB 2FI4E 2EI8A 1VZQH 2IPQX 2VIOA 3WW7A 1G30B 1THSH 4RSPA 2NU1E 3RC4A 1XX9A 1S85A 5H4IB 5EODA 3VEQB 3S69A 3KHVA 3RLYH 1EAUA 1F5RA 3F0PA 4XFQA 2GJGA 2EEKA 3RC6A 3M3SA 4AC9A 2O8MA 2O8UA 2XNDD 1GHZA 5E0JA 5A8YA 5FPTA 3TGIE 2ZDNA 4ABFA 1SLUB 1SGYE 4X2VA 2HNTC 4KELA 1WQSA 1QCPA 4OM9A 1DE7H 5EJ1A 1FX0B 2ZU1A 5DP9A 2GD4B 2ZDLA 3SQEE 3VXFH 1P8VC 3TGKE 3N7DA 3SNEA 1YY3A 2PKAA 2W7SA 3K6ZA 3EYDA 1O37A 1Z6JH 3M5NA 4JYVH 2WZQA 3E8LA 1CT4E 1HXEH 2ZFSA 2HLDD 3PMAB 1GVLA 3F2FA 2XRCA 4E7NA 4FU9A 1GJ4H 3A87A 2FODA 1ZGIA 1D4PB 3P95A 4Y6DA 1HYLA 2J2UA 3P70B 5BPEA 5DP7A 1Z1JA 2V3OH 5G4BA 7LPRA 1F92A 3DSGA 1NZQH 1UMAH 1ZZZA 3GYLB 4UD9H 1MAXA 4X2XA 2F9OA 2ZDMA 3LJJA 4TWWA 1O2OA 2XC0A 1MD7A 1M9UA 2SGQE 4WH6A 3K6YA 2PSXA 1ACBE 1NRSH 1O3LA 1Q2WA 4Y0ZE 4MNXA 1DXWA 3NZIA 1GWAA 2GCTC 1BIOA 2ODYB 2ZHQH 1FJSA 1S82A 1V2ST 2ZCLP 3STIA 5TCCA 3SJ8A 2CF8H 2A0QB 5F8XA 5GDSH 1G2LA 2P8OC 1AIXH 1F0RA 3UUZA 1UVTH 3GY8A 2K0QA 1NFWA 1OKXA 3T29A 1L4DA 1HAXB 1S6HA 1F5KU 4WWYA 3HATH 3TJUA 4NA7A 4A92A 2AMQA 3SUDA 3BTDE 1JMOH 3H09A 2V3HH 2GT8A 3UREA 1P2QA 5FBIA 3GOVB 1C5XB 2FI5E 3GICB 1TE0A 1NN6A 1BRBE 4ZXYH 2H9TH 1GJ9B 1GBJA 1UTJA 2BLVA 1V2VT 3ELAH 3OTPA 1MCTA 1P3EA 4TPIZ 4D76A 4Y8ZA 4P02A 4HTCH 2GMTB 4XBBA 2CHAC 3I77A 1VCPA 3V13A 1GI7B 7GCHG 2ZEBA 4AZ2B 1BHXF 4UFGH 6CHAC 3S9BA 2BLQA 1Z71A 1O2KA 2LPRA 4BTUB 1AZZA 1ELCA 3W1EA 2O9QA 3HKJB 3M7UA 4Q7XA 2AMDA 1UTQA 1O3HA 1Y8TA 2AEIH 5AF9H 1SQTA 1IOEA 1EPTB 1WOFA 1CGJE 1W0JD 3FP7E 2ZHFH 1TPPA 2ZECA 1T31A 4ABIA 1FQ3A 4JZ1A 1C2IA 5JB8S 2BD4A 2VWOA 3PLPA 1IQFA 1GBIA 4X1PU 2W5EA 4YM9A 2UWLA 3E91A 1O2SA 1O3PB 2J98B 1GBHA 1BQYA 1DSUA 1WTGH 3B9FH 4KGAA 2RG3A 5HKKD 2G5NA 2I6SA 1P2IA 2EQNA 1SHYA 1CU1A 4CH2B 3D49H 2UUKB 4Y71A 1XVMA 2DUCA 3HGPA 3MNXA 2FOGA 1GBKA 2A7JA 3MH4A 1GBAA 1TQ0B 1GI9B 2BD5A 1IQKA 3ZYEA 7ESTE 1PPGE 1BDAA 1W8BH 4AX9H 1W12U 5ESTE 2ZQ1A 1TRMA 1YPGH 3ZYDA 2YMSB 3F3BA 4UDWH 4UFFH 1AB9C 4ZKSU 2EY4C 5EPYA 1O35A 1D3TB 1E36B 3GCHB 3LJOA 3M36A 2BOHB 1LPGB 5GNDA 2D26C 1O2JA 2TGTA 1GHVH 1EQ9A 4YESB 5DSFA 1XUFA 1Z1IA 1MTNC 3E0NB 1D3PB 3W94A 3STJA 3ZZ4A 2A2QH 2YOLA 2ZPSA 4ABDA 1LCYA 1GMDF 4BAMB 2ZO3H 1ETTH 1G3DA 2A7CA 3BTFE 3KQ5A 3MMGA 2SFAA 2Z6BD 4FUFA 4B1TA 2V35A 2NU4E 4UONA 3SN8A 3LONA 3QTVH 3Q76A 1GJ7B 3LC3A 2QN5T 2HPPH 1WDIA 4CREA 2PKAB 4NIXA 1UK2A 3ZZAA 2D8WA 4XD7D 1G32B 1MBQA 2WPHS 2VINA 4NSYA 2Q6DA 1DWBH 1QURH 2A1DB 1Z8RA 3FZZA 4I8KA 3V0XA 1TX8A 8GCHF 3RU4E 5B6LA 4O97A 4K8BA 1ZOMA 4XBCA 4BTIB 1C4V2 1QJ1B 1ORFA 1ELGA 2A4GA 1C5QA 2EI7A 3SBKA 4AG1A 5T6GA 2BD9A 3L6PA 3RDZA 2ZP0H 3TH4H 5JYIA 3UNQA 5EIYA 4LZ4B 3KYFA 1C2JA 2BDCA 1NFYA 4FVDA 5JBAS 4Q4LA 3GISB 1QB9A 1GDNA 2IOTA 1SMFE 2K1QA 1JRSA 1TALA 2M5TA 3EA7A 3NWUA 1P03A 2PSYA 2QYIA 3MNCA 2AS9A 3GY4A 4NA9H 1LHFH 3IITA 2BLOA 1Y3YA 4B2AA 3N7EA 4ISIH 5CE1A 2VIWA 3AAUA 4H6TA 2FPZA 1VITG 1O3OA 2FTMA 2W6ID 3QLPH 1SGFG 1KXCA 4NZQA 1D6RA 1C2LA 3DD2H 1EATA 2Y81A 3F9FA 3GDSA 4RKJB 1XMNB 3H7TA 4X2WA 1FY1A 1SGPE 1YC0A 1UTMA 2ZIQH 3HK6B 4ZHMU 1QRZA 4NSVA 1QTFA 1GMCF 3AW0A 3KN2A 2ZHDA 9ESTA 1N6XA 3SV2H 1AFQC 2GV7A 1YPJH 1GBEA 1NBME 3VGCC 4CRAA 1O2NA 2BDHA 4NG9H 2C8ZB 4Q80A 2Q6GA 4CHAC 4JZDH 5C1XA 2A2XH 2K8IA 4ASUD 3OE7D 2JJ2D 2BX3A 3MI4A 3ZVCA 2F9NA 1ANEA 3CNRA 1HCGA 1SL3A 1W14U 2FS8A 1HAHH 3S7HB 1C1MA 5GXPA 2H5CA 3FZDA 4JYTA 5FXLA 1N6YA 1TRYA 2L74A 2R0LA 1GHAF 1GI3A 2BXTH 3Q3XA 1MABB 3RXJA 1PFXC 1DITH 3TNSA 4SGAE 1EZSC 2F9VA 1J17T 1E35B 1C1QA 1DUEA 2FOMB 3QTOH 1GGDC 2PUXB 3MH7A 2F4LA 1ABIH 1KXEA 2W7UA 4WY3A 1SR5C 1O2HA 3G01A 1C5OH 1BRCE 2ASUB 3F2HA 1ZPCA 3SU0A 1TA6A 3A7VA 1O34A 3S0NA 1V2OT 1GHBG 2YMSD 3MU8A 3C27B 1YF4A 3MNBA 5AVDA 1W0ZU 1A0JA 3U28C 3RXQA 2Z9JA 3CS7A 3O8DA 1HBTH 1DXPA 5JBTA 1DT2A 3BF6H 1F2SE 5EPNA 3E6PH 1TIOA 1Y3WA 1J15A 2FS9A 1PQAA 1GG6C 5AHGH 4FUJA 1BRAA 2PHBA 3FVFB 3A84A 4OS6A 1NRPH 1P2NA 1C2HA 2XCNA 3LGIA 1AO5A 3PMJA 3RMOH 3S9CA 1TPAE 5EG4A 4ZHAA 4ABJA 2EA3A 3A8BA 4JK5A 1WU1A 1V2MT 2R2MB 3M35A 4GCHF 1F5LA 1T32A 2VU8E 4X1RU 1KLJH 2UWPA 1BHXB 1FUJA 1MQ6A 5GIBA 4OS5A 1C2DA 3LU9B 3DFLA 3UQOA 2DE9A 2QIQA 2P93A 4ZKNU 4ABHA 3SZEA 1JOUB 1O3CA 2J34A 2W3IA 5C20A 1S0QA 2FXRA 2NU2E 2WHXA 4RT1A 5CDFE 4R8TB 2VIQA 4OGXA 1CT0E 1MCVA 1F7ZA 3RM2H 3PO1C 2ILNA 4ZH8A 2BD7A 4KKDA 4M7GA 5C94A 1FIWA 1O39A 3KQCA 1O2GH 3WWFA 3UQVA 2ZDAH 2Z3DA 1C1PA 3LGWA 4MPXA 1BTHH 1WYKA 4A7IB 1ZR0A 1GI6A 1AE5A 1ZSLA 2XOKD 1IQMA 2A4OA 3RMLH 5FBEA 3N7OA 1TMTH 2BX4A 1LPKB 1TGTA 3OAAD 2G00A 1L2EA 2XC4A 4U01A 1Z7KA 6ESTA 5LH8A 1YPHE 4O3UA 1TBZH 4J1YA 1VCWA 2VGCC 3GDUA 1GMHG 3RMMH 1FONA 3ATKA 1S84A 4KP0A 4XDEA 3CP7A 5TCAA 3RM0H 3SJIA 1NY22 4DCDA 4XE4A 4DW2U 1P12E 4WVPE 1P05A 2BZ6H 2VIPA 1IQEA 3RLWH 3U1IB 3VB4A 1K1OA 3A89A 1KLTA 1O3BA 3O8BA 3VFEA 1EXFA 3LDXH 1P11E 5KEDA 3ZZ9A 3P8FA 3SV7A 2OQ5A 1NFXA 1UJ1A 2HVXA 1O3IA 4IC6A 2J9NA 1A7SA 1IQNA 1P10A 3RXUA 4JCNA 4IS5A 2H6MA 2FEQH 2WYGA 4CBOA 1YGCH 1TB6H 2RA0A 1GI0A 3RXSA 2OC0A 1HXFH 3DSPA 1A5GH 2FLBH 4BXWA 1C4U2 1ZRBA 1MKWH 1YPMH 1ABJH 3RXLA 4MTBA 2Y7XA 1FY5A 2QC2A 3R3GB 3E1XB 3EE0B 2OC8A 2ZGCA 3O8RA 1GBFA 3U98H 2ZCKP 1V2WT 2J98A 3KNXA 5EQRA 2BY7X 1QQ4A 1JWTA 1QL9A 2PUQH 4NGAH 2VBCA 1AD8H 1P2KA 3RXIA 4AORA 1BMFD 4I33A 5GPIB 2F43B 1O3MA 3VG8A 1K28D 1TAWA 2GDDA 2KR7A 1ESTA 2JETC 2G4TA 2ODQA 1YBWA 1CBWC 4FETA 1C9TA 1HDTH 2FIRH 3QZRA 4HGCA 4TPYA 3SHAH 2BB4A 2SGAA 1HFDA 3PV2A 1P09A 1GI1A 1O5BB 4HG6A 1SSXA 2A5IA 1BCUH 1O2QA 4YLUA 3RXBA 5JB9S 3RXRA 1L1JA 3RXTA 3QN7A 1WAYB 1TGBA 4ABBA 3T28A 3CENA 1X7AC 1LMWB 2ZQ2A 5L2YH 3FANA 4J2YB 5F53A 3R0FA 1Z8IB 2OBQA 4X2YA 1S83A 1BTZA 1PPFE 5GCHF 4R0IA 2A45B 3NPSA 1BZXE 1SGNE 1KTSB 3PV5A 4ZUHA 1Y5UT 3TJNA 3QWCH 4A1TA 4E7RG 2BDGA 1GCDA 1DWDH 1QFKH 1O5EH 5I25A 1FN8A 1IQGA 1TRNA 1C4Y2 5EJLA 3SNCA 1RJXB 4FUBA 1FAXA 4VGCC 1YLDA 3KQEA 1AMHA 5A8ZA 5IYTA 2FOBA 2Z9GA 5F03A 1GI5A 4X1QU 3U8RH 1MTUA 5FCRA 3UR6A 1VCQA 2FZZA 3I78A 4CR5A 1WUNH 2KCOA 5C1YA 2GZ7A 1SOTA 4DG4A 2IJOB 1C2KA 3VB3A 3SU2A 1GCTC 1NPMA 1ZTLA 1TPOA 5A0AE 4B75A 2P16A 2XNIA 2ANYA 1FPHH 2JDID 1LVMA 1TA2A 3Q77A 1A5HA 2GCHF 1C5SA 2XXLA 5LPRA 4OS4A 5ETXA 5CMXH 1EFRD 1V2NT 3SU6A 3RP2A 2F9UA 2OLGA 2AIPA 1OYTH 1W7GH 1V2RT 1Y5AT 3LC5A 4TYDA 3F9EA 1E34B 2D2DA 1TNLA 4BAOB 1V2KT 4Y7BA 3MOCA 2FOFA 2G8TA 3U69H 1GJBB 3FOAA 1THPB 1QL8A 5EXLA 4CH8B 1KSNA 3SV8A 1O3DA 2QV1A 1WSSH 2PW8H 1GDQA 1AFEH 1UVPA 1V2PT 3M61U 1NESE 1HLTH 1G36A 3LGTA 1BTPA 1THRH 1SQRA 2Z9LA 3MWIU 5JDUB 2VNTA 3VB5A 4X0WU 2ZU3A 4X8VH 3E0PB 3SORA 1O5GH 2ZGHA 2GT7A 2P94A 1IQLA 2HNTE 4AB8A 1O5FH 2AIQA 4AB9A 4BNRA 1E79D 4CRBA 2A5AA 4DJZB 1PPBH 3A7XA 1T4VH 1LVBA 1BITA 2F9PA 2UUYA 1W7XH 1DLEA 4RT0A 2WPIS 1VITH 2FP7B 1SLXB 1RTFB 3RXOA 1MUEB 5J4SA 4CR9A 1C1UH 1EZQA 2KZ4A 2VH6A 2P3UB 1YPKH 3ZVEA 2SGFE 1SGDE 3RXHA 2ZU2A 1AWHB 3M37A 4ESTE 1OYQA 2V6NA 3RUOA 2ZTXA 4FUCA 1LKAA 2FI3E 1CA8B 1C2GA 1ESAA 2C93B 3HKIB 3WWBA 1C5LH 1HRTH 2J95A 2BQ6B 3VPKA 2GVFA 4MNYA 2WINI 3KYGA 4BOHA 1HIAA 2GMTC 3BTEE 4NCYA 2AFQB 2TGAA 3MO6A 4NWKA 4X1NU 2LELA 4X6NA 1JXPA 4YTAA 3ZV9A 2H2ZA 5EXNA 3U8OH 2CF9H 2WV5A 2BYAX 3TH3H 1XUJA 4YOGA 8GCHG 5JBCS 2ZDKA 4WMFA 3GY2A 5FAHA 1O2WA 2VWLA 1DVAH 1QY6A 1EPTC 3L33A 1OXGA 1CA0C 1OWEA 2AMPA 2VWMA 3SGBE 3SUGA 1EASA 4Q7ZA 1Q31A 2CMYA 2SGDE 3DT0H 3M3VA 4FUGA 1TNGA 1O31A 1OWDA 2FOAA 3A82A 5GWZA 1H9HE 3S9AA 1AKSB 2VVUA 1SGEE 1GJCB 3V7TA 2ZKSA 2EI6A 4GHQA 5EGMA 2BD8A 2H1UA 4BXSA 4U32A 3UIRA 2BVXH 4A5TS 1O38A 5SGAE 1T8MA 2F9BH 3A80A 7GCHF 2GZ8A 2TGPZ 3EDXB 4JK6A 5T3HA 1VJ9U 1C1TA 3A7ZA 1MKWK 1P2JA 5I46H 1UTKA 3KQDA 1AHTH 3GCNA 2FTLE 2BD2A 1OWJA 1HB0B 5DKMA 1FN6A 4Y8YA 4MPUA 4YOIA 1C5RA 3GY3A 2YMSC 5IDKA 1DY9A 1DSTA 1Z8JB 3U9AH 5FX5A 4I7YH 3GCHC 4DIHH 1HPGA 5JBBS 1C5ZB 1GHXH 1S0RA 2C90B 1TBQH 3MFJA 2KCYA 1BA8B 1K2I1 2FOCA 4K60A 4O03A 2C4FH 4ZKOU 1Y3UA 1PPHE 2WPLS 5K0HA 1H8IH 5AFYH 1XM1A 1PYTD 3BEIB 1DY8A 4H6SB 4TSFD 4AN7A 2Y82A 1LHCH 4HI3A 5HGGA 3NK8A 2Z3CA 1P06A 3URCA 1CHOG 1CT2E 2G51A 6GCHG 1OWKA 3NUMA 1T4UH 2KFWA 1KYNA 3QGJA 1AI8H 1T7CA 3RXMA 1DICA 3F68H 3JZ1B 1O2UA 2ZFTA 3A85A 1EAIA 2QXJA 5CHAC 1Y3XA 1ZHMA 1A5IA 1K1PA 3LT3A 1MU8B 1Z8GA 2OTVA 1TBRH 3GY5A 3NCLA 1QGFA 3BIVH 1QL7A 4UFEH 5DP5A 3TJOA 3UR9A 3SZNA 3V12A 3BN9A 5EOKA 1W13U 2HNTF 1O36A 1E1RD 4WXIA 4ISNA 3ZV8A 1V2UT 2P3TB 1OHHD 4CRCA 5FX6A 3QX5H 2IPHA 2JIZD 1T8OA 3DHKH 1SLWB 1SB1H 1IHTH 3KEEA 3LPRA 2HPQH 1C5PA 3VGCB 1DS2E 2QY0B 1W0YH 2JH6D 1A2CH 1IQHA 1GI8B 4B2BA 5E2PA 4FUHA 2VB0A 5F8ZA 1GBBA 4E06H 5B6OA 1GBDA 3ZIAD 1MAYA 2PKSB 2WV4A 1MZAA 2XCFA 1W0KD 4DGJA 1P9SA 1AGJA 4YT6H 3PTBA 2BZAA 4KTUA 1XKAC 3DUXH 1GI4A 2BOKA 2R3UA 3OSYA 5HXFA 3TIUA 2GGVB 3RU4D 1KIGH 4SGBE 1IQJA 2F83A 3CS0A 4X8TH 1C1OA 1TGSZ 1ELDE 1GBTA 4AG2A 4AYVB 2QA9E 2HWLB 3ZZ3A 1ELBA 4X8SH 2BQWB 1P9UA 2ZTZA 4I8LA 4H4FA 5F6MA 1Y5BT 1TWXB 3BG4B 5TJXA 4YOJA 1ZHPA 1O5DH 1BBRH 3P8GA 4IMQA 3RXDA 2ZU5A 3ENSB 2STAE 5HIZA 5C5NA 3DSOA 2SNVA 1O2ZA 3DFJA 4DIIH 1J8AA 3SW2B 1UW7A 4TWYA 3KIDU 4ABGA 2FWWA 1HIAB 3BTHE 2OINA 2XBXA 1WQVH 1MTWA 2P95A 1QBNA 1V2LT 1FV9A 1IAUA 1HJAB 2PTCE 2P59A 6LPRA 4UE7H 3UOUA 1RRKA 2I6QA 2PP6A 2WPJS 2AGEX 3UB0A 1FIZA 1VJAU 3BSQA 5C2ZA 1AWFH 4BANB 2SGPE 3TK5A 3AASA 5T1VA 1K1IA 1EB1H 1YWUA 2FOEA 3VB7A 2B9LA 1QBOA 3PM3A 1XUKA 1MU6B 2RDLA 1TNIA 4U30A 1VITF 2V0BA 3BG8A 1C5VA 1MH0A 1TGNA 4Q7YA 1RGQA 3PV4A 3ZVFA 1ZMLA 4K8YA 3EE7A 2BVSH 1BTWA 2OBOA 1SLVB 2BTCE 4TY7A 1DLKB 3ODDA 1H9IE 3LH3A 1O33A 3SI4H 3A7WA 1UHBA 3UAIC 1NBMD 5DN6D 2GX4A 3P8OA 3KQBA 1W3CA 3A86A 4X1SU 1NT1A 4KTSA 4ZMAH 1A3BH 4INLA 3ZZCA 1O30A 4FUEA 1O2LA 4JZEH 4IC5A 3QK1A 1LVOA 3C1KA 1BBRE 3SI3H 1G37A 1SGQE 2TIOA 1TOCB 1L1NA 3ZVBA 2O8TA 3FO8D 1XXFA 4BAQB 3PMHB 3QGNB 1A0LA 1ANBA 1BRUP 1W2KH 4MPWA 3D23A 1C5WB 3SV6A 2PLXA 1ZMNA 1H8DH 4NIVA 4Y7AA 1XKBC 2GV6A 4O3TA 5L30H 4D7FA 2KAIB 2FX6A 2HOBA 1JRTA 3F1SB 2VGCB 1K9OE 1C1VH 4Z0KA 1ZPBA 9LPRA 2XBYA 4CRFA 2ZU4A 1ZMJA 1LQDB 4IGDA 2PTNA 1QB6A 5DJ7A 3F9GA 3M7TA 2C3SA 1YP9A 2A31A 2ZFPH 1PQ7A 4ZHLU 3SO3A 1C1WH 5HMAA 1WXRA 2BXUH 1TNKA 1C5YB 2KX4A 4GUXA 1SFQB 3BTKE 1MKXH 1N8OB 4DT7B 1A46H 1H4WA 5KGOA 3T25A 3GYMA 1O5CB 1E38B 3A8CA 1HV7A 1SGTA 4AFSA 2LP6A 1DANH 1ZTKA 1ELVA 4JZIA 3H5CB 2XWBI 4XOJA 1TX7A 1P01A 4NWLA 1ZHRA 3SYJA 2Y5HA 1AVXA 2QAAA 2GP9B 1GBLA 2AH4X 3HGNA 1B5GH 1V2JT 3TH2H 4F55A 8ESTE 2FM2A 1ETSH 4FVBA 3GY7A 1AZ8A 2J97A 4F4OC 2YNBA 4K1SA 4MG3A 2WYJA 1B0FA 1KMHB 1DPOA 3MHWU 2Z7FE 3NKKA 1BMNH 1XUGA 4ISLA 4YZUA 2RFKC 5DPAA 1HAIH 1NU7B 2ZF0H 2L6OA 4D8NA 1P3CA 1KDQB 1HAZB 1AVWA 1CGHA 3SJ9A 4GHTA 5PTPA 1ID5H 3TJVA 3A8AA 3A8DA 1ELEE 1C5UA 1UTLM 2J5UA 4Y79A 3UWJH 1V6DA 1MTSA 2PGQB 1O3JA 3OU0A 5GCHG 4E05H 1BTUA 1FPCH 5A2MH 5AFZH 2ZHEH 3RXKA 3ZZ7A 2ZFFH 2R2WU 3M5MA 1LTOA 2B5TB 2Y7ZA 3VXEH 5C0UA 1O3EA 2Q1JA 1O5AB 1FLEE 4XSKU 5C5OA 1QA0A 4WXVA 2OC1A 4CRDA 1P57B 1YLNA 3SUFA 4DURA 1GHYH 4BTTB 1RIWC 3PRDA 1VGCC 5E0HA 3ZZ8A 1YKTA 2RA3A 2B0FA 1MQ5A 1GMHF 2G52A 3AW1A 2QF0A 2F3CE 1LHEH 3GCTF 4ZROA 2ZGXH 2B8OH 1EB2A 4OGYA 4Z1MD 3LH1A 4B73A 3MTYA 4MVNA 1UTNA 1H8ED 1V2TT 2YNAA 2RDEA 5EQSA 4ZXXH 3B23B 3OY6U 3MU1A 4WJG2 2HALA 3TNTA 4WH8A 1KXAA 1YPLH 2ALPA 1OOKB 4VGCB 3JZ2B 1AKSA 3O8CA 4K69A 1LHGH 1ARBA 3LGUA 2KCPA 4Q2KA 3K9XB 1Q3XA 2FMJA 1UHBB 1FZZA 2ZFRH 5EXMA 2QXIA 2A4QA 3ATMA 1EP5A 4QT8C 2XYAA 5EQQA 3PMBB 2NU0E 1Y59T 1MMJN 3LKWA 1FMGA 1E0FD 4Y8XA 3UNRA 4K5ZA 4B74A 1CGIE 1ELFA 3PTNA 2NU3E 4RI0A 4MQAA 3PLBA 4I8GA 3S7KB 4IMZA 4X8UH 1DWEH 2R3YA 3KGPA 1OP2A 2WUBA 1BBRK 2H9EH 1L1GA 1TMUH 1AVGH 4K2YA 1NU9A 1J9CH 3M7QA 5HYOA 1AUTC 3U8TH 1N1LA 1EOLA 1U6QA 3OEED 3T27A 2GCTB 3ESTA 4MNWA 1KY9A 3U1JB 5K7RA 3MH6A 2J4IA 1ZJDA 1UO6A 1RTKA 4GPGA 2P8OB 3DCLA 1O32A 1QHRB 1V3XA 2ALVA 1VKYA 1EJNA 3QDZB 4THNH 3ODFA 4I8HA 1AY6H 1QB1A 1BJVA 1XUHA 3SU4A 5FCKA 1AE8H 2BM2A 4WMDA 3LIWA 2PR3A 1ELAA 5L6NH 1SFIA 1ZRKA 4HZHA 5GJ4B 1OPHB 5FPYA 5EW1H 1J16A 1NTPA 4Q63A 1IQIA 1SG8B 1ZYOA 1KXDA 2NWNA 2HVYB 2PFEA 4UFDH 1TNHA 5HIYA 3D62A 1P04A 1L0ZA 2XC5A 3SJOA 5T6FA 3PWCA 1TPSA 1H1BA 2C8YB 2BY9X 2JKHA 2CHAB 4JMYA 1ZGVA 3NRLA 3ATWA 3WY8A 6CHAB 1DWCH 3M3TA 3SOSA 3EA8A 3SU5A 5F8TA 3Q00A 1W10U 1S6FA 3OFND 5HM2A 1K1LA 3M5LA 3RXVA 1PYTC 4IBLH 3SU3A 2QF4A 3EGKH 3SQHE 1FY3A 2CK3D 2ANMH 3NXPA 4INKA 3IWMA 2GDEH 1QNJA 2VIVA 1SBWA 2JJ1D 1C1RA 1TNJA 4M9FA 2G4UA 3SNBA 1HJ9A 2FLRH 4GVUA 2XWAA 2CXVA 2IN2A 3QUMP 2WPMS 2GTBA 1F0SA 4ZCNA 3ZVAA 2C8WB 1NM6A 2BVRH 4MDSA 2Z3EA 3ZZBA 1GJ8B 3FP8E 1SC8U 3DA9B 4XBDA 1D3DB 1BTXA 3A83A 2OP9A 2OC7A 1QA7A 3LGVA 1H8HD 2JH0D 1GMDG 2FYRA 3PYHA 3Q3YA 5FHTA 5A0BA 1GPZA 1JIMA 1ANCA 3KCGH 4YT7H 1AB9B 1TMBH 1SGCA 2R0KA 1CA0B 2XBVA 1BMMH 2Y5FA 3MH5A 1SVPA 1MKXK 3SNAA 1T8LA 1UCYH 1SPJA 4ISOA 1CE5A 2ANKH 5LPEA 2W26A 1DDJA 3L3TA 2STBE 4NFFA 2Y80A 4AOQA 2ZGJA 4FUIA 4Z6AH 1ESBA 3PWBA 5FPSA 2FYQA 1OP0A 4PROA 2HLCA 4WMEA 1G9IE 2TBSA 2IJD1 1MTNB 2ZFQH 3RC5A 1NS3A 1YCPM 2O8LA 2WV9A 1SGRE 1RFNA 1EJAA 2ZDVH 3RXEA 1GL1A 2BDAA 1B0EA 2Z9KA 5ESBA 2C8XB 1GBCA 1GL0E 2DE8A 1O2XA 3F9HA 4MNVA 2BY8X 1DM4B 4DOQA 3A88A 1PQ5A 4FXGH 2W3KA 1DX5M 1MD8A 1XUIA 1CO7E 5DGJA 5E2OA 1K21H 1TGCA 1GI2A 2TPIZ 1O0DH 2A4RA 5E8EH 2B7DH 1SKYE 1QQUA 2XBWA 5KECA 1J14A 1NRNH 1PPCE 1FAKH 4HFPB 4U2WA 1ZLRA 1ZSJA 2FDAA 1SQOA 2ZPQA 4X6MA 5LPFA 4IN1A 1GVKB 1HGTH 4MPVA 2O8WA 2ZHWH 1RXPA 5DO4H 4UEHH 3UFAA 2ZA5A 1EKBB 1GBMA 1BTYA 1P02A 3UNSA 3VB6A 1A61H 1FNIA 1DUAA 1UCYE 3SNDA 1P2MA 2CGAA 2F91A 4ACAA 2ZPRA 3MO3A 1EJMA 1A4WH 2WUCA 5A09A 1HAVA 1WV7H 2BY5X 2TGDA 3P92A 3V3MA 4I8JA 1GJAB 3Q3KA 4OS2A 3EA9A 3SGAE 3PROA 2KAIA 1QJ7B 3UWIA 1GMCG 3BTQE 3KF2A 5CHBA 5CHAB 3B8JA 3A7TA 3QZQA 4MLFB 1KLIH 2D1JA 4DT4A 1FDPA 2M2AA 2Z9IA 1BOQA 5EJZA 3K2UA 3TGJE 1O2RA 1LO6A 5EU8A 1FXYA 1FI8A 1G3CA 2QF3A 2G5VA 5DP6A 4WF8A 2LNCA 3MU5A 4I86A 4KTCA 1ARCA 5JPMH 4BAKB 1UK3A 2OCVB 3ZVDA 3P17H 1SI5H 1YCPH 1VR1H 2J38A 2UUJB 1O2IA 4NFEA 2FOHA 2CN0H 1BMAA 1GHAG 1BT7A 3BV9B 2W6JD 4GSOA 2QE7D 1EZXC 1QR3E 5FL7D 5BRRE 1T8NA 3ZVGA 1UVOA 3OX7U 1QRWA 1PQ8A 2V7QD 1S5SA 4NIWA 3ATIA 3TITA 3AAVA 4D9RA 4RKOB 5DP3A 4FOUC 1AFQB 3FP6E 1TONA 2ZC9H 5DP4A 4CHAB 1NRQH 2ZWLH 1O2PA 3MNSA 1ETRH 1LVYA 1KXBA 3ZZ5A 1EAWA 1XVOA 4INHA 3TK6A 4ZKRU 1SHHB 1GJ5H 2R9PA 2KCAA 4AFUA 1W11U 1YLCA 4D7GA 3M5OA 1C1NA 2VJ1A 1CSOE 2WPKS 2RCEA 3LGYA 4OS1A 1P0SH 2Q6FA 3EAJA 1C5NH 2UUFB 4YLQH 3URDA 1KDQA 3A81A 4B6FA 1XXDA 2ODPA 4NA8A 1WTHD 3OEHD
chains in the Genus database with same CATH topology
1OWHA 5ABWA 1NROH 3HPTB 2ZGBH 1GGDB 1ZJKA 3BTWE 3W95A 1HAPH 1UVSH 1DFPA 1NRRH 2JH5D 1WCZA 1SQAA 4GCHG 4I31A 1INCA 2HGTH 3TLOA 2J92A 4K3JA 1HAYB 1YM0A 3HK3B 4A1XA 2HRVA 4JZFH 3FAOA 1IHSH 1QBVH 3T5FH 2UWOA 1CHOF 1SGIB 6GCHF 1Z6EA 4X6PA 2ANWA 4NIYA 3AVZA 1C2FA 4Y11E 5DP8A 1NFUA 1GJDB 2ULLA 2PKSC 2ZTYA 3LOXA 1YPEH 4LOYH 1AN1E 1HNEE 1C2MA 1EUFA 3RMNH 1BMLA 4B2CA 1GG6B 4K1EA 2G81E 4DY7B 1GJ6A 5EW2H 1O3NA 3BTGE 3BTME 3RXPA 1UTOA 2THFB 3PB1E 3TPIZ 2GZ9A 4AFZA 3ZZDA 3OY5U 1A0HB 2FX4A 3BG4C 1O3AA 5E0GA 4AGJA 5C67A 1A1RA 5C1UA 1A3EH 1S81A 1GHWH 2AGIX 2ZI2H 3SGQE 1TABE 3SUEA 1D6WA 1YPHC 2VIDA 4OS7A 2AERH 2AGGX 1TOMH 1QJ6B 4BAHB 1C9PA 2SGEE 3SV9A 1F0UA 1HJAC 1LQEA 1LPZB 2FO9A 3PO1B 1PPZA 1OSSA 3A7YA 1ZTJA 2QXGA 1DOJA 3UPEA 1NC6A 4CRGA 1H9LB 3OYPA 3SU1A 1E37B 1K1NA 3UY9A 4ISHH 3E16B 4ZAEA 3H7OA 1HAGE 2OUAA 4CBNA 2A7HA 1TFXA 1GVZA 1TYNA 2ZG0H 3BIUH 2ZZUH 5HM9A 5L2ZH 2VH0A 4YO9A 1UCYK 1FY4A 1HAVB 2OD3B 4A6LA 1LHDH 2BDBA 3TU7H 1RTLA 1UK4A 1HJ8A 3I29A 3BTTE 1AUJA 3GCOA 1Y3VA 1HAOH 1KXFA 5A8XA 1O3FA 4ABEA 4FUDA 3KL6A 4O9VA 3GDVA 4ASHA 4Y0YE 4H42U 3E90B 1K22H 4AFQA 2G55A 1O2VA 1GHBF 3FFGA 1SOZA 4TY6A 4AYYB 3P8NA 1D3QB 2OXSA 2ZNKH 1C5TA 4ABAA 3SHCH 2OQUA 1C1SA 2Z94A 3BEFB 5DK1A 1ELTA 1F0TA 3RXGA 1AQ7A 1ZSKA 4K1TA 1O3GA 1G2MA 3UOPA 2BD3A 1G3EA 1PPEE 4Y10E 1RD3B 5DG6A 1C2EA 1EZUC 3RXFA 1CHGA 2TRMA 3T26A 1L4ZA 1SGFA 1K1JA 2PGBB 5LGOA 2GKVE 1O2TA 4FU8A 1JBUH 1C5MD 3MO9A 8KME2 3GCTG 1TX6A 1EOJA 2BQ7B 1K1MA 3RXAA 1TQ7B 4IN2A 4FU7A 2QXHA 4GAWA 2A5KA 1G3BA 5C3NA 4NZLA 1B7XB 3QO6A 3MYWA 3MU4A 1RS0A 1N8OC 3F6UH 2H9HA 2QGRA 4GLYA 2Y6TA 1NO9H 3ATLA 3P6ZB 3EQ0H 3TK9A 1P2OA 2BMGB 2CJIA 8LPRA 1RIWB 1VGCB 2ZCHP 2AYWA 1OP8A 4I32A 1BJUA 2H5DA 4Y76A 3SJKA 3ZZ6A 1QRXA 2QCYA 1BUIA 1LDTT 1CVWH 4JYUH 2BLWA 2A32A 2XTTB 1UVUH 1YYY1 2JETB 2BHGA 2Y5GA 3T62A 1CBWB 5A0CA 7KMEH 1KTTB 1FY8E 2BY6X 3D65E 3BEUA 1EPTA 1OX1A 3RU4T 4LK4A 1PJPA 4IW4E 4LZ1H 4D9QA 1YCPK 1O3KA 4LXBH 1EP6A 1JIRA 2P3FH 1AU8A 3ITIA 4DVAU 2PWXA 3UTUH 1ZPZA 4A1VA 1OWIA 1WBGB 2BDIA 1MBMA 1UTPA 2EC9H 1MTVA 3GY6A 2VWNA 3MU0A 1BB0B 1V2QT 1MZDA 4X6OA 1TLDA 2FESH 2XW9A 3OTJE 2GCHG 1QIXB 5J4QA 3K65B 1OS8A 2PV9B 3T2NA 1CQQA 1EX3A 1LKBA 4AGKA 2VVCA 3RXCA 4RN6A 2SNWA 4B76A 4B71A 4F49A 1O2MA 2VVVA 2BDYA 1O2YA 2CV3A 1ANDA 2J94A 3IG6B 1D9IA 1HUTH 3E3TA 3PLKA 5T6DA 1EAXA 1GDUA 1GCTB 2ESTE 3TVJB 2FI4E 2EI8A 1VZQH 2VIOA 1G30B 1THSH 4RSPA 2NU1E 3RC4A 1XX9A 1S85A 5H4IB 5EODA 3VEQB 3S69A 3KHVA 3RLYH 1EAUA 1F5RA 4XFQA 2EEKA 3RC6A 3M3SA 2O8MA 2O8UA 5A8YA 1GHZA 5E0JA 3TGIE 5FPTA 2ZDNA 4ABFA 1SLUB 1SGYE 4X2VA 2HNTC 4KELA 1WQSA 1QCPA 1DE7H 2ZU1A 5DP9A 2GD4B 2ZDLA 3SQEE 3VXFH 1P8VC 3TGKE 3SNEA 2PKAA 2W7SA 3K6ZA 3EYDA 1O37A 1Z6JH 3M5NA 4JYVH 3E8LA 1CT4E 1HXEH 2ZFSA 3PMAB 1GVLA 2XRCA 4E7NA 4FU9A 1GJ4H 3A87A 2FODA 1ZGIA 1D4PB 3P95A 4Y6DA 1HYLA 2J2UA 3P70B 5BPEA 5DP7A 1Z1JA 2V3OH 5G4BA 7LPRA 1F92A 1NZQH 1UMAH 1ZZZA 3GYLB 4UD9H 1MAXA 4X2XA 2F9OA 2ZDMA 3LJJA 4TWWA 1O2OA 2XC0A 1MD7A 1M9UA 2SGQE 4WH6A 3K6YA 2PSXA 1ACBE 1NRSH 1O3LA 1Q2WA 4Y0ZE 4MNXA 1DXWA 3NZIA 1GWAA 2GCTC 1BIOA 2ODYB 2ZHQH 1FJSA 1S82A 1V2ST 2ZCLP 3STIA 5TCCA 3SJ8A 2CF8H 2A0QB 5F8XA 5GDSH 1G2LA 2P8OC 1AIXH 1F0RA 3UUZA 1UVTH 3GY8A 1NFWA 1OKXA 3T29A 1L4DA 1HAXB 1S6HA 1F5KU 4WWYA 3HATH 3TJUA 4NA7A 4A92A 2AMQA 3SUDA 3BTDE 1JMOH 2V3HH 2GT8A 3UREA 1P2QA 5FBIA 3GOVB 1C5XB 2FI5E 3GICB 1TE0A 1NN6A 1BRBE 4ZXYH 2H9TH 1GJ9B 1GBJA 1UTJA 2BLVA 1V2VT 3ELAH 1MCTA 1P3EA 4TPIZ 4D76A 4Y8ZA 4HTCH 2GMTB 4XBBA 2CHAC 3I77A 1VCPA 3V13A 1GI7B 7GCHG 2ZEBA 4AZ2B 1BHXF 4UFGH 6CHAC 3S9BA 2BLQA 1Z71A 1O2KA 2LPRA 4BTUB 1AZZA 1ELCA 2O9QA 3HKJB 3M7UA 4Q7XA 2AMDA 1UTQA 1O3HA 1Y8TA 2AEIH 5AF9H 1SQTA 1IOEA 1EPTB 1WOFA 1CGJE 3FP7E 2ZHFH 1TPPA 2ZECA 1T31A 4ABIA 1FQ3A 4JZ1A 1C2IA 5JB8S 2BD4A 2VWOA 3PLPA 1IQFA 1GBIA 4X1PU 2W5EA 4YM9A 2UWLA 3E91A 1O2SA 1O3PB 1GBHA 1BQYA 1DSUA 1WTGH 3B9FH 4KGAA 2RG3A 2G5NA 2I6SA 1P2IA 1SHYA 1CU1A 4CH2B 3D49H 2UUKB 4Y71A 1XVMA 2DUCA 3HGPA 3MNXA 2FOGA 1GBKA 2A7JA 3MH4A 1GBAA 1TQ0B 1GI9B 2BD5A 1IQKA 3ZYEA 7ESTE 1PPGE 1BDAA 1W8BH 4AX9H 1W12U 5ESTE 2ZQ1A 1TRMA 1YPGH 3ZYDA 4UDWH 4UFFH 1AB9C 4ZKSU 5EPYA 1O35A 1D3TB 1E36B 3GCHB 3LJOA 3M36A 2BOHB 1LPGB 2D26C 1O2JA 2TGTA 1GHVH 1EQ9A 4YESB 1XUFA 1Z1IA 1MTNC 3E0NB 1D3PB 3W94A 3STJA 3ZZ4A 2A2QH 2YOLA 2ZPSA 4ABDA 1LCYA 1GMDF 4BAMB 2ZO3H 1ETTH 1G3DA 2A7CA 3BTFE 3MMGA 2SFAA 2Z6BD 4FUFA 4B1TA 2V35A 2NU4E 4UONA 3SN8A 3LONA 3QTVH 3Q76A 1GJ7B 3LC3A 2QN5T 2HPPH 4CREA 2PKAB 4NIXA 1UK2A 3ZZAA 2D8WA 1G32B 1MBQA 2WPHS 2VINA 4NSYA 2Q6DA 1DWBH 1QURH 2A1DB 1Z8RA 3FZZA 4I8KA 3V0XA 1TX8A 8GCHF 3RU4E 4O97A 4K8BA 1ZOMA 4XBCA 4BTIB 1C4V2 1QJ1B 1ORFA 1ELGA 2A4GA 1C5QA 2EI7A 3SBKA 4AG1A 5T6GA 2BD9A 3L6PA 3RDZA 2ZP0H 3TH4H 5JYIA 3UNQA 4LZ4B 1C2JA 2BDCA 1NFYA 4FVDA 5JBAS 3GISB 1QB9A 1GDNA 2IOTA 1SMFE 2K1QA 1JRSA 1TALA 2M5TA 3EA7A 3NWUA 1P03A 2PSYA 2QYIA 3MNCA 2AS9A 3GY4A 4NA9H 1LHFH 3IITA 2BLOA 1Y3YA 4B2AA 4ISIH 5CE1A 2VIWA 3AAUA 4H6TA 2FPZA 1VITG 1O3OA 2FTMA 3QLPH 1SGFG 1KXCA 4NZQA 1D6RA 1C2LA 3DD2H 1EATA 2Y81A 3F9FA 3GDSA 4RKJB 1XMNB 3H7TA 4X2WA 1FY1A 1SGPE 1YC0A 1UTMA 2ZIQH 3HK6B 4ZHMU 1QRZA 4NSVA 1QTFA 1GMCF 3AW0A 3KN2A 2ZHDA 9ESTA 1N6XA 3SV2H 1AFQC 2GV7A 1YPJH 1GBEA 3VGCC 4CRAA 1O2NA 2BDHA 4NG9H 2C8ZB 4Q80A 2Q6GA 4CHAC 4JZDH 5C1XA 2A2XH 2BX3A 3MI4A 3ZVCA 2F9NA 1ANEA 1HCGA 1SL3A 1W14U 2FS8A 1HAHH 3S7HB 1C1MA 5GXPA 2H5CA 3FZDA 4JYTA 5FXLA 1N6YA 1TRYA 2R0LA 1GHAF 1GI3A 2BXTH 3Q3XA 3RXJA 1PFXC 1DITH 3TNSA 4SGAE 1EZSC 2F9VA 1J17T 1E35B 1C1QA 1DUEA 2FOMB 3QTOH 1GGDC 2PUXB 3MH7A 1ABIH 1KXEA 2W7UA 4WY3A 1SR5C 1O2HA 3G01A 1C5OH 1BRCE 2ASUB 1ZPCA 3SU0A 1TA6A 3A7VA 1O34A 3S0NA 1V2OT 1GHBG 3MU8A 3C27B 1YF4A 3MNBA 5AVDA 1W0ZU 1A0JA 3RXQA 2Z9JA 3CS7A 3O8DA 1HBTH 1DXPA 5JBTA 1DT2A 3BF6H 1F2SE 5EPNA 3E6PH 1TIOA 1Y3WA 1J15A 2FS9A 1PQAA 1GG6C 5AHGH 4FUJA 1BRAA 2PHBA 3FVFB 3A84A 4OS6A 1NRPH 1P2NA 1C2HA 2XCNA 3LGIA 1AO5A 3PMJA 3RMOH 3S9CA 1TPAE 5EG4A 4ZHAA 4ABJA 2EA3A 3A8BA 4JK5A 1WU1A 1V2MT 2R2MB 3M35A 4GCHF 1F5LA 1T32A 2VU8E 4X1RU 1KLJH 2UWPA 1BHXB 1FUJA 1MQ6A 5GIBA 4OS5A 1C2DA 3LU9B 3DFLA 3UQOA 2DE9A 2QIQA 2P93A 4ZKNU 4ABHA 1JOUB 1O3CA 2J34A 2W3IA 5C20A 1S0QA 2FXRA 2NU2E 4R8TB 2VIQA 4OGXA 1CT0E 1MCVA 1F7ZA 3RM2H 3PO1C 2ILNA 4ZH8A 2BD7A 4KKDA 4M7GA 1FIWA 1O39A 3KQCA 1O2GH 3UQVA 2ZDAH 2Z3DA 1C1PA 3LGWA 4MPXA 1BTHH 1WYKA 4A7IB 1ZR0A 1GI6A 1AE5A 1ZSLA 1IQMA 2A4OA 3RMLH 5FBEA 3N7OA 1TMTH 2BX4A 1LPKB 1TGTA 2G00A 1L2EA 2XC4A 4U01A 1Z7KA 6ESTA 5LH8A 1YPHE 4O3UA 1TBZH 4J1YA 1VCWA 2VGCC 3GDUA 1GMHG 3RMMH 1FONA 3ATKA 1S84A 4KP0A 4XDEA 3CP7A 5TCAA 3RM0H 3SJIA 1NY22 4DCDA 4XE4A 4DW2U 1P12E 4WVPE 1P05A 2BZ6H 2VIPA 1IQEA 3RLWH 3U1IB 3VB4A 1K1OA 3A89A 1KLTA 1O3BA 3O8BA 3VFEA 1EXFA 3LDXH 1P11E 3ZZ9A 3P8FA 3SV7A 2OQ5A 1NFXA 1UJ1A 2HVXA 1O3IA 4IC6A 2J9NA 1A7SA 1IQNA 1P10A 3RXUA 4JCNA 4IS5A 2H6MA 2FEQH 2WYGA 4CBOA 1YGCH 1TB6H 2RA0A 1GI0A 3RXSA 2OC0A 1HXFH 1A5GH 2FLBH 4BXWA 1C4U2 1ZRBA 1MKWH 1YPMH 1ABJH 3RXLA 4MTBA 2Y7XA 1FY5A 2QC2A 3R3GB 3E1XB 3EE0B 2OC8A 2ZGCA 3O8RA 1GBFA 3U98H 2ZCKP 1V2WT 3KNXA 5EQRA 2BY7X 1QQ4A 1JWTA 1QL9A 2PUQH 4NGAH 1AD8H 1P2KA 3RXIA 4AORA 4I33A 5GPIB 1O3MA 1K28D 1TAWA 2GDDA 1ESTA 2JETC 2ODQA 2G4TA 1YBWA 1CBWC 1C9TA 1HDTH 2FIRH 3QZRA 4HGCA 4TPYA 3SHAH 2BB4A 2SGAA 1HFDA 1P09A 1GI1A 1O5BB 1SSXA 2A5IA 1BCUH 1O2QA 4YLUA 3RXBA 5JB9S 3RXRA 1L1JA 3RXTA 3QN7A 1WAYB 1TGBA 4ABBA 3T28A 3CENA 1X7AC 1LMWB 2ZQ2A 5L2YH 3FANA 4J2YB 3R0FA 1Z8IB 2OBQA 4X2YA 1S83A 1BTZA 1PPFE 5GCHF 4R0IA 2A45B 3NPSA 1BZXE 1SGNE 1KTSB 4ZUHA 3TJNA 1Y5UT 3QWCH 4A1TA 4E7RG 2BDGA 1GCDA 1DWDH 1QFKH 1O5EH 5I25A 1FN8A 1IQGA 1TRNA 1C4Y2 3SNCA 1RJXB 4FUBA 1FAXA 4VGCC 1YLDA 3KQEA 1AMHA 5A8ZA 5IYTA 2FOBA 2Z9GA 5F03A 1GI5A 4X1QU 3U8RH 1MTUA 5FCRA 3UR6A 1VCQA 2FZZA 3I78A 4CR5A 1WUNH 5C1YA 2GZ7A 1SOTA 4DG4A 2IJOB 1C2KA 3VB3A 3SU2A 1GCTC 1NPMA 1ZTLA 1TPOA 5A0AE 4B75A 2P16A 2XNIA 2ANYA 1FPHH 1LVMA 1TA2A 3Q77A 1A5HA 2GCHF 1C5SA 2XXLA 5LPRA 4OS4A 5ETXA 5CMXH 1V2NT