1QR3E

Structure of porcine pancreatic elastase in complex with fr901277, a novel macrocyclic inhibitor of elastases at 1.6 angstrom resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ELASTASE 1
publication title Structure of porcine pancreatic elastase complexed with FR901277, a novel macrocyclic inhibitor of elastases, at 1.6 A resolution.
pubmed doi rcsb
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1999-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qr3E02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qr3E01
5SGAE 1A7SA 2A4GA 1A1RA 1UK2A 2CJIA 1TRMA 2WPIS 3AAUA 1FN6A 3GCNA 1EXFA 2WPKS 3OTJE 4DT7B 1WSSH 1C2EA 1HPGA 1AE8H 1VGCC 4D9QA 2FX6A 3ZZBA 1AZ8A 1O3IA 5EQQA 1LCYA 3QTOH 1CBWC 4DJZB 1OKXA 6ESTA 2WV5A 3N7OA 3QZQA 1HAPH 2TPIZ 2W7SA 1YLDA 1FONA 3BN9A 2YNBA 4DIHH 1L2EA 5C67A 2ASUB 3ATIA 4AYYB 1C2JA 4BAMB 3SU3A 5I25A 1NFWA 4K60A 4CHAB 1ZR0A 1O3FA 4XBBA 3MNSA 3OYPA 1LVBA 3DD2H 1HAIH 3BTEE 1UCYE 2ANMH 1SR5C 1W8BH 2QXJA 2BQ6B 4X2VA 1O30A 4K5ZA 4HFPB 2G51A 1FAXA 2RCEA 1E0FD 2Z9LA 2R0KA 2ZQ1A 1KSNA 2J2UA 1FY1A 1TGNA 1S84A 4X1QU 1O2TA 1UTJA 3ZYEA 1ARCA 1O2YA 1SOTA 1TOMH 4TPYA 4GVUA 1HAXB 2W5EA 3KL6A 4ZKNU 2OC8A 1O33A 1Y59T 1BDAA 1Z6JH 2ZDAH 1X7AC 3GY7A 3MU1A 1MAYA 3UWIA 1O36A 1AN1E 3KN2A 1DSTA 4HZHA 1QTFA 2QCYA 1CA0C 5FXLA 2RA3A 1O5CB 1KXBA 3O8BA 1QBNA 3QX5H 4MG3A 1HAGE 2WUCA 1IQHA 3VB3A 1AI8H 1O5FH 1BTPA 5DG6A 1A5GH 3E16B 2BY6X 4HI3A 1L4DA 1NRQH 2ZI2H 1DPOA 1O3GA 1GHXH 1KIGH 3GISB 4K1EA 3Q77A 4BTIB 1P12E 3GY2A 1SGFG 3JZ1B 1G3EA 3QTVH 3W95A 1HAYB 1BMMH 2F9NA 2Z9KA 1K1LA 3V3MA 4MTBA 1C4Y2 2A5AA 1EPTB 1NROH 1QL8A 1GGDB 3A8AA 2QXIA 4Y8ZA 4ISNA 4B74A 1C5OH 1T31A 2HVXA 2OQ5A 1GHZA 1AFQC 3LH1A 3SJ8A 2RDLA 4FUCA 1GI6A 2BY7X 2SGEE 5EG4A 2OTVA 1HXEH 1NC6A 2VVUA 1AD8H 1HJAC 4OS4A 3F1SB 5A09A 2PTCE 1CT2E 1SL3A 4XBDA 3TJNA 1P2NA 2HWLB 2NU4E 2AERH 5GCHF 3A84A 2R3YA 2D2DA 1SLXB 5EU8A 5TCAA 4CH8B 3NKKA 2QAAA 1SHYA 3MH6A 1K1NA 2AH4X 1GJAB 2AIQA 1BCUH 3SNCA 1TALA 1BHXF 2AMPA 1HAVA 1A0JA 1PFXC 1GG6B 1P06A 4GHQA 4X2XA 1AE5A 4I7YH 3NZIA 5HGGA 1HIAB 4ZXYH 3ZZ4A 1UK3A 1UTNA 3CP7A 3QDZB 1G9IE 3QWCH 4PROA 5LPRA 3LJJA 1EKBB 1YGCH 1P8VC 2YOLA 3LIWA 3LGTA 1TNLA 1ZPBA 2VU8E 1O3NA 4DG4A 1XUHA 4X2WA 1EJMA 2FOHA 1UCYK 4IS5A 3NK8A 1Z1JA 3RMMH 3BF6H 4B2CA 4I8LA 4WMDA 5F8ZA 3RXJA 1TFXA 2ZGJA 3QK1A 1GWAA 3GCTG 2XCNA 2BDHA 4YTAA 3MOCA 3TITA 1B7XB 2O8TA 1PQ5A 1LHDH 2ZQ2A 3OY5U 3TH4H 2ZTXA 4ISIH 3RXTA 5DJ7A 2STAE 1TNHA 3RXBA 4E05H 3LONA 2DUCA 1Y5AT 2F9BH 5T6FA 2OUAA 1K28D 3H5CB 4YLQH 3MHWU 1ETTH 2ZFPH 1ZSKA 3ODFA 2VIDA 1AO5A 1YF4A 2VWOA 1RGQA 1AWHB 4CBOA 2B5TB 2VGCC 3L33A 1YBWA 3T28A 1CSOE 2J38A 2F91A 4JZEH 1V6DA 1GBDA 3C1KA 1P3EA 3SJ9A 2Y5HA 4O97A 2G55A 1BRAA 3PROA 4YZUA 3FZDA 3LC3A 3AW1A 2XBWA 1GBJA 3ZVAA 2AS9A 1H8IH 1O2MA 3E1XB 2AEIH 4IN1A 3LGUA 2R0LA 1GMDG 1CGIE 3ZZAA 1GVZA 2FOCA 2GCTC 2VIOA 3BIUH 4BAOB 1RRKA 1GCDA 1IHSH 2BLWA 2ZDVH 3KNXA 1ZSJA 3D49H 1ANBA 1HRTH 1UHBB 4FVDA 3K6YA 5F8XA 1K9OE 4CR5A 5LH8A 4IMQA 2ZDMA 1GBAA 4GLYA 3BTWE 1ZTKA 2SGFE 2BYAX 1ELFA 1YCPK 3T29A 1OP2A 1C5MD 3A83A 4AG2A 4Y0YE 9ESTA 3VB6A 1C2DA 1NRSH 1XM1A 2JKHA 5H4IB 4CH2B 1QCPA 1T4VH 1EP6A 4I8GA 4NFFA 3LGVA 2BLVA 1DS2E 2CXVA 1RJXB 3TPIZ 2ZFQH 3OY6U 1NT1A 1SI5H 1ELGA 3GCOA 1AUJA 1Y3YA 1J8AA 4CR9A 1C1UH 1K1MA 1HFDA 3SU0A 4VGCC 1OS8A 5C5OA 3SNAA 3TNTA 1K1OA 2NU1E 3ZZCA 1ELAA 1B0FA 1CA0B 4NFEA 4NZLA 4ASHA 2PW8H 4BXSA 1SFIA 4GPGA 3SI4H 1QA0A 2FO9A 2IJOB 4JYTA 1F0TA 1C9PA 1THRH 1TRYA 5HXFA 1NFXA 3M61U 1FQ3A 1BTHH 2V35A 1MZDA 4DURA 2ZHWH 3GY5A 2FPZA 1AUTC 2BD2A 4U30A 3IG6B 3ZZ5A 1UHBA 1O3MA 3P17H 4OGYA 2ZU4A 1TX8A 3QGJA 4O3TA 4UFDH 1LMWB 1T4UH 3GCTF 1BRUP 1IQLA 1Q2WA 3M5OA 1C1QA 3RXAA 4ABJA 3NXPA 1EAUA 2ZCKP 4WJG2 3UNSA 1LDTT 5E0GA 3FFGA 1P2QA 1QJ7B 3V0XA 1QIXB 4UFFH 1EP5A 1F2SE 1GHVH 2P16A 4RSPA 2Z3DA 2ZFSA 1VCWA 1ABJH 4X6NA 3KQBA 5AFYH 1UTMA 3SOSA 2FM2A 1HJAB 3M5MA 2Z3CA 2BB4A 4MPXA 5LPFA 1MKXK 1O2QA 1CQQA 1O3OA 2BXTH 1HAOH 1CT4E 3RU4T 1QQUA 5HM9A 3UQVA 1FDPA 4NSYA 1C5ZB 2VWMA 1ELCA 3T25A 2BDGA 3TK6A 3LDXH 4ZKRU 2CGAA 5E2OA 4MPUA 1YKTA 2BVSH 1GMDF 4U2WA 1LO6A 1O3JA 4UE7H 1C1RA 1ZJDA 1O38A 1SB1H 1ZMJA 1P0SH 3RXLA 1F92A 2AYWA 3MO6A 5HYOA 4X8SH 4AFSA 3E0NB 3RXCA 2OC0A 3KQEA 4FUGA 3A8BA 4B76A 3S7HB 1UVPA 1K22H 2D8WA 4TPIZ 2ANYA 1HCGA 1QL7A 2GCHG 3SUDA 1ANDA 2ULLA 3T27A 4JMYA 5C2ZA 3HKIB 1PPEE 3T62A 2Y6TA 3RP2A 1Y3VA 2O8LA 3BEFB 3HGPA 1XX9A 3S9CA 1PPFE 1IQJA 2HOBA 3RDZA 5DP9A 3A85A 3PLBA 3UTUH 3U69H 4Q7ZA 3UPEA 3LT3A 1DWDH 2AIPA 1LTOA 2BOHB 2ZDKA 3PLPA 2BLOA 2QF0A 2A7JA 2PUQH 4THNH 1TA6A 4I33A 3UY9A 5L2ZH 1GCTB 5AVDA 4AN7A 1O5DH 4WXIA 2OBQA 4I8HA 1IQMA 4Y76A 1GJDB 1O2XA 3DHKH 2LPRA 2VIWA 1V2VT 3MNXA 1C4V2 2VGCB 4TWYA 3NWUA 3Q3YA 3DFLA 1UTPA 1GJ4H 3OX7U 5IDKA 3UNQA 2J95A 3LJOA 3FANA 1BBRE 1EOJA 1GI3A 1ZZZA 2H9TH 2UWPA 1ETRH 3ODDA 3V7TA 2R2WU 2GT7A 1PPBH 2I6SA 3B8JA 3T26A 3RC6A 2HPQH 4AB8A 5JPMH 2F83A 2UWLA 1PYTC 2PR3A 1P9UA 1KYNA 2ZU3A 3K65B 5EXNA 1FMGA 3SU4A 2FXRA 1QR3E 1JOUB 1KLJH 2GGVB 3ESTA 1CA8B 3P95A 3O8RA 4INKA 1JBUH 1LKAA 1ZGIA 1ZLRA 4BOHA 3HK6B 5EQSA 1C1PA 1MAXA 1GI1A 3GYMA 1TLDA 2FTLE 1MTVA 1O2UA 2VWNA 4E7NA 1ZTLA 2B9LA 4U01A 1EJAA 4MNYA 1N6YA 5C5NA 4E7RG 1CO7E 3AAVA 3VFEA 2BY5X 4YOIA 1ZSLA 3GCHB 2Z3EA 4NIYA 5EW2H 1GPZA 4K1TA 3TK9A 1Z71A 2CF9H 1O5BB 1TX7A 1LVYA 1NU7B 1SMFE 3PM3A 4B2AA 4XSKU 2CHAC 1DVAH 1VITG 2GD4B 3P92A 2M5TA 1XKAC 2VH6A 2Z9GA 3SJKA 4MQAA 3ZYDA 1O2IA 1Z6EA 5CHAB 3RXFA 3P8OA 3MFJA 1Z8IB 2I6QA 1EB2A 2BDIA 4CRCA 4ZMAH 2ZDNA 1TOCB 4NWKA 2GKVE 2J34A 1O37A 1QURH 4WMFA 2YNAA 4F4OC 3M7UA 1BMNH 1NZQH 1UMAH 4INLA 3U98H 3GY6A 4DOQA 1O3BA 2GCHF 2BMGB 3M5LA 3A8CA 1P02A 1GJ9B 3P70B 2C90B 4KTSA 4NA9H 1GJ5H 1RTLA 2TIOA 2IN2A 1PYTD 1C1VH 2BDYA 1HUTH 1ABIH 1K1JA 2O8UA 3TGJE 4FUJA 2ZTYA 4XBCA 1HB0B 4FUHA 4I31A 1H9LB 1MKWK 1HBTH 2A4RA 1ELTA 3RMLH 1D6RA 2FOAA 4A6LA 4ABAA 3Q00A 1TPSA 3NUMA 4UFEH 5I46H 5A0CA 2Z94A 1TMTH 3AW0A 4ZAEA 5JDUB 4ABEA 1QQ4A 6GCHG 3SGAE 3FP7E 4BXWA 1SGQE 1TIOA 2H1UA 3SV7A 1SGIB 1O2WA 3A7ZA 3ZZDA 3TNSA 3PMJA 1TGTA 3EE0B 2AGEX 1SGRE 1GBMA 1Z8RA 1P2OA 1J17T 1DXWA 3SV9A 3PO1C 2G5VA 5DP3A 3V13A 8KME2 2VIPA 1PPHE 3STIA 1RS0A 2Q6FA 1BBRK 4CBNA 3PLKA 2ZZUH 3SUEA 1TBZH 3FAOA 1P09A 3NPSA 3VXFH 1GL1A 1L1GA 1UCYH 1H1BA 3BTFE 2EA3A 2D26C 1HAZB 1V2OT 1EAIA 2BD4A 1CGJE 1C5SA 6CHAB 1VJAU 2ZHDA 3RXQA 1SGDE 1VR1H 4MNVA 4MNXA 2ZHQH 1HAHH 2GP9B 2PKAB 2A5IA 1DE7H 1ZOMA 1UJ1A 2OCVB 2PUXB 1MQ5A 4NIXA 1GHAG 8LPRA 1YPLH 5FPTA 1NU9A 2P3FH 1O0DH 1CE5A 3GY8A 2P8OC 4WWYA 5C1YA 1KY9A 1QGFA 3DT0H 4O3UA 2XXLA 3E0PB 1MD7A 2NU0E 2ZNKH 2WPHS 3BG4C 2JETC 2ZPQA 4DCDA 1W11U 3SHAH 1V2UT 1KDQB 4KP0A 2Y81A 1LPZB 3BTHE 4ZKOU 1PPZA 5DKMA 2XNIA 1OXGA 3HKJB 4LK4A 2NWNA 3SI3H 1C9TA 1TPAE 1SGPE 3SV2H 5HMAA 5GXPA 1J16A 3MO3A 3QN7A 7KMEH 4A92A 3RXEA 4K3JA 1YM0A 1ZHRA 3SUGA 3BTDE 5TCCA 2OINA 2OC1A 4A5TS 3TH3H 1NFUA 1SQAA 3PMAB 1A46H 3RU4E 1S85A 2RG3A 3MYWA 1NRRH 2BHGA 5E0HA 1GI9B 2ZF0H 1XKBC 5T3HA 2XWBI 1NTPA 3EGKH 3UR9A 4B71A 1KLTA 1FY8E 2FIRH 1C5TA 3NCLA 1C2GA 3RXVA 2FZZA 1S82A 2FMJA 3F6UH 1EZSC 1FIZA 1P03A 1NO9H 5E2PA 2IOTA 1SG8B 4BAHB 5FCKA 5K0HA 4MLFB 2EI7A 2PLXA 1O3LA 4IBLH 2OBOA 2HNTE 2BM2A 2EC9H 2H9HA 1AZZA 1EUFA 2WYJA 4BANB 1A61H 5GJ4B 1O3HA 1OP8A 2BD5A 1WOFA 1O2KA 5EXLA 1HJ9A 3UIRA 1GBFA 2ZDLA 4JZ1A 4ABGA 1ZPCA 1FPHH 1TE0A 1C5RA 6GCHF 1BTYA 1FIWA 4IC6A 3STJA 1YLCA 3JZ2B 1AKSB 1PPCE 1SHHB 2ILNA 3AVZA 1EPTA 2H9EH 4X8TH 3LC5A 5EPNA 3SZNA 3SQEE 1F0RA 4FUIA 1AVGH 2Z9IA 3G01A 4GUXA 1LHCH 4H4FA 3E90B 1FV9A 1ELBA 2A31A 1MTNC 1XUFA 3EA9A 3B9FH 4H6SB 1WUNH 5E8EH 3LOXA 4FVBA 3RU4D 3H7OA 1W12U 3VB7A 1V2WT 1ZMNA 4INHA 5FBEA 2ZECA 1K2I1 5DP6A 1O5GH 4Y8YA 1TB6H 1BOQA 4AYVB 4I32A 1RTFB 4F49A 1W7XH 1P11E 1L1JA 3DUXH 1D9IA 3TK5A 1K1PA 3BTGE 1XVOA 2VB0A 4ABDA 4B73A 3SORA 3TJOA 4UDWH 1MTWA 1HIAA 3PMBB 1SGYE 1WQVH 3A81A 3CENA 4Z0KA 2Y82A 2FI4E 5FPYA 3QO6A 1O3AA 5JBBS 1GHAF 1UTLM 2FEQH 3SHCH 2ZC9H 1P2IA 2J4IA 1VGCB 3MH4A 1U6QA 3TH2H 4YOGA 3WY8A 1ZPZA 1CBWB 7GCHG 5BPEA 2ALVA 1T8LA 1ZRKA 1V2QT 1MKXH 2ZO3H 3M7TA 4RN6A 1G36A 1TMBH 1ZMLA 5DGJA 1IQKA 5AFZH 3UR6A 5F6MA 3ZZ9A 3ZV9A 5C3NA 2KAIB 2QGRA 1TONA 1GBTA 1LHFH 2Y5GA 1G30B 3RXMA 4NA7A 1C5LH 1DWCH 3VXEH 3L6PA 4Q80A 5J4QA 1FNIA 4Z6AH 5HM2A 2Q6DA 3RXOA 1GDNA 1GJ8B 2FI5E 2Y5FA 4AFZA 1V2PT 4ZH8A 1W0YH 3A89A 2ZHEH 3MI4A 1AQ7A 4NG9H 1FI8A 3PYHA 5ABWA 1BTUA 2TGTA 2AGIX 3RXDA 2HGTH 1TNIA 3HPTB 5JB8S 3ITIA 1PJPA 2EI6A 4LXBH 1G32B 4X1SU 5JB9S 5DP7A 1ANEA 2C93B 4AB9A 1GBEA 1CHOG 3IWMA 1QBVH 5GPIB 1Y8TA 1ZYOA 1NFYA 2ZP0H 4NIWA 3LGWA 9LPRA 1HJ8A 2BD8A 3I78A 2FS8A 4I8JA 1N6XA 4X6PA 4GHTA 1AMHA 5DPAA 2WYGA 4J1YA 3A7TA 5AHGH 1TAWA 4FUEA 4X2YA 4YM9A 2QN5T 3GY3A 2XTTB 1KXEA 3HGNA 3LGIA 1OOKB 1Q31A 4NWLA 1F5KU 1S6HA 4OS7A 8GCHG 2FYQA 1GHWH 4ESTE 2ZKSA 3MH5A 1GBKA 4Y79A 1L1NA 1UO6A 4ISOA 4ZKSU 1OP0A 1BHXB 2P94A 4FU8A 1EJNA 4SGBE 1SGNE 3M35A 4WY3A 5CMXH 3CS0A 3GDUA 1O2PA 3Q3XA 1P2KA 2G8TA 5T6GA 1DOJA 1EATA 1Z7KA 3ZVFA 5A2MH 1AFQB 8ESTE 2WPLS 1MD8A 2PSXA 5FAHA 1B5GH 2C4FH 3SO3A 1MTUA 4B1TA 1THSH 3GDVA 5T6DA 4YO9A 3KEEA 4AOQA 3TLOA 3P6ZB 1A2CH 1KTTB 3RXHA 4CHAC 1UTOA 1F5RA 4AGJA 1LQEA 5LGOA 1GDQA 3RLYH 2QA9E 1J9CH 2O8WA 2PWXA 1YPGH 4O03A 1IQIA 1LKBA 4CRBA 1V2MT 1FY3A 1BJUA 2P59A 4CRFA 1WU1A 3A7VA 1V2LT 1DANH 3Q3KA 5L2YH 1W13U 2ZGCA 2FX4A 4AX9H 3F9GA 1S6FA 3KCGH 1QL9A 1Y3XA 1MZAA 7GCHF 2FLRH 4RKJB 2Z6BD 4J2YB 1BIOA 1K1IA 1GL0E 3O8DA 2BD7A 2Z9JA 3BIVH 3MTYA 1L4ZA 1ESTA 4NIVA 1JXPA 1KXFA 2AGGX 4I8KA 1BRCE 3PMHB 3SU2A 2G52A 1SLUB 1O2OA 4TWWA 4A1TA 1O3DA 4AFQA 1GBHA 1QHRB 7ESTE 3BTME 1V2NT 3GICB 3SUFA 2QXGA 1V2KT 4FU7A 3P8GA 1RD3B 2PKSC 1YPHC 5EXMA 2GTBA 3URDA 3ATWA 2AMDA 2R2MB 2G00A 2DE9A 2ZFFH 4RKOB 1JRTA 1GI2A 1SQOA 2GMTC 2BXUH 2ALPA 3B23B 4CREA 1GI5A 2QXHA 3MH7A 4FXGH 1UVTH 2XW9A 1AWFH 1EPTC 1GI8B 1CHOF 1YPHE 1GGDC 2A2XH 1C1MA 4AORA 2SNVA 1SOZA 2WPJS 1GMHG 3F9EA 2XYAA 1NESE 4X1RU 3RM2H 2Q1JA 2PHBA 1C1NA 1MKWH 1NM6A 3ELAH 2C8ZB 1GBCA 1GI7B 1SQTA 3S9AA 1SGCA 3PTNA 1TPOA 1G37A 4X8UH 2A7HA 2TGPZ 1NN6A 1MBQA 1ANCA 3RXIA 1JMOH 4NGAH 1AHTH 2A4QA 4XOJA 1QB6A 1O34A 1ELDE 3HK3B 2OQUA 3VB4A 1NRNH 8GCHF 3U1JB 2FOGA 2UUKB 2GCTB 3KQCA 1AVWA 1EAXA 2UUFB 1EASA 1BMAA 1VZQH 2FESH 1OX1A 1WTHD 2SFAA 5F8TA 1OWIA 1GBLA 1BBRH 4B2BA 1VCQA 1XUGA 1DM4B 1KXCA 1UTKA 1TMUH 3AASA 3SGQE 1G3BA 4YLUA 1O2JA 1EZQA 1J14A 3BTTE 1SLVB 2G5NA 2THFB 2GV7A 2HLCA 3SV6A 1A0LA 3PV4A 1ARBA 1SGTA 1IQEA 1XUKA 3EYDA 2ZHFH 2CV3A 3A86A 2BDBA 4K2YA 5J4SA 1MMJN 5EODA 1A5IA 1YPJH 3UOPA 2ZFRH 2K1QA 4JZDH 1O31A 1BRBE 3ZZ3A 1A3EH 1AU8A 1GHBG 2ZIQH 1JIMA 4QT8C 5A0AE 1FXYA 1D3QB 3T2NA 1ZRBA 4OS5A 1ELVA 2ZWLH 3EDXB 2ZU1A 4IGDA 2TRMA 2QF3A 5ESBA 1LHEH 1GI0A 1OWDA 1SC8U 2ZPRA 4VGCB 1G2MA 1W10U 1GBIA 4OS6A 1O5AB 1DSUA 2G4UA 2SGDE 2Y80A 4NZQA 3RXPA 4SGAE 4ZHLU 2QIQA 1L0ZA 5DP8A 1W2KH 4XFQA 1ZHPA 4ZHAA 1WYKA 2R9PA 3MU8A 2GZ7A 2OC7A 2BD3A 3S9BA 2V0BA 3FP6E 1D6WA 1W3CA 5G4BA 2BVRH 3BV9B 1CVWH 4D7GA 1Z8GA 1O35A 2A1DB 1P10A 1E35B 1N1LA 5ESTE 3VPKA 1TQ0B 3TVJB 4IC5A 1LVMA 2BZ6H 2NU2E 1UK4A 2UUYA 1C1OA 4Y11E 1GMCG 1OWEA 3MNBA 4Y10E 2JH5D 1C5WB 2Y7XA 3RC4A 1RTKA 4LZ1H 1IQNA 3SNBA 2Z7FE 3TJUA 1GVLA 1N8OC 3RMNH 4U32A 1CHGA 1MU8B 3UUZA 1XUIA 2BX3A 4ABIA 2W7UA 1A0HB 4ZUHA 1H9IE 1BITA 1O3KA 1BUIA 5TJXA 1GMHF 1QY6A 4TY6A 2CMYA 2ODPA 3RXUA 4D76A 5GIBA 1QFKH 3GY4A 1MUEB 1ETSH 2BY9X 1D3DB 1T8OA 2XC0A 4KELA 4FUDA 3ENSB 4CRDA 3RUOA 3TGKE 1P9SA 1UVUH 4D7FA 1C2LA 3A87A 5K7RA 2FI3E 3SJIA 2PGQB 1YPEH 1V2ST 4H6TA 2C3SA 1GVKB 4Q2KA 1P05A 2UUJB 1E36B 1M9UA 2ZPSA 1DY9A 1HXFH 4R0IA 1IQFA 3M3TA 2XBXA 5CE1A 2STBE 1AFEH 3UOUA 1MQ6A 4DIIH 2ODYB 3M36A 3OU0A 2SGAA 1DXPA 4K1SA 4X0WU 3U9AH 1C5NH 2C8WB 1GHYH 4WH8A 2FS9A 3BSQA 1V2RT 1CU1A 1DT2A 1HAVB 5FX6A 1NPMA 1C1TA 4IW4E 2ANKH 1Y3WA 4O9VA 2O9QA 1CT0E 2J92A 2BDAA 1DFPA 5ETXA 2VIQA 1EB1H 3DFJA 3E6PH 3M3SA 3SV8A 1P57B 1DDJA 1SLWB 3RMOH 2BTCE 4YT6H 1QA7A 1PPGE 2GV6A 3GOVB 3F9FA 1XXFA 3F9HA 1A5HA 2PKSB 1C2KA 1KLIH 2OXSA 2ZU2A 1VITF 3QZRA 1OYTH 1S83A 1UTQA 1WV7H 5FHTA 1O2LA 1S0QA 1QRXA 1SGEE 4LZ4B 2GMTB 4JZFH 1GHBF 4ISLA 2AMQA 1VITH 2D1JA 2FYRA 2V3HH 1TGCA 4KKDA 1EX3A 2BD9A 2GDDA 2F9UA 4HGCA 1BMLA 4BTTB 5A8ZA 1AB9C 3M5NA 4ZROA 4E06H 1OWHA 1E37B 5EPYA 1O2NA 1QRZA 1J15A 1GJ7B 1SVPA 2ZGXH 1C5PA 3A7XA 1Z8JB 3KGPA 1O32A 2HNTC 4ABHA 2VIVA 1O3PB 1MH0A 1TX6A 1YCPH 2DE8A 2PKAA 2WINI 2V3OH 2XBYA 1O3EA 1O2VA 2FOBA 2A32A 5EQRA 2ZEBA 2VWLA 4AG1A 3E91A 5GDSH 1QNJA 1A4WH 3CS7A 4M7GA 1S5SA 4MVNA 2VNTA 3LGYA 6LPRA 2TGDA 3U8OH 1FN8A 1YP9A 2QYIA 1H9HE 1D3TB 2ZCHP 1TGSZ 1F7ZA 1GMCF 3ZVCA 3K6ZA 4Q7YA 3U8RH 3KF2A 1XUJA 1DLEA 1F0UA 2CN0H 3UNRA 1RXPA 4Y7AA 1DLKB 4JK5A 1FJSA 2XCFA 1C2MA 1EQ9A 1KDQA 4MNWA 4JYUH 1AVXA 2SNWA 3TGIE 1TBQH 1JWTA 3A80A 1RIWC 5L6NH 1E38B 2HNTF 4MDSA 1P01A 2BDCA 1BB0B 3U1IB 1TQ7B 3RLWH 2H5CA 4Q7XA 1OPHB 4NCYA 2GZ9A 1TNJA 1HLTH 2CHAB 1O2GH 1W7GH 3Q76A 4UD9H 2QY0B 3MU0A 1TA2A 3S7KB 1GDUA 3BG8A 4NA8A 2ZTZA 1C2HA 3ZVGA 1FUJA 2FWWA 1Y5UT 2GZ8A 3LH3A 3ATMA 4X1PU 1H8DH 1YPKH 1GCTC 2W26A 3KQDA 2ZGHA 2BX4A 1OWJA 1W14U 1O2ZA 2BLQA 3A88A 3MU4A 1G2LA 3ZVDA 3D62A 3SN8A 1A3BH 1AIXH 1YCPM 3RXRA 1BTZA 3P8FA 2RA0A 2VH0A 3SNEA 1HGTH 3UQOA 3DA9B 4B75A 3BEUA 3K2UA 4Y7BA 2B0FA 3ZZ6A 4A7IB 1WAYB 2HRVA 1S0RA 3EA7A 1B0EA 2BQWB 1P2MA 3R0FA 3VGCC 1E34B 3MO9A 3ZVEA 4HTCH 3H7TA 3SU5A 1Y3UA 2ZFTA 1FY5A 1WTGH 1MU6B 1RFNA 2F9VA 4UEHH 1DICA 1DITH 1C1WH 1AKSA 3W94A 4BAKB 2WPMS 4FUBA 2LNCA 4D8NA 5A0BA 3KHVA 3SW2B 2TBSA 4DW2U 5EOKA 2ZCLP 1FZZA 1N8OB 3S0NA 1OYQA 3E3TA 1C5VA 4JYVH 2FOEA 2SGQE 2PSYA 1LPGB 2JH0D 1T8NA 3SNDA 1O5EH 4CRGA 3BEIB 1DUAA 3C27B 5JYIA 1O3CA 2TGAA 3RXSA 5EGMA 3GCHC 3R3GB 2GT8A 1UVSH 3PO1B 3UFAA 1HYLA 4WH6A 4LOYH 1QJ1B 1F5LA 1MCTA 4OS1A 1Z1IA 2B7DH 2VVCA 5A8YA 4K8BA 2FOFA 3K9XB 3MMGA 1DWBH 1K21H 4KGAA 1V2JT 5LPEA 7LPRA 3QLPH 4FU9A 1KXAA 5C1XA 4JCNA 4AGKA 1NS3A 1HDTH 5JBTA 4FUFA 5CHAC 2P93A 2QV1A 1KXDA 3OSYA 1C2FA 4ZXXH 1WQSA 2A2QH 3PB1E 3TU7H 1UVOA 1O2RA 5DP5A 1SSXA 2HALA 4Y71A 3I77A 2JH6D 1VJ9U 1BTWA 1D4PB 3M37A 1XMNB 1F0SA 2P8OB 4WVPE 1BT7A 5L30H 2KAIA 1YYY1 4Y0ZE 1T32A 4X1NU 1LVOA 1V3XA 3KIDU 3BG4B 1JIRA 3I29A 1IOEA 2JETB 1ELEE 5A8XA 2J94A 3F68H 1INCA 5IYTA 3E8LA 4DY7B 2NU3E 1ACBE 1D3PB 1H4WA 5GWZA 1S81A 1TABE 3M3VA 2EI8A 2WUBA 4TY7A 1O2HA 2FOMB 1BTXA 3A7YA 4WXVA 5FBIA 1SFQB 3FVFB 1TYNA 4GAWA 3BTQE 2XC5A 2ANWA 1ZHMA 2VINA 2SGPE 2C8YB 3D23A 2FTMA 4XDEA 3RXGA 1AB9B 2A4OA 3GDSA 3M7QA 3MWIU 1EZUC 1SPJA 3BTKE 5DO4H 1NY22 2F9OA 2IPHA 2V6NA 2ODQA 1WBGB 2OP9A 3D65E 1IAUA 3MNCA 1G3CA 2EEKA 5BRRE 1XVMA 1HV7A 4D9RA 4MPVA 2BVXH 2B8OH 1DUEA 4ABBA 3ATLA 1PQ7A 3MU5A 1ZTJA 2ZU5A 4R8TB 4GCHG 5E0JA 4WMEA 5C1UA 1Y5BT 3L3TA 1WCZA 2OLGA 3PWBA 3EA8A 3LKWA 4YOJA 1GI4A 3ATKA 1QJ6B 1CGHA 4CRAA 1BQYA 2PGBB 1GJBB 5AF9H 1TWXB 1OWKA 2XWAA 3O8CA 5DP4A 4OGXA 1HNEE 6CHAC 3URCA 1EZXC 1SBWA 1T7CA 1ID5H 1C5UA 1PQ8A 1JRSA 2Y7ZA 4AZ2B 3LPRA 2BZAA 1DY8A 3SJOA 4Y6DA 1AY6H 1YC0A 1GJ6A 4X8VH 4DGJA 4JK6A 2A0QB 2BY8X 4JZIA 5FX5A 1V2TT 3VB5A 3A82A 3EQ0H 1C2IA 3U8TH 4UFGH 1RIWB 4IN2A 2FLBH 1C5YB 1MCVA 2ZGBH 1MBMA 3SGBE 4A1XA 1TNGA 2GX4A 1P3CA 2G4TA 2AFQB 1AGJA 2A5KA 2WV4A 3A7WA 1C5XB 1LQDB 1MTNB 4DVAU 2GDEH 2XBVA 1VCPA 1THPB 3QGNB 1LPKB 4H42U 3TJVA 2PFEA 5EW1H 5B6OA 1TPPA 2PV9B 3RXKA 2H5DA 4YT7H 1P2JA 4WF8A 4ZHMU 3SU6A 2H6MA 3VEQB 3HATH 2OD3B 1ORFA 4IMZA 3RC5A 4YESB 4MPWA 2P3TB 1TNKA 2F3CE 1C4U2 1IHTH 1MTSA 5FCRA 1ZGVA 3V12A 1ZJKA 2A45B 1DX5M 2BQ7B 3SU1A 4BNRA 3ZV8A 1C1SA 1IQGA 1LHGH 1QRWA 1TRNA 1GG6C 4K69A 2CF8H 3VGCB 1QB1A 1QB9A 4BTUB 2C8XB 3LU9B 4OS2A 2Q6GA 1TBRH 3IITA 1FY4A 2FODA 2BOKA 2R3UA 1ESAA 1QBOA 4TYDA 1O2SA 2HPPH 1FAKH 2W3KA 2ZA5A 2FDAA 2FP7B 3PTBA 1DWEH 3P8NA 3RM0H 2PTNA 5DK1A 1FPCH 3EAJA 4ISHH 3SQHE 1P04A 2P95A 3FP8E 1BJVA 3UREA 2H2ZA 1XXDA 2W3IA 2VVVA 4KTUA 3QUMP 3A8DA 4BAQB 1OSSA 1KTSB 1SGFA 1NRPH 4UONA 4A1VA 2P3UB 4X6OA 2O8MA 1GJCB 5F03A 1Q3XA 4KTCA 4Y8XA 3ZZ8A 2VJ1A 1EAWA 4ABFA 1G3DA 1ESBA 4XE4A 5JBCS 3TIUA 3FZZA 4X6MA 3ZZ7A 2ZG0H 5PTPA 2ESTE 1YPMH 3PWCA 4GCHF 1C5QA 1O39A 4NSVA 4AFUA 1W0ZU 1BZXE 2GVFA 4GSOA 2XC4A 5FPSA 3ZVBA 5JBAS 2A7CA 2XRCA 1TGBA 1GBBA 2J9NA 4K8YA 1PQAA 2QC2A 3T5FH 5GCHG 3GYLB 1T8MA 3UWJH 3SBKA 5C20A 1BA8B 1EOLA 3S69A 2UWOA 1FLEE 2G81E 2F9PA
chains in the Genus database with same CATH superfamily
5SGAE 3OEED 1A7SA 2A4GA 4RT1A 1A1RA 1UK2A 2CJIA 1TRMA 2WPIS 3AAUA 1FN6A 3GCNA 1EXFA 2WPKS 3OTJE 4DT7B 1WSSH 1C2EA 1HPGA 1AE8H 1VGCC 3SYJA 4D9QA 2FX6A 3ZZBA 1AZ8A 1O3IA 5EQQA 1LCYA 2F4LA 3QTOH 1CBWC 4DJZB 1OKXA 6ESTA 2WV5A 3N7OA 3QZQA 1HAPH 2V7QD 2TPIZ 2W7SA 1YLDA 1FONA 3BN9A 2YNBA 4DIHH 1L2EA 5C67A 2J5UA 2ASUB 3ATIA 4AYYB 1C2JA 4BAMB 3SU3A 5I25A 1NFWA 4K60A 4CHAB 1ZR0A 1O3FA 4XBBA 3MNSA 3OYPA 1LVBA 3DD2H 1HAIH 3BTEE 1UCYE 2ANMH 1SR5C 1W8BH 2QXJA 2BQ6B 3OEHD 1O30A 4X2VA 4K5ZA 4HFPB 2G51A 1FAXA 2RCEA 1E0FD 2Z9LA 2R0KA 2ZQ1A 1KSNA 2J2UA 1FY1A 1TGNA 1S84A 4X1QU 1O2TA 1UTJA 3ZYEA 1ARCA 1O2YA 1SOTA 1TOMH 4TPYA 4GVUA 1HAXB 1YWUA 2W5EA 3KL6A 4ZKNU 4ACBA 2OC8A 1O33A 1Y59T 1BDAA 1Z6JH 2ZDAH 2LP6A 1X7AC 3GY7A 3VG8A 3MU1A 1MAYA 3UWIA 1O36A 1AN1E 3KN2A 1DSTA 4HZHA 1QTFA 2QCYA 1CA0C 5FXLA 2RA3A 1O5CB 1KXBA 3O8BA 1QBNA 4P00A 3QX5H 4MG3A 1HAGE 2WUCA 1IQHA 3VB3A 1AI8H 1O5FH 1BTPA 5DG6A 1A5GH 3E16B 2BY6X 4HI3A 1L4DA 1NRQH 1KMHB 2ZI2H 1DPOA 1O3GA 1GHXH 1KIGH 3GISB 4K1EA 3Q77A 4BTIB 1P12E 3GY2A 5KEDA 1SGFG 3JZ1B 1G3EA 3QTVH 3W95A 1HAYB 1BMMH 2F9NA 2Z9KA 1K1LA 3V3MA 4MTBA 1C4Y2 2A5AA 1EPTB 1NROH 1MABB 3PRBA 3PRDA 1QL8A 1GGDB 3A8AA 2QXIA 4Y8ZA 4ISNA 4B74A 1C5OH 1QZ8A 1T31A 2HVXA 2OQ5A 1GHZA 1AFQC 3LH1A 3SJ8A 2RDLA 4FUCA 1GI6A 2BY7X 2SGEE 5EG4A 2OTVA 1HXEH 1NC6A 2VVUA 1AD8H 1HJAC 4OS4A 3F1SB 3FO8D 5A09A 2PTCE 1CT2E 1SL3A 4XBDA 3TJNA 1P2NA 2HWLB 2NU4E 3ZIAD 2AERH 5GCHF 3A84A 2R3YA 2D2DA 1SLXB 5EU8A 5TCAA 4CH8B 3NKKA 2QAAA 1SHYA 3MH6A 1K1NA 2AH4X 1GJAB 2AIQA 1BCUH 3SNCA 1TALA 1BHXF 2AMPA 1HAVA 1A0JA 5KGOA 1PFXC 1GG6B 1P06A 4GHQA 4X2XA 1AE5A 4I7YH 3NZIA 5HGGA 1HIAB 4ZXYH 3ZZ4A 1UK3A 1UTNA 3CP7A 3QDZB 1G9IE 3QWCH 4PROA 5LPRA 3DSGA 3LJJA 1EKBB 1YGCH 1P8VC 1WDIA 2YOLA 3LIWA 3LGTA 1TNLA 1ZPBA 2VU8E 1O3NA 4DG4A 1XUHA 4X2WA 1EJMA 3UAIC 2FOHA 1UCYK 4IS5A 3NK8A 1Z1JA 3RMMH 3BF6H 2QF5A 4B2CA 4I8LA 4WMDA 5F8ZA 3RXJA 1TFXA 2ZGJA 3QK1A 1GWAA 3GCTG 2XCNA 2BDHA 3PV5A 4YTAA 3MOCA 3TITA 1B7XB 2O8TA 1PQ5A 1LHDH 2ZQ2A 3OY5U 3TH4H 2ZTXA 4ISIH 3RXTA 5DJ7A 2STAE 1TNHA 3RXBA 4E05H 3LONA 2DUCA 1Y5AT 2F9BH 5T6FA 2OUAA 1K28D 3H5CB 4YLQH 3MHWU 1ETTH 2ZFPH 1ZSKA 3ODFA 2VIDA 1AO5A 1YF4A 2VWOA 1RGQA 1AWHB 4CBOA 2B5TB 2VGCC 3L33A 1YBWA 3T28A 1CSOE 2J38A 2F91A 4JZEH 1V6DA 1GBDA 3C1KA 1P3EA 3SJ9A 2Y5HA 4O97A 2G55A 3N7DA 1BRAA 3PROA 4YZUA 2JJ2D 4Z1MD 3FZDA 3LC3A 3AW1A 2XBWA 1GBJA 3ZVAA 2AS9A 1H8IH 1O2MA 3E1XB 2AEIH 4IN1A 3LGUA 2R0LA 1GMDG 1CGIE 3ZZAA 1GVZA 2FOCA 2GCTC 2VIOA 3BIUH 4BAOB 1RRKA 1GCDA 1IHSH 2BLWA 2ZDVH 3KNXA 1ZSJA 3D49H 1ANBA 1HRTH 1UHBB 4FVDA 3K6YA 3KYGA 5F8XA 1K9OE 4CR5A 5LH8A 4IMQA 2ZDMA 1GBAA 4GLYA 2YMSD 3BTWE 1ZTKA 2XOKD 2SGFE 2BYAX 1ELFA 1YCPK 5CDFE 3T29A 1OP2A 1C5MD 3A83A 2EY4C 4AG2A 4Y0YE 9ESTA 3VB6A 1C2DA 1NRSH 1XM1A 2JKHA 5H4IB 4CH2B 1QCPA 1T4VH 1EP6A 4I8GA 4NFFA 3LGVA 2BLVA 1DS2E 2CXVA 1RJXB 3TPIZ 2ZFQH 3OY6U 1NT1A 1SI5H 1ELGA 3GCOA 1AUJA 1Y3YA 1J8AA 4CR9A 1C1UH 1K1MA 1HFDA 3SU0A 4VGCC 1OS8A 2RDEA 5C5OA 3SNAA 3TNTA 1K1OA 2NU1E 3ZZCA 1ELAA 1B0FA 1CA0B 4NFEA 4NZLA 4ASHA 2PW8H 4BXSA 1SFIA 4GPGA 3SI4H 1QA0A 2FO9A 2IJOB 4JYTA 1F0TA 1C9PA 1THRH 1TRYA 5HXFA 1NFXA 3M61U 1FQ3A 3F2FA 1BTHH 2V35A 1MZDA 4DURA 2ZHWH 3GY5A 2FPZA 1AUTC 2BD2A 4U30A 3IG6B 2QE7D 3ZZ5A 1UHBA 1O3MA 3P17H 4OGYA 2ZU4A 1TX8A 3QGJA 4O3TA 4UFDH 1LMWB 1T4UH 3GCTF 1BRUP 1IQLA 1Q2WA 3M5OA 1C1QA 3RXAA 4ABJA 3NXPA 1EAUA 2ZCKP 4WJG2 3UNSA 1LDTT 5E0GA 3FFGA 1P2QA 1QJ7B 3V0XA 1QIXB 4UFFH 1EP5A 1F2SE 3KYFA 1GHVH 2W6JD 2P16A 1YLNA 3OTPA 4RSPA 2Z3DA 5B6LA 2ZFSA 1VCWA 1ABJH 4X6NA 3KQBA 5AFYH 1UTMA 3SOSA 2FM2A 1HJAB 3M5MA 2Z3CA 2BB4A 4MPXA 5LPFA 1MKXK 1O2QA 1CQQA 1O3OA 2BXTH 1HAOH 3F0OA 1CT4E 3RU4T 1QQUA 5HM9A 3UQVA 1FDPA 4NSYA 1C5ZB 2VWMA 1ELCA 3T25A 2BDGA 3TK6A 3LDXH 4ZKRU 2CGAA 5E2OA 4MPUA 1YKTA 2BVSH 1GMDF 4HG6A 4U2WA 1LO6A 2PP6A 1O3JA 4UE7H 1C1RA 1ZJDA 1O38A 1SB1H 1ZMJA 1P0SH 3RXLA 1F92A 2AYWA 3MO6A 5HYOA 4X8SH 4AFSA 2KX4A 3E0NB 3RXCA 2OC0A 3KQEA 4FUGA 3A8BA 4B76A 3S7HB 1UVPA 1K22H 2D8WA 4TPIZ 2ANYA 1HCGA 1QL7A 2GCHG 3SUDA 5C17A 1ANDA 2ULLA 3T27A 4JMYA 5C2ZA 3OE7D 3HKIB 1PPEE 3T62A 2Y6TA 3RP2A 1Y3VA 2O8LA 3BEFB 3HGPA 1XX9A 3S9CA 1PPFE 1IQJA 2HOBA 3RDZA 5DP9A 3A85A 3PLBA 3UTUH 3U69H 4Q7ZA 3UPEA 3LT3A 1DWDH 2AIPA 1LTOA 2BOHB 3GS9A 2L74A 2ZDKA 3PLPA 2BLOA 2QF0A 2A7JA 2PUQH 4THNH 1TA6A 4I33A 3UY9A 5L2ZH 1GCTB 5AVDA 4AN7A 1O5DH 4WXIA 2OBQA 4I8HA 1IQMA 4Y76A 1GJDB 1O2XA 3DHKH 2HLDD 2LPRA 2VIWA 1V2VT 3MNXA 1C4V2 2VGCB 4TWYA 3NWUA 3Q3YA 3DFLA 1UTPA 1GJ4H 3OX7U 4DT4A 5IDKA 3UNQA 2J95A 3LJOA 2WSSD 2WZQA 2QF4A 3FANA 1BBRE 1EOJA 1GI3A 1ZZZA 2H9TH 2UWPA 1ETRH 3ODDA 3V7TA 3W1EA 2R2WU 2GT7A 1PPBH 2I6SA 3B8JA 3T26A 3RC6A 2HPQH 4AB8A 5JPMH 2F83A 2UWLA 1PYTC 2PR3A 1P9UA 1KYNA 2ZU3A 3K65B 5EXNA 1FMGA 3SU4A 2FXRA 1QR3E 1JOUB 5EIYA 1KLJH 2GGVB 3ESTA 1CA8B 3P95A 3O8RA 4INKA 1JBUH 1LKAA 1ZGIA 1ZLRA 4BOHA 3HK6B 5EQSA 1C1PA 1MAXA 1GI1A 3GYMA 1TLDA 2FTLE 1MTVA 1O2UA 2VWNA 4E7NA 1ZTLA 2IJD1 2B9LA 4U01A 1EJAA 4MNYA 1N6YA 5C5NA 4E7RG 1CO7E 3FOAA 3AAVA 3VFEA 2BY5X 4YOIA 1ZSLA 3GCHB 2Z3EA 4NIYA 5EW2H 1GPZA 4K1TA 3TK9A 1Z71A 2CF9H 1O5BB 1TX7A 1LVYA 1NU7B 1SMFE 3PM3A 4B2AA 4XSKU 2CHAC 1DVAH 1VITG 2GD4B 3P92A 2J98A 2M5TA 1XKAC 2VH6A 2Z9GA 3SJKA 4MQAA 3ZYDA 1O2IA 1Z6EA 5CHAB 3RXFA 3P8OA 3MFJA 1Z8IB 1FX0B 1EB2A 2BDIA 2I6QA 5C0UA 1UW7A 4CRCA 4ZMAH 2ZDNA 1TOCB 4NWKA 2GKVE 2J34A 1O37A 1QURH 2RFKC 4WMFA 1BMFD 2YNAA 4F4OC 3M7UA 1BMNH 1NZQH 1UMAH 4INLA 3U98H 4OM9A 3GY6A 4DOQA 1O3BA 2GCHF 2BMGB 3M5LA 3A8CA 1P02A 1GJ9B 3P70B 1W0JD 2C90B 4KTSA 4NA9H 1GJ5H 1RTLA 2TIOA 2IN2A 1PYTD 1C1VH 2BDYA 1HUTH 1ABIH 1K1JA 2O8UA 3TGJE 4FUJA 2ZTYA 4XBCA 1HB0B 4FUHA 4I31A 4M9FA 1H8ED 1H9LB 2CK3D 1MKWK 1HBTH 2A4RA 1ELTA 3RMLH 1D6RA 2FOAA 4A6LA 4ABAA 3Q00A 1TPSA 3NUMA 4UFEH 5I46H 5A0CA 2Z94A 1TMTH 3AW0A 4ZAEA 5JDUB 4ABEA 1QQ4A 6GCHG 3SGAE 3FP7E 5EJ1A 4BXWA 1SGQE 1TIOA 2H1UA 3SV7A 1SGIB 1O2WA 3A7ZA 3ZZDA 3TNSA 3PMJA 1SKYE 1TGTA 3EE0B 2AGEX 1SGRE 2WHXA 1GBMA 2KZ4A 1Z8RA 1P2OA 1J17T 1DXWA 3SV9A 3PO1C 2G5VA 5DP3A 3V13A 8KME2 2VIPA 1PPHE 3STIA 1RS0A 2Q6FA 1BBRK 4CBNA 3PLKA 2ZZUH 3SUEA 1TBZH 3FAOA 1P09A 3NPSA 3VXFH 1GL1A 1L1GA 1UCYH 1H1BA 3BTFE 2EA3A 2D26C 1HAZB 1V2OT 1EAIA 2BD4A 1CGJE 1C5SA 6CHAB 1VJAU 2ZHDA 3RXQA 1SGDE 1VR1H 4MNVA 4MNXA 2ZHQH 1HAHH 2GP9B 2PKAB 2A5IA 1DE7H 1ZOMA 1UJ1A 2OCVB 2PUXB 1MQ5A 4NIXA 3SZEA 1GHAG 4B6FA 8LPRA 1YPLH 5FPTA 1NU9A 2P3FH 1O0DH 1CE5A 3GY8A 2P8OC 4WWYA 5C1YA 1KY9A 1QGFA 3DT0H 4O3UA 2XXLA 3E0PB 1MD7A 2NU0E 2ZNKH 2WPHS 3BG4C 2JETC 2ZPQA 4DCDA 1W11U 3SHAH 1V2UT 1KDQB 4KP0A 2Y81A 1LPZB 3BTHE 3F2HA 4ZKOU 1PPZA 5DKMA 2XNIA 3AK5A 1OXGA 3HKJB 4LK4A 2NWNA 3SI3H 1C9TA 1TPAE 1SGPE 3SV2H 5HMAA 5GXPA 1J16A 3MO3A 3QN7A 7KMEH 4A92A 3RXEA 4K3JA 1YM0A 1ZHRA 3SUGA 3BTDE 5TCCA 2OINA 2OC1A 4A5TS 3TH3H 1NFUA 1SQAA 3PMAB 1A46H 5FL7D 3RU4E 1S85A 2RG3A 3MYWA 1NRRH 2BHGA 2M2AA 5E0HA 1GI9B 2ZF0H 4B6EA 1XKBC 5T3HA 2XWBI 1NTPA 3EGKH 3UR9A 4B71A 1KLTA 1FY8E 2FIRH 1C5TA 3NCLA 1C2GA 3RXVA 2FZZA 1S82A 2FMJA 3F6UH 3N7EA 1EZSC 1FIZA 1P03A 2OK5A 1NO9H 3OAAD 5E2PA 2IOTA 1SG8B 1SQRA 4BAHB 5FCKA 5K0HA 4MLFB 2EI7A 2PLXA 1O3LA 4IBLH 2OBOA 2HNTE 2BM2A 2EC9H 2H9HA 4Q4LA 1AZZA 1EUFA 2WYJA 4BANB 1A61H 5GJ4B 1O3HA 1OP8A 2BD5A 1WOFA 1O2KA 5EXLA 1HJ9A 3UIRA 1GBFA 2YMSC 2ZDLA 4JZ1A 4ABGA 1ZPCA 1FPHH 1TE0A 1C5RA 6GCHF 1BTYA 1FIWA 4IC6A 3STJA 1YLCA 3JZ2B 1AKSB 1PPCE 1SHHB 2ILNA 3AVZA 1EPTA 2H9EH 4X8TH 3LC5A 2F43B 5EPNA 3SZNA 3SQEE 1F0RA 4FUIA 1AVGH 2Z9IA 3G01A 4GUXA 1LHCH 4H4FA 3E90B 1FV9A 1ELBA 2A31A 4F55A 1MTNC 1XUFA 3EA9A 3B9FH 4H6SB 1WUNH 5E8EH 3LOXA 1E1QD 4FVBA 3RU4D 3H7OA 1W12U 3VB7A 1V2WT 1ZMNA 4INHA 5FBEA 2ZECA 1K2I1 5DP6A 1O5GH 4Y8YA 1TB6H 1BOQA 4AYVB 4I32A 1RTFB 4F49A 1W7XH 1P11E 1L1JA 3DUXH 1D9IA 3TK5A 1K1PA 3BTGE 1XVOA 2VB0A 4ABDA 4B73A 3SORA 3TJOA 4UDWH 1MTWA 1HIAA 3PMBB 1SGYE 1WQVH 3A81A 3CENA 4Z0KA 2Y82A 2FI4E 5FPYA 3QO6A 1O3AA 5JBBS 1GHAF 1UTLM 2FEQH 3SHCH 2ZC9H 1P2IA 2J4IA 1VGCB 3MH4A 1U6QA 3TH2H 4YXWD 4YOGA 3WY8A 1ZPZA 1CBWB 7GCHG 5BPEA 2ALVA 1T8LA 1ZRKA 1V2QT 1MKXH 2ZO3H 3M7TA 4RN6A 1G36A 1TMBH 1ZMLA 5DGJA 1IQKA 5AFZH 3UR6A 5F6MA 3ZZ9A 2JDID 3ZV9A 2KAIB 2QGRA 5C3NA 1TONA 1GBTA 1LHFH 2Y5GA 1G30B 3RXMA 2KM0A 4NA7A 4FETA 1C5LH 1DWCH 3VXEH 3L6PA 4Q80A 5J4QA 1FNIA 4Z6AH 4AC9A 5HM2A 2Q6DA 3RXOA 1GDNA 1GJ8B 2FI5E 2Y5FA 4AFZA 1V2PT 4ZH8A 1W0YH 3A89A 2ZHEH 3MI4A 2KR7A 1AQ7A 4NG9H 1FI8A 3PYHA 2J97A 5ABWA 1BTUA 2TGTA 2AGIX 3RXDA 2HGTH 1TNIA 3HPTB 5JB8S 3ITIA 1PJPA 2EI6A 4LXBH 1G32B 4X1SU 5JB9S 5DP7A 1ANEA 2C93B 4AB9A 2XNDD 1GBEA 1CHOG 3IWMA 4TT3D 1QBVH 5GPIB 1Y8TA 1ZYOA 1NFYA 2ZP0H 4NIWA 3LGWA 9LPRA 1HJ8A 2BD8A 3I78A 2FS8A 4I8JA 1N6XA 4F48B 4X6PA 4GHTA 1AMHA 5DPAA 2WYGA 4J1YA 3A7TA 5AHGH 1TAWA 4FUEA 4X2YA 4YM9A 2QN5T 3GY3A 2XTTB 1KXEA 3HGNA 3LGIA 1OOKB 1Q31A 3N99A 4NWLA 1F5KU 1S6HA 4OS7A 8GCHG 2FYQA 1GHWH 1EFRD 4ESTE 5C0TA 2ZKSA 3MH5A 1GBKA 4Y79A 1L1NA 1UO6A 4ISOA 4XRNA 4ZKSU 1OP0A 1BHXB 2P94A 4FU8A 1EJNA 4SGBE 1SGNE 3M35A 4WY3A 5CMXH 3CS0A 3GDUA 1O2PA 3Q3XA 1P2KA 2G8TA 2KCPA 5T6GA 1DOJA 1EATA 1Z7KA 3ZVFA 5A2MH 1AFQB 8ESTE 2WPLS 1MD8A 2PSXA 3F3BA 1B5GH 2C4FH 3SO3A 5FAHA 1MTUA 4B1TA 1THSH 3GDVA 5T6DA 4YO9A 3KEEA 4AOQA 3TLOA 3P6ZB 1A2CH 1KTTB 3RXHA 2HVYB 4CHAC 1UTOA 1F5RA 4AGJA 1LQEA 5LGOA 1GDQA 3RLYH 2QA9E 1J9CH 2O8WA 2PWXA 1YPGH 4O03A 1IQIA 1LKBA 4CRBA 1V2MT 1FY3A 1BJUA 2P59A 4CRFA 1WU1A 3A7VA 1V2LT 1DANH 3Q3KA 5L2YH 1W13U 2ZGCA 2FX4A 4AX9H 3F9GA 2WV9A 1S6FA 3KCGH 1QL9A 1Y3XA 1MZAA 7GCHF 2FLRH 4RKJB 2Z6BD 4J2YB 3MQKC 1BIOA 1K1IA 1GL0E 3O8DA 2BD7A 2Z9JA 3BIVH 3MTYA 1L4ZA 1ESTA 3F0PA 4NIVA 5HIYA 1JXPA 1KXFA 2AGGX 3EE7A 4I8KA 1BRCE 3PMHB 3SU2A 2G52A 1SLUB 1O2OA 4TWWA 4A1TA 1COWD 2YMSB 1O3DA 4AFQA 1GBHA 1QHRB 7ESTE 3BTME 1V2NT 3GICB 3SUFA 2QXGA 1V2KT 4FU7A 3P8GA 1RD3B 2PKSC 1YPHC 5EXMA 2GTBA 5HIZA 3ATWA 3URDA 1VKYA 2AMDA 2R2MB 2G00A 2DE9A 2ZFFH 4RKOB 1JRTA 1GI2A 1SQOA 2GMTC 2BXUH 2ALPA 3B23B 4CREA 1GI5A 2QXHA 3MH7A 4FXGH 1UVTH 2XW9A 1AWFH 1EPTC 1GI8B 1CHOF 1YPHE 1GGDC 2A2XH 1C1MA 4AORA 2SNVA 1SOZA 2WPJS 1GMHG 3F9EA 2XYAA 1NESE 4X1RU 3RM2H 2Q1JA 4I86A 2PHBA 1C1NA 1MKWH 1NM6A 3ELAH 2C8ZB 1GBCA 1GI7B 1SQTA 3S9AA 1SGCA 3PTNA 1TPOA 1G37A 4X8UH 2A7HA 2TGPZ 1NN6A 1MBQA 3NRLA 1ANCA 3RXIA 1E79D 1JMOH 4NGAH 1AHTH 2A4QA 4XOJA 1QB6A 1O34A 1ELDE 3HK3B 2OQUA 3VB4A 1NRNH 8GCHF 3U1JB 2FOGA 2UUKB 2GCTB 3KQCA 1AVWA 1EAXA 2UUFB 1EASA 1BMAA 1VZQH 2FESH 1OX1A 1WTHD 2SFAA 5F8TA 1OWIA 1GBLA 1BBRH 4B2BA 2W6ID 1VCQA 2K0QA 1XUGA 1DM4B 1KXCA 1UTKA 1TMUH 3AASA 3SGQE 1G3BA 4YLUA 1O2JA 1EZQA 1J14A 3BTTE 1SLVB 2G5NA 2THFB 2GV7A 2HLCA 3SV6A 1A0LA 3PV4A 2LELA 1ARBA 1SGTA 1IQEA 1XUKA 3EYDA 2ZHFH 2CV3A 3A86A 2BDBA 1S6LA 3H09A 4K2YA 5J4SA 1MMJN 5EODA 1A5IA 1YPJH 3UOPA 2ZFRH 2K1QA 4JZDH 1O31A 1BRBE 3ZZ3A 1A3EH 1AU8A 1GHBG 2ZIQH 1JIMA 4QT8C 5A0AE 1FXYA 1D3QB 3T2NA 1ZRBA 4OS5A 1ELVA 5EJLA 2ZWLH 3EDXB 2ZU1A 4IGDA 2TRMA 2QF3A 5ESBA 1LHEH 1GI0A 1OWDA 1SC8U 2ZPRA 4VGCB 1G2MA 1W10U 1GBIA 4OS6A 1O5AB 1DSUA 2G4UA 2SGDE 2Y80A 4NZQA 3RXPA 1W0KD 4SGAE 4ZHLU 2QIQA 1L0ZA 5DP8A 1W2KH 4XFQA 1ZHPA 4ZHAA 1WYKA 2L6OA 2R9PA 3MU8A 2GZ7A 2OC7A 2BD3A 3S9BA 2V0BA 3FP6E 1D6WA 1W3CA 5G4BA 2BVRH 3BV9B 1WXRA 1CVWH 4D7GA 1Z8GA 1O35A 2A1DB 1P10A 1E35B 1N1LA 5ESTE 3VPKA 1TQ0B 3TVJB 4IC5A 1LVMA 2BZ6H 2NU2E 1UK4A 2UUYA 1C1OA 4Y11E 1GMCG 1OWEA 3MNBA 2K8IA 4Y10E 2JH5D 3UB0A 1C5WB 2Y7XA 3RC4A 1RTKA 4LZ1H 1IQNA 3SNBA 2Z7FE 3TJUA 1GVLA 1N8OC 3RMNH 4U32A 1CHGA 1MU8B 3UUZA 1XUIA 2BX3A 4ABIA 2W7UA 1A0HB 4ZUHA 1H9IE 1BITA 1O3KA 4ACAA 1BUIA 5TJXA 1GMHF 1QY6A 4TY6A 2CMYA 5CHBA 2ODPA 3RXUA 4D76A 5GIBA 1QFKH 3GY4A 1MUEB 1ETSH 2BY9X 1D3DB 3WW7A 1T8OA 2XC0A 4KELA 4FUDA 3ENSB 4CRDA 5C94A 3RUOA 5KECA 1P9SA 3TGKE 1UVUH 4D7FA 1C2LA 3A87A 5K7RA 2FI3E 3SJIA 2AHME 2PGQB 1YPEH 1V2ST 1E1RD 4H6TA 2C3SA 1GVKB 4Q2KA 1P05A 2UUJB 1E36B 1M9UA 2ZPSA 1DY9A 1HXFH 4R0IA 1IQFA 3M3TA 2XBXA 5CE1A 2STBE 1AFEH 3UOUA 1MQ6A 4DIIH 2ODYB 3M36A 3OU0A 2SGAA 1DXPA 4K1SA 4X0WU 3U9AH 1C5NH 2C8WB 1GHYH 4WH8A 2FS9A 5DSFA 3BSQA 1V2RT 1CU1A 1DT2A 1HAVB 3FKSD 5FX6A 1NPMA 1C1TA 4IW4E 2ANKH 1Y3WA 3DCLA 4O9VA 2O9QA 1CT0E 2J92A 2WPDD 2BDAA 1DFPA 5ETXA 2VIQA 1EB1H 3DFJA 3E6PH 3M3SA 3SV8A 1P57B 1DDJA 1SLWB 3RMOH 2BTCE 4YT6H 1QA7A 1PPGE 2GV6A 3GOVB 3F9FA 1XXFA 3F9HA 1A5HA 2PKSB 1C2KA 2KFWA 1KLIH 2OXSA 2ZU2A 1VITF 3QZRA 1OYTH 1S83A 1UTQA 1WV7H 5FHTA 1O2LA 1S0QA 1QRXA 1SGEE 4LZ4B 1H8HD 2GMTB 4JZFH 1GHBF 4ISLA 2AMQA 1VITH 2D1JA 2FYRA 2V3HH 1TGCA 4KKDA 1EX3A 2BD9A 4P02A 2GDDA 2F9UA 4HGCA 1BMLA 4BTTB 5A8ZA 1AB9C 3M5NA 2KCAA 4ZROA 4E06H 1OWHA 1E37B 5EPYA 1O2NA 1QRZA 1J15A 1GJ7B 1SVPA 2ZGXH 1C5PA 3A7XA 1Z8JB 3KGPA 1O32A 2HNTC 4ABHA 2VIVA 1O3PB 3U28C 1MH0A 1TX6A 1YCPH 2DE8A 2PKAA 2WINI 2V3OH 2XBYA 1O3EA 1O2VA 2FOBA 2A32A 5EQRA 2ZEBA 2VWLA 4AG1A 3E91A 5GDSH 1QNJA 1A4WH 5DN6D 3CS7A 4M7GA 1S5SA 4MVNA 2VNTA 3LGYA 6LPRA 2TGDA 3U8OH 1FN8A 1YP9A 2QYIA 1H9HE 1D3TB 2ZCHP 1TGSZ 1F7ZA 1GMCF 3ZVCA 3K6ZA 4ASUD 4Q7YA 3U8RH 3KF2A 1XUJA 1DLEA 1F0UA 2CN0H 3UNRA 1RXPA 4Y7AA 3F2GA 1DLKB 4JK5A 1FJSA 2XCFA 1C2MA 1EQ9A 1KDQA 4MNWA 4JYUH 1AVXA 2SNWA 3TGIE 1TBQH 1JWTA 3A80A 1RIWC 5L6NH 1E38B 2HNTF 4MDSA 1P01A 2BDCA 1BB0B 3U1IB 1TQ7B 3RLWH 2H5CA 4Q7XA 1OPHB 4NCYA 2GZ9A 1TNJA 1HLTH 2CHAB 3FN8A 1O2GH 1W7GH 3Q76A 4UD9H 2QY0B 3MU0A 2V3MA 1TA2A 3S7KB 1GDUA 3BG8A 4NA8A 2ZTZA 1C2HA 3ZVGA 1FUJA 2FWWA 1Y5UT 2GZ8A 3LH3A 3ATMA 4X1PU 1H8DH 1YPKH 1GCTC 2W26A 3KQDA 2JJ1D 2ZGHA 2BX4A 1OWJA 1W14U 1O2ZA 2BLQA 3A88A 3MU4A 1G2LA 3ZVDA 3D62A 3SN8A 1A3BH 1AIXH 1YCPM 5F53A 3RXRA 1BTZA 3P8FA 2RA0A 2VH0A 3SNEA 1HGTH 3UQOA 1K0HA 3DA9B 4B75A 3BEUA 3K2UA 4Y7BA 2B0FA 3ZZ6A 4A7IB 1WAYB 2HRVA 1S0RA 3EA7A 1B0EA 2BQWB 1P2MA 3R0FA 3VGCC 1E34B 3MO9A 3ZVEA 4HTCH 3H7TA 3SU5A 1Y3UA 2ZFTA 1FY5A 1WTGH 1MU6B 1RFNA 2F9VA 4UEHH 1DICA 3WWFA 1DITH 1C1WH 1AKSA 3W94A 4BAKB 2WPMS 4FUBA 2LNCA 4D8NA 5A0BA 3KHVA 3SW2B 2TBSA 4DW2U 5EOKA 2ZCLP 1FZZA 1N8OB 3S0NA 1OYQA 3E3TA 1C5VA 1OHHD 4JYVH 2FOEA 2SGQE 2PSYA 1LPGB 2JH0D 1T8NA 4RI0A 3SNDA 1O5EH 4CRGA 2EQNA 3BEIB 4RT0A 1DUAA 3C27B 5JYIA 1O3CA 2TGAA 3KQ5A 3RXSA 5EGMA 3GCHC 3R3GB 2GT8A 1UVSH 3PO1B 3UFAA 1HYLA 2GJGA 4WH6A 4LOYH 1QJ1B 1F5LA 1MCTA 4OS1A 1Z1IA 2B7DH 2VVCA 5A8YA 4K8BA 2FOFA 3K9XB 3MMGA 1DWBH 1K21H 4KGAA 1V2JT 5LPEA 7LPRA 3QLPH 4FU9A 1KXAA 5C1XA 4JCNA 4AGKA 1NS3A 1HDTH 5JBTA 5HKKD 4FUFA 5CHAC 2P93A 2QV1A 1KXDA 3OSYA 1C2FA 2KCOA 4ZXXH 1WQSA 2A2QH 5GNDA 3PB1E 4FOUC 3TU7H 2JIZD 1UVOA 1O2RA 5DP5A 1SSXA 2HALA 2KCYA 4Y71A 3I77A 2JH6D 1VJ9U 1BTWA 1D4PB 3M37A 1XMNB 1F0SA 2P8OB 4WVPE 1BT7A 5L30H 2KAIA 1YYY1 4Y0ZE 3PV2A 1T32A 4X1NU 1LVOA 1V3XA 3KIDU 3BG4B 1JIRA 3I29A 1IOEA 2JETB 1ELEE 5A8XA 2J94A 4Q63A 3F68H 1INCA 5EJZA 5IYTA 3E8LA 4DY7B 2NU3E 1ACBE 1D3PB 1H4WA 5GWZA 1S81A 1TABE 3M3VA 2EI8A 1YY3A 2WUBA 4TY7A 1O2HA 2FOMB 1NBME 1BTXA 3A7YA 5IK2D 4WXVA 5FBIA 1SFQB 3FVFB 1TYNA 4GAWA 4XD7D 3BTQE 2XC5A 2ANWA 1ZHMA 2VINA 2SGPE 2C8YB 3D23A 2FTMA 4XDEA 3RXGA 1AB9B 2A4OA 3GDSA 3M7QA 3MWIU 1EZUC 1SPJA 3BTKE 5DO4H 1NY22 2F9OA 2IPHA 2V6NA 2ODQA 1WBGB 2OP9A 3D65E 1IAUA 3MNCA 1G3CA 2EEKA 5BRRE 1XVMA 1HV7A 4D9RA 4MPVA 2BVXH 2B8OH 1DUEA 4ABBA 3ATLA 1PQ7A 3MU5A 1ZTJA 2ZU5A 4R8TB 4GCHG 5E0JA 4WMEA 5C1UA 1Y5BT 3L3TA 1WCZA 2OLGA 3PWBA 3EA8A 3LKWA 4YOJA 1GI4A 3ATKA 1QJ6B 1CGHA 4CRAA 1BQYA 2PGBB 1GJBB 5AF9H 1TWXB 1OWKA 2VBCA 2XWAA 3O8CA 5DP4A 4OGXA 1HNEE 6CHAC 3URCA 1EZXC 1SBWA 1T7CA 1ID5H 1C5UA 1PQ8A 1JRSA 2Y7ZA 4AZ2B 3LPRA 2IPQX 2BZAA 1DY8A 3SJOA 4Y6DA 1AY6H 1YC0A 1GJ6A 4X8VH 4DGJA 4JK6A 2A0QB 2BY8X 4JZIA 5FX5A 1V2TT 3VB5A 1NBMD 3A82A 3EQ0H 1C2IA 3U8TH 4UFGH 1RIWB 4IN2A 2FLBH 1C5YB 1MCVA 2ZGBH 1MBMA 3SGBE 4A1XA 1TNGA 5T1VA 2GX4A 3WWBA 4TSFD 1P3CA 2G4TA 2AFQB 1AGJA 2A5KA 2WV4A 3A7WA 1C5XB 1LQDB 1MTNB 4DVAU 2GDEH 2XBVA 1VCPA 1THPB 3QGNB 1LPKB 4H42U 3TJVA 2PFEA 5EW1H 5B6OA 1TPPA 3OFND 2PV9B 3RXKA 2H5DA 4YT7H 1P2JA 4WF8A 4ZHMU 3SU6A 2H6MA 3VEQB 3HATH 2OD3B 1ORFA 2J98B 4IMZA 3RC5A 4YESB 4MPWA 2P3TB 1TNKA 2F3CE 1C4U2 1IHTH 1MTSA 5FCRA 1ZGVA 3V12A 1ZJKA 2A45B 1DX5M 2BQ7B 3SU1A 4BNRA 3ZV8A 1C1SA 1IQGA 1LHGH 1QRWA 1TRNA 1GG6C 4K69A 2CF8H 3VGCB 1QB1A 1QB9A 4BTUB 2C8XB 3LU9B 4OS2A 2Q6GA 1TBRH 3IITA 1FY4A 2FODA 2BOKA 2R3UA 1ESAA 1QBOA 4TYDA 1O2SA 2HPPH 1FAKH 2W3KA 2ZA5A 2FDAA 2FP7B 3PTBA 1DWEH 3P8NA 3RM0H 2PTNA 5DK1A 1FPCH 3EAJA 4ISHH 3SQHE 1P04A 2P95A 3FP8E 1BJVA 3UREA 2H2ZA 1XXDA 2W3IA 2VVVA 4KTUA 3QUMP 3A8DA 4BAQB 1OSSA 1KTSB 1SGFA 1NRPH 4UONA 4A1VA 2P3UB 4X6OA 2O8MA 1GJCB 5F03A 1Q3XA 4KTCA 4Y8XA 3ZZ8A 2VJ1A 1EAWA 4ABFA 1G3DA 1ESBA 4XE4A 5JBCS 3TIUA 3DSPA 3CNRA 3FZZA 4X6MA 3ZZ7A 2ZG0H 5PTPA 2ESTE 1YPMH 3PWCA 4GCHF 1C5QA 1O39A 4NSVA 4AFUA 1W0ZU 1BZXE 2GVFA 4GSOA 2XC4A 5FPSA 3ZVBA 4ZCNA 5JBAS 2A7CA 2XRCA 1TGBA 1GBBA 2J9NA 4K8YA 1PQAA 2QC2A 3T5FH 5GCHG 3GYLB 3DSOA 1T8MA 3UWJH 3SBKA 5C20A 1BA8B 1EOLA 3S69A 2UWOA 1FLEE 2G81E 2F9PA
chains in the Genus database with same CATH topology
5SGAE 1A7SA 2A4GA 1A1RA 1UK2A 2CJIA 1TRMA 2WPIS 3AAUA 1FN6A 3GCNA 1EXFA 2WPKS 3OTJE 4DT7B 1WSSH 1C2EA 1HPGA 1AE8H 1VGCC 4D9QA 2FX6A 3ZZBA 1AZ8A 1O3IA 5EQQA 1LCYA 3QTOH 1CBWC 4DJZB 1OKXA 6ESTA 2WV5A 3N7OA 3QZQA 1HAPH 2TPIZ 2W7SA 1YLDA 1FONA 3BN9A 2YNBA 4DIHH 1L2EA 5C67A 2ASUB 3ATIA 4AYYB 1C2JA 4BAMB 3SU3A 5I25A 1NFWA 4K60A 4CHAB 1ZR0A 1O3FA 4XBBA 3MNSA 3OYPA 1LVBA 3DD2H 1HAIH 3BTEE 1UCYE 2ANMH 1SR5C 1W8BH 2QXJA 2BQ6B 4X2VA 1O30A 4K5ZA 4HFPB 2G51A 1FAXA 2RCEA 1E0FD 2Z9LA 2R0KA 2ZQ1A 1KSNA 2J2UA 1FY1A 1TGNA 1S84A 4X1QU 1O2TA 1UTJA 3ZYEA 1ARCA 1O2YA 1SOTA 1TOMH 4TPYA 4GVUA 1HAXB 2W5EA 3KL6A 4ZKNU 2OC8A 1O33A 1Y59T 1BDAA 1Z6JH 2ZDAH 1X7AC 3GY7A 3MU1A 1MAYA 3UWIA 1O36A 1AN1E 3KN2A 1DSTA 4HZHA 1QTFA 2QCYA 1CA0C 5FXLA 2RA3A 1O5CB 1KXBA 3O8BA 1QBNA 3QX5H 4MG3A 1HAGE 2WUCA 1IQHA 3VB3A 1AI8H 1O5FH 1BTPA 5DG6A 1A5GH 3E16B 2BY6X 4HI3A 1L4DA 1NRQH 2ZI2H 1DPOA 1O3GA 1GHXH 1KIGH 3GISB 4K1EA 3Q77A 4BTIB 1P12E 3GY2A 1SGFG 3JZ1B 1G3EA 3QTVH 3W95A 1HAYB 1BMMH 2F9NA 2Z9KA 1K1LA 3V3MA 4MTBA 1C4Y2 2A5AA 1EPTB 1NROH 1QL8A 1GGDB 3A8AA 2QXIA 4Y8ZA 4ISNA 4B74A 1C5OH 1T31A 2HVXA 2OQ5A 1GHZA 1AFQC 3LH1A 3SJ8A 2RDLA 4FUCA 1GI6A 2BY7X 2SGEE 5EG4A 2OTVA 1HXEH 1NC6A 2VVUA 1AD8H 1HJAC 4OS4A 3F1SB 5A09A 2PTCE 1CT2E 1SL3A 4XBDA 3TJNA 1P2NA 2HWLB 2NU4E 2AERH 5GCHF 3A84A 2R3YA 2D2DA 1SLXB 5EU8A 5TCAA 4CH8B 3NKKA 2QAAA 1SHYA 3MH6A 1K1NA 2AH4X 1GJAB 2AIQA 1BCUH 3SNCA 1TALA 1BHXF 2AMPA 1HAVA 1A0JA 1PFXC 1GG6B 1P06A 4GHQA 4X2XA 1AE5A 4I7YH 3NZIA 5HGGA 1HIAB 4ZXYH 3ZZ4A 1UK3A 1UTNA 3CP7A 3QDZB 1G9IE 3QWCH 4PROA 5LPRA 3LJJA 1EKBB 1YGCH 1P8VC 2YOLA 3LIWA 3LGTA 1TNLA 1ZPBA 2VU8E 1O3NA 4DG4A 1XUHA 4X2WA 1EJMA 2FOHA 1UCYK 4IS5A 3NK8A 1Z1JA 3RMMH 3BF6H 4B2CA 4I8LA 4WMDA 5F8ZA 3RXJA 1TFXA 2ZGJA 3QK1A 1GWAA 3GCTG 2XCNA 2BDHA 4YTAA 3MOCA 3TITA 1B7XB 2O8TA 1PQ5A 1LHDH 2ZQ2A 3OY5U 3TH4H 2ZTXA 4ISIH 3RXTA 5DJ7A 2STAE 1TNHA 3RXBA 4E05H 3LONA 2DUCA 1Y5AT 2F9BH 5T6FA 2OUAA 1K28D 3H5CB 4YLQH 3MHWU 1ETTH 2ZFPH 1ZSKA 3ODFA 2VIDA 1AO5A 1YF4A 2VWOA 1RGQA 1AWHB 4CBOA 2B5TB 2VGCC 3L33A 1YBWA 3T28A 1CSOE 2J38A 2F91A 4JZEH 1V6DA 1GBDA 3C1KA 1P3EA 3SJ9A 2Y5HA 4O97A 2G55A 1BRAA 3PROA 4YZUA 3FZDA 3LC3A 3AW1A 2XBWA 1GBJA 3ZVAA 2AS9A 1H8IH 1O2MA 3E1XB 2AEIH 4IN1A 3LGUA 2R0LA 1GMDG 1CGIE 3ZZAA 1GVZA 2FOCA 2GCTC 2VIOA 3BIUH 4BAOB 1RRKA 1GCDA 1IHSH 2BLWA 2ZDVH 3KNXA 1ZSJA 3D49H 1ANBA 1HRTH 1UHBB 4FVDA 3K6YA 5F8XA 1K9OE 4CR5A 5LH8A 4IMQA 2ZDMA 1GBAA 4GLYA 3BTWE 1ZTKA 2SGFE 2BYAX 1ELFA 1YCPK 3T29A 1OP2A 1C5MD 3A83A 4AG2A 4Y0YE 9ESTA 3VB6A 1C2DA 1NRSH 1XM1A 2JKHA 5H4IB 4CH2B 1QCPA 1T4VH 1EP6A 4I8GA 4NFFA 3LGVA 2BLVA 1DS2E 2CXVA 1RJXB 3TPIZ 2ZFQH 3OY6U 1NT1A 1SI5H 1ELGA 3GCOA 1AUJA 1Y3YA 1J8AA 4CR9A 1C1UH 1K1MA 1HFDA 3SU0A 4VGCC 1OS8A 5C5OA 3SNAA 3TNTA 1K1OA 2NU1E 3ZZCA 1ELAA 1B0FA 1CA0B 4NFEA 4NZLA 4ASHA 2PW8H 4BXSA 1SFIA 4GPGA 3SI4H 1QA0A 2FO9A 2IJOB 4JYTA 1F0TA 1C9PA 1THRH 1TRYA 5HXFA 1NFXA 3M61U 1FQ3A 1BTHH 2V35A 1MZDA 4DURA 2ZHWH 3GY5A 2FPZA 1AUTC 2BD2A 4U30A 3IG6B 3ZZ5A 1UHBA 1O3MA 3P17H 4OGYA 2ZU4A 1TX8A 3QGJA 4O3TA 4UFDH 1LMWB 1T4UH 3GCTF 1BRUP 1IQLA 1Q2WA 3M5OA 1C1QA 3RXAA 4ABJA 3NXPA 1EAUA 2ZCKP 4WJG2 3UNSA 1LDTT 5E0GA 3FFGA 1P2QA 1QJ7B 3V0XA 1QIXB 4UFFH 1EP5A 1F2SE 1GHVH 2P16A 4RSPA 2Z3DA 2ZFSA 1VCWA 1ABJH 4X6NA 3KQBA 5AFYH 1UTMA 3SOSA 2FM2A 1HJAB 3M5MA 2Z3CA 2BB4A 4MPXA 5LPFA 1MKXK 1O2QA 1CQQA 1O3OA 2BXTH 1HAOH 1CT4E 3RU4T 1QQUA 5HM9A 3UQVA 1FDPA 4NSYA 1C5ZB 2VWMA 1ELCA 3T25A 2BDGA 3TK6A 3LDXH 4ZKRU 2CGAA 5E2OA 4MPUA 1YKTA 2BVSH 1GMDF 4U2WA 1LO6A 1O3JA 4UE7H 1C1RA 1ZJDA 1O38A 1SB1H 1ZMJA 1P0SH 3RXLA 1F92A 2AYWA 3MO6A 5HYOA 4X8SH 4AFSA 3E0NB 3RXCA 2OC0A 3KQEA 4FUGA 3A8BA 4B76A 3S7HB 1UVPA 1K22H 2D8WA 4TPIZ 2ANYA 1HCGA 1QL7A 2GCHG 3SUDA 1ANDA 2ULLA 3T27A 4JMYA 5C2ZA 3HKIB 1PPEE 3T62A 2Y6TA 3RP2A 1Y3VA 2O8LA 3BEFB 3HGPA 1XX9A 3S9CA 1PPFE 1IQJA 2HOBA 3RDZA 5DP9A 3A85A 3PLBA 3UTUH 3U69H 4Q7ZA 3UPEA 3LT3A 1DWDH 2AIPA 1LTOA 2BOHB 2ZDKA 3PLPA 2BLOA 2QF0A 2A7JA 2PUQH 4THNH 1TA6A 4I33A 3UY9A 5L2ZH 1GCTB 5AVDA 4AN7A 1O5DH 4WXIA 2OBQA 4I8HA 1IQMA 4Y76A 1GJDB 1O2XA 3DHKH 2LPRA 2VIWA 1V2VT 3MNXA 1C4V2 2VGCB 4TWYA 3NWUA 3Q3YA 3DFLA 1UTPA 1GJ4H 3OX7U 5IDKA 3UNQA 2J95A 3LJOA 3FANA 1BBRE 1EOJA 1GI3A 1ZZZA 2H9TH 2UWPA 1ETRH 3ODDA 3V7TA 2R2WU 2GT7A 1PPBH 2I6SA 3B8JA 3T26A 3RC6A 2HPQH 4AB8A 5JPMH 2F83A 2UWLA 1PYTC 2PR3A 1P9UA 1KYNA 2ZU3A 3K65B 5EXNA 1FMGA 3SU4A 2FXRA 1QR3E 1JOUB 1KLJH 2GGVB 3ESTA 1CA8B 3P95A 3O8RA 4INKA 1JBUH 1LKAA 1ZGIA 1ZLRA 4BOHA 3HK6B 5EQSA 1C1PA 1MAXA 1GI1A 3GYMA 1TLDA 2FTLE 1MTVA 1O2UA 2VWNA 4E7NA 1ZTLA 2B9LA 4U01A 1EJAA 4MNYA 1N6YA 5C5NA 4E7RG 1CO7E 3AAVA 3VFEA 2BY5X 4YOIA 1ZSLA 3GCHB 2Z3EA 4NIYA 5EW2H 1GPZA 4K1TA 3TK9A 1Z71A 2CF9H 1O5BB 1TX7A 1LVYA 1NU7B 1SMFE 3PM3A 4B2AA 4XSKU 2CHAC 1DVAH 1VITG 2GD4B 3P92A 2M5TA 1XKAC 2VH6A 2Z9GA 3SJKA 4MQAA 3ZYDA 1O2IA 1Z6EA 5CHAB 3RXFA 3P8OA 3MFJA 1Z8IB 2I6QA 1EB2A 2BDIA 4CRCA 4ZMAH 2ZDNA 1TOCB 4NWKA 2GKVE 2J34A 1O37A 1QURH 4WMFA 2YNAA 4F4OC 3M7UA 1BMNH 1NZQH 1UMAH 4INLA 3U98H 3GY6A 4DOQA 1O3BA 2GCHF 2BMGB 3M5LA 3A8CA 1P02A 1GJ9B 3P70B 2C90B 4KTSA 4NA9H 1GJ5H 1RTLA 2TIOA 2IN2A 1PYTD 1C1VH 2BDYA 1HUTH 1ABIH 1K1JA 2O8UA 3TGJE 4FUJA 2ZTYA 4XBCA 1HB0B 4FUHA 4I31A 1H9LB 1MKWK 1HBTH 2A4RA 1ELTA 3RMLH 1D6RA 2FOAA 4A6LA 4ABAA 3Q00A 1TPSA 3NUMA 4UFEH 5I46H 5A0CA 2Z94A 1TMTH 3AW0A 4ZAEA 5JDUB 4ABEA 1QQ4A 6GCHG 3SGAE 3FP7E 4BXWA 1SGQE 1TIOA 2H1UA 3SV7A 1SGIB 1O2WA 3A7ZA 3ZZDA 3TNSA 3PMJA 1TGTA 3EE0B 2AGEX 1SGRE 1GBMA 1Z8RA 1P2OA 1J17T 1DXWA 3SV9A 3PO1C 2G5VA 5DP3A 3V13A 8KME2 2VIPA 1PPHE 3STIA 1RS0A 2Q6FA 1BBRK 4CBNA 3PLKA 2ZZUH 3SUEA 1TBZH 3FAOA 1P09A 3NPSA 3VXFH 1GL1A 1L1GA 1UCYH 1H1BA 3BTFE 2EA3A 2D26C 1HAZB 1V2OT 1EAIA 2BD4A 1CGJE 1C5SA 6CHAB 1VJAU 2ZHDA 3RXQA 1SGDE 1VR1H 4MNVA 4MNXA 2ZHQH 1HAHH 2GP9B 2PKAB 2A5IA 1DE7H 1ZOMA 1UJ1A 2OCVB 2PUXB 1MQ5A 4NIXA 1GHAG 8LPRA 1YPLH 5FPTA 1NU9A 2P3FH 1O0DH 1CE5A 3GY8A 2P8OC 4WWYA 5C1YA 1KY9A 1QGFA 3DT0H 4O3UA 2XXLA 3E0PB 1MD7A 2NU0E 2ZNKH 2WPHS 3BG4C 2JETC 2ZPQA 4DCDA 1W11U 3SHAH 1V2UT 1KDQB 4KP0A 2Y81A 1LPZB 3BTHE 4ZKOU 1PPZA 5DKMA 2XNIA 1OXGA 3HKJB 4LK4A 2NWNA 3SI3H 1C9TA 1TPAE 1SGPE 3SV2H 5HMAA 5GXPA 1J16A 3MO3A 3QN7A 7KMEH 4A92A 3RXEA 4K3JA 1YM0A 1ZHRA 3SUGA 3BTDE 5TCCA 2OINA 2OC1A 4A5TS 3TH3H 1NFUA 1SQAA 3PMAB 1A46H 3RU4E 1S85A 2RG3A 3MYWA 1NRRH 2BHGA 5E0HA 1GI9B 2ZF0H 1XKBC 5T3HA 2XWBI 1NTPA 3EGKH 3UR9A 4B71A 1KLTA 1FY8E 2FIRH 1C5TA 3NCLA 1C2GA 3RXVA 2FZZA 1S82A 2FMJA 3F6UH 1EZSC 1FIZA 1P03A 1NO9H 5E2PA 2IOTA 1SG8B 4BAHB 5FCKA 5K0HA 4MLFB 2EI7A 2PLXA 1O3LA 4IBLH 2OBOA 2HNTE 2BM2A 2EC9H 2H9HA 1AZZA 1EUFA 2WYJA 4BANB 1A61H 5GJ4B 1O3HA 1OP8A 2BD5A 1WOFA 1O2KA 5EXLA 1HJ9A 3UIRA 1GBFA 2ZDLA 4JZ1A 4ABGA 1ZPCA 1FPHH 1TE0A 1C5RA 6GCHF 1BTYA 1FIWA 4IC6A 3STJA 1YLCA 3JZ2B 1AKSB 1PPCE 1SHHB 2ILNA 3AVZA 1EPTA 2H9EH 4X8TH 3LC5A 5EPNA 3SZNA 3SQEE 1F0RA 4FUIA 1AVGH 2Z9IA 3G01A 4GUXA 1LHCH 4H4FA 3E90B 1FV9A 1ELBA 2A31A 1MTNC 1XUFA 3EA9A 3B9FH 4H6SB 1WUNH 5E8EH 3LOXA 4FVBA 3RU4D 3H7OA 1W12U 3VB7A 1V2WT 1ZMNA 4INHA 5FBEA 2ZECA 1K2I1 5DP6A 1O5GH 4Y8YA 1TB6H 1BOQA 4AYVB 4I32A 1RTFB 4F49A 1W7XH 1P11E 1L1JA 3DUXH 1D9IA 3TK5A 1K1PA 3BTGE 1XVOA 2VB0A 4ABDA 4B73A 3SORA 3TJOA 4UDWH 1MTWA 1HIAA 3PMBB 1SGYE 1WQVH 3A81A 3CENA 4Z0KA 2Y82A 2FI4E 5FPYA 3QO6A 1O3AA 5JBBS 1GHAF 1UTLM 2FEQH 3SHCH 2ZC9H 1P2IA 2J4IA 1VGCB 3MH4A 1U6QA 3TH2H 4YOGA 3WY8A 1ZPZA 1CBWB 7GCHG 5BPEA 2ALVA 1T8LA 1ZRKA 1V2QT 1MKXH 2ZO3H 3M7TA 4RN6A 1G36A 1TMBH 1ZMLA 5DGJA 1IQKA 5AFZH 3UR6A 5F6MA 3ZZ9A 3ZV9A 5C3NA 2KAIB 2QGRA 1TONA 1GBTA 1LHFH 2Y5GA 1G30B 3RXMA 4NA7A 1C5LH 1DWCH 3VXEH 3L6PA 4Q80A 5J4QA 1FNIA 4Z6AH 5HM2A 2Q6DA 3RXOA 1GDNA 1GJ8B 2FI5E 2Y5FA 4AFZA 1V2PT 4ZH8A 1W0YH 3A89A 2ZHEH 3MI4A 1AQ7A 4NG9H 1FI8A 3PYHA 5ABWA 1BTUA 2TGTA 2AGIX 3RXDA 2HGTH 1TNIA 3HPTB 5JB8S 3ITIA 1PJPA 2EI6A 4LXBH 1G32B 4X1SU 5JB9S 5DP7A 1ANEA 2C93B 4AB9A 1GBEA 1CHOG 3IWMA 1QBVH 5GPIB 1Y8TA 1ZYOA 1NFYA 2ZP0H 4NIWA 3LGWA 9LPRA