3N7EA

Crystal structure of copk bound to cu(ii)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
NVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Copper resistance protein K
publication title Two new crystal forms of copper resistance protein CopK
rcsb
source organism Cupriavidus metallidurans
total genus 11
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3n7eA00
2K0QA 3DSOA 3N7EA 2LELA 2KM0A 3DSPA 3N7DA
chains in the Genus database with same CATH superfamily
1O3FA 1C5ZB 4NIWA 1C2HA 3ZV9A 2AMQA 6LPRA 1P0SH 5JYIA 2ZCLP 3ZVGA 4VGCC 1C5TA 1P01A 1MKWH 2IPQX 4CRCA 2C8ZB 1PYTD 4JK6A 3S69A 2BZ6H 3ZZ9A 1K21H 5DKMA 1Y59T 1QRWA 1HNEE 1SMFE 3ATLA 2JJ2D 4ZROA 2FOCA 1SLXB 1TRNA 4X6MA 1SVPA 1OXGA 2ZC9H 1AVXA 1UTOA 5J4QA 1Y3YA 1GBEA 1T4VH 2W3IA 1GWAA 2QXHA 1NRPH 3PRBA 1LHGH 2BY9X 4ZH8A 1YBWA 1MTNC 3SORA 1SGPE 3QTVH 1YPEH 3S7HB 1Y3VA 2W7UA 1C5LH 3RMMH 1DOJA 1ZMLA 1BCUH 4B73A 1IQNA 4TYDA 1LO6A 3A8CA 5C0UA 1F7ZA 1VZQH 2GX4A 2FIRH 3RXLA 4AZ2B 4IC5A 1O2RA 4I8JA 3F0PA 5C20A 1UMAH 3MU4A 2VIOA 2AFQB 3JZ2B 4JZIA 2VVCA 5FBIA 1HCGA 5HM2A 5F8ZA 3ZZBA 4K1EA 1GBCA 1P10A 2ZHQH 1C2KA 2HGTH 1A2CH 2BZAA 4Y76A 3OX7U 2ZDKA 2BDIA 2AIQA 4NFFA 4X6PA 2HOBA 1SLUB 5A0AE 2F9UA 2DUCA 1OWKA 4Y0YE 2G00A 2ZG0H 5CHAB 1UVPA 2IN2A 1TA6A 1OP2A 1C5RA 1GG6B 4DVAU 1ELDE 1B0EA 1T8MA 1ZMJA 3BTTE 1MQ5A 1XX9A 3UR6A 4MNYA 1KTSB 1TGSZ 1FN6A 1O30A 2F9NA 1AE8H 2XC5A 1C5VA 3U98H 4CHAB 3T28A 1GBKA 2AMDA 1EZUC 1EAWA 1MMJN 1UVOA 4FUDA 1YPGH 2ZTZA 1MQ6A 1O2WA 3FN8A 5LGOA 1GHAG 4I8LA 1BHXB 1CA8B 1UTNA 3CNRA 5C67A 4NGAH 1GHVH 1IQJA 5FX5A 1ZRKA 2XXLA 3D62A 3LC5A 4YESB 1H4WA 3E8LA 4TWYA 3RC5A 1NU9A 4Y79A 3RXEA 1IQMA 1DSTA 1B7XB 1CGIE 2UUFB 3SW2B 1GHXH 1QA0A 1QBNA 4HTCH 1EPTC 1MKWK 5DK1A 4A1XA 5IYTA 3S7KB 1SI5H 1W0ZU 2EY4C 2Z7FE 1PQ8A 2KAIB 4DIHH 1GCTB 2BD9A 3SNAA 1P12E 4X6OA 4AYYB 1VJ9U 2BLVA 3FP6E 1D3DB 1THSH 3JZ1B 1BRUP 1GGDC 1P9SA 4ZCNA 1EX3A 1HUTH 2FTMA 1YLCA 3QUMP 2ZGCA 1OWJA 4H6SB 3PLBA 1ZSJA 3Q77A 3LPRA 1Z8RA 2GTBA 5I25A 3P70B 3AW1A 1W0JD 2TGDA 4NIVA 3LOXA 2VGCB 5CMXH 1LHFH 4YT6H 3A85A 3UWJH 1GI2A 4X8VH 3PTNA 2UWPA 1FPCH 3AASA 3D23A 1Y5UT 1G3DA 1O2GH 4HI3A 1CHGA 5ESBA 1C2GA 2G4UA 1QZ8A 3BTEE 1O3OA 5GIBA 1NU7B 3QZRA 1DE7H 3NK8A 1AD8H 1HAZB 2GDEH 2QF5A 3MO6A 4X1QU 1UK4A 2G4TA 3ODDA 1LVYA 2PLXA 3QK1A 4ABFA 1YM0A 2ESTE 2H9TH 2A7JA 1KSNA 2GP9B 1QB1A 1O2ZA 5HGGA 4NZLA 2A0QB 2OUAA 1GHYH 2QXJA 1C5MD 1LMWB 1A5GH 3T29A 1Z71A 2KCYA 3SJ8A 5CE1A 3SU6A 3ZZ4A 3PWBA 2UWOA 3GICB 1UTLM 4WWYA 3DD2H 2R2WU 2Y80A 4JYUH 1TNLA 2ILNA 5DP6A 1DWBH 1OKXA 1H9IE 4XBBA 1GMCG 3RXPA 4ABEA 1Q31A 1L2EA 2KAIA 2NU4E 1V2WT 1PPCE 4UFGH 4HG6A 1GJAB 3HPTB 4U01A 2WUCA 3TK6A 3TK9A 2FLRH 2TIOA 1A61H 1BDAA 1DWCH 2FX6A 2PUQH 5F8TA 4UFDH 2F9PA 1CVWH 4NA7A 1MD8A 2V0BA 3UFAA 3GS9A 2RA0A 4ZAEA 1BRCE 1O2YA 2NU1E 4ZHLU 4XFQA 3IITA 3RXIA 1GJBB 4Q7ZA 5HMAA 2HNTE 2P16A 3DCLA 3UQOA 1JIRA 4AFUA 2A4QA 1SGQE 1O3HA 3VB7A 2FOBA 1SGNE 3ATIA 3E0NB 3GISB 3Q3YA 4MLFB 4RT0A 1C2LA 2XBWA 4B2AA 3GY5A 1S81A 5AFZH 3SO3A 1W14U 1O32A 3O8DA 3FKSD 1MU8B 1RXPA 2PSXA 1HIAB 1PJPA 3E6PH 1XUHA 3RM2H 1ESTA 2A7CA 5EQSA 5A0CA 1K1LA 3UB0A 1H1BA 1FN8A 1K1MA 1L4DA 3KHVA 2EI6A 1YPJH 4TPYA 1ZYOA 1QB9A 4UFEH 4J2YB 2Y82A 2F91A 2K8IA 5GJ4B 1YPHC 4ISOA 1UTJA 1P11E 1O2NA 1UW7A 4TPIZ 2R3YA 4RN6A 1QIXB 1XUGA 1OWHA 1RIWC 1DT2A 4TWWA 3PV2A 3O8RA 1OWIA 2ZP0H 1A0JA 3UNSA 4ZKRU 4JZEH 4Y8ZA 5AF9H 1FAKH 1UTMA 5T6FA 2GT7A 3MNBA 5A8ZA 1KXAA 1W12U 3MWIU 4MVNA 1SFQB 1V2UT 3BG4C 4ASHA 1GBMA 3A87A 1LDTT 1YPHE 2JH5D 2C3SA 3B8JA 1SHHB 1FPHH 1SGFG 1Q2WA 3S9AA 1H8HD 3FVFB 3URCA 1FAXA 3DA9B 3HGNA 4OM9A 1P06A 3UNRA 2VH6A 1EOLA 1O2IA 2ZU5A 1C9PA 1HLTH 1K0HA 2RDEA 3ZZ5A 1IHSH 1S5SA 2QC2A 1QCPA 3DUXH 5GDSH 5KECA 1BJVA 2ZFQH 1MD7A 1PPGE 1AZ8A 1TE0A 1TRYA 3SJKA 2G81E 1TB6H 1W13U 3CS7A 4IBLH 5A8XA 1O33A 5IK2D 1RTFB 2HVXA 4XSKU 3P8OA 1Y5BT 1OOKB 4Q7XA 7GCHF 1QB6A 3WWBA 2ANMH 2G5NA 3DHKH 3MNXA 2RDLA 3PMBB 3GCTF 2F9BH 1NBMD 3GDVA 1BBRE 5GWZA 1CGHA 1HAOH 3MNCA 1FIZA 1WAYB 3SI4H 1ELGA 1FV9A 3W94A 4WH6A 4NCYA 1LHEH 1XUKA 4ISHH 2BY8X 1WTGH 2FZZA 3DFJA 2H9HA 1GMHF 2QF4A 2Z9LA 3ZZCA 3RDZA 4FUGA 2CXVA 3M5MA 3PMJA 5FAHA 1GHWH 2STBE 2CHAB 2Y5FA 1NPMA 4X2YA 3KQDA 5FXLA 1L1GA 4ASUD 1C2EA 2BVRH 1UTPA 5EODA 4WY3A 1VJAU 3FFGA 1ESBA 4Y8YA 2LPRA 1Y3UA 2J94A 4K2YA 2Z9IA 2FP7B 2L74A 1SGTA 3ZVCA 2VH0A 3A7VA 1UTQA 2VIVA 2OCVB 3QZQA 2W5EA 3EA9A 4QT8C 3UUZA 4IW4E 1NZQH 4VGCB 1MAXA 3UIRA 3UOPA 2H9EH 1WYKA 4H42U 2VBCA 5EPNA 2SGFE 3A80A 5EJLA 2A4RA 2DE9A 1E38B 4ZKOU 1H8ED 2V7QD 1C1NA 3Q3KA 4O97A 3KF2A 4IS5A 1P3CA 1ZOMA 1BMLA 1SGFA 4B1TA 3F0OA 1ZPZA 4WXIA 3TIUA 3DSOA 4NFEA 3E90B 1MTNB 2SGPE 4LXBH 1GVKB 1MH0A 3SUEA 5E2OA 1D3TB 2BDYA 1KXEA 1ZSLA 4HFPB 4M7GA 4AORA 1MZDA 3MH5A 1RGQA 3RXTA 1LHCH 1DICA 1F5RA 1V2OT 2FXRA 4FOUC 1P2IA 5C1YA 3MMGA 2ZI2H 3LU9B 1SKYE 2XCNA 1P2QA 3EGKH 1BOQA 3RXJA 3N7OA 4CRAA 1HAYB 3B9FH 1WQVH 3P8FA 3MU0A 1UK2A 4OS6A 3SQHE 3VB4A 1TNKA 3UTUH 1HJ8A 1O34A 2WPLS 3I29A 1AIXH 4XBCA 3TGKE 1O5FH 2OLGA 3C27B 1IQEA 3U8RH 1MUEB 2WPIS 2ZNKH 1OX1A 4TY6A 3F3BA 3SGAE 1DUEA 2HLDD 4WXVA 1F92A 2OC7A 4ZUHA 3RMLH 1QFKH 4WVPE 1TQ7B 5C1UA 1GJ4H 3RXOA 3TGJE 1GI4A 1ELEE 3BTQE 2GV7A 1ETSH 2B7DH 1CGJE 1BTZA 1EB2A 2FS9A 4DJZB 1FY5A 2Z3DA 1CO7E 2VIQA 1DX5M 3FP7E 3LGTA 4O03A 2P8OC 3ELAH 1O5GH 1HAVB 1P2OA 2PTNA 1C5UA 3GY7A 4FU9A 4D76A 3V7TA 4K1TA 2XNDD 4ZMAH 4I31A 5JDUB 1EAIA 1FNIA 1ZMNA 1YLNA 4B6EA 1GHAF 4Z1MD 1DDJA 1GHZA 4H4FA 2GGVB 3BIUH 3OY6U 2VU8E 1C5PA 1EOJA 3E16B 3KQBA 2W6JD 1CU1A 4P02A 1EPTB 3MFJA 1AO5A 2W6ID 2C8XB 2GZ7A 1ELVA 3IWMA 3L3TA 3PRDA 1IQKA 4AB9A 3N99A 1V2TT 1EQ9A 2AIPA 1TPAE 2O9QA 3TH2H 4CRDA 1GGDB 2JH0D 1T31A 2D26C 1VITF 3F9FA 3P8NA 5EOKA 5FPTA 1CHOF 3KNXA 3RP2A 4XE4A 3U8OH 3UY9A 9LPRA 5CDFE 4MNXA 3ZZAA 4BTUB 2A5AA 3ITIA 2BY6X 2PFEA 2G5VA 3F68H 4INHA 1S85A 1O3EA 2D8WA 2I6QA 2RA3A 5EQQA 3P17H 1O3GA 1AFQC 2G8TA 1NRNH 1PPFE 2NU3E 4XRNA 3OE7D 1UHBB 3SN8A 1KTTB 2ZEBA 1THRH 1K1NA 1D3QB 1FI8A 1C1VH 2HPQH 1NBME 1QL8A 1Z6JH 3GY3A 1VCWA 2WPKS 2LNCA 3S9BA 3SUGA 1Y3XA 2GDDA 3F9EA 4D7GA 4X6NA 3SU3A 3SYJA 3WWFA 1A0HB 1C2DA 2H1UA 2K0QA 2Z94A 4YO9A 3BSQA 4ZKNU 2O8MA 2P3FH 4Q63A 1AVWA 2VB0A 1BTXA 1BT7A 5JBTA 3PMAB 3FOAA 1IOEA 3VB6A 1AWHB 1K9OE 1O2UA 3KEEA 1BITA 1OS8A 5F53A 4CBOA 1AU8A 4Z6AH 5FCRA 1SB1H 5E2PA 4CRGA 4YT7H 1LVOA 1ZRBA 3R3GB 5LH8A 2YMSC 2R3UA 4ZHMU 1G37A 3H7OA 3SHAH 1IQIA 3MOCA 3RU4E 1S0QA 4BTTB 3S9CA 2BD7A 4X0WU 1QRXA 3FO8D 4BNRA 4CR5A 3BEIB 2CV3A 3STJA 5HM9A 2F3CE 2V35A 2A1DB 2QE7D 2ZDVH 1GMCF 2AGGX 2SGAA 1LTOA 2ANYA 1OP8A 1MAYA 3QDZB 3LJJA 3BTKE 1O5EH 4B71A 1JXPA 2FTLE 2HLCA 2J38A 2F43B 1O5CB 1ETRH 1HAPH 2LP6A 1OSSA 1C1RA 1NRRH 3F2FA 9ESTA 3R0FA 1SC8U 2P3TB 5L30H 1MABB 2PTCE 2BLQA 4I86A 3TLOA 1MZAA 5C3NA 2VIWA 4MPXA 1BRBE 3GCOA 1ZHPA 4WMEA 1AKSA 1AFEH 1UHBA 2HPPH 1C1PA 2FYQA 5B6OA 3U1JB 4Y11E 1HBTH 1PQ7A 1SGRE 1C4U2 1QBOA 2OC0A 2K1QA 1LQDB 1TYNA 3BF6H 5BPEA 4AFSA 3MQKC 5C1XA 4LZ4B 4X2VA 2W3KA 2CN0H 2WUBA 3SNBA 3VB5A 1OWDA 1KMHB 1C2MA 1GDQA 2ZKSA 3PV4A 5F03A 2J98B 3B23B 3V12A 3SU5A 1Y5AT 1RIWB 3KL6A 3VXFH 1ZTLA 1NFXA 3AVZA 3N7EA 1V2ST 2ASUB 3VB3A 1THPB 1F5KU 3S0NA 1GVLA 2A4OA 2C93B 2THFB 1Z8JB 3BG4B 1V2RT 2BVXH 3T2NA 1TX7A 1DANH 1COWD 3D65E 3A8AA 2BD8A 1SOTA 4RSPA 4WMDA 5A8YA 1GBFA 4I8KA 4HGCA 4THNH 1B5GH 3ZZ7A 3MYWA 1F0SA 1KXBA 1N8OC 1AGJA 5DSFA 4E06H 3F9HA 1EZSC 1C1TA 2VWOA 3PV5A 4B76A 2J9NA 3K6ZA 5JB8S 1BMNH 1ID5H 1KIGH 1SHYA 3GY8A 4F48B 2BDAA 1GJ5H 1TA2A 3GDSA 4BAMB 4JCNA 2BX4A 1KXDA 2C8YB 1VITG 1CHOG 1SGCA 3P6ZB 1EASA 8ESTE 1UVSH 1T32A 4FETA 1S0RA 1TGNA 3M7TA 4IN1A 2W26A 4UEHH 4X1SU 1LPKB 4YTAA 4NSVA 1SQAA 5EPYA 1O3JA 1TPSA 2VWMA 3PB1E 1IQGA 3P8GA 1ANEA 3SZEA 4B6FA 1C5XB 1ELAA 1V6DA 1SGEE 1EJNA 2PKAB 4WJG2 2ZFTA 3TGIE 4AFQA 1CT2E 3VG8A 1T8OA 1WV7H 2ZDNA 1C5WB 4ISNA 1OYQA 1MTWA 2CJIA 1HXEH 2XC4A 3GY4A 1TOMH 4CH2B 2ZIQH 2ZCKP 3ZYDA 1O3IA 1O2TA 2Z9KA 5JBBS 3T26A 1HAHH 3ZVDA 4ABJA 5JBCS 1O31A 4BAHB 2WINI 1GJ6A 1CSOE 4SGBE 1AVGH 2J98A 4JMYA 1UTKA 2AMPA 1K1JA 3K65B 1IHTH 3MU5A 1DXPA 1F0TA 1EAUA 3HK3B 2KCAA 5AVDA 2V6NA 3T5FH 5ESTE 2LELA 3BEFB 3H5CB 1TMTH 5TCCA 2ZZUH 4MNWA 1D6WA 2OQUA 3A7WA 5DP4A 3LC3A 1XXFA 1PYTC 3LT3A 2BLWA 2HVYB 5DP3A 1BRAA 1P2KA 2WSSD 1OYTH 1P9UA 1DS2E 2QF3A 1GHBF 2ZGJA 3SNEA 1Z1JA 1CBWC 5A2MH 1SSXA 1FX0B 1ANCA 1GBIA 1ZHMA 1O2LA 5TCAA 1EB1H 2IOTA 2VWNA 2WV5A 4OS7A 3EQ0H 5DPAA 2ZFSA 5DP5A 2FOAA 5B6LA 3RMOH 4B2BA 1O5BB 2HNTC 2ZFRH 1O2VA 2KCPA 2ODPA 4F55A 2OBQA 4JK5A 1TOCB 4AFZA 1O5AB 4K5ZA 1QQUA 2J34A 5LPFA 1DWEH 4FUJA 3QWCH 4K60A 1F0UA 4O3UA 4X2XA 1ELTA 5FL7D 1EAXA 1KYNA 1KDQB 4NZQA 4AG1A 3OAAD 1O2QA 1A5IA 1G3BA 2NWNA 5HIZA 3OSYA 5EXLA 1YWUA 2OQ5A 3VPKA 2HWLB 4GHQA 1C9TA 1ANDA 4YOIA 2Y5HA 3SBKA 1T7CA 3A86A 2J4IA 2BDGA 1ABIH 2J97A 2EEKA 1WTHD 1XKAC 5EW2H 1BMAA 4NSYA 5K0HA 2BD3A 3ATMA 3BTFE 2NU2E 2KFWA 1FY3A 2EI7A 3M5LA 4AOQA 4KGAA 2TGAA 2Z3CA 3DT0H 3QGJA 2SFAA 1EP5A 1C1OA 5DP8A 1YLDA 4E7RG 8KME2 2BDBA 2WPHS 2P8OB 2HALA 1YKTA 1VCQA 4YXWD 1WQSA 3FP8E 1NM6A 2ZGHA 5C94A 1GI8B 2TPIZ 3K6YA 3SI3H 1PQ5A 3K2UA 4E05H 4AN7A 3A89A 3KQCA 1O3PB 3KQEA 1DXWA 2Y7ZA 1QHRB 1DLEA 3MI4A 1KXFA 5T6GA 1WXRA 3SGQE 4NIXA 3RXFA 3L33A 3EA8A 1C5OH 4KTUA 1P03A 1T8NA 3M35A 1QURH 4JZDH 4Q2KA 1AWFH 1GI6A 2L6OA 2DE8A 1IQLA 1F0RA 1GBBA 5EG4A 3ZVAA 5DP9A 3LKWA 2BQ6B 1O2KA 2SNVA 1DSUA 3ZVFA 1OPHB 4GAWA 1L0ZA 3SV6A 5FBEA 2EA3A 2FO9A 2FOHA 1HYLA 2BVSH 2EQNA 1FJSA 1S82A 1UCYH 4U2WA 4O3TA 3H7TA 1YC0A 3I77A 5ABWA 1UO6A 2BY7X 4BXSA 6CHAC 2GV6A 1O2PA 1SQTA 4MG3A 1RRKA 4GSOA 5DJ7A 4ACBA 1TBRH 1TGCA 1AFQB 2P59A 1GDUA 2PV9B 3LONA 1HIAA 4YOGA 2WV9A 4DGJA 4YOJA 1ZTKA 4GCHG 1ANBA 2O8LA 1GBTA 1CQQA 1A46H 3U28C 2PGQB 3TPIZ 1D9IA 1O37A 4DG4A 1TAWA 4TSFD 3MH7A 1F2SE 2J95A 2B8OH 1TALA 3V3MA 3TVJB 4A1TA 2Z6BD 3SHCH 1C1UH 1P3EA 6GCHG 1C4V2 1WBGB 2UUKB 3EAJA 2ODYB 2XTTB 4I8GA 1MKXH 2F9VA 3MH4A 1TONA 2C4FH 1P04A 5H4IB 3RXRA 5FHTA 1TBZH 3OTPA 2ALVA 3NZIA 5ETXA 1KLJH 1YP9A 2HNTF 5T6DA 1GHBG 2YMSB 1ETTH 4Y6DA 2XCFA 1JRTA 1BBRH 4NIYA 1NRQH 1NTPA 1SQOA 3TK5A 2QXIA 1RFNA 1XXDA 1P2NA 3G01A 4YM9A 1XVOA 4PROA 4X1PU 3TNTA 1K1OA 1DWDH 3HGPA 5L2ZH 3A83A 5FCKA 4K8BA 1ZR0A 4IGDA 2SNWA 8GCHG 1A7SA 4P00A 3NXPA 3SZNA 1TFXA 3SQEE 1O38A 1VITH 1AB9C 1NC6A 3GY6A 3FZDA 3HKJB 3MTYA 3M36A 3AAUA 1WOFA 4B74A 3D49H 5KGOA 3RUOA 1EP6A 3UNQA 2A2QH 2GMTC 5SGAE 3V13A 2FS8A 5DG6A 1W7XH 2WV4A 3MU8A 1UCYK 1PQAA 1ZJDA 1TMUH 1INCA 3RLYH 1GBJA 4FXGH 3WW7A 2GCTC 1RJXB 2OINA 4A92A 1D6RA 3Q3XA 2BXTH 1JIMA 1ZJKA 3RXMA 3KCGH 1YCPH 3LGIA 1H9HE 2BQWB 3SU0A 3LJOA 2ZA5A 2P3UB 1HAGE 1HJAC 1Q3XA 2UWLA 3NWUA 4UDWH 5EIYA 2I6SA 1LQEA 1GJ9B 3FANA 3P92A 5E0JA 4BANB 2XBVA 2OXSA 1WSSH 2ZFFH 2STAE 4ZXYH 5DP7A 1QTFA 2QGRA 5GXPA 2Q6DA 4WF8A 1CA0C 3PWCA 4CH8B 4E7NA 1G30B 4JZFH 2JETC 2FM2A 3RXDA 4A1VA 2AGEX 1MKXK 2VVUA 1ZPBA 3VEQB 1ORFA 3RXAA 1B0FA 1HRTH 2QCYA 2XWBI 2ZCHP 3OY5U 1N8OB 2ZDMA 3H09A 1S6LA 3U1IB 4XBDA 4MPWA 1EATA 2FPZA 5PTPA 1SPJA 1D3PB 1GVZA 4B2CA 2R9PA 2ZPSA 1MTSA 1BBRK 1FZZA 1LVMA 1BMFD 1QJ1B 4K8YA 3UAIC 1V2KT 2FWWA 5EGMA 1O2SA 1AY6H 4X1RU 2UUYA 3URDA 3GYMA 2AH4X 1BA8B 4FVDA 1AZZA 2FI5E 2KR7A 1RTKA 2J2UA 1OHHD 2RCEA 1DPOA 4D7FA 3KGPA 5GNDA 4ZHAA 1YF4A 1SR5C 5J4SA 5HYOA 4AG2A 4A6LA 2H5DA 3STIA 2VNTA 2A45B 2OC8A 1PPZA 2ULLA 2CMYA 1C2FA 3SJ9A 1SG8B 3A7XA 1ZGIA 1GBHA 3F2HA 2ZECA 2KM0A 2WHXA 4AGKA 3LIWA 7ESTE 1P02A 3RM0H 2BD5A 2ZGBH 2QV1A 1HAIH 2Y5GA 4Y7AA 1ZTJA 3RXQA 2ZHDA 1W7GH 5KEDA 4A7IB 6ESTA 4TY7A 2AHME 4NWKA 1VR1H 1JBUH 2EI8A 2M2AA 4JZ1A 3OEED 2A31A 1AMHA 1VGCC 1YCPK 1O3NA 2PP6A 1QRZA 2FODA 2C8WB 2QY0B 1HAVA 1ZZZA 1C1SA 1MTUA 1S6FA 1H9LB 5C5NA 3M7UA 4BXWA 2KX4A 2P94A 3ENSB 2FDAA 3A82A 1JMOH 2FOGA 1GI9B 3PTBA 4DT7B 4ZKSU 1QR3E 2TGPZ 3ZIAD 1CBWB 1LHDH 1O36A 1N6YA 1U6QA 2CF8H 4Z0KA 3PLPA 3BTGE 1EPTA 5I46H 2JDID 2F83A 4BAOB 1D4PB 1TBQH 1P05A 4OS5A 4DIIH 4I7YH 5EQRA 1BIOA 3MU1A 2ZF0H 1V2VT 4IMQA 1RD3B 2NU0E 1ELBA 3VGCC 3A81A 5DO4H 4NA9H 3TJOA 2P95A 1K22H 2ZTXA 3OU0A 1AN1E 1M9UA 3RC4A 4MNVA 3A7TA 1O3BA 2FOMB 3SGBE 1DM4B 1CT0E 2FESH 2BOKA 4OGXA 4Q4LA 2PW8H 3T62A 1OP0A 7KMEH 5A0BA 2BDHA 3ZZ8A 1O2MA 2BX3A 2XC0A 5AFYH 5T3HA 1Z8GA 1W11U 1TLDA 4AYVB 1V2NT 2G52A 1S84A 2JKHA 3RXBA 2SGQE 2VWLA 4BAQB 3GYLB 1HGTH 5GCHF 1RS0A 1GI7B 1QJ7B 1E1RD 1PPBH 3SV7A 4OGYA 1BTUA 4CBNA 3NRLA 1K1PA 1CE5A 3M7QA 4U30A 3U9AH 2ZHWH 4FU7A 1FQ3A 1GJCB 3EE7A 3SJIA 3U8TH 4K3JA 3BG8A 3E3TA 4OS2A 2BLOA 3RU4T 2XBXA 2CF9H 2J5UA 4FUFA 1P2JA 2ZTYA 2Y7XA 4DOQA 1TX8A 1W0KD 3GOVB 2OTVA 2IPHA 2OP9A 3CENA 3RXGA 1GI0A 1NRSH 1QGFA 1WDIA 3BEUA 3PYHA 3RLWH 1TIOA 4F49A 4J1YA 4FUBA 1NO9H 4I8HA 1BJUA 4Y10E 3E0PB 5E8EH 1XKBC 1O3DA 2ANKH 1F5LA 1DLKB 2D1JA 3T25A 2YOLA 2G55A 4KELA 1HB0B 2R0KA 4AX9H 1PPHE 1Y8TA 2BQ7B 4UE7H 3MH6A 5CHBA 1EFRD 3ZZ6A 3M61U 3F9GA 2A2XH 1ACBE 1C1QA 3M5OA 2V3HH 3PO1C 3GY2A 3GCHC 6CHAB 3QLPH 5FPYA 3ATKA 4ABBA 1O3LA 4FUEA 2QIQA 2R2MB 2WPJS 1AI8H 2FLBH 3I78A 1YCPM 3SOSA 1P09A 3M3VA 1WCZA 3SJOA 2Y81A 5JBAS 1DUAA 3MHWU 1Z1IA 2VVVA 2UUJB 4B75A 3A8BA 4WMFA 2RFKC 2RG3A 2O8TA 3A88A 4DURA 2IJD1 1A1RA 2SGDE 1V2JT 5LPRA 2AS9A 2PKSC 2ZO3H 2PR3A 2FOEA 2VIDA 4ZXXH 1GI1A 4GCHF 1IQHA 3E1XB 2XYAA 3ZVBA 3A7ZA 1ESAA 1MBMA 1T4UH 2FOFA 2BHGA 2P93A 3EYDA 4LK4A 4DT4A 2GVFA 4Y0ZE 1AUTC 3ESTA 2VINA 4MPUA 1NFYA 4X8SH 1DY8A 5TJXA 2WZQA 4NG9H 1AUJA 1J8AA 3PLKA 3N7DA 1BZXE 4UFFH 3UOUA 6GCHF 2KZ4A 4HZHA 1SOZA 4GUXA 1VKYA 5K7RA 2R0LA 2VJ1A 3M5NA 4XDEA 3SUFA 5FPSA 2HRVA 1RTLA 4D9RA 2FYRA 4MTBA 1SLVB 1O3MA 2F9OA 2VIPA 1EKBB 5A09A 4ISIH 1TPOA 1TPPA 2ODQA 2BD4A 3LGUA 1ZSKA 1IQFA 1YPKH 1O3KA 1G36A 1LKAA 3BTDE 1G3EA 4R0IA 2PSYA 3LGVA 1GPZA 2ZU1A 3AW0A 1LPGB 1K1IA 1BUIA 5C0TA 2BD2A 3DSPA 3GCNA 3K9XB 4XD7D 1AB9B 1E35B 8GCHF 3NUMA 3RXKA 3F1SB 1L4ZA 2GCHF 1LVBA 1G32B 2XW9A 3BV9B 4RKJB 5IDKA 1EXFA 2ZPQA 1GDNA 1GMDF 3SV2H 4DY7B 2FX4A 2B0FA 1O39A 1NY22 1SL3A 1UJ1A 3QTOH 1E37B 3M3SA 2GMTB 5HXFA 1O0DH 2TRMA 3KQ5A 2FI3E 2PHBA 1SGYE 2D2DA 4LOYH 1QQ4A 1SGDE 1YGCH 1G3CA 2KCOA 3U69H 2PKAA 3BTME 4ABGA 1O2XA 4CREA 1C5QA 1C1WH 1QA7A 2GCTB 1A4WH 3RMNH 3BTWE 1T8LA 1UVTH 1W2KH 1XUIA 2PUXB 2ANWA 1TQ0B 1MCTA 3LH3A 4Q7YA 3TJNA 1C1MA 3A7YA 5JPMH 1K2I1 2Z9GA 1TGBA 2A4GA 1J14A 5GCHG 1MU6B 1E36B 1AQ7A 1HJAB 1V2LT 2AGIX 2ZWLH 3SU4A 1GL1A 3WY8A 2XOKD 4AGJA 3L6PA 4O9VA 2XWAA 1NT1A 5E0GA 5GPIB 1HXFH 4RT1A 2BB4A 3EDXB 3TH4H 1O3CA 4IC6A 1HDTH 2ZQ1A 3FAOA 3RXUA 5F8XA 4CRBA 4OS4A 1CA0B 2TBSA 1FXYA 1DITH 3UR9A 3LH1A 1UVUH 2CK3D 1G2MA 3CS0A 3QGNB 2PWXA 4TT3D 3SV8A 1J15A 2JETB 5CHAC 3M37A 2ZGXH 1H8IH 1GJ8B 1GG6C 2XRCA 1L1NA 1UCYE 5EXMA 2PGBB 4UD9H 3Q76A 2GKVE 1HPGA 2EC9H 1V2MT 3KYGA 2BDCA 4XOJA 1W8BH 1ZPCA 3F2GA 1A3EH 4D9QA 1NS3A 4CHAC 2BTCE 5C17A 1TNJA 1GL0E 4MDSA 5F6MA 4INKA 3KYFA 1H8DH 1IAUA 1BTHH 1L1JA 1KLTA 2WPDD 4RI0A 1AE5A 2SGEE 4FUCA 4ABHA 5E0HA 3BTHE 3BN9A 2IJOB 3SNDA 3MO9A 4ABIA 4DW2U 1KDQA 1E34B 1E1QD 1HJ9A 1QNJA 1GJ7B 4CR9A 2ZPRA 1O2OA 1X7AC 1G2LA 3PMHB 3CP7A 4U32A 3FZZA 4YLUA 1O5DH 3MNSA 2C90B 3NKKA 4BAKB 1GCTC 5C2ZA 1TABE 5EJZA 4ACAA 1ZHRA 1KY9A 1SGIB 3RXCA 3O8CA 1KXCA 1XUJA 2Q6FA 1EZQA 2V3MA 4NWLA 1ARBA 1TX6A 2QXGA 2F4LA 2WYGA 1TNIA 2QN5T 3W95A 4ABAA 1FY4A 3TU7H 1TWXB 1A0LA 5BRRE 3ZZ3A 1FY8E 1QL9A 3OYPA 3KIDU 1VGCB 1Z7KA 3RXSA 3TH3H 2VGCC 2GZ9A 2J92A 1NFWA 4MPVA 3ZV8A 1KLIH 3LDXH 2QF0A 1ELFA 3SU1A 2CGAA 2OK5A 4X8TH 4D8NA 1ARCA 4ISLA 4X8UH 5JB9S 1EUFA 5EW1H 3Q00A 2YNBA 5HIYA 1FUJA 2O8WA 3PM3A 3OTJE 4R8TB 3HKIB 5DGJA 1FONA 3GDUA 3IG6B 1BQYA 3QO6A 1N1LA 1O2HA 1SBWA 1O2JA 1YPLH 4KKDA 4SGAE 1J9CH 1FIWA 4H6TA 2V3OH 1UK3A 3PROA 3RXVA 4JYTA 2Y6TA 2FI4E 1ABJH 1GI5A 3RU4D 1V2QT 1QBVH 1YPMH 3HK6B 4Y8XA 1S83A 3VGCB 1LPZB 3HATH 1J16A 2B9LA 1W10U 2GCHG 3ZVEA 7LPRA 2A5KA 4KTCA 1GMDG 5AHGH 1CT4E 2GD4B 1V3XA 1YY3A 2WYJA 2M5TA 2YMSD 3ODFA 1SFIA 3UREA 1FMGA 4FU8A 1LCYA 4RKOB 2BY5X 1SLWB 1LKBA 2BOHB 2H2ZA 3V0XA 2G51A 4Q80A 4Y7BA 1BTPA 2H6MA 2OD3B 2ZDLA 3QN7A 5LPEA 5EJ1A 1DVAH 1DFPA 1N6XA 3E91A 1C2IA 1XUFA 3EE0B 4X1NU 1Y3WA 3VXEH 3W1EA 1Z8IB 3TJUA 2A5IA 3OFND 3RXHA 4GHTA 3O8BA 2ZU2A 4ABDA 8LPRA 1BTYA 1C5YB 4GVUA 2QAAA 3QX5H 1DY9A 1XM1A 1Z6EA 1GI3A 2BXUH 3ATWA 4KTSA 1PPEE 1NN6A 3A84A 4OS1A 3M3TA 2TGTA 3NPSA 3DFLA 1GBDA 2BM2A 5C5OA 4K69A 3F6UH 4INLA 1J17T 2XBYA 4FUIA 4AB8A 1V2PT 2ZU3A 4I33A 5EXNA 1HFDA 4A5TS 2ZFPH 1C2JA 4M9FA 1GCDA 3C1KA 1E79D 1BB0B 4X2WA 1TRMA 4CRFA 1O3AA 1P57B 3VFEA 2GZ8A 3ZZDA 2AERH 1NESE 2QYIA 3KN2A 3LGYA 3SV9A 1FY1A 2YNAA 1GBLA 1BHXF 1MCVA 1P2MA 1W3CA 2ZDAH 2ZU4A 2B5TB 1A3BH 1MTVA 5G4BA 1GBAA 1GJDB 2XNIA 2OBOA 3MO3A 5T1VA 1EZXC 4YLQH 1YYY1 2Q6GA 1NROH 1MBQA 4GPGA 1XMNB 3T27A 1HV7A 3PO1B 2BMGB 3UQVA 1EJAA 2ZHFH 5FX6A 3OEHD 4UONA 3GCHB 4LZ1H 1VCPA 1FLEE 2A7HA 2QA9E 3TNSA 2JJ1D 1QY6A 1G9IE 1NFUA 3LGWA 1TNHA 3AAVA 2W7SA 3TITA 2JIZD 1O35A 1S6HA 4JYVH 1A5HA 4IMZA 3SU2A 1QJ6B 3P95A 1OWEA 2WPMS 3ZYEA 1E0FD 4YZUA 4MQAA 4WH8A 2PKSB 5L6NH 1XVMA 3UPEA 4F4OC 7GCHG 4I32A 1WU1A 5HKKD 1C4Y2 3EA7A 4DCDA 4ESTE 3UWIA 1C5NH 1EJMA 4BTIB 3GCTG 4K1SA 5DN6D 2H5CA 1TGTA 2ALPA 5EU8A 2AYWA 4NA8A 1AKSB 2JH6D 1TMBH 1ZGVA 4FUHA 4IN2A 1BMMH 1BTWA 1GMHG 3BIVH 4GLYA 4AC9A 2ZHEH 1ZLRA 3SNCA 2Z9JA 3SUDA 1QL7A 1JRSA 4KP0A 2ZQ2A 1W0YH 4FVBA 3AK5A 2GJGA 2O8UA 1ELCA 2A32A 2CHAC 4Y71A 2BYAX 3NCLA 2Q1JA 2GT8A 1K28D 1PFXC 1C5SA 1SQRA 1WUNH 3DSGA 1TNGA 2FEQH 1JWTA 2OC1A 1FDPA 3TJVA 5L2YH 3RC6A 1P8VC 2AEIH 2FMJA 2Z3EA 1AHTH 1HAXB 4BOHA 1JOUB 3A8DA
chains in the Genus database with same CATH topology
1NBME 2XOKD 3L6PA 3SV9A 3SU5A 3RC5A 3WWBA 2L6OA 5GPIB 2KR7A 4R8TB 3SUGA 1OHHD 3GS9A 3N7EA 5GNDA 4DT4A 3EYDA 1N1LA 4A1XA 2WSSD 3SU3A 2GVFA 3SYJA 3WWFA 3LKWA 1W3CA 1NBMD 2K0QA 1FX0B 3DCLA 1DY8A 2CK3D 2JJ2D 3SV8A 3F3BA 4TT3D 2OC8A 2WZQA 2A4QA 2XNIA 4B74A 3SV6A 2OBOA 4WH6A 2HLDD 5T1VA 2O8MA 3N7DA 4Q63A 1COWD 2OC7A 5B6LA 3F2HA 1E1RD 1BT7A 2KM0A 2KZ4A 3FOAA 2WHXA 2QF4A 3SV7A 4ZCNA 3OEHD 2KCPA 3M5MA 3NRLA 4Q4LA 4F55A 2OBQA 2QV1A 3KEEA 3PRBA 3M5NA 5F53A 3SUFA 3O8DA 3FKSD 2JJ1D 5FPSA 1RTLA 3WW7A 5DSFA 5EQSA 3F2GA 4ASUD 2OINA 1NS3A 3UB0A 4A92A 4KTCA 3PV5A 2J5UA 2YMSC 2JIZD 4B76A 1W0JD 5C17A 2AHME 4NWKA 1W0KD 2YMSD 3LOXA 2M2AA 2XNDD 2P59A 3OEED 4B73A 3FO8D 3LONA 4TYDA 3SU0A 5FL7D 3SU2A 4I31A 2WV9A 5C0UA 2FP7B 2WPDD 3OAAD 4RI0A 4WH8A 4B6EA 3F0PA 4FETA 2K8IA 4I32A 2QE7D 4Z1MD 5HKKD 2IJOB 5GJ4B 2GGVB 5ESBA 5C0TA 4TSFD 3DSPA 4XD7D 2W6JD 5EPYA 4B71A 1JXPA 1CU1A 4U01A 1E1QD 2W6ID 2VBCA 2F43B 3W1EA 5EPNA 3PV2A 3ZIAD 3O8RA 5DN6D 3OFND 2A4RA 3SZEA 4B6FA 1H8ED 2V7QD 3O8BA 2YOLA 5IDKA 4A1TA 2F9UA 2QF5A 4WF8A 3PRDA 3F2FA 1DY9A 3VG8A 3N99A 5CHBA 1EFRD 3KF2A 2JDID 1MABB 2FM2A 2KFWA 3O8CA 2F9VA 3M5LA 3P8NA 3SUDA 4A1VA 5FPTA 4NWLA 1H8HD 3KNXA 3F0OA 5EQRA 3M5OA 2KCOA 2F4LA 3DSOA 5H4IB 3AK5A 3E90B 5CDFE 5FPYA 3SUEA 3H09A 3OTPA 5ETXA 3U1JB 1S6LA 4OM9A 3U1IB 2YMSB 4YXWD 2KCYA 4I33A 1RGQA 2OC0A 2XCFA 2K1QA 4JMYA 3SU6A 3OYPA 5EQQA 2OC1A 1DXPA 4M9FA 3RC4A 2KCAA 2A4GA 1DXWA 1BMFD 1E79D 3FN8A 3RC6A 3OE7D 4B75A 1SKYE 2FOMB 2XCNA 1KMHB 1WXRA 2LELA 2IJD1 1A1RA 5IK2D 3SU1A 3SU4A 2OK5A 3P8OA 4K8BA 3KN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K0Q A;  3DSO A;  3N7E A;  2LEL A;  2KM0 A;  3DSP A;  3N7D A; 
#chains in the Genus database with same CATH topology
 1O3F A;  1C5Z B;  4NIW A;  1C2H A;  3ZV9 A;  2AMQ A;  6LPR A;  1P0S H;  5JYI A;  2ZCL P;  3ZVG A;  4VGC C;  1C5T A;  1P01 A;  1MKW H;  2IPQ X;  4CRC A;  2C8Z B;  1PYT D;  4JK6 A;  3S69 A;  2BZ6 H;  3ZZ9 A;  1K21 H;  5DKM A;  1Y59 T;  1QRW A;  1HNE E;  1SMF E;  3ATL A;  2JJ2 D;  4ZRO A;  2FOC A;  1SLX B;  1TRN A;  4X6M A;  1SVP A;  1OXG A;  2ZC9 H;  1AVX A;  1UTO A;  5J4Q A;  1Y3Y A;  1GBE A;  1T4V H;  2W3I A;  1GWA A;  2QXH A;  1NRP H;  3PRB A;  1LHG H;  2BY9 X;  4ZH8 A;  1YBW A;  1MTN C;  3SOR A;  1SGP E;  3QTV H;  1YPE H;  3S7H B;  1Y3V A;  2W7U A;  1C5L H;  3RMM H;  1DOJ A;  1ZML A;  1BCU H;  4B73 A;  1IQN A;  4TYD A;  1LO6 A;  3A8C A;  5C0U A;  1F7Z A;  1VZQ H;  2GX4 A;  2FIR H;  3RXL A;  4AZ2 B;  4IC5 A;  1O2R A;  4I8J A;  3F0P A;  5C20 A;  1UMA H;  3MU4 A;  2VIO A;  2AFQ B;  3JZ2 B;  4JZI A;  2VVC A;  5FBI A;  1HCG A;  5HM2 A;  5F8Z A;  3ZZB A;  4K1E A;  1GBC A;  1P10 A;  2ZHQ H;  1C2K A;  2HGT H;  1A2C H;  2BZA A;  4Y76 A;  3OX7 U;  2ZDK A;  2BDI A;  2AIQ A;  4NFF A;  4X6P A;  2HOB A;  1SLU B;  5A0A E;  2F9U A;  2DUC A;  1OWK A;  4Y0Y E;  2G00 A;  2ZG0 H;  5CHA B;  1UVP A;  2IN2 A;  1TA6 A;  1OP2 A;  1C5R A;  1GG6 B;  4DVA U;  1ELD E;  1B0E A;  1T8M A;  1ZMJ A;  3BTT E;  1MQ5 A;  1XX9 A;  3UR6 A;  4MNY A;  1KTS B;  1TGS Z;  1FN6 A;  1O30 A;  2F9N A;  1AE8 H;  2XC5 A;  1C5V A;  3U98 H;  4CHA B;  3T28 A;  1GBK A;  2AMD A;  1EZU C;  1EAW A;  1MMJ N;  1UVO A;  4FUD A;  1YPG H;  2ZTZ A;  1MQ6 A;  1O2W A;  3FN8 A;  5LGO A;  1GHA G;  4I8L A;  1BHX B;  1CA8 B;  1UTN A;  3CNR A;  5C67 A;  4NGA H;  1GHV H;  1IQJ A;  5FX5 A;  1ZRK A;  2XXL A;  3D62 A;  3LC5 A;  4YES B;  1H4W A;  3E8L A;  4TWY A;  3RC5 A;  1NU9 A;  4Y79 A;  3RXE A;  1IQM A;  1DST A;  1B7X B;  1CGI E;  2UUF B;  3SW2 B;  1GHX H;  1QA0 A;  1QBN A;  4HTC H;  1EPT C;  1MKW K;  5DK1 A;  4A1X A;  5IYT A;  3S7K B;  1SI5 H;  1W0Z U;  2EY4 C;  2Z7F E;  1PQ8 A;  2KAI B;  4DIH H;  1GCT B;  2BD9 A;  3SNA A;  1P12 E;  4X6O A;  4AYY B;  1VJ9 U;  2BLV A;  3FP6 E;  1D3D B;  1THS H;  3JZ1 B;  1BRU P;  1GGD C;  1P9S A;  4ZCN A;  1EX3 A;  1HUT H;  2FTM A;  1YLC A;  3QUM P;  2ZGC A;  1OWJ A;  4H6S B;  3PLB A;  1ZSJ A;  3Q77 A;  3LPR A;  1Z8R A;  2GTB A;  5I25 A;  3P70 B;  3AW1 A;  1W0J D;  2TGD A;  4NIV A;  3LOX A;  2VGC B;  5CMX H;  1LHF H;  4YT6 H;  3A85 A;  3UWJ H;  1GI2 A;  4X8V H;  3PTN A;  2UWP A;  1FPC H;  3AAS A;  3D23 A;  1Y5U T;  1G3D A;  1O2G H;  4HI3 A;  1CHG A;  5ESB A;  1C2G A;  2G4U A;  1QZ8 A;  3BTE E;  1O3O A;  5GIB A;  1NU7 B;  3QZR A;  1DE7 H;  3NK8 A;  1AD8 H;  1HAZ B;  2GDE H;  2QF5 A;  3MO6 A;  4X1Q U;  1UK4 A;  2G4T A;  3ODD A;  1LVY A;  2PLX A;  3QK1 A;  4ABF A;  1YM0 A;  2EST E;  2H9T H;  2A7J A;  1KSN A;  2GP9 B;  1QB1 A;  1O2Z A;  5HGG A;  4NZL A;  2A0Q B;  2OUA A;  1GHY H;  2QXJ A;  1C5M D;  1LMW B;  1A5G H;  3T29 A;  1Z71 A;  2KCY A;  3SJ8 A;  5CE1 A;  3SU6 A;  3ZZ4 A;  3PWB A;  2UWO A;  3GIC B;  1UTL M;  4WWY A;  3DD2 H;  2R2W U;  2Y80 A;  4JYU H;  1TNL A;  2ILN A;  5DP6 A;  1DWB H;  1OKX A;  1H9I E;  4XBB A;  1GMC G;  3RXP A;  4ABE A;  1Q31 A;  1L2E A;  2KAI A;  2NU4 E;  1V2W T;  1PPC E;  4UFG H;  4HG6 A;  1GJA B;  3HPT B;  4U01 A;  2WUC A;  3TK6 A;  3TK9 A;  2FLR H;  2TIO A;  1A61 H;  1BDA A;  1DWC H;  2FX6 A;  2PUQ H;  5F8T A;  4UFD H;  2F9P A;  1CVW H;  4NA7 A;  1MD8 A;  2V0B A;  3UFA A;  3GS9 A;  2RA0 A;  4ZAE A;  1BRC E;  1O2Y A;  2NU1 E;  4ZHL U;  4XFQ A;  3IIT A;  3RXI A;  1GJB B;  4Q7Z A;  5HMA A;  2HNT E;  2P16 A;  3DCL A;  3UQO A;  1JIR A;  4AFU A;  2A4Q A;  1SGQ E;  1O3H A;  3VB7 A;  2FOB A;  1SGN E;  3ATI A;  3E0N B;  3GIS B;  3Q3Y A;  4MLF B;  4RT0 A;  1C2L A;  2XBW A;  4B2A A;  3GY5 A;  1S81 A;  5AFZ H;  3SO3 A;  1W14 U;  1O32 A;  3O8D A;  3FKS D;  1MU8 B;  1RXP A;  2PSX A;  1HIA B;  1PJP A;  3E6P H;  1XUH A;  3RM2 H;  1EST A;  2A7C A;  5EQS A;  5A0C A;  1K1L A;  3UB0 A;  1H1B A;  1FN8 A;  1K1M A;  1L4D A;  3KHV A;  2EI6 A;  1YPJ H;  4TPY A;  1ZYO A;  1QB9 A;  4UFE H;  4J2Y B;  2Y82 A;  2F91 A;  2K8I A;  5GJ4 B;  1YPH C;  4ISO A;  1UTJ A;  1P11 E;  1O2N A;  1UW7 A;  4TPI Z;  2R3Y A;  4RN6 A;  1QIX B;  1XUG A;  1OWH A;  1RIW C;  1DT2 A;  4TWW A;  3PV2 A;  3O8R A;  1OWI A;  2ZP0 H;  1A0J A;  3UNS A;  4ZKR U;  4JZE H;  4Y8Z A;  5AF9 H;  1FAK H;  1UTM A;  5T6F A;  2GT7 A;  3MNB A;  5A8Z A;  1KXA A;  1W12 U;  3MWI U;  4MVN A;  1SFQ B;  1V2U T;  3BG4 C;  4ASH A;  1GBM A;  3A87 A;  1LDT T;  1YPH E;  2JH5 D;  2C3S A;  3B8J A;  1SHH B;  1FPH H;  1SGF G;  1Q2W A;  3S9A A;  1H8H D;  3FVF B;  3URC A;  1FAX A;  3DA9 B;  3HGN A;  4OM9 A;  1P06 A;  3UNR A;  2VH6 A;  1EOL A;  1O2I A;  2ZU5 A;  1C9P A;  1HLT H;  1K0H A;  2RDE A;  3ZZ5 A;  1IHS H;  1S5S A;  2QC2 A;  1QCP A;  3DUX H;  5GDS H;  5KEC A;  1BJV A;  2ZFQ H;  1MD7 A;  1PPG E;  1AZ8 A;  1TE0 A;  1TRY A;  3SJK A;  2G81 E;  1TB6 H;  1W13 U;  3CS7 A;  4IBL H;  5A8X A;  1O33 A;  5IK2 D;  1RTF B;  2HVX A;  4XSK U;  3P8O A;  1Y5B T;  1OOK B;  4Q7X A;  7GCH F;  1QB6 A;  3WWB A;  2ANM H;  2G5N A;  3DHK H;  3MNX A;  2RDL A;  3PMB B;  3GCT F;  2F9B H;  1NBM D;  3GDV A;  1BBR E;  5GWZ A;  1CGH A;  1HAO H;  3MNC A;  1FIZ A;  1WAY B;  3SI4 H;  1ELG A;  1FV9 A;  3W94 A;  4WH6 A;  4NCY A;  1LHE H;  1XUK A;  4ISH H;  2BY8 X;  1WTG H;  2FZZ A;  3DFJ A;  2H9H A;  1GMH F;  2QF4 A;  2Z9L A;  3ZZC A;  3RDZ A;  4FUG A;  2CXV A;  3M5M A;  3PMJ A;  5FAH A;  1GHW H;  2STB E;  2CHA B;  2Y5F A;  1NPM A;  4X2Y A;  3KQD A;  5FXL A;  1L1G A;  4ASU D;  1C2E A;  2BVR H;  1UTP A;  5EOD A;  4WY3 A;  1VJA U;  3FFG A;  1ESB A;  4Y8Y A;  2LPR A;  1Y3U A;  2J94 A;  4K2Y A;  2Z9I A;  2FP7 B;  2L74 A;  1SGT A;  3ZVC A;  2VH0 A;  3A7V A;  1UTQ A;  2VIV A;  2OCV B;  3QZQ A;  2W5E A;  3EA9 A;  4QT8 C;  3UUZ A;  4IW4 E;  1NZQ H;  4VGC B;  1MAX A;  3UIR A;  3UOP A;  2H9E H;  1WYK A;  4H42 U;  2VBC A;  5EPN A;  2SGF E;  3A80 A;  5EJL A;  2A4R A;  2DE9 A;  1E38 B;  4ZKO U;  1H8E D;  2V7Q D;  1C1N A;  3Q3K A;  4O97 A;  3KF2 A;  4IS5 A;  1P3C A;  1ZOM A;  1BML A;  1SGF A;  4B1T A;  3F0O A;  1ZPZ A;  4WXI A;  3TIU A;  3DSO A;  4NFE A;  3E90 B;  1MTN B;  2SGP E;  4LXB H;  1GVK B;  1MH0 A;  3SUE A;  5E2O A;  1D3T B;  2BDY A;  1KXE A;  1ZSL A;  4HFP B;  4M7G A;  4AOR A;  1MZD A;  3MH5 A;  1RGQ A;  3RXT A;  1LHC H;  1DIC A;  1F5R A;  1V2O T;  2FXR A;  4FOU C;  1P2I A;  5C1Y A;  3MMG A;  2ZI2 H;  3LU9 B;  1SKY E;  2XCN A;  1P2Q A;  3EGK H;  1BOQ A;  3RXJ A;  3N7O A;  4CRA A;  1HAY B;  3B9F H;  1WQV H;  3P8F A;  3MU0 A;  1UK2 A;  4OS6 A;  3SQH E;  3VB4 A;  1TNK A;  3UTU H;  1HJ8 A;  1O34 A;  2WPL S;  3I29 A;  1AIX H;  4XBC A;  3TGK E;  1O5F H;  2OLG A;  3C27 B;  1IQE A;  3U8R H;  1MUE B;  2WPI S;  2ZNK H;  1OX1 A;  4TY6 A;  3F3B A;  3SGA E;  1DUE A;  2HLD D;  4WXV A;  1F92 A;  2OC7 A;  4ZUH A;  3RML H;  1QFK H;  4WVP E;  1TQ7 B;  5C1U A;  1GJ4 H;  3RXO A;  3TGJ E;  1GI4 A;  1ELE E;  3BTQ E;  2GV7 A;  1ETS H;  2B7D H;  1CGJ E;  1BTZ A;  1EB2 A;  2FS9 A;  4DJZ B;  1FY5 A;  2Z3D A;  1CO7 E;  2VIQ A;  1DX5 M;  3FP7 E;  3LGT A;  4O03 A;  2P8O C;  3ELA H;  1O5G H;  1HAV B;  1P2O A;  2PTN A;  1C5U A;  3GY7 A;  4FU9 A;  4D76 A;  3V7T A;  4K1T A;  2XND D;  4ZMA H;  4I31 A;  5JDU B;  1EAI A;  1FNI A;  1ZMN A;  1YLN A;  4B6E A;  1GHA F;  4Z1M D;  1DDJ A;  1GHZ A;  4H4F A;  2GGV B;  3BIU H;  3OY6 U;  2VU8 E;  1C5P A;  1EOJ A;  3E16 B;  3KQB A;  2W6J D;  1CU1 A;  4P02 A;  1EPT B;  3MFJ A;  1AO5 A;  2W6I D;  2C8X B;  2GZ7 A;  1ELV A;  3IWM A;  3L3T A;  3PRD A;  1IQK A;  4AB9 A;  3N99 A;  1V2T T;  1EQ9 A;  2AIP A;  1TPA E;  2O9Q A;  3TH2 H;  4CRD A;  1GGD B;  2JH0 D;  1T31 A;  2D26 C;  1VIT F;  3F9F A;  3P8N A;  5EOK A;  5FPT A;  1CHO F;  3KNX A;  3RP2 A;  4XE4 A;  3U8O H;  3UY9 A;  9LPR A;  5CDF E;  4MNX A;  3ZZA A;  4BTU B;  2A5A A;  3ITI A;  2BY6 X;  2PFE A;  2G5V A;  3F68 H;  4INH A;  1S85 A;  1O3E A;  2D8W A;  2I6Q A;  2RA3 A;  5EQQ A;  3P17 H;  1O3G A;  1AFQ C;  2G8T A;  1NRN H;  1PPF E;  2NU3 E;  4XRN A;  3OE7 D;  1UHB B;  3SN8 A;  1KTT B;  2ZEB A;  1THR H;  1K1N A;  1D3Q B;  1FI8 A;  1C1V H;  2HPQ H;  1NBM E;  1QL8 A;  1Z6J H;  3GY3 A;  1VCW A;  2WPK S;  2LNC A;  3S9B A;  3SUG A;  1Y3X A;  2GDD A;  3F9E A;  4D7G A;  4X6N A;  3SU3 A;  3SYJ A;  3WWF A;  1A0H B;  1C2D A;  2H1U A;  2K0Q A;  2Z94 A;  4YO9 A;  3BSQ A;  4ZKN U;  2O8M A;  2P3F H;  4Q63 A;  1AVW A;  2VB0 A;  1BTX A;  1BT7 A;  5JBT A;  3PMA B;  3FOA A;  1IOE A;  3VB6 A;  1AWH B;  1K9O E;  1O2U A;  3KEE A;  1BIT A;  1OS8 A;  5F53 A;  4CBO A;  1AU8 A;  4Z6A H;  5FCR A;  1SB1 H;  5E2P A;  4CRG A;  4YT7 H;  1LVO A;  1ZRB A;  3R3G B;  5LH8 A;  2YMS C;  2R3U A;  4ZHM U;  1G37 A;  3H7O A;  3SHA H;  1IQI A;  3MOC A;  3RU4 E;  1S0Q A;  4BTT B;  3S9C A;  2BD7 A;  4X0W U;  1QRX A;  3FO8 D;  4BNR A;  4CR5 A;  3BEI B;  2CV3 A;  3STJ A;  5HM9 A;  2F3C E;  2V35 A;  2A1D B;  2QE7 D;  2ZDV H;  1GMC F;  2AGG X;  2SGA A;  1LTO A;  2ANY A;  1OP8 A;  1MAY A;  3QDZ B;  3LJJ A;  3BTK E;  1O5E H;  4B71 A;  1JXP A;  2FTL E;  2HLC A;  2J38 A;  2F43 B;  1O5C B;  1ETR H;  1HAP H;  2LP6 A;  1OSS A;  1C1R A;  1NRR H;  3F2F A;  9EST A;  3R0F A;  1SC8 U;  2P3T B;  5L30 H;  1MAB B;  2PTC E;  2BLQ A;  4I86 A;  3TLO A;  1MZA A;  5C3N A;  2VIW A;  4MPX A;  1BRB E;  3GCO A;  1ZHP A;  4WME A;  1AKS A;  1AFE H;  1UHB A;  2HPP H;  1C1P A;  2FYQ A;  5B6O A;  3U1J B;  4Y11 E;  1HBT H;  1PQ7 A;  1SGR E;  1C4U 2;  1QBO A;  2OC0 A;  2K1Q A;  1LQD B;  1TYN A;  3BF6 H;  5BPE A;  4AFS A;  3MQK C;  5C1X A;  4LZ4 B;  4X2V A;  2W3K A;  2CN0 H;  2WUB A;  3SNB A;  3VB5 A;  1OWD A;  1KMH B;  1C2M A;  1GDQ A;  2ZKS A;  3PV4 A;  5F03 A;  2J98 B;  3B23 B;  3V12 A;  3SU5 A;  1Y5A T;  1RIW B;  3KL6 A;  3VXF H;  1ZTL A;  1NFX A;  3AVZ A;  3N7E A;  1V2S T;  2ASU B;  3VB3 A;  1THP B;  1F5K U;  3S0N A;  1GVL A;  2A4O A;  2C93 B;  2THF B;  1Z8J B;  3BG4 B;  1V2R T;  2BVX H;  3T2N A;  1TX7 A;  1DAN H;  1COW D;  3D65 E;  3A8A A;  2BD8 A;  1SOT A;  4RSP A;  4WMD A;  5A8Y A;  1GBF A;  4I8K A;  4HGC A;  4THN H;  1B5G H;  3ZZ7 A;  3MYW A;  1F0S A;  1KXB A;  1N8O C;  1AGJ A;  5DSF A;  4E06 H;  3F9H A;  1EZS C;  1C1T A;  2VWO A;  3PV5 A;  4B76 A;  2J9N A;  3K6Z A;  5JB8 S;  1BMN H;  1ID5 H;  1KIG H;  1SHY A;  3GY8 A;  4F48 B;  2BDA A;  1GJ5 H;  1TA2 A;  3GDS A;  4BAM B;  4JCN A;  2BX4 A;  1KXD A;  2C8Y B;  1VIT G;  1CHO G;  1SGC A;  3P6Z B;  1EAS A;  8EST E;  1UVS H;  1T32 A;  4FET A;  1S0R A;  1TGN A;  3M7T A;  4IN1 A;  2W26 A;  4UEH H;  4X1S U;  1LPK B;  4YTA A;  4NSV A;  1SQA A;  5EPY A;  1O3J A;  1TPS A;  2VWM A;  3PB1 E;  1IQG A;  3P8G A;  1ANE A;  3SZE A;  4B6F A;  1C5X B;  1ELA A;  1V6D A;  1SGE E;  1EJN A;  2PKA B;  4WJG 2;  2ZFT A;  3TGI E;  4AFQ A;  1CT2 E;  3VG8 A;  1T8O A;  1WV7 H;  2ZDN A;  1C5W B;  4ISN A;  1OYQ A;  1MTW A;  2CJI A;  1HXE H;  2XC4 A;  3GY4 A;  1TOM H;  4CH2 B;  2ZIQ H;  2ZCK P;  3ZYD A;  1O3I A;  1O2T A;  2Z9K A;  5JBB S;  3T26 A;  1HAH H;  3ZVD A;  4ABJ A;  5JBC S;  1O31 A;  4BAH B;  2WIN I;  1GJ6 A;  1CSO E;  4SGB E;  1AVG H;  2J98 A;  4JMY A;  1UTK A;  2AMP A;  1K1J A;  3K65 B;  1IHT H;  3MU5 A;  1DXP A;  1F0T A;  1EAU A;  3HK3 B;  2KCA A;  5AVD A;  2V6N A;  3T5F H;  5EST E;  2LEL A;  3BEF B;  3H5C B;  1TMT H;  5TCC A;  2ZZU H;  4MNW A;  1D6W A;  2OQU A;  3A7W A;  5DP4 A;  3LC3 A;  1XXF A;  1PYT C;  3LT3 A;  2BLW A;  2HVY B;  5DP3 A;  1BRA A;  1P2K A;  2WSS D;  1OYT H;  1P9U A;  1DS2 E;  2QF3 A;  1GHB F;  2ZGJ A;  3SNE A;  1Z1J A;  1CBW C;  5A2M H;  1SSX A;  1FX0 B;  1ANC A;  1GBI A;  1ZHM A;  1O2L A;  5TCA A;  1EB1 H;  2IOT A;  2VWN A;  2WV5 A;  4OS7 A;  3EQ0 H;  5DPA A;  2ZFS A;  5DP5 A;  2FOA A;  5B6L A;  3RMO H;  4B2B A;  1O5B B;  2HNT C;  2ZFR H;  1O2V A;  2KCP A;  2ODP A;  4F55 A;  2OBQ A;  4JK5 A;  1TOC B;  4AFZ A;  1O5A B;  4K5Z A;  1QQU A;  2J34 A;  5LPF A;  1DWE H;  4FUJ A;  3QWC H;  4K60 A;  1F0U A;  4O3U A;  4X2X A;  1ELT A;  5FL7 D;  1EAX A;  1KYN A;  1KDQ B;  4NZQ A;  4AG1 A;  3OAA D;  1O2Q A;  1A5I A;  1G3B A;  2NWN A;  5HIZ A;  3OSY A;  5EXL A;  1YWU A;  2OQ5 A;  3VPK A;  2HWL B;  4GHQ A;  1C9T A;  1AND A;  4YOI A;  2Y5H A;  3SBK A;  1T7C A;  3A86 A;  2J4I A;  2BDG A;  1ABI H;  2J97 A;  2EEK A;  1WTH D;  1XKA C;  5EW2 H;  1BMA A;  4NSY A;  5K0H A;  2BD3 A;  3ATM A;  3BTF E;  2NU2 E;  2KFW A;  1FY3 A;  2EI7 A;  3M5L A;  4AOQ A;  4KGA A;  2TGA A;  2Z3C A;  3DT0 H;  3QGJ A;  2SFA A;  1EP5 A;  1C1O A;  5DP8 A;  1YLD A;  4E7R G;  8KME 2;  2BDB A;  2WPH S;  2P8O B;  2HAL A;  1YKT A;  1VCQ A;  4YXW D;  1WQS A;  3FP8 E;  1NM6 A;  2ZGH A;  5C94 A;  1GI8 B;  2TPI Z;  3K6Y A;  3SI3 H;  1PQ5 A;  3K2U A;  4E05 H;  4AN7 A;  3A89 A;  3KQC A;  1O3P B;  3KQE A;  1DXW A;  2Y7Z A;  1QHR B;  1DLE A;  3MI4 A;  1KXF A;  5T6G A;  1WXR A;  3SGQ E;  4NIX A;  3RXF A;  3L33 A;  3EA8 A;  1C5O H;  4KTU A;  1P03 A;  1T8N A;  3M35 A;  1QUR H;  4JZD H;  4Q2K A;  1AWF H;  1GI6 A;  2L6O A;  2DE8 A;  1IQL A;  1F0R A;  1GBB A;  5EG4 A;  3ZVA A;  5DP9 A;  3LKW A;  2BQ6 B;  1O2K A;  2SNV A;  1DSU A;  3ZVF A;  1OPH B;  4GAW A;  1L0Z A;  3SV6 A;  5FBE A;  2EA3 A;  2FO9 A;  2FOH A;  1HYL A;  2BVS H;  2EQN A;  1FJS A;  1S82 A;  1UCY H;  4U2W A;  4O3T A;  3H7T A;  1YC0 A;  3I77 A;  5ABW A;  1UO6 A;  2BY7 X;  4BXS A;  6CHA C;  2GV6 A;  1O2P A;  1SQT A;  4MG3 A;  1RRK A;  4GSO A;  5DJ7 A;  4ACB A;  1TBR H;  1TGC A;  1AFQ B;  2P59 A;  1GDU A;  2PV9 B;  3LON A;  1HIA A;  4YOG A;  2WV9 A;  4DGJ A;  4YOJ A;  1ZTK A;  4GCH G;  1ANB A;  2O8L A;  1GBT A;  1CQQ A;  1A46 H;  3U28 C;  2PGQ B;  3TPI Z;  1D9I A;  1O37 A;  4DG4 A;  1TAW A;  4TSF D;  3MH7 A;  1F2S E;  2J95 A;  2B8O H;  1TAL A;  3V3M A;  3TVJ B;  4A1T A;  2Z6B D;  3SHC H;  1C1U H;  1P3E A;  6GCH G;  1C4V 2;  1WBG B;  2UUK B;  3EAJ A;  2ODY B;  2XTT B;  4I8G A;  1MKX H;  2F9V A;  3MH4 A;  1TON A;  2C4F H;  1P04 A;  5H4I B;  3RXR A;  5FHT A;  1TBZ H;  3OTP A;  2ALV A;  3NZI A;  5ETX A;  1KLJ H;  1YP9 A;  2HNT F;  5T6D A;  1GHB G;  2YMS B;  1ETT H;  4Y6D A;  2XCF A;  1JRT A;  1BBR H;  4NIY A;  1NRQ H;  1NTP A;  1SQO A;  3TK5 A;  2QXI A;  1RFN A;  1XXD A;  1P2N A;  3G01 A;  4YM9 A;  1XVO A;  4PRO A;  4X1P U;  3TNT A;  1K1O A;  1DWD H;  3HGP A;  5L2Z H;  3A83 A;  5FCK A;  4K8B A;  1ZR0 A;  4IGD A;  2SNW A;  8GCH G;  1A7S A;  4P00 A;  3NXP A;  3SZN A;  1TFX A;  3SQE E;  1O38 A;  1VIT H;  1AB9 C;  1NC6 A;  3GY6 A;  3FZD A;  3HKJ B;  3MTY A;  3M36 A;  3AAU A;  1WOF A;  4B74 A;  3D49 H;  5KGO A;  3RUO A;  1EP6 A;  3UNQ A;  2A2Q H;  2GMT C;  5SGA E;  3V13 A;  2FS8 A;  5DG6 A;  1W7X H;  2WV4 A;  3MU8 A;  1UCY K;  1PQA A;  1ZJD A;  1TMU H;  1INC A;  3RLY H;  1GBJ A;  4FXG H;  3WW7 A;  2GCT C;  1RJX B;  2OIN A;  4A92 A;  1D6R A;  3Q3X A;  2BXT H;  1JIM A;  1ZJK A;  3RXM A;  3KCG H;  1YCP H;  3LGI A;  1H9H E;  2BQW B;  3SU0 A;  3LJO A;  2ZA5 A;  2P3U B;  1HAG E;  1HJA C;  1Q3X A;  2UWL A;  3NWU A;  4UDW H;  5EIY A;  2I6S A;  1LQE A;  1GJ9 B;  3FAN A;  3P92 A;  5E0J A;  4BAN B;  2XBV A;  2OXS A;  1WSS H;  2ZFF H;  2STA E;  4ZXY H;  5DP7 A;  1QTF A;  2QGR A;  5GXP A;  2Q6D A;  4WF8 A;  1CA0 C;  3PWC A;  4CH8 B;  4E7N A;  1G30 B;  4JZF H;  2JET C;  2FM2 A;  3RXD A;  4A1V A;  2AGE X;  1MKX K;  2VVU A;  1ZPB A;  3VEQ B;  1ORF A;  3RXA A;  1B0F A;  1HRT H;  2QCY A;  2XWB I;  2ZCH P;  3OY5 U;  1N8O B;  2ZDM A;  3H09 A;  1S6L A;  3U1I B;  4XBD A;  4MPW A;  1EAT A;  2FPZ A;  5PTP A;  1SPJ A;  1D3P B;  1GVZ A;  4B2C A;  2R9P A;  2ZPS A;  1MTS A;  1BBR K;  1FZZ A;  1LVM A;  1BMF D;  1QJ1 B;  4K8Y A;  3UAI C;  1V2K T;  2FWW A;  5EGM A;  1O2S A;  1AY6 H;  4X1R U;  2UUY A;  3URD A;  3GYM A;  2AH4 X;  1BA8 B;  4FVD A;  1AZZ A;  2FI5 E;  2KR7 A;  1RTK A;  2J2U A;  1OHH D;  2RCE A;  1DPO A;  4D7F A;  3KGP A;  5GND A;  4ZHA A;  1YF4 A;  1SR5 C;  5J4S A;  5HYO A;  4AG2 A;  4A6L A;  2H5D A;  3STI A;  2VNT A;  2A45 B;  2OC8 A;  1PPZ A;  2ULL A;  2CMY A;  1C2F A;  3SJ9 A;  1SG8 B;  3A7X A;  1ZGI A;  1GBH A;  3F2H A;  2ZEC A;  2KM0 A;  2WHX A;  4AGK A;  3LIW A;  7EST E;  1P02 A;  3RM0 H;  2BD5 A;  2ZGB H;  2QV1 A;  1HAI H;  2Y5G A;  4Y7A A;  1ZTJ A;  3RXQ A;  2ZHD A;  1W7G H;  5KED A;  4A7I B;  6EST A;  4TY7 A;  2AHM E;  4NWK A;  1VR1 H;  1JBU H;  2EI8 A;  2M2A A;  4JZ1 A;  3OEE D;  2A31 A;  1AMH A;  1VGC C;  1YCP K;  1O3N A;  2PP6 A;  1QRZ A;  2FOD A;  2C8W B;  2QY0 B;  1HAV A;  1ZZZ A;  1C1S A;  1MTU A;  1S6F A;  1H9L B;  5C5N A;  3M7U A;  4BXW A;  2KX4 A;  2P94 A;  3ENS B;  2FDA A;  3A82 A;  1JMO H;  2FOG A;  1GI9 B;  3PTB A;  4DT7 B;  4ZKS U;  1QR3 E;  2TGP Z;  3ZIA D;  1CBW B;  1LHD H;  1O36 A;  1N6Y A;  1U6Q A;  2CF8 H;  4Z0K A;  3PLP A;  3BTG E;  1EPT A;  5I46 H;  2JDI D;  2F83 A;  4BAO B;  1D4P B;  1TBQ H;  1P05 A;  4OS5 A;  4DII H;  4I7Y H;  5EQR A;  1BIO A;  3MU1 A;  2ZF0 H;  1V2V T;  4IMQ A;  1RD3 B;  2NU0 E;  1ELB A;  3VGC C;  3A81 A;  5DO4 H;  4NA9 H;  3TJO A;  2P95 A;  1K22 H;  2ZTX A;  3OU0 A;  1AN1 E;  1M9U A;  3RC4 A;  4MNV A;  3A7T A;  1O3B A;  2FOM B;  3SGB E;  1DM4 B;  1CT0 E;  2FES H;  2BOK A;  4OGX A;  4Q4L A;  2PW8 H;  3T62 A;  1OP0 A;  7KME H;  5A0B A;  2BDH A;  3ZZ8 A;  1O2M A;  2BX3 A;  2XC0 A;  5AFY H;  5T3H A;  1Z8G A;  1W11 U;  1TLD A;  4AYV B;  1V2N T;  2G52 A;  1S84 A;  2JKH A;  3RXB A;  2SGQ E;  2VWL A;  4BAQ B;  3GYL B;  1HGT H;  5GCH F;  1RS0 A;  1GI7 B;  1QJ7 B;  1E1R D;  1PPB H;  3SV7 A;  4OGY A;  1BTU A;  4CBN A;  3NRL A;  1K1P A;  1CE5 A;  3M7Q A;  4U30 A;  3U9A H;  2ZHW H;  4FU7 A;  1FQ3 A;  1GJC B;  3EE7 A;  3SJI A;  3U8T H;  4K3J A;  3BG8 A;  3E3T A;  4OS2 A;  2BLO A;  3RU4 T;  2XBX A;  2CF9 H;  2J5U A;  4FUF A;  1P2J A;  2ZTY A;  2Y7X A;  4DOQ A;  1TX8 A;  1W0K D;  3GOV B;  2OTV A;  2IPH A;  2OP9 A;  3CEN A;  3RXG A;  1GI0 A;  1NRS H;  1QGF A;  1WDI A;  3BEU A;  3PYH A;  3RLW H;  1TIO A;  4F49 A;  4J1Y A;  4FUB A;  1NO9 H;  4I8H A;  1BJU A;  4Y10 E;  3E0P B;  5E8E H;  1XKB C;  1O3D A;  2ANK H;  1F5L A;  1DLK B;  2D1J A;  3T25 A;  2YOL A;  2G55 A;  4KEL A;  1HB0 B;  2R0K A;  4AX9 H;  1PPH E;  1Y8T A;  2BQ7 B;  4UE7 H;  3MH6 A;  5CHB A;  1EFR D;  3ZZ6 A;  3M61 U;  3F9G A;  2A2X H;  1ACB E;  1C1Q A;  3M5O A;  2V3H H;  3PO1 C;  3GY2 A;  3GCH C;  6CHA B;  3QLP H;  5FPY A;  3ATK A;  4ABB A;  1O3L A;  4FUE A;  2QIQ A;  2R2M B;  2WPJ S;  1AI8 H;  2FLB H;  3I78 A;  1YCP M;  3SOS A;  1P09 A;  3M3V A;  1WCZ A;  3SJO A;  2Y81 A;  5JBA S;  1DUA A;  3MHW U;  1Z1I A;  2VVV A;  2UUJ B;  4B75 A;  3A8B A;  4WMF A;  2RFK C;  2RG3 A;  2O8T A;  3A88 A;  4DUR A;  2IJD 1;  1A1R A;  2SGD E;  1V2J T;  5LPR A;  2AS9 A;  2PKS C;  2ZO3 H;  2PR3 A;  2FOE A;  2VID A;  4ZXX H;  1GI1 A;  4GCH F;  1IQH A;  3E1X B;  2XYA A;  3ZVB A;  3A7Z A;  1ESA A;  1MBM A;  1T4U H;  2FOF A;  2BHG A;  2P93 A;  3EYD A;  4LK4 A;  4DT4 A;  2GVF A;  4Y0Z E;  1AUT C;  3EST A;  2VIN A;  4MPU A;  1NFY A;  4X8S H;  1DY8 A;  5TJX A;  2WZQ A;  4NG9 H;  1AUJ A;  1J8A A;  3PLK A;  3N7D A;  1BZX E;  4UFF H;  3UOU A;  6GCH F;  2KZ4 A;  4HZH A;  1SOZ A;  4GUX A;  1VKY A;  5K7R A;  2R0L A;  2VJ1 A;  3M5N A;  4XDE A;  3SUF A;  5FPS A;  2HRV A;  1RTL A;  4D9R A;  2FYR A;  4MTB A;  1SLV B;  1O3M A;  2F9O A;  2VIP A;  1EKB B;  5A09 A;  4ISI H;  1TPO A;  1TPP A;  2ODQ A;  2BD4 A;  3LGU A;  1ZSK A;  1IQF A;  1YPK H;  1O3K A;  1G36 A;  1LKA A;  3BTD E;  1G3E A;  4R0I A;  2PSY A;  3LGV A;  1GPZ A;  2ZU1 A;  3AW0 A;  1LPG B;  1K1I A;  1BUI A;  5C0T A;  2BD2 A;  3DSP A;  3GCN A;  3K9X B;  4XD7 D;  1AB9 B;  1E35 B;  8GCH F;  3NUM A;  3RXK A;  3F1S B;  1L4Z A;  2GCH F;  1LVB A;  1G32 B;  2XW9 A;  3BV9 B;  4RKJ B;  5IDK A;  1EXF A;  2ZPQ A;  1GDN A;  1GMD F;  3SV2 H;  4DY7 B;  2FX4 A;  2B0F A;  1O39 A;  1NY2 2;  1SL3 A;  1UJ1 A;  3QTO H;  1E37 B;  3M3S A;  2GMT B;  5HXF A;  1O0D H;  2TRM A;  3KQ5 A;  2FI3 E;  2PHB A;  1SGY E;  2D2D A;  4LOY H;  1QQ4 A;  1SGD E;  1YGC H;  1G3C A;  2KCO A;  3U69 H;  2PKA A;  3BTM E;  4ABG A;  1O2X A;  4CRE A;  1C5Q A;  1C1W H;  1QA7 A;  2GCT B;  1A4W H;  3RMN H;  3BTW E;  1T8L A;  1UVT H;  1W2K H;  1XUI A;  2PUX B;  2ANW A;  1TQ0 B;  1MCT A;  3LH3 A;  4Q7Y A;  3TJN A;  1C1M A;  3A7Y A;  5JPM H;  1K2I 1;  2Z9G A;  1TGB A;  2A4G A;  1J14 A;  5GCH G;  1MU6 B;  1E36 B;  1AQ7 A;  1HJA B;  1V2L T;  2AGI X;  2ZWL H;  3SU4 A;  1GL1 A;  3WY8 A;  2XOK D;  4AGJ A;  3L6P A;  4O9V A;  2XWA A;  1NT1 A;  5E0G A;  5GPI B;  1HXF H;  4RT1 A;  2BB4 A;  3EDX B;  3TH4 H;  1O3C A;  4IC6 A;  1HDT H;  2ZQ1 A;  3FAO A;  3RXU A;  5F8X A;  4CRB A;  4OS4 A;  1CA0 B;  2TBS A;  1FXY A;  1DIT H;  3UR9 A;  3LH1 A;  1UVU H;  2CK3 D;  1G2M A;  3CS0 A;  3QGN B;  2PWX A;  4TT3 D;  3SV8 A;  1J15 A;  2JET B;  5CHA C;  3M37 A;  2ZGX H;  1H8I H;  1GJ8 B;  1GG6 C;  2XRC A;  1L1N A;  1UCY E;  5EXM A;  2PGB B;  4UD9 H;  3Q76 A;  2GKV E;  1HPG A;  2EC9 H;  1V2M T;  3KYG A;  2BDC A;  4XOJ A;  1W8B H;  1ZPC A;  3F2G A;  1A3E H;  4D9Q A;  1NS3 A;  4CHA C;  2BTC E;  5C17 A;  1TNJ A;  1GL0 E;  4MDS A;  5F6M A;  4INK A;  3KYF A;  1H8D H;  1IAU A;  1BTH H;  1L1J A;  1KLT A;  2WPD D;  4RI0 A;  1AE5 A;  2SGE E;  4FUC A;  4ABH A;  5E0H A;  3BTH E;  3BN9 A;  2IJO B;  3SND A;  3MO9 A;  4ABI A;  4DW2 U;  1KDQ A;  1E34 B;  1E1Q D;  1HJ9 A;  1QNJ A;  1GJ7 B;  4CR9 A;  2ZPR A;  1O2O A;  1X7A C;  1G2L A;  3PMH B;  3CP7 A;  4U32 A;  3FZZ A;  4YLU A;  1O5D H;  3MNS A;  2C90 B;  3NKK A;  4BAK B;  1GCT C;  5C2Z A;  1TAB E;  5EJZ A;  4ACA A;  1ZHR A;  1KY9 A;  1SGI B;  3RXC A;  3O8C A;  1KXC A;  1XUJ A;  2Q6F A;  1EZQ A;  2V3M A;  4NWL A;  1ARB A;  1TX6 A;  2QXG A;  2F4L A;  2WYG A;  1TNI A;  2QN5 T;  3W95 A;  4ABA A;  1FY4 A;  3TU7 H;  1TWX B;  1A0L A;  5BRR E;  3ZZ3 A;  1FY8 E;  1QL9 A;  3OYP A;  3KID U;  1VGC B;  1Z7K A;  3RXS A;  3TH3 H;  2VGC C;  2GZ9 A;  2J92 A;  1NFW A;  4MPV A;  3ZV8 A;  1KLI H;  3LDX H;  2QF0 A;  1ELF A;  3SU1 A;  2CGA A;  2OK5 A;  4X8T H;  4D8N A;  1ARC A;  4ISL A;  4X8U H;  5JB9 S;  1EUF A;  5EW1 H;  3Q00 A;  2YNB A;  5HIY A;  1FUJ A;  2O8W A;  3PM3 A;  3OTJ E;  4R8T B;  3HKI B;  5DGJ A;  1FON A;  3GDU A;  3IG6 B;  1BQY A;  3QO6 A;  1N1L A;  1O2H A;  1SBW A;  1O2J A;  1YPL H;  4KKD A;  4SGA E;  1J9C H;  1FIW A;  4H6T A;  2V3O H;  1UK3 A;  3PRO A;  3RXV A;  4JYT A;  2Y6T A;  2FI4 E;  1ABJ H;  1GI5 A;  3RU4 D;  1V2Q T;  1QBV H;  1YPM H;  3HK6 B;  4Y8X A;  1S83 A;  3VGC B;  1LPZ B;  3HAT H;  1J16 A;  2B9L A;  1W10 U;  2GCH G;  3ZVE A;  7LPR A;  2A5K A;  4KTC A;  1GMD G;  5AHG H;  1CT4 E;  2GD4 B;  1V3X A;  1YY3 A;  2WYJ A;  2M5T A;  2YMS D;  3ODF A;  1SFI A;  3URE A;  1FMG A;  4FU8 A;  1LCY A;  4RKO B;  2BY5 X;  1SLW B;  1LKB A;  2BOH B;  2H2Z A;  3V0X A;  2G51 A;  4Q80 A;  4Y7B A;  1BTP A;  2H6M A;  2OD3 B;  2ZDL A;  3QN7 A;  5LPE A;  5EJ1 A;  1DVA H;  1DFP A;  1N6X A;  3E91 A;  1C2I A;  1XUF A;  3EE0 B;  4X1N U;  1Y3W A;  3VXE H;  3W1E A;  1Z8I B;  3TJU A;  2A5I A;  3OFN D;  3RXH A;  4GHT A;  3O8B A;  2ZU2 A;  4ABD A;  8LPR A;  1BTY A;  1C5Y B;  4GVU A;  2QAA A;  3QX5 H;  1DY9 A;  1XM1 A;  1Z6E A;  1GI3 A;  2BXU H;  3ATW A;  4KTS A;  1PPE E;  1NN6 A;  3A84 A;  4OS1 A;  3M3T A;  2TGT A;  3NPS A;  3DFL A;  1GBD A;  2BM2 A;  5C5O A;  4K69 A;  3F6U H;  4INL A;  1J17 T;  2XBY A;  4FUI A;  4AB8 A;  1V2P T;  2ZU3 A;  4I33 A;  5EXN A;  1HFD A;  4A5T S;  2ZFP H;  1C2J A;  4M9F A;  1GCD A;  3C1K A;  1E79 D;  1BB0 B;  4X2W A;  1TRM A;  4CRF A;  1O3A A;  1P57 B;  3VFE A;  2GZ8 A;  3ZZD A;  2AER H;  1NES E;  2QYI A;  3KN2 A;  3LGY A;  3SV9 A;  1FY1 A;  2YNA A;  1GBL A;  1BHX F;  1MCV A;  1P2M A;  1W3C A;  2ZDA H;  2ZU4 A;  2B5T B;  1A3B H;  1MTV A;  5G4B A;  1GBA A;  1GJD B;  2XNI A;  2OBO A;  3MO3 A;  5T1V A;  1EZX C;  4YLQ H;  1YYY 1;  2Q6G A;  1NRO H;  1MBQ A;  4GPG A;  1XMN B;  3T27 A;  1HV7 A;  3PO1 B;  2BMG B;  3UQV A;  1EJA A;  2ZHF H;  5FX6 A;  3OEH D;  4UON A;  3GCH B;  4LZ1 H;  1VCP A;  1FLE E;  2A7H A;  2QA9 E;  3TNS A;  2JJ1 D;  1QY6 A;  1G9I E;  1NFU A;  3LGW A;  1TNH A;  3AAV A;  2W7S A;  3TIT A;  2JIZ D;  1O35 A;  1S6H A;  4JYV H;  1A5H A;  4IMZ A;  3SU2 A;  1QJ6 B;  3P95 A;  1OWE A;  2WPM S;  3ZYE A;  1E0F D;  4YZU A;  4MQA A;  4WH8 A;  2PKS B;  5L6N H;  1XVM A;  3UPE A;  4F4O C;  7GCH G;  4I32 A;  1WU1 A;  5HKK D;  1C4Y 2;  3EA7 A;  4DCD A;  4EST E;  3UWI A;  1C5N H;  1EJM A;  4BTI B;  3GCT G;  4K1S A;  5DN6 D;  2H5C A;  1TGT A;  2ALP A;  5EU8 A;  2AYW A;  4NA8 A;  1AKS B;  2JH6 D;  1TMB H;  1ZGV A;  4FUH A;  4IN2 A;  1BMM H;  1BTW A;  1GMH G;  3BIV H;  4GLY A;  4AC9 A;  2ZHE H;  1ZLR A;  3SNC A;  2Z9J A;  3SUD A;  1QL7 A;  1JRS A;  4KP0 A;  2ZQ2 A;  1W0Y H;  4FVB A;  3AK5 A;  2GJG A;  2O8U A;  1ELC A;  2A32 A;  2CHA C;  4Y71 A;  2BYA X;  3NCL A;  2Q1J A;  2GT8 A;  1K28 D;  1PFX C;  1C5S A;  1SQR A;  1WUN H;  3DSG A;  1TNG A;  2FEQ H;  1JWT A;  2OC1 A;  1FDP A;  3TJV A;  5L2Y H;  3RC6 A;  1P8V C;  2AEI H;  2FMJ A;  2Z3E A;  1AHT H;  1HAX B;  4BOH A;  1JOU B;  3A8D A; 
#chains in the Genus database with same CATH homology
 1NBM E;  2XOK D;  3L6P A;  3SV9 A;  3SU5 A;  3RC5 A;  3WWB A;  2L6O A;  5GPI B;  2KR7 A;  4R8T B;  3SUG A;  1OHH D;  3GS9 A;  3N7E A;  5GND A;  4DT4 A;  3EYD A;  1N1L A;  4A1X A;  2WSS D;  3SU3 A;  2GVF A;  3SYJ A;  3WWF A;  3LKW A;  1W3C A;  1NBM D;  2K0Q A;  1FX0 B;  3DCL A;  1DY8 A;  2CK3 D;  2JJ2 D;  3SV8 A;  3F3B A;  4TT3 D;  2OC8 A;  2WZQ A;  2A4Q A;  2XNI A;  4B74 A;  3SV6 A;  2OBO A;  4WH6 A;  2HLD D;  5T1V A;  2O8M A;  3N7D A;  4Q63 A;  1COW D;  2OC7 A;  5B6L A;  3F2H A;  1E1R D;  1BT7 A;  2KM0 A;  2KZ4 A;  3FOA A;  2WHX A;  2QF4 A;  3SV7 A;  4ZCN A;  3OEH D;  2KCP A;  3M5M A;  3NRL A;  4Q4L A;  4F55 A;  2OBQ A;  2QV1 A;  3KEE A;  3PRB A;  3M5N A;  5F53 A;  3SUF A;  3O8D A;  3FKS D;  2JJ1 D;  5FPS A;  1RTL A;  3WW7 A;  5DSF A;  5EQS A;  3F2G A;  4ASU D;  2OIN A;  1NS3 A;  3UB0 A;  4A92 A;  4KTC A;  3PV5 A;  2J5U A;  2YMS C;  2JIZ D;  4B76 A;  1W0J D;  5C17 A;  2AHM E;  4NWK A;  1W0K D;  2YMS D;  3LOX A;  2M2A A;  2XND D;  2P59 A;  3OEE D;  4B73 A;  3FO8 D;  3LON A;  4TYD A;  3SU0 A;  5FL7 D;  3SU2 A;  4I31 A;  2WV9 A;  5C0U A;  2FP7 B;  2WPD D;  3OAA D;  4RI0 A;  4WH8 A;  4B6E A;  3F0P A;  4FET A;  2K8I A;  4I32 A;  2QE7 D;  4Z1M D;  5HKK D;  2IJO B;  5GJ4 B;  2GGV B;  5ESB A;  5C0T A;  4TSF D;  3DSP A;  4XD7 D;  2W6J D;  5EPY A;  4B71 A;  1JXP A;  1CU1 A;  4U01 A;  1E1Q D;  2W6I D;  2VBC A;  2F43 B;  3W1E A;  5EPN A;  3PV2 A;  3ZIA D;  3O8R A;  5DN6 D;  3OFN D;  2A4R A;  3SZE A;  4B6F A;  1H8E D;  2V7Q D;  3O8B A;  2YOL A;  5IDK A;  4A1T A;  2F9U A;  2QF5 A;  4WF8 A;  3PRD A;  3F2F A;  1DY9 A;  3VG8 A;  3N99 A;  5CHB A;  1EFR D;  3KF2 A;  2JDI D;  1MAB B;  2FM2 A;  2KFW A;  3O8C A;  2F9V A;  3M5L A;  3P8N A;  3SUD A;  4A1V A;  5FPT A;  4NWL A;  1H8H D;  3KNX A;  3F0O A;  5EQR A;  3M5O A;  2KCO A;  2F4L A;  3DSO A;  5H4I B;  3AK5 A;  3E90 B;  5CDF E;  5FPY A;  3SUE A;  3H09 A;  3OTP A;  5ETX A;  3U1J B;  1S6L A;  4OM9 A;  3U1I B;  2YMS B;  4YXW D;  2KCY A;  4I33 A;  1RGQ A;  2OC0 A;  2XCF A;  2K1Q A;  4JMY A;  3SU6 A;  3OYP A;  5EQQ A;  2OC1 A;  1DXP A;  4M9F A;  3RC4 A;  2KCA A;  2A4G A;  1DXW A;  1BMF D;  1E79 D;  3FN8 A;  3RC6 A;  3OE7 D;  4B75 A;  1SKY E;  2FOM B;  2XCN A;  1KMH B;  1WXR A;  2LEL A;  2IJD 1;  1A1R A;  5IK2 D;  3SU1 A;  3SU4 A;  2OK5 A;  3P8O A;  4K8B A;  3KN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...