3N7EA

Crystal structure of copk bound to cu(ii)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
NVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper resistance protein K
publication title Two new crystal forms of copper resistance protein CopK
rcsb
source organism Cupriavidus metallidurans
molecule tags Metal binding protein
total genus 11
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3n7eA00
3N7EA 2LELA 3N7DA 3DSOA 3DSPA 2KM0A 2K0QA
chains in the Genus database with same CATH superfamily
5DGJA 4WXVA 1QRXA 4R8TB 2Z9GA 4BNRA 1BUIA 1FDPA 3VEQB 3E90B 1C1PA 5ETXA 1A0HB 3RC6A 1A7SA 3E91A 4U32A 4TWWA 2P95A 1O2YA 1AFEH 2OP9A 4B6EA 4GCHF 1ETTH 1HAIH 1GWAA 2A7CA 3M36A 1UK4A 2BLOA 1GHWH 3D23A 1TMTH 1J14A 1QBVH 1HAZB 2GCHG 1E36B 1NFWA 3BTKE 3EYDA 4FUJA 2VVCA 3NPSA 4MPWA 3ZZBA 2BVSH 2XCFA 1OSSA 1ESTA 1BMLA 1YY3A 2GKVE 3Q3XA 5E0GA 2P93A 2PW8H 2UUKB 2AS9A 3QK1A 4GUXA 1V2LT 1FNIA 1YCPH 1O35A 3LPRA 1NBMD 2JETB 4ZHAA 1S6LA 3UWIA 3PLKA 1AFQB 3E6PH 2C93B 3DSPA 2TGAA 1V2ST 1Z1IA 1O2RA 3T5FH 1H8IH 1GBMA 1KTTB 3ZIAD 4TY6A 2BD5A 1TRYA 2DE8A 1T8OA 3LH3A 4X0WU 1N8OB 2XW9A 4ZXXH 2ZDKA 5CHAB 3AASA 4CHAC 1EUFA 1B0EA 5DP5A 4Y11E 1A5GH 1QIXB 2W7SA 4AZ2B 3BV9B 1WQSA 1KDQB 1GCTB 2B0FA 2BY7X 1A5HA 5F8TA 2ZCKP 3A81A 4YTAA 3FP8E 4BOHA 1ZTJA 8GCHF 1LTOA 4DCDA 4TSFD 3RC4A 1SQRA 4ACAA 1QZ8A 1SLXB 2FXRA 1TGSZ 1ZYOA 1HUTH 2WV5A 2P3TB 4XE4A 3E8LA 2GGVB 2JJ1D 1ZPCA 5C0UA 2B8OH 2G55A 2ZGCA 1VKYA 3DCLA 4XOJA 4Y8ZA 1GG6C 2R9PA 1AZZA 1BTYA 1UK2A 5GNDA 1Q2WA 2GDDA 1O2PA 4NIXA 4JYUH 1CGIE 3BEIB 2F9PA 3MH7A 5T3HA 1GI5A 4UONA 1GHBG 2GCTC 3OAAD 1SHHB 4E06H 3O8CA 3EE7A 2ZDNA 1SLVB 1XXDA 1O2ZA 1AI8H 2XNDD 1BJUA 4I7YH 2XC5A 3P6ZB 1ORFA 4JZFH 4AOQA 2Z3DA 1W3CA 1V2WT 1DT2A 3N7OA 2FODA 4CRFA 2BY9X 1K28D 3QN7A 4YESB 1K1LA 1DANH 2A31A 3PYHA 2PKAB 3RXVA 1ARCA 2KFWA 1HPGA 1BBRK 1ZR0A 1PYTC 1GBIA 4X6NA 3Q00A 4Y0ZE 3P70B 1P09A 1MZAA 5DJ7A 1ABJH 4GHQA 3UQOA 4BTIB 7KMEH 1AD8H 1AKSB 4GAWA 1DOJA 3QX5H 3A8BA 5A0CA 4CRGA 4X1SU 5F8XA 2GJGA 5EPNA 1OWDA 4B76A 3RU4E 3PV4A 1QJ6B 3OY5U 1QQ4A 1TBQH 2A7HA 4IMQA 3OU0A 3SU1A 2ZU2A 3EDXB 1O3MA 1O2MA 1K1NA 6ESTA 5IDKA 1MD8A 1SGRE 2OUAA 6CHAC 1D6RA 3BSQA 3AK5A 3UOPA 1OKXA 4ZHLU 5DKMA 3PTBA 3LGYA 4ZROA 1BTWA 1SGTA 2ZZUH 1ZTLA 2V3HH 2P3FH 1QRZA 3PWCA 3WW7A 5C1XA 3CNRA 4YXWD 1HAGE 2Y5HA 1XUKA 3GICB 1ELEE 1UW7A 2FESH 3QUMP 1H8HD 4A1TA 3M35A 1O2WA 1C5VA 2NWNA 2ZCHP 4NFFA 2VIWA 3SU2A 1GBEA 2XXLA 1EPTC 2TBSA 3ESTA 1TWXB 3PM3A 1EZSC 1ETRH 3RC5A 1TGCA 4TT3D 4UFDH 1KDQA 1OPHB 3LKWA 3RU4T 3ITIA 4OS4A 2P8OB 1SBWA 3PV2A 5EJLA 4H6SB 1GCDA 4ZCNA 1D3PB 4WF8A 2UUYA 4ABEA 2IN2A 1TBZH 2FOMB 4B6FA 1O37A 2VB0A 2ZNKH 1O31A 1VJ9U 1P2MA 1UVUH 2XWAA 5K7RA 3B23B 1TPAE 4D9QA 1EATA 1S5SA 3RXIA 3A80A 2HGTH 1ZMNA 3SI4H 2QXIA 2QF0A 3M5NA 4BAOB 2RDLA 1P04A 2FTLE 4CR5A 1PPHE 3M5MA 2C8WB 3QDZB 2IPHA 3GCHC 3DSGA 4NGAH 1MKWH 1C2JA 1C9TA 1C5NH 5FHTA 3T62A 3RM2H 3SU6A 5CMXH 2FOHA 5AVDA 4TPIZ 3ZVCA 1Y5BT 5EQRA 1SB1H 2FI5E 1D4PB 2F9UA 1GI0A 1NT1A 1GVLA 1C1SA 1H9HE 2F91A 2BOHB 3U98H 2SNVA 1KYNA 1ZZZA 1ELTA 5FPSA 1C2GA 1HAVB 3MNCA 5I46H 1ELDE 1KTSB 1LHEH 3KF2A 4DG4A 2KZ4A 3R3GB 4Y76A 1AB9B 2QGRA 2XOKD 2WPIS 2ZDAH 1SQTA 1SFIA 2EA3A 5E0HA 4GPGA 3N7DA 2ZFFH 2W6ID 3SORA 1LMWB 1GDNA 2VWNA 1IQEA 1C1NA 1W14U 5KEDA 1GBCA 1W13U 3BTQE 4WXIA 1YPGH 1TA2A 1T4UH 4P00A 1FIZA 4OS7A 4NZLA 2ZDMA 1LO6A 5LH8A 4AX9H 2KAIB 1EP5A 2Q6GA 1C5ZB 1Y8TA 1FY3A 1C2FA 1FN8A 5EOKA 1TFXA 2Y5FA 4UFGH 2IOTA 2OBOA 1GMHG 1G3BA 5FBIA 1EAIA 2BD4A 5ABWA 3IWMA 1MTSA 2ZC9H 1BHXF 3ATMA 1W0JD 3VXEH 2AMDA 1FY1A 1AQ7A 1QRWA 1D3DB 4LK4A 3RXHA 1BDAA 2PTCE 2GTBA 5EW1H 1TGBA 2GZ7A 5IK2D 4GSOA 3W1EA 5E8EH 1BBRE 4F48B 5L2ZH 1F5LA 3TGJE 1GI3A 2NU4E 5C1UA 3SV8A 1YBWA 1FPCH 1W7XH 2CXVA 4FU7A 5PTPA 4WVPE 4JK6A 4CR9A 8LPRA 1UTKA 2GX4A 1GHVH 1SGIB 1BIOA 2KR7A 3A85A 1NZQH 2KM0A 4YT6H 1RJXB 1CSOE 2NU3E 1HAOH 3K65B 4Y79A 5GWZA 5FAHA 4FVDA 5GPIB 4XDEA 1O2OA 3ATLA 2ZHWH 3A83A 1MTNC 5FXLA 4BAMB 4WWYA 1BCUH 4HZHA 5DP4A 2TGPZ 1LHFH 3BG4C 1W2KH 3QZRA 1RTFB 4GVUA 1HIAB 3A7VA 4LZ4B 3KNXA 3LONA 1C1UH 3P95A 3RXFA 1GJ4H 3UOUA 1EXFA 2WHXA 4B73A 2AHME 4D7FA 2KCYA 1TX8A 3MU1A 1WYKA 1GMHF 2ZCLP 4AFQA 2R2MB 4B1TA 2FPZA 3SGAE 4K2YA 1JRTA 1NFXA 2TRMA 3GS9A 2J4IA 1UHBB 4NSYA 1QBOA 3ODDA 1V2JT 3SUFA 1BMFD 1BTHH 1DY9A 1C5LH 2GZ8A 1P10A 2BDAA 1Y3UA 1XKAC 2O8WA 4I8KA 3RMLH 5EU8A 3KN2A 3UQVA 1FN6A 1O2LA 1NU9A 2RFKC 5FCRA 2XC0A 4DGJA 2ZWLH 5EXNA 1AVGH 4HGCA 1HAVA 1O3IA 4IC6A 5JB8S 3MOCA 3TH4H 4ZUHA 2FDAA 1GMCG 1YPEH 1QQUA 4KELA 3ZZ6A 4A6LA 2JH5D 2A4RA 2WPDD 1YGCH 1BMNH 4WMFA 5HM2A 1VJAU 3RXTA 3F0OA 1HDTH 1ZSLA 6CHAB 1BTUA 3I78A 3E1XB 4KTCA 3QGNB 4LOYH 2F3CE 1UJ1A 3DUXH 1C1WH 2Y7ZA 2F9OA 1HJ8A 2GMTC 1MBQA 1S0RA 1GGDC 2Y80A 4ISOA 2CHAC 4WJG2 1VCPA 4O03A 2GVFA 3K9XB 4Z1MD 3STJA 1C2MA 3MYWA 4JMYA 2KAIA 1YCPM 2Y5GA 2FYRA 1CHOF 1HCGA 1O3AA 3U8TH 3UNQA 2TPIZ 2SGPE 1GI6A 4Q4LA 1OP2A 2Y82A 4VGCC 1BT7A 3M3VA 2ANWA 2B7DH 2J98B 1KIGH 5EG4A 1DVAH 1TA6A 1YLDA 2YOLA 1UCYH 2FS9A 2G4UA 1W0ZU 3PO1C 3RLYH 2LELA 2R0KA 4MLFB 2F9VA 4J1YA 2WPJS 2O8UA 3KGPA 1DM4B 1ZJDA 1TLDA 1BTPA 3U28C 2CJIA 2H2ZA 2CV3A 2BOKA 5HYOA 4FUCA 2ZQ2A 1UTLM 1NC6A 1C4V2 3CP7A 1C2LA 2ODYB 3AAUA 3SQEE 5KECA 2JDID 2ZEBA 1C5PA 1UCYE 4X8VH 2FX4A 3MHWU 5HMAA 2EY4C 4MTBA 2AGIX 1WDIA 3V7TA 1P2OA 1C2EA 1V2UT 2Z9JA 1DWCH 2OLGA 3GCHB 3GY7A 2FOCA 1XVOA 1YPKH 3EE0B 4XBDA 1H4WA 1WAYB 2ZTXA 1ANEA 2XBVA 3LC5A 1P2KA 3DHKH 1QFKH 2CF8H 5LGOA 1Z6JH 1J17T 3RU4D 1TX6A 2BLQA 1HIAA 1P3EA 3BF6H 4AYYB 4Y8YA 1GJ6A 1KXEA 1MKXH 2BQWB 3KEEA 2HNTC 1NROH 4ABAA 2PV9B 4IBLH 1HJAB 1YLCA 4ABIA 3GCOA 3T2NA 4X1RU 1C4Y2 3LGTA 1UHBA 3MNSA 2FI4E 1XM1A 3SNBA 1C2KA 3ODFA 1O3DA 3G01A 4Q2KA 4B2BA 1RIWC 3FZZA 1MBMA 2VGCC 2D1JA 5A0BA 1O2GH 3C27B 3FAOA 5E0JA 1J8AA 3QTOH 1MTUA 4E7RG 4YOJA 4RT1A 3SU4A 3TLOA 1IQFA 5B6LA 1DXWA 2ZI2H 1TOCB 3D62A 1JBUH 2OTVA 3NZIA 1D3QB 5A8ZA 2IJD1 1C5MD 2A5IA 1HNEE 1SGFA 4F4OC 1LQDB 3PB1E 3BTME 4HFPB 1OHHD 1V2TT 2Y7XA 3TIUA 2DUCA 1CT4E 3WWBA 2HPQH 5HXFA 2DE9A 2ZHFH 1AIXH 1HAPH 1QL8A 2ZU4A 3RXOA 3BTTE 2ZIQH 3V12A 2L74A 3UR9A 2BQ6B 2WPMS 2SGAA 1TALA 4HTCH 2V3OH 4MNWA 1PPZA 2PSYA 2ZA5A 3LIWA 3OSYA 2LPRA 3CS7A 1GJAB 1C1OA 3DFLA 4FOUC 2UWOA 2A4QA 1ZRKA 3A8CA 2G81E 4KKDA 2J98A 4K1SA 9LPRA 1VCWA 3ZVAA 2BM2A 5DPAA 1SI5H 3RXBA 5EW2H 4YOIA 4MDSA 1LPGB 2V0BA 2XWBI 2P16A 1WSSH 3ZV8A 1EJAA 2ULLA 2FLRH 2Q6FA 3TK6A 2JKHA 2HOBA 3IITA 1GJ8B 2BDCA 1VGCC 3O8BA 3KL6A 1LVYA 2VIPA 2VJ1A 1ZTKA 1DICA 2F9NA 2VVUA 5J4QA 4PROA 7GCHG 1IQMA 1QNJA 1W12U 3FANA 3LJOA 1YC0A 3UR6A 4AG2A 4U2WA 1O2HA 1Y5UT 3TNSA 5JPMH 1O34A 3F68H 1S84A 4Z0KA 3FP7E 1O2XA 2HVXA 3R0FA 2J97A 1YLNA 2ZGJA 2R3UA 4HI3A 4BAHB 1P57B 2Z9IA 3RXRA 1BITA 3SBKA 2BLWA 2VINA 4I31A 1CVWH 1EOLA 1O2SA 4FUDA 4UE7H 1OWKA 1THRH 1BMAA 2D26C 1CA0C 1ELAA 4AB9A 5HIZA 5C5OA 3SZNA 4ZKSU 1KXAA 4DT4A 3NCLA 1RD3B 1FXYA 1LQEA 3W94A 3LGVA 1FY4A 1A46H 1P9SA 2CN0H 4X2YA 4UFFH 2C8ZB 3C1KA 4DT7B 2OC8A 1H8ED 3SV2H 2ZGBH 4ZKRU 2BX3A 5E2OA 2GD4B 3OEED 5CHBA 1MU6B 1BRAA 2VIVA 1AE5A 2BXTH 2F43B 3M7QA 4ABJA 2GCHF 1OXGA 4ZHMU 1GGDB 2ZF0H 1JXPA 3KQDA 1QB6A 3QGJA 5K0HA 7GCHF 3HKIB 3L33A 4IW4E 2VIQA 3ATIA 1U6QA 3GISB 3M61U 4OS2A 2PWXA 2H9TH 5JB9S 3BTHE 4AFZA 4RN6A 4Q7YA 4ABFA 1HGTH 2GV7A 1SFQB 2ALVA 4JZIA 4XBCA 2AIPA 2ANKH 3S0NA 2QXJA 1T4VH 2SGQE 3RXGA 5DO4H 1W10U 3PO1B 4QT8C 4OS5A 1S6FA 2G5NA 1G2LA 4BXSA 5F6MA 1J16A 1V2VT 1ZHPA 2BD3A 2QXGA 3K6ZA 1UTPA 4Q7ZA 5GIBA 4Q63A 1TIOA 2A2XH 3TITA 1JIRA 3RXUA 1EP6A 2ZTZA 1QURH 3SNDA 3KQEA 3SUDA 3TNTA 4E7NA 3VB5A 1NY22 3F9FA 3M5LA 1O3OA 4TWYA 1GHAG 1GMDG 1TMUH 5SGAE 3SYJA 4AFUA 1O2QA 2A4OA 1A1RA 2D2DA 4GHTA 1MU8B 2F9BH 2GT8A 2LP6A 1VITG 1YM0A 3PWBA 4AGJA 4P02A 1TGTA 1T8NA 2W5EA 3MU4A 3HKJB 5HKKD 1A5IA 3KYFA 2QV1A 4X2WA 1UVTH 2ZFTA 2QN5T 3UY9A 3EA9A 4K3JA 2FOAA 2HNTF 3F2HA 3ZYDA 3HATH 2R3YA 1SL3A 1CT0E 3SQHE 3GY2A 1FIWA 1NM6A 2FOFA 4OS1A 2ZHDA 4MNXA 2ILNA 1V2PT 4JCNA 3RP2A 3MH6A 2V7QD 5FPTA 4X6OA 2OC1A 3MNXA 1GHBF 3MWIU 1XUJA 3OEHD 4MPXA 1KXCA 4OGXA 1YPHC 3L3TA 3URCA 1QHRB 3P8OA 1ELCA 3BTEE 2ZGXH 1TAWA 2TGDA 4I8HA 4X8SH 4KP0A 3VGCC 6GCHG 1O3BA 1PYTD 2IJOB 3UB0A 3BTFE 1WU1A 3H09A 1RIWB 1IQGA 2BTCE 2WYGA 1FUJA 4ISIH 4RKOB 4WMDA 2EI7A 3PMJA 1UTNA 3OE7D 2O8LA 2PTNA 3VPKA 1FY5A 4CH8B 1IQIA 3MMGA 3SOSA 2BY6X 1K21H 1TRMA 2M2AA 2SNWA 1O30A 1FY8E 4SGBE 4A1XA 4K60A 3F2GA 4U01A 4X1QU 1O32A 4B75A 4B2AA 1AGJA 2W6JD 1GHZA 2FEQH 3UPEA 1SGEE 2HALA 2ZPSA 1L0ZA 1AY6H 2FOGA 1MD7A 3KYGA 1HRTH 3E3TA 1NRNH 2HNTE 1H9IE 3F9GA 1V2OT 5C5NA 1UMAH 4E05H 1L4ZA 1C1QA 1V2RT 1O5DH 2EI6A 3ZZAA 3HGPA 2GT7A 3MU8A 3PLPA 1TBRH 2O9QA 4OGYA 1GVZA 1TRNA 3U8RH 1O3NA 1C5TA 4FU9A 4FUGA 2ZGHA 3E0PB 5L30H 1O2NA 1RGQA 1C5WB 1OYQA 1DUEA 5BPEA 1GDQA 1THSH 1GBAA 3ZZ5A 1GBKA 1BTZA 1QB9A 1Z1JA 1MAYA 2BQ7B 4CRBA 1IQLA 1O2TA 1HAYB 2F83A 1XKBC 7ESTE 1ELBA 5DP8A 5TJXA 2YMSC 5E2PA 1A0JA 2ZU3A 4BAKB 2Y81A 3LGIA 1F2SE 4K8BA 4FUIA 2FMJA 2OQ5A 3LGWA 3ZVDA 1MCVA 3F9HA 1Q31A 1DLKB 5DG6A 1G3EA 3GY6A 1VGCB 2AGGX 2I6QA 2PKAA 2FI3E 1PPGE 2AGEX 1C2IA 4I32A 3Q76A 4D76A 1OX1A 2ZO3H 1ARBA 1XUIA 5CDFE 3A7XA 1S6HA 3OX7U 2BDYA 4DIHH 3UUZA 2A32A 3VB4A 5FPYA 3I29A 1EZQA 1XXFA 1COWD 5DP7A 1K1IA 1F0RA 4MPUA 2K0QA 1AKSA 4U30A 1GI2A 3ELAH 3ZZ7A 3TJOA 2GV6A 2PKSC 3GY5A 1KXFA 4B2CA 5GCHG 4CBOA 1BBRH 1MTWA 3TJVA 3VB6A 4O3UA 1ZMLA 2ZHQH 3SUGA 3P8GA 1BQYA 1HFDA 1LCYA 5FBEA 2FS8A 1O3JA 3PROA 4NIYA 1NS3A 2GP9B 2J92A 3BN9A 1UVOA 2Z3CA 4CHAB 2QXHA 1MTVA 1AE8H 1AU8A 3DT0H 3ZZ9A 1A61H 4RT0A 2PLXA 2J38A 4AFSA 2J94A 3UNRA 5GJ4B 5I25A 1F5KU 1L1GA 3K6YA 1YKTA 2ZECA 4DURA 5KGOA 3BTDE 1TONA 3H7TA 1C5XB 1MQ6A 1XUGA 2SGDE 2ANYA 2UUJB 3HPTB 1UVSH 1O5CB 3MFJA 2JJ2D 3RM0H 4MQAA 2BY5X 3OFND 2AIQA 1PFXC 1BHXB 4X2VA 5BRRE 1MCTA 1TE0A 4IC5A 2WUBA 1CQQA 1GBBA 1SGFG 1Y59T 4XFQA 3FVFB 1GG6B 2ZFPH 3FN8A 2NU0E 4O97A 1ZSJA 1JOUB 3QZQA 1DWBH 1BMMH 2J2UA 2FWWA 3F2FA 1CO7E 2VIDA 2PUXB 3LT3A 1TNHA 2A5KA 3CENA 3EAJA 4K1EA 1QJ1B 1SKYE 2GCTB 1JIMA 1GL0E 5LPRA 5GDSH 2R2WU 4A5TS 3KCGH 1PJPA 2ZDVH 4R0IA 1W0KD 3ZVFA 3A7WA 3A8DA 1GL1A 1E1QD 1IAUA 2EI8A 3UTUH 2C8YB 4ABHA 1AWHB 3FFGA 1G30B 3O8RA 1C9PA 1KXBA 4D7GA 1SG8B 5F53A 3RDZA 1SR5C 1HAXB 3EA7A 1LVOA 1GJDB 1F7ZA 3SV9A 1O3HA 4AG1A 1OS8A 1SGQE 1V2MT 4MNYA 2IPQX 5C3NA 4ISLA 3O8DA 1Y5AT 3OY6U 1PPFE 5EPYA 3SV7A 2JETC 5T6GA 1T32A 4WY3A 1K9OE 2FOEA 1WQVH 1O5FH 1WTGH 2BY8X 2G52A 4KTUA 2ZFSA 1C2HA 4FXGH 3D49H 1K2I1 1ID5H 1DWDH 3TJUA 2ZU5A 5L2YH 3QTVH 4IN1A 5HGGA 4NG9H 1V6DA 3T26A 5DP3A 4XBBA 2RDEA 4FUHA 1P11E 1CA8B 1EFRD 3ZZ8A 4INKA 2W7UA 1N8OC 3TPIZ 3ZZ4A 5C17A 4NA7A 3WWFA 5CHAC 1XX9A 2ZKSA 1K1OA 4INHA 1CGHA 3GCTG 1NO9H 4NA9H 4RSPA 1AO5A 2QF5A 4YLUA 1O36A 3ZVBA 3OTPA 1GCTC 1KY9A 2H9HA 1JWTA 3ATWA 3TK9A 2EEKA 3VGCB 1P9UA 1TMBH 4K5ZA 2RCEA 1DDJA 2ZPQA 4WH8A 3BTGE 1EPTB 1P01A 2VBCA 1GI4A 2QIQA 2Y6TA 2I6SA 2P59A 1EKBB 3RMMH 2NU2E 5TCAA 1D9IA 1ZPBA 4X2XA 1ETSH 2BMGB 5JBCS 3PLBA 2J9NA 4AYVB 4ABDA 3P8FA 1K1PA 2QE7D 2R0LA 2A2QH 2STAE 3SJ8A 1GPZA 5EJZA 3T28A 5GXPA 4RI0A 3SN8A 1YP9A 1ZGIA 1J15A 4WMEA 1F92A 2THFB 4UFEH 2G00A 1YPHE 1YCPK 2G8TA 5A2MH 1VCQA 2CGAA 3IG6B 1GMCF 3GDUA 2PGBB 4F49A 2YNBA 1ZPZA 1P0SH 3U9AH 1G2MA 1TNIA 1D6WA 2ZFQH 1ZMJA 1O2IA 3A7YA 3B9FH 2XBXA 1H9LB 4D9RA 4FETA 4JK5A 3LU9B 3H7OA 4ISHH 3GCTF 2AYWA 4YT7H 4INLA 3I77A 1P02A 2QAAA 1CBWC 2YMSB 1IQKA 3RXQA 3MI4A 3AW0A 3LDXH 1EAUA 4ESTE 1FMGA 2K8IA 4ABGA 3ZZCA 1F5RA 1P3CA 1MAXA 1P06A 2FO9A 4HG6A 1IHSH 2OQUA 3KHVA 1BJVA 1GJ9B 2ZHEH 2FX6A 4NWKA 2Z94A 1QL9A 3V0XA 1XMNB 2QCYA 4OM9A 1O3CA 2EQNA 1EASA 5DP9A 1L2EA 3PMHB 4Y71A 1THPB 1FAKH 2XBYA 4CRAA 1MH0A 1D3TB 3UIRA 4X6MA 4BANB 5DN6D 1F0TA 3ATKA 2V6NA 4ABBA 1AUTC 2PKSB 4X8TH 1SLUB 3KQ5A 4ZXYH 2Z9KA 4X6PA 1E34B 4OS6A 1O2JA 5LPFA 4NA8A 4M9FA 2P94A 2C90B 1AMHA 1RXPA 4K8YA 5DK1A 5EQQA 4CH2B 1ZGVA 4YO9A 2ZFRH 3VFEA 4DOQA 2W26A 1ANDA 2OBQA 4DVAU 4Y8XA 3MU0A 1L4DA 4XD7D 1ELVA 1O2VA 5FX5A 3W95A 2P8OC 1GI9B 1LHGH 3A7TA 2AEIH 3NXPA 2VU8E 1LVMA 2KCAA 1Z71A 1GBLA 2UWPA 3LOXA 1E38B 1N6XA 3GDVA 1GJCB 1RTKA 4ACBA 3T25A 2W3KA 1EPTA 1GBJA 4X1PU 2Z3EA 1NESE 1NFYA 3V3MA 1O3LA 4DY7B 1P8VC 3TH2H 4NWLA 1YPLH 1SGCA 3JZ2B 1SOZA 3M3SA 3S9AA 1Z8GA 2OINA 1HV7A 1CHGA 1QJ7B 3QLPH 1O39A 2O8TA 1MTNB 1RFNA 2VVVA 3AW1A 2ODQA 3DSOA 3LC3A 3UFAA 4AORA 2K1QA 3BG4B 3NUMA 2A0QB 2UWLA 1PPBH 2Z6BD 8GCHG 1ABIH 1SOTA 1C5RA 3N7EA 3A7ZA 3B8JA 1YWUA 2Z7FE 1KMHB 4UEHH 4XRNA 4YM9A 1BZXE 2XC4A 4I8JA 1NRRH 3WY8A 2HVYB 1GBDA 1UO6A 3PTNA 1MZDA 1AB9C 1RS0A 1ZJKA 1KLIH 1TNKA 3F0PA 1TPPA 1G37A 1C1TA 3A8AA 2C3SA 1Y3WA 3FZDA 1KLJH 1UK3A 5T6DA 1EX3A 1WOFA 4BTTB 3S9BA 2TGTA 1B0FA 4Y7BA 2WV4A 1O3EA 1GJBB 1YYY1 6LPRA 2G51A 1W8BH 4AC9A 1TNGA 4BXWA 1GHYH 3Q77A 2ZDLA 8ESTE 5C20A 1EJNA 1O5BB 3SUEA 1BRCE 3T29A 2BB4A 1MABB 2PHBA 1Y3XA 2Z9LA 4IGDA 2AFQB 5C67A 2GMTB 5EJ1A 1O5AB 1HJ9A 2FM2A 3SNAA 5IYTA 2CHAB 4Y10E 1JRSA 1MKWK 5FX6A 1MQ5A 3HK6B 3FO8D 2G4TA 1TOMH 1OP8A 2A1DB 2C8XB 2H5DA 2HLDD 2ESTE 1IOEA 4VGCB 5FL7D 2F4LA 1VR1H 1SSXA 4B74A 1O3PB 3RXEA 1Z6EA 3FKSD 4KTSA 1SMFE 3RXPA 2XBWA 2H1UA 2XYAA 1T7CA 1W7GH 1DWEH 2A7JA 4FUEA 3GY8A 3SO3A 1G32B 4BAQB 3S69A 1QCPA 1OWJA 1S81A 1T8MA 1SVPA 4O3TA 2QF4A 1HB0B 1J9CH 1WV7H 2UUFB 1L1NA 2RA3A 3SU3A 3SJOA 1QR3E 1FI8A 4ZAEA 1EAXA 3ZV9A 1ANBA 1G36A 4A7IB 3MNBA 1WBGB 3KQCA 3DA9B 1ANCA 1OP0A 3P8NA 1ZSKA 1SPJA 1A2CH 1HLTH 1GDUA 4NZQA 1A0LA 3GOVB 1Y3VA 1OWHA 3A89A 3VXFH 4SGAE 1ZHMA 4K1TA 4Y7AA 3RXDA 2GDEH 1SLWB 2SFAA 1E1RD 1RTLA 1T31A 1PPCE 4D8NA 2LNCA 4A1VA 1HXEH 1V2KT 2PUQH 1JMOH 1CBWB 1C5UA 3SGBE 2FOBA 1O3GA 2ZPRA 2M5TA 2FYQA 1BTXA 2ZQ1A 5L6NH 3F1SB 1PQ8A 1DX5M 1S83A 1ZLRA 1GBFA 1X7AC 1AVWA 5EXLA 2OCVB 3A82A 1ELFA 3SU0A 3UAIC 2HWLB 3QO6A 5LPEA 1K22H 1LPZB 3MO9A 5DSFA 3S7HB 1O3FA 3H5CB 1ESAA 1UTJA 3TGIE 2BZ6H 1MUEB 5T6FA 4ASHA 2VGCB 3NK8A 1C1VH 2D8WA 1Z7KA 5EIYA 2J95A 1PPEE 1XUHA 3F9EA 3MTYA 1GHAF 1GMDF 2ZG0H 3GCNA 4F55A 4I86A 8KME2 2BDHA 3SU5A 9ESTA 1WXRA 1VITF 2H6MA 3UWJH 2PP6A 1LHCH 4MVNA 4MPVA 1NN6A 1GBHA 1RRKA 3CS0A 2B9LA 4JYTA 1AZ8A 2VIOA 2HRVA 1LKBA 3Q3YA 3M37A 2BLVA 1KSNA 1A4WH 1P2IA 3SI3H 1EQ9A 2HLCA 1EJMA 1MMJN 2AMQA 2BDBA 5T1VA 4XSKU 1PQAA 2QF3A 2PSXA 2PR3A 5HM9A 2WPLS 1Y3YA 4ZKOU 2VH0A 2VWOA 4K69A 3SJ9A 2RA0A 1TYNA 1DFPA 1FONA 5H4IB 3P17H 1DPOA 1WUNH 4CRDA 3SHAH 1C5SA 1QA0A 1HYLA 5G4BA 3UREA 1LPKB 4NCYA 2BYAX 3SJKA 1SGNE 3A87A 5JYIA 3VB7A 1FV9A 3MQKC 1VITH 2SGFE 1QA7A 4UD9H 2OK5A 2OD3B 1NPMA 5ESTE 2WPKS 6GCHF 1LKAA 1TPOA 1TB6H 1BB0B 5FCKA 2JIZD 2B5TB 1BRBE 2C4FH 3FP6E 4FU8A 1K1MA 2P3UB 1GVKB 4ISNA 5EQSA 1NU7B 3EQ0H 5C2ZA 4TPYA 3T27A 3F6UH 1OWIA 2ZP0H 2QYIA 4MNVA 2BDIA 1CU1A 1V2NT 4CREA 4JZEH 3RXAA 1GI7B 3MH5A 5A0AE 1FPHH 2XCNA 1Q3XA 1F0SA 1AN1E 2G5VA 2ZU1A 3LGUA 1DITH 2SGEE 1HJAC 3PMBB 4JYVH 4JZ1A 4ZMAH 4FUBA 1UVPA 1AWFH 2QC2A 2QY0B 5A8YA 3S7KB 1NBME 1O3KA 1INCA 1OOKB 1K1JA 2BX4A 3RXMA 3STIA 2RG3A 2YMSD 1UCYK 1XVMA 1O38A 3D65E 3NRLA 1CA0B 1YF4A 3TH3H 1WTHD 3JZ1B 3ZVGA 1A3EH 4IS5A 1AVXA 1BOQA 1Z8RA 1ZHRA 1EZXC 1C4U2 2XRCA 4FVBA 2GZ9A 3NWUA 3RMNH 1P2NA 1P2JA 2A4GA 3AAVA 3SV6A 1ELGA 2WPHS 4TY7A 5JDUB 3V13A 1BRUP 1GHXH 2J5UA 2EC9H 1GJ5H 1O0DH 3U1JB 3ZVEA 1E0FD 3RXKA 1AUJA 2CK3D 5A09A 1LVBA 3OYPA 1QBNA 3SZEA 4B71A 2A45B 1CGJE 1DLEA 1H1BA 4FUFA 1O5GH 2XNIA 1P12E 1P03A 1QY6A 1TGNA 5JBAS 4GLYA 1OWEA 1EB1H 1SGPE 2FZZA 1NTPA 2KCPA 2AH4X 1C1MA 2PGQB 1G9IE 2Q1JA 1DSTA 1GI8B 1IQJA 1C5QA 3BIUH 3RXJA 1HAHH 4A92A 1F0UA 1SQOA 1Z8IB 3HK3B 1K0HA 3E0NB 5DP6A 1M9UA 2TIOA 4TYDA 1S82A 1WCZA 2JH6D 2ALPA 3ENSB 5GCHF 1MKXK 4UDWH 3SGQE 1PQ7A 4NSVA 1B5GH 1IHTH 1LHDH 2CF9H 2BD7A 5J4SA 2H5CA 1C1RA 1GI1A 1HBTH 3TGKE 1SQAA 1TNLA 5EGMA 4Z6AH 1O2UA 2BDGA 3M3TA 1S85A 5TCCA 4WH6A 3ZZ3A 3BEUA 1CHOG 4DJZB 2KCOA 2ANMH 3K2UA 2OXSA 1EAWA 1L1JA 2WV9A 4M7GA 3M7UA 2XTTB 1OYTH 1AFQC 3EGKH 5CE1A 4AB8A 1TNJA 3KIDU 1FJSA 2STBE 3SW2B 4AN7A 5AF9H 1TPSA 1UTMA 1SGDE 5ESBA 1UTQA 1NRSH 3LJJA 4IMZA 1DE7H 3ZYEA 2ASUB 1TABE 3F3BA 3RMOH 2HPPH 1GBTA 2VNTA 4RKJB 3GYLB 3A88A 5EODA 3A86A 1XUFA 3TU7H 1QTFA 3MH4A 4LZ1H 3M7TA 1E35B 5AFYH 1TQ7B 3SNEA 4AGKA 2WZQA 2VH6A 2WUCA 4Y6DA 3E16B 1DXPA 3VB3A 2BHGA 2BD9A 4Y0YE 3PRBA 2YNAA 4X8UH 2AERH 2FLBH 2AMPA 1E37B 1DSUA 3PRDA 4NIVA 2BD8A 3M5OA 5AFZH 4YLQH 1O33A 1FQ3A 4X1NU 1N1LA 1FZZA 1TQ0B 1Z8JB 1YPMH 3MO6A 3PV5A 1IQHA 1W11U 3BEFB 1ACBE 3AVZA 3TK5A 2BD2A 3QWCH 4KGAA 3S9CA 2QA9E 2FTMA 5C1YA 3RUOA 3FOAA 1P2QA 3N99A 1N6YA 4IN2A 2FP7B 1KXDA 4J2YB 1DS2E 2A5AA 1HXFH 1SGYE 2L6OA 1DY8A 1C5YB 2J34A 1B7XB 1UTOA 1C2DA 4Q80A 1ZOMA 5JBTA 1ZRBA 1E79D 2FIRH 1O5EH 1SC8U 5HIYA 1VZQH 2W3IA 4I8GA 3GDSA 2BZAA 1CT2E 1GJ7B 1V2QT 3BG8A 3GY3A 5C0TA 1W0YH 4CRCA 1V3XA 3RXCA 3U69H 1C5OH 2O8MA 4THNH 3TVJB 4H4FA 5AHGH 4ZKNU 3PMAB 3SHCH 1SHYA 2H9EH 4BTUB 3SNCA 1AHTH 7LPRA 4ZH8A 1EB2A 2WYJA 1NFUA 1TX7A 3L6PA 3MU5A 2OC7A 4NFEA 4YZUA 1PQ5A 1EZUC 3RLWH 4LXBH 2BVXH 4MG3A 4YOGA 3P92A 2Q6DA 2OC0A 3MO3A 3URDA 1YPJH 1FAXA 4I8LA 3KQBA 3UNSA 5EXMA 1IQNA 1LDTT 3EA8A 4I33A 4DW2U 1A3BH 3SJIA 3A84A 4GCHG 1QGFA 4DIIH 1P05A 5F8ZA 3TJNA 4H6TA 1H8DH 3RXSA 1CE5A 1QB1A 1O2KA 3RXLA 4CBNA 1QL7A 3Q3KA 3HGNA 2ZTYA 1G3CA 3DD2H 2VWMA 2CMYA 3ZZDA 1ESBA 3BIVH 1FLEE 2BVRH 2WINI 1S0QA 2BXUH 4JZDH 5A8XA 1NRPH 4ASUD 4Q7XA 1T8LA 4H42U 3U8OH 4O9VA 1KLTA 1EOJA 1FX0B 3VG8A 4NIWA 3GYMA 2NU1E 1BA8B 3LH1A 2VWLA 2KX4A 2JH0D 3NKKA 1NRQH 2V3MA 5F03A 3DFJA 3GY4A 3BTWE 5JBBS 2WSSD 3U1IB 3OTJE 2ODPA 5C94A 1DUAA 2V35A 2PFEA 1G3DA 5B6OA
chains in the Genus database with same CATH topology
2GVFA 5EQSA 4Z1MD 3PV2A 3P8OA 2L6OA 4R8TB 1DY8A 5GNDA 4JMYA 2IJD1 4WF8A 4ZCNA 5IK2D 3W1EA 1E1RD 1RTLA 4NWKA 2FOMB 3E90B 1E79D 4B6FA 5ETXA 3RC6A 3SUGA 4OM9A 2OC8A 1H8ED 2IJOB 3OAAD 3UB0A 4A1VA 4Q4LA 3H09A 3O8CA 3SV8A 1BT7A 1OHHD 4WH6A 3OEED 2XNDD 3F0PA 1CU1A 1NS3A 2F43B 5CHBA 5C0TA 3OE7D 1EFRD 3WWBA 2YOLA 4B6EA 1W3CA 2KCOA 5C17A 3WWFA 2LELA 2O8MA 3M5NA 1JXPA 2XCNA 2M2AA 2F9VA 2KR7A 2WV9A 2QF5A 2KM0A 5GJ4B 5DN6D 3OTPA 4A1XA 3F2GA 4U01A 3M5MA 3SU0A 3EYDA 2KFWA 4B75A 5GPIB 2W6JD 2XCFA 3L6PA 2OC7A 5ESBA 3SU6A 5DSFA 4M9FA 1NBME 2A4QA 5EQRA 5EQQA 3SUEA 3F3BA 4WH8A 2JJ2D 2F9UA 2VBCA 2JDID 2YMSD 2OC0A 3OFND 3NRLA 1MABB 2P59A 3KNXA 3LONA 2OBQA 1NBMD 2WHXA 4B73A 2AHME 2KCYA 2FM2A 4XD7D 1S6LA 4F55A 3FN8A 2WZQA 4Q63A 5FPSA 3LKWA 4I33A 3SU5A 2QE7D 3F2FA 2A4GA 3SUDA 3O8BA 1DXPA 3KF2A 5EPNA 3DSPA 1RGQA 3GS9A 2KCAA 4B76A 1WXRA 3SV6A 3FO8D 3M5LA 2KZ4A 1SKYE 3LOXA 3SUFA 2XOKD 1BMFD 4RI0A 5B6LA 1DXWA 1DY9A 2HLDD 3SYJA 2J5UA 2F4LA 3PRBA 5FL7D 3SU1A 4B74A 1A1RA 3ZIAD 3FKSD 5IDKA 3U1JB 2CK3D 3N7DA 1W0KD 2W6ID 3PRDA 3OYPA 2YMSC 3AK5A 3OEHD 1E1QD 5T1VA 3M5OA 3KN2A 3SZEA 4B71A 5HKKD 4K8BA 2QV1A 1N1LA 2XNIA 3KEEA 3O8RA 2QF4A 3WW7A 3PV5A 4NWLA 3F2HA 4YXWD 5F53A 4ASUD 5H4IB 3SU3A 2KCPA 2OINA 4FETA 4TSFD 3RC4A 2WPDD 1H8HD 2A4RA 1FX0B 4I31A 4I32A 3VG8A 4A1TA 3SV9A 2OBOA 3DSOA 3F0OA 3SU2A 2K1QA 4A92A 5CDFE 4KTCA 2YMSB 2V7QD 4TYDA 3O8DA 5FPTA 2GGVB 5EPYA 3SV7A 3FOAA 2JJ1D 3N99A 5FPYA 5C0UA 3P8NA 3N7EA 2OC1A 2OK5A 3U1IB 3DCLA 2WSSD 2FP7B 3SU4A 1W0JD 1COWD 2K8IA 2JIZD 4DT4A 3RC5A 4TT3D 1KMHB 2K0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7E A;  2LEL A;  3N7D A;  3DSO A;  3DSP A;  2KM0 A;  2K0Q A; 
#chains in the Genus database with same CATH topology
 5DGJ A;  4WXV A;  1QRX A;  4R8T B;  2Z9G A;  4BNR A;  1BUI A;  1FDP A;  3VEQ B;  3E90 B;  1C1P A;  5ETX A;  1A0H B;  3RC6 A;  1A7S A;  3E91 A;  4U32 A;  4TWW A;  2P95 A;  1O2Y A;  1AFE H;  2OP9 A;  4B6E A;  4GCH F;  1ETT H;  1HAI H;  1GWA A;  2A7C A;  3M36 A;  1UK4 A;  2BLO A;  1GHW H;  3D23 A;  1TMT H;  1J14 A;  1QBV H;  1HAZ B;  2GCH G;  1E36 B;  1NFW A;  3BTK E;  3EYD A;  4FUJ A;  2VVC A;  3NPS A;  4MPW A;  3ZZB A;  2BVS H;  2XCF A;  1OSS A;  1EST A;  1BML A;  1YY3 A;  2GKV E;  3Q3X A;  5E0G A;  2P93 A;  2PW8 H;  2UUK B;  2AS9 A;  3QK1 A;  4GUX A;  1V2L T;  1FNI A;  1YCP H;  1O35 A;  3LPR A;  1NBM D;  2JET B;  4ZHA A;  1S6L A;  3UWI A;  3PLK A;  1AFQ B;  3E6P H;  2C93 B;  3DSP A;  2TGA A;  1V2S T;  1Z1I A;  1O2R A;  3T5F H;  1H8I H;  1GBM A;  1KTT B;  3ZIA D;  4TY6 A;  2BD5 A;  1TRY A;  2DE8 A;  1T8O A;  3LH3 A;  4X0W U;  1N8O B;  2XW9 A;  4ZXX H;  2ZDK A;  5CHA B;  3AAS A;  4CHA C;  1EUF A;  1B0E A;  5DP5 A;  4Y11 E;  1A5G H;  1QIX B;  2W7S A;  4AZ2 B;  3BV9 B;  1WQS A;  1KDQ B;  1GCT B;  2B0F A;  2BY7 X;  1A5H A;  5F8T A;  2ZCK P;  3A81 A;  4YTA A;  3FP8 E;  4BOH A;  1ZTJ A;  8GCH F;  1LTO A;  4DCD A;  4TSF D;  3RC4 A;  1SQR A;  4ACA A;  1QZ8 A;  1SLX B;  2FXR A;  1TGS Z;  1ZYO A;  1HUT H;  2WV5 A;  2P3T B;  4XE4 A;  3E8L A;  2GGV B;  2JJ1 D;  1ZPC A;  5C0U A;  2B8O H;  2G55 A;  2ZGC A;  1VKY A;  3DCL A;  4XOJ A;  4Y8Z A;  1GG6 C;  2R9P A;  1AZZ A;  1BTY A;  1UK2 A;  5GND A;  1Q2W A;  2GDD A;  1O2P A;  4NIX A;  4JYU H;  1CGI E;  3BEI B;  2F9P A;  3MH7 A;  5T3H A;  1GI5 A;  4UON A;  1GHB G;  2GCT C;  3OAA D;  1SHH B;  4E06 H;  3O8C A;  3EE7 A;  2ZDN A;  1SLV B;  1XXD A;  1O2Z A;  1AI8 H;  2XND D;  1BJU A;  4I7Y H;  2XC5 A;  3P6Z B;  1ORF A;  4JZF H;  4AOQ A;  2Z3D A;  1W3C A;  1V2W T;  1DT2 A;  3N7O A;  2FOD A;  4CRF A;  2BY9 X;  1K28 D;  3QN7 A;  4YES B;  1K1L A;  1DAN H;  2A31 A;  3PYH A;  2PKA B;  3RXV A;  1ARC A;  2KFW A;  1HPG A;  1BBR K;  1ZR0 A;  1PYT C;  1GBI A;  4X6N A;  3Q00 A;  4Y0Z E;  3P70 B;  1P09 A;  1MZA A;  5DJ7 A;  1ABJ H;  4GHQ A;  3UQO A;  4BTI B;  7KME H;  1AD8 H;  1AKS B;  4GAW A;  1DOJ A;  3QX5 H;  3A8B A;  5A0C A;  4CRG A;  4X1S U;  5F8X A;  2GJG A;  5EPN A;  1OWD A;  4B76 A;  3RU4 E;  3PV4 A;  1QJ6 B;  3OY5 U;  1QQ4 A;  1TBQ H;  2A7H A;  4IMQ A;  3OU0 A;  3SU1 A;  2ZU2 A;  3EDX B;  1O3M A;  1O2M A;  1K1N A;  6EST A;  5IDK A;  1MD8 A;  1SGR E;  2OUA A;  6CHA C;  1D6R A;  3BSQ A;  3AK5 A;  3UOP A;  1OKX A;  4ZHL U;  5DKM A;  3PTB A;  3LGY A;  4ZRO A;  1BTW A;  1SGT A;  2ZZU H;  1ZTL A;  2V3H H;  2P3F H;  1QRZ A;  3PWC A;  3WW7 A;  5C1X A;  3CNR A;  4YXW D;  1HAG E;  2Y5H A;  1XUK A;  3GIC B;  1ELE E;  1UW7 A;  2FES H;  3QUM P;  1H8H D;  4A1T A;  3M35 A;  1O2W A;  1C5V A;  2NWN A;  2ZCH P;  4NFF A;  2VIW A;  3SU2 A;  1GBE A;  2XXL A;  1EPT C;  2TBS A;  3EST A;  1TWX B;  3PM3 A;  1EZS C;  1ETR H;  3RC5 A;  1TGC A;  4TT3 D;  4UFD H;  1KDQ A;  1OPH B;  3LKW A;  3RU4 T;  3ITI A;  4OS4 A;  2P8O B;  1SBW A;  3PV2 A;  5EJL A;  4H6S B;  1GCD A;  4ZCN A;  1D3P B;  4WF8 A;  2UUY A;  4ABE A;  2IN2 A;  1TBZ H;  2FOM B;  4B6F A;  1O37 A;  2VB0 A;  2ZNK H;  1O31 A;  1VJ9 U;  1P2M A;  1UVU H;  2XWA A;  5K7R A;  3B23 B;  1TPA E;  4D9Q A;  1EAT A;  1S5S A;  3RXI A;  3A80 A;  2HGT H;  1ZMN A;  3SI4 H;  2QXI A;  2QF0 A;  3M5N A;  4BAO B;  2RDL A;  1P04 A;  2FTL E;  4CR5 A;  1PPH E;  3M5M A;  2C8W B;  3QDZ B;  2IPH A;  3GCH C;  3DSG A;  4NGA H;  1MKW H;  1C2J A;  1C9T A;  1C5N H;  5FHT A;  3T62 A;  3RM2 H;  3SU6 A;  5CMX H;  2FOH A;  5AVD A;  4TPI Z;  3ZVC A;  1Y5B T;  5EQR A;  1SB1 H;  2FI5 E;  1D4P B;  2F9U A;  1GI0 A;  1NT1 A;  1GVL A;  1C1S A;  1H9H E;  2F91 A;  2BOH B;  3U98 H;  2SNV A;  1KYN A;  1ZZZ A;  1ELT A;  5FPS A;  1C2G A;  1HAV B;  3MNC A;  5I46 H;  1ELD E;  1KTS B;  1LHE H;  3KF2 A;  4DG4 A;  2KZ4 A;  3R3G B;  4Y76 A;  1AB9 B;  2QGR A;  2XOK D;  2WPI S;  2ZDA H;  1SQT A;  1SFI A;  2EA3 A;  5E0H A;  4GPG A;  3N7D A;  2ZFF H;  2W6I D;  3SOR A;  1LMW B;  1GDN A;  2VWN A;  1IQE A;  1C1N A;  1W14 U;  5KED A;  1GBC A;  1W13 U;  3BTQ E;  4WXI A;  1YPG H;  1TA2 A;  1T4U H;  4P00 A;  1FIZ A;  4OS7 A;  4NZL A;  2ZDM A;  1LO6 A;  5LH8 A;  4AX9 H;  2KAI B;  1EP5 A;  2Q6G A;  1C5Z B;  1Y8T A;  1FY3 A;  1C2F A;  1FN8 A;  5EOK A;  1TFX A;  2Y5F A;  4UFG H;  2IOT A;  2OBO A;  1GMH G;  1G3B A;  5FBI A;  1EAI A;  2BD4 A;  5ABW A;  3IWM A;  1MTS A;  2ZC9 H;  1BHX F;  3ATM A;  1W0J D;  3VXE H;  2AMD A;  1FY1 A;  1AQ7 A;  1QRW A;  1D3D B;  4LK4 A;  3RXH A;  1BDA A;  2PTC E;  2GTB A;  5EW1 H;  1TGB A;  2GZ7 A;  5IK2 D;  4GSO A;  3W1E A;  5E8E H;  1BBR E;  4F48 B;  5L2Z H;  1F5L A;  3TGJ E;  1GI3 A;  2NU4 E;  5C1U A;  3SV8 A;  1YBW A;  1FPC H;  1W7X H;  2CXV A;  4FU7 A;  5PTP A;  4WVP E;  4JK6 A;  4CR9 A;  8LPR A;  1UTK A;  2GX4 A;  1GHV H;  1SGI B;  1BIO A;  2KR7 A;  3A85 A;  1NZQ H;  2KM0 A;  4YT6 H;  1RJX B;  1CSO E;  2NU3 E;  1HAO H;  3K65 B;  4Y79 A;  5GWZ A;  5FAH A;  4FVD A;  5GPI B;  4XDE A;  1O2O A;  3ATL A;  2ZHW H;  3A83 A;  1MTN C;  5FXL A;  4BAM B;  4WWY A;  1BCU H;  4HZH A;  5DP4 A;  2TGP Z;  1LHF H;  3BG4 C;  1W2K H;  3QZR A;  1RTF B;  4GVU A;  1HIA B;  3A7V A;  4LZ4 B;  3KNX A;  3LON A;  1C1U H;  3P95 A;  3RXF A;  1GJ4 H;  3UOU A;  1EXF A;  2WHX A;  4B73 A;  2AHM E;  4D7F A;  2KCY A;  1TX8 A;  3MU1 A;  1WYK A;  1GMH F;  2ZCL P;  4AFQ A;  2R2M B;  4B1T A;  2FPZ A;  3SGA E;  4K2Y A;  1JRT A;  1NFX A;  2TRM A;  3GS9 A;  2J4I A;  1UHB B;  4NSY A;  1QBO A;  3ODD A;  1V2J T;  3SUF A;  1BMF D;  1BTH H;  1DY9 A;  1C5L H;  2GZ8 A;  1P10 A;  2BDA A;  1Y3U A;  1XKA C;  2O8W A;  4I8K A;  3RML H;  5EU8 A;  3KN2 A;  3UQV A;  1FN6 A;  1O2L A;  1NU9 A;  2RFK C;  5FCR A;  2XC0 A;  4DGJ A;  2ZWL H;  5EXN A;  1AVG H;  4HGC A;  1HAV A;  1O3I A;  4IC6 A;  5JB8 S;  3MOC A;  3TH4 H;  4ZUH A;  2FDA A;  1GMC G;  1YPE H;  1QQU A;  4KEL A;  3ZZ6 A;  4A6L A;  2JH5 D;  2A4R A;  2WPD D;  1YGC H;  1BMN H;  4WMF A;  5HM2 A;  1VJA U;  3RXT A;  3F0O A;  1HDT H;  1ZSL A;  6CHA B;  1BTU A;  3I78 A;  3E1X B;  4KTC A;  3QGN B;  4LOY H;  2F3C E;  1UJ1 A;  3DUX H;  1C1W H;  2Y7Z A;  2F9O A;  1HJ8 A;  2GMT C;  1MBQ A;  1S0R A;  1GGD C;  2Y80 A;  4ISO A;  2CHA C;  4WJG 2;  1VCP A;  4O03 A;  2GVF A;  3K9X B;  4Z1M D;  3STJ A;  1C2M A;  3MYW A;  4JMY A;  2KAI A;  1YCP M;  2Y5G A;  2FYR A;  1CHO F;  1HCG A;  1O3A A;  3U8T H;  3UNQ A;  2TPI Z;  2SGP E;  1GI6 A;  4Q4L A;  1OP2 A;  2Y82 A;  4VGC C;  1BT7 A;  3M3V A;  2ANW A;  2B7D H;  2J98 B;  1KIG H;  5EG4 A;  1DVA H;  1TA6 A;  1YLD A;  2YOL A;  1UCY H;  2FS9 A;  2G4U A;  1W0Z U;  3PO1 C;  3RLY H;  2LEL A;  2R0K A;  4MLF B;  2F9V A;  4J1Y A;  2WPJ S;  2O8U A;  3KGP A;  1DM4 B;  1ZJD A;  1TLD A;  1BTP A;  3U28 C;  2CJI A;  2H2Z A;  2CV3 A;  2BOK A;  5HYO A;  4FUC A;  2ZQ2 A;  1UTL M;  1NC6 A;  1C4V 2;  3CP7 A;  1C2L A;  2ODY B;  3AAU A;  3SQE E;  5KEC A;  2JDI D;  2ZEB A;  1C5P A;  1UCY E;  4X8V H;  2FX4 A;  3MHW U;  5HMA A;  2EY4 C;  4MTB A;  2AGI X;  1WDI A;  3V7T A;  1P2O A;  1C2E A;  1V2U T;  2Z9J A;  1DWC H;  2OLG A;  3GCH B;  3GY7 A;  2FOC A;  1XVO A;  1YPK H;  3EE0 B;  4XBD A;  1H4W A;  1WAY B;  2ZTX A;  1ANE A;  2XBV A;  3LC5 A;  1P2K A;  3DHK H;  1QFK H;  2CF8 H;  5LGO A;  1Z6J H;  1J17 T;  3RU4 D;  1TX6 A;  2BLQ A;  1HIA A;  1P3E A;  3BF6 H;  4AYY B;  4Y8Y A;  1GJ6 A;  1KXE A;  1MKX H;  2BQW B;  3KEE A;  2HNT C;  1NRO H;  4ABA A;  2PV9 B;  4IBL H;  1HJA B;  1YLC A;  4ABI A;  3GCO A;  3T2N A;  4X1R U;  1C4Y 2;  3LGT A;  1UHB A;  3MNS A;  2FI4 E;  1XM1 A;  3SNB A;  1C2K A;  3ODF A;  1O3D A;  3G01 A;  4Q2K A;  4B2B A;  1RIW C;  3FZZ A;  1MBM A;  2VGC C;  2D1J A;  5A0B A;  1O2G H;  3C27 B;  3FAO A;  5E0J A;  1J8A A;  3QTO H;  1MTU A;  4E7R G;  4YOJ A;  4RT1 A;  3SU4 A;  3TLO A;  1IQF A;  5B6L A;  1DXW A;  2ZI2 H;  1TOC B;  3D62 A;  1JBU H;  2OTV A;  3NZI A;  1D3Q B;  5A8Z A;  2IJD 1;  1C5M D;  2A5I A;  1HNE E;  1SGF A;  4F4O C;  1LQD B;  3PB1 E;  3BTM E;  4HFP B;  1OHH D;  1V2T T;  2Y7X A;  3TIU A;  2DUC A;  1CT4 E;  3WWB A;  2HPQ H;  5HXF A;  2DE9 A;  2ZHF H;  1AIX H;  1HAP H;  1QL8 A;  2ZU4 A;  3RXO A;  3BTT E;  2ZIQ H;  3V12 A;  2L74 A;  3UR9 A;  2BQ6 B;  2WPM S;  2SGA A;  1TAL A;  4HTC H;  2V3O H;  4MNW A;  1PPZ A;  2PSY A;  2ZA5 A;  3LIW A;  3OSY A;  2LPR A;  3CS7 A;  1GJA B;  1C1O A;  3DFL A;  4FOU C;  2UWO A;  2A4Q A;  1ZRK A;  3A8C A;  2G81 E;  4KKD A;  2J98 A;  4K1S A;  9LPR A;  1VCW A;  3ZVA A;  2BM2 A;  5DPA A;  1SI5 H;  3RXB A;  5EW2 H;  4YOI A;  4MDS A;  1LPG B;  2V0B A;  2XWB I;  2P16 A;  1WSS H;  3ZV8 A;  1EJA A;  2ULL A;  2FLR H;  2Q6F A;  3TK6 A;  2JKH A;  2HOB A;  3IIT A;  1GJ8 B;  2BDC A;  1VGC C;  3O8B A;  3KL6 A;  1LVY A;  2VIP A;  2VJ1 A;  1ZTK A;  1DIC A;  2F9N A;  2VVU A;  5J4Q A;  4PRO A;  7GCH G;  1IQM A;  1QNJ A;  1W12 U;  3FAN A;  3LJO A;  1YC0 A;  3UR6 A;  4AG2 A;  4U2W A;  1O2H A;  1Y5U T;  3TNS A;  5JPM H;  1O34 A;  3F68 H;  1S84 A;  4Z0K A;  3FP7 E;  1O2X A;  2HVX A;  3R0F A;  2J97 A;  1YLN A;  2ZGJ A;  2R3U A;  4HI3 A;  4BAH B;  1P57 B;  2Z9I A;  3RXR A;  1BIT A;  3SBK A;  2BLW A;  2VIN A;  4I31 A;  1CVW H;  1EOL A;  1O2S A;  4FUD A;  4UE7 H;  1OWK A;  1THR H;  1BMA A;  2D26 C;  1CA0 C;  1ELA A;  4AB9 A;  5HIZ A;  5C5O A;  3SZN A;  4ZKS U;  1KXA A;  4DT4 A;  3NCL A;  1RD3 B;  1FXY A;  1LQE A;  3W94 A;  3LGV A;  1FY4 A;  1A46 H;  1P9S A;  2CN0 H;  4X2Y A;  4UFF H;  2C8Z B;  3C1K A;  4DT7 B;  2OC8 A;  1H8E D;  3SV2 H;  2ZGB H;  4ZKR U;  2BX3 A;  5E2O A;  2GD4 B;  3OEE D;  5CHB A;  1MU6 B;  1BRA A;  2VIV A;  1AE5 A;  2BXT H;  2F43 B;  3M7Q A;  4ABJ A;  2GCH F;  1OXG A;  4ZHM U;  1GGD B;  2ZF0 H;  1JXP A;  3KQD A;  1QB6 A;  3QGJ A;  5K0H A;  7GCH F;  3HKI B;  3L33 A;  4IW4 E;  2VIQ A;  3ATI A;  1U6Q A;  3GIS B;  3M61 U;  4OS2 A;  2PWX A;  2H9T H;  5JB9 S;  3BTH E;  4AFZ A;  4RN6 A;  4Q7Y A;  4ABF A;  1HGT H;  2GV7 A;  1SFQ B;  2ALV A;  4JZI A;  4XBC A;  2AIP A;  2ANK H;  3S0N A;  2QXJ A;  1T4V H;  2SGQ E;  3RXG A;  5DO4 H;  1W10 U;  3PO1 B;  4QT8 C;  4OS5 A;  1S6F A;  2G5N A;  1G2L A;  4BXS A;  5F6M A;  1J16 A;  1V2V T;  1ZHP A;  2BD3 A;  2QXG A;  3K6Z A;  1UTP A;  4Q7Z A;  5GIB A;  4Q63 A;  1TIO A;  2A2X H;  3TIT A;  1JIR A;  3RXU A;  1EP6 A;  2ZTZ A;  1QUR H;  3SND A;  3KQE A;  3SUD A;  3TNT A;  4E7N A;  3VB5 A;  1NY2 2;  3F9F A;  3M5L A;  1O3O A;  4TWY A;  1GHA G;  1GMD G;  1TMU H;  5SGA E;  3SYJ A;  4AFU A;  1O2Q A;  2A4O A;  1A1R A;  2D2D A;  4GHT A;  1MU8 B;  2F9B H;  2GT8 A;  2LP6 A;  1VIT G;  1YM0 A;  3PWB A;  4AGJ A;  4P02 A;  1TGT A;  1T8N A;  2W5E A;  3MU4 A;  3HKJ B;  5HKK D;  1A5I A;  3KYF A;  2QV1 A;  4X2W A;  1UVT H;  2ZFT A;  2QN5 T;  3UY9 A;  3EA9 A;  4K3J A;  2FOA A;  2HNT F;  3F2H A;  3ZYD A;  3HAT H;  2R3Y A;  1SL3 A;  1CT0 E;  3SQH E;  3GY2 A;  1FIW A;  1NM6 A;  2FOF A;  4OS1 A;  2ZHD A;  4MNX A;  2ILN A;  1V2P T;  4JCN A;  3RP2 A;  3MH6 A;  2V7Q D;  5FPT A;  4X6O A;  2OC1 A;  3MNX A;  1GHB F;  3MWI U;  1XUJ A;  3OEH D;  4MPX A;  1KXC A;  4OGX A;  1YPH C;  3L3T A;  3URC A;  1QHR B;  3P8O A;  1ELC A;  3BTE E;  2ZGX H;  1TAW A;  2TGD A;  4I8H A;  4X8S H;  4KP0 A;  3VGC C;  6GCH G;  1O3B A;  1PYT D;  2IJO B;  3UB0 A;  3BTF E;  1WU1 A;  3H09 A;  1RIW B;  1IQG A;  2BTC E;  2WYG A;  1FUJ A;  4ISI H;  4RKO B;  4WMD A;  2EI7 A;  3PMJ A;  1UTN A;  3OE7 D;  2O8L A;  2PTN A;  3VPK A;  1FY5 A;  4CH8 B;  1IQI A;  3MMG A;  3SOS A;  2BY6 X;  1K21 H;  1TRM A;  2M2A A;  2SNW A;  1O30 A;  1FY8 E;  4SGB E;  4A1X A;  4K60 A;  3F2G A;  4U01 A;  4X1Q U;  1O32 A;  4B75 A;  4B2A A;  1AGJ A;  2W6J D;  1GHZ A;  2FEQ H;  3UPE A;  1SGE E;  2HAL A;  2ZPS A;  1L0Z A;  1AY6 H;  2FOG A;  1MD7 A;  3KYG A;  1HRT H;  3E3T A;  1NRN H;  2HNT E;  1H9I E;  3F9G A;  1V2O T;  5C5N A;  1UMA H;  4E05 H;  1L4Z A;  1C1Q A;  1V2R T;  1O5D H;  2EI6 A;  3ZZA A;  3HGP A;  2GT7 A;  3MU8 A;  3PLP A;  1TBR H;  2O9Q A;  4OGY A;  1GVZ A;  1TRN A;  3U8R H;  1O3N A;  1C5T A;  4FU9 A;  4FUG A;  2ZGH A;  3E0P B;  5L30 H;  1O2N A;  1RGQ A;  1C5W B;  1OYQ A;  1DUE A;  5BPE A;  1GDQ A;  1THS H;  1GBA A;  3ZZ5 A;  1GBK A;  1BTZ A;  1QB9 A;  1Z1J A;  1MAY A;  2BQ7 B;  4CRB A;  1IQL A;  1O2T A;  1HAY B;  2F83 A;  1XKB C;  7EST E;  1ELB A;  5DP8 A;  5TJX A;  2YMS C;  5E2P A;  1A0J A;  2ZU3 A;  4BAK B;  2Y81 A;  3LGI A;  1F2S E;  4K8B A;  4FUI A;  2FMJ A;  2OQ5 A;  3LGW A;  3ZVD A;  1MCV A;  3F9H A;  1Q31 A;  1DLK B;  5DG6 A;  1G3E A;  3GY6 A;  1VGC B;  2AGG X;  2I6Q A;  2PKA A;  2FI3 E;  1PPG E;  2AGE X;  1C2I A;  4I32 A;  3Q76 A;  4D76 A;  1OX1 A;  2ZO3 H;  1ARB A;  1XUI A;  5CDF E;  3A7X A;  1S6H A;  3OX7 U;  2BDY A;  4DIH H;  3UUZ A;  2A32 A;  3VB4 A;  5FPY A;  3I29 A;  1EZQ A;  1XXF A;  1COW D;  5DP7 A;  1K1I A;  1F0R A;  4MPU A;  2K0Q A;  1AKS A;  4U30 A;  1GI2 A;  3ELA H;  3ZZ7 A;  3TJO A;  2GV6 A;  2PKS C;  3GY5 A;  1KXF A;  4B2C A;  5GCH G;  4CBO A;  1BBR H;  1MTW A;  3TJV A;  3VB6 A;  4O3U A;  1ZML A;  2ZHQ H;  3SUG A;  3P8G A;  1BQY A;  1HFD A;  1LCY A;  5FBE A;  2FS8 A;  1O3J A;  3PRO A;  4NIY A;  1NS3 A;  2GP9 B;  2J92 A;  3BN9 A;  1UVO A;  2Z3C A;  4CHA B;  2QXH A;  1MTV A;  1AE8 H;  1AU8 A;  3DT0 H;  3ZZ9 A;  1A61 H;  4RT0 A;  2PLX A;  2J38 A;  4AFS A;  2J94 A;  3UNR A;  5GJ4 B;  5I25 A;  1F5K U;  1L1G A;  3K6Y A;  1YKT A;  2ZEC A;  4DUR A;  5KGO A;  3BTD E;  1TON A;  3H7T A;  1C5X B;  1MQ6 A;  1XUG A;  2SGD E;  2ANY A;  2UUJ B;  3HPT B;  1UVS H;  1O5C B;  3MFJ A;  2JJ2 D;  3RM0 H;  4MQA A;  2BY5 X;  3OFN D;  2AIQ A;  1PFX C;  1BHX B;  4X2V A;  5BRR E;  1MCT A;  1TE0 A;  4IC5 A;  2WUB A;  1CQQ A;  1GBB A;  1SGF G;  1Y59 T;  4XFQ A;  3FVF B;  1GG6 B;  2ZFP H;  3FN8 A;  2NU0 E;  4O97 A;  1ZSJ A;  1JOU B;  3QZQ A;  1DWB H;  1BMM H;  2J2U A;  2FWW A;  3F2F A;  1CO7 E;  2VID A;  2PUX B;  3LT3 A;  1TNH A;  2A5K A;  3CEN A;  3EAJ A;  4K1E A;  1QJ1 B;  1SKY E;  2GCT B;  1JIM A;  1GL0 E;  5LPR A;  5GDS H;  2R2W U;  4A5T S;  3KCG H;  1PJP A;  2ZDV H;  4R0I A;  1W0K D;  3ZVF A;  3A7W A;  3A8D A;  1GL1 A;  1E1Q D;  1IAU A;  2EI8 A;  3UTU H;  2C8Y B;  4ABH A;  1AWH B;  3FFG A;  1G30 B;  3O8R A;  1C9P A;  1KXB A;  4D7G A;  1SG8 B;  5F53 A;  3RDZ A;  1SR5 C;  1HAX B;  3EA7 A;  1LVO A;  1GJD B;  1F7Z A;  3SV9 A;  1O3H A;  4AG1 A;  1OS8 A;  1SGQ E;  1V2M T;  4MNY A;  2IPQ X;  5C3N A;  4ISL A;  3O8D A;  1Y5A T;  3OY6 U;  1PPF E;  5EPY A;  3SV7 A;  2JET C;  5T6G A;  1T32 A;  4WY3 A;  1K9O E;  2FOE A;  1WQV H;  1O5F H;  1WTG H;  2BY8 X;  2G52 A;  4KTU A;  2ZFS A;  1C2H A;  4FXG H;  3D49 H;  1K2I 1;  1ID5 H;  1DWD H;  3TJU A;  2ZU5 A;  5L2Y H;  3QTV H;  4IN1 A;  5HGG A;  4NG9 H;  1V6D A;  3T26 A;  5DP3 A;  4XBB A;  2RDE A;  4FUH A;  1P11 E;  1CA8 B;  1EFR D;  3ZZ8 A;  4INK A;  2W7U A;  1N8O C;  3TPI Z;  3ZZ4 A;  5C17 A;  4NA7 A;  3WWF A;  5CHA C;  1XX9 A;  2ZKS A;  1K1O A;  4INH A;  1CGH A;  3GCT G;  1NO9 H;  4NA9 H;  4RSP A;  1AO5 A;  2QF5 A;  4YLU A;  1O36 A;  3ZVB A;  3OTP A;  1GCT C;  1KY9 A;  2H9H A;  1JWT A;  3ATW A;  3TK9 A;  2EEK A;  3VGC B;  1P9U A;  1TMB H;  4K5Z A;  2RCE A;  1DDJ A;  2ZPQ A;  4WH8 A;  3BTG E;  1EPT B;  1P01 A;  2VBC A;  1GI4 A;  2QIQ A;  2Y6T A;  2I6S A;  2P59 A;  1EKB B;  3RMM H;  2NU2 E;  5TCA A;  1D9I A;  1ZPB A;  4X2X A;  1ETS H;  2BMG B;  5JBC S;  3PLB A;  2J9N A;  4AYV B;  4ABD A;  3P8F A;  1K1P A;  2QE7 D;  2R0L A;  2A2Q H;  2STA E;  3SJ8 A;  1GPZ A;  5EJZ A;  3T28 A;  5GXP A;  4RI0 A;  3SN8 A;  1YP9 A;  1ZGI A;  1J15 A;  4WME A;  1F92 A;  2THF B;  4UFE H;  2G00 A;  1YPH E;  1YCP K;  2G8T A;  5A2M H;  1VCQ A;  2CGA A;  3IG6 B;  1GMC F;  3GDU A;  2PGB B;  4F49 A;  2YNB A;  1ZPZ A;  1P0S H;  3U9A H;  1G2M A;  1TNI A;  1D6W A;  2ZFQ H;  1ZMJ A;  1O2I A;  3A7Y A;  3B9F H;  2XBX A;  1H9L B;  4D9R A;  4FET A;  4JK5 A;  3LU9 B;  3H7O A;  4ISH H;  3GCT F;  2AYW A;  4YT7 H;  4INL A;  3I77 A;  1P02 A;  2QAA A;  1CBW C;  2YMS B;  1IQK A;  3RXQ A;  3MI4 A;  3AW0 A;  3LDX H;  1EAU A;  4EST E;  1FMG A;  2K8I A;  4ABG A;  3ZZC A;  1F5R A;  1P3C A;  1MAX A;  1P06 A;  2FO9 A;  4HG6 A;  1IHS H;  2OQU A;  3KHV A;  1BJV A;  1GJ9 B;  2ZHE H;  2FX6 A;  4NWK A;  2Z94 A;  1QL9 A;  3V0X A;  1XMN B;  2QCY A;  4OM9 A;  1O3C A;  2EQN A;  1EAS A;  5DP9 A;  1L2E A;  3PMH B;  4Y71 A;  1THP B;  1FAK H;  2XBY A;  4CRA A;  1MH0 A;  1D3T B;  3UIR A;  4X6M A;  4BAN B;  5DN6 D;  1F0T A;  3ATK A;  2V6N A;  4ABB A;  1AUT C;  2PKS B;  4X8T H;  1SLU B;  3KQ5 A;  4ZXY H;  2Z9K A;  4X6P A;  1E34 B;  4OS6 A;  1O2J A;  5LPF A;  4NA8 A;  4M9F A;  2P94 A;  2C90 B;  1AMH A;  1RXP A;  4K8Y A;  5DK1 A;  5EQQ A;  4CH2 B;  1ZGV A;  4YO9 A;  2ZFR H;  3VFE A;  4DOQ A;  2W26 A;  1AND A;  2OBQ A;  4DVA U;  4Y8X A;  3MU0 A;  1L4D A;  4XD7 D;  1ELV A;  1O2V A;  5FX5 A;  3W95 A;  2P8O C;  1GI9 B;  1LHG H;  3A7T A;  2AEI H;  3NXP A;  2VU8 E;  1LVM A;  2KCA A;  1Z71 A;  1GBL A;  2UWP A;  3LOX A;  1E38 B;  1N6X A;  3GDV A;  1GJC B;  1RTK A;  4ACB A;  3T25 A;  2W3K A;  1EPT A;  1GBJ A;  4X1P U;  2Z3E A;  1NES E;  1NFY A;  3V3M A;  1O3L A;  4DY7 B;  1P8V C;  3TH2 H;  4NWL A;  1YPL H;  1SGC A;  3JZ2 B;  1SOZ A;  3M3S A;  3S9A A;  1Z8G A;  2OIN A;  1HV7 A;  1CHG A;  1QJ7 B;  3QLP H;  1O39 A;  2O8T A;  1MTN B;  1RFN A;  2VVV A;  3AW1 A;  2ODQ A;  3DSO A;  3LC3 A;  3UFA A;  4AOR A;  2K1Q A;  3BG4 B;  3NUM A;  2A0Q B;  2UWL A;  1PPB H;  2Z6B D;  8GCH G;  1ABI H;  1SOT A;  1C5R A;  3N7E A;  3A7Z A;  3B8J A;  1YWU A;  2Z7F E;  1KMH B;  4UEH H;  4XRN A;  4YM9 A;  1BZX E;  2XC4 A;  4I8J A;  1NRR H;  3WY8 A;  2HVY B;  1GBD A;  1UO6 A;  3PTN A;  1MZD A;  1AB9 C;  1RS0 A;  1ZJK A;  1KLI H;  1TNK A;  3F0P A;  1TPP A;  1G37 A;  1C1T A;  3A8A A;  2C3S A;  1Y3W A;  3FZD A;  1KLJ H;  1UK3 A;  5T6D A;  1EX3 A;  1WOF A;  4BTT B;  3S9B A;  2TGT A;  1B0F A;  4Y7B A;  2WV4 A;  1O3E A;  1GJB B;  1YYY 1;  6LPR A;  2G51 A;  1W8B H;  4AC9 A;  1TNG A;  4BXW A;  1GHY H;  3Q77 A;  2ZDL A;  8EST E;  5C20 A;  1EJN A;  1O5B B;  3SUE A;  1BRC E;  3T29 A;  2BB4 A;  1MAB B;  2PHB A;  1Y3X A;  2Z9L A;  4IGD A;  2AFQ B;  5C67 A;  2GMT B;  5EJ1 A;  1O5A B;  1HJ9 A;  2FM2 A;  3SNA A;  5IYT A;  2CHA B;  4Y10 E;  1JRS A;  1MKW K;  5FX6 A;  1MQ5 A;  3HK6 B;  3FO8 D;  2G4T A;  1TOM H;  1OP8 A;  2A1D B;  2C8X B;  2H5D A;  2HLD D;  2EST E;  1IOE A;  4VGC B;  5FL7 D;  2F4L A;  1VR1 H;  1SSX A;  4B74 A;  1O3P B;  3RXE A;  1Z6E A;  3FKS D;  4KTS A;  1SMF E;  3RXP A;  2XBW A;  2H1U A;  2XYA A;  1T7C A;  1W7G H;  1DWE H;  2A7J A;  4FUE A;  3GY8 A;  3SO3 A;  1G32 B;  4BAQ B;  3S69 A;  1QCP A;  1OWJ A;  1S81 A;  1T8M A;  1SVP A;  4O3T A;  2QF4 A;  1HB0 B;  1J9C H;  1WV7 H;  2UUF B;  1L1N A;  2RA3 A;  3SU3 A;  3SJO A;  1QR3 E;  1FI8 A;  4ZAE A;  1EAX A;  3ZV9 A;  1ANB A;  1G36 A;  4A7I B;  3MNB A;  1WBG B;  3KQC A;  3DA9 B;  1ANC A;  1OP0 A;  3P8N A;  1ZSK A;  1SPJ A;  1A2C H;  1HLT H;  1GDU A;  4NZQ A;  1A0L A;  3GOV B;  1Y3V A;  1OWH A;  3A89 A;  3VXF H;  4SGA E;  1ZHM A;  4K1T A;  4Y7A A;  3RXD A;  2GDE H;  1SLW B;  2SFA A;  1E1R D;  1RTL A;  1T31 A;  1PPC E;  4D8N A;  2LNC A;  4A1V A;  1HXE H;  1V2K T;  2PUQ H;  1JMO H;  1CBW B;  1C5U A;  3SGB E;  2FOB A;  1O3G A;  2ZPR A;  2M5T A;  2FYQ A;  1BTX A;  2ZQ1 A;  5L6N H;  3F1S B;  1PQ8 A;  1DX5 M;  1S83 A;  1ZLR A;  1GBF A;  1X7A C;  1AVW A;  5EXL A;  2OCV B;  3A82 A;  1ELF A;  3SU0 A;  3UAI C;  2HWL B;  3QO6 A;  5LPE A;  1K22 H;  1LPZ B;  3MO9 A;  5DSF A;  3S7H B;  1O3F A;  3H5C B;  1ESA A;  1UTJ A;  3TGI E;  2BZ6 H;  1MUE B;  5T6F A;  4ASH A;  2VGC B;  3NK8 A;  1C1V H;  2D8W A;  1Z7K A;  5EIY A;  2J95 A;  1PPE E;  1XUH A;  3F9E A;  3MTY A;  1GHA F;  1GMD F;  2ZG0 H;  3GCN A;  4F55 A;  4I86 A;  8KME 2;  2BDH A;  3SU5 A;  9EST A;  1WXR A;  1VIT F;  2H6M A;  3UWJ H;  2PP6 A;  1LHC H;  4MVN A;  4MPV A;  1NN6 A;  1GBH A;  1RRK A;  3CS0 A;  2B9L A;  4JYT A;  1AZ8 A;  2VIO A;  2HRV A;  1LKB A;  3Q3Y A;  3M37 A;  2BLV A;  1KSN A;  1A4W H;  1P2I A;  3SI3 H;  1EQ9 A;  2HLC A;  1EJM A;  1MMJ N;  2AMQ A;  2BDB A;  5T1V A;  4XSK U;  1PQA A;  2QF3 A;  2PSX A;  2PR3 A;  5HM9 A;  2WPL S;  1Y3Y A;  4ZKO U;  2VH0 A;  2VWO A;  4K69 A;  3SJ9 A;  2RA0 A;  1TYN A;  1DFP A;  1FON A;  5H4I B;  3P17 H;  1DPO A;  1WUN H;  4CRD A;  3SHA H;  1C5S A;  1QA0 A;  1HYL A;  5G4B A;  3URE A;  1LPK B;  4NCY A;  2BYA X;  3SJK A;  1SGN E;  3A87 A;  5JYI A;  3VB7 A;  1FV9 A;  3MQK C;  1VIT H;  2SGF E;  1QA7 A;  4UD9 H;  2OK5 A;  2OD3 B;  1NPM A;  5EST E;  2WPK S;  6GCH F;  1LKA A;  1TPO A;  1TB6 H;  1BB0 B;  5FCK A;  2JIZ D;  2B5T B;  1BRB E;  2C4F H;  3FP6 E;  4FU8 A;  1K1M A;  2P3U B;  1GVK B;  4ISN A;  5EQS A;  1NU7 B;  3EQ0 H;  5C2Z A;  4TPY A;  3T27 A;  3F6U H;  1OWI A;  2ZP0 H;  2QYI A;  4MNV A;  2BDI A;  1CU1 A;  1V2N T;  4CRE A;  4JZE H;  3RXA A;  1GI7 B;  3MH5 A;  5A0A E;  1FPH H;  2XCN A;  1Q3X A;  1F0S A;  1AN1 E;  2G5V A;  2ZU1 A;  3LGU A;  1DIT H;  2SGE E;  1HJA C;  3PMB B;  4JYV H;  4JZ1 A;  4ZMA H;  4FUB A;  1UVP A;  1AWF H;  2QC2 A;  2QY0 B;  5A8Y A;  3S7K B;  1NBM E;  1O3K A;  1INC A;  1OOK B;  1K1J A;  2BX4 A;  3RXM A;  3STI A;  2RG3 A;  2YMS D;  1UCY K;  1XVM A;  1O38 A;  3D65 E;  3NRL A;  1CA0 B;  1YF4 A;  3TH3 H;  1WTH D;  3JZ1 B;  3ZVG A;  1A3E H;  4IS5 A;  1AVX A;  1BOQ A;  1Z8R A;  1ZHR A;  1EZX C;  1C4U 2;  2XRC A;  4FVB A;  2GZ9 A;  3NWU A;  3RMN H;  1P2N A;  1P2J A;  2A4G A;  3AAV A;  3SV6 A;  1ELG A;  2WPH S;  4TY7 A;  5JDU B;  3V13 A;  1BRU P;  1GHX H;  2J5U A;  2EC9 H;  1GJ5 H;  1O0D H;  3U1J B;  3ZVE A;  1E0F D;  3RXK A;  1AUJ A;  2CK3 D;  5A09 A;  1LVB A;  3OYP A;  1QBN A;  3SZE A;  4B71 A;  2A45 B;  1CGJ E;  1DLE A;  1H1B A;  4FUF A;  1O5G H;  2XNI A;  1P12 E;  1P03 A;  1QY6 A;  1TGN A;  5JBA S;  4GLY A;  1OWE A;  1EB1 H;  1SGP E;  2FZZ A;  1NTP A;  2KCP A;  2AH4 X;  1C1M A;  2PGQ B;  1G9I E;  2Q1J A;  1DST A;  1GI8 B;  1IQJ A;  1C5Q A;  3BIU H;  3RXJ A;  1HAH H;  4A92 A;  1F0U A;  1SQO A;  1Z8I B;  3HK3 B;  1K0H A;  3E0N B;  5DP6 A;  1M9U A;  2TIO A;  4TYD A;  1S82 A;  1WCZ A;  2JH6 D;  2ALP A;  3ENS B;  5GCH F;  1MKX K;  4UDW H;  3SGQ E;  1PQ7 A;  4NSV A;  1B5G H;  1IHT H;  1LHD H;  2CF9 H;  2BD7 A;  5J4S A;  2H5C A;  1C1R A;  1GI1 A;  1HBT H;  3TGK E;  1SQA A;  1TNL A;  5EGM A;  4Z6A H;  1O2U A;  2BDG A;  3M3T A;  1S85 A;  5TCC A;  4WH6 A;  3ZZ3 A;  3BEU A;  1CHO G;  4DJZ B;  2KCO A;  2ANM H;  3K2U A;  2OXS A;  1EAW A;  1L1J A;  2WV9 A;  4M7G A;  3M7U A;  2XTT B;  1OYT H;  1AFQ C;  3EGK H;  5CE1 A;  4AB8 A;  1TNJ A;  3KID U;  1FJS A;  2STB E;  3SW2 B;  4AN7 A;  5AF9 H;  1TPS A;  1UTM A;  1SGD E;  5ESB A;  1UTQ A;  1NRS H;  3LJJ A;  4IMZ A;  1DE7 H;  3ZYE A;  2ASU B;  1TAB E;  3F3B A;  3RMO H;  2HPP H;  1GBT A;  2VNT A;  4RKJ B;  3GYL B;  3A88 A;  5EOD A;  3A86 A;  1XUF A;  3TU7 H;  1QTF A;  3MH4 A;  4LZ1 H;  3M7T A;  1E35 B;  5AFY H;  1TQ7 B;  3SNE A;  4AGK A;  2WZQ A;  2VH6 A;  2WUC A;  4Y6D A;  3E16 B;  1DXP A;  3VB3 A;  2BHG A;  2BD9 A;  4Y0Y E;  3PRB A;  2YNA A;  4X8U H;  2AER H;  2FLB H;  2AMP A;  1E37 B;  1DSU A;  3PRD A;  4NIV A;  2BD8 A;  3M5O A;  5AFZ H;  4YLQ H;  1O33 A;  1FQ3 A;  4X1N U;  1N1L A;  1FZZ A;  1TQ0 B;  1Z8J B;  1YPM H;  3MO6 A;  3PV5 A;  1IQH A;  1W11 U;  3BEF B;  1ACB E;  3AVZ A;  3TK5 A;  2BD2 A;  3QWC H;  4KGA A;  3S9C A;  2QA9 E;  2FTM A;  5C1Y A;  3RUO A;  3FOA A;  1P2Q A;  3N99 A;  1N6Y A;  4IN2 A;  2FP7 B;  1KXD A;  4J2Y B;  1DS2 E;  2A5A A;  1HXF H;  1SGY E;  2L6O A;  1DY8 A;  1C5Y B;  2J34 A;  1B7X B;  1UTO A;  1C2D A;  4Q80 A;  1ZOM A;  5JBT A;  1ZRB A;  1E79 D;  2FIR H;  1O5E H;  1SC8 U;  5HIY A;  1VZQ H;  2W3I A;  4I8G A;  3GDS A;  2BZA A;  1CT2 E;  1GJ7 B;  1V2Q T;  3BG8 A;  3GY3 A;  5C0T A;  1W0Y H;  4CRC A;  1V3X A;  3RXC A;  3U69 H;  1C5O H;  2O8M A;  4THN H;  3TVJ B;  4H4F A;  5AHG H;  4ZKN U;  3PMA B;  3SHC H;  1SHY A;  2H9E H;  4BTU B;  3SNC A;  1AHT H;  7LPR A;  4ZH8 A;  1EB2 A;  2WYJ A;  1NFU A;  1TX7 A;  3L6P A;  3MU5 A;  2OC7 A;  4NFE A;  4YZU A;  1PQ5 A;  1EZU C;  3RLW H;  4LXB H;  2BVX H;  4MG3 A;  4YOG A;  3P92 A;  2Q6D A;  2OC0 A;  3MO3 A;  3URD A;  1YPJ H;  1FAX A;  4I8L A;  3KQB A;  3UNS A;  5EXM A;  1IQN A;  1LDT T;  3EA8 A;  4I33 A;  4DW2 U;  1A3B H;  3SJI A;  3A84 A;  4GCH G;  1QGF A;  4DII H;  1P05 A;  5F8Z A;  3TJN A;  4H6T A;  1H8D H;  3RXS A;  1CE5 A;  1QB1 A;  1O2K A;  3RXL A;  4CBN A;  1QL7 A;  3Q3K A;  3HGN A;  2ZTY A;  1G3C A;  3DD2 H;  2VWM A;  2CMY A;  3ZZD A;  1ESB A;  3BIV H;  1FLE E;  2BVR H;  2WIN I;  1S0Q A;  2BXU H;  4JZD H;  5A8X A;  1NRP H;  4ASU D;  4Q7X A;  1T8L A;  4H42 U;  3U8O H;  4O9V A;  1KLT A;  1EOJ A;  1FX0 B;  3VG8 A;  4NIW A;  3GYM A;  2NU1 E;  1BA8 B;  3LH1 A;  2VWL A;  2KX4 A;  2JH0 D;  3NKK A;  1NRQ H;  2V3M A;  5F03 A;  3DFJ A;  3GY4 A;  3BTW E;  5JBB S;  2WSS D;  3U1I B;  3OTJ E;  2ODP A;  5C94 A;  1DUA A;  2V35 A;  2PFE A;  1G3D A;  5B6O A; 
#chains in the Genus database with same CATH homology
 2GVF A;  5EQS A;  4Z1M D;  3PV2 A;  3P8O A;  2L6O A;  4R8T B;  1DY8 A;  5GND A;  4JMY A;  2IJD 1;  4WF8 A;  4ZCN A;  5IK2 D;  3W1E A;  1E1R D;  1RTL A;  4NWK A;  2FOM B;  3E90 B;  1E79 D;  4B6F A;  5ETX A;  3RC6 A;  3SUG A;  4OM9 A;  2OC8 A;  1H8E D;  2IJO B;  3OAA D;  3UB0 A;  4A1V A;  4Q4L A;  3H09 A;  3O8C A;  3SV8 A;  1BT7 A;  1OHH D;  4WH6 A;  3OEE D;  2XND D;  3F0P A;  1CU1 A;  1NS3 A;  2F43 B;  5CHB A;  5C0T A;  3OE7 D;  1EFR D;  3WWB A;  2YOL A;  4B6E A;  1W3C A;  2KCO A;  5C17 A;  3WWF A;  2LEL A;  2O8M A;  3M5N A;  1JXP A;  2XCN A;  2M2A A;  2F9V A;  2KR7 A;  2WV9 A;  2QF5 A;  2KM0 A;  5GJ4 B;  5DN6 D;  3OTP A;  4A1X A;  3F2G A;  4U01 A;  3M5M A;  3SU0 A;  3EYD A;  2KFW A;  4B75 A;  5GPI B;  2W6J D;  2XCF A;  3L6P A;  2OC7 A;  5ESB A;  3SU6 A;  5DSF A;  4M9F A;  1NBM E;  2A4Q A;  5EQR A;  5EQQ A;  3SUE A;  3F3B A;  4WH8 A;  2JJ2 D;  2F9U A;  2VBC A;  2JDI D;  2YMS D;  2OC0 A;  3OFN D;  3NRL A;  1MAB B;  2P59 A;  3KNX A;  3LON A;  2OBQ A;  1NBM D;  2WHX A;  4B73 A;  2AHM E;  2KCY A;  2FM2 A;  4XD7 D;  1S6L A;  4F55 A;  3FN8 A;  2WZQ A;  4Q63 A;  5FPS A;  3LKW A;  4I33 A;  3SU5 A;  2QE7 D;  3F2F A;  2A4G A;  3SUD A;  3O8B A;  1DXP A;  3KF2 A;  5EPN A;  3DSP A;  1RGQ A;  3GS9 A;  2KCA A;  4B76 A;  1WXR A;  3SV6 A;  3FO8 D;  3M5L A;  2KZ4 A;  1SKY E;  3LOX A;  3SUF A;  2XOK D;  1BMF D;  4RI0 A;  5B6L A;  1DXW A;  1DY9 A;  2HLD D;  3SYJ A;  2J5U A;  2F4L A;  3PRB A;  5FL7 D;  3SU1 A;  4B74 A;  1A1R A;  3ZIA D;  3FKS D;  5IDK A;  3U1J B;  2CK3 D;  3N7D A;  1W0K D;  2W6I D;  3PRD A;  3OYP A;  2YMS C;  3AK5 A;  3OEH D;  1E1Q D;  5T1V A;  3M5O A;  3KN2 A;  3SZE A;  4B71 A;  5HKK D;  4K8B A;  2QV1 A;  1N1L A;  2XNI A;  3KEE A;  3O8R A;  2QF4 A;  3WW7 A;  3PV5 A;  4NWL A;  3F2H A;  4YXW D;  5F53 A;  4ASU D;  5H4I B;  3SU3 A;  2KCP A;  2OIN A;  4FET A;  4TSF D;  3RC4 A;  2WPD D;  1H8H D;  2A4R A;  1FX0 B;  4I31 A;  4I32 A;  3VG8 A;  4A1T A;  3SV9 A;  2OBO A;  3DSO A;  3F0O A;  3SU2 A;  2K1Q A;  4A92 A;  5CDF E;  4KTC A;  2YMS B;  2V7Q D;  4TYD A;  3O8D A;  5FPT A;  2GGV B;  5EPY A;  3SV7 A;  3FOA A;  2JJ1 D;  3N99 A;  5FPY A;  5C0U A;  3P8N A;  3N7E A;  2OC1 A;  2OK5 A;  3U1I B;  3DCL A;  2WSS D;  2FP7 B;  3SU4 A;  1W0J D;  1COW D;  2K8I A;  2JIZ D;  4DT4 A;  3RC5 A;  4TT3 D;  1KMH B;  2K0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...