1QB1A

Bovine trypsin with 1-[2-[5-[amino(imino)methyl]-2-hydroxyphenoxy]-6-[3-(4,5-dihydro-1-methyl-1h-imidazol-2-yl)phenoxy]pyridin-4-yl]piperidine-3-carboxylic acid (zk-806974)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title Crystallographic analysis of potent and selective factor Xa inhibitors complexed to bovine trypsin.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qb1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qb1A02
1BDAA 3HK3B 1UVPA 1O2MA 2ZFSA 1V2UT 1THPB 3RMNH 4BTUB 5LH8A 1GBCA 1GI8B 4RSPA 2Y5HA 1GDQA 1C1UH 2A31A 2O8LA 1KTSB 5A8ZA 1O3HA 1PPEE 4X1RU 4ZMAH 5FBEA 2G5VA 1J8AA 1DXWA 2JH5D 1DWDH 1H4WA 1NS3A 1X7AC 1ANBA 1CT4E 2ZGXH 3TJNA 1D3QB 2QF0A 3QK1A 4CBNA 1NESE 1A5GH 6LPRA 3T27A 3SJKA 3MNBA 5FCKA 1AGJA 4X8SH 3MHWU 2PFEA 2C8XB 1Z7KA 1O3OA 2V3HH 3BN9A 3RXCA 1HV7A 3SUEA 2Z9GA 2O9QA 5DG6A 2BLWA 2HOBA 3NZIA 2UUKB 3BTGE 1FN8A 5E2PA 3RMOH 3M3TA 4MTBA 1TNHA 1DDJA 1PJPA 4A1VA 2QYIA 4CRAA 3MU1A 1G3BA 2C90B 5J4SA 1O3JA 2VJ1A 4B73A 3O8RA 2PKSC 4TY6A 4ABEA 5B6OA 4ZHAA 2CJIA 2TBSA 4B2BA 1YPJH 3ODFA 3UR9A 1BITA 3U1JB 1TX7A 1FY1A 4I32A 2PKSB 1M9UA 4UFEH 5FXLA 3RXQA 3I29A 5FBIA 1QBNA 1O32A 1CVWH 3SU5A 2CXVA 1HAVA 1ANEA 5GDSH 1P03A 1FNIA 3SI3H 1NY22 4ISNA 1YGCH 4Z0KA 7GCHG 2WPMS 1A4WH 4A1XA 1IQFA 1MZAA 3EA9A 3MH7A 1SGFA 1W7XH 1YPGH 3RC6A 2ILNA 1GI1A 2PGQB 3VB4A 2BD5A 2GTBA 1EPTC 1OOKB 2ANMH 1T4VH 1BIOA 3KEEA 1CHOF 2FYQA 4BAOB 5I46H 4WMEA 4B71A 1YCPK 2O8TA 1YLDA 1NRRH 4JZIA 1BMMH 1VCPA 1EPTB 2P3FH 1CA0C 3ZZ3A 1H8DH 1THSH 3PO1C 3LIWA 1ABJH 1MKXK 1C1NA 3BTFE 3E0NB 2V35A 3MOCA 1Q2WA 2VVCA 3NKKA 2QAAA 1CA0B 3RXJA 2Q6FA 3PO1B 3F1SB 2EA3A 2WV5A 2FI3E 3GDSA 1G30B 3SV7A 1IQHA 2AMPA 4RKOB 4B74A 3V3MA 5JPMH 3E0PB 4RN6A 2GGVB 2ZZUH 4X0WU 8LPRA 1HXEH 2PV9B 1SOZA 3SN8A 1BTXA 2IN2A 3ESTA 1P01A 2CHAC 1KY9A 1P2KA 3GY6A 4AB9A 2ZU5A 4Y71A 1KXFA 4GCHG 2FIRH 2G52A 4A92A 1EZXC 1ABIH 1GMCF 2CHAB 3RXPA 1ZLRA 4LXBH 2Q6GA 1S84A 1BOQA 2BDCA 5AF9H 3A83A 1QL8A 1HAOH 4WF8A 2D1JA 1C2MA 2WPKS 2G8TA 2XC4A 2XNIA 3MNCA 3OY6U 1G37A 1TNGA 1LDTT 4LK4A 4I8LA 2ZFPH 1AZZA 3FVFB 1LQEA 1F0TA 1GL1A 1NZQH 1UCYE 1GHBG 2XW9A 1L4DA 4MLFB 4UEHH 1E36B 5DP3A 1KLJH 1TB6H 5EXNA 2TGPZ 3QWCH 1UK2A 3SNBA 1C4Y2 1MCTA 5AFZH 1O2YA 2ASUB 4TYDA 4ZAEA 2HNTC 1FZZA 3KL6A 3UR6A 2FTMA 3MI4A 1SGIB 3N7OA 1J16A 4ZXXH 5LGOA 3U1IB 2OQ5A 2F3CE 3KNXA 3Q3KA 4YESB 4O03A 1XKBC 2BY9X 3GY3A 4MPUA 2OC7A 3NCLA 1J15A 5F6MA 1HAGE 4O3UA 1Q31A 2ZI2H 4ISLA 3O8CA 1DPOA 1OWJA 4AORA 5A0CA 3A81A 1AO5A 1P9SA 2A32A 1UVTH 2H5CA 2ZGHA 4ZUHA 5T6FA 1YM0A 1C5WB 3TJVA 1GMHG 2FI4E 4ABIA 2OC1A 4NIVA 4ZHLU 1JIMA 4O9VA 1OP2A 1OS8A 2OQUA 3VB3A 2R2MB 3Q3XA 2UUFB 3V0XA 2A2XH 2QIQA 2JH6D 2XRCA 2ZHEH 5E8EH 3AAVA 1TQ7B 2FOFA 1A46H 1UVUH 2WYGA 1NRPH 4ZKNU 2F9BH 1HIAB 1QGFA 4CHAC 2GDDA 1O3IA 1TOCB 1QR3E 1P9UA 2A4QA 1KTTB 4D76A 1PQ5A 4F4OC 3IG6B 3GCTG 3A8AA 1O5CB 1NRSH 1MKXH 1Z1JA 4CHAB 1SLWB 4JYVH 3TPIZ 3ZZ5A 4CH8B 4IBLH 3ZVEA 1C2GA 1E37B 1G3EA 2VINA 2HNTF 3FP8E 2ZGJA 4HFPB 3P8NA 3BEUA 2ZDMA 1H9LB 4JMYA 4BAMB 1P3CA 2VIVA 1O2WA 1GBLA 3GOVB 4WMFA 3S9BA 4ZKSU 1W0YH 3UOUA 2BOHB 1TGNA 3NXPA 4X1SU 9ESTA 1C5MD 3RXVA 2BDYA 2HVXA 1B0EA 1ZMNA 5JB9S 1C5NH 4FUCA 1Y8TA 3SGAE 2VVVA 4UFGH 4E7RG 2H2ZA 1N1LA 1HAPH 2F9PA 2D8WA 1ZPCA 2FPZA 3BTTE 3D49H 3O8DA 4YM9A 4ASHA 3STIA 3MU4A 4DVAU 2W7SA 2KAIA 2R0KA 5BPEA 3E1XB 3ATMA 4DIHH 4LZ1H 5GXPA 1VITH 3KQEA 2ZKSA 2J2UA 1BRAA 1H9HE 3RU4D 2ZTZA 4B2CA 1MAXA 1GJAB 1CGIE 3LGUA 2VWMA 4XOJA 2Y7XA 4K3JA 1P02A 1H1BA 2BDHA 2RG3A 3RM2H 3ZZ7A 2QCYA 2Y5GA 3LOXA 3SQHE 3KF2A 2B9LA 1QBOA 3ZZ9A 2RDLA 2BLVA 1GI6A 2SGFE 1UTMA 3QUMP 3ATKA 1IQJA 1EUFA 3RXSA 4D9QA 1P10A 1O3KA 1LHDH 1W13U 3CP7A 1XXFA 2BY5X 5GIBA 3ZYDA 1AVGH 4GAWA 1HCGA 1LHCH 1C1TA 4AYVB 3UNQA 2FOEA 1RJXB 1A3BH 2WUCA 1AQ7A 1MTVA 1ELBA 4CH2B 1Y5UT 3DFLA 1YPLH 1HFDA 1P05A 1SVPA 1CU1A 1EAUA 1GDNA 3P95A 2GKVE 1YPHC 4O97A 3T5FH 3DFJA 1JXPA 4UE7H 1BTZA 1GBAA 1P3EA 1ZR0A 3KQCA 4X8VH 3M5MA 1SLXB 4AZ2B 4WXVA 3UTUH 1DSTA 4OGYA 2HLCA 2WPLS 1BTUA 3TGIE 2P16A 3QO6A 1C5SA 2FOHA 5A8YA 3P8GA 2Y5FA 3U9AH 1BTWA 1AFQC 7ESTE 2C8ZB 3VB6A 1HPGA 1RD3B 1GJ5H 1O3EA 1CHOG 1H8IH 2ESTE 3A7VA 2ZIQH 1ZHRA 3B8JA 4AN7A 4X6MA 3L33A 1AFQB 3UOPA 3RM0H 3H5CB 3MU0A 1Z1IA 1DLEA 4HGCA 3ZVGA 3SI4H 1ELAA 1SGTA 3KHVA 1O2LA 2XYAA 4XBBA 3S7KB 4SGBE 3RXKA 5FPYA 2WYJA 1UHBA 2J9NA 1HNEE 1O2TA 1G3CA 1INCA 1V2ST 1BJUA 4K60A 1GBEA 1O5FH 2OTVA 2GZ7A 2XC5A 2ZWLH 1KSNA 2ANYA 5A8XA 1A61H 3PLKA 3RXRA 2B8OH 1TA6A 3H7TA 1YC0A 1K9OE 2EI6A 1NRQH 1AZ8A 3SW2B 3AW0A 1YPKH 1WTHD 4CRBA 1TFXA 1P04A 3LH1A 4Q2KA 5EODA 4SGAE 1LVBA 1L4ZA 1EX3A 2QXHA 1LVMA 1AVWA 2OUAA 1XUGA 4FUHA 3T29A 5K0HA 2VWOA 1GMCG 1Z8IB 2BM2A 2XCNA 1PPHE 5L2ZH 3SJIA 1GJDB 4JYUH 1S85A 2PSXA 1AB9C 2VWNA 1K21H 5C5NA 1AWFH 1QB1A 4IS5A 1UO6A 1DOJA 4KTUA 1G2LA 2NWNA 1VGCC 3R3GB 1FXYA 2BD2A 2I6QA 1FQ3A 4Y11E 1AB9B 3KQBA 3SZNA 4IGDA 5GJ4B 3H7OA 1VGCB 1TMUH 3MO6A 3D62A 4AFUA 3PM3A 1LKBA 3GISB 3TH3H 5AVDA 2BHGA 1O30A 4Y79A 2BMGB 2QN5T 2VIWA 1HAVB 3ZVCA 1F92A 1FN6A 1N8OC 4CRCA 5IDKA 1JBUH 1QRZA 3M36A 2BXUH 1N8OB 2SGAA 5E2OA 4IMZA 1MCVA 2ZDAH 2SFAA 1TPOA 1FUJA 1PFXC 4Y8YA 4UD9H 1JRSA 2FP7B 1EXFA 1GMHF 1MTWA 2EI7A 3U8TH 4HI3A 2ZQ2A 2FMJA 2BD3A 3E6PH 1UTQA 2AGEX 1QNJA 2ZGBH 4MPXA 3F9FA 5C3NA 1RTFB 5H4IB 3LGWA 3S0NA 4CBOA 2DUCA 2HALA 3C27B 1QB6A 3UIRA 3SHCH 1S5SA 4AFSA 1YPEH 1TRNA 5HMAA 1AUTC 2H9EH 1AUJA 5J4QA 3EYDA 1CBWC 2NU2E 1MUEB 3RXMA 1AD8H 3QZRA 1C1OA 2BY7X 5F8XA 3RXUA 1MTNC 1BRUP 2FXRA 1CBWB 1CGJE 3SOSA 1DVAH 1SI5H 1ZSLA 3M5NA 1C2FA 4O3TA 1Z8RA 1MTNB 1V6DA 1FJSA 1QA0A 5FX5A 3A87A 3BG8A 1P2MA 2FI5E 2QXGA 5T3HA 1O2QA 2F9VA 3TH2H 4JK6A 4X1PU 1CSOE 2UUJB 2H9HA 1TPSA 2VH0A 3SV9A 7LPRA 4UFFH 5L2YH 3S69A 1TGTA 1BTYA 1Y5AT 2P94A 2WV4A 2Y80A 4H6SB 3HGNA 5DP9A 1HAYB 1KDQA 2WPHS 3GCNA 5E0HA 4DOQA 3W94A 1GHAF 4GHQA 1IHTH 2W7UA 1PPZA 1AKSA 1MMJN 1SL3A 1T7CA 4NG9H 1RTLA 4AGJA 1ZRBA 3VXFH 1K1LA 4NA8A 3UNRA 1WOFA 1MTUA 1UMAH 3PYHA 3Q3YA 2Z3EA 4Q7XA 2FLRH 1QRXA 3EGKH 2P59A 1EATA 1S82A 1ZGVA 3BV9B 3K6YA 1ETTH 3MYWA 1KXBA 1C5TA 1GMDF 5IYTA 2YOLA 2IJOB 3M37A 1C1WH 2BDAA 2ZDKA 2G81E 4ZH8A 2CN0H 1HB0B 3BF6H 4ABDA 2ZC9H 4TWWA 4MNVA 3PROA 1OWKA 1ZTLA 1IQIA 2O8WA 1VITF 1IAUA 4FUFA 1SHYA 1AFEH 4B75A 1TIOA 2R0LA 2ODQA 1T4UH 3BTHE 1GG6C 1K22H 2ZCHP 4K8YA 1OYQA 1HJAC 1P11E 1Y3UA 3LJJA 4WVPE 3RMMH 1ZGIA 1ZRKA 4K1TA 3MNSA 4OS6A 1GG6B 1A0HB 3AW1A 5DO4H 1HJAB 1NU9A 1T8OA 1YYY1 2CMYA 1P2IA 3DHKH 1TMTH 2FZZA 2QC2A 4MQAA 1DFPA 4QT8C 4XDEA 1MD8A 3RXHA 2AIPA 1PQ8A 3SJ8A 1QB9A 4FU7A 4DGJA 1K2I1 1O5EH 3RUOA 4K69A 2BOKA 1XKAC 3A89A 1L1GA 3E90B 1RTKA 4Y0YE 4XFQA 3P8OA 1D3PB 1P8VC 5DPAA 1DANH 1DUAA 4AX9H 1FY8E 1ESAA 4GLYA 2VIPA 1E35B 2Z3CA 1KIGH 1P0SH 1D9IA 1DT2A 1BTHH 3GY4A 4J2YB 5LPFA 4CRFA 1T8MA 1WQSA 2AGIX 3A8DA 3V12A 2FO9A 3AAUA 2GMTC 1GBDA 2C3SA 4NIXA 4YT6H 4AYYB 1P06A 2UUYA 2BVXH 3SNAA 1AMHA 2PUXB 2BLOA 2GMTB 1IHSH 1PPFE 2KAIB 1F7ZA 1HAHH 4H4FA 2I6SA 3ODDA 1C2DA 3EE0B 1NROH 4KTCA 3FZZA 4I7YH 3BTEE 1C5VA 3IWMA 5CHAC 1C5XB 4AGKA 2PKAA 4GPGA 4NA7A 1K1PA 3W95A 1YCPM 4KELA 4A6LA 1RS0A 3K6ZA 1F0SA 4AOQA 1CGHA 2Q1JA 2ZFFH 5CHAB 1Z8JB 1NM6A 2PTNA 1DS2E 1QQ4A 1DM4B 1BMAA 4FUBA 4WMDA 1QL9A 1PYTC 2ULLA 3PB1E 4DIIH 1D6RA 2AERH 1EASA 1OP0A 2GCHF 1UTKA 1Y3XA 4K1SA 3RDZA 5ABWA 1W0ZU 1HYLA 3B23B 1J14A 3FP6E 3S9CA 4UONA 1IQMA 1GBBA 3BG4C 3BEIB 2K1QA 3M3VA 4ZXYH 4AFZA 1TWXB 8GCHF 3P17H 1C5YB 2FOBA 1LTOA 1C2LA 3BG4B 1TRYA 1TPPA 4Y8XA 5GPIB 4CRDA 1A0LA 2LNCA 5HYOA 1CHGA 2A7CA 2BTCE 3IITA 5LPEA 1QJ7B 1SFIA 3QLPH 2JKHA 1FDPA 2FOCA 4NIYA 1SGEE 1ZTKA 2WPJS 4IC5A 1O39A 3NWUA 1GVLA 3PTNA 4R8TB 3P6ZB 1UK4A 3ATIA 3RXFA 1G36A 1VZQH 3SORA 2BY6X 3SU1A 2XCFA 1FY3A 1C4U2 4DY7B 1DE7H 1MBMA 1ELDE 2Y82A 1BBRE 3DA9B 4TY7A 5C20A 3TK5A 3QTVH 1OP8A 2HRVA 1O38A 2OBOA 3OYPA 3M5LA 5DP5A 3LGTA 2ZFTA 4X8UH 1W7GH 3SUFA 3A85A 1NRNH 1O2NA 3GCOA 4ABFA 2THFB 1ZSJA 1Y3YA 2Z9KA 1DWEH 2FDAA 1UHBB 1UTJA 4X2VA 5FPSA 2D26C 3M35A 1P12E 2BD7A 1PYTD 3MH6A 1LHFH 1XUHA 3V13A 4GSOA 2UWLA 2BDBA 1GI2A 1XUKA 3QDZB 1GJCB 4OS1A 3LONA 1HAZB 4K8BA 1KYNA 1V2PT 2R9PA 3BTDE 3QN7A 2BD4A 4J1YA 1LO6A 1K1OA 2AGGX 2TGAA 1XX9A 4U30A 2Z9IA 5E0JA 1C1QA 2XWBI 1SGFG 3MH4A 1SG8B 3M61U 1O35A 1GJ6A 2QY0B 1TALA 8KME2 3U8OH 3SNEA 2P3UB 1A7SA 3A8BA 4FVBA 4CRGA 3LKWA 3DD2H 3SV6A 3M3SA 4HTCH 1O3GA 3E91A 3L6PA 1WCZA 1HJ8A 3ZZ8A 3EA8A 2BVRH 4Q7ZA 1MBQA 5CMXH 2EI8A 1MD7A 5JBAS 2OLGA 1ZMJA 1GHAG 3P70B 1XM1A 1EAXA 4GHTA 2FOMB 1UCYK 1Q3XA 2OXSA 1JMOH 1TABE 1C5RA 2AMQA 1WU1A 3T28A 1O3LA 2F91A 5F8ZA 4XBDA 4CREA 3VEQB 5C1YA 1QTFA 4YOIA 1C5QA 2W26A 1TNLA 4KP0A 1LKAA 1GBHA 3I77A 2NU3E 1ZJDA 2EC9H 2ZCKP 1WSSH 1EZQA 4JCNA 2FEQH 3ITIA 3S9AA 4BANB 4A1TA 2ZCLP 1LQDB 1BB0B 1FI8A 2IOTA 3VFEA 1L2EA 1GMDG 3C1KA 4PROA 3PMJA 4MG3A 1DITH 3FFGA 1AHTH 4X6PA 3HATH 3RXEA 4I8KA 1SGNE 1IQEA 1EP6A 3FAOA 3VXEH 2RA0A 2AMDA 5DP7A 1UVOA 2ZF0H 1VITG 3A7YA 2WPIS 1UVSH 2BB4A 3SU2A 1NC6A 2HPPH 2R3YA 1MKWK 2OD3B 5EOKA 5A0BA 5JB8S 2PLXA 1EJMA 1O31A 3QZQA 3MFJA 2G4UA 1O3BA 1O5AB 1YBWA 3LT3A 4TPYA 4BTIB 2XTTB 1BTPA 3TU7H 1EZUC 4E06H 2QV1A 1C5UA 4UDWH 3RXGA 2A0QB 3TNTA 1GBMA 1AN1E 2B7DH 1ZYOA 3GY8A 5ESTE 2IPHA 2FTLE 3SBKA 1WUNH 3BTQE 3U8RH 3GY5A 5L30H 1O5GH 1IQNA 2PHBA 1L1JA 1O2HA 1TGCA 2Z6BD 1EOJA 1ANCA 2ODYB 4BOHA 1C9TA 1C9PA 4I33A 1ELFA 2VIQA 3SGQE 3PWCA 1FPHH 1AWHB 4X6OA 1CE5A 3SNCA 2ZO3H 2G51A 1GWAA 2Z9LA 2ZP0H 2VNTA 3OTJE 3Q00A 1IOEA 1KDQB 1W10U 3PTBA 1B7XB 4YOJA 2BXTH 1K1JA 1LCYA 2ALVA 1AKSB 1W12U 1MU8B 2FM2A 1GJ4H 3PWBA 3B9FH 2V6NA 1GBKA 3SO3A 3ZVAA 1CQQA 1GHZA 1NN6A 4UFDH 4JZDH 3SU4A 1SB1H 4FXGH 1V2WT 1LVOA 3HGPA 5DKMA 1K1NA 2ZFQH 4YLQH 1YF4A 1P57B 2BDIA 2G4TA 2PW8H 4Q80A 5JDUB 1BZXE 1C2EA 4ABGA 4E05H 2F83A 3A7XA 2GCTC 3U69H 1NPMA 5BRRE 5T6GA 1QIXB 1SGCA 4ZHMU 2ZA5A 1FAKH 4IN2A 4OS4A 5C5OA 2GCTB 1YKTA 1K28D 1YPHE 4K2YA 5G4BA 3RU4T 1O2OA 2OP9A 1HBTH 1UCYH 1MH0A 5JBBS 3E16B 3SU6A 1QFKH 2ZTXA 1SGYE 5LPRA 4E7NA 1GJBB 2ZEBA 2ANWA 2FLBH 3ZZ6A 2GCHG 2W5EA 1HUTH 2J94A 1U6QA 1O3CA 5HGGA 2PSYA 2H6MA 4RKJB 5DJ7A 1AE8H 1ID5H 2PR3A 1JOUB 2BYAX 1C5PA 1DICA 3GDVA 3LPRA 6CHAC 8GCHG 1O3PB 1G32B 1P2QA 2FYRA 3RMLH 5C1UA 1HRTH 1KXCA 3E3TA 4OS2A 1HGTH 1OWIA 1Z71A 2VU8E 4Q7YA 8ESTE 1ZHPA 2C93B 2A4GA 1C5OH 2Z9JA 6CHAB 1D3TB 2G55A 4Y7AA 1D4PB 1SHHB 1GBFA 2VGCC 3DUXH 2ANKH 5TJXA 4MVNA 5EQSA 3MU8A 1PPGE 2WUBA 4BAHB 1D6WA 4INLA 2VGCB 1WQVH 1NTPA 2A7HA 1MQ5A 1GHYH 2OBQA 1KLIH 4XBCA 3TVJB 3UQVA 1C5ZB 4XSKU 5EXMA 1MKWH 2O8MA 2A4RA 5L6NH 5DK1A 1O37A 1C2IA 4NCYA 1ESTA 1GVZA 1B0FA 1T8LA 1OKXA 2V0BA 1TAWA 2W3KA 1C4V2 3P8FA 4H42U 5C67A 2TGDA 3ZZ4A 4Y8ZA 1O2KA 2C8YB 1GL0E 2XXLA 1RFNA 1FLEE 2AEIH 2W3IA 5E0GA 1IQKA 3A7WA 3EDXB 3SU0A 1ZSKA 1BCUH 1Z6EA 1GHXH 4INKA 4IN1A 1LHEH 3RLYH 3ELAH 3MNXA 5FPTA 1T31A 2UWPA 1C2JA 1LPGB 2PKAB 3SHAH 1EJNA 1HDTH 1O2UA 1DLKB 3ZVBA 3F68H 1ACBE 1P2OA 4BXWA 4GUXA 1EKBB 1MQ6A 3TITA 1GHVH 1SLUB 2P3TB 2XWAA 2SGPE 2ZPRA 4MPWA 1CT2E 4DCDA 1O3FA 1OYTH 1O3NA 1O2SA 1ORFA 2ZU2A 3CS7A 3SJOA 1ELEE 1VJ9U 2QXJA 1C1RA 3ZYEA 2A5AA 1GBIA 1XUJA 4I31A 4FU9A 2JH0D 1P09A 4MDSA 1OWHA 4ZKOU 4YLUA 1GI9B 3QTOH 5DP8A 4A5TS 1G2MA 3JZ1B 5JYIA 1ZOMA 3MWIU 2BD8A 1LPKB 1O3DA 4X6NA 1AIXH 2ODPA 1O5BB 2OCVB 4Y76A 2VH6A 7KMEH 2M5TA 3A88A 3OU0A 2DE9A 1V2OT 4NWKA 5AFYH 4VGCC 3PMHB 3D23A 3A82A 1QURH 5EXLA 3A8CA 4IMQA 3BEFB 3UWJH 2PWXA 1F5KU 2YNBA 3TK6A 4JYTA 4U01A 1LVYA 4VGCB 1S83A 3LGYA 1QBVH 3ZZBA 3EQ0H 4YT7H 1BHXB 4MNYA 3ZZDA 4X1NU 1F2SE 1GHWH 2ZHQH 2GZ8A 3VPKA 4Y0ZE 1MZDA 4LZ4B 2ZG0H 2OC0A 1V2JT 3CENA 3KCGH 4ABJA 2AFQB 1C1MA 5ETXA 1JIRA 3TGKE 1L1NA 3RP2A 3MH5A 5HM9A 1GI7B 1V2RT 3KN2A 1WBGB 3T62A 2FS8A 1TPAE 1DX5M 2CF9H 1GJ7B 5EG4A 3G01A 2PTCE 1FY4A 4X2WA 2AS9A 3HKJB 5GCHG 3R0FA 3UY9A 2XBXA 1ZPZA 1E34B 1FONA 4WY3A 5TCCA 3TIUA 4FUDA 5EW2H 1DY9A 1GBJA 4OS7A 2GT7A 4B1TA 1TE0A 4JZ1A 2J38A 3GDUA 2AIQA 1V2LT 4X8TH 3ZVDA 2BX4A 4OGXA 1W14U 2GP9B 3QGJA 4CR9A 1GCTC 4NA9H 1O3AA 2B5TB 3NUMA 4YZUA 4NSVA 1S6HA 1T32A 4X1QU 2GD4B 1EJAA 1GCTB 3Q76A 4ZKRU 1KXDA 1BHXF 3BTME 3JZ2B 4TPIZ 1EZSC 3BTKE 3BTWE 3MO3A 5AHGH 1G9IE 2SNWA 5EQRA 3UNSA 1V2VT 1C2KA 1FAXA 3F9HA 3AVZA 3F6UH 1YLCA 2BVSH 1EP5A 1TBQH 1QQUA 1CO7E 4M7GA 4NZLA 1THRH 1EAIA 1C1VH 2PGBB 1SPJA 1Z6JH 3ZZCA 5A0AE 1QRWA 1S0QA 3S7HB 3UFAA 3F9EA 2A2QH 1FMGA 4CR5A 1PQ7A 1O33A 1GI5A 1TX8A 4ISOA 1ARBA 2JETC 4YTAA 2FWWA 2J34A 5F8TA 5K7RA 1NU7B 2ZTYA 2JETB 3A7ZA 3FANA 3MU5A 1NFYA 4YO9A 2AYWA 2QGRA 2BX3A 1OWDA 1ELCA 2XBYA 5FHTA 6GCHG 3ZZAA 2QXIA 1JRTA 1FIZA 1UK3A 3UQOA 1ETRH 1XUIA 2ZQ1A 1LPZB 3ATLA 1UTOA 1GJ9B 1O2GH 1VJAU 1NT1A 1TLDA 4XE4A 1Y3WA 5EGMA 1BRCE 1VCQA 4I8JA 4MNWA 2ZU4A 2XC0A 2EEKA 3PV4A 1SGRE 3PMBB 3T26A 1UTPA 3A7TA 1TNJA 2H1UA 3GICB 1VR1H 1FIWA 1E0FD 1K1IA 2TPIZ 2FODA 2Q6DA 1Z8GA 5CE1A 1O2RA 2TRMA 5FAHA 1C1PA 2ALPA 3GYMA 4YOGA 1V2QT 1GI4A 1G3DA 2RA3A 2Y7ZA 2A7JA 2BZAA 3F9GA 3RLWH 1GCDA 4B76A 3ZVFA 4D7FA 1ZTJA 3UPEA 3KQDA 1RRKA 1V2MT 1ZPBA 2C8WB 2G5NA 4FUJA 4DURA 1B5GH 2BQWB 3PLPA 1HJ9A 1HLTH 3D65E 1Y5BT 1SFQB 2FOAA 3K2UA 2STAE 1WYKA 3BIVH 5SGAE 2J92A 1BUIA 1QL7A 3HKIB 1LHGH 1A2CH 3O8BA 3RXOA 3RXAA 3GCHC 4D7GA 1EB2A 1TYNA 3DT0H 1GBTA 1ELGA 1PPBH 1OPHB 2BQ6B 1Y3VA 2A5IA 2Z3DA 4BTTB 4DT7B 2VVUA 1SC8U 2GT8A 4Y10E 1DWCH 2XBVA 4Z6AH 5JBTA 4D8NA 2H5DA 3GCHB 4BAQB 3LU9B 1CT0E 1QY6A 5TCAA 1ELVA 3RC4A 3SV2H 2SNVA 4KTSA 2QA9E 5DP4A 3WY8A 3BIUH 1HAXB 1F5RA 4I8HA 2QF3A 2GV7A 2RCEA 2FX4A 4D9RA 1FY5A 1YCPH 4ISHH 1VCWA 1DWBH 2VIDA 2Z94A 1P2JA 1NFWA 1EAWA 2GDEH 1GDUA 2HNTE 2F9UA 4AG1A 1BMNH 1ETSH 2LPRA 3ZV8A 4WH8A 1SSXA 3K65B 4IC6A 5FCRA 4BXSA 3SJ9A 2CF8H 2DE8A 1NFXA 4WWYA 1O2ZA 3HPTB 2BY8X 1AY6H 1TONA 2ZDNA 2CGAA 2G00A 2P8OC 2PUQH 4NIWA 4ABHA 1EPTA 3LC3A 2WINI 1UJ1A 3RU4E 3FP7E 3TK9A 2BDGA 3A80A 2ZU3A 1A0JA 1QJ6B 2FX6A 3STJA 2P8OB 1NFUA 1W8BH 6ESTA 3ATWA 1MAYA 1O36A 1J9CH 2STBE 3LDXH 1IQGA 1KXEA 2NU0E 1OSSA 1GPZA 1ESBA 1UTNA 2BZ6H 3A86A 1ZJKA 4Y6DA 3ENSB 1CA8B 3EAJA 1S6FA 4Y7BA 3ZV9A 1S0RA 1ZZZA 3KGPA 1A3EH 1O3MA 1O2VA 1MU6B 3RXLA 1QA7A 1OXGA 5DGJA 1EOLA 2ZFRH 5DP6A 5T6DA 1YPMH 3SV8A 1GGDC 1BBRK 1F5LA 2J4IA 2J95A 2H9TH 1WV7H 1KXAA 2FS9A 4MPVA 1GGDB 4I8GA 1S81A 4THNH 5EPYA 2F9OA 1O2PA 1BQYA 5HXFA 4FUEA 5GCHF 2P95A 3TGJE 1F0RA 2OC8A 2A45B 1GVKB 3UREA 5ESBA 2ZHWH 3BSQA 3GYLB 1O5DH 2OINA 2D2DA 3TJUA 1TBZH 1TGSZ 2NU4E 2BQ7B 4WXIA 3FZDA 4DG4A 2GV6A 5FX6A 1TNKA 4DW2U 2NU1E 1N6XA 4KGAA 4BAKB 3LGVA 4R0IA 1WTGH 5HM2A 1KLTA 3K9XB 4X2YA 1PQAA 2AH4X 1C2HA 4FVDA 3RXBA 2UWOA 1RXPA 1SLVB 7GCHF 3OSYA 1FPCH 3P92A 4NWLA 1BRBE 1AI8H 1IQLA 3E8LA 1V3XA 4IW4E 1T8NA 1WAYB 2Y6TA 4INHA 4U32A 1DXPA 2SGQE 3URDA 2Z7FE 1ZHMA 1MTSA 3A84A 3RC5A 4BNRA 3HK6B 4GVUA 4A7IB 4JZFH 4ISIH 2ZDVH 3RXTA 4TWYA 1DSUA 1GI3A 2A1DB 3AASA 1TGBA 1QCPA 1XMNB 3LGIA 3RXDA 4KKDA 2C4FH 2GVFA 1SR5C 2A4OA 3MO9A 4LOYH 3UWIA 4X2XA 1LMWB 1TQ0B 1H9IE 1XVOA 2TGTA 1TMBH 2ZU1A 3T25A 2VIOA 1W2KH 4NFEA 2FESH 4WH6A 1YP9A 2A5KA 2BLQA 6GCHF 1SQTA 3V7TA 3SUDA 4FU8A 1V2NT 3PLBA 2Y81A 1BA8B 1ANDA 1E38B 1HIAA 2ZGCA 4FUGA 1K1MA 1HAIH 3TJOA 5EPNA 2HPQH 4GCHF 3SUGA 3KIDU 4ABAA 3MTYA 1UTLM 2ZNKH 1C5LH 3M7UA 4ZROA 3RXIA 1BT7A 1XUFA 5A2MH 3CS0A 1SQAA 4FUIA 1BMLA 3Q77A 4AFQA 1N6YA 2B0FA 2BD9A 2O8UA 1W11U 1O2XA 1V2KT 2HWLB 4JZEH 3T2NA 4B2AA 1TNIA 1P2NA 4AG2A 3VB7A 1Y59T 3SGBE 2V3OH 1RIWC 1AVXA 2HGTH 2ZPSA 3QX5H 5JBCS 1A1RA 2VWLA 2ZDLA 1GHBF 3M5OA 1ELTA 1RIWB 1TA2A 4JK5A 2GZ9A 3I78A 1A5IA 1W3CA 3LJOA 4K1EA 1BBRH 1SQOA 5F03A 3SU3A 3TNSA 3NPSA 4ESTE 1C1SA 4DJZB 3URCA 5C1XA 4MNXA 1F0UA 2VB0A 4U2WA 3TLOA 9LPRA 1OX1A 1TX6A 3LH3A 4NFFA 1EQ9A 2SGEE 1ZMLA 1DUEA 3SNDA 3PMAB 1DY8A 1FV9A 4WJG2 3GY2A 5EQQA 2R3UA 1SMFE 1EB1H 1BJVA 2ZPQA 1J17T 1OWEA 3GY7A 4NSYA 3M7TA 3M7QA 4H6TA 1SOTA 1O0DH 1O2IA 1TOMH 2TIOA 3TH4H 3EA7A 5EU8A 5GWZA 2ZHFH 1QHRB 1JWTA 1O34A 3OY5U 4HZHA 1PPCE 2CV3A 1XXDA 3MMGA 5A09A 5EW1H 5I25A 1HXFH 1ARCA 1A5HA 1SGPE 2XBWA 2ZHDA 1L0ZA 3VGCC 2YNAA 3QGNB 3NK8A 1AE5A 3GCTF 1AU8A 3SQEE 4AB8A 4OS5A 4NZQA 3VGCB 3OX7U 2GX4A 3VB5A 2R2WU 4K5ZA 1TBRH 4ABBA 1O2JA 3LC5A 1RGQA 4F49A 1D3DB 3U98H 3UUZA 5C2ZA 4NGAH 1QJ1B 2F9NA 1NO9H 1GI0A 5PTPA 1SGDE 1TRMA 1XVMA 3L3TA 2ZECA 1V2TT 2P93A 1GJ8B 1SBWA 2SGDE 2FOGA 1SGQE
chains in the Genus database with same CATH superfamily
5HIYA 1BDAA 3HK3B 1UVPA 1O2MA 2ZFSA 2HVYB 1V2UT 1THPB 3RMNH 4BTUB 5LH8A 1GBCA 1GI8B 4RSPA 2Y5HA 1GDQA 1C1UH 2A31A 2O8LA 1KTSB 5A8ZA 1O3HA 1PPEE 4X1RU 4ZMAH 5FBEA 2G5VA 1J8AA 1DXWA 2JH5D 1DWDH 1H4WA 1NS3A 1X7AC 1ANBA 1CT4E 2ZGXH 3TJNA 1D3QB 2QF0A 2EQNA 3QK1A 4CBNA 1NESE 1A5GH 6LPRA 3T27A 2J98B 3SJKA 3MNBA 5FCKA 1AGJA 4X8SH 3MHWU 2PFEA 2C8XB 1Z7KA 1O3OA 2V3HH 3BN9A 3RXCA 1HV7A 3SUEA 2Z9GA 2O9QA 5DG6A 2BLWA 2HOBA 3NZIA 2UUKB 3BTGE 1FN8A 5E2PA 3RMOH 3M3TA 1MABB 4MTBA 1TNHA 1DDJA 1PJPA 4A1VA 3OE7D 2QYIA 4CRAA 1K0HA 3MU1A 1G3BA 2C90B 5J4SA 1O3JA 2VJ1A 4B73A 3O8RA 3SZEA 2PKSC 4TY6A 4ABEA 5B6OA 4ZHAA 2CJIA 2TBSA 4B2BA 1YPJH 3ODFA 3UR9A 1BITA 3U1JB 1TX7A 1FY1A 4I32A 2PKSB 5CDFE 1M9UA 4UFEH 4RT1A 5FXLA 3RXQA 3I29A 5FBIA 2XOKD 1QBNA 1O32A 1CVWH 3SU5A 2CXVA 1HAVA 1ANEA 5GDSH 4B6FA 1P03A 1FNIA 3SI3H 1NY22 4ISNA 1YGCH 4Z0KA 7GCHG 2WPMS 1A4WH 4A1XA 1IQFA 1MZAA 1SKYE 3EA9A 3MH7A 1SGFA 1W7XH 1YPGH 3RC6A 2ILNA 1GI1A 1SQRA 2PGQB 2BD5A 3VB4A 3PV5A 2GTBA 1EPTC 1OOKB 2ANMH 1T4VH 1BIOA 3KEEA 1CHOF 2FYQA 4BAOB 5I46H 4WMEA 4B71A 1YCPK 2O8TA 1YLDA 1NRRH 4JZIA 1BMMH 1VCPA 1EPTB 2P3FH 1CA0C 3ZZ3A 1H8DH 1THSH 3PO1C 3LIWA 1ABJH 1MKXK 1C1NA 3BTFE 5HIZA 3E0NB 2V35A 3MOCA 1Q2WA 2VVCA 3NKKA 2QAAA 1CA0B 3RXJA 2Q6FA 3PO1B 3F1SB 2EA3A 2WV5A 2FI3E 3GDSA 1G30B 4ASUD 3SV7A 1IQHA 2AMPA 4RKOB 5CHBA 3V3MA 4B74A 5JPMH 3E0PB 3WWFA 4RN6A 2GGVB 2ZZUH 4X0WU 8LPRA 1HXEH 2PV9B 1SOZA 3SN8A 1BTXA 2IN2A 3ESTA 1P01A 2CHAC 1KY9A 1P2KA 3GY6A 4AB9A 2ZU5A 4Y71A 1KXFA 2KCAA 4GCHG 2FIRH 2G52A 4A92A 1EZXC 1ABIH 1GMCF 2CHAB 3RXPA 1ZLRA 2JJ2D 4LXBH 2Q6GA 1S84A 1BOQA 2BDCA 5AF9H 3A83A 1QL8A 5F53A 1HAOH 4WF8A 2D1JA 1C2MA 2WPKS 2G8TA 2XC4A 2XNIA 3MNCA 3OY6U 1G37A 1TNGA 1LDTT 4LK4A 4I8LA 2ZFPH 1AZZA 3FVFB 1LQEA 1F0TA 3F0PA 1GL1A 1NZQH 3SYJA 1UCYE 1GHBG 2XW9A 1L4DA 4MLFB 4UEHH 1E36B 5DP3A 1KLJH 1TB6H 5EXNA 2TGPZ 3QWCH 1UK2A 3SNBA 1C4Y2 1MCTA 5AFZH 1O2YA 2ASUB 4TYDA 4ZAEA 2HNTC 1FZZA 3KL6A 3UR6A 2FTMA 3MI4A 1SGIB 3N7OA 1J16A 4ZXXH 5LGOA 5FL7D 3U1IB 2OQ5A 2F3CE 4AC9A 3KNXA 3Q3KA 4YESB 4O03A 1XKBC 2BY9X 3GY3A 4MPUA 2OC7A 3NCLA 1J15A 5F6MA 1HAGE 4O3UA 1Q31A 2ZI2H 4ISLA 3O8CA 1DPOA 1OWJA 4AORA 5A0CA 3A81A 1AO5A 1P9SA 2A32A 1UVTH 2H5CA 2ZGHA 4ZUHA 5T6FA 1YM0A 1C5WB 1YLNA 3TJVA 1GMHG 2FI4E 4ABIA 2OC1A 4NIVA 4ZHLU 1JIMA 4O9VA 1OP2A 1OS8A 2OQUA 3VB3A 2R2MB 3Q3XA 2UUFB 3V0XA 2A2XH 2QIQA 2JH6D 2XRCA 2ZHEH 5E8EH 3AAVA 1TQ7B 2FOFA 1A46H 1UVUH 2WYGA 1NRPH 4ZKNU 2F9BH 1HIAB 1QGFA 4CHAC 2GDDA 1O3IA 1TOCB 1QR3E 1P9UA 2A4QA 1KTTB 4D76A 1PQ5A 4F4OC 3IG6B 3GCTG 3A8AA 1O5CB 1NRSH 1MKXH 1Z1JA 4CHAB 1SLWB 3OEHD 4JYVH 3TPIZ 3ZZ5A 4CH8B 4IBLH 3ZVEA 1C2GA 1E37B 1G3EA 2VINA 2HNTF 3FP8E 2ZGJA 4HFPB 3P8NA 3BEUA 2ZDMA 1H9LB 4JMYA 4BAMB 1P3CA 2VIVA 1O2WA 1GBLA 3GOVB 4WMFA 2QE7D 2HLDD 3S9BA 4ZKSU 1W0YH 3UOUA 2BOHB 1TGNA 3NXPA 4X1SU 9ESTA 1C5MD 3RXVA 2BDYA 2HVXA 1B0EA 4I86A 1ZMNA 5JB9S 1C5NH 4FUCA 1Y8TA 3SGAE 2VVVA 4UFGH 4E7RG 2H2ZA 1N1LA 1HAPH 2F9PA 2D8WA 1ZPCA 2FPZA 3BTTE 3D49H 3O8DA 4YM9A 4ASHA 3STIA 2L74A 3MU4A 4DVAU 2W7SA 2KAIA 2R0KA 5BPEA 3E1XB 3ATMA 4DIHH 4LZ1H 5GXPA 1VITH 5EJ1A 3KQEA 2ZKSA 2J2UA 1BRAA 1H9HE 3RU4D 2ZTZA 4B2CA 1MAXA 1GJAB 1CGIE 3LGUA 2VWMA 2M2AA 4XOJA 5DSFA 2Y7XA 4K3JA 1P02A 1H1BA 2BDHA 2RG3A 3RM2H 3ZZ7A 2QCYA 2Y5GA 3LOXA 2L6OA 3KF2A 3SQHE 2B9LA 1QBOA 3ZZ9A 2RDLA 2BLVA 1GI6A 2SGFE 1UTMA 3QUMP 3ATKA 1IQJA 1EUFA 3RXSA 4D9QA 1P10A 1O3KA 1LHDH 1W13U 3CP7A 1XXFA 2BY5X 5GIBA 3ZYDA 1AVGH 4GAWA 1E1QD 1HCGA 1LHCH 1C1TA 4AYVB 3UNQA 2FOEA 1RJXB 1A3BH 2WUCA 1AQ7A 1MTVA 4TT3D 1ELBA 3F0OA 4CH2B 1Y5UT 3DFLA 4XD7D 1YPLH 1HFDA 1P05A 1SVPA 1CU1A 1EAUA 1GDNA 3P95A 2GKVE 1YPHC 4O97A 3T5FH 3DFJA 1JXPA 4UE7H 5C17A 1BTZA 1GBAA 1P3EA 1ZR0A 3KQCA 4X8VH 3M5MA 1SLXB 4AZ2B 4WXVA 3UTUH 1DSTA 4OGYA 2HLCA 2WPLS 1BTUA 3TGIE 2P16A 3QO6A 1C5SA 2FOHA 5A8YA 3P8GA 2Y5FA 3U9AH 1BTWA 1AFQC 7ESTE 2C8ZB 3VB6A 1HPGA 1RD3B 1GJ5H 2RFKC 1O3EA 1CHOG 1H8IH 3DCLA 2ESTE 3A7VA 2ZIQH 1ZHRA 3B8JA 4AN7A 4X6MA 3L33A 1AFQB 3UOPA 3RM0H 3H5CB 3MU0A 2K8IA 1Z1IA 1DLEA 4HGCA 3ZVGA 3SI4H 1ELAA 1SGTA 3KHVA 1O2LA 2XYAA 4XBBA 1BMFD 3S7KB 4SGBE 3RXKA 5FPYA 2WYJA 1UHBA 2J9NA 1HNEE 1O2TA 1G3CA 4DT4A 1INCA 1V2ST 1BJUA 4K60A 4Q63A 1GBEA 1O5FH 2OTVA 2GZ7A 2XC5A 2ZWLH 1KSNA 2ANYA 5A8XA 1A61H 3PLKA 3RXRA 2B8OH 1TA6A 3H7TA 1YC0A 1K9OE 2EI6A 1NRQH 1AZ8A 3SW2B 3AW0A 1YPKH 1WTHD 4CRBA 1TFXA 1P04A 3LH1A 4Q2KA 5EODA 4SGAE 1LVBA 1L4ZA 1EX3A 2QXHA 1LVMA 1AVWA 2OUAA 1XUGA 4FUHA 3T29A 5K0HA 3NRLA 2VWOA 1GMCG 1Z8IB 2BM2A 2XCNA 1PPHE 5L2ZH 3SJIA 4B6EA 1GJDB 4JYUH 1S85A 2PSXA 1AB9C 2VWNA 1K21H 1KMHB 1AWFH 1QB1A 5C5NA 4IS5A 1UO6A 1DOJA 4KTUA 1G2LA 2NWNA 1VGCC 5KEDA 3PRDA 3R3GB 1FXYA 2BD2A 2I6QA 1FQ3A 4Y11E 1AB9B 3KQBA 3SZNA 4IGDA 5GJ4B 3H7OA 1VGCB 1TMUH 3MO6A 3D62A 4AFUA 3PM3A 1LKBA 3GISB 3TH3H 5AVDA 2BHGA 1O30A 4Y79A 2BMGB 5C0TA 2QN5T 2VIWA 1HAVB 3ZVCA 1F92A 1FN6A 1N8OC 4CRCA 5IDKA 1JBUH 1QRZA 3M36A 2BXUH 1N8OB 2SGAA 5E2OA 4IMZA 3N7EA 1MCVA 2ZDAH 2SFAA 3OEED 1TPOA 1FUJA 1PFXC 4Y8YA 4UD9H 1JRSA 2FP7B 1EXFA 1GMHF 1MTWA 2EI7A 3U8TH 4HI3A 2ZQ2A 2FMJA 2BD3A 2RDEA 3E6PH 1UTQA 2AGEX 1QNJA 2ZGBH 4MPXA 3F9FA 5C3NA 1RTFB 5H4IB 3LGWA 3S0NA 4CBOA 2DUCA 1COWD 2HALA 3C27B 1QB6A 3UIRA 3SHCH 1S5SA 4AFSA 1YPEH 1TRNA 5HMAA 1AUTC 2H9EH 1AUJA 2V3MA 3EYDA 5J4QA 1CBWC 4Q4LA 2NU2E 1MUEB 3RXMA 1AD8H 3QZRA 1C1OA 2BY7X 5F8XA 3RXUA 1MTNC 1BRUP 2W6ID 2FXRA 1CBWB 1CGJE 3SOSA 1DVAH 1SI5H 1ZSLA 3M5NA 1C2FA 4O3TA 1Z8RA 1MTNB 1V6DA 1FJSA 1QA0A 5FX5A 2WHXA 3A87A 3BG8A 1P2MA 2FI5E 2QXGA 5T3HA 1O2QA 2F9VA 3TH2H 4JK6A 4X1PU 1CSOE 2UUJB 4P00A 2H9HA 1TPSA 2JJ1D 2VH0A 3SV9A 7LPRA 4UFFH 5L2YH 3S69A 1TGTA 1BTYA 1Y5AT 2P94A 2WV4A 2Y80A 4H6SB 3HGNA 5DP9A 1HAYB 1KDQA 2WPHS 3GCNA 5E0HA 4DOQA 2CK3D 3W94A 1GHAF 4GHQA 1IHTH 2IJD1 2W7UA 1PPZA 1AKSA 1MMJN 1SL3A 4TSFD 2LELA 1T7CA 4NG9H 1RTLA 4AGJA 1ZRBA 3VXFH 1K1LA 4NA8A 3UNRA 1WOFA 1MTUA 1UMAH 3PYHA 3Q3YA 2Z3EA 4Q7XA 4F48B 2FLRH 1QRXA 3EGKH 3H09A 2P59A 1EATA 1S82A 1ZGVA 3BV9B 1NBMD 3K6YA 1ETTH 3MYWA 1KXBA 1C5TA 1GMDF 5IYTA 2YOLA 2IJOB 2KCOA 3M37A 1C1WH 2BDAA 2ZDKA 2G81E 2JDID 4ZH8A 2CN0H 1HB0B 3BF6H 4ABDA 2ZC9H 4TWWA 4MNVA 3PROA 1OWKA 1ZTLA 1IQIA 2O8WA 1VITF 1IAUA 4FUFA 1SHYA 1AFEH 4B75A 1TIOA 2R0LA 2ODQA 1T4UH 3BTHE 1EFRD 1GG6C 1K22H 2ZCHP 4K8YA 1OYQA 1HJAC 1P11E 1Y3UA 5C0UA 3LJJA 4WVPE 3RMMH 1ZGIA 1ZRKA 4K1TA 3MNSA 4OS6A 1GG6B 1A0HB 3AW1A 5DO4H 1HJAB 1NU9A 4XRNA 1T8OA 1WDIA 1YYY1 2CMYA 1P2IA 3DHKH 4Z1MD 1TMTH 2FZZA 2QC2A 4MQAA 1DFPA 4QT8C 4XDEA 1MD8A 5IK2D 3RXHA 2AIPA 1PQ8A 3SJ8A 2IPQX 1QB9A 4FU7A 4DGJA 1K2I1 1O5EH 3RUOA 4K69A 2BOKA 2KZ4A 5KECA 3VG8A 1XKAC 3A89A 1L1GA 5T1VA 3E90B 1RTKA 4Y0YE 4XFQA 3P8OA 1D3PB 1P8VC 5DPAA 1DANH 1DUAA 4AX9H 1FY8E 1ESAA 3PV2A 4GLYA 2VIPA 1E35B 2Z3CA 1KIGH 1P0SH 1D9IA 1DT2A 1BTHH 3GY4A 4J2YB 5DN6D 5LPFA 4CRFA 1T8MA 1WQSA 2AGIX 4HG6A 3A8DA 2KR7A 3V12A 2FO9A 3AAUA 2GMTC 1GBDA 2VBCA 2C3SA 4NIXA 4YT6H 3FO8D 4AYYB 1P06A 2UUYA 2BVXH 3SNAA 1AMHA 2WZQA 2PUXB 2BLOA 2GMTB 1IHSH 1PPFE 2KAIB 1F7ZA 1HAHH 4H4FA 2I6SA 3ODDA 1C2DA 3EE0B 1NROH 4KTCA 3FZZA 4I7YH 3BTEE 1C5VA 3IWMA 5CHAC 1C5XB 4AGKA 2PKAA 4GPGA 4NA7A 1K1PA 3W95A 5HKKD 1YCPM 4KELA 4A6LA 1RS0A 3K6ZA 1F0SA 4AOQA 1CGHA 2Q1JA 2ZFFH 5CHAB 1Z8JB 1NM6A 2PTNA 1DS2E 1QQ4A 1DM4B 1BMAA 4FUBA 4WMDA 1QL9A 1PYTC 2ULLA 3KYGA 3PB1E 4DIIH 1D6RA 2AERH 1EASA 1OP0A 2GCHF 1UTKA 1Y3XA 4K1SA 3RDZA 5ABWA 1W0ZU 1HYLA 2XNDD 3B23B 1J14A 3FP6E 3S9CA 4UONA 1IQMA 1GBBA 3BG4C 3BEIB 2K1QA 3M3VA 4ZXYH 3AK5A 4AFZA 1TWXB 8GCHF 3P17H 1C5YB 2FOBA 1LTOA 1C2LA 3DSOA 3BG4B 1TRYA 1TPPA 1QZ8A 4Y8XA 5GPIB 4CRDA 1A0LA 2LNCA 5HYOA 1CHGA 2A7CA 2BTCE 3IITA 5LPEA 1QJ7B 1SFIA 3QLPH 2JKHA 1FDPA 2FOCA 4NIYA 1SGEE 1ZTKA 2WPJS 4IC5A 1YWUA 1O39A 3NWUA 1GVLA 3WW7A 3PTNA 4R8TB 3DSPA 3P6ZB 1UK4A 3ATIA 4ACAA 3RXFA 1G36A 1VZQH 3SORA 2BY6X 3SU1A 2XCFA 1FY3A 1C4U2 4DY7B 1DE7H 1MBMA 1ELDE 1H8ED 4P02A 2Y82A 1BBRE 3DA9B 3DSGA 4TY7A 2KM0A 5C20A 3TK5A 3QTVH 1OP8A 2HRVA 1O38A 2OBOA 3OYPA 3M5LA 5DP5A 3LGTA 2ZFTA 2J5UA 4X8UH 1W7GH 3SUFA 3A85A 1NRNH 1O2NA 3GCOA 4ABFA 1S6LA 2THFB 1ZSJA 1Y3YA 2Z9KA 1DWEH 2FDAA 1UHBB 1UTJA 4X2VA 5FPSA 2D26C 3M35A 1P12E 2BD7A 1H8HD 1PYTD 3MH6A 1LHFH 1XUHA 3V13A 4GSOA 2UWLA 2BDBA 1GI2A 1XUKA 3QDZB 1GJCB 4OS1A 3LONA 1HAZB 4K8BA 1KYNA 1V2PT 2R9PA 3BTDE 3QN7A 2BD4A 4J1YA 1LO6A 2QF4A 1K1OA 2AGGX 2TGAA 1XX9A 4U30A 2Z9IA 5E0JA 1C1QA 2XWBI 1SGFG 3MH4A 1SG8B 3M61U 1O35A 1GJ6A 2QY0B 1TALA 8KME2 3U8OH 3SNEA 2P3UB 1A7SA 3A8BA 4FVBA 4CRGA 3LKWA 3DD2H 3SV6A 3M3SA 4HTCH 1O3GA 3E91A 3L6PA 1WCZA 1HJ8A 3ZZ8A 3EA8A 2BVRH 4Q7ZA 1MBQA 5CMXH 2EI8A 1MD7A 5JBAS 2OLGA 1ZMJA 1GHAG 3P70B 1XM1A 1EAXA 4GHTA 2FOMB 1UCYK 1Q3XA 2OXSA 1JMOH 1TABE 1C5RA 2AMQA 1WU1A 3T28A 3N99A 1O3LA 2F91A 5F8ZA 4XBDA 4CREA 3VEQB 5C1YA 1QTFA 4YOIA 1W0KD 1C5QA 3ZIAD 2W26A 1TNLA 4KP0A 1LKAA 1GBHA 3I77A 2NU3E 1ZJDA 3KYFA 2EC9H 2ZCKP 1WSSH 1EZQA 4JCNA 2FEQH 3ITIA 3S9AA 4BANB 4A1TA 2ZCLP 1LQDB 1BB0B 1FI8A 2IOTA 3VFEA 1L2EA 1GMDG 3C1KA 4PROA 3PMJA 4MG3A 1DITH 3FFGA 1AHTH 4X6PA 3HATH 3RXEA 4I8KA 1SGNE 1IQEA 1EP6A 3FAOA 3VXEH 2RA0A 2AMDA 5DP7A 1UVOA 2ZF0H 1VITG 3A7YA 2WPIS 1UVSH 2BB4A 3SU2A 1NC6A 2HPPH 2R3YA 1MKWK 2OD3B 5EOKA 2F43B 5A0BA 5JB8S 2PLXA 1EJMA 1O31A 3QZQA 3MFJA 2G4UA 1O3BA 1O5AB 1YBWA 3LT3A 4TPYA 4BTIB 2XTTB 1BTPA 3TU7H 1EZUC 4E06H 2QV1A 1C5UA 4UDWH 3RXGA 2A0QB 3TNTA 1GBMA 1AN1E 2B7DH 4ZCNA 1ZYOA 3GY8A 5ESTE 2IPHA 2FTLE 3SBKA 1WUNH 3BTQE 3U8RH 3GY5A 5L30H 1O5GH 1IQNA 2PHBA 1L1JA 1O2HA 1TGCA 2Z6BD 1EOJA 1ANCA 2ODYB 4BOHA 1C9TA 1C9PA 4I33A 1ELFA 2VIQA 3SGQE 3PWCA 1FPHH 1AWHB 3OFND 4X6OA 1CE5A 3SNCA 2ZO3H 2G51A 1GWAA 2Z9LA 2ZP0H 2VNTA 3OTJE 3Q00A 1IOEA 1KDQB 1W10U 3PTBA 1B7XB 4YOJA 2BXTH 2QF5A 1K1JA 1LCYA 2ALVA 1AKSB 1W12U 1MU8B 2FM2A 1GJ4H 3PWBA 3B9FH 3EE7A 2V6NA 1GBKA 3SO3A 2YMSC 3ZVAA 1CQQA 1GHZA 1NN6A 4UFDH 4JZDH 3SU4A 1SB1H 4FXGH 1V2WT 1LVOA 3HGPA 5DKMA 1K1NA 2YMSB 2ZFQH 1YF4A 1P57B 2BDIA 2G4TA 2PP6A 2PW8H 4YLQH 4Q80A 5JDUB 1BZXE 1C2EA 4ABGA 4E05H 2F83A 3A7XA 2GCTC 3U69H 1NPMA 5BRRE 5T6GA 1QIXB 1SGCA 4ZHMU 2ZA5A 1FAKH 4IN2A 4OS4A 5C5OA 2GCTB 1YKTA 1K28D 1YPHE 4K2YA 5G4BA 3RU4T 1O2OA 2OP9A 4ACBA 3W1EA 1HBTH 3F2HA 1UCYH 1MH0A 5JBBS 3E16B 3SU6A 1QFKH 1E79D 2ZTXA 1SGYE 5LPRA 4E7NA 1GJBB 2ZEBA 2ANWA 2FLBH 3ZZ6A 2GCHG 2W5EA 1HUTH 2J94A 1U6QA 1O3CA 5HGGA 2PSYA 2H6MA 4RKJB 5DJ7A 1AE8H 1ID5H 2PR3A 1JOUB 2BYAX 1C5PA 1DICA 3GDVA 3LPRA 6CHAC 8GCHG 1O3PB 1G32B 1P2QA 2FYRA 3RMLH 5C1UA 1HRTH 1KXCA 3E3TA 4OS2A 1HGTH 1OWIA 1Z71A 2VU8E 4Q7YA 8ESTE 1ZHPA 2C93B 2A4GA 1C5OH 2Z9JA 6CHAB 1D3TB 2G55A 4Y7AA 1D4PB 1SHHB 1GBFA 2VGCC 3DUXH 2ANKH 5TJXA 4MVNA 5EQSA 3MU8A 1PPGE 2WUBA 4BAHB 1D6WA 4INLA 2VGCB 1WQVH 1NTPA 2A7HA 1MQ5A 1GHYH 2OBQA 1KLIH 4XBCA 3TVJB 3UQVA 1C5ZB 4XSKU 5EXMA 1MKWH 2O8MA 3CNRA 2A4RA 5L6NH 5DK1A 2YMSD 1O37A 1OHHD 1C2IA 4NCYA 1ESTA 2WV9A 1GVZA 1B0FA 1T8LA 1OKXA 2V0BA 1TAWA 2W3KA 1C4V2 3P8FA 4H42U 5C67A 2TGDA 3ZZ4A 4Y8ZA 1O2KA 2C8YB 1GL0E 2K0QA 2XXLA 1RFNA 1FLEE 2AEIH 2AHME 2W3IA 5E0GA 1IQKA 3A7WA 3EDXB 3SU0A 1ZSKA 1BCUH 1Z6EA 1W0JD 1GHXH 4INKA 4IN1A 1LHEH 3RLYH 3ELAH 3MNXA 5FPTA 1T31A 2UWPA 1C2JA 1LPGB 2OK5A 2PKAB 1YY3A 3SHAH 3GS9A 1EJNA 1HDTH 1O2UA 1DLKB 3ZVBA 2V7QD 3F68H 2KCPA 1ACBE 2F4LA 1P2OA 3KQ5A 4BXWA 4GUXA 1EKBB 1MQ6A 3TITA 2KCYA 1GHVH 1UW7A 1SLUB 2P3TB 2XWAA 2SGPE 2ZPRA 4MPWA 1CT2E 4DCDA 1O3FA 1OYTH 1O3NA 1O2SA 1ORFA 2ZU2A 3CS7A 3SJOA 1ELEE 3F3BA 1VJ9U 3FOAA 2QXJA 1C1RA 3ZYEA 3N7DA 2A5AA 1GBIA 1XUJA 4I31A 4FU9A 2JH0D 1P09A 4MDSA 1OWHA 4ZKOU 3U28C 4YLUA 1GI9B 3QTOH 5DP8A 4A5TS 1G2MA 3JZ1B 5JYIA 1ZOMA 3MWIU 1NBME 2BD8A 1LPKB 1O3DA 4X6NA 1AIXH 2ODPA 1O5BB 2J97A 2OCVB 4Y76A 2VH6A 7KMEH 2M5TA 3A88A 3OU0A 4YXWD 2DE9A 1V2OT 4NWKA 5AFYH 4VGCC 3PMHB 3D23A 5EJZA 3A82A 1QURH 5EXLA 2GJGA 3A8CA 4IMQA 3BEFB 3UWJH 2PWXA 1F5KU 2YNBA 3TK6A 4JYTA 4U01A 1LVYA 4VGCB 1S83A 3LGYA 1QBVH 3ZZBA 3EQ0H 4YT7H 1BHXB 4MNYA 3ZZDA 4X1NU 1F2SE 1GHWH 2ZHQH 2GZ8A 3VPKA 4Y0ZE 1MZDA 4LZ4B 2ZG0H 2OC0A 1V2JT 3CENA 3KCGH 4ABJA 2AFQB 1C1MA 5ETXA 1JIRA 5EIYA 3TGKE 1L1NA 3RP2A 3MH5A 5HM9A 1GI7B 1V2RT 1VKYA 3KN2A 1WBGB 3T62A 2FS8A 1TPAE 1DX5M 2CF9H 1GJ7B 5EG4A 3G01A 2PTCE 1FY4A 4X2WA 2AS9A 3HKJB 5GCHG 3R0FA 3UY9A 2XBXA 1ZPZA 1E34B 1FONA 4WY3A 5TCCA 3TIUA 4FUDA 5EW2H 1DY9A 1GBJA 4OS7A 2GT7A 4B1TA 1TE0A 4JZ1A 2J38A 3GDUA 2AIQA 1V2LT 4X8TH 3ZVDA 2BX4A 4OGXA 1W14U 2GP9B 3QGJA 4CR9A 1GCTC 4NA9H 1O3AA 2B5TB 3NUMA 4YZUA 4NSVA 1S6HA 1T32A 4X1QU 2GD4B 1EJAA 1GCTB 3Q76A 4ZKRU 1KXDA 1BHXF 3BTME 3JZ2B 4TPIZ 1EZSC 3BTKE 3BTWE 3MO3A 5AHGH 1G9IE 2SNWA 5EQRA 3UNSA 1V2VT 1C2KA 1FAXA 3F9HA 3AVZA 3F6UH 1YLCA 2BVSH 1EP5A 1TBQH 1QQUA 1CO7E 4M7GA 4NZLA 1THRH 1EAIA 1C1VH 2PGBB 3MQKC 1SPJA 1Z6JH 3ZZCA 5A0AE 1QRWA 1S0QA 3S7HB 2JIZD 3UFAA 3F9EA 2A2QH 1FMGA 4CR5A 1PQ7A 1O33A 1GI5A 5GNDA 1TX8A 4ISOA 1ARBA 2JETC 4YTAA 2FWWA 2J34A 5F8TA 5K7RA 1NU7B 2ZTYA 2JETB 3A7ZA 3FN8A 3FANA 3MU5A 1NFYA 4YO9A 2AYWA 2QGRA 2BX3A 1OWDA 1ELCA 2XBYA 5FHTA 6GCHG 3ZZAA 3UAIC 2QXIA 1JRTA 1FIZA 1UK3A 3UQOA 1ETRH 1XUIA 2ZQ1A 1LPZB 2KX4A 3ATLA 1UTOA 1GJ9B 1O2GH 1VJAU 1NT1A 1TLDA 4XE4A 1Y3WA 5EGMA 1BRCE 1VCQA 4I8JA 4MNWA 2ZU4A 2XC0A 2EEKA 3PV4A 1SGRE 3PMBB 3T26A 2WPDD 3F2GA 1UTPA 3A7TA 1TNJA 2H1UA 3GICB 1VR1H 1FIWA 1E0FD 1K1IA 2TPIZ 2FODA 2Q6DA 1Z8GA 5CE1A 1O2RA 2TRMA 5FAHA 1C1PA 2ALPA 3GYMA 4YOGA 1V2QT 1GI4A 1G3DA 2RA3A 2Y7ZA 2A7JA 2BZAA 3F9GA 3RLWH 1GCDA 4B76A 3ZVFA 4D7FA 1ZTJA 3UPEA 3KQDA 1RRKA 1V2MT 2J98A 1ZPBA 2C8WB 2G5NA 4FUJA 4DURA 1B5GH 2BQWB 3PLPA 1HJ9A 1HLTH 3D65E 1Y5BT 1SFQB 2FOAA 3K2UA 3UB0A 2STAE 1WYKA 3BIVH 5SGAE 2J92A 1BUIA 1QL7A 3HKIB 1LHGH 1A2CH 3O8BA 3RXOA 3RXAA 3GCHC 4D7GA 1EB2A 1TYNA 3DT0H 1GBTA 1ELGA 1PPBH 1OPHB 2BQ6B 1Y3VA 2A5IA 2Z3DA 4BTTB 4DT7B 2VVUA 1SC8U 2GT8A 4Y10E 1DWCH 2XBVA 4RT0A 4Z6AH 5JBTA 4D8NA 2H5DA 3GCHB 4BAQB 3LU9B 1CT0E 1QY6A 5TCAA 1ELVA 3RC4A 3SV2H 2SNVA 4KTSA 2QA9E 5DP4A 5EJLA 3WY8A 3BIUH 1HAXB 1F5RA 4I8HA 2QF3A 2GV7A 2RCEA 2FX4A 4D9RA 1FY5A 1YCPH 4ISHH 1VCWA 1DWBH 2VIDA 2Z94A 1P2JA 1NFWA 1EAWA 2GDEH 1GDUA 2HNTE 2F9UA 4AG1A 1BMNH 1ETSH 2LPRA 3ZV8A 2WSSD 1SSXA 4WH8A 3K65B 4IC6A 5FCRA 4BXSA 3SJ9A 2CF8H 2DE8A 1NFXA 3OAAD 4WWYA 1O2ZA 3HPTB 2BY8X 1AY6H 1TONA 2ZDNA 2CGAA 2G00A 2P8OC 2PUQH 4NIWA 4ABHA 1EPTA 3LC3A 2WINI 1UJ1A 3RU4E 3FP7E 3TK9A 2BDGA 3A80A 2ZU3A 1A0JA 1QJ6B 2FX6A 3STJA 2P8OB 1NFUA 1W8BH 6ESTA 3ATWA 1MAYA 1O36A 2LP6A 1J9CH 2STBE 3LDXH 1IQGA 1KXEA 2NU0E 1OSSA 1GPZA 1ESBA 1UTNA 2BZ6H 3A86A 1ZJKA 4Y6DA 3ENSB 1CA8B 3EAJA 5KGOA 1S6FA 4Y7BA 3ZV9A 1S0RA 1ZZZA 3KGPA 1A3EH 1O3MA 1O2VA 1MU6B 3RXLA 1QA7A 1OXGA 5DGJA 1EOLA 2ZFRH 5DP6A 5T6DA 1YPMH 3SV8A 1GGDC 1BBRK 1F5LA 2J4IA 3WWBA 2J95A 2H9TH 1WV7H 1KXAA 2FS9A 4MPVA 1GGDB 4I8GA 1S81A 4THNH 5EPYA 2F9OA 1O2PA 1BQYA 5HXFA 4FUEA 5GCHF 2P95A 3F2FA 3TGJE 1F0RA 2OC8A 2A45B 1GVKB 3UREA 5ESBA 2ZHWH 3BSQA 3GYLB 1O5DH 2OINA 2D2DA 4FETA 3TJUA 1TBZH 1TGSZ 2NU4E 2BQ7B 4WXIA 3FZDA 4DG4A 2GV6A 1WXRA 5FX6A 1TNKA 4DW2U 2NU1E 1N6XA 4KGAA 5B6LA 4BAKB 3LGVA 4R0IA 1WTGH 5HM2A 1KLTA 3K9XB 4X2YA 1PQAA 2AH4X 1C2HA 2W6JD 4FVDA 3RXBA 2UWOA 5C94A 1RXPA 1SLVB 7GCHF 3OSYA 1FPCH 3P92A 4NWLA 1BRBE 1AI8H 1IQLA 3E8LA 1V3XA 4IW4E 1T8NA 1WAYB 2Y6TA 4INHA 4U32A 1DXPA 2SGQE 3URDA 2Z7FE 4F55A 1ZHMA 1MTSA 3A84A 3RC5A 4BNRA 3HK6B 4GVUA 4A7IB 4JZFH 4ISIH 2ZDVH 3RXTA 4TWYA 1DSUA 1GI3A 2A1DB 3AASA 2KFWA 1TGBA 1QCPA 1XMNB 3LGIA 3RXDA 4KKDA 2C4FH 2GVFA 1SR5C 2A4OA 3MO9A 4LOYH 3UWIA 4X2XA 1LMWB 1TQ0B 1H9IE 1XVOA 2TGTA 1TMBH 2EY4C 2ZU1A 3T25A 2VIOA 1W2KH 4NFEA 2FESH 4WH6A 1YP9A 2A5KA 2BLQA 6GCHF 1SQTA 3V7TA 3SUDA 4FU8A 1V2NT 1FX0B 3PLBA 2Y81A 1BA8B 1ANDA 1E38B 1HIAA 2ZGCA 4FUGA 1K1MA 1HAIH 3TJOA 5EPNA 2HPQH 4GCHF 3SUGA 3KIDU 4ABAA 3MTYA 1UTLM 2ZNKH 1C5LH 3M7UA 4ZROA 3RXIA 1BT7A 1XUFA 5A2MH 3CS0A 1SQAA 4M9FA 3OTPA 1BMLA 4FUIA 3Q77A 4AFQA 1N6YA 2B0FA 2BD9A 2O8UA 1W11U 1O2XA 1V2KT 2HWLB 4JZEH 3T2NA 4B2AA 1TNIA 1P2NA 4AG2A 3VB7A 1Y59T 3SGBE 2V3OH 1RIWC 1AVXA 2HGTH 2ZPSA 3QX5H 5JBCS 1A1RA 2VWLA 2ZDLA 1GHBF 3M5OA 1ELTA 1E1RD 4RI0A 1RIWB 1TA2A 4JK5A 2GZ9A 3I78A 1A5IA 3PRBA 1W3CA 3LJOA 4K1EA 1BBRH 1SQOA 5F03A 3SU3A 3TNSA 3NPSA 4ESTE 1C1SA 4DJZB 3URCA 5C1XA 4MNXA 1F0UA 2VB0A 4U2WA 3TLOA 9LPRA 1OX1A 1TX6A 3LH3A 4NFFA 1EQ9A 2SGEE 1ZMLA 1DUEA 3SNDA 3PMAB 1DY8A 1FV9A 4WJG2 3GY2A 5EQQA 2R3UA 1SMFE 1EB1H 1BJVA 2ZPQA 1J17T 1OWEA 3GY7A 4NSYA 3M7TA 3M7QA 4H6TA 1SOTA 1O0DH 1O2IA 1TOMH 2TIOA 3TH4H 3EA7A 5EU8A 5GWZA 2ZHFH 1QHRB 1JWTA 1O34A 3OY5U 4HZHA 1PPCE 2CV3A 1XXDA 3MMGA 5A09A 5EW1H 4OM9A 5I25A 1HXFH 1ARCA 1A5HA 1SGPE 2XBWA 2ZHDA 1L0ZA 3VGCC 2YNAA 3QGNB 3NK8A 1AE5A 3GCTF 3FKSD 1AU8A 3SQEE 4AB8A 4OS5A 4NZQA 3VGCB 3OX7U 2GX4A 3VB5A 2R2WU 4K5ZA 1TBRH 4ABBA 1O2JA 3LC5A 1RGQA 4F49A 1D3DB 3U98H 3UUZA 5C2ZA 4NGAH 1QJ1B 2F9NA 1NO9H 1GI0A 5PTPA 1SGDE 1TRMA 1XVMA 3L3TA 2ZECA 1V2TT 2P93A 1GJ8B 1SBWA 4FOUC 2SGDE 2FOGA 1SGQE
chains in the Genus database with same CATH topology
1BDAA 3HK3B 1UVPA 1O2MA 2ZFSA 1V2UT 1THPB 3RMNH 4BTUB 5LH8A 1GBCA 1GI8B 4RSPA 2Y5HA 1GDQA 1C1UH 2A31A 2O8LA 1KTSB 5A8ZA 1O3HA 1PPEE 4X1RU 4ZMAH 5FBEA 2G5VA 1J8AA 1DXWA 2JH5D 1DWDH 1H4WA 1NS3A 1X7AC 1ANBA 1CT4E 2ZGXH 3TJNA 1D3QB 2QF0A 3QK1A 4CBNA 1NESE 1A5GH 6LPRA 3T27A 3SJKA 3MNBA 5FCKA 1AGJA 4X8SH 3MHWU 2PFEA 2C8XB 1Z7KA 1O3OA 2V3HH 3BN9A 3RXCA 1HV7A 3SUEA 2Z9GA 2O9QA 5DG6A 2BLWA 2HOBA 3NZIA 2UUKB 3BTGE 1FN8A 5E2PA 3RMOH 3M3TA 4MTBA 1TNHA 1DDJA 1PJPA 4A1VA 2QYIA 4CRAA 3MU1A 1G3BA 2C90B 5J4SA 1O3JA 2VJ1A 4B73A 3O8RA 2PKSC 4TY6A 4ABEA 5B6OA 4ZHAA 2CJIA 2TBSA 4B2BA 1YPJH 3ODFA 3UR9A 1BITA 3U1JB 1TX7A 1FY1A 4I32A 2PKSB 1M9UA 4UFEH 5FXLA 3RXQA 3I29A 5FBIA 1QBNA 1O32A 1CVWH 3SU5A 2CXVA 1HAVA 1ANEA 5GDSH 1P03A 1FNIA 3SI3H 1NY22 4ISNA 1YGCH 4Z0KA 7GCHG 2WPMS 1A4WH 4A1XA 1IQFA 1MZAA 3EA9A 3MH7A 1SGFA 1W7XH 1YPGH 3RC6A 2ILNA 1GI1A 2PGQB 3VB4A 2BD5A 2GTBA 1EPTC 1OOKB 2ANMH 1T4VH 1BIOA 3KEEA 1CHOF 2FYQA 4BAOB 5I46H 4WMEA 4B71A 1YCPK 2O8TA 1YLDA 1NRRH 4JZIA 1BMMH 1VCPA 1EPTB 2P3FH 1CA0C 3ZZ3A 1H8DH 1THSH 3PO1C 3LIWA 1ABJH 1MKXK 1C1NA 3BTFE 3E0NB 2V35A 3MOCA 1Q2WA 2VVCA 3NKKA 2QAAA 1CA0B 3RXJA 2Q6FA 3PO1B 3F1SB 2EA3A 2WV5A 2FI3E 3GDSA 1G30B 3SV7A 1IQHA 2AMPA 4RKOB 4B74A 3V3MA 5JPMH 3E0PB 4RN6A 2GGVB 2ZZUH 4X0WU 8LPRA 1HXEH 2PV9B 1SOZA 3SN8A 1BTXA 2IN2A 3ESTA 1P01A 2CHAC 1KY9A 1P2KA 3GY6A 4AB9A 2ZU5A 4Y71A 1KXFA 4GCHG 2FIRH 2G52A 4A92A 1EZXC 1ABIH 1GMCF 2CHAB 3RXPA 1ZLRA 4LXBH 2Q6GA 1S84A 1BOQA 2BDCA 5AF9H 3A83A 1QL8A 1HAOH 4WF8A 2D1JA 1C2MA 2WPKS 2G8TA 2XC4A 2XNIA 3MNCA 3OY6U 1G37A 1TNGA 1LDTT 4LK4A 4I8LA 2ZFPH 1AZZA 3FVFB 1LQEA 1F0TA 1GL1A 1NZQH 1UCYE 1GHBG 2XW9A 1L4DA 4MLFB 4UEHH 1E36B 5DP3A 1KLJH 1TB6H 5EXNA 2TGPZ 3QWCH 1UK2A 3SNBA 1C4Y2 1MCTA 5AFZH 1O2YA 2ASUB 4TYDA 4ZAEA 2HNTC 1FZZA 3KL6A 3UR6A 2FTMA 3MI4A 1SGIB 3N7OA 1J16A 4ZXXH 5LGOA 3U1IB 2OQ5A 2F3CE 3KNXA 3Q3KA 4YESB 4O03A 1XKBC 2BY9X 3GY3A 4MPUA 2OC7A 3NCLA 1J15A 5F6MA 1HAGE 4O3UA 1Q31A 2ZI2H 4ISLA 3O8CA 1DPOA 1OWJA 4AORA 5A0CA 3A81A 1AO5A 1P9SA 2A32A 1UVTH 2H5CA 2ZGHA 4ZUHA 5T6FA 1YM0A 1C5WB 3TJVA 1GMHG 2FI4E 4ABIA 2OC1A 4NIVA 4ZHLU 1JIMA 4O9VA 1OP2A 1OS8A 2OQUA 3VB3A 2R2MB 3Q3XA 2UUFB 3V0XA 2A2XH 2QIQA 2JH6D 2XRCA 2ZHEH 5E8EH 3AAVA 1TQ7B 2FOFA 1A46H 1UVUH 2WYGA 1NRPH 4ZKNU 2F9BH 1HIAB 1QGFA 4CHAC 2GDDA 1O3IA 1TOCB 1QR3E 1P9UA 2A4QA 1KTTB 4D76A 1PQ5A 4F4OC 3IG6B 3GCTG 3A8AA 1O5CB 1NRSH 1MKXH 1Z1JA 4CHAB 1SLWB 4JYVH 3TPIZ 3ZZ5A 4CH8B 4IBLH 3ZVEA 1C2GA 1E37B 1G3EA 2VINA 2HNTF 3FP8E 2ZGJA 4HFPB 3P8NA 3BEUA 2ZDMA 1H9LB 4JMYA 4BAMB 1P3CA 2VIVA 1O2WA 1GBLA 3GOVB 4WMFA 3S9BA 4ZKSU 1W0YH 3UOUA 2BOHB 1TGNA 3NXPA 4X1SU 9ESTA 1C5MD 3RXVA 2BDYA 2HVXA 1B0EA 1ZMNA 5JB9S 1C5NH 4FUCA 1Y8TA 3SGAE 2VVVA 4UFGH 4E7RG 2H2ZA 1N1LA 1HAPH 2F9PA 2D8WA 1ZPCA 2FPZA 3BTTE 3D49H 3O8DA 4YM9A 4ASHA 3STIA 3MU4A 4DVAU 2W7SA 2KAIA 2R0KA 5BPEA 3E1XB 3ATMA 4DIHH 4LZ1H 5GXPA 1VITH 3KQEA 2ZKSA 2J2UA 1BRAA 1H9HE 3RU4D 2ZTZA 4B2CA 1MAXA 1GJAB 1CGIE 3LGUA 2VWMA 4XOJA 2Y7XA 4K3JA 1P02A 1H1BA 2BDHA 2RG3A 3RM2H 3ZZ7A 2QCYA 2Y5GA 3LOXA 3SQHE 3KF2A 2B9LA 1QBOA 3ZZ9A 2RDLA 2BLVA 1GI6A 2SGFE 1UTMA 3QUMP 3ATKA 1IQJA 1EUFA 3RXSA 4D9QA 1P10A 1O3KA 1LHDH 1W13U 3CP7A 1XXFA 2BY5X 5GIBA 3ZYDA 1AVGH 4GAWA 1HCGA 1LHCH 1C1TA 4AYVB 3UNQA 2FOEA 1RJXB 1A3BH 2WUCA 1AQ7A 1MTVA 1ELBA 4CH2B 1Y5UT 3DFLA 1YPLH 1HFDA 1P05A 1SVPA 1CU1A 1EAUA 1GDNA 3P95A 2GKVE 1YPHC 4O97A 3T5FH 3DFJA 1JXPA 4UE7H 1BTZA 1GBAA 1P3EA 1ZR0A 3KQCA 4X8VH 3M5MA 1SLXB 4AZ2B 4WXVA 3UTUH 1DSTA 4OGYA 2HLCA 2WPLS 1BTUA 3TGIE 2P16A 3QO6A 1C5SA 2FOHA 5A8YA 3P8GA 2Y5FA 3U9AH 1BTWA 1AFQC 7ESTE 2C8ZB 3VB6A 1HPGA 1RD3B 1GJ5H 1O3EA 1CHOG 1H8IH 2ESTE 3A7VA 2ZIQH 1ZHRA 3B8JA 4AN7A 4X6MA 3L33A 1AFQB 3UOPA 3RM0H 3H5CB 3MU0A 1Z1IA 1DLEA 4HGCA 3ZVGA 3SI4H 1ELAA 1SGTA 3KHVA 1O2LA 2XYAA 4XBBA 3S7KB 4SGBE 3RXKA 5FPYA 2WYJA 1UHBA 2J9NA 1HNEE 1O2TA 1G3CA 1INCA 1V2ST 1BJUA 4K60A 1GBEA 1O5FH 2OTVA 2GZ7A 2XC5A 2ZWLH 1KSNA 2ANYA 5A8XA 1A61H 3PLKA 3RXRA 2B8OH 1TA6A 3H7TA 1YC0A 1K9OE 2EI6A 1NRQH 1AZ8A 3SW2B 3AW0A 1YPKH 1WTHD 4CRBA 1TFXA 1P04A 3LH1A 4Q2KA 5EODA 4SGAE 1LVBA 1L4ZA 1EX3A 2QXHA 1LVMA 1AVWA 2OUAA 1XUGA 4FUHA 3T29A 5K0HA 2VWOA 1GMCG 1Z8IB 2BM2A 2XCNA 1PPHE 5L2ZH 3SJIA 1GJDB 4JYUH 1S85A 2PSXA 1AB9C 2VWNA 1K21H 5C5NA 1AWFH 1QB1A 4IS5A 1UO6A 1DOJA 4KTUA 1G2LA 2NWNA 1VGCC 3R3GB 1FXYA 2BD2A 2I6QA 1FQ3A 4Y11E 1AB9B 3KQBA 3SZNA 4IGDA 5GJ4B 3H7OA 1VGCB 1TMUH 3MO6A 3D62A 4AFUA 3PM3A 1LKBA 3GISB 3TH3H 5AVDA 2BHGA 1O30A 4Y79A 2BMGB 2QN5T 2VIWA 1HAVB 3ZVCA 1F92A 1FN6A 1N8OC 4CRCA 5IDKA 1JBUH 1QRZA 3M36A 2BXUH 1N8OB 2SGAA 5E2OA 4IMZA 1MCVA 2ZDAH 2SFAA 1TPOA 1FUJA 1PFXC 4Y8YA 4UD9H 1JRSA 2FP7B 1EXFA 1GMHF 1MTWA 2EI7A 3U8TH 4HI3A 2ZQ2A 2FMJA 2BD3A 3E6PH 1UTQA 2AGEX 1QNJA 2ZGBH 4MPXA 3F9FA 5C3NA 1RTFB 5H4IB 3LGWA 3S0NA 4CBOA 2DUCA 2HALA 3C27B 1QB6A 3UIRA 3SHCH 1S5SA 4AFSA 1YPEH 1TRNA 5HMAA 1AUTC 2H9EH 1AUJA 5J4QA 3EYDA 1CBWC 2NU2E 1MUEB 3RXMA 1AD8H 3QZRA 1C1OA 2BY7X 5F8XA 3RXUA 1MTNC 1BRUP 2FXRA 1CBWB 1CGJE 3SOSA 1DVAH 1SI5H 1ZSLA 3M5NA 1C2FA 4O3TA 1Z8RA 1MTNB 1V6DA 1FJSA 1QA0A 5FX5A 3A87A 3BG8A 1P2MA 2FI5E 2QXGA 5T3HA 1O2QA 2F9VA 3TH2H 4JK6A 4X1PU 1CSOE 2UUJB 2H9HA 1TPSA 2VH0A 3SV9A 7LPRA 4UFFH 5L2YH 3S69A 1TGTA 1BTYA 1Y5AT 2P94A 2WV4A 2Y80A 4H6SB 3HGNA 5DP9A 1HAYB 1KDQA 2WPHS 3GCNA 5E0HA 4DOQA 3W94A 1GHAF 4GHQA 1IHTH 2W7UA 1PPZA 1AKSA 1MMJN 1SL3A 1T7CA 4NG9H 1RTLA 4AGJA 1ZRBA 3VXFH 1K1LA 4NA8A 3UNRA 1WOFA 1MTUA 1UMAH 3PYHA 3Q3YA 2Z3EA 4Q7XA 2FLRH 1QRXA 3EGKH 2P59A 1EATA 1S82A 1ZGVA 3BV9B 3K6YA 1ETTH 3MYWA 1KXBA 1C5TA 1GMDF 5IYTA 2YOLA 2IJOB 3M37A 1C1WH 2BDAA 2ZDKA 2G81E 4ZH8A 2CN0H 1HB0B 3BF6H 4ABDA 2ZC9H 4TWWA 4MNVA 3PROA 1OWKA 1ZTLA 1IQIA 2O8WA 1VITF 1IAUA 4FUFA 1SHYA 1AFEH 4B75A 1TIOA 2R0LA 2ODQA 1T4UH 3BTHE 1GG6C 1K22H 2ZCHP 4K8YA 1OYQA 1HJAC 1P11E 1Y3UA 3LJJA 4WVPE 3RMMH 1ZGIA 1ZRKA 4K1TA 3MNSA 4OS6A 1GG6B 1A0HB 3AW1A 5DO4H 1HJAB 1NU9A 1T8OA 1YYY1 2CMYA 1P2IA 3DHKH 1TMTH 2FZZA 2QC2A 4MQAA 1DFPA 4QT8C 4XDEA 1MD8A 3RXHA 2AIPA 1PQ8A 3SJ8A 1QB9A 4FU7A 4DGJA 1K2I1 1O5EH 3RUOA 4K69A 2BOKA 1XKAC 3A89A 1L1GA 3E90B 1RTKA 4Y0YE 4XFQA 3P8OA 1D3PB 1P8VC 5DPAA 1DANH 1DUAA 4AX9H 1FY8E 1ESAA 4GLYA 2VIPA 1E35B 2Z3CA 1KIGH 1P0SH 1D9IA 1DT2A 1BTHH 3GY4A 4J2YB 5LPFA 4CRFA 1T8MA 1WQSA 2AGIX 3A8DA 3V12A 2FO9A 3AAUA 2GMTC 1GBDA 2C3SA 4NIXA 4YT6H 4AYYB 1P06A 2UUYA 2BVXH 3SNAA 1AMHA 2PUXB 2BLOA 2GMTB 1IHSH 1PPFE 2KAIB 1F7ZA 1HAHH 4H4FA 2I6SA 3ODDA 1C2DA 3EE0B 1NROH 4KTCA 3FZZA 4I7YH 3BTEE 1C5VA 3IWMA 5CHAC 1C5XB 4AGKA 2PKAA 4GPGA 4NA7A 1K1PA 3W95A 1YCPM 4KELA 4A6LA 1RS0A 3K6ZA 1F0SA 4AOQA 1CGHA 2Q1JA 2ZFFH 5CHAB 1Z8JB 1NM6A 2PTNA 1DS2E 1QQ4A 1DM4B 1BMAA 4FUBA 4WMDA 1QL9A 1PYTC 2ULLA 3PB1E 4DIIH 1D6RA 2AERH 1EASA 1OP0A 2GCHF 1UTKA 1Y3XA 4K1SA 3RDZA 5ABWA 1W0ZU 1HYLA 3B23B 1J14A 3FP6E 3S9CA 4UONA 1IQMA 1GBBA 3BG4C 3BEIB 2K1QA 3M3VA 4ZXYH 4AFZA 1TWXB 8GCHF 3P17H 1C5YB 2FOBA 1LTOA 1C2LA 3BG4B 1TRYA 1TPPA 4Y8XA 5GPIB 4CRDA 1A0LA 2LNCA 5HYOA 1CHGA 2A7CA 2BTCE 3IITA 5LPEA 1QJ7B 1SFIA 3QLPH 2JKHA 1FDPA 2FOCA 4NIYA 1SGEE 1ZTKA 2WPJS 4IC5A 1O39A 3NWUA 1GVLA 3PTNA 4R8TB 3P6ZB 1UK4A 3ATIA 3RXFA 1G36A 1VZQH 3SORA 2BY6X 3SU1A 2XCFA 1FY3A 1C4U2 4DY7B 1DE7H 1MBMA 1ELDE 2Y82A 1BBRE 3DA9B 4TY7A 5C20A 3TK5A 3QTVH 1OP8A 2HRVA 1O38A 2OBOA 3OYPA 3M5LA 5DP5A 3LGTA 2ZFTA 4X8UH 1W7GH 3SUFA 3A85A 1NRNH 1O2NA 3GCOA 4ABFA 2THFB 1ZSJA 1Y3YA 2Z9KA 1DWEH 2FDAA 1UHBB 1UTJA 4X2VA 5FPSA 2D26C 3M35A 1P12E 2BD7A 1PYTD 3MH6A 1LHFH 1XUHA 3V13A 4GSOA 2UWLA 2BDBA 1GI2A 1XUKA 3QDZB 1GJCB 4OS1A 3LONA 1HAZB 4K8BA 1KYNA 1V2PT 2R9PA 3BTDE 3QN7A 2BD4A 4J1YA 1LO6A 1K1OA 2AGGX 2TGAA 1XX9A 4U30A 2Z9IA 5E0JA 1C1QA 2XWBI 1SGFG 3MH4A 1SG8B 3M61U 1O35A 1GJ6A 2QY0B 1TALA 8KME2 3U8OH 3SNEA 2P3UB 1A7SA 3A8BA 4FVBA 4CRGA 3LKWA 3DD2H 3SV6A 3M3SA 4HTCH 1O3GA 3E91A 3L6PA 1WCZA 1HJ8A 3ZZ8A 3EA8A 2BVRH 4Q7ZA 1MBQA 5CMXH 2EI8A 1MD7A 5JBAS 2OLGA 1ZMJA 1GHAG 3P70B 1XM1A 1EAXA 4GHTA 2FOMB 1UCYK 1Q3XA 2OXSA 1JMOH 1TABE