1QB1A

Bovine trypsin with 1-[2-[5-[amino(imino)methyl]-2-hydroxyphenoxy]-6-[3-(4,5-dihydro-1-methyl-1h-imidazol-2-yl)phenoxy]pyridin-4-yl]piperidine-3-carboxylic acid (zk-806974)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (TRYPSIN)
publication title Crystallographic analysis of potent and selective factor Xa inhibitors complexed to bovine trypsin.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qb1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qb1A02
2BD9A 2GKVE 5EQQA 4RKOB 1UTJA 3ZZ7A 3RMNH 1A0LA 2Q6FA 1QA0A 1IHTH 2BD8A 1Z1IA 4IN2A 3BG4B 1GI8B 2YNBA 2V6NA 1GI2A 2VWLA 1HIAB 4TPIZ 3O8RA 4I31A 2GT8A 5HYOA 1O5GH 4X2WA 6GCHG 1QB1A 3K6ZA 2C8XB 5EXNA 3M3SA 1VR1H 5C1YA 1MTUA 1UVPA 1TYNA 1J15A 2WYJA 3LH3A 4YOJA 1RD3B 2PLXA 1A4WH 5DO4H 1THPB 4WF8A 4DOQA 1E35B 2K1QA 1NFWA 2BMGB 1BZXE 1BBRH 1UTLM 1AWFH 1C1NA 4GCHG 5FPYA 4WXVA 1YM0A 1PYTD 1Y3XA 3F6UH 2G55A 2QV1A 2P93A 1GBJA 3BTHE 1HPGA 4WMDA 3V13A 3BIVH 2XNIA 3EA7A 4ZKRU 1LCYA 5DP6A 3AW0A 1NU9A 1E36B 1P0SH 3BTEE 3TVJB 1TRMA 2BDHA 3BG4C 2VIOA 3DFJA 4OS4A 1B0FA 4BNRA 1N8OB 4A1XA 3W94A 1XUJA 4O03A 3RLWH 4B74A 1V2OT 5AF9H 2GZ9A 4KTUA 1QL8A 3RU4D 4GPGA 1NFUA 4DIHH 7LPRA 2ZHFH 1TABE 4ZHMU 1OWKA 2A5KA 1Q31A 2ILNA 3KQDA 1QRXA 1INCA 1OOKB 1RTKA 1TB6H 1UCYH 4FUJA 1YKTA 3ZVEA 3BG8A 1ABJH 3RXCA 5DP9A 2H9HA 3ZZCA 1HAOH 2VH6A 3M7QA 5DP7A 4F49A 2FP7B 3ITIA 1DT2A 1C1TA 1G32B 4UONA 1NN6A 3ZZDA 1SGFG 3D62A 1O36A 1O32A 2VINA 3RXAA 2ZTYA 4FUHA 4X8UH 1P11E 1O3IA 1TMBH 3RM2H 1YBWA 1HAHH 1N8OC 4HTCH 2C8YB 2F9UA 3GICB 1LPZB 4DT7B 2A4RA 1O37A 4AFQA 3GY4A 3MFJA 4B75A 3GCNA 1C5XB 4NG9H 4U2WA 2B8OH 1IOEA 1SR5C 2O8UA 4TY7A 1EJAA 1C2IA 1C5ZB 1GBKA 1L1JA 1ID5H 4ZHLU 5LPEA 1C5QA 3DFLA 1PPFE 2ZCKP 3TGIE 5JDUB 3EGKH 4OS1A 3KEEA 5H4IB 1C9PA 2TPIZ 1P06A 1FV9A 2ZDMA 1FY8E 2BM2A 2A7CA 1K1IA 1CHGA 1EPTB 1H9LB 2ZECA 4K1SA 1KDQB 1V2LT 3DA9B 1DWDH 1FXYA 2BLQA 1XUGA 1ZHRA 2AERH 3LGTA 1QIXB 2OBOA 1GBLA 1G36A 1P04A 3O8DA 4K2YA 4NWLA 1BTHH 3VXFH 2PKAB 7ESTE 5EGMA 4AGKA 3STJA 1LO6A 2GDEH 1HIAA 5EXMA 3M5MA 3GOVB 2ZDLA 2JH5D 1OPHB 1UTNA 3QUMP 8ESTE 1S84A 1GMCF 4MQAA 1DLKB 3HGNA 4F4OC 4H6TA 2BXUH 3MH7A 1NS3A 2PFEA 1DE7H 3U9AH 2H6MA 1EB2A 3UY9A 2ASUB 1SGPE 2OP9A 1JMOH 4AB9A 2FPZA 2BD3A 4X2YA 2WPHS 1EPTC 5FCRA 2JETB 1OWEA 3F9EA 1BTPA 2QF3A 2ODQA 3SNEA 5FCKA 1LDTT 2A2QH 3T62A 2WPMS 1DITH 2WINI 1O3GA 1C5VA 4ISIH 4Y8YA 1TNLA 1P12E 1T8OA 4NIWA 2P3TB 2GZ8A 4ZMAH 4JZ1A 2BZ6H 4ASHA 1W0ZU 3GY7A 4B2AA 1BBRE 3SU2A 3S7HB 2BD4A 4MNYA 1DVAH 2SGDE 1BITA 1O3JA 2A4OA 2VIDA 4KELA 4DCDA 1A1RA 2ZGBH 4ZUHA 2ZIQH 1O3OA 3R0FA 5JBTA 1KLIH 1SFIA 1D3PB 1LKAA 3SUEA 7GCHF 1BHXF 2W7SA 1S82A 3OY5U 1J8AA 2JETC 1VZQH 2VIWA 1P2QA 2QYIA 4O3TA 2AMDA 2V3OH 2XC0A 5A09A 3F1SB 1L1GA 4NZLA 4ISNA 5E0JA 4DW2U 1L0ZA 1XUKA 4ABGA 4BANB 1QRZA 1TE0A 2RA3A 2PTCE 2FS9A 2PWXA 4NA7A 5FPTA 1HRTH 3MWIU 1C9TA 2XW9A 1QNJA 2IPHA 3ODFA 6CHAB 2Y82A 3FP6E 4WY3A 1GJ9B 1BTZA 2FOHA 4I8HA 1UCYE 4Q7XA 3D23A 1SOZA 1C5NH 1CE5A 1ZMNA 4I8KA 2CV3A 1EASA 1RGQA 2FOCA 1C5WB 1CA8B 1GHBG 1FNIA 3G01A 3SU0A 1HDTH 2ZQ1A 1V2JT 4FVBA 1C1SA 2P8OB 3PTNA 1BTXA 2BD5A 3EA9A 3SGQE 1C1WH 2FOAA 1Z1JA 1QB6A 3SV8A 3RXHA 1O5EH 1BTWA 2FLBH 3FVFB 5DP5A 1J16A 1FONA 2WV4A 4X8SH 4H4FA 2ZZUH 4AB8A 1EPTA 1A3BH 4MDSA 3LIWA 3E1XB 3WY8A 1GI6A 3TH4H 3SU6A 2ZTZA 2PGBB 4D76A 1L1NA 2GDDA 6CHAC 1DANH 1ZR0A 4Q7ZA 3HK6B 1ZYOA 2Y7ZA 1LPKB 4ZH8A 2TGPZ 1B5GH 2PKAA 3TK9A 4CRGA 2C8ZB 5DP3A 4RSPA 1OP8A 2TGDA 1O3CA 3PYHA 2BY9X 3VGCB 4FUIA 1HAIH 1Y5AT 1YPHC 1GHYH 2FOGA 1QFKH 1UTPA 1DICA 1IQKA 1ELBA 4NIVA 2UWPA 1NRNH 1MBQA 1Q2WA 1XUIA 3Q3XA 1XKAC 5EPNA 4X6MA 4AX9H 2NU0E 4DJZB 3QZQA 4O97A 4Y79A 5FPSA 1RRKA 3VB7A 4AOQA 4AGJA 1EAXA 4K1EA 1T8LA 2FZZA 1NT1A 3RMLH 3BEIB 5FHTA 3SORA 1SL3A 5L2YH 3EDXB 4MPVA 4OS7A 4BAQB 1TGNA 1RXPA 1DOJA 1AB9B 1GJ4H 2STAE 2ZCHP 2M5TA 3O8BA 2GGVB 1SVPA 3QX5H 2Q6DA 2ZEBA 1A5GH 3SNDA 3AASA 2W7UA 4ABJA 2ZFSA 1UK4A 1GBHA 3T25A 2ZGCA 3D49H 1SC8U 3VGCC 4LXBH 3M7TA 1KXAA 5BPEA 1O2XA 3H7OA 5T6GA 4GAWA 2BB4A 5J4SA 1GJ5H 3MU8A 3SUFA 1BCUH 1MMJN 4Y8ZA 3CS0A 2CJIA 1GL0E 1O35A 1DSTA 5CMXH 2F9NA 3SZNA 3PMBB 3SHAH 1K1JA 4ISLA 1AE5A 1Y5BT 3UWJH 3LGVA 1QURH 1E38B 4VGCC 5EPYA 4NSVA 2Z9IA 4MPWA 1ANBA 1ABIH 3SNCA 2A7HA 4UE7H 2TGTA 1YCPH 2IOTA 3P8FA 2ZWLH 4JYTA 4BTTB 1AB9C 1HAXB 2O8LA 3NUMA 5BRRE 4CRFA 1LQEA 4DIIH 3C27B 3KQBA 4B73A 1CHOG 3KNXA 1KSNA 1C2MA 1AD8H 4QT8C 4AORA 2ZFTA 1ARCA 1ZSLA 1P2OA 1O2KA 4IGDA 1O5CB 4BAOB 1WUNH 4UFEH 1EZXC 4X6PA 4XDEA 3A80A 1O34A 4K8YA 1LHFH 2FWWA 3RXBA 1ARBA 1K1LA 3RMMH 1W2KH 1WTHD 2J9NA 3SU4A 1THSH 2OQUA 3KCGH 4B2BA 1V6DA 2BOKA 3I29A 3RXSA 2SGEE 4WMEA 2BYAX 1K1OA 4FUEA 1GMDF 1TNIA 1HLTH 2ZHWH 1A61H 1H8IH 3BTDE 3P95A 5F8TA 1AWHB 4CH8B 2A2XH 1XUHA 2SNWA 4ISOA 1Y3UA 1KXFA 3T5FH 2WPIS 1EZSC 1XKBC 5E2PA 1BRBE 4JMYA 4MNWA 2QXJA 3SU3A 4Z0KA 2ANYA 2GX4A 2BD7A 3P70B 1V2UT 1O2TA 2ZP0H 4Y7BA 3A87A 1YF4A 1G9IE 1NRSH 4X6OA 3EQ0H 4NGAH 1O3DA 4WWYA 4OGYA 2CMYA 3K2UA 1L4ZA 1O3KA 3KIDU 4Y76A 1C5LH 1GI3A 1D6WA 4KP0A 3GCTG 1DDJA 3GY5A 4GLYA 4D8NA 4MNXA 1GJAB 2FLRH 3LU9B 4SGAE 1KLJH 1T8NA 1GJ7B 1EUFA 4CRBA 2XC4A 3QTOH 5GJ4B 3PO1B 5F8ZA 3EA8A 3KQCA 3UPEA 1SHYA 3LKWA 3JZ1B 4INKA 1ACBE 4INLA 2NU4E 1DUAA 3NZIA 1CGJE 1G3EA 1GMHF 3O8CA 2QAAA 3V12A 3QK1A 1OYTH 4XOJA 1SGIB 3UNRA 3A86A 2AGGX 3MTYA 3RXIA 1D3DB 1CVWH 1LVOA 3FAOA 3BTFE 1SGNE 1CT0E 5AFYH 3SUGA 1GBCA 2C93B 2A5AA 1QGFA 3A88A 1TA6A 4B76A 3PWCA 2RCEA 1UCYK 1A5IA 2Y7XA 3ENSB 1S81A 3LPRA 4ABIA 3ZZBA 3SUDA 3AW1A 3HATH 1C1UH 1A0HB 1IHSH 1P01A 1Z8RA 3ATIA 4X2XA 1RFNA 3ZZ5A 3PO1C 3PMAB 4CRCA 2EI6A 1EAIA 3R3GB 1W14U 2XXLA 2EEKA 5HGGA 2GP9B 1BMLA 1C5RA 1PPZA 1Z71A 1IQLA 1TOMH 1F2SE 1O3PB 3FP8E 1QTFA 5C3NA 5EQRA 1ZSJA 1C2JA 1SI5H 1T4VH 2GCHF 1O38A 1AKSB 2BVRH 2F83A 3A8CA 1YPJH 4GUXA 1HB0B 2H2ZA 3MH4A 3Q76A 1PPCE 1VITF 3UQOA 3A82A 3S9BA 4NCYA 1YLDA 2HNTE 1ETSH 3A7YA 1TQ0B 3SHCH 1C1VH 1P03A 4JZDH 4Y6DA 1GBFA 2CF9H 2XBXA 1RS0A 1LTOA 3T27A 1SB1H 1QR3E 2AEIH 2DUCA 3OSYA 4FUDA 3ATKA 3KN2A 2Z9JA 4X1NU 4ZHAA 4CRAA 2ZGXH 4Z6AH 2GV7A 2ZKSA 1QHRB 4JZEH 1KYNA 2SFAA 4UEHH 5EOKA 3UQVA 1V2KT 4AFZA 3PTBA 5C67A 1MZDA 2EI7A 1PPHE 1LHDH 1S0RA 3GY8A 3TH2H 3DD2H 1O2NA 2PW8H 4Y0YE 3PM3A 1Q3XA 2BLVA 1JIMA 1MTNB 1SPJA 3LJOA 3MYWA 4I8LA 3A7TA 1GPZA 1QJ7B 1QL7A 1Y3WA 4MPUA 4A5TS 1GVZA 5DP4A 4E06H 4K60A 3T29A 1MKWK 1O0DH 1TGSZ 1QRWA 4Y0ZE 1GBEA 1O2UA 4U30A 1UVOA 1TPOA 3VEQB 2BXTH 3I78A 4FUGA 4CRDA 2HOBA 3S69A 1P57B 2XYAA 1GMCG 1ZJKA 3MU5A 3K65B 3VB3A 2Z9KA 2XCFA 1TIOA 1AN1E 1XVOA 2HNTC 3A89A 2DE9A 3E8LA 1GDUA 1MTNC 1VITH 3QGNB 1FMGA 3TJOA 3BSQA 1D3QB 4A1VA 1H8DH 3BTQE 2BDBA 1V2QT 2PKSB 5HMAA 3NPSA 4X8TH 2XC5A 4FUFA 2FOEA 2J92A 1NRQH 1A7SA 1H9IE 2VIQA 3KHVA 1V3XA 1T7CA 3ODDA 1O2OA 1TPAE 5F8XA 1QY6A 1TRNA 1ELGA 3GYMA 1C1RA 3M5OA 4LZ1H 5HXFA 1SHHB 3P6ZB 1Y5UT 1FN6A 1CGHA 1GHVH 2P95A 4ZXXH 3MMGA 4Y7AA 4AFUA 2BDGA 1NRRH 1QJ1B 3AAUA 5JBCS 1AU8A 1A3EH 2FXRA 4MPXA 1C1OA 3SJOA 4J1YA 3UNQA 5JB9S 1MBMA 2PGQB 2ZF0H 3OU0A 3ZVBA 1PQ5A 7GCHG 2G5NA 1V2RT 1N6XA 4NFFA 2PKSC 1SSXA 5A0BA 9LPRA 3UWIA 1K28D 1ZGVA 4BTIB 4B2CA 5E0HA 1MTSA 1ZSKA 3BV9B 3T28A 1AKSA 1ELDE 2R0LA 1C1MA 5FX5A 1SQTA 3JZ2B 1MKWH 1ZMJA 2UUJB 3ATLA 4ZKNU 4GSOA 1FDPA 3RXVA 3U1JB 1W10U 4TPYA 2QC2A 1Y3VA 5I25A 1C5TA 3M3VA 4XFQA 3M5LA 1TPSA 1LVYA 5EODA 1MD8A 3P8GA 1LPGB 3SV6A 1TRYA 1SGTA 1O2HA 3ZVDA 2BZAA 3Q00A 2VWNA 2OXSA 1TNJA 1QA7A 2ODPA 2ALVA 2VNTA 3L6PA 3ZZ9A 2SGAA 1XMNB 1VJAU 1IQIA 1GJBB 5C2ZA 3U69H 3SGAE 4CR5A 3FFGA 2A5IA 8GCHF 2BY8X 1YPKH 3AAVA 4XE4A 1ESTA 1Z8IB 3LJJA 2WPLS 3E0NB 1HUTH 1GVKB 1FY1A 2ANWA 2FYQA 1C2DA 1C5UA 1O5AB 4FU7A 4INHA 2R3UA 3RXEA 2B5TB 4DVAU 5T3HA 1GGDC 2A0QB 3RXRA 1UHBB 2ANMH 2V35A 1XX9A 5HM9A 5GCHF 1N6YA 3BTTE 1AVWA 1TGTA 1O2SA 3ZZAA 3B23B 2RA0A 1C5MD 1GBIA 3GDVA 4ABAA 1S0QA 1LVMA 1ELFA 2NWNA 3RMOH 1ELCA 3B9FH 4B1TA 2BDAA 3NCLA 3QN7A 2B9LA 4TYDA 3P8NA 4A7IB 3UOUA 1BRCE 1TX8A 1YPMH 1D3TB 2FESH 5JBBS 1YPHE 2OC7A 1EAWA 2OQ5A 1DXPA 1O5DH 4AYVB 2WV5A 5GIBA 4D9RA 4MG3A 1ZMLA 4HFPB 1YCPM 1L2EA 3GY3A 1HGTH 3V0XA 1ELVA 1OP2A 2BLOA 3A7WA 1F92A 3IG6B 1QB9A 3QZRA 1GI5A 4M7GA 3TK6A 1O5BB 1V2MT 2FDAA 1P09A 1P3EA 1TX6A 2O8MA 1HAPH 4BAMB 3ZZ4A 1EZUC 2ZPRA 1BDAA 1C5OH 2XBYA 4HGCA 3PLBA 1NPMA 1TNGA 3AVZA 3Q3YA 5DJ7A 1YYY1 1NFYA 1SOTA 3ATMA 1QBNA 1S6FA 1ZZZA 1TQ7B 2AFQB 2TGAA 1CU1A 4I7YH 1AZZA 1KDQA 2HLCA 5LPFA 2BX4A 1NROH 1ZRBA 1UTQA 1YCPK 1MKXH 1S83A 1LHGH 1FJSA 1O3MA 1QBVH 1GHZA 1HJAC 3TPIZ 3H5CB 1EP5A 2VIVA 1O3FA 2HPQH 2ESTE 2PTNA 2HALA 2Z3DA 1FIZA 2BVXH 4IN1A 1CO7E 3OTJE 5T6FA 1O3NA 1J14A 3BTWE 2HNTF 1J9CH 2ALPA 2ZTXA 2ZDVH 2HVXA 2G4TA 3FP7E 1GWAA 3SV9A 3S9AA 2BQWB 3P8OA 1Z8GA 4ABHA 1FIWA 3BN9A 2YNAA 3VXEH 5FBEA 2H5CA 2KAIB 4XBCA 3E0PB 1AUTC 3K6YA 1FI8A 1ELAA 1ELEE 3RP2A 1O2LA 2TRMA 5E0GA 1WQVH 2WYGA 4VGCB 2CHAB 4IS5A 3SNBA 1VCQA 1OWDA 3M35A 1YPLH 2PHBA 3PV4A 1ZTLA 3A8AA 3MO6A 1K2I1 3TGKE 1O39A 1JRTA 1Z7KA 2ZQ2A 1A2CH 4CREA 1BB0B 1D9IA 1HBTH 4ISHH 1FPHH 3MU0A 1Z6JH 1O2GH 1FAKH 4Y71A 4AN7A 2ZFQH 3UNSA 3M36A 1K1PA 3A85A 3P92A 2RDLA 1KXCA 3LDXH 3DUXH 1GMDG 2Z6BD 3BEFB 3STIA 1SLVB 1WQSA 1HV7A 1XXDA 3B8JA 5DGJA 1UHBA 3MNCA 1MCVA 1A0JA 1O3EA 3SBKA 5DK1A 2BY6X 4YO9A 4XSKU 1TX7A 3MU1A 2BHGA 1ZOMA 2Z9GA 4JZFH 3T26A 1SGDE 3TJUA 1IAUA 2CHAC 1ESBA 2BQ6B 1GG6B 1WOFA 2F9PA 5GWZA 5TCAA 1BTUA 4D9QA 2DE8A 1NM6A 3RXJA 2D1JA 1T32A 1W0YH 4A92A 2F9BH 2G52A 5K0HA 1GJ6A 2FI4E 2WUBA 1EJMA 4YOGA 5C5OA 2G81E 1C2LA 1J17T 4K8BA 1AGJA 2G8TA 2G00A 3T2NA 1DS2E 2NU2E 1PQ8A 2SNVA 5E8EH 1IQEA 2FTMA 1IQJA 3SW2B 6LPRA 3DT0H 5GPIB 2J34A 4CH2B 1O2YA 1GBTA 4NWKA 1GJCB 1OKXA 2QXIA 4HZHA 4IMQA 1KXBA 2FIRH 1ZTJA 2W26A 2A32A 1GMHG 3KL6A 4ESTE 1O2VA 5AFZH 4I8JA 1DXWA 1GG6C 3TIUA 4KTCA 4O3UA 3PB1E 3TITA 2JKHA 2BQ7B 2AGEX 3SV7A 4WH8A 1G3CA 5F6MA 4X1PU 2ULLA 4LZ4B 2PSXA 1GJDB 1MD7A 2FX6A 2J4IA 2Z9LA 1ESAA 3ZYDA 3A8BA 1BT7A 4RKJB 1BRAA 3E6PH 1JBUH 3LGUA 2ZHDA 1YPEH 1QBOA 1VGCB 2A1DB 2GCTB 2OC0A 2P59A 1C4V2 1E0FD 1GCTB 2GT7A 3C1KA 1O3AA 1F0UA 3LGWA 1E37B 1F5KU 2ZGJA 1FY5A 2QIQA 5DKMA 1FN8A 1VCPA 2W5EA 1LQDB 2Z94A 3UR9A 1V2ST 2GCHG 2A45B 4GHQA 5GXPA 4YT6H 2OTVA 4IBLH 3UFAA 3A84A 3MH5A 2KAIA 3F9GA 1KTSB 2VH0A 4ABFA 1O2QA 1VITG 2D26C 3OY6U 1PYTC 4ZAEA 2BD2A 4BTUB 1ZPZA 1X7AC 4CBNA 1WCZA 3VB4A 3KQEA 5C20A 1EKBB 2J95A 2P94A 2H5DA 1G37A 1VGCC 3TJNA 2GCTC 3QO6A 1UVSH 3HPTB 4HI3A 1ETRH 1WTGH 3SQEE 3ZV8A 1GCTC 2Y80A 2ZHEH 3A7VA 1SGYE 4Y11E 4AG2A 1UTKA 2ZDAH 1RTFB 3PROA 1P02A 1SLWB 1LMWB 1HJ8A 3ESTA 2W3IA 3K9XB 1IQFA 3ZZ6A 2ZG0H 1UVUH 2F9VA 1S5SA 2RG3A 5A8YA 2C4FH 2YOLA 2IJOB 2Y5FA 1H1BA 1AY6H 1N1LA 4NFEA 3VB6A 2ANKH 3TGJE 4CR9A 3OX7U 3VPKA 1QL9A 4CBOA 3U1IB 4UFGH 3RXLA 5C5NA 1MAYA 1AIXH 1CQQA 3PLKA 4K69A 2AH4X 4H42U 1JOUB 3RC6A 5A8XA 1AHTH 3S0NA 4WMFA 4BOHA 1O5FH 1GHAF 1P3CA 4J2YB 4DG4A 2ZGHA 2D8WA 2BY7X 2ZFRH 2P3UB 4BXSA 3ATWA 2ZA5A 5T6DA 3GDUA 2ZCLP 3V7TA 2QGRA 1IQNA 2Z3CA 2CXVA 1C2KA 1K9OE 3BTGE 1P9UA 1AQ7A 3GDSA 1T8MA 1P05A 1NESE 5FXLA 1O2IA 1HAGE 1HAZB 2C8WB 1ETTH 1MQ6A 1SGCA 3NWUA 2PR3A 1W11U 4TWYA 3ELAH 2Z7FE 1MU6B 3GCTF 2ZDKA 3F9FA 2A4GA 2H9TH 4MVNA 1AFQB 1AE8H 3BEUA 3GCHB 1ZGIA 5A0AE 2QA9E 2QXGA 2V0BA 1BOQA 1ELTA 1BTYA 3LOXA 1TBZH 2G51A 1NY22 2FI3E 2FMJA 1HAYB 4ZXYH 2SGPE 5AVDA 3UR6A 3SGBE 1F7ZA 3Q3KA 2PUQH 2UWOA 1DLEA 2BOHB 1EATA 2BTCE 4D7GA 5DP8A 2XCNA 3RDZA 1BMAA 1SGEE 3SJIA 3UOPA 3VB5A 4FVDA 1DWEH 3QTVH 1F0SA 1TOCB 2ZNKH 3PWBA 2GVFA 5EQSA 4WVPE 1T31A 4ABDA 4BXWA 2Q1JA 1TBRH 1NFXA 3SU1A 1FQ3A 4ZKSU 1SMFE 5GDSH 1TBQH 1TAWA 2XRCA 1GBBA 1H4WA 2NU3E 4JK5A 5C1UA 3M37A 1GI4A 3ZVCA 1C5SA 2XBVA 1AFQC 4NSYA 2GZ7A 2W3KA 4MLFB 3GCHC 3GY6A 4PROA 2P16A 1C1QA 1DY9A 1MUEB 1OYQA 1SGFA 1BUIA 4MNVA 3QLPH 1IQHA 5FX6A 2Y6TA 1GI0A 3LGIA 2UUYA 1YC0A 1AI8H 5EW1H 1HCGA 2R3YA 2VIPA 3GYLB 3M7UA 2FEQH 1RJXB 1PQ7A 1F5LA 1O2JA 4A1TA 1ZJDA 4ZKOU 4U01A 3BF6H 2OINA 4E7NA 1DFPA 3LH1A 2WPJS 2VVVA 1DWBH 2GTBA 4I8GA 3SJ8A 4DY7B 1Z6EA 6GCHF 3RXPA 3M5NA 1W3CA 1FAXA 1IQGA 3F9HA 4U32A 2G5VA 8GCHG 1SGRE 4OGXA 5I46H 1W8BH 5ETXA 1HJ9A 1V2NT 2FX4A 1F5RA 2AYWA 1P2IA 1W12U 1O2PA 1HAVB 1MZAA 1OS8A 2ZO3H 4GCHF 1B7XB 4WJG2 4Y8XA 2GV6A 2BLWA 2GD4B 2ZI2H 5G4BA 2AIQA 4X2VA 1UMAH 8LPRA 5GCHG 1SLUB 1K1NA 1GI7B 1O2ZA 1GDQA 1MU8B 1V2TT 3L33A 1DX5M 4JK6A 2VJ1A 2ZFFH 4UFDH 2AIPA 1K21H 2J2UA 1MAXA 1GBAA 2JH0D 2BDIA 2THFB 3UIRA 1SQOA 2XBWA 2C3SA 3MI4A 5LGOA 3MH6A 2UUFB 4IC5A 2PSYA 4IC6A 1DWCH 3SO3A 1S6HA 2ZU4A 1P2KA 2VVUA 3H7TA 1C1PA 3FZZA 3M3TA 3RLYH 5EXLA 4NA8A 1GGDB 1TA2A 4XBDA 2VB0A 3IWMA 4Q80A 1WAYB 1NU7B 4TWWA 3BIUH 3BTME 3U98H 1Z8JB 2HPPH 3GISB 5EG4A 3E16B 5J4QA 3ZVGA 1UK3A 4B71A 3BTKE 2J94A 3MNSA 2FM2A 4BAHB 4UFFH 3MNBA 1TGBA 3RUOA 3SU5A 2HGTH 2G4UA 1LHEH 1CA0B 1MQ5A 4MTBA 1PPBH 4YLQH 4SGBE 1W7XH 4ZROA 3FZDA 1P8VC 1MKXK 5HM2A 1P2NA 3M61U 1YLCA 5L6NH 1T4UH 5A0CA 2A31A 3TU7H 1F0TA 4UDWH 3SI3H 1O2RA 2R0KA 1OWJA 3SN8A 2TIOA 4Q2KA 3RXGA 4YESB 2ZU1A 3SJ9A 3SOSA 1GL1A 2AMQA 1C4U2 1GI1A 1SG8B 1L4DA 5ESTE 1G3DA 1GHXH 1UJ1A 4X6NA 1SQAA 3SJKA 1NC6A 3RXKA 3URDA 3EYDA 1C2GA 1PQAA 1BMNH 1CBWB 1K1MA 1O3HA 1TMUH 2FODA 3HKJB 3A83A 3SQHE 5B6OA 2UUKB 5LPRA 1AVGH 3UTUH 1TALA 1E34B 5JB8S 1HFDA 1XM1A 1PFXC 2XTTB 4E7RG 1ZLRA 2ZU3A 1KIGH 5C1XA 1SFQB 2O8WA 2OBQA 1H9HE 1CA0C 1TFXA 3ZZ3A 2ODYB 1SBWA 2IN2A 2ZU2A 3TLOA 1UO6A 4FU9A 4FXGH 4I33A 3MO9A 2P3FH 3F68H 1EJNA 1B0EA 3RM0H 3ZYEA 1HJAB 1Y8TA 3QWCH 2F3CE 1NO9H 2CN0H 1OX1A 4K5ZA 2D2DA 1W7GH 4NZQA 2AGIX 1O2WA 3ZZ8A 2H9EH 3KF2A 3RXUA 2HRVA 4WXIA 2EI8A 1AMHA 1CBWC 2ZPSA 1RIWB 1HXEH 4YM9A 3RC4A 1TNHA 1O3BA 1TMTH 1MTVA 2A7JA 3U8RH 2I6SA 4RN6A 4GVUA 3A7ZA 1C5PA 1GBDA 1HAVA 1ZHPA 4YTAA 1HNEE 1KY9A 1G2MA 1YGCH 1VJ9U 2ZPQA 3GY2A 4H6SB 5L2ZH 4JZIA 2VWOA 2R9PA 1GBMA 1PPEE 2SGFE 4A6LA 1AZ8A 3CENA 2BDCA 1LHCH 4X0WU 1RTLA 2FS8A 2C90B 1O31A 3GCOA 1M9UA 1GI9B 1THRH 4CHAB 2FOBA 6ESTA 4I32A 5SGAE 1AO5A 4LK4A 1C2HA 1EQ9A 4BAKB 5FBIA 3RXDA 1OWHA 1RIWC 1AFEH 3URCA 4YT7H 3P17H 3PMJA 4OS2A 1VCWA 4XBBA 1GVLA 1FY3A 1U6QA 2NU1E 1FPCH 1MCTA 1V2WT 2AMPA 1EB1H 4FU8A 4OS5A 1NZQH 2UWLA 3RXQA 1JWTA 5IDKA 1LVBA 1V2PT 3RXFA 4K3JA 2P8OC 2Y5HA 3A8DA 1CT2E 3LT3A 1DUEA 5TJXA 1BIOA 1EOLA 2EA3A 2QCYA 3SV2H 1JXPA 4AZ2B 1ZPBA 3V3MA 2ZDNA 4X1QU 1OXGA 4YOIA 3TH3H 1UTMA 2OCVB 4JYUH 4CHAC 1IQMA 3LGYA 1UK2A 2STBE 1OWIA 4X1RU 2V3HH 1WU1A 1SLXB 1YP9A 1EOJA 2FO9A 1CSOE 1CT4E 2BVSH 1WBGB 3PMHB 1GHBF 1ANDA 3I77A 3MHWU 4YLUA 1WSSH 3RXOA 4JCNA 3SI4H 4THNH 1ZRKA 1A5HA 4O9VA 2QY0B 5DG6A 1QJ6B 5JBAS 1D6RA 2ZFPH 1KXEA 3E90B 3A7XA 1QQ4A 1AVXA 5LH8A 1ZPCA 2AS9A 1DSUA 3LONA 3S9CA 1G3BA 1Y3YA 2WUCA 1QCPA 1HXFH 2BDYA 1KTTB 3EE0B 1QQUA 4GHTA 2FYRA 5A2MH 5ESBA 3E3TA 1TLDA 1C4Y2 1EXFA 1GCDA 2QF0A 1BRUP 5E2OA 3VFEA 5K7RA 3PLPA 4TY6A 7KMEH 5DPAA 2BY5X 2FOMB 2QN5T 5PTPA 1K22H 2B0FA 2O9QA 1FUJA 2FOFA 2PV9B 4X8VH 4X1SU 1JRSA 3RC5A 3TK5A 4ABBA 3LC5A 2VGCB 4R0IA 1PJPA 1W13U 3ZVAA 3NXPA 3TNSA 1ANCA 4AYYB 3Q77A 1GJ8B 5IYTA 2F91A 2JH6D 1CGIE 3LC3A 3QGJA 4KGAA 4KKDA 4OS6A 3W95A 1D4PB 2Y5GA 1UVTH 3S7KB 1MH0A 4NIYA 1O3LA 3NKKA 1O30A 1P2JA 3HKIB 2OUAA 1EZQA 2B7DH 5F03A 1JIRA 1BJVA 3EAJA 1ZTKA 4DGJA 1BJUA 4AG1A 2BX3A 3ZVFA 3RU4E 2TBSA 3U8OH 3D65E 9ESTA 1ZHMA 2EC9H 5EU8A 1XVMA 3IITA 4WH6A 8KME2 1DPOA 4FUBA 4IW4E 1HYLA 1P2MA 5JPMH 2WPKS 3CP7A 2VGCC 3A81A 1O33A 1A46H 2F9OA 2LNCA 2QXHA 1GHAG 3MU4A 1ORFA 2XWAA 1FLEE 1F0RA 1O2MA 1C5YB 2Z3EA 3ZV9A 1P9SA 4Y10E 1BA8B 1C2EA 1MTWA 1KLTA 1NRPH 3CS7A 3L3TA 1S85A 3OYPA 2GMTB 3MOCA 1ANEA 5A8ZA 2HWLB 3RU4T 5EW2H 2ZHQH 1WYKA 4K1TA 4D7FA 1Y59T 1FZZA 3MNXA 1BMMH 3RXMA 5ABWA 4IMZA 3DHKH 2FTLE 1AUJA 2OC8A 3U8TH 1BBRK 4AFSA 2O8TA 3FANA 5CHAB 1CHOF 3RXTA 4YZUA 1C2FA 1XUFA 3E91A 3UUZA 1OP0A 1GHWH 5JYIA 1EAUA 2A4QA 2CGAA 5CE1A 3TNTA 3TJVA 1PPGE 2VU8E 2CF8H 4NIXA 1P10A 4ABEA 5FAHA 3HK3B 2OLGA 1EP6A 3QDZB 2OD3B 2XWBI 1TONA 2H1UA 2GMTC 3SNAA 2SGQE 4NA9H 1UTOA 2PUXB 1FY4A 1BHXB 1G30B 2LPRA 2J38A 4E05H 4DURA 1XXFA 1DY8A 3MO3A 2FI5E 2VVCA 3KGPA 3N7OA 4UD9H 1TPPA 4KTSA 3UREA 1V2VT 1DM4B 2VWMA 4Q7YA 1SGQE 1YPGH 3HGPA 5CHAC 2OC1A 1WV7H 2I6QA 3NK8A 5AHGH 5L30H 1TWXB 1LKBA 2ZU5A 4JYVH 1G2LA 1NTPA 1KXDA 4LOYH 4R8TB 1TNKA 1TGCA 4FUCA 1GDNA 2R2WU 5TCCA 1BQYA 2Y81A 2R2MB 2ZC9H 1OSSA 1EX3A 2Q6GA
chains in the Genus database with same CATH superfamily
2BD9A 2GKVE 5EQQA 4RKOB 1UTJA 3ZZ7A 3RMNH 1A0LA 2Q6FA 1QA0A 1IHTH 2BD8A 1Z1IA 4IN2A 3BG4B 1GI8B 2YNBA 2V6NA 1GI2A 2VWLA 1HIAB 4TPIZ 3O8RA 4I31A 2GT8A 5HYOA 1O5GH 1E1RD 4X2WA 6GCHG 1QB1A 3K6ZA 2C8XB 5EXNA 3M3SA 1VR1H 5C1YA 1MTUA 1UVPA 1TYNA 1J15A 2WYJA 3LH3A 4YOJA 1RD3B 2PLXA 1A4WH 5DO4H 1THPB 4WF8A 4DOQA 1E35B 2K1QA 1NFWA 2BMGB 1BZXE 1BBRH 1UTLM 1AWFH 1C1NA 4GCHG 5FPYA 4WXVA 1YM0A 1PYTD 1Y3XA 3F6UH 2G55A 2QV1A 2P93A 1GBJA 3BTHE 1HPGA 4WMDA 3V13A 3BIVH 2XNIA 3EA7A 3CNRA 4ZKRU 1LCYA 5DP6A 3AW0A 2JIZD 1NU9A 1E36B 1P0SH 3BTEE 3TVJB 1TRMA 2BDHA 3BG4C 2VIOA 3DFJA 5DSFA 4OS4A 1B0FA 4BNRA 1N8OB 4A1XA 3W94A 1XUJA 4O03A 3RLWH 4B74A 1V2OT 5AF9H 2GZ9A 4KTUA 1QL8A 3PRDA 3RU4D 4GPGA 1NFUA 4DIHH 4TT3D 7LPRA 2ZHFH 1TABE 4ZHMU 1OWKA 2XOKD 2A5KA 1Q31A 2ILNA 3KQDA 1QRXA 1INCA 1OOKB 1RTKA 1TB6H 1UCYH 4FUJA 4OM9A 1YKTA 3ZVEA 3BG8A 1ABJH 3RXCA 5DP9A 2H9HA 3ZZCA 1HAOH 2VH6A 3M7QA 5DP7A 4F49A 2FP7B 3ITIA 1DT2A 1C1TA 2L6OA 1G32B 4UONA 1NN6A 3ZZDA 1SGFG 3D62A 1O36A 1O32A 2VINA 3RXAA 2ZTYA 4FUHA 4X8UH 1P11E 1O3IA 1TMBH 3RM2H 1YBWA 1HAHH 1N8OC 4HTCH 2C8YB 2F9UA 1YWUA 3GICB 1LPZB 4DT7B 2A4RA 1O37A 4AFQA 3GY4A 3MFJA 4B75A 3GCNA 1C5XB 4NG9H 4U2WA 2B8OH 1IOEA 1SR5C 2O8UA 4TY7A 1EJAA 1C2IA 1C5ZB 1GBKA 1L1JA 1ID5H 4ZHLU 5LPEA 1C5QA 3DFLA 1PPFE 2ZCKP 5FL7D 5JDUB 3TGIE 3EGKH 4OS1A 2KCYA 3KEEA 5H4IB 1C9PA 2TPIZ 1P06A 1FV9A 2ZDMA 3PRBA 1FY8E 2BM2A 4ACBA 2A7CA 1K1IA 1CHGA 1EPTB 1H9LB 2ZECA 4K1SA 1KDQB 1V2LT 3DA9B 1DWDH 1FXYA 2BLQA 1XUGA 1ZHRA 2AERH 3LGTA 1QIXB 2OBOA 2LELA 3WWBA 1GBLA 1G36A 1P04A 3O8DA 4K2YA 3FO8D 4NWLA 1BTHH 2V7QD 2PKAB 3VXFH 5EGMA 7ESTE 4AGKA 3STJA 1LO6A 2GDEH 1HIAA 5EXMA 3M5MA 3GOVB 5F53A 2ZDLA 2JH5D 1OPHB 1UTNA 3QUMP 8ESTE 1S84A 1GMCF 4MQAA 1DLKB 3HGNA 4F4OC 4H6TA 2BXUH 3MH7A 1NS3A 2PFEA 1DE7H 2KCAA 3MQKC 3U9AH 2H6MA 1EB2A 3UY9A 2ASUB 1EFRD 1SGPE 2OP9A 1JMOH 4AB9A 2FPZA 2BD3A 4X2YA 2WPHS 1EPTC 5FCRA 2JETB 1OWEA 3F9EA 1BTPA 2QF3A 2ODQA 3SNEA 5FCKA 1LDTT 2A2QH 3T62A 2KR7A 2WPMS 1DITH 2EY4C 2WINI 1O3GA 1C5VA 4ISIH 4Y8YA 1TNLA 1P12E 1T8OA 2IJD1 4NIWA 2P3TB 2GZ8A 2WV9A 4JZ1A 4ZMAH 2BZ6H 4ASHA 1W0ZU 3GY7A 4B2AA 1BBRE 3SU2A 3S7HB 2BD4A 4MNYA 1DVAH 2SGDE 1BITA 1O3JA 2A4OA 3EE7A 2VIDA 4KELA 4DCDA 1SKYE 1A1RA 2ZGBH 4ZUHA 2ZIQH 1O3OA 3R0FA 5JBTA 1KLIH 1SFIA 1D3PB 1LKAA 3SUEA 7GCHF 1BHXF 2W7SA 1S82A 5C0UA 3OY5U 1J8AA 2JETC 1VZQH 2VIWA 1P2QA 2QYIA 4O3TA 2AMDA 2V3OH 2XC0A 5A09A 3F1SB 1L1GA 4NZLA 4ISNA 5E0JA 4DW2U 1L0ZA 1XUKA 4ABGA 4BANB 1QRZA 1TE0A 3WWFA 4RI0A 2RA3A 2PTCE 2FS9A 2PWXA 4NA7A 5FPTA 2YMSB 1HRTH 3MWIU 1C9TA 2XW9A 1QNJA 2IPHA 3ODFA 6CHAB 2Y82A 3FP6E 4WY3A 1GJ9B 2KM0A 1BTZA 2FOHA 4I8HA 1UCYE 4Q7XA 3D23A 1SOZA 1C5NH 1CE5A 1ZMNA 4I8KA 2CV3A 1EASA 1RGQA 5C0TA 2FOCA 1C5WB 2J97A 1CA8B 1GHBG 1FNIA 3G01A 3SU0A 1HDTH 2ZQ1A 1V2JT 4FVBA 1C1SA 2P8OB 3PTNA 1BTXA 2BD5A 2GJGA 3EA9A 3SGQE 1C1WH 2FOAA 1Z1JA 1QB6A 3SV8A 3RXHA 1O5EH 1BTWA 2FLBH 3FVFB 5DP5A 1J16A 1FONA 2WV4A 3N7EA 4X8SH 4H4FA 2ZZUH 4AB8A 1EPTA 1UW7A 1A3BH 4MDSA 3LIWA 4FETA 3E1XB 3WY8A 1GI6A 3TH4H 3SU6A 3F2FA 2ZTZA 2PGBB 2YMSC 4D76A 1L1NA 2GDDA 6CHAC 1DANH 1ZR0A 4Q7ZA 3HK6B 1ZYOA 2Y7ZA 1LPKB 4ZH8A 2TGPZ 1B5GH 2PKAA 3F2HA 3TK9A 4CRGA 2C8ZB 5DP3A 4RSPA 1OP8A 2TGDA 1O3CA 3PYHA 2BY9X 3VGCB 4FUIA 1HAIH 1Y5AT 1YPHC 1GHYH 2FOGA 1QFKH 1UTPA 1DICA 1IQKA 1ELBA 4NIVA 2UWPA 3OFND 1NRNH 1MBQA 1Q2WA 1XUIA 3Q3XA 1XKAC 5EPNA 4X6MA 4AX9H 2NU0E 4DJZB 3QZQA 4O97A 4Y79A 5FPSA 1RRKA 3VB7A 4AOQA 4AGJA 1EAXA 4K1EA 1T8LA 2FZZA 1NT1A 3RMLH 3BEIB 5FHTA 3SORA 1SL3A 5L2YH 3EDXB 4MPVA 4OS7A 5HIYA 3N7DA 4BAQB 1TGNA 1RXPA 1DOJA 1AB9B 1GJ4H 2STAE 2ZCHP 2M5TA 3O8BA 2GGVB 1SVPA 3QX5H 2Q6DA 2ZEBA 1A5GH 3SNDA 3AASA 2W7UA 4ABJA 2ZFSA 1UK4A 1GBHA 3T25A 2ZGCA 3D49H 1SC8U 3VGCC 4LXBH 3M7TA 1KXAA 5BPEA 4ACAA 1O2XA 3H7OA 5T6GA 4GAWA 2BB4A 5J4SA 1GJ5H 3MU8A 3SUFA 1BCUH 1MMJN 4Y8ZA 3CS0A 2CJIA 1GL0E 1O35A 1DSTA 5C94A 5CMXH 2F9NA 3SZNA 3PMBB 3SHAH 1K1JA 4ISLA 1AE5A 1Y5BT 3UWJH 5KGOA 3LGVA 1QURH 1E38B 4VGCC 5EPYA 4NSVA 2Z9IA 4MPWA 1ANBA 1ABIH 3SNCA 2A7HA 4UE7H 2TGTA 1YCPH 2IOTA 3P8FA 2ZWLH 3KYFA 4JYTA 4BTTB 1AB9C 1HAXB 2O8LA 3NUMA 5BRRE 4CRFA 1LQEA 4DIIH 3C27B 3KQBA 4B73A 1CHOG 3KNXA 1KSNA 1C2MA 1AD8H 4QT8C 4AORA 2ZFTA 1ARCA 2YMSD 1ZSLA 1P2OA 1O2KA 2KCOA 5IK2D 4IGDA 1O5CB 4BAOB 1WUNH 4RT0A 4UFEH 1EZXC 4X6PA 4XDEA 3A80A 1O34A 4K8YA 1LHFH 2FWWA 3RXBA 1ARBA 1K1LA 3RMMH 1W2KH 1WTHD 2J9NA 3SU4A 1THSH 2OQUA 4DT4A 2XNDD 3KCGH 4B2BA 1V6DA 2BOKA 3I29A 3RXSA 2SGEE 4WMEA 1NBME 2BYAX 1K1OA 4FUEA 1GMDF 1TNIA 2WSSD 1HLTH 2ZHWH 1A61H 1H8IH 3BTDE 3P95A 5F8TA 1AWHB 4CH8B 2A2XH 1XUHA 2SNWA 4ISOA 1Y3UA 1KXFA 1KMHB 3T5FH 1YLNA 2WPIS 1EZSC 1XKBC 5E2PA 1BRBE 4JMYA 4MNWA 2QXJA 3SU3A 4Z0KA 2ANYA 2GX4A 2BD7A 3P70B 1V2UT 1O2TA 2ZP0H 4Y7BA 3A87A 1YF4A 1G9IE 1NRSH 4X6OA 3EQ0H 4NGAH 1O3DA 4WWYA 4OGYA 2CMYA 3K2UA 1L4ZA 1O3KA 3KIDU 4Y76A 1C5LH 1GI3A 1D6WA 4KP0A 3GCTG 1DDJA 3GY5A 4GLYA 4D8NA 4MNXA 1GJAB 3GS9A 2FLRH 3LU9B 4SGAE 1KLJH 1T8NA 1GJ7B 1EUFA 4CRBA 2XC4A 3QTOH 5GJ4B 3PO1B 2V3MA 5F8ZA 3EA8A 3KQCA 3UPEA 3SZEA 4ASUD 1SHYA 3LKWA 3JZ1B 4INKA 1ACBE 4INLA 2NU4E 1DUAA 3NZIA 1CGJE 1G3EA 1GMHF 3O8CA 2QAAA 3PV5A 3V12A 3QK1A 1OYTH 4XOJA 1SGIB 3UNRA 3A86A 2AGGX 3MTYA 3DCLA 3RXIA 1D3DB 1CVWH 2JJ1D 3UAIC 1LVOA 3FAOA 3BTFE 1SGNE 3H09A 1CT0E 5AFYH 3SUGA 1GBCA 2C93B 2A5AA 1QGFA 3A88A 1TA6A 4B76A 3PWCA 2RCEA 1UCYK 2HVYB 1A5IA 2WPDD 3F0PA 2Y7XA 3ENSB 1S81A 2W6ID 3LPRA 4ABIA 3ZZBA 3SUDA 3AW1A 4ZCNA 3HATH 1C1UH 1A0HB 1IHSH 1P01A 1Z8RA 3ATIA 4X2XA 1RFNA 3ZZ5A 3PO1C 3PMAB 4CRCA 2EI6A 1EAIA 3R3GB 1W14U 2XXLA 2EEKA 5HGGA 2GP9B 1BMLA 1C5RA 1PPZA 1Z71A 1IQLA 1TOMH 1F2SE 1O3PB 3FP8E 1QTFA 2LP6A 5C3NA 5EQRA 1ZSJA 1C2JA 1SI5H 1T4VH 2GCHF 1O38A 1AKSB 2BVRH 2F83A 3A8CA 1YPJH 3F2GA 4GUXA 1HB0B 2H2ZA 3MH4A 3Q76A 1PPCE 1VITF 3UQOA 3A82A 3S9BA 4NCYA 1YLDA 2HNTE 1ETSH 3A7YA 1TQ0B 3SHCH 1C1VH 1P03A 4JZDH 4Y6DA 1GBFA 2CF9H 2XBXA 1RS0A 1LTOA 3T27A 1SB1H 1QR3E 2AEIH 2DUCA 3OSYA 4FUDA 3ATKA 3KN2A 2Z9JA 5CHBA 4X1NU 4ZHAA 4CRAA 2ZGXH 4Z6AH 2GV7A 2ZKSA 1QHRB 4JZEH 1KYNA 2SFAA 4UEHH 5EOKA 3UQVA 1V2KT 4AFZA 3PTBA 5C67A 5EIYA 1MZDA 2EI7A 1PPHE 1LHDH 1S0RA 3GY8A 3TH2H 3DD2H 1O2NA 5KECA 2PW8H 4Y0YE 3PM3A 3KYGA 1Q3XA 2BLVA 1JIMA 4B6FA 1MTNB 1SPJA 3LJOA 3MYWA 4I8LA 3A7TA 1GPZA 1QJ7B 1QL7A 1Y3WA 4MPUA 4A5TS 1GVZA 5DP4A 4E06H 4K60A 3T29A 2PP6A 1MKWK 1O0DH 1TGSZ 1QRWA 4Y0ZE 4YXWD 1GBEA 1O2UA 4U30A 1UVOA 1TPOA 1NBMD 1FX0B 3VEQB 2BXTH 3I78A 4FUGA 4CRDA 2HOBA 3S69A 1P57B 2XYAA 1GMCG 1ZJKA 3MU5A 3K65B 3VB3A 2Z9KA 2XCFA 1TIOA 1AN1E 1XVOA 2HNTC 3A89A 2DE9A 3E8LA 1GDUA 1MTNC 1VITH 3QGNB 1FMGA 3TJOA 5KEDA 3BSQA 1D3QB 4A1VA 1H8DH 3BTQE 2BDBA 1V2QT 2PKSB 5HMAA 1COWD 3NPSA 4X8TH 2XC5A 4FUFA 2FOEA 2J92A 1NRQH 1A7SA 1H9IE 2VIQA 3KHVA 1V3XA 2HLDD 1T7CA 3ODDA 2L74A 1O2OA 1TPAE 5F8XA 1QY6A 1TRNA 1ELGA 3GYMA 1C1RA 3M5OA 4LZ1H 5HXFA 1SHHB 3P6ZB 1Y5UT 1FN6A 1CGHA 1GHVH 2P95A 4ZXXH 3MMGA 4Y7AA 4AFUA 2BDGA 1NRRH 1QJ1B 4Q4LA 3AAUA 5JBCS 1AU8A 1A3EH 2FXRA 4MPXA 1C1OA 3SJOA 4J1YA 3UNQA 3FKSD 5JB9S 1MBMA 2PGQB 2ZF0H 3OU0A 3ZVBA 5CDFE 1PQ5A 7GCHG 2G5NA 1V2RT 1N6XA 4NFFA 2PKSC 1SSXA 5A0BA 9LPRA 3UWIA 1K28D 1ZGVA 4BTIB 4B2CA 5E0HA 1MTSA 1ZSKA 3BV9B 3T28A 1AKSA 1ELDE 2R0LA 3FOAA 1C1MA 5FX5A 1SQTA 3JZ2B 1MKWH 1ZMJA 2UUJB 3ATLA 4ZKNU 1H8ED 4GSOA 1FDPA 3RXVA 3U1JB 4Q63A 1W10U 4TPYA 2QC2A 1Y3VA 5I25A 1C5TA 3M3VA 4XFQA 3M5LA 5T1VA 1TPSA 1LVYA 5EODA 1MD8A 3P8GA 1LPGB 3SV6A 1TRYA 1SGTA 1O2HA 3ZVDA 2BZAA 3Q00A 1E1QD 2VWNA 2QF5A 2OXSA 1TNJA 1QA7A 5GNDA 2ODPA 2ALVA 2VNTA 1BMFD 3L6PA 4RT1A 3ZZ9A 2SGAA 1XMNB 1VJAU 1IQIA 1GJBB 5C2ZA 3U69H 3SGAE 4CR5A 3FFGA 1K0HA 2A5IA 8GCHF 2BY8X 1YPKH 3AAVA 1S6LA 4XE4A 1ESTA 1Z8IB 3LJJA 2WPLS 3E0NB 1HUTH 1GVKB 1FY1A 2ANWA 2FYQA 1C2DA 1C5UA 1O5AB 4FU7A 4INHA 2R3UA 3RXEA 2B5TB 4DVAU 5T3HA 1GGDC 2A0QB 3RXRA 1UHBB 2ANMH 2V35A 1XX9A 5HM9A 5GCHF 1N6YA 3BTTE 1AVWA 1TGTA 1O2SA 3ZZAA 3B23B 2RA0A 1C5MD 1GBIA 3GDVA 4ABAA 1S0QA 1LVMA 1ELFA 2NWNA 3RMOH 1ELCA 3B9FH 4B1TA 2BDAA 3NCLA 3QN7A 2B9LA 4TYDA 3P8NA 4A7IB 3UOUA 1BRCE 1TX8A 1YPMH 1D3TB 2FESH 5JBBS 1YPHE 1EAWA 2OC7A 2OQ5A 1DXPA 1O5DH 4AYVB 2WV5A 5GIBA 4D9RA 4MG3A 1ZMLA 4HFPB 1YCPM 1L2EA 3GY3A 1HGTH 3V0XA 1ELVA 1OP2A 2BLOA 3A7WA 3F3BA 1F92A 3IG6B 1QB9A 1QZ8A 3QZRA 1GI5A 4M7GA 3TK6A 1O5BB 1V2MT 2FDAA 1P09A 1P3EA 1TX6A 2O8MA 1HAPH 4BAMB 3ZZ4A 1EZUC 1YY3A 2ZPRA 1BDAA 1C5OH 2XBYA 4HGCA 3PLBA 1NPMA 1TNGA 3AVZA 3Q3YA 5DJ7A 1YYY1 1NFYA 1SOTA 3ATMA 1QBNA 1WDIA 2VBCA 1S6FA 1ZZZA 1TQ7B 2AFQB 2TGAA 1CU1A 4I7YH 1AZZA 1KDQA 2HLCA 5LPFA 2BX4A 1NROH 1ZRBA 1UTQA 1YCPK 1MKXH 1S83A 1LHGH 1FJSA 1O3MA 1QBVH 1GHZA 1HJAC 3TPIZ 3H5CB 1EP5A 2VIVA 1O3FA 2HPQH 2ESTE 2PTNA 3OE7D 2HALA 2Z3DA 1FIZA 2BVXH 4IN1A 1CO7E 3OTJE 5T6FA 1O3NA 1J14A 3BTWE 2HNTF 1J9CH 2ALPA 2ZTXA 1WXRA 2ZDVH 2HVXA 5DN6D 2G4TA 3FP7E 1GWAA 1W0KD 3SV9A 3S9AA 2BQWB 3P8OA 1Z8GA 4ABHA 1FIWA 3BN9A 2YNAA 3VXEH 5FBEA 2H5CA 2KAIB 4XBCA 3E0PB 1AUTC 3K6YA 1FI8A 1ELAA 1ELEE 3RP2A 1O2LA 2TRMA 5E0GA 1WQVH 2WYGA 4VGCB 2M2AA 2CHAB 4IS5A 3SNBA 1VCQA 1OWDA 3M35A 1YPLH 2PHBA 5C17A 3PV4A 1ZTLA 3A8AA 3MO6A 1K2I1 3TGKE 1O39A 1JRTA 1Z7KA 2ZQ2A 1A2CH 4CREA 1BB0B 1D9IA 1HBTH 4ISHH 1FPHH 3MU0A 1Z6JH 1O2GH 1FAKH 4Y71A 4AN7A 2ZFQH 3UNSA 3M36A 1K1PA 3A85A 3P92A 2RDLA 1KXCA 3LDXH 3DUXH 1GMDG 3OEHD 2Z6BD 3BEFB 3STIA 1SLVB 1WQSA 1HV7A 1XXDA 3B8JA 5DGJA 1UHBA 3MNCA 1MCVA 1A0JA 1O3EA 3SBKA 5DK1A 2BY6X 4YO9A 4XSKU 1TX7A 3MU1A 2BHGA 1ZOMA 2Z9GA 4JZFH 3T26A 1SGDE 3TJUA 4I86A 1IAUA 2CHAC 1ESBA 2BQ6B 1GG6B 1WOFA 2F9PA 5GWZA 5TCAA 3WW7A 1BTUA 4D9QA 2DE8A 1NM6A 3RXJA 2D1JA 1T32A 1W0YH 4A92A 2F9BH 2G52A 5K0HA 1GJ6A 2FI4E 2WUBA 1EJMA 4YOGA 5C5OA 2G81E 1C2LA 1J17T 4K8BA 1AGJA 1OHHD 2G8TA 2G00A 3T2NA 1DS2E 2F4LA 1PQ8A 2NU2E 2SNVA 5E8EH 1IQEA 2FTMA 1IQJA 3SW2B 6LPRA 3DT0H 5GPIB 2J34A 4CH2B 1O2YA 1GBTA 4NWKA 1GJCB 1OKXA 2EQNA 2QXIA 4HZHA 4IMQA 1KXBA 2FIRH 1ZTJA 3PV2A 2W26A 2A32A 1GMHG 3KL6A 4ESTE 1O2VA 2KX4A 5AFZH 4I8JA 1DXWA 1GG6C 3TIUA 4KTCA 4O3UA 3PB1E 3TITA 2JKHA 2BQ7B 2AGEX 3SV7A 4WH8A 1G3CA 5F6MA 4X1PU 2ULLA 4LZ4B 2PSXA 1GJDB 1MD7A 2FX6A 4F55A 2J4IA 2QF4A 2Z9LA 1ESAA 3ZYDA 3A8BA 4B6EA 1BT7A 4RKJB 1BRAA 3E6PH 1JBUH 3LGUA 2ZHDA 1YPEH 1QBOA 3OAAD 1VGCB 2A1DB 2GCTB 2OC0A 2P59A 1C4V2 1E0FD 1GCTB 2GT7A 3C1KA 1MABB 1O3AA 1F0UA 3LGWA 1E37B 1F5KU 2ZGJA 1FY5A 2QIQA 5DKMA 1FN8A 1VCPA 2W5EA 1LQDB 2Z94A 3UR9A 1V2ST 2GCHG 2A45B 4GHQA 5GXPA 4YT6H 2OTVA 4IBLH 3UFAA 3A84A 3MH5A 2KAIA 3F9GA 1KTSB 2VH0A 4ABFA 1O2QA 1VITG 2D26C 3OY6U 1PYTC 4ZAEA 2BD2A 4BTUB 1ZPZA 1X7AC 2J98B 2K8IA 3NRLA 4CBNA 1WCZA 3VB4A 3KQEA 5C20A 1EKBB 2J95A 2P94A 4F48B 2H5DA 1G37A 1VGCC 3TJNA 2GCTC 3QO6A 1UVSH 3HPTB 4HI3A 1ETRH 1WTGH 3SQEE 3ZV8A 1GCTC 2Y80A 2ZHEH 3A7VA 1SGYE 4Y11E 4AG2A 1UTKA 2ZDAH 1RTFB 3PROA 1P02A 1SLWB 1LMWB 1HJ8A 3ESTA 2W3IA 3K9XB 1IQFA 3ZZ6A 2ZG0H 1UVUH 2F9VA 1S5SA 2RG3A 5A8YA 2C4FH 2YOLA 2IJOB 2Y5FA 1H1BA 1AY6H 1N1LA 4NFEA 3VB6A 2ANKH 3TGJE 4CR9A 3W1EA 3OX7U 3VPKA 1QL9A 4CBOA 3U1IB 4UFGH 3RXLA 5C5NA 1MAYA 1AIXH 1CQQA 3PLKA 4K69A 2AH4X 4H42U 1JOUB 3RC6A 5A8XA 1AHTH 3S0NA 4WMFA 3AK5A 4BOHA 1O5FH 1GHAF 1P3CA 4J2YB 4DG4A 2ZGHA 2D8WA 2BY7X 2ZFRH 2P3UB 4BXSA 2QE7D 3ATWA 2ZA5A 5T6DA 3GDUA 3N99A 2ZCLP 3V7TA 2QGRA 1IQNA 2Z3CA 2CXVA 1C2KA 1K9OE 4HG6A 3BTGE 1P9UA 3SYJA 1AQ7A 3GDSA 1T8MA 1P05A 1NESE 5FXLA 1O2IA 1HAGE 1HAZB 2C8WB 3DSPA 1ETTH 1MQ6A 1SGCA 2CK3D 2PR3A 3NWUA 2K0QA 1W11U 4TWYA 3ELAH 2Z7FE 1MU6B 3GCTF 2ZDKA 3F9FA 2A4GA 2H9TH 4MVNA 1AFQB 1AE8H 3BEUA 2WHXA 3GCHB 1ZGIA 5A0AE 2QA9E 2QXGA 2V0BA 2KZ4A 1BOQA 5EJLA 1ELTA 1BTYA 3LOXA 2W6JD 1TBZH 2G51A 1NY22 2FI3E 2FMJA 1HAYB 4ZXYH 2SGPE 5AVDA 3UR6A 3SGBE 1F7ZA 3Q3KA 2PUQH 2UWOA 1DLEA 2BOHB 1EATA 2BTCE 4D7GA 5DP8A 2XCNA 3RDZA 1BMAA 1SGEE 3SJIA 3UOPA 3VB5A 4FVDA 1DWEH 3QTVH 1F0SA 1TOCB 1SQRA 1VKYA 2ZNKH 3PWBA 2GVFA 5EQSA 4WVPE 1T31A 4ABDA 4BXWA 2Q1JA 1TBRH 1NFXA 3SU1A 1FQ3A 4ZKSU 1SMFE 5GDSH 5EJZA 1TBQH 1TAWA 2XRCA 1GBBA 1H4WA 2NU3E 4JK5A 5C1UA 3M37A 1GI4A 3ZVCA 1C5SA 2XBVA 1AFQC 4NSYA 2GZ7A 2W3KA 4MLFB 3GCHC 3GY6A 4PROA 1C1QA 1DY9A 1MUEB 1OYQA 1SGFA 1BUIA 2P16A 4MNVA 3QLPH 1IQHA 5FX6A 2Y6TA 3KQ5A 1GI0A 3LGIA 2UUYA 2RFKC 2J98A 1YC0A 1AI8H 5EW1H 1HCGA 2R3YA 2VIPA 3GYLB 3F0OA 3M7UA 2FEQH 1RJXB 1PQ7A 1F5LA 1O2JA 4A1TA 1ZJDA 4ZKOU 4U01A 3BF6H 2OINA 4E7NA 1DFPA 3LH1A 2WPJS 5B6LA 2VVVA 1DWBH 2GTBA 4I8GA 3SJ8A 4DY7B 1Z6EA 6GCHF 3RXPA 3M5NA 1W3CA 1FAXA 1IQGA 3F9HA 4U32A 2G5VA 8GCHG 1SGRE 4OGXA 5I46H 1W8BH 5ETXA 5HKKD 1HJ9A 1V2NT 2FX4A 1F5RA 2AYWA 1P2IA 1W12U 1O2PA 1HAVB 1MZAA 1OS8A 2ZO3H 4GCHF 1B7XB 4WJG2 4Y8XA 2GV6A 2BLWA 2GD4B 2ZI2H 5G4BA 2AIQA 4X2VA 1UMAH 4FOUC 5GCHG 8LPRA 1SLUB 1K1NA 1GI7B 1O2ZA 1GDQA 1MU8B 1V2TT 3L33A 1DX5M 4JK6A 2VJ1A 2ZFFH 4UFDH 2AIPA 1K21H 2J2UA 4M9FA 1MAXA 1GBAA 2JH0D 2BDIA 2THFB 3UIRA 1SQOA 2XBWA 2C3SA 3MI4A 2JJ2D 5LGOA 3MH6A 2UUFB 4IC5A 2PSYA 4IC6A 1DWCH 3SO3A 1S6HA 2ZU4A 1P2KA 2VVUA 3UB0A 3H7TA 1C1PA 3FZZA 3M3TA 3RLYH 5EXLA 4NA8A 1GGDB 1H8HD 1TA2A 2VB0A 3IWMA 4Q80A 1WAYB 4P02A 4XBDA 1NU7B 2WZQA 4TWWA 3BIUH 3BTME 3U98H 1Z8JB 2HPPH 3GISB 5EG4A 3E16B 5J4QA 3ZVGA 1UK3A 4B71A 3BTKE 2J94A 3MNSA 2FM2A 4BAHB 3U28C 4UFFH 3MNBA 1TGBA 3RUOA 3SU5A 2HGTH 2G4UA 2KFWA 1LHEH 1CA0B 1MQ5A 4MTBA 1PPBH 4YLQH 4SGBE 1W7XH 4ZROA 3FZDA 1P8VC 1MKXK 5HM2A 1P2NA 3M61U 1YLCA 5L6NH 1T4UH 5A0CA 2A31A 3TU7H 1F0TA 4UDWH 3SI3H 1O2RA 2R0KA 1OWJA 3SN8A 2TIOA 4Q2KA 3RXGA 4YESB 2ZU1A 3SJ9A 3SOSA 1GL1A 2AMQA 1C4U2 1GI1A 1SG8B 1L4DA 5ESTE 1G3DA 1GHXH 1UJ1A 4X6NA 1SQAA 3SJKA 1NC6A 3RXKA 3URDA 3EYDA 1C2GA 1PQAA 1BMNH 4XRNA 1CBWB 1K1MA 1O3HA 1TMUH 2FODA 3HKJB 3A83A 3SQHE 5B6OA 2UUKB 5LPRA 1AVGH 3UTUH 1W0JD 1TALA 1E34B 5JB8S 1HFDA 1XM1A 1PFXC 2XTTB 4E7RG 1ZLRA 2ZU3A 1KIGH 5C1XA 1SFQB 2O8WA 2OBQA 1H9HE 2KCPA 1CA0C 1TFXA 3ZZ3A 2ODYB 1SBWA 2IN2A 2ZU2A 3TLOA 1UO6A 4FU9A 4FXGH 4I33A 3MO9A 2P3FH 3F68H 1EJNA 1B0EA 3RM0H 3ZYEA 1HJAB 1Y8TA 3QWCH 2F3CE 1NO9H 2CN0H 1OX1A 4K5ZA 2D2DA 1W7GH 4NZQA 2AGIX 1O2WA 3ZZ8A 2H9EH 3KF2A 3RXUA 2HRVA 4WXIA 2EI8A 1AMHA 1CBWC 2ZPSA 1RIWB 1HXEH 4YM9A 3RC4A 1TNHA 1O3BA 1TMTH 1MTVA 2A7JA 3U8RH 2I6SA 4RN6A 4GVUA 2OK5A 5EJ1A 3A7ZA 1C5PA 1GBDA 1HAVA 4TSFD 1ZHPA 4YTAA 1HNEE 1KY9A 1G2MA 1YGCH 1VJ9U 2ZPQA 3GY2A 4H6SB 5L2ZH 4JZIA 2JDID 2VWOA 2R9PA 1GBMA 1PPEE 2SGFE 4A6LA 1AZ8A 3CENA 2BDCA 1LHCH 4X0WU 1RTLA 2RDEA 2FS8A 2C90B 1O31A 3GCOA 1M9UA 1GI9B 1THRH 4CHAB 2FOBA 6ESTA 4I32A 5SGAE 1AO5A 4LK4A 1C2HA 1EQ9A 4BAKB 5FBIA 3RXDA 1OWHA 1RIWC 1AFEH 3URCA 4YT7H 3P17H 3PMJA 4OS2A 1VCWA 4XBBA 1GVLA 1FY3A 1U6QA 2NU1E 1FPCH 1MCTA 1V2WT 2AMPA 1EB1H 4FU8A 4OS5A 1NZQH 2UWLA 3RXQA 1JWTA 3OTPA 5IDKA 1LVBA 1V2PT 3RXFA 4K3JA 2P8OC 2Y5HA 3A8DA 1CT2E 3LT3A 1DUEA 5TJXA 1BIOA 1EOLA 2EA3A 2QCYA 3SV2H 1JXPA 4AZ2B 1ZPBA 3V3MA 2ZDNA 4X1QU 1OXGA 4YOIA 3TH3H 1UTMA 2OCVB 4JYUH 4CHAC 1IQMA 3LGYA 1UK2A 2STBE 1OWIA 4X1RU 2V3HH 1WU1A 1SLXB 1YP9A 5HIZA 1EOJA 2FO9A 1CSOE 1CT4E 2BVSH 1WBGB 3PMHB 1GHBF 1ANDA 3I77A 3MHWU 4YLUA 1WSSH 3RXOA 4JCNA 3SI4H 4THNH 1ZRKA 1A5HA 4O9VA 2QY0B 5DG6A 1QJ6B 5JBAS 1D6RA 2ZFPH 1KXEA 3E90B 3A7XA 1QQ4A 1AVXA 5LH8A 1ZPCA 2AS9A 1DSUA 3LONA 3S9CA 1G3BA 1Y3YA 2WUCA 1QCPA 1HXFH 2BDYA 1KTTB 3EE0B 1QQUA 4GHTA 2FYRA 5A2MH 5ESBA 3E3TA 1TLDA 1C4Y2 1EXFA 1GCDA 2QF0A 1BRUP 5E2OA 3VFEA 5K7RA 3PLPA 4TY6A 7KMEH 5DPAA 2BY5X 3VG8A 2FOMB 2QN5T 5PTPA 1K22H 2B0FA 2O9QA 1FUJA 1E79D 2FOFA 2PV9B 4X8VH 4X1SU 1JRSA 3RC5A 3TK5A 2F43B 3LC5A 2VGCB 4R0IA 4ABBA 1PJPA 1W13U 3ZVAA 3NXPA 3TNSA 1ANCA 4AYYB 3Q77A 1GJ8B 5IYTA 2F91A 2JH6D 1CGIE 3LC3A 3QGJA 4KGAA 2J5UA 4KKDA 4OS6A 3W95A 1D4PB 2Y5GA 1UVTH 3S7KB 1MH0A 4NIYA 1O3LA 3NKKA 1O30A 1P2JA 3HKIB 2OUAA 1EZQA 4P00A 2B7DH 5F03A 1JIRA 1BJVA 3EAJA 1ZTKA 4DGJA 1BJUA 4AG1A 2BX3A 3ZVFA 3RU4E 2TBSA 3U8OH 3D65E 9ESTA 1ZHMA 2EC9H 5EU8A 1XVMA 3IITA 4WH6A 8KME2 1DPOA 4FUBA 4IW4E 1HYLA 1P2MA 5JPMH 2WPKS 3CP7A 2VGCC 3A81A 1O33A 4XD7D 1A46H 2F9OA 2LNCA 2QXHA 1GHAG 3ZIAD 3MU4A 1ORFA 2XWAA 1FLEE 1F0RA 4Z1MD 1O2MA 1C5YB 2AHME 2Z3EA 3ZV9A 1P9SA 4Y10E 1BA8B 1C2EA 1MTWA 1KLTA 1NRPH 3CS7A 3L3TA 4AC9A 3DSOA 1S85A 2IPQX 3OYPA 2GMTB 3OEED 3MOCA 1ANEA 5A8ZA 2HWLB 3RU4T 5EW2H 2ZHQH 1WYKA 4K1TA 4D7FA 1Y59T 1FZZA 3MNXA 1BMMH 3RXMA 5ABWA 4IMZA 3DHKH 2FTLE 1AUJA 2OC8A 3U8TH 1BBRK 4AFSA 2O8TA 3FANA 5CHAB 1CHOF 3RXTA 4YZUA 1C2FA 1XUFA 3E91A 3UUZA 1OP0A 1GHWH 5JYIA 1EAUA 2A4QA 2CGAA 5CE1A 3TNTA 3TJVA 1PPGE 2VU8E 2CF8H 4NIXA 1P10A 4ABEA 5FAHA 3DSGA 3HK3B 2OLGA 1EP6A 3QDZB 2OD3B 2XWBI 1TONA 2H1UA 2GMTC 3SNAA 2SGQE 4NA9H 1UTOA 2PUXB 1FY4A 1BHXB 1G30B 2LPRA 2J38A 4E05H 4DURA 1XXFA 1DY8A 3MO3A 2FI5E 2VVCA 3KGPA 3N7OA 4UD9H 1TPPA 4KTSA 3UREA 1V2VT 1DM4B 2VWMA 4Q7YA 1SGQE 1YPGH 3HGPA 5CHAC 1WV7H 2OC1A 2I6QA 3NK8A 5AHGH 5L30H 1TWXB 1LKBA 2ZU5A 4JYVH 3FN8A 1G2LA 1NTPA 1KXDA 4LOYH 4R8TB 1TNKA 1TGCA 4FUCA 1GDNA 2R2WU 5TCCA 1BQYA 2Y81A 2R2MB 2ZC9H 1OSSA 1EX3A 2Q6GA
chains in the Genus database with same CATH topology
2BD9A 2GKVE 5EQQA 4RKOB 1UTJA 3ZZ7A 3RMNH 1A0LA 2Q6FA 1QA0A 1IHTH 2BD8A 1Z1IA 4IN2A 3BG4B 1GI8B 2YNBA 2V6NA 1GI2A 2VWLA 1HIAB 4TPIZ 3O8RA 4I31A 2GT8A 5HYOA 1O5GH 4X2WA 6GCHG 1QB1A 3K6ZA 2C8XB 5EXNA 3M3SA 1VR1H 5C1YA 1MTUA 1UVPA 1TYNA 1J15A 2WYJA 3LH3A 4YOJA 1RD3B 2PLXA 1A4WH 5DO4H 1THPB 4WF8A 4DOQA 1E35B 2K1QA 1NFWA 2BMGB 1BZXE 1BBRH 1UTLM 1AWFH 1C1NA 4GCHG 5FPYA 4WXVA 1YM0A 1PYTD 1Y3XA 3F6UH 2G55A 2QV1A 2P93A 1GBJA 3BTHE 1HPGA 4WMDA 3V13A 3BIVH 2XNIA 3EA7A 4ZKRU 1LCYA 5DP6A 3AW0A 1NU9A 1E36B 1P0SH 3BTEE 3TVJB 1TRMA 2BDHA 3BG4C 2VIOA 3DFJA 4OS4A 1B0FA 4BNRA 1N8OB 4A1XA 3W94A 1XUJA 4O03A 3RLWH 4B74A 1V2OT 5AF9H 2GZ9A 4KTUA 1QL8A 3RU4D 4GPGA 1NFUA 4DIHH 7LPRA 2ZHFH 1TABE 4ZHMU 1OWKA 2A5KA 1Q31A 2ILNA 3KQDA 1QRXA 1INCA 1OOKB 1RTKA 1TB6H 1UCYH 4FUJA 1YKTA 3ZVEA 3BG8A 1ABJH 3RXCA 5DP9A 2H9HA 3ZZCA 1HAOH 2VH6A 3M7QA 5DP7A 4F49A 2FP7B 3ITIA 1DT2A 1C1TA 1G32B 4UONA 1NN6A 3ZZDA 1SGFG 3D62A 1O36A 1O32A 2VINA 3RXAA 2ZTYA 4FUHA 4X8UH 1P11E 1O3IA 1TMBH 3RM2H 1YBWA 1HAHH 1N8OC 4HTCH 2C8YB 2F9UA 3GICB 1LPZB 4DT7B 2A4RA 1O37A 4AFQA 3GY4A 3MFJA 4B75A 3GCNA 1C5XB 4NG9H 4U2WA 2B8OH 1IOEA 1SR5C 2O8UA 4TY7A 1EJAA 1C2IA 1C5ZB 1GBKA 1L1JA 1ID5H 4ZHLU 5LPEA 1C5QA 3DFLA 1PPFE 2ZCKP 3TGIE 5JDUB 3EGKH 4OS1A 3KEEA 5H4IB 1C9PA 2TPIZ 1P06A 1FV9A 2ZDMA 1FY8E 2BM2A 2A7CA 1K1IA 1CHGA 1EPTB 1H9LB 2ZECA 4K1SA 1KDQB 1V2LT 3DA9B 1DWDH 1FXYA 2BLQA 1XUGA 1ZHRA 2AERH 3LGTA 1QIXB 2OBOA 1GBLA 1G36A 1P04A 3O8DA 4K2YA 4NWLA 1BTHH 3VXFH 2PKAB 7ESTE 5EGMA 4AGKA 3STJA 1LO6A 2GDEH 1HIAA 5EXMA 3M5MA 3GOVB 2ZDLA 2JH5D 1OPHB 1UTNA 3QUMP 8ESTE 1S84A 1GMCF 4MQAA 1DLKB 3HGNA 4F4OC 4H6TA 2BXUH 3MH7A 1NS3A 2PFEA 1DE7H 3U9AH 2H6MA 1EB2A 3UY9A 2ASUB 1SGPE 2OP9A 1JMOH 4AB9A 2FPZA 2BD3A 4X2YA 2WPHS 1EPTC 5FCRA 2JETB 1OWEA 3F9EA 1BTPA 2QF3A 2ODQA 3SNEA 5FCKA 1LDTT 2A2QH 3T62A 2WPMS 1DITH 2WINI 1O3GA 1C5VA 4ISIH 4Y8YA 1TNLA 1P12E 1T8OA 4NIWA 2P3TB 2GZ8A 4ZMAH 4JZ1A 2BZ6H 4ASHA 1W0ZU 3GY7A 4B2AA 1BBRE 3SU2A 3S7HB 2BD4A 4MNYA 1DVAH 2SGDE 1BITA 1O3JA 2A4OA 2VIDA 4KELA 4DCDA 1A1RA 2ZGBH 4ZUHA 2ZIQH 1O3OA 3R0FA 5JBTA 1KLIH 1SFIA 1D3PB 1LKAA 3SUEA 7GCHF 1BHXF 2W7SA 1S82A 3OY5U 1J8AA 2JETC 1VZQH 2VIWA 1P2QA 2QYIA 4O3TA 2AMDA 2V3OH 2XC0A 5A09A 3F1SB 1L1GA 4NZLA 4ISNA 5E0JA 4DW2U 1L0ZA 1XUKA 4ABGA 4BANB 1QRZA 1TE0A 2RA3A 2PTCE 2FS9A 2PWXA 4NA7A 5FPTA 1HRTH 3MWIU 1C9TA 2XW9A 1QNJA 2IPHA 3ODFA 6CHAB 2Y82A 3FP6E 4WY3A 1GJ9B 1BTZA 2FOHA 4I8HA 1UCYE 4Q7XA 3D23A 1SOZA 1C5NH 1CE5A 1ZMNA 4I8KA 2CV3A 1EASA 1RGQA 2FOCA 1C5WB 1CA8B 1GHBG 1FNIA 3G01A 3SU0A 1HDTH 2ZQ1A 1V2JT 4FVBA 1C1SA 2P8OB 3PTNA 1BTXA 2BD5A 3EA9A 3SGQE 1C1WH 2FOAA 1Z1JA 1QB6A 3SV8A 3RXHA 1O5EH 1BTWA 2FLBH 3FVFB 5DP5A 1J16A 1FONA 2WV4A 4X8SH 4H4FA 2ZZUH 4AB8A 1EPTA 1A3BH 4MDSA 3LIWA 3E1XB 3WY8A 1GI6A 3TH4H 3SU6A 2ZTZA 2PGBB 4D76A 1L1NA 2GDDA 6CHAC 1DANH 1ZR0A 4Q7ZA 3HK6B 1ZYOA 2Y7ZA 1LPKB 4ZH8A 2TGPZ 1B5GH 2PKAA 3TK9A 4CRGA 2C8ZB 5DP3A 4RSPA 1OP8A 2TGDA 1O3CA 3PYHA 2BY9X 3VGCB 4FUIA 1HAIH 1Y5AT 1YPHC 1GHYH 2FOGA 1QFKH 1UTPA 1DICA 1IQKA 1ELBA 4NIVA 2UWPA 1NRNH 1MBQA 1Q2WA 1XUIA 3Q3XA 1XKAC 5EPNA 4X6MA 4AX9H 2NU0E 4DJZB 3QZQA 4O97A 4Y79A 5FPSA 1RRKA 3VB7A 4AOQA 4AGJA 1EAXA 4K1EA 1T8LA 2FZZA 1NT1A 3RMLH 3BEIB 5FHTA 3SORA 1SL3A 5L2YH 3EDXB 4MPVA 4OS7A 4BAQB 1TGNA 1RXPA 1DOJA 1AB9B 1GJ4H 2STAE 2ZCHP 2M5TA 3O8BA 2GGVB 1SVPA 3QX5H 2Q6DA 2ZEBA 1A5GH 3SNDA 3AASA 2W7UA 4ABJA 2ZFSA 1UK4A 1GBHA 3T25A 2ZGCA 3D49H 1SC8U 3VGCC 4LXBH 3M7TA 1KXAA 5BPEA 1O2XA 3H7OA 5T6GA 4GAWA 2BB4A 5J4SA 1GJ5H 3MU8A 3SUFA 1BCUH 1MMJN 4Y8ZA 3CS0A 2CJIA 1GL0E 1O35A 1DSTA 5CMXH 2F9NA 3SZNA 3PMBB 3SHAH 1K1JA 4ISLA 1AE5A 1Y5BT 3UWJH 3LGVA 1QURH 1E38B 4VGCC 5EPYA 4NSVA 2Z9IA 4MPWA 1ANBA 1ABIH 3SNCA 2A7HA 4UE7H 2TGTA 1YCPH 2IOTA 3P8FA 2ZWLH 4JYTA 4BTTB 1AB9C 1HAXB 2O8LA 3NUMA 5BRRE 4CRFA 1LQEA 4DIIH 3C27B 3KQBA 4B73A 1CHOG 3KNXA 1KSNA 1C2MA 1AD8H 4QT8C 4AORA 2ZFTA 1ARCA 1ZSLA 1P2OA 1O2KA 4IGDA 1O5CB 4BAOB 1WUNH 4UFEH 1EZXC 4X6PA 4XDEA 3A80A 1O34A 4K8YA 1LHFH 2FWWA 3RXBA 1ARBA 1K1LA 3RMMH 1W2KH 1WTHD 2J9NA 3SU4A 1THSH 2OQUA 3KCGH 4B2BA 1V6DA 2BOKA 3I29A 3RXSA 2SGEE 4WMEA 2BYAX 1K1OA 4FUEA 1GMDF 1TNIA 1HLTH 2ZHWH 1A61H 1H8IH 3BTDE 3P95A 5F8TA 1AWHB 4CH8B 2A2XH 1XUHA 2SNWA 4ISOA 1Y3UA 1KXFA 3T5FH 2WPIS 1EZSC 1XKBC 5E2PA 1BRBE 4JMYA 4MNWA 2QXJA 3SU3A 4Z0KA 2ANYA 2GX4A 2BD7A 3P70B 1V2UT 1O2TA 2ZP0H 4Y7BA 3A87A 1YF4A 1G9IE 1NRSH 4X6OA 3EQ0H 4NGAH 1O3DA 4WWYA 4OGYA 2CMYA 3K2UA 1L4ZA 1O3KA 3KIDU 4Y76A 1C5LH 1GI3A 1D6WA 4KP0A 3GCTG 1DDJA 3GY5A 4GLYA 4D8NA 4MNXA 1GJAB 2FLRH 3LU9B 4SGAE 1KLJH 1T8NA 1GJ7B 1EUFA 4CRBA 2XC4A 3QTOH 5GJ4B 3PO1B 5F8ZA 3EA8A 3KQCA 3UPEA 1SHYA 3LKWA 3JZ1B 4INKA 1ACBE 4INLA 2NU4E 1DUAA 3NZIA 1CGJE 1G3EA 1GMHF 3O8CA 2QAAA 3V12A 3QK1A 1OYTH 4XOJA 1SGIB 3UNRA 3A86A 2AGGX 3MTYA 3RXIA 1D3DB 1CVWH 1LVOA 3FAOA 3BTFE 1SGNE 1CT0E 5AFYH 3SUGA 1GBCA 2C93B 2A5AA 1QGFA 3A88A 1TA6A 4B76A 3PWCA 2RCEA 1UCYK 1A5IA 2Y7XA 3ENSB 1S81A 3LPRA 4ABIA 3ZZBA 3SUDA 3AW1A 3HATH 1C1UH 1A0HB 1IHSH 1P01A 1Z8RA 3ATIA 4X2XA 1RFNA 3ZZ5A 3PO1C 3PMAB 4CRCA 2EI6A 1EAIA 3R3GB 1W14U 2XXLA 2EEKA 5HGGA 2GP9B 1BMLA 1C5RA 1PPZA 1Z71A 1IQLA 1TOMH 1F2SE 1O3PB 3FP8E 1QTFA 5C3NA 5EQRA 1ZSJA 1C2JA 1SI5H 1T4VH 2GCHF 1O38A 1AKSB 2BVRH 2F83A 3A8CA 1YPJH 4GUXA 1HB0B 2H2ZA 3MH4A 3Q76A 1PPCE 1VITF 3UQOA 3A82A 3S9BA 4NCYA 1YLDA 2HNTE 1ETSH 3A7YA 1TQ0B 3SHCH 1C1VH 1P03A 4JZDH 4Y6DA 1GBFA 2CF9H 2XBXA 1RS0A 1LTOA 3T27A 1SB1H 1QR3E 2AEIH 2DUCA 3OSYA 4FUDA 3ATKA 3KN2A 2Z9JA 4X1NU 4ZHAA 4CRAA 2ZGXH 4Z6AH 2GV7A 2ZKSA 1QHRB 4JZEH 1KYNA 2SFAA 4UEHH 5EOKA 3UQVA 1V2KT 4AFZA 3PTBA 5C67A 1MZDA 2EI7A 1PPHE 1LHDH 1S0RA 3GY8A 3TH2H 3DD2H 1O2NA 2PW8H 4Y0YE 3PM3A 1Q3XA 2BLVA 1JIMA 1MTNB 1SPJA 3LJOA 3MYWA 4I8LA 3A7TA 1GPZA 1QJ7B 1QL7A 1Y3WA 4MPUA 4A5TS 1GVZA 5DP4A 4E06H 4K60A 3T29A 1MKWK 1O0DH 1TGSZ 1QRWA 4Y0ZE 1GBEA 1O2UA 4U30A 1UVOA 1TPOA 3VEQB 2BXTH 3I78A 4FUGA 4CRDA 2HOBA 3S69A 1P57B 2XYAA 1GMCG 1ZJKA 3MU5A 3K65B 3VB3A 2Z9KA 2XCFA 1TIOA 1AN1E 1XVOA 2HNTC 3A89A 2DE9A 3E8LA 1GDUA 1MTNC 1VITH 3QGNB 1FMGA 3TJOA 3BSQA 1D3QB 4A1VA 1H8DH 3BTQE 2BDBA 1V2QT 2PKSB 5HMAA 3NPSA 4X8TH 2XC5A 4FUFA 2FOEA 2J92A 1NRQH 1A7SA 1H9IE 2VIQA 3KHVA 1V3XA 1T7CA 3ODDA 1O2OA 1TPAE 5F8XA 1QY6A 1TRNA 1ELGA 3GYMA 1C1RA 3M5OA 4LZ1H 5HXFA 1SHHB 3P6ZB 1Y5UT 1FN6A 1CGHA 1GHVH 2P95A 4ZXXH 3MMGA 4Y7AA 4AFUA 2BDGA 1NRRH 1QJ1B 3AAUA 5JBCS 1AU8A 1A3EH 2FXRA 4MPXA 1C1OA 3SJOA 4J1YA 3UNQA 5JB9S 1MBMA 2PGQB 2ZF0H 3OU0A 3ZVBA 1PQ5A 7GCHG 2G5NA 1V2RT 1N6XA 4NFFA 2PKSC 1SSXA 5A0BA 9LPRA 3UWIA 1K28D 1ZGVA 4BTIB 4B2CA 5E0HA 1MTSA 1ZSKA 3BV9B 3T28A 1AKSA 1ELDE 2R0LA 1C1MA 5FX5A 1SQTA 3JZ2B 1MKWH 1ZMJA 2UUJB 3ATLA 4ZKNU 4GSOA 1FDPA 3RXVA 3U1JB 1W10U 4TPYA 2QC2A 1Y3VA 5I25A 1C5TA 3M3VA 4XFQA 3M5LA 1TPSA 1LVYA 5EODA 1MD8A 3P8GA 1LPGB 3SV6A 1TRYA 1SGTA 1O2HA 3ZVDA 2BZAA 3Q00A 2VWNA 2OXSA 1TNJA 1QA7A 2ODPA 2ALVA 2VNTA 3L6PA 3ZZ9A 2SGAA 1XMNB 1VJAU 1IQIA 1GJBB 5C2ZA 3U69H 3SGAE 4CR5A 3FFGA 2A5IA 8GCHF 2BY8X 1YPKH 3AAVA 4XE4A 1ESTA 1Z8IB 3LJJA 2WPLS 3E0NB 1HUTH 1GVKB 1FY1A 2ANWA 2FYQA 1C2DA 1C5UA 1O5AB 4FU7A 4INHA 2R3UA 3RXEA 2B5TB 4DVAU 5T3HA 1GGDC 2A0QB 3RXRA 1UHBB 2ANMH 2V35A 1XX9A 5HM9A 5GCHF 1N6YA 3BTTE 1AVWA 1TGTA 1O2SA 3ZZAA 3B23B 2RA0A 1C5MD 1GBIA 3GDVA 4ABAA 1S0QA 1LVMA 1ELFA 2NWNA 3RMOH 1ELCA 3B9FH 4B1TA 2BDAA 3NCLA 3QN7A 2B9LA 4TYDA 3P8NA 4A7IB 3UOUA 1BRCE 1TX8A 1YPMH 1D3TB 2FESH 5JBBS 1YPHE 2OC7A 1EAWA 2OQ5A 1DXPA 1O5DH 4AYVB 2WV5A 5GIBA 4D9RA 4MG3A 1ZMLA 4HFPB 1YCPM 1L2EA 3GY3A 1HGTH 3V0XA 1ELVA 1OP2A 2BLOA 3A7WA 1F92A 3IG6B 1QB9A 3QZRA 1GI5A 4M7GA 3TK6A 1O5BB 1V2MT 2FDAA 1P09A 1P3EA 1TX6A 2O8MA 1HAPH 4BAMB 3ZZ4A 1EZUC 2ZPRA 1BDAA 1C5OH 2XBYA 4HGCA 3PLBA 1NPMA 1TNGA 3AVZA 3Q3YA 5DJ7A 1YYY1 1NFYA 1SOTA 3ATMA 1QBNA 1S6FA 1ZZZA 1TQ7B 2AFQB 2TGAA 1CU1A 4I7YH 1AZZA 1KDQA 2HLCA 5LPFA 2BX4A 1NROH 1ZRBA 1UTQA 1YCPK 1MKXH 1S83A 1LHGH 1FJSA 1O3MA 1QBVH 1GHZA 1HJAC 3TPIZ 3H5CB 1EP5A 2VIVA 1O3FA 2HPQH 2ESTE 2PTNA 2HALA