1QB1A

Bovine trypsin with 1-[2-[5-[amino(imino)methyl]-2-hydroxyphenoxy]-6-[3-(4,5-dihydro-1-methyl-1h-imidazol-2-yl)phenoxy]pyridin-4-yl]piperidine-3-carboxylic acid (zk-806974)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title Crystallographic analysis of potent and selective factor Xa inhibitors complexed to bovine trypsin.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qb1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qb1A02
1K1PA 1C1MA 1H4WA 1MKXK 5JDUB 4KP0A 2CXVA 4NSYA 2J95A 2O8LA 1J15A 3LJJA 1IQMA 1K28D 2BQ7B 4JMYA 3RXVA 1C1PA 3MMGA 1EP5A 3RXIA 1QL9A 3ELAH 5DP9A 2WYGA 1V2WT 1EPTB 2FOHA 3SJIA 2Y81A 2Y7XA 5JYIA 1IQJA 1KYNA 2B8OH 4OS5A 1QNJA 4U01A 5DJ7A 4CRBA 3I78A 1C5ZB 1C2EA 2J2UA 2O8WA 3PM3A 1GBIA 3HK3B 5A0BA 2FOAA 2WYJA 5EOKA 4R8TB 1AFQB 4AOQA 1PQ8A 1O5AB 3MWIU 1AE5A 2G00A 3MO9A 3P8NA 4AFQA 1IQGA 1ZYOA 3RXHA 1SFIA 3ATWA 4FU8A 1C5VA 2BVXH 4J2YB 3KF2A 1PQAA 2K1QA 1ELGA 2NU2E 4B71A 2EC9H 1PQ5A 1O2HA 2FOFA 2W26A 2ZU5A 2CGAA 3E8LA 1O5CB 1PPBH 4JYTA 1NZQH 1ANBA 4K8BA 4I32A 1GHXH 2P93A 4Y6DA 2XBWA 1E34B 4ZXYH 2G4UA 3SQHE 1GJDB 1GHBG 1J9CH 1ESBA 4IGDA 3EYDA 1O37A 2ILNA 3D65E 4ZAEA 4TPYA 5AFYH 3LGWA 4JK6A 1SQOA 3UOUA 2W3KA 4YTAA 3UFAA 3AASA 1MQ5A 1V2OT 4K8YA 1DUAA 4TY6A 4CH8B 2QXGA 2A2QH 4FUIA 3LDXH 4D9RA 1F0TA 1HNEE 1F5KU 1Y3WA 4HGCA 4DW2U 3RXTA 3NCLA 1GI8B 2GMTB 3BTFE 1DXPA 3LIWA 2O8UA 1GBKA 1PYTC 7ESTE 1DS2E 3UNRA 1UTOA 2A0QB 1UTMA 2Z9GA 2G5VA 2FDAA 3ZZCA 2PV9B 2FS8A 3GISB 2PWXA 3KEEA 3LGVA 5DP5A 1O3LA 1MCTA 2O9QA 3IITA 1C1NA 4ABBA 3P70B 2ZFTA 1A0JA 1WTGH 1ETSH 2O8MA 1FV9A 1AZZA 1TIOA 4K5ZA 1QBOA 1WTHD 1FI8A 1GDNA 1OYQA 1W7GH 1VJ9U 3EGKH 2ANWA 2FXRA 1Z8GA 3SOSA 1LVOA 1O32A 4GUXA 3UQVA 1LHGH 3PTNA 2GVFA 5EW1H 1SPJA 1C5NH 1AZ8A 1JRSA 2WPIS 4H6TA 1EZUC 2AS9A 2A1DB 1YC0A 1YYY1 3MNXA 1Y3VA 3G01A 4AFZA 1GCDA 2D26C 1YCPM 1XUIA 4I31A 3ZZ4A 2SGEE 3KCGH 1DY9A 2J92A 2IJOB 7GCHF 4ISLA 3BEFB 4DVAU 2ZCLP 3QZQA 3P92A 1ESAA 1BHXF 4ESTE 2QXJA 3A85A 4HZHA 1O3FA 1F0UA 2A4RA 4CHAC 4GSOA 3LONA 2OQ5A 1JXPA 3SGBE 1H9HE 2PHBA 3T29A 2ZHQH 1N1LA 1DWEH 3HGPA 4H6SB 5JPMH 1O2ZA 2XBVA 4X0WU 1MTWA 1V2NT 4A1TA 2ZTYA 1HRTH 1S81A 1TX6A 3IWMA 6GCHF 2OC1A 1C1RA 3L33A 3ZZ8A 3E0PB 1NO9H 1PPGE 3MH6A 5FCKA 1W2KH 1RS0A 3MNBA 2BLVA 3BTDE 1O36A 1CSOE 2TGAA 2QF0A 1O2RA 1DWBH 1SVPA 4Y7BA 1J17T 4RN6A 1GBAA 1QL7A 4I8LA 2Y5GA 4AZ2B 3CS0A 1FDPA 2AGIX 1SLVB 5AFZH 2GP9B 2FP7B 2H5CA 4I8JA 1EAXA 4DURA 1IQNA 2VWLA 4Y8ZA 1VZQH 5T3HA 1FY8E 1C4V2 1AKSB 1P05A 1T4UH 1OWDA 2C8WB 2ZQ2A 3D23A 1FJSA 3TJUA 1BJVA 1MTNB 1BTXA 3LU9B 5EQRA 4IW4E 4X8VH 1V2LT 4D7FA 1ANCA 2OBOA 3E90B 2RA0A 2I6SA 4YOGA 1UO6A 1BT7A 1O39A 4BANB 1LPZB 3LJOA 2VWOA 1NRRH 1XUKA 3NPSA 1TMUH 1INCA 4UFDH 4X1PU 5JBCS 3ZVGA 4X8SH 4YOJA 2WPMS 2OP9A 3A89A 3SGQE 1XUHA 1W0YH 1FNIA 5L2YH 1VITG 1C5TA 1J16A 3F9HA 3FAOA 3OYPA 3OX7U 2EI7A 4MNYA 4U30A 3TPIZ 1YP9A 3GCHC 3A82A 1QR3E 1OP0A 3SV6A 3RXJA 1C2KA 3K9XB 4JYVH 3P6ZB 4NZQA 1P01A 2FX4A 5E2PA 2TRMA 1AU8A 1ZRBA 1K1IA 4K1EA 4Y79A 3F9GA 4UFGH 3A84A 1ANEA 1CGHA 5DKMA 3SW2B 3MYWA 3UR6A 9ESTA 1EAIA 3RXEA 2Y6TA 1C2HA 1SLWB 2PUXB 4X8TH 3STIA 3SHAH 2QGRA 3M5OA 3K2UA 3Q3KA 4H4FA 1TNGA 3A8AA 2ALPA 4Q2KA 2C93B 1S6FA 1UHBA 2OCVB 1TNKA 3MNCA 1MAYA 2KAIB 2B9LA 3RXMA 1EAUA 2ZU2A 1P3EA 4YLUA 1AN1E 3PWCA 3ZVCA 4WVPE 3UY9A 2GZ7A 5EG4A 1KDQA 4ABDA 5FXLA 4JZDH 1SBWA 2G8TA 1RRKA 1KTTB 1OX1A 1PQ7A 3S7KB 3GDSA 2GGVB 2ZU3A 5JBBS 4WY3A 4UDWH 9LPRA 1KY9A 5C1UA 4RKJB 1MD7A 1ELBA 1KSNA 1F0SA 1T4VH 2JETC 1HB0B 2AMDA 2ZP0H 3A7YA 1QY6A 3ENSB 1DWCH 1F0RA 1AMHA 1GBHA 1TPAE 2Y5HA 3MO3A 5ESBA 1HJ9A 4INLA 2ZDNA 3UR9A 3PMJA 4ABIA 1GVKB 1O5GH 2ZGCA 3BG4C 3ZZBA 4B2BA 1GGDC 1VITH 1V2TT 1HYLA 3URDA 2UUJB 1XM1A 1EJMA 1A5GH 1BRUP 1PPZA 5HM9A 2XBXA 1Q31A 3EE0B 3TIUA 1C2JA 1BMMH 3ODDA 4M7GA 2ULLA 1TQ7B 1ZHRA 1BA8B 3GYMA 3VEQB 1D3PB 1GL1A 4NIYA 8GCHG 1LHCH 4NWLA 2Q6FA 2XRCA 3FVFB 2FYRA 5I46H 4SGBE 2TPIZ 2HOBA 1A5IA 1TNJA 4WMDA 1SGYE 4ZHAA 4MTBA 2YOLA 1GJ4H 1C5WB 1W10U 4IMZA 2G4TA 2C8YB 4IN1A 1YPHC 2Z9JA 1FAKH 1UTKA 4X8UH 3HGNA 1E38B 4JZ1A 1C2MA 1MQ6A 4AFSA 1GI6A 1HJ8A 1LVYA 2F9NA 1O3DA 2Z9KA 4E7NA 1Y3YA 3LH3A 3GCNA 2PSYA 3BF6H 3PMAB 4A6LA 1C1WH 1O3MA 2GD4B 4Q80A 1TNLA 1DFPA 1WCZA 1JBUH 1O2TA 2VJ1A 3SN8A 2I6QA 2PUQH 2AMPA 1ETRH 1SQAA 1VR1H 2W5EA 5DP6A 2BY9X 1D3TB 1P8VC 1TPPA 1O5FH 1C4Y2 4BAMB 3SNDA 4VGCC 1ELFA 2SGAA 1SMFE 1AVGH 3A87A 1UCYH 2FYQA 1VCQA 3MH7A 3P8GA 3Q00A 5JBTA 1IQKA 2FOCA 2XC0A 4QT8C 1GI1A 1AVWA 3RMNH 1DT2A 1O3NA 1XVOA 4AYVB 1CGIE 1DLKB 1O2UA 1HAYB 2XCFA 3ZVFA 1BTWA 1K2I1 4YM9A 1O2VA 5F8TA 1C5UA 2ZCKP 1WQSA 3DFJA 3SU2A 1ACBE 1ZPCA 1HCGA 3TJNA 3RXGA 3V3MA 3NK8A 2XWAA 3TVJB 3ZVAA 2QXIA 1K1JA 1C5YB 1QURH 3V7TA 1LQDB 3BTTE 3U98H 1W14U 3EA9A 1HV7A 1LMWB 2ZDKA 1DPOA 2UWPA 1KXAA 2XXLA 2CF9H 3UNQA 3ZZ9A 2QIQA 4OS6A 2R2MB 2EI6A 3P17H 2ZHWH 3ODFA 3LKWA 1GI5A 1AO5A 5FX6A 4Q7YA 3U69H 1TOCB 2GCHF 3QWCH 1W0ZU 1C5PA 1H9IE 1ZJDA 4I8GA 1C9TA 4K60A 1OWEA 1OP2A 4BAQB 2ZFRH 1ELCA 3ZVBA 1N8OC 1K1NA 2FX6A 1CGJE 1THRH 4GCHF 2QA9E 1IQIA 1HAVB 1NU9A 2FMJA 3BTWE 3VB3A 1TB6H 1DWDH 1DDJA 3EDXB 3QGJA 5LPRA 4THNH 2C3SA 1H9LB 4RSPA 1NESE 2B0FA 1A4WH 2P3UB 1DITH 4ABGA 1YCPH 4MVNA 4YESB 2Q6GA 3STJA 5HXFA 1UK2A 2BLWA 2CHAC 3I77A 1NRNH 4K69A 3UIRA 2WPJS 2OC7A 4ZHLU 1Z6JH 2GTBA 1FN6A 3FANA 1K1OA 1O38A 4BAOB 1GMDG 5JB8S 3MU5A 2TBSA 4RKOB 2ZIQH 1CBWC 1TGTA 5LPEA 4I7YH 1WQVH 2BD8A 2ASUB 4CRFA 1F5LA 1IOEA 2F9VA 2JETB 1TRNA 2GCHG 2XNIA 4Q7XA 2Z9LA 2VGCC 5FAHA 1UCYK 2BDBA 4FUJA 1A0LA 1LKAA 1FAXA 2QYIA 2BD7A 3BG4B 1NFWA 2IN2A 3FP6E 4LZ4B 2AGEX 2AYWA 3P8FA 3ZV9A 1QJ7B 2GCTC 4JZEH 2XWBI 2NU4E 3QTOH 3ZZAA 3SUGA 3PO1B 3RMMH 1GWAA 1SB1H 3PB1E 1CT0E 1P10A 2FIRH 3D62A 3UREA 1LO6A 4MPVA 3PROA 2H9EH 1SGEE 2ZNKH 1TONA 4O9VA 1ZOMA 4X6MA 1GDQA 2OD3B 1XVMA 3ZYDA 1Z8IB 2BX3A 1ZR0A 1GI7B 3M3TA 1QRWA 3R3GB 3FP7E 2BY7X 4F4OC 3RXLA 1KIGH 4AB9A 4SGAE 1A46H 1O3GA 2HVXA 5GPIB 1C2FA 3MU4A 3DFLA 1UMAH 1GBMA 1L4ZA 2XC5A 4D7GA 2FOMB 2D2DA 2SGDE 2SGFE 1LCYA 1U6QA 3SZNA 1TABE 2C8XB 3VGCB 1O0DH 2ANMH 1BDAA 3T26A 1IHTH 4NIXA 2R0LA 1W8BH 5EPYA 1YPKH 1UTQA 1XXDA 3P95A 1TBQH 3BN9A 4DIHH 1Z7KA 3B9FH 5A8ZA 1SR5C 1Y5AT 2VIWA 3NUMA 5T6DA 3S9CA 3S9AA 1NN6A 1B5GH 1FPHH 1MUEB 1O2SA 1UHBB 5A8YA 4GAWA 1YCPK 5DO4H 5C1XA 1SI5H 1HAPH 4GVUA 5EXLA 1WBGB 1BOQA 3D49H 3RM2H 1NRQH 2VIDA 1BMNH 3LH1A 1ZLRA 3SI4H 1X7AC 1P2OA 1P9SA 2BD3A 1BTPA 1O2GH 3GY2A 4ZROA 2TGTA 1LHFH 1EP6A 1LPKB 2GT8A 1TRYA 5LH8A 1ELAA 4K2YA 1QGFA 2BOHB 1GHVH 1KXBA 1BJUA 1EZSC 2RG3A 1C5QA 2GZ9A 6CHAC 1O2XA 2G55A 1VGCB 4INHA 4MLFB 1FPCH 2VIOA 3MU0A 4XDEA 4NA8A 1RXPA 5FBIA 5GJ4B 1B7XB 3ZZ6A 1XXFA 3SNCA 3SV9A 2FZZA 3V12A 1GBFA 1L4DA 2HNTC 2F3CE 2Z3DA 2Q6DA 5FCRA 1HGTH 1QTFA 1O5EH 1RGQA 3B8JA 3MTYA 1G32B 1O3IA 2ZTXA 3RC5A 2G51A 2XCNA 1Z71A 2HPQH 2QCYA 5DPAA 1C1SA 1NFXA 2ZC9H 1GVZA 1ETTH 1TBZH 1J14A 4Y71A 1NRPH 2QAAA 3K65B 4MNVA 3SNEA 4ZXXH 4WMFA 3OSYA 1FY1A 2J4IA 4FUGA 3CP7A 4GHQA 3PWBA 1S83A 1UVTH 3Q76A 1C2DA 3SUEA 3AW1A 2FI3E 1O3EA 4CRAA 1DICA 4UE7H 2R3YA 3KQBA 3SU4A 1YF4A 2IPHA 1CA0C 3A8BA 1O31A 1QHRB 1P3CA 3U1IB 5GIBA 5TCAA 2D1JA 1A61H 4D8NA 1XUFA 2G52A 1DUEA 1CHOF 1HJAB 1UTLM 1C2IA 1JMOH 5DG6A 2STBE 3SNAA 1V3XA 1UVUH 1WAYB 1HAGE 1V2QT 1O2PA 1FQ3A 5GCHF 4LOYH 1BIOA 1A1RA 1CVWH 1OS8A 1P04A 2F9UA 4KTUA 5LGOA 5E0JA 2JH6D 2OC0A 2Y7ZA 5T6FA 5GWZA 3V13A 1P2NA 5FX5A 1YPHE 1ABJH 2ZU4A 1FN8A 3M37A 1FIZA 3SV8A 1RTKA 1MKWH 1ZMJA 3BG8A 3T25A 3QX5H 1G30B 7GCHG 3HPTB 1SGTA 3A88A 3PLPA 3RDZA 1C4U2 3NWUA 2SGQE 1GMHF 1A3EH 1F5RA 1HAHH 1L0ZA 2W3IA 2VVVA 2THFB 1C5SA 2BX4A 3HKIB 3RU4D 2Y5FA 2ZI2H 3IG6B 3SV2H 2ZFQH 4CBNA 1Y8TA 2AERH 2GV7A 3T27A 1O2MA 5C3NA 1HBTH 3H7TA 4WH8A 1Y3UA 3KIDU 1GCTC 1CHOG 2FO9A 2ZDVH 4Y76A 6GCHG 2RDLA 5IYTA 1O3HA 1QJ1B 1C5MD 3T2NA 1YPLH 2PKSC 4FUEA 3SU0A 1E36B 2VNTA 2ZPSA 1AVXA 3M35A 4TY7A 3RXSA 4AFUA 1S0RA 2AIQA 1EPTA 4AN7A 1IQLA 1Y5UT 2FOEA 2ZU1A 2R0KA 1Y5BT 2VH6A 3OTJE 4LZ1H 1Q2WA 4NA7A 3F9FA 1GI3A 2FI4E 2BVSH 3CS7A 5F03A 5EGMA 3F68H 1EXFA 2Z6BD 1P02A 3PYHA 2PTNA 1MU8B 1TMTH 3GY3A 3RUOA 5AVDA 1TLDA 1ARCA 4GPGA 1FY3A 1HLTH 1DSUA 6ESTA 3DT0H 1GHYH 4UEHH 4UFEH 1K1LA 2P8OC 3VFEA 2AIPA 3NXPA 1CT4E 3U8RH 1N6XA 1ZGVA 3A80A 3KNXA 1C2LA 3PMBB 1DOJA 2Q1JA 1JOUB 2HRVA 1SGPE 1MZDA 1HAZB 1SFQB 3SU6A 1THPB 5C2ZA 3RU4T 1G2LA 1NRSH 2BXUH 4ISNA 1PPHE 1LTOA 2CV3A 5LPFA 3V0XA 4NFEA 1ARBA 1EKBB 1K21H 3F6UH 1DSTA 3MFJA 4INKA 1S0QA 4JZFH 1EASA 1J8AA 1PFXC 1QQUA 1XKAC 2ZA5A 2BXTH 1FY5A 1ZTKA 1EQ9A 3ZZ3A 1GG6C 2A5AA 1ZMLA 1P2JA 3TGIE 2WINI 1RFNA 1WV7H 5FPTA 1TWXB 2ZGXH 1ORFA 1P09A 1UTNA 1P0SH 3MNSA 2F83A 3RU4E 1ZTJA 1MKWK 1O2NA 5TCCA 4WF8A 2C90B 1T8OA 5F8XA 3UQOA 1RIWC 4X1QU 3E6PH 1MBMA 1O2JA 1EUFA 3QN7A 4Z0KA 4DGJA 1C1OA 2F9PA 1A0HB 2VH0A 5GDSH 1AD8H 1TOMH 2H5DA 3M5LA 2YNBA 1Z1JA 2H6MA 1UCYE 2JH0D 3EQ0H 1WU1A 1EX3A 4ABJA 2PSXA 3HATH 4K1TA 1AUTC 3LOXA 4NSVA 1YPMH 2FODA 1TPOA 1GJ8B 1Y3XA 2XW9A 5C20A 3AW0A 3ATMA 2BD2A 3BEUA 4CHAB 4DJZB 4XBBA 1P2KA 3M5NA 1EPTC 5EQQA 2PW8H 1ESTA 2ZGBH 4XE4A 4NZLA 2NU0E 1O33A 1QA0A 1IQFA 1C5XB 1O35A 3MU8A 4B2CA 4CRCA 4ZHMU 1NFUA 1W7XH 3RMLH 1GI0A 3EA7A 4FXGH 2FI5E 2UWLA 1UVOA 1AFQC 4Y8YA 3RC4A 3GICB 1OWIA 4KGAA 1RTFB 4HFPB 1PPCE 5A2MH 1BBRH 1S84A 2WUBA 2Y82A 5AHGH 4YLQH 4MNXA 2VIPA 3OY6U 5HYOA 2WUCA 5CE1A 3VB6A 3QTVH 3HK6B 3F1SB 1EZXC 4JK5A 2R9PA 1AY6H 1MTVA 2Z3CA 1JIRA 3EAJA 2BYAX 1D3QB 3U8OH 2QN5T 1HIAA 2R3UA 1S6HA 4AGJA 3ATIA 3GOVB 3NZIA 1OSSA 1WUNH 1UK4A 2A31A 2PKAA 2G5NA 1KXDA 2NU1E 2OXSA 2DE9A 2BZAA 5SGAE 3SUDA 3SJ9A 5L6NH 5G4BA 4BXSA 1ID5H 4ABHA 4D9QA 4X6NA 1NTPA 2V3OH 1BZXE 4BNRA 3GY7A 1JIMA 3L6PA 3I29A 1AKSA 1GJ5H 3RXDA 1GHAF 2AMQA 4KKDA 4TWYA 2GMTC 1DXWA 1DLEA 1QB1A 3RXPA 2GDDA 1O2KA 2FOBA 2B7DH 1SC8U 2BDGA 3GCHB 1A3BH 1BRCE 3NKKA 4NIWA 1GI4A 1C5RA 3TK9A 2PKSB 1FMGA 1E0FD 1TE0A 1ZSJA 3UWJH 3BEIB 5ESTE 4XBDA 1QQ4A 1NT1A 1L1NA 2ANKH 2O8TA 4AORA 5A09A 3QGNB 1MZAA 1VCPA 2UUYA 3PTBA 1O3KA 3JZ1B 1P2QA 2W7SA 5JBAS 4UFFH 1XUGA 1T8LA 3P8OA 4TYDA 4CR9A 4FVBA 2V3HH 3K6YA 1S5SA 4IC5A 4K1SA 4NFFA 5E2OA 3RXOA 3KQDA 1CQQA 3PV4A 4CR5A 1NPMA 3SJ8A 1O2OA 2BOKA 3RXFA 4ABAA 5C1YA 2PFEA 4BTIB 2ZZUH 1OXGA 4AYYB 1GMCF 1AWFH 2BHGA 1P2MA 4OS4A 2SNVA 4AX9H 1TQ0B 2UUFB 2P8OB 4FU7A 4JZIA 3SBKA 4X1RU 1C9PA 1O34A 3GCTF 4XSKU 4BTUB 4H42U 2JH5D 1T8NA 4WMEA 2ZQ1A 3GDUA 3SJOA 4LK4A 3SU5A 1TPSA 1GL0E 2HNTE 1C1TA 1LVBA 4LXBH 4MNWA 4J1YA 1SOTA 1TGNA 1KTSB 4B75A 2A5KA 2UUKB 5DP8A 1HPGA 3SUFA 1ABIH 1YLDA 1W3CA 3BTGE 4E7RG 1PPEE 1UTPA 3AVZA 2GKVE 1BBRK 1CO7E 1XUJA 1C5LH 3BV9B 2KAIA 2ZCHP 3GYLB 5A0CA 2QY0B 1P9UA 1G37A 3DA9B 2ZHDA 4DG4A 1SHYA 3QO6A 1DY8A 1YM0A 1AB9C 1FIWA 3Q3YA 3BTEE 3CENA 4MPWA 1HXEH 1OWKA 3SHCH 1DM4B 1GGDB 1KLJH 1TGBA 4MG3A 3RP2A 4GCHG 2C8ZB 4ZKNU 4YZUA 1TNHA 3RXUA 1M9UA 3A7TA 3RXCA 4XBCA 1TX7A 1ELEE 1GHZA 2GV6A 1N6YA 2ZPRA 1V2UT 4YT6H 1AE8H 1ZGIA 3FP8E 1H8IH 5EPNA 1OWJA 1GVLA 1UJ1A 3UOPA 1V2VT 2H9TH 4X2WA 4AG2A 1GHBF 1O2QA 1KLTA 3SGAE 1QB9A 4JCNA 3S7HB 1MTNC 5DK1A 3H5CB 1ZRKA 2BMGB 3UTUH 5GXPA 1QB6A 2ZFSA 7LPRA 3RXKA 4AG1A 5CMXH 2ZFFH 2ALVA 3HKJB 3U9AH 2ZHFH 3RLYH 1Z8RA 1GBDA 2VU8E 1GI9B 1AIXH 2HPPH 1ZSKA 1WSSH 1Z1IA 1EJNA 1FZZA 1MCVA 1SLUB 1GJCB 1UTJA 3B23B 1A5HA 2F9BH 4Y0YE 2YNAA 4WXIA 5FPYA 3SORA 2P95A 1RTLA 1G3EA 2A7JA 1GBBA 2EEKA 2BDIA 1CT2E 2Z9IA 1BTUA 1ZPZA 2A5IA 1GBJA 5T6GA 1JWTA 1V2PT 3M36A 3SQEE 3A86A 2RCEA 3KHVA 2FWWA 1W12U 2A45B 4X6PA 5A8XA 4MDSA 3TK6A 1QFKH 4OS1A 1HXFH 4OS2A 1P06A 2PTCE 2F9OA 3LGIA 1HAOH 3QUMP 4B76A 4NG9H 4VGCB 1IHSH 2UWOA 5J4SA 1V2RT 1EOLA 1TA2A 2NU3E 2OINA 4IMQA 3TK5A 3E16B 3M7UA 1GJ7B 2NWNA 1RJXB 5C5OA 1O2YA 2P16A 2WV4A 2ZG0H 2VINA 3WY8A 1YPGH 4Y0ZE 2BDYA 2A4QA 5FHTA 1KDQB 1HUTH 8KME2 2WPLS 3MH5A 3RXRA 1BHXB 3T28A 3VPKA 1L1GA 1C5OH 2TIOA 3A7XA 2B5TB 3TGJE 2FOGA 2P94A 1SGIB 1A2CH 2FLRH 3M61U 4Y11E 2SFAA 1TGCA 3MI4A 3N7OA 4KTCA 5HM2A 1V2ST 3LGTA 5IDKA 1O3AA 2BDAA 2BVRH 3QDZB 1V2JT 3QLPH 2P3TB 2BZ6H 2STAE 4B2AA 1WYKA 2V0BA 1D9IA 1LVMA 2ZDAH 4I8HA 1ZMNA 3EA8A 2BD9A 4ZKOU 4DOQA 2EA3A 3PLBA 1FUJA 1O3JA 5K0HA 3W95A 3MH4A 4NWKA 1ZZZA 3BIUH 1TGSZ 3KQEA 1HDTH 1MD8A 5E8EH 3RMOH 1DE7H 1S85A 5I25A 3E3TA 1SGNE 4FU9A 1C1VH 1HAXB 4ASHA 3T62A 4A1VA 1N8OB 2WPKS 5B6OA 1K22H 2LPRA 2BY5X 4GLYA 1BTHH 1L1JA 4B73A 1QCPA 2FM2A 1T8MA 4I8KA 1AHTH 2R2WU 3BTHE 1TALA 3GDVA 3LC5A 1BTZA 4YT7H 3M3SA 3H7OA 3MOCA 4YO9A 6LPRA 1EJAA 8LPRA 2CHAB 3VXFH 1W13U 3A83A 1QRXA 1NY22 4TWWA 5EQSA 2A4OA 1SGCA 1Z6EA 4FUDA 3FZZA 1OYTH 5A0AE 2J94A 3TH2H 1O5DH 1G3BA 2ZO3H 1HAVA 1QBVH 1P12E 4X2YA 3S69A 1OPHB 1Z8JB 4I33A 3E91A 2AH4X 1CBWB 1QJ6B 2A7HA 1O30A 4XOJA 5ABWA 3C27B 5EU8A 1C1UH 2BLQA 1K1MA 1GBEA 2OLGA 1P11E 3TGKE 1O2LA 2VGCB 1AB9B 4PROA 3ZZ5A 1TMBH 1TYNA 1FLEE 2BDCA 1VITF 2XBYA 4OS7A 3BIVH 1KXFA 1TA6A 2BB4A 1BRBE 1TFXA 3SO3A 2SGPE 3M7QA 4X2VA 1HIAB 2GCTB 2F91A 1AGJA 5ETXA 2GDEH 2Z7FE 2PKAB 1NC6A 3DHKH 1G3DA 2XTTB 1XKBC 1NU7B 2V6NA 3MU1A 3DUXH 3PLKA 5PTPA 2FTLE 3RXQA 2AFQB 2VWNA 1CE5A 3F9EA 1SGDE 1O3OA 1K9OE 5E0GA 1UVPA 1EZQA 2PGQB 2CJIA 5DP3A 1PJPA 1ELTA 4FUFA 4X2XA 1CHGA 2J34A 5J4QA 4A92A 1V2KT 1BUIA 1ZHMA 1T7CA 2ZPQA 4U32A 1EB1H 3AAUA 3Q77A 1GHWH 3TITA 3A7VA 5BRRE 4O3UA 3OU0A 3LC3A 3QK1A 1V2MT 1BMLA 1GBTA 1GBCA 3O8RA 1BB0B 2HGTH 1EOJA 5GCHG 1AWHB 3T5FH 3TU7H 2IOTA 4A7IB 1ZHPA 4CREA 1QL8A 1SSXA 4ZUHA 7KMEH 1H8DH 1MTUA 3SV7A 4ISIH 1E37B 1LPGB 1KLIH 4CRGA 3U1JB 2QXHA 5FBEA 3KQCA 1IQEA 2BDHA 2W7UA 4UONA 1OOKB 4BOHA 4ISOA 3BTKE 1P2IA 2QV1A 1NROH 2ODPA 5CHAC 3TJOA 2ODQA 1LQEA 3ZZDA 3A8CA 1CA8B 4IN2A 1ZSLA 5E0HA 4NCYA 4ZKSU 1CU1A 1D3DB 4DY7B 3GY5A 4OGXA 1GBLA 1RD3B 4E06H 1GMHG 5DP4A 1S82A 2WPHS 3GY8A 3L3TA 2ODYB 4B1TA 1OKXA 2HLCA 1F2SE 2QC2A 3FZDA 4FVDA 4Y7AA 1MU6B 1SL3A 4ISHH 2CMYA 1C1QA 1LHDH 1ELDE 1G2MA 1SLXB 4MPUA 1MTSA 3LGUA 1HAIH 2HWLB 3RM0H 4X6OA 2BY8X 1EATA 2OQUA 2VB0A 8GCHF 4A5TS 2FESH 2BTCE 3R0FA 1F7ZA 3ZYEA 1XX9A 2SNWA 6CHAB 1SGQE 1VCWA 3KL6A 4GHTA 3UPEA 1GJ9B 3W94A 3TJVA 2TGPZ 5HMAA 2A7CA 1GI2A 5L30H 3M7TA 2JKHA 1F92A 1DVAH 3QZRA 2ZDMA 4U2WA 1LKBA 3LPRA 1G9IE 2ZF0H 3TH3H 4KTSA 5TJXA 1BQYA 2ZGHA 2AEIH 2J38A 3AAVA 2P59A 2A32A 2DUCA 1Q3XA 4B74A 4ZMAH 1P03A 3VB7A 5F8ZA 1MAXA 4XFQA 3UNSA 1GDUA 1BBRE 2ZFPH 1ZJKA 1BITA 1AFEH 2RA3A 2OUAA 5L2ZH 2FEQH 2ZGJA 5F6MA 3PMHB 1GPZA 2ANYA 4Q7ZA 1YGCH 5JB9S 2BD4A 3C1KA 2ZWLH 3PO1C 4DIIH 4IBLH 3BTME 1SGFG 3GCOA 1EAWA 1QIXB 4CBOA 5DGJA 1D6RA 3TNSA 1OP8A 3VB5A 2ZTZA 2XC4A 1TX8A 2H9HA 1CA0B 3SI3H 1E35B 4BAKB 3Q3XA 4X1SU 3VXEH 4WH6A 3JZ2B 3ZZ7A 2VVCA 3U8TH 1SGRE 4DT7B 1W11U 2BQ6B 2ZECA 1XMNB 4NA9H 4O97A 2J9NA 1PYTD 4MQAA 2ZHEH 4WXVA 4Y8XA 2G81E 4BAHB 4D76A 3O8DA 4YOIA 2GZ8A 2TGDA 4CRDA 1BRAA 1THSH 2OBQA 1YBWA 2Z94A 1IAUA 4ZH8A 4NGAH 1ZPBA 1SG8B 3ZVDA 1PPFE 2BQWB 1EB2A 4FUHA 1MMJN 3VGCC 1BMAA 2OTVA 3ITIA 3M5MA 1AI8H 4ZKRU 3GY4A 1G36A 3TNTA 2HNTF 3UUZA 3MO6A 2DE8A 2VIQA 4FUCA 1YLCA 3E1XB 1G3CA 2BLOA 3LT3A 4WWYA 3TLOA 2CF8H 1SHHB 1O3PB 2GT7A 1YPEH 1Y59T 1T32A 4A1XA 1LHEH 4IS5A 1O5BB 3VB4A 2ZDLA 2FLBH 1BCUH 3LGYA 4UD9H 3SJKA 1ZTLA 1GCTB 8ESTE 1MKXH 1H1BA 1DANH 1JRTA 2VVUA 3S0NA 1P57B 1SGFA 2FTMA 1NM6A 3FFGA 1D4PB 1L2EA 2FS9A 4K3JA 1YKTA 4WJG2 4ABFA 3SU3A 1MH0A 2Z3EA 5BPEA 1GJ6A 1NS3A 2BY6X 1ANDA 3RC6A 5EODA 4AGKA 4OGYA 5EXMA 2OC8A 4E05H 5C67A 1C2GA 3ATLA 3UWIA 1O2WA 1GMDF 1VGCC 1TNIA 2BM2A 2ESTE 4AB8A 1HFDA 1V6DA 1GJBB 3URCA 4ABEA 1TRMA 2WV5A 4JYUH 4Z6AH 2PGBB 1B0FA 3A7WA 1TBRH 2ZKSA 4IC6A 3ATKA 5CHAB 1O3CA 3K6ZA 3SU1A 4DCDA 2ZEBA 3O8BA 1YPJH 1FY4A 4Y10E 3S9BA 2A2XH 1ELVA 1SOZA 2VWMA 4F49A 1BTYA 5AF9H 1SQTA 3OY5U 4TPIZ 1QBNA 2M5TA 4KELA 2AGGX 2XYAA 1KXCA 1A7SA 2V35A 3A81A 1IQHA 2FPZA 2LNCA 1GHAG 1MBQA 2GX4A 3E0NB 2H1UA 1O2IA 1O3BA 1DX5M 2CN0H 5DP7A 3RXBA 5H4IB 3O8CA 2QF3A 4BTTB 2P3FH 1T31A 1AQ7A 1QA7A 3BTQE 1B0EA 2HALA 1GG6B 2D8WA 4FUBA 1NFYA 3RLWH 3RXAA 2EI8A 2PLXA 1D6WA 1GJAB 1WOFA 4BXWA 1QRZA 4MPXA 1OWHA 3KGPA 3A8DA 1HJAC 1KXEA 1UVSH 3MHWU 4CH2B 4O03A 2BD5A 3SNBA 1FXYA 1UK3A 1RIWB 3ESTA 2PR3A 1VJAU 1FONA 2C4FH 4X1NU 1GMCG 4NIVA 3TH4H 5EW2H 1AUJA 4HI3A 2H2ZA 3A7ZA 3KN2A 3M3VA 4HTCH 5FPSA 5HGGA 2VIVA 3GCTG 3DD2H 3ZVEA 1TAWA 3GY6A 3BSQA 3ZV8A 1LDTT 5EXNA 2A4GA 2Y80A 4O3TA 4R0IA 5C5NA 5K7RA
chains in the Genus database with same CATH superfamily
1K1PA 1C1MA 1H4WA 1MKXK 5JDUB 4KP0A 2CXVA 4NSYA 2J95A 2O8LA 1J15A 3LJJA 1IQMA 1K28D 2BQ7B 4JMYA 3RXVA 1C1PA 3MMGA 1EP5A 3RXIA 1QL9A 3ELAH 5DP9A 2WYGA 1V2WT 1EPTB 2FOHA 3SJIA 3F0OA 4XRNA 2Y81A 2Y7XA 5JYIA 2YMSB 1IQJA 1KYNA 2B8OH 4OS5A 1QNJA 4U01A 5DJ7A 4CRBA 3I78A 1C5ZB 1C2EA 2J2UA 2O8WA 3PM3A 1GBIA 3HK3B 5A0BA 2FOAA 2WYJA 5EOKA 4R8TB 1AFQB 4AOQA 1PQ8A 1O5AB 3MWIU 1AE5A 2G00A 3MO9A 3P8NA 4AFQA 1IQGA 1ZYOA 3RXHA 1SFIA 3ATWA 4FU8A 1C5VA 2BVXH 4J2YB 3KF2A 1PQAA 2K1QA 1ELGA 2NU2E 4B71A 2EC9H 1PQ5A 1O2HA 1VKYA 2FOFA 2W26A 2ZU5A 2CGAA 3E8LA 1O5CB 1PPBH 4JYTA 1NZQH 1ANBA 4K8BA 4I32A 1GHXH 2P93A 3W1EA 4Y6DA 2XBWA 1E34B 4ZXYH 2G4UA 3SQHE 1GJDB 3PV5A 1GHBG 1J9CH 1ESBA 4IGDA 3EYDA 1O37A 2ILNA 3D65E 4ZAEA 4TPYA 5AFYH 3LGWA 4JK6A 1SQOA 3UOUA 5EIYA 2W3KA 4XD7D 4YTAA 3UFAA 3AASA 1MQ5A 1V2OT 4K8YA 1DUAA 4TY6A 4CH8B 2QXGA 2A2QH 4FUIA 3LDXH 2HVYB 5CHBA 4D9RA 1F0TA 1HNEE 1F5KU 1Y3WA 4HGCA 4DW2U 3RXTA 3NCLA 1GI8B 2GMTB 3BTFE 1DXPA 3LIWA 2O8UA 1GBKA 1PYTC 7ESTE 1DS2E 3UNRA 1UTOA 2A0QB 1UTMA 2Z9GA 2G5VA 2FDAA 3ZZCA 2PV9B 2FS8A 3GISB 2PWXA 3KEEA 3LGVA 5DP5A 1O3LA 1MCTA 2O9QA 3IITA 1C1NA 4ABBA 3P70B 2ZFTA 1A0JA 1WTGH 1ETSH 2O8MA 1FV9A 1AZZA 1TIOA 4K5ZA 1QBOA 1WTHD 1FI8A 1GDNA 1OYQA 1W7GH 1VJ9U 3EGKH 2ANWA 2FXRA 1Z8GA 3SOSA 1LVOA 1O32A 4GUXA 3UQVA 1LHGH 3PTNA 2GVFA 5EW1H 1SPJA 1C5NH 1AZ8A 1JRSA 2WPIS 4H6TA 1EZUC 2AS9A 2A1DB 1YC0A 1YYY1 1H8HD 3MNXA 1Y3VA 4B6FA 3G01A 1WXRA 4AFZA 1GCDA 2D26C 5EJZA 4I86A 1YCPM 4DT4A 1XUIA 4I31A 3ZZ4A 2SGEE 3KCGH 1DY9A 2J92A 2IJOB 7GCHF 1H8ED 4ISLA 5F53A 3BEFB 4DVAU 2ZCLP 3QZQA 3P92A 1ESAA 1BHXF 4ESTE 2QXJA 3A85A 4HZHA 1O3FA 1F0UA 2A4RA 4CHAC 4GSOA 3LONA 2OQ5A 1JXPA 3SGBE 1H9HE 2PHBA 5IK2D 3T29A 2ZHQH 1N1LA 1DWEH 3HGPA 4H6SB 5JPMH 1O2ZA 2XBVA 5GNDA 4X0WU 1MTWA 1V2NT 4A1TA 2KCYA 1HRTH 2ZTYA 1S81A 1TX6A 3IWMA 6GCHF 2OC1A 1C1RA 3L33A 3ZZ8A 3E0PB 1NO9H 1PPGE 3MH6A 5FCKA 1W2KH 1RS0A 3MNBA 2BLVA 3BTDE 1O36A 1CSOE 2TGAA 2QF0A 1O2RA 1DWBH 1SVPA 4Y7BA 1J17T 4RN6A 1GBAA 1QL7A 4I8LA 2Y5GA 4AZ2B 3CS0A 3F2HA 1FDPA 2AGIX 1SLVB 5AFZH 2GP9B 2FP7B 2H5CA 4I8JA 1EAXA 4DURA 1IQNA 2VWLA 4Y8ZA 1VZQH 5T3HA 1FY8E 1C4V2 1AKSB 1P05A 1T4UH 1OWDA 2C8WB 2ZQ2A 3D23A 1FJSA 3TJUA 1BJVA 1MTNB 1BTXA 3LU9B 5EQRA 4IW4E 4X8VH 1V2LT 4D7FA 1ANCA 2OBOA 3E90B 2RA0A 2I6SA 4YOGA 1UO6A 1BT7A 1O39A 4BANB 1LPZB 3LJOA 2VWOA 1NRRH 1XUKA 3NPSA 1TMUH 1INCA 4UFDH 4X1PU 5JBCS 3ZVGA 2QF4A 4X8SH 4YOJA 2WPMS 2OP9A 3A89A 3SGQE 1XUHA 3N99A 1W0YH 1FNIA 5L2YH 1VITG 1C5TA 1J16A 3F9HA 3FAOA 3F3BA 3OYPA 3OX7U 2EI7A 2V7QD 4MNYA 4U30A 3TPIZ 1YP9A 3GCHC 3A82A 1QR3E 1OP0A 3SV6A 3RXJA 1C2KA 3K9XB 4JYVH 3P6ZB 4NZQA 1P01A 2FX4A 5E2PA 2TRMA 1AU8A 1ZRBA 1K1IA 4K1EA 4Y79A 3F9GA 4UFGH 3A84A 1ANEA 1CGHA 5DKMA 3SW2B 3MYWA 3UR6A 9ESTA 1EAIA 3RXEA 2Y6TA 1C2HA 1SLWB 2PUXB 4X8TH 3STIA 3SHAH 2QGRA 3M5OA 1UW7A 3K2UA 3Q3KA 4H4FA 1TNGA 3A8AA 2ALPA 4Q2KA 2C93B 1S6FA 1COWD 1UHBA 2OCVB 1TNKA 3MNCA 1MAYA 2KAIB 2B9LA 3RXMA 1EAUA 2ZU2A 1P3EA 4YLUA 1AN1E 1NBME 3PWCA 3ZVCA 4WVPE 3UY9A 2GZ7A 5EG4A 1KDQA 4ABDA 5FXLA 4JZDH 1SBWA 2G8TA 1RRKA 1KTTB 1OX1A 1PQ7A 3S7KB 3GDSA 2GGVB 2ZU3A 5JBBS 4WY3A 4UDWH 9LPRA 1KY9A 5C1UA 4RKJB 1MD7A 1ELBA 1KSNA 1F0SA 1T4VH 2JETC 1HB0B 2AMDA 2ZP0H 3A7YA 1QY6A 3ENSB 2J98A 1DWCH 1F0RA 1AMHA 1GBHA 1TPAE 2Y5HA 3MO3A 5ESBA 1HJ9A 4INLA 2ZDNA 3UR9A 3PMJA 5EJLA 4ABIA 1GVKB 1O5GH 2ZGCA 3BG4C 3ZZBA 4B2BA 1GGDC 1EFRD 1VITH 1V2TT 1HYLA 3URDA 2UUJB 1XM1A 1EJMA 1A5GH 1BRUP 1PPZA 5HM9A 2XBXA 1Q31A 3EE0B 3TIUA 1C2JA 1BMMH 3ODDA 4M7GA 2ULLA 1TQ7B 1ZHRA 1BA8B 3GYMA 3VEQB 1D3PB 1GL1A 4NIYA 8GCHG 3OE7D 1LHCH 4NWLA 3F2FA 2Q6FA 2XRCA 3FVFB 2FYRA 5I46H 4SGBE 2TPIZ 2HOBA 1A5IA 1TNJA 4WMDA 1SGYE 4ZHAA 4MTBA 2YOLA 1GJ4H 1C5WB 1W10U 4IMZA 2G4TA 2C8YB 4IN1A 1YPHC 2Z9JA 4M9FA 1FAKH 1UTKA 4X8UH 3HGNA 1E38B 4JZ1A 1C2MA 1MQ6A 4AFSA 1GI6A 1HJ8A 1LVYA 2F9NA 1O3DA 2Z9KA 4E7NA 1Y3YA 3LH3A 3GCNA 2PSYA 3BF6H 3PMAB 4A6LA 1C1WH 1QZ8A 1O3MA 2GD4B 4Q80A 1TNLA 1DFPA 1WCZA 1JBUH 1O2TA 2VJ1A 3SN8A 2I6QA 2PUQH 2AMPA 1ETRH 1SQAA 1VR1H 3N7DA 2W5EA 5DP6A 2BY9X 1D3TB 1P8VC 1TPPA 1O5FH 1C4Y2 4BAMB 3SNDA 4VGCC 1ELFA 2SGAA 1SMFE 5HKKD 1AVGH 3A87A 1UCYH 2FYQA 1VCQA 3MH7A 3P8GA 3Q00A 5JBTA 1IQKA 2FOCA 2XC0A 4QT8C 1GI1A 1AVWA 3RMNH 1DT2A 1O3NA 1XVOA 4AYVB 1CGIE 1DLKB 1O2UA 1HAYB 5EJ1A 2XCFA 3ZVFA 1BTWA 1K2I1 4YM9A 1O2VA 3KYFA 5F8TA 1C5UA 2ZCKP 1WQSA 3DFJA 3SU2A 1ACBE 1ZPCA 1HCGA 3TJNA 3RXGA 3V3MA 3NK8A 2XWAA 3TVJB 3ZVAA 2QXIA 1K1JA 1C5YB 1QURH 3V7TA 1LQDB 3BTTE 3U98H 1W14U 3EA9A 1HV7A 1LMWB 2ZDKA 1DPOA 2UWPA 1KXAA 2XXLA 2CF9H 3UNQA 3ZZ9A 2QIQA 4OS6A 2R2MB 2EI6A 3P17H 2ZHWH 3ODFA 3CNRA 3LKWA 1GI5A 1AO5A 5FX6A 4Q7YA 3U69H 1TOCB 2GCHF 3QWCH 1W0ZU 1S6LA 2WV9A 1C5PA 1H9IE 1ZJDA 2XOKD 4I8GA 1C9TA 4K60A 1OWEA 1OP2A 4BAQB 2ZFRH 1ELCA 3ZVBA 1N8OC 1K1NA 2FX6A 1CGJE 1THRH 4GCHF 2QA9E 1IQIA 1HAVB 1NU9A 2FMJA 3BTWE 3VB3A 1TB6H 1DWDH 1YY3A 1DDJA 3EDXB 3QGJA 5LPRA 4THNH 2AHME 2C3SA 1H9LB 4RSPA 1NESE 2B0FA 1A4WH 2P3UB 2KCPA 1DITH 4ABGA 1YCPH 4MVNA 4YESB 2Q6GA 3STJA 4F48B 5HXFA 3FKSD 1UK2A 2BLWA 2CHAC 3I77A 1NRNH 4K69A 3UIRA 2WPJS 2OC7A 4ZHLU 1Z6JH 2GTBA 4ZCNA 1FN6A 3FANA 4ACBA 1K1OA 5DN6D 1O38A 4BAOB 1GMDG 5JB8S 3MU5A 2TBSA 4RKOB 2ZIQH 1CBWC 1TGTA 5LPEA 4I7YH 4Q4LA 1WQVH 2BD8A 2ASUB 4CRFA 1F5LA 1IOEA 2F9VA 2JETB 1TRNA 2GCHG 2XNIA 4Q7XA 2Z9LA 2VGCC 5FAHA 1UCYK 2BDBA 4FUJA 1A0LA 1LKAA 1FAXA 2QYIA 2BD7A 3BG4B 1NFWA 2IN2A 3FP6E 4LZ4B 2AGEX 2AYWA 3P8FA 3ZV9A 1QJ7B 2GCTC 4JZEH 2XWBI 2NU4E 3QTOH 5DSFA 3ZZAA 3SUGA 3PO1B 2WZQA 3RMMH 1GWAA 1SB1H 3PB1E 1CT0E 1P10A 2FIRH 3D62A 3UREA 1LO6A 5KGOA 4MPVA 3PROA 2H9EH 1SGEE 2ZNKH 1TONA 4RI0A 4O9VA 1ZOMA 4X6MA 1GDQA 2OD3B 1XVMA 3ZYDA 1Z8IB 2BX3A 3WWBA 1ZR0A 1GI7B 3M3TA 1QRWA 3R3GB 3FP7E 2BY7X 4F4OC 3RXLA 1KIGH 4AB9A 4SGAE 1A46H 1O3GA 2HVXA 5GPIB 1C2FA 3MU4A 3DFLA 1UMAH 1GBMA 1L4ZA 2XC5A 4D7GA 2FOMB 2D2DA 2SGDE 2SGFE 1LCYA 1U6QA 3SZNA 1TABE 2C8XB 3VGCB 1O0DH 2ANMH 1BDAA 3T26A 1IHTH 4NIXA 2R0LA 1W8BH 5EPYA 1YPKH 1UTQA 1XXDA 3P95A 1TBQH 3BN9A 4DIHH 1Z7KA 3B9FH 5A8ZA 1SR5C 1Y5AT 2VIWA 3NUMA 2HLDD 5T6DA 3S9CA 3S9AA 1NN6A 1B5GH 1FPHH 1MUEB 1O2SA 1UHBB 5A8YA 4GAWA 1YCPK 5DO4H 5C1XA 1SI5H 1HAPH 4GVUA 5EXLA 1WBGB 1BOQA 3D49H 3RM2H 1NRQH 2VIDA 1BMNH 3LH1A 1ZLRA 3SI4H 3DSGA 1X7AC 1P2OA 1P9SA 2BD3A 1BTPA 1O2GH 3GY2A 4ZROA 2TGTA 1LHFH 1EP6A 1LPKB 2GT8A 1TRYA 5LH8A 1ELAA 4K2YA 1QGFA 2BOHB 1GHVH 1KXBA 1BJUA 4OM9A 1EZSC 2RG3A 1C5QA 2GZ9A 6CHAC 1O2XA 2G55A 1VGCB 4INHA 4MLFB 1FPCH 2VIOA 3MU0A 4XDEA 4NA8A 1RXPA 5FBIA 5GJ4B 5HIZA 1B7XB 3ZZ6A 1XXFA 3SNCA 3SV9A 2FZZA 3V12A 1GBFA 1L4DA 2HNTC 2F3CE 2Z3DA 2Q6DA 5FCRA 1HGTH 1QTFA 1O5EH 1RGQA 3B8JA 3MTYA 1G32B 1O3IA 2ZTXA 3RC5A 2G51A 2XCNA 1Z71A 2HPQH 2QCYA 5DPAA 1C1SA 1NFXA 2KM0A 1GVZA 2ZC9H 1ETTH 1TBZH 1J14A 4Y71A 1NRPH 2QAAA 3K65B 4MNVA 3SNEA 4ZXXH 3FOAA 4WMFA 3OSYA 1FY1A 2J4IA 4FUGA 3CP7A 4GHQA 3PWBA 3GS9A 4FOUC 1S83A 1UVTH 3Q76A 1C2DA 3SUEA 3AW1A 3F0PA 2FI3E 1O3EA 4CRAA 1DICA 4UE7H 2R3YA 3KQBA 3SU4A 1YF4A 2IPHA 1CA0C 3A8BA 1O31A 1QHRB 1P3CA 3U1IB 5GIBA 5TCAA 2D1JA 1A61H 4D8NA 1XUFA 2IJD1 2G52A 1DUEA 1CHOF 1HJAB 1UTLM 1C2IA 1JMOH 5DG6A 2STBE 3SNAA 1V3XA 1UVUH 1WAYB 1HAGE 1V2QT 1O2PA 1FQ3A 5GCHF 2JJ2D 4LOYH 1BIOA 1A1RA 1CVWH 1OS8A 1P04A 2F9UA 4KTUA 5LGOA 5E0JA 5CDFE 2JH6D 3KYGA 2OC0A 2Y7ZA 5T6FA 5GWZA 3V13A 3AK5A 1P2NA 5FX5A 1YPHE 1ABJH 2ZU4A 1FN8A 3M37A 1FIZA 3SV8A 1RTKA 1MKWH 1ZMJA 3BG8A 3T25A 3QX5H 1G30B 7GCHG 3HPTB 1SGTA 3A88A 3PLPA 3RDZA 1C4U2 3NWUA 2SGQE 1GMHF 1A3EH 1F5RA 1HAHH 1L0ZA 2W3IA 2VVVA 2THFB 1C5SA 2BX4A 3HKIB 3RU4D 2Y5FA 2ZI2H 3IG6B 3SV2H 2ZFQH 4CBNA 1Y8TA 2AERH 2GV7A 3T27A 1O2MA 5C3NA 1HBTH 3H7TA 4WH8A 1Y3UA 3KIDU 1GCTC 1CHOG 2FO9A 2ZDVH 4Y76A 6GCHG 2RDLA 5IYTA 1O3HA 1QJ1B 1C5MD 3T2NA 1YPLH 2PKSC 4FUEA 3SU0A 1E36B 2VNTA 2ZPSA 1AVXA 3M35A 4TY7A 3RXSA 4AFUA 1S0RA 2AIQA 1EPTA 4AN7A 1IQLA 1YWUA 1Y5UT 2FOEA 2ZU1A 2R0KA 1Y5BT 2VH6A 3OTJE 4LZ1H 1Q2WA 4NA7A 3F9FA 1GI3A 2FI4E 3U28C 2BVSH 3CS7A 2LP6A 5F03A 5EGMA 3F68H 1EXFA 2Z6BD 1P02A 3PYHA 2PTNA 1MU8B 1TMTH 3GY3A 3RUOA 5AVDA 1TLDA 1ARCA 4GPGA 1FY3A 1HLTH 1DSUA 6ESTA 3DT0H 1GHYH 4UEHH 4UFEH 1K1LA 2P8OC 3VFEA 2AIPA 3NXPA 1CT4E 3U8RH 1N6XA 1ZGVA 5KECA 3A80A 3KNXA 1C2LA 3PMBB 1DOJA 2Q1JA 1JOUB 2HRVA 1SGPE 1MABB 1MZDA 1HAZB 1SFQB 3SU6A 1THPB 5C2ZA 2WPDD 3RU4T 1G2LA 1NRSH 2BXUH 4ISNA 1PPHE 1LTOA 2CV3A 5LPFA 3V0XA 1E1QD 3N7EA 4NFEA 1ARBA 1EKBB 1K21H 1OHHD 3F6UH 1DSTA 3MFJA 4INKA 1S0QA 4JZFH 1EASA 1J8AA 1PFXC 1QQUA 1XKAC 3SZEA 2ZA5A 2BXTH 1FY5A 1ZTKA 1EQ9A 3ZZ3A 5KEDA 1GG6C 2A5AA 1ZMLA 1P2JA 3TGIE 2WINI 5C94A 1KMHB 1RFNA 1WV7H 5FPTA 1TWXB 2ZGXH 5T1VA 1ORFA 1P09A 1UTNA 1P0SH 3MNSA 2F83A 3RU4E 1ZTJA 1MKWK 1O2NA 5TCCA 4WF8A 2C90B 3ZIAD 1T8OA 5F8XA 3UQOA 1RIWC 4X1QU 3E6PH 1MBMA 2KR7A 1O2JA 1EUFA 3QN7A 4Z0KA 4DGJA 1C1OA 2F9PA 1A0HB 2VH0A 5GDSH 1E79D 1AD8H 1TOMH 2H5DA 3M5LA 2YNBA 1Z1JA 2H6MA 1UCYE 2JH0D 3EQ0H 1WU1A 1EX3A 4ABJA 2PSXA 3HATH 4K1TA 1AUTC 3LOXA 4NSVA 1YPMH 2FODA 1TPOA 1K0HA 1GJ8B 1Y3XA 2XW9A 5C20A 3AW0A 3ATMA 2BD2A 3BEUA 4CHAB 4DJZB 4XBBA 1P2KA 3M5NA 1EPTC 5EQQA 2PW8H 1ESTA 2ZGBH 4XE4A 4NZLA 2YMSC 2KFWA 2NU0E 1O33A 1QA0A 1IQFA 1C5XB 1O35A 3MU8A 4B2CA 4CRCA 4ZHMU 5C0TA 1NFUA 1W7XH 3RMLH 1GI0A 3EA7A 4FXGH 2FI5E 2UWLA 1UVOA 1AFQC 4RT1A 4Y8YA 3RC4A 3GICB 1OWIA 4KGAA 1RTFB 4HFPB 1PPCE 3UAIC 5A2MH 1BBRH 1S84A 2WUBA 2Y82A 5AHGH 4YLQH 4MNXA 2VIPA 3OY6U 3OAAD 2WUCA 1WDIA 3VB6A 2QE7D 5CE1A 5HYOA 3QTVH 3HK6B 3F1SB 3OFND 1EZXC 4JK5A 2R9PA 1AY6H 1MTVA 2Z3CA 3OEHD 1JIRA 3EAJA 2BYAX 1D3QB 3U8OH 2QN5T 1HIAA 2R3UA 1S6HA 4AGJA 3ATIA 3GOVB 3NZIA 1OSSA 1WUNH 1UK4A 2A31A 2PKAA 3NRLA 2G5NA 3DSOA 1KXDA 2NU1E 2OXSA 2DE9A 2BZAA 5SGAE 3SUDA 3SJ9A 5L6NH 5G4BA 4BXSA 1ID5H 4ABHA 4D9QA 4X6NA 1NTPA 2V3OH 1BZXE 4BNRA 3GY7A 1JIMA 3L6PA 3I29A 1AKSA 1GJ5H 3RXDA 1GHAF 5FL7D 2AMQA 4KKDA 4TWYA 2GMTC 1DXWA 3F2GA 1DLEA 1QB1A 3RXPA 2RDEA 2GDDA 1O2KA 2FOBA 2B7DH 1SC8U 2BDGA 3GCHB 1A3BH 1BRCE 3NKKA 4NIWA 1GI4A 1C5RA 3TK9A 2PKSB 2PP6A 1FMGA 1E0FD 1TE0A 1ZSJA 3UWJH 3BEIB 5ESTE 4XBDA 1QQ4A 1NT1A 1L1NA 2ANKH 2F4LA 2O8TA 4AORA 3QGNB 1MZAA 1VCPA 5A09A 2UUYA 3PTBA 1O3KA 2VBCA 3JZ1B 1P2QA 2W7SA 5JBAS 4UFFH 1XUGA 1T8LA 3P8OA 4TYDA 4CR9A 4FVBA 2V3HH 3K6YA 1S5SA 4IC5A 4K1SA 4NFFA 5E2OA 3RXOA 3KQDA 1CQQA 3PV4A 4CR5A 1NPMA 2QF5A 3SJ8A 1O2OA 2BOKA 3RXFA 4ABAA 5C1YA 2PFEA 4BTIB 2ZZUH 1OXGA 4AYYB 1GMCF 1AWFH 2BHGA 1P2MA 4OS4A 2SNVA 4AX9H 1TQ0B 2UUFB 2P8OB 4FU7A 4JZIA 3SBKA 4X1RU 1C9PA 1O34A 3GCTF 4XSKU 4BTUB 4H42U 2JH5D 1T8NA 4TSFD 2ZQ1A 3GDUA 4WMEA 4LK4A 3SJOA 1TPSA 1GL0E 2HNTE 1C1TA 1LVBA 4LXBH 4MNWA 4J1YA 5HIYA 1SOTA 1TGNA 1KTSB 4B75A 2A5KA 2UUKB 5C0UA 5DP8A 1HPGA 3SUFA 1ABIH 1YLDA 1W3CA 3BTGE 4E7RG 1PPEE 2L74A 1UTPA 3AVZA 2GKVE 1BBRK 1CO7E 1XUJA 1C5LH 3BV9B 2KAIA 2ZCHP 3GYLB 5A0CA 2QY0B 1P9UA 1G37A 3DA9B 2ZHDA 4DG4A 1SHYA 3QO6A 1DY8A 1YM0A 1AB9C 1FIWA 3Q3YA 3BTEE 3CENA 4MPWA 1HXEH 1OWKA 3SHCH 1DM4B 1GGDB 1KLJH 2W6JD 1TGBA 4MG3A 3RP2A 4GCHG 2C8ZB 4ZKNU 4YZUA 1TNHA 3RXUA 3SYJA 1M9UA 3A7TA 3RXCA 4XBCA 1W0KD 1TX7A 1ELEE 1GHZA 2GV6A 3FN8A 1N6YA 2ZPRA 1V2UT 4YT6H 1AE8H 1ZGIA 3FP8E 1H8IH 5EPNA 4RT0A 1OWJA 1GVLA 1UJ1A 3UOPA 1V2VT 2H9TH 2K0QA 4X2WA 4AG2A 1GHBF 1O2QA 1KLTA 3SGAE 1QB9A 1SKYE 4JCNA 3S7HB 1MTNC 5DK1A 3H5CB 1ZRKA 2BMGB 3UTUH 5GXPA 1QB6A 2ZFSA 3DCLA 7LPRA 3RXKA 4AG1A 5CMXH 2ZFFH 2ALVA 3HKJB 3U9AH 2ZHFH 3RLYH 1Z8RA 1GBDA 2JJ1D 2VU8E 1GI9B 1AIXH 2HPPH 1ZSKA 1WSSH 1Z1IA 1EJNA 1FZZA 1MCVA 1SLUB 2KCOA 1GJCB 1UTJA 3B23B 1A5HA 2F9BH 4Y0YE 2YNAA 4WXIA 5FPYA 3SORA 2P95A 1RTLA 1G3EA 2A7JA 1GBBA 2EEKA 2BDIA 1CT2E 2Z9IA 1BTUA 1ZPZA 2A5IA 1GBJA 5T6GA 1JWTA 1V2PT 3M36A 3SQEE 3A86A 2RCEA 3KHVA 2FWWA 1W12U 2A45B 4X6PA 5A8XA 4MDSA 3TK6A 1QFKH 4OS1A 3OEED 1HXFH 4OS2A 1P06A 2PTCE 2F9OA 3LGIA 1HAOH 3QUMP 4B76A 4NG9H 4VGCB 1IHSH 2UWOA 5J4SA 1V2RT 1EOLA 1TA2A 2NU3E 2OINA 4IMQA 3TK5A 3E16B 3M7UA 1GJ7B 2NWNA 2XNDD 1RJXB 5C5OA 1O2YA 2P16A 5B6LA 2WV4A 2ZG0H 2VINA 3WY8A 1YPGH 3WWFA 3PRDA 4Y0ZE 2BDYA 2A4QA 5FHTA 1KDQB 1HUTH 8KME2 2WPLS 3MH5A 3RXRA 1BHXB 3T28A 3VPKA 1L1GA 1C5OH 2TIOA 3A7XA 2B5TB 3TGJE 2FOGA 2P94A 1SGIB 1A2CH 2FLRH 3M61U 4Y11E 2SFAA 1TGCA 3MI4A 3N7OA 4KTCA 5HM2A 1V2ST 3LGTA 4TT3D 5IDKA 1O3AA 2BDAA 2BVRH 2J98B 3QDZB 1V2JT 3QLPH 2P3TB 2BZ6H 2F43B 2STAE 1WYKA 4B2AA 2V0BA 1D9IA 1LVMA 2ZDAH 4I8HA 1ZMNA 2YMSD 3EA8A 2BD9A 4ZKOU 4DOQA 2EA3A 3PLBA 1FUJA 1O3JA 5K0HA 3W95A 3MH4A 3EE7A 2GJGA 4NWKA 2RFKC 1ZZZA 3BIUH 1TGSZ 2V3MA 3KQEA 2OK5A 1HDTH 1MD8A 5E8EH 3RMOH 1DE7H 3WW7A 4ACAA 1S85A 5I25A 3E3TA 1SGNE 4FU9A 1C1VH 1HAXB 4ASHA 3T62A 4A1VA 1N8OB 2WPKS 5B6OA 1K22H 2LPRA 2BY5X 4GLYA 1BTHH 2K8IA 1L1JA 4B73A 1QCPA 2FM2A 1T8MA 4I8KA 2EQNA 1AHTH 2R2WU 3BTHE 1TALA 3GDVA 3LC5A 1BTZA 4YT7H 3M3SA 3H7OA 3MOCA 4YO9A 6LPRA 2W6ID 1EJAA 8LPRA 2CHAB 3VXFH 1W13U 3A83A 1QRXA 1NY22 4TWWA 5EQSA 2A4OA 1SGCA 1Z6EA 4FUDA 3FZZA 1OYTH 5A0AE 2J94A 3VG8A 3TH2H 1O5DH 1G3BA 2ZO3H 1HAVA 1QBVH 1P12E 4X2YA 3S69A 1OPHB 1Z8JB 4I33A 3E91A 2AH4X 1CBWB 1QJ6B 2A7HA 1O30A 4XOJA 5ABWA 3C27B 5EU8A 1E1RD 1C1UH 2BLQA 1K1MA 1GBEA 2OLGA 1P11E 3TGKE 1O2LA 2VGCB 1AB9B 4PROA 3ZZ5A 1TMBH 1TYNA 1FLEE 2BDCA 1VITF 2XBYA 3MQKC 4OS7A 3BIVH 1KXFA 1TA6A 2BB4A 1BRBE 1TFXA 3SO3A 2SGPE 3M7QA 4X2VA 3KQ5A 1HIAB 2GCTB 2F91A 1AGJA 5ETXA 2GDEH 2Z7FE 2PKAB 1NC6A 3DHKH 1G3DA 2XTTB 1XKBC 1NU7B 2V6NA 3MU1A 3DUXH 3PLKA 5PTPA 2FTLE 3RXQA 2AFQB 2VWNA 1CE5A 3F9EA 3PV2A 4Z1MD 1NBMD 1SGDE 1O3OA 1K9OE 5E0GA 1UVPA 1EZQA 2PGQB 2CJIA 5DP3A 1PJPA 1ELTA 4FUFA 4X2XA 1CHGA 2J34A 5J4QA 4A92A 1V2KT 1BUIA 2L6OA 4F55A 1ZHMA 1T7CA 2ZPQA 4U32A 1EB1H 3AAUA 3Q77A 1GHWH 3TITA 3A7VA 5BRRE 4O3UA 3OU0A 3LC3A 3FO8D 3QK1A 1V2MT 1BMLA 1GBTA 1GBCA 3O8RA 1BB0B 2HGTH 1EOJA 5GCHG 1AWHB 3T5FH 3TU7H 2IOTA 4A7IB 1ZHPA 4CREA 1QL8A 1SSXA 4ZUHA 7KMEH 1H8DH 1MTUA 3SV7A 4ISIH 1E37B 1LPGB 1KLIH 4CRGA 3U1JB 2QXHA 5FBEA 3KQCA 1IQEA 2BDHA 2W7UA 4UONA 1OOKB 4BOHA 4ISOA 3BTKE 1P2IA 2QV1A 1NROH 3OTPA 4YXWD 2ODPA 4P00A 5CHAC 4FETA 2ODQA 3TJOA 1LQEA 3ZZDA 3A8CA 1CA8B 4IN2A 1ZSLA 5E0HA 4NCYA 4ZKSU 1CU1A 1D3DB 4DY7B 3GY5A 4OGXA 1GBLA 1RD3B 4E06H 1GMHG 1YLNA 5DP4A 1S82A 2WPHS 3GY8A 3L3TA 2ODYB 4B1TA 1W0JD 1OKXA 2HLCA 1F2SE 2QC2A 3FZDA 4FVDA 4Y7AA 1MU6B 1SL3A 4ISHH 2CMYA 1C1QA 1LHDH 1ELDE 1G2MA 1SLXB 4MPUA 1MTSA 3LGUA 1HAIH 2HWLB 3RM0H 4X6OA 2BY8X 1EATA 2OQUA 2VB0A 8GCHF 4A5TS 2FESH 2BTCE 3R0FA 1F7ZA 3ZYEA 1XX9A 2SNWA 6CHAB 1SGQE 1VCWA 3KL6A 4GHTA 3UB0A 1GJ9B 3UPEA 3DSPA 3W94A 3TJVA 2TGPZ 5HMAA 2A7CA 1GI2A 5L30H 3M7TA 2JKHA 1F92A 1DVAH 3QZRA 2ZDMA 4U2WA 1LKBA 3LPRA 1G9IE 2ZF0H 3TH3H 4KTSA 5TJXA 2WSSD 1BQYA 2ZGHA 2AEIH 2J38A 2M2AA 3AAVA 2P59A 2A32A 2DUCA 1Q3XA 4B74A 4ZMAH 1P03A 3VB7A 5F8ZA 1MAXA 4XFQA 3UNSA 1GDUA 1BBRE 2ZFPH 2JDID 1ZJKA 1BITA 1AFEH 2RA3A 2OUAA 5L2ZH 2FEQH 2ZGJA 5F6MA 3PMHB 1GPZA 2ANYA 4Q7ZA 1YGCH 5JB9S 2BD4A 3C1KA 2ZWLH 3PO1C 4DIIH 4IBLH 3BTME 1SGFG 3GCOA 1EAWA 1QIXB 4CBOA 5DGJA 1D6RA 2J5UA 3TNSA 1OP8A 2IPQX 3VB5A 2ZTZA 2XC4A 1TX8A 2H9HA 1CA0B 3SI3H 1E35B 4BAKB 3Q3XA 4X1SU 3VXEH 4WH6A 3JZ2B 3ZZ7A 2VVCA 3U8TH 1SGRE 4DT7B 1W11U 2BQ6B 2ZECA 1XMNB 1BMFD 4NA9H 4O97A 2J9NA 1PYTD 4MQAA 2ZHEH 4WXVA 4Y8XA 2G81E 4BAHB 4D76A 3O8DA 4YOIA 2GZ8A 2TGDA 4CRDA 1BRAA 1THSH 2OBQA 1YBWA 2Z94A 1IAUA 4ZH8A 4NGAH 1ZPBA 1SG8B 3ZVDA 1PPFE 2BQWB 1EB2A 2KX4A 4FUHA 1MMJN 3VGCC 1BMAA 2OTVA 3ITIA 3M5MA 3SU5A 1AI8H 4ZKRU 1FX0B 3GY4A 1G36A 3TNTA 2HNTF 3UUZA 2KCAA 3MO6A 2DE8A 2VIQA 4FUCA 1YLCA 4ASUD 3E1XB 1G3CA 2BLOA 3LT3A 4WWYA 3TLOA 2CF8H 1SHHB 1O3PB 2GT7A 1YPEH 1Y59T 2EY4C 1T32A 2WHXA 4HG6A 4A1XA 1LHEH 4IS5A 1O5BB 3VB4A 2ZDLA 2FLBH 1BCUH 3LGYA 4UD9H 3SJKA 1ZTLA 1GCTB 8ESTE 1MKXH 4AC9A 1H1BA 1DANH 1JRTA 2VVUA 3S0NA 1P57B 1SGFA 2FTMA 1NM6A 3FFGA 1D4PB 1L2EA 2FS9A 4K3JA 1YKTA 4WJG2 4ABFA 3SU3A 1MH0A 2Z3EA 5BPEA 1GJ6A 1NS3A 2BY6X 1ANDA 3RC6A 4Q63A 5EODA 4AGKA 4OGYA 5EXMA 2OC8A 4E05H 5C67A 1C2GA 3ATLA 3UWIA 1O2WA 1GMDF 1VGCC 1TNIA 2BM2A 2ESTE 4AB8A 1HFDA 1V6DA 1GJBB 3URCA 4ABEA 1TRMA 2WV5A 4JYUH 4Z6AH 2PGBB 1B0FA 3A7WA 1TBRH 2ZKSA 4IC6A 3ATKA 5CHAB 1O3CA 3K6ZA 3SU1A 4DCDA 2ZEBA 3O8BA 1YPJH 1FY4A 4Y10E 3S9BA 2A2XH 1ELVA 1SOZA 2VWMA 4F49A 1BTYA 5AF9H 1SQTA 2CK3D 3OY5U 4TPIZ 1QBNA 2M5TA 4KELA 2AGGX 2XYAA 3PRBA 1KXCA 1A7SA 2V35A 3A81A 1IQHA 2FPZA 2LNCA 1GHAG 1MBQA 2GX4A 3E0NB 2H1UA 1O2IA 1O3BA 1DX5M 2CN0H 5DP7A 3RXBA 5H4IB 3O8CA 2QF3A 2J97A 4BTTB 2P3FH 1T31A 2LELA 1AQ7A 1QA7A 3BTQE 1B0EA 2HALA 1GG6B 2D8WA 4FUBA 1NFYA 3RLWH 3RXAA 2EI8A 2PLXA 1D6WA 1GJAB 1WOFA 4BXWA 1QRZA 4MPXA 1OWHA 3KGPA 3A8DA 2KZ4A 1HJAC 1KXEA 1UVSH 3MHWU 4CH2B 4O03A 2BD5A 3SNBA 1FXYA 1UK3A 1RIWB 3ESTA 2PR3A 1VJAU 1FONA 2C4FH 4X1NU 1GMCG 4NIVA 3TH4H 5EW2H 1AUJA 4HI3A 2H2ZA 3A7ZA 3KN2A 3M3VA 4HTCH 3H09A 5C17A 5FPSA 5HGGA 2VIVA 3GCTG 4P02A 3ZVEA 3DD2H 1TAWA 3GY6A 4B6EA 1SQRA 3BSQA 3ZV8A 1LDTT 5EXNA 2A4GA 2Y80A 4O3TA 4R0IA 5C5NA 2JIZD 5K7RA
chains in the Genus database with same CATH topology
1K1PA 1C1MA 1H4WA 1MKXK 5JDUB 4KP0A 2CXVA 4NSYA 2J95A 2O8LA 1J15A 3LJJA 1IQMA 1K28D 2BQ7B 4JMYA 3RXVA 1C1PA 3MMGA 1EP5A 3RXIA 1QL9A 3ELAH 5DP9A 2WYGA 1V2WT 1EPTB 2FOHA 3SJIA 2Y81A 2Y7XA 5JYIA 1IQJA 1KYNA 2B8OH 4OS5A 1QNJA 4U01A 5DJ7A 4CRBA 3I78A 1C5ZB 1C2EA 2J2UA 2O8WA 3PM3A 1GBIA 3HK3B 5A0BA 2FOAA 2WYJA 5EOKA 4R8TB 1AFQB 4AOQA 1PQ8A 1O5AB 3MWIU 1AE5A 2G00A 3MO9A 3P8NA 4AFQA 1IQGA 1ZYOA 3RXHA 1SFIA 3ATWA 4FU8A 1C5VA 2BVXH 4J2YB 3KF2A 1PQAA 2K1QA 1ELGA 2NU2E 4B71A 2EC9H 1PQ5A 1O2HA 2FOFA 2W26A 2ZU5A 2CGAA 3E8LA 1O5CB 1PPBH 4JYTA 1NZQH 1ANBA 4K8BA 4I32A 1GHXH 2P93A 4Y6DA 2XBWA 1E34B 4ZXYH 2G4UA 3SQHE 1GJDB 1GHBG 1J9CH 1ESBA 4IGDA 3EYDA 1O37A 2ILNA 3D65E 4ZAEA 4TPYA 5AFYH 3LGWA 4JK6A 1SQOA 3UOUA 2W3KA 4YTAA 3UFAA 3AASA 1MQ5A 1V2OT 4K8YA 1DUAA 4TY6A 4CH8B 2QXGA 2A2QH 4FUIA 3LDXH 4D9RA 1F0TA 1HNEE 1F5KU 1Y3WA 4HGCA 4DW2U 3RXTA 3NCLA 1GI8B 2GMTB 3BTFE 1DXPA 3LIWA 2O8UA 1GBKA 1PYTC 7ESTE 1DS2E 3UNRA 1UTOA 2A0QB 1UTMA 2Z9GA 2G5VA 2FDAA 3ZZCA 2PV9B 2FS8A 3GISB 2PWXA 3KEEA 3LGVA 5DP5A 1O3LA 1MCTA 2O9QA 3IITA 1C1NA 4ABBA 3P70B 2ZFTA 1A0JA 1WTGH 1ETSH 2O8MA 1FV9A 1AZZA 1TIOA 4K5ZA 1QBOA 1WTHD 1FI8A 1GDNA 1OYQA 1W7GH 1VJ9U 3EGKH 2ANWA 2FXRA 1Z8GA 3SOSA 1LVOA 1O32A 4GUXA 3UQVA 1LHGH 3PTNA 2GVFA 5EW1H 1SPJA 1C5NH 1AZ8A 1JRSA 2WPIS 4H6TA 1EZUC 2AS9A 2A1DB 1YC0A 1YYY1 3MNXA 1Y3VA 3G01A 4AFZA 1GCDA 2D26C 1YCPM 1XUIA 4I31A 3ZZ4A 2SGEE 3KCGH 1DY9A 2J92A 2IJOB 7GCHF 4ISLA 3BEFB 4DVAU 2ZCLP 3QZQA 3P92A 1ESAA 1BHXF 4ESTE 2QXJA 3A85A 4HZHA 1O3FA 1F0UA 2A4RA 4CHAC 4GSOA 3LONA 2OQ5A 1JXPA 3SGBE 1H9HE 2PHBA 3T29A 2ZHQH 1N1LA 1DWEH 3HGPA 4H6SB 5JPMH 1O2ZA 2XBVA 4X0WU 1MTWA 1V2NT 4A1TA 2ZTYA 1HRTH 1S81A 1TX6A 3IWMA 6GCHF 2OC1A 1C1RA 3L33A 3ZZ8A 3E0PB 1NO9H 1PPGE 3MH6A 5FCKA 1W2KH 1RS0A 3MNBA 2BLVA 3BTDE 1O36A 1CSOE 2TGAA 2QF0A 1O2RA 1DWBH 1SVPA 4Y7BA 1J17T 4RN6A 1GBAA 1QL7A 4I8LA 2Y5GA 4AZ2B 3CS0A 1FDPA 2AGIX 1SLVB 5AFZH 2GP9B 2FP7B 2H5CA 4I8JA 1EAXA 4DURA 1IQNA 2VWLA 4Y8ZA 1VZQH 5T3HA 1FY8E 1C4V2 1AKSB 1P05A 1T4UH 1OWDA 2C8WB 2ZQ2A 3D23A 1FJSA 3TJUA 1BJVA 1MTNB 1BTXA 3LU9B 5EQRA 4IW4E 4X8VH 1V2LT 4D7FA 1ANCA 2OBOA 3E90B 2RA0A 2I6SA 4YOGA 1UO6A 1BT7A 1O39A 4BANB 1LPZB 3LJOA 2VWOA 1NRRH 1XUKA 3NPSA 1TMUH 1INCA 4UFDH 4X1PU 5JBCS 3ZVGA 4X8SH 4YOJA 2WPMS 2OP9A 3A89A 3SGQE 1XUHA 1W0YH 1FNIA 5L2YH 1VITG 1C5TA 1J16A 3F9HA 3FAOA 3OYPA 3OX7U 2EI7A 4MNYA 4U30A 3TPIZ 1YP9A 3GCHC 3A82A 1QR3E 1OP0A 3SV6A 3RXJA 1C2KA 3K9XB 4JYVH 3P6ZB 4NZQA 1P01A 2FX4A 5E2PA 2TRMA 1AU8A 1ZRBA 1K1IA 4K1EA 4Y79A 3F9GA 4UFGH 3A84A 1ANEA 1CGHA 5DKMA 3SW2B 3MYWA 3UR6A 9ESTA 1EAIA 3RXEA 2Y6TA 1C2HA 1SLWB 2PUXB 4X8TH 3STIA 3SHAH 2QGRA 3M5OA 3K2UA 3Q3KA 4H4FA 1TNGA 3A8AA 2ALPA 4Q2KA 2C93B 1S6FA 1UHBA 2OCVB 1TNKA 3MNCA 1MAYA 2KAIB 2B9LA 3RXMA 1EAUA 2ZU2A 1P3EA 4YLUA 1AN1E 3PWCA 3ZVCA 4WVPE 3UY9A 2GZ7A 5EG4A 1KDQA 4ABDA 5FXLA 4JZDH 1SBWA 2G8TA 1RRKA 1KTTB 1OX1A 1PQ7A 3S7KB 3GDSA 2GGVB 2ZU3A 5JBBS 4WY3A 4UDWH 9LPRA 1KY9A 5C1UA 4RKJB 1MD7A 1ELBA 1KSNA 1F0SA 1T4VH 2JETC 1HB0B 2AMDA 2ZP0H 3A7YA 1QY6A 3ENSB 1DWCH 1F0RA 1AMHA 1GBHA 1TPAE 2Y5HA 3MO3A 5ESBA 1HJ9A 4INLA 2ZDNA 3UR9A 3PMJA 4ABIA 1GVKB 1O5GH 2ZGCA 3BG4C 3ZZBA 4B2BA 1GGDC 1VITH 1V2TT 1HYLA 3URDA 2UUJB 1XM1A 1EJMA 1A5GH 1BRUP 1PPZA 5HM9A 2XBXA 1Q31A 3EE0B 3TIUA 1C2JA 1BMMH 3ODDA 4M7GA 2ULLA 1TQ7B 1ZHRA 1BA8B 3GYMA 3VEQB 1D3PB 1GL1A 4NIYA 8GCHG 1LHCH 4NWLA 2Q6FA 2XRCA 3FVFB 2FYRA 5I46H 4SGBE 2TPIZ 2HOBA 1A5IA 1TNJA 4WMDA 1SGYE 4ZHAA 4MTBA 2YOLA 1GJ4H 1C5WB 1W10U 4IMZA 2G4TA 2C8YB 4IN1A 1YPHC 2Z9JA 1FAKH 1UTKA 4X8UH 3HGNA 1E38B 4JZ1A 1C2MA 1MQ6A 4AFSA 1GI6A 1HJ8A 1LVYA 2F9NA 1O3DA 2Z9KA 4E7NA 1Y3YA 3LH3A 3GCNA 2PSYA 3BF6H 3PMAB 4A6LA 1C1WH 1O3MA 2GD4B 4Q80A 1TNLA 1DFPA 1WCZA 1JBUH 1O2TA 2VJ1A 3SN8A 2I6QA 2PUQH 2AMPA 1ETRH 1SQAA 1VR1H 2W5EA 5DP6A 2BY9X 1D3TB 1P8VC 1TPPA 1O5FH 1C4Y2 4BAMB 3SNDA 4VGCC 1ELFA 2SGAA 1SMFE 1AVGH 3A87A 1UCYH 2FYQA 1VCQA 3MH7A 3P8GA 3Q00A 5JBTA 1IQKA 2FOCA 2XC0A 4QT8C 1GI1A 1AVWA 3RMNH 1DT2A 1O3NA 1XVOA 4AYVB 1CGIE 1DLKB 1O2UA 1HAYB 2XCFA 3ZVFA 1BTWA 1K2I1 4YM9A 1O2VA 5F8TA 1C5UA 2ZCKP 1WQSA 3DFJA 3SU2A 1ACBE 1ZPCA 1HCGA 3TJNA 3RXGA 3V3MA 3NK8A 2XWAA 3TVJB 3ZVAA 2QXIA 1K1JA 1C5YB 1QURH 3V7TA 1LQDB 3BTTE 3U98H 1W14U 3EA9A 1HV7A 1LMWB 2ZDKA 1DPOA 2UWPA 1KXAA 2XXLA 2CF9H 3UNQA 3ZZ9A 2QIQA 4OS6A 2R2MB 2EI6A 3P17H 2ZHWH 3ODFA 3LKWA 1GI5A 1AO5A 5FX6A 4Q7YA 3U69H 1TOCB 2GCHF 3QWCH 1W0ZU 1C5PA 1H9IE 1ZJDA 4I8GA 1C9TA 4K60A 1OWEA 1OP2A 4BAQB 2ZFRH 1ELCA 3ZVBA 1N8OC 1K1NA 2FX6A 1CGJE 1THRH 4GCHF 2QA9E 1IQIA 1HAVB 1NU9A 2FMJA 3BTWE 3VB3A 1TB6H 1DWDH 1DDJA 3EDXB 3QGJA 5LPRA 4THNH 2C3SA 1H9LB 4RSPA 1NESE 2B0FA 1A4WH 2P3UB 1DITH 4ABGA 1YCPH 4MVNA 4YESB 2Q6GA 3STJA 5HXFA 1UK2A 2BLWA 2CHAC 3I77A 1NRNH 4K69A 3UIRA 2WPJS 2OC7A 4ZHLU 1Z6JH 2GTBA 1FN6A 3FANA 1K1OA 1O38A 4BAOB 1GMDG 5JB8S 3MU5A 2TBSA 4RKOB 2ZIQH 1CBWC 1TGTA 5LPEA 4I7YH 1WQVH 2BD8A 2ASUB 4CRFA 1F5LA 1IOEA 2F9VA 2JETB 1TRNA 2GCHG 2XNIA 4Q7XA 2Z9LA 2VGCC 5FAHA 1UCYK 2BDBA 4FUJA 1A0LA 1LKAA 1FAXA 2QYIA 2BD7A 3BG4B 1NFWA 2IN2A 3FP6E 4LZ4B 2AGEX 2AYWA 3P8FA 3ZV9A 1QJ7B 2GCTC 4JZEH 2XWBI 2NU4E 3QTOH 3ZZAA 3SUGA 3PO1B 3RMMH 1GWAA 1SB1H 3PB1E 1CT0E 1P10A 2FIRH 3D62A 3UREA 1LO6A 4MPVA 3PROA 2H9EH 1SGEE 2ZNKH 1TONA 4O9VA 1ZOMA 4X6MA 1GDQA 2OD3B 1XVMA 3ZYDA 1Z8IB 2BX3A 1ZR0A 1GI7B 3M3TA 1QRWA 3R3GB 3FP7E 2BY7X 4F4OC 3RXLA 1KIGH 4AB9A 4SGAE 1A46H 1O3GA 2HVXA 5GPIB 1C2FA 3MU4A 3DFLA 1UMAH 1GBMA 1L4ZA 2XC5A 4D7GA 2FOMB 2D2DA 2SGDE 2SGFE 1LCYA 1U6QA 3SZNA 1TABE 2C8XB 3VGCB 1O0DH 2ANMH 1BDAA 3T26A 1IHTH 4NIXA 2R0LA 1W8BH 5EPYA 1YPKH 1UTQA 1XXDA 3P95A 1TBQH 3BN9A 4DIHH 1Z7KA 3B9FH 5A8ZA 1SR5C 1Y5AT 2VIWA 3NUMA 5T6DA 3S9CA 3S9AA 1NN6A 1B5GH 1FPHH 1MUEB 1O2SA 1UHBB 5A8YA 4GAWA 1YCPK 5DO4H 5C1XA 1SI5H 1HAPH 4GVUA 5EXLA 1WBGB 1BOQA 3D49H 3RM2H 1NRQH 2VIDA 1BMNH 3LH1A 1ZLRA 3SI4H 1X7AC 1P2OA 1P9SA 2BD3A 1BTPA 1O2GH 3GY2A 4ZROA 2TGTA 1LHFH 1EP6A 1LPKB 2GT8A 1TRYA 5LH8A 1ELAA 4K2YA 1QGFA 2BOHB 1GHVH 1KXBA 1BJUA 1EZSC 2RG3A 1C5QA 2GZ9A 6CHAC 1O2XA 2G55A 1VGCB 4INHA 4MLFB 1FPCH 2VIOA 3MU0A 4XDEA 4NA8A 1RXPA 5FBIA 5GJ4B 1B7XB 3ZZ6A 1XXFA 3SNCA 3SV9A 2FZZA 3V12A 1GBFA 1L4DA 2HNTC 2F3CE 2Z3DA 2Q6DA 5FCRA 1HGTH 1QTFA 1O5EH 1RGQA 3B8JA 3MTYA 1G32B 1O3IA 2ZTXA 3RC5A 2G51A 2XCNA 1Z71A 2HPQH 2QCYA 5DPAA 1C1SA 1NFXA 2ZC9H 1GVZA 1ETTH 1TBZH 1J14A 4Y71A 1NRPH 2QAAA 3K65B 4MNVA 3SNEA 4ZXXH 4WMFA 3OSYA 1FY1A 2J4IA 4FUGA 3CP7A 4GHQA 3PWBA 1S83A 1UVTH 3Q76A 1C2DA 3SUEA 3AW1A 2FI3E 1O3EA 4CRAA 1DICA 4UE7H 2R3YA 3KQBA 3SU4A 1YF4A 2IPHA 1CA0C 3A8BA 1O31A 1QHRB 1P3CA 3U1IB 5GIBA 5TCAA 2D1JA 1A61H 4D8NA 1XUFA 2G52A 1DUEA 1CHOF 1HJAB 1UTLM 1C2IA 1JMOH 5DG6A 2STBE 3SNAA 1V3XA 1UVUH 1WAYB 1HAGE 1V2QT 1O2PA 1FQ3A 5GCHF 4LOYH 1BIOA 1A1RA 1CVWH 1OS8A 1P04A 2F9UA 4KTUA 5LGOA 5E0JA 2JH6D 2OC0A 2Y7ZA 5T6FA 5GWZA 3V13A 1P2NA 5FX5A 1YPHE 1ABJH 2ZU4A 1FN8A 3M37A 1FIZA 3SV8A 1RTKA 1MKWH 1ZMJA 3BG8A 3T25A 3QX5H 1G30B 7GCHG 3HPTB 1SGTA 3A88A 3PLPA 3RDZA 1C4U2 3NWUA 2SGQE 1GMHF 1A3EH 1F5RA 1HAHH 1L0ZA 2W3IA 2VVVA 2THFB 1C5SA 2BX4A 3HKIB 3RU4D 2Y5FA 2ZI2H 3IG6B 3SV2H 2ZFQH 4CBNA 1Y8TA 2AERH 2GV7A 3T27A 1O2MA 5C3NA 1HBTH 3H7TA 4WH8A 1Y3UA 3KIDU 1GCTC 1CHOG 2FO9A 2ZDVH 4Y76A 6GCHG 2RDLA 5IYTA 1O3HA 1QJ1B 1C5MD 3T2NA 1YPLH 2PKSC 4FUEA 3SU0A 1E36B 2VNTA 2ZPSA 1AVXA 3M35A 4TY7A 3RXSA 4AFUA 1S0RA 2AIQA 1EPTA 4AN7A 1IQLA 1Y5UT 2FOEA 2ZU1A 2R0KA 1Y5BT 2VH6A 3OTJE 4LZ1H 1Q2WA 4NA7A 3F9FA 1GI3A 2FI4E 2BVSH 3CS7A 5F03A 5EGMA 3F68H 1EXFA 2Z6BD 1P02A 3PYHA 2PTNA 1MU8B 1TMTH 3GY3A 3RUOA 5AVDA 1TLDA 1ARCA 4GPGA 1FY3A 1HLTH 1DSUA 6ESTA 3DT0H 1GHYH 4UEHH 4UFEH 1K1LA 2P8OC 3VFEA 2AIPA 3NXPA 1CT4E 3U8RH 1N6XA 1ZGVA 3A80A 3KNXA 1C2LA 3PMBB 1DOJA 2Q1JA 1JOUB 2HRVA 1SGPE 1MZDA 1HAZB 1SFQB 3SU6A 1THPB 5C2ZA 3RU4T 1G2LA 1NRSH 2BXUH 4ISNA 1PPHE 1LTOA 2CV3A 5LPFA 3V0XA 4NFEA 1ARBA 1EKBB 1K21H 3F6UH 1DSTA 3MFJA 4INKA 1S0QA 4JZFH 1EASA 1J8AA 1PFXC 1QQUA 1XKAC 2ZA5A 2BXTH 1FY5A 1ZTKA 1EQ9A 3ZZ3A