1QB1A

Bovine trypsin with 1-[2-[5-[amino(imino)methyl]-2-hydroxyphenoxy]-6-[3-(4,5-dihydro-1-methyl-1h-imidazol-2-yl)phenoxy]pyridin-4-yl]piperidine-3-carboxylic acid (zk-806974)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of potent and selective factor Xa inhibitors complexed to bovine trypsin.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PROTEIN (TRYPSIN)
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qb1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qb1A02
4F49A 1FUJA 4CRAA 2ZU4A 1V2KT 3SNAA 3A7XA 1IQGA 3SGBE 1A2CH 3D62A 4Y11E 1TQ0B 1MZDA 3MNBA 2OLGA 1CT2E 3RXSA 2ZPSA 1DFPA 1O2UA 3EA9A 3MTYA 1N1LA 4Y7BA 1C5LH 1FONA 4JYTA 1FIWA 2ZA5A 1THRH 1AKSA 4UE7H 1S85A 3MYWA 5A0BA 1D9IA 1LKBA 3MNXA 3M61U 1BCUH 1NTPA 5HYOA 3F9GA 4KTSA 4OGXA 1YPEH 3QDZB 4H6SB 3U9AH 1CGJE 2QV1A 2PLXA 2XWAA 1DXWA 1KDQA 2RCEA 3NXPA 1WYKA 1DDJA 1KXCA 3BTKE 1DWEH 4AFUA 4ZROA 3QN7A 2BDIA 5C67A 2QIQA 1Z8IB 4IBLH 2ZIQH 1OWEA 2FOBA 4VGCB 1UVTH 5EGMA 4TPIZ 1SG8B 3EA7A 5B6OA 1CQQA 1IQEA 2W3IA 5EQSA 1C4Y2 3TNSA 2ANKH 4XDEA 3DA9B 4X6MA 2P3FH 3S7KB 2GCHG 1W0YH 2F9NA 1NZQH 2CN0H 1EB1H 1O3HA 2BD4A 2HPPH 1GMDG 1TNJA 3BTWE 4I8HA 1AFQB 2BD7A 1YCPH 7ESTE 5L6NH 2P3UB 2W26A 1P02A 4Y0ZE 1G30B 2BX3A 1DWCH 1AI8H 2UWPA 2PUQH 3PTBA 4KP0A 4F4OC 2IJOB 2A7HA 5F6MA 3VXFH 1Z1JA 2A31A 2JH6D 5C3NA 4I33A 4NIWA 1QQ4A 5JPMH 1GMCF 3BEIB 2ZU3A 1GI7B 4KELA 1ACBE 2NU4E 2IOTA 2W3KA 4Y76A 2FI5E 1DY9A 4NA7A 1ZZZA 4OGYA 2AERH 3UR6A 1O3OA 3A83A 4DGJA 1GHBG 1YCPK 3A85A 1P06A 1SLUB 1SGQE 2VVCA 1GBCA 2ULLA 1GHWH 1VITF 1ZJKA 4WXVA 2A5IA 1QA0A 3DFLA 4X6OA 1SGYE 3TK5A 4UD9H 1P09A 1O3JA 1GJ9B 2FO9A 1QB9A 1SFQB 1J8AA 2ODYB 5E0HA 3Q77A 1KXEA 3ELAH 4NIYA 4K60A 3RU4E 1XXFA 3SV2H 4IN1A 3RXIA 5C2ZA 3HKJB 1C5WB 4FUGA 4UDWH 1S84A 4K2YA 1AFEH 2PKAB 2J34A 1W0ZU 3P92A 4Q7XA 1K1PA 3FANA 4OS4A 1EPTB 5FCKA 3H7TA 2Y5HA 3RUOA 1TMBH 1UTLM 2Z9GA 4H42U 4X6NA 1QL7A 1UTQA 1O2MA 3BTHE 1B0FA 4BAOB 3PLPA 2XBWA 3EQ0H 2ZCKP 2SNVA 2VGCC 1ANEA 4NFEA 1ZGIA 4Q80A 4YM9A 1TRYA 1QJ7B 1QJ1B 2XTTB 1C2LA 3GOVB 3UR9A 4Q2KA 2FP7B 4WMEA 3BTDE 3TGJE 1KTSB 2F91A 4HTCH 3A7ZA 5I46H 4ABDA 3Q00A 4MNYA 1C1WH 3L6PA 2FX4A 3LGWA 1HLTH 4CHAB 1EZXC 1ZSJA 4ESTE 1DT2A 2CGAA 2BY9X 1F5RA 4YT7H 1QY6A 2Y7ZA 1C1MA 1YLDA 2C3SA 2XC0A 2GT7A 3SU4A 4B71A 1NRNH 3GY7A 1BMLA 2DE8A 1TPSA 1SLXB 1SC8U 2Q6GA 3LKWA 2JKHA 3ZVCA 3LC3A 2BY8X 3KEEA 3RLYH 3A8DA 2EA3A 1E35B 4OS5A 4X6PA 3LOXA 2HOBA 5CHAB 3ZZ9A 1ABJH 1AHTH 1P2MA 1O2WA 2FX6A 1LQEA 2I6SA 1G9IE 2P3TB 4YO9A 2WYJA 1MTWA 3LGVA 1ZPZA 1O5BB 1MTSA 4KTUA 3K9XB 3QZQA 3KNXA 1Z7KA 4FU9A 1BMMH 1T4VH 1ID5H 1BRCE 1KYNA 3PWBA 2ZCHP 5JBAS 4WJG2 1J9CH 4D7GA 3A7TA 3U8OH 1A0LA 5E2OA 1V2ST 2ASUB 3SW2B 1CHGA 5BPEA 4WMDA 1UHBB 2BY6X 1Z8GA 2D8WA 1Y3VA 4YTAA 3RXLA 2Z7FE 2FTLE 1TGSZ 4FXGH 1O3KA 2J2UA 3S7HB 1O2OA 4ZXYH 4WXIA 1SLWB 5EPYA 4NIXA 3GY2A 1O2ZA 2OP9A 1AFQC 1FY4A 1YYY1 2R9PA 3S9BA 1P12E 2VWLA 3GY4A 2QXIA 1A3EH 2DUCA 2G81E 1O2SA 4MVNA 1GI2A 2BDGA 1SLVB 2ANWA 1NRSH 1XXDA 4DG4A 3LH1A 3SV6A 1PPCE 1PPBH 3BN9A 4U2WA 2F9PA 3SI4H 1YGCH 5GDSH 1WTGH 1T32A 2ODPA 3W95A 3QGJA 3GCTF 1N8OB 1ZTKA 1UVUH 1O3GA 2BTCE 2VNTA 2QA9E 3LT3A 1HAVA 1O2GH 1FN8A 1QBNA 1AE8H 2RG3A 1FY5A 5A0CA 6ESTA 1OP8A 3OY5U 3PMJA 1Z6EA 3RXQA 1SGTA 1RTKA 3T2NA 1BTHH 1HAYB 2HNTE 3BG4B 2GT8A 2HLCA 3KF2A 8GCHF 3C1KA 3SJ8A 1GBDA 3A8AA 3SN8A 1GBKA 2FOHA 4MQAA 4ASHA 4ZKSU 2BDCA 1L1JA 3E1XB 1O2IA 1QCPA 1E38B 4I31A 2BMGB 2OTVA 3QX5H 3URCA 2GX4A 1HNEE 3S9CA 3ZZ5A 5ABWA 4FVDA 4J2YB 4YOIA 8GCHG 1VITH 3EYDA 2GCTC 3NCLA 3SUGA 4Z6AH 2XC5A 1AGJA 1PYTC 3O8DA 4TWYA 1O5GH 1QB6A 2AEIH 1P8VC 2A5KA 4KTCA 4CR9A 3E91A 2WV5A 1IQHA 1RRKA 1TRMA 4RKJB 1A7SA 4AX9H 1K1OA 2H9EH 4I8JA 4HI3A 1MMJN 1ZHPA 5T6FA 2ZDMA 3RXEA 3SNBA 1S5SA 1UTPA 4K3JA 5FX6A 4IC5A 1TBQH 1UCYH 2UUFB 3MH4A 1NC6A 1UK2A 3STJA 1AB9C 5A8YA 1S6FA 2SGEE 4D8NA 2R0LA 3SU1A 3S69A 3WY8A 5GPIB 5CHAC 2UUKB 3TLOA 1D3PB 1C5XB 2GDDA 1XUIA 1ELBA 3ZZ3A 2W7SA 1Z6JH 2PKSC 1TAWA 2CHAC 3F1SB 2M5TA 7GCHG 1O31A 1GJAB 1S6HA 1CHOG 2R2MB 8KME2 1QR3E 1J16A 4XBCA 1CT4E 2SGFE 4BAQB 1VCPA 2V6NA 1UMAH 1ZRKA 2FM2A 3RXCA 1AMHA 5A8ZA 4KKDA 1KY9A 2BOHB 4H6TA 2A4OA 2ZECA 4Y6DA 1GI1A 1V2LT 3SU2A 1RS0A 3GDUA 1SGFA 3AW0A 5ESBA 4UFEH 3O8BA 1VGCB 1FDPA 4CHAC 4AG1A 1YC0A 5F8XA 2FI3E 1NS3A 1LPGB 3EAJA 3TJNA 3I29A 2FS9A 1KXBA 4GCHG 4CRCA 1UVPA 1O2PA 4SGAE 1GJ6A 4Q7ZA 1QFKH 5GWZA 1ESTA 3M3VA 1GG6B 4K5ZA 1IQLA 2C90B 1S83A 1GBAA 1T4UH 2G4TA 4AOQA 4O3TA 1N8OC 1HRTH 4CH8B 4MDSA 3KQEA 4Y10E 2PGQB 1TX8A 1GHXH 3F9FA 4TY7A 2A45B 1GDQA 4IN2A 3B8JA 1EP6A 1WBGB 2FYQA 2H9TH 1VGCC 3CS0A 1TYNA 1EUFA 2Z3EA 1KXDA 1G3CA 1SQTA 5C5OA 3MNSA 1BRAA 5PTPA 3ATMA 1BZXE 2ODQA 2PFEA 1BBRE 4CREA 2Z3CA 1OOKB 1SBWA 4WH8A 3GCHC 2FODA 1C5QA 2Q6FA 2OQUA 1EJNA 3SBKA 1NFUA 3NZIA 2AS9A 1JRTA 1HAGE 4BAHB 1C2MA 1KDQB 1L1NA 3ZZDA 1CT0E 3I78A 2Z9JA 2ZDLA 3P95A 1QHRB 1BOQA 2ZO3H 5TCAA 1JOUB 1ZR0A 2A7JA 1OWDA 3TGIE 2AGGX 1SFIA 3G01A 5AVDA 2GCHF 1E34B 1V2RT 1U6QA 5E0JA 2XW9A 2ZGXH 1C5ZB 4NSYA 1IQJA 1OWIA 4BTTB 3HGPA 5EW2H 1ETSH 1MTNC 5F03A 2HWLB 5IYTA 5EXNA 1V2MT 1ZYOA 1BUIA 1QJ6B 4ZXXH 1BMNH 3GCTG 1TQ7B 1Y5AT 3ZYDA 2PKAA 4JZEH 1PPEE 3UQOA 2B8OH 1SL3A 5DGJA 1LKAA 3SV9A 2PKSB 4CR5A 1OXGA 2ZDVH 1Z71A 1E0FD 1FV9A 1HCGA 2BY7X 1LCYA 1HAVB 5T6GA 3RMMH 1IQKA 1GI6A 1UVOA 1GBHA 3GICB 3Q76A 2GCTB 3DD2H 3M7TA 3MH6A 3L33A 3MMGA 4A1VA 1GBLA 4VGCC 1WV7H 1Y59T 3AAUA 1CU1A 5GIBA 1IQMA 2BD2A 2EI8A 1DLKB 1DITH 4IW4E 3FP8E 1DWDH 3QWCH 1G3BA 1LVBA 5H4IB 1GMCG 4ISNA 5FPTA 2ZTZA 3U8TH 1OP0A 2GD4B 1NN6A 2A4QA 3SUDA 3BV9B 2OC7A 2HRVA 2QN5T 4JZFH 4AG2A 3P8FA 4CH2B 1EZQA 1E37B 1GJDB 2HPQH 3A86A 3PROA 5FCRA 2Z94A 4B2BA 1QBOA 1O36A 5A2MH 2STAE 2VU8E 2BLWA 5L2YH 2BD9A 1RGQA 2D1JA 2ZKSA 3GYLB 3K2UA 1P2KA 3IITA 1GJ5H 1O34A 1NPMA 1O2QA 3LONA 2SNWA 1KSNA 3AW1A 4OS7A 1ZRBA 5ETXA 5AFYH 4SGBE 1PFXC 2ZZUH 4UFFH 2WUBA 1DICA 4MLFB 1YF4A 1BB0B 2GKVE 1Y5UT 4LZ1H 3BTTE 3BF6H 2TIOA 1ELGA 3HK3B 5DP8A 2BD5A 5E0GA 3LGYA 1BMAA 2D2DA 1GI4A 4D9QA 1QL9A 5G4BA 1FI8A 2ZCLP 2J92A 2R0KA 2ESTE 4BOHA 4CRDA 4E7RG 1C5RA 5JB8S 1MAYA 3TITA 2FI4E 2BM2A 1RTFB 4JMYA 4YLQH 3SO3A 1AIXH 3U69H 3VFEA 1CA0C 4Y0YE 1DUAA 3KHVA 3UY9A 2FLRH 1LHEH 1TB6H 3TK6A 3M7UA 1OWHA 1B0EA 2NU1E 2OXSA 3A8BA 2CXVA 1P9UA 3JZ2B 4X0WU 2PHBA 1HUTH 3P6ZB 1LVMA 3E0PB 2Q6DA 3R3GB 5K7RA 1S0QA 2ZFTA 3Q3KA 9LPRA 3BSQA 1IHTH 3MHWU 1ELFA 1SGRE 4K69A 1D3TB 3M3TA 1FQ3A 2FXRA 1UTJA 3T27A 1TX7A 4K1TA 3SORA 1JIMA 5C5NA 4LOYH 1TOCB 2RDLA 1XUGA 1PYTD 4TYDA 3F9HA 3IG6B 1NT1A 4QT8C 4GHTA 1IAUA 4IS5A 1HGTH 3VGCC 5DG6A 2GGVB 1F0UA 2WINI 1C1TA 1H4WA 3NK8A 3UREA 1JRSA 2C93B 2P8OC 1EPTA 1O3IA 2LNCA 1O0DH 2AIQA 1LHFH 1EAUA 5C1XA 1SSXA 2ALVA 4XFQA 2G5NA 1V2QT 1EX3A 4NCYA 4CRBA 2P16A 2R2WU 1Z8RA 1ANCA 4O97A 3RM0H 1MKXH 1C5TA 1F0SA 1EKBB 2Q1JA 2ZGCA 3BTFE 2V3OH 1Q31A 4UFGH 1C5UA 2O8WA 4AZ2B 2ZWLH 1TGTA 2AMPA 1LO6A 3MU5A 1O3FA 2ZEBA 1KLJH 2RA0A 3VEQB 1CGHA 1GMHG 1O37A 1TA2A 2BD8A 1UTOA 3R0FA 3HGNA 1GDNA 5F8TA 5FX5A 2RA3A 3D65E 2XCFA 1O2YA 1A1RA 2WPKS 2SGAA 5HM9A 1K1JA 1EXFA 1S0RA 3GY5A 1DANH 1UO6A 3T25A 3VB6A 1MKXK 6CHAC 3VPKA 5C1UA 2AH4X 3RXTA 2OBOA 3V3MA 1IHSH 3RXMA 5FHTA 3K6ZA 4ZH8A 1IQNA 1K22H 1Y3XA 1CA0B 2F83A 1XVOA 1Y3YA 3E16B 3NWUA 2SFAA 2PWXA 3Q3YA 3RXDA 4X8UH 3ZV8A 2ZFFH 2J4IA 2ZU2A 1GJ8B 3RXJA 1TRNA 2QC2A 3IWMA 4MPXA 3D49H 3M5MA 4A92A 3V12A 1TMUH 4YESB 1C1PA 3RXFA 2KAIA 1KLTA 2UUJB 3LIWA 4XBBA 1EASA 3I77A 1QRZA 3STIA 3M7QA 2TBSA 5LGOA 3DT0H 5EXLA 2H2ZA 3FVFB 1SGCA 2TGAA 5GCHF 3A80A 1ARCA 1GBTA 1V2JT 3OY6U 5DP3A 5FBIA 1T7CA 4CBNA 1MKWH 1O2TA 1WQVH 3PTNA 1HPGA 1ZSLA 4GVUA 5GJ4B 3PLBA 1WU1A 1EJAA 3ZZCA 4Q7YA 1T31A 1QTFA 3ATIA 3C27B 2GMTB 1FIZA 1NRRH 1H9LB 4BXWA 1T8MA 2VIWA 1SGDE 2Y82A 3ZYEA 3ZV9A 2GZ8A 1ETTH 1Z1IA 4B73A 2EI7A 3UFAA 4OS2A 1EZUC 1P2JA 1AWFH 1VZQH 1P3EA 1QNJA 2WPHS 3SNDA 1AU8A 1TNHA 3MU1A 3P8GA 4XE4A 2H9HA 2TGDA 1HAXB 2O8LA 3TVJB 1DM4B 5CMXH 5EOKA 2ZHFH 3ZVAA 3LH3A 3VGCB 1GI8B 2WUCA 2VIOA 1B5GH 3M37A 4ZKNU 1WTHD 2UWOA 2Z9LA 4U32A 1BQYA 6GCHF 2W5EA 1GBJA 1OX1A 1ZMNA 1W10U 1W14U 1C5PA 1AKSB 1EQ9A 2C8WB 3GCHB 1UTKA 3RC4A 5IDKA 2H1UA 5EG4A 4LZ4B 3RU4D 1K28D 1O30A 3ESTA 3PLKA 1GWAA 1K2I1 1P2QA 4UEHH 1FY1A 3ZZ4A 4X2WA 5L2ZH 3DHKH 4X1SU 4KGAA 1V2UT 2ZFQH 1HJ8A 3A87A 3E90B 3TJVA 1Z8JB 4D9RA 2OQ5A 3LJJA 2OC1A 4X8SH 2ZPQA 1O2HA 3A8CA 1GHVH 1GI0A 1TPAE 3SI3H 3T29A 4XOJA 2GDEH 2ZGJA 3KN2A 4K8YA 1DXPA 2GP9B 2Z3DA 1W8BH 1GL1A 2ZHQH 3OYPA 4ZUHA 4GCHF 3GY6A 4ZMAH 2OUAA 2A7CA 2J9NA 3BEFB 1UTNA 4ZHAA 3TNTA 2G5VA 4U30A 1C2HA 2ZQ1A 2BDAA 1V2PT 1C1OA 1GMHF 1LHGH 4AFSA 1YPGH 5JBTA 4R8TB 2ZHWH 3S0NA 2SGQE 2XBYA 3A84A 3SGQE 1GPZA 3A89A 1QBVH 1RIWC 1P11E 1T8OA 2P95A 5AHGH 1YPKH 2FOFA 2FOEA 2XRCA 1A61H 3U1JB 4E7NA 1O3AA 1CO7E 1YKTA 3LGTA 4AN7A 2P94A 2GVFA 1K21H 2Y5FA 1UHBA 3OX7U 2WPLS 1MU6B 3P17H 2HVXA 2FZZA 4AB8A 1HJAB 3LDXH 4GSOA 3MH7A 3SNCA 3HK6B 2EEKA 3GYMA 4RKOB 1BRUP 1BTYA 1VCQA 2GTBA 4O3UA 2FIRH 3PB1E 3ATKA 2QCYA 3ZVGA 3VXEH 2TPIZ 2ZFRH 1EB2A 3QK1A 1HAHH 3ZVEA 1TA6A 1TE0A 4Z0KA 2GV7A 1CSOE 5GXPA 2BLVA 1A4WH 5JB9S 1TGBA 1SB1H 4YOJA 4ISIH 1GG6C 2QXHA 2XBXA 4NZLA 4X2YA 4ISHH 4A6LA 2FS8A 4WVPE 3SOSA 2QXGA 1MZAA 1A5GH 1O2VA 2Z9IA 3ATLA 1INCA 4OS6A 3BEUA 1YP9A 1FAKH 1FXYA 5EU8A 2PV9B 1TALA 1SGFG 3RLWH 1AE5A 4X1RU 1GI3A 3EE0B 1BTUA 3FAOA 3KGPA 1ORFA 2CF9H 3FZDA 4B1TA 1BT7A 1DUEA 2PR3A 1D4PB 1GL0E 2WYGA 1GCTB 1FN6A 2FOGA 4MPUA 1DPOA 1TPOA 1N6YA 2G4UA 1BHXB 1P01A 4NWLA 1EAIA 1UCYE 3QZRA 1ZLRA 4NA9H 2YNBA 1ELTA 3ZZ7A 4JYUH 1P57B 3SV7A 4CBOA 2F3CE 1TX6A 5HM2A 4MNXA 1CBWB 2A2QH 1HFDA 3S9AA 1BTPA 3A7VA 2LPRA 4ABBA 4UFDH 5J4SA 2ZHDA 2BDYA 1CVWH 2VIQA 4BTUB 1C4U2 1FPHH 2ZQ2A 2WPJS 1MTNB 3LGUA 4ISLA 1QIXB 2BY5X 5JBCS 5T3HA 3AASA 1AVXA 1MQ5A 1LQDB 1ZTJA 1H8DH 4ABGA 4TWWA 2IPHA 4GPGA 1C1VH 4O9VA 2CF8H 5A09A 2ILNA 1AVWA 1LTOA 1C1QA 4JZIA 1ZSKA 2F9OA 1DWBH 4INKA 2PTCE 6CHAB 2FPZA 1V6DA 1V2OT 2XWBI 1ELCA 3UNSA 3ZVDA 2OCVB 3A7WA 4AFZA 1AD8H 4H4FA 1O33A 3P8OA 3PWCA 2A0QB 2Y7XA 3BIUH 1O2XA 3ITIA 1DLEA 2BDBA 4TY6A 2O9QA 4A7IB 1XM1A 1C1RA 3D23A 3FP7E 3SU0A 5F8ZA 2BZ6H 2J94A 1X7AC 3ZVBA 4LK4A 3LU9B 4DCDA 1L4ZA 3T26A 3SU3A 2C8XB 1H8IH 3SQEE 1WAYB 2ZI2H 1WOFA 2ZP0H 4JK6A 3ZZ6A 1SGNE 1O35A 5GCHG 1O3DA 1LPKB 1ZOMA 1HYLA 3ODDA 1GVKB 1B7XB 1QA7A 1K1MA 1GGDB 1H1BA 1Q2WA 3VB3A 2V35A 1AZ8A 1D6WA 1TPPA 3TGKE 3KQBA 1XUKA 2PW8H 4ABFA 3RXBA 2FTMA 4MNWA 1DOJA 3N7OA 1G32B 3KCGH 2PUXB 1S82A 2G52A 3RMOH 1OSSA 3ODFA 5HMAA 1A0JA 3MFJA 1E36B 1YBWA 2ZFSA 4FVBA 1OWJA 2VIVA 1J14A 2QGRA 3MU8A 4YT6H 2R3UA 1GJCB 4K1EA 1HAIH 1TBZH 1BDAA 1TFXA 1HB0B 1N6XA 4ABIA 4B2CA 3FZZA 1XKBC 2PGBB 1O32A 4XBDA 1A46H 1IQIA 2VIDA 1EZSC 1YCPM 1A0HB 2HALA 1P10A 5DP4A 2BD3A 1A5IA 4B76A 2CHAB 2OC0A 1J17T 1PPFE 2THFB 1SQOA 2F9UA 1GCTC 1AQ7A 1NU7B 4R0IA 5JBBS 3V0XA 3QTOH 2BXTH 3A82A 3RXUA 2ZNKH 1ESBA 2YNAA 4O03A 1YPJH 4FUFA 3RXHA 1C2FA 3T5FH 1NRPH 2QYIA 1Y3WA 3UWIA 1V2VT 2ZG0H 2V0BA 3SGAE 1XUHA 1QQUA 1ZMJA 5C1YA 2BDHA 2UWLA 3F9EA 1UJ1A 2Y80A 1LPZB 1UVSH 1ZPCA 3FP6E 2JH0D 2GZ7A 1TIOA 4ZAEA 5DO4H 4TPYA 1O5EH 2V3HH 1MKWK 2WV4A 1O3PB 2NWNA 4RSPA 4A1XA 3UOPA 1GBFA 1V2WT 1WSSH 4IMZA 4AB9A 1NO9H 1XKAC 2FWWA 2VINA 3HKIB 1P2OA 3RXKA 1ZPBA 4THNH 4AYVB 4NIVA 1CE5A 3CENA 2TGTA 2ZGBH 3GY8A 1WUNH 1DSUA 2AMDA 3TPIZ 1L2EA 3MWIU 1GBIA 2VH0A 1GGDC 3RXOA 1GHBF 2A2XH 2W7UA 2HNTF 1JWTA 1ZJDA 2G00A 2SGDE 3MO3A 1TONA 1FJSA 2AYWA 4GHQA 4LXBH 4MNVA 2NU0E 1ELEE 2XC4A 1BTWA 3PMBB 5EPNA 1HV7A 3OTJE 1S81A 4WMFA 2Y6TA 1ELVA 3HATH 1F92A 3TU7H 1FY3A 4FU8A 1JMOH 1C5YB 2Y5GA 2UUYA 1PQAA 4NG9H 4AGKA 2FYRA 4JZDH 4WWYA 3QLPH 5K0HA 4ZKRU 1W13U 1RJXB 2AMQA 1OS8A 2BX4A 2H5CA 1CHOF 8LPRA 1AWHB 1HAZB 1NFYA 3ZZAA 3KQDA 2ZC9H 3L3TA 3SJOA 2ALPA 1BTZA 1AY6H 4DT7B 3PMAB 1O5AB 4DIHH 2ZFPH 5DPAA 1BRBE 1CA8B 2ANYA 1MD7A 2G55A 3UOUA 1C1NA 6GCHG 1P2IA 1ZHRA 2VVUA 4FU7A 3TJOA 2VIPA 3PMHB 5ESTE 3RC5A 1HAPH 1NY22 1NU9A 2VWMA 1TWXB 3NUMA 1MAXA 1W7XH 1NESE 4FUHA 1T8NA 3UTUH 3TH3H 5AFZH 4NGAH 2VVVA 4K1SA 2FESH 1ELDE 1RIWB 3T62A 1NROH 3RDZA 2GMTC 2O8TA 6LPRA 1C9PA 3EDXB 3PM3A 3SJIA 1JIRA 1P3CA 1K1IA 3SHAH 1P2NA 1O3NA 3GDSA 1EAWA 1O39A 3UNQA 4ZHMU 1ARBA 4A1TA 5EXMA 3GY3A 5DKMA 2EI6A 1C2GA 3P70B 4E06H 4BAMB 4BTIB 3E3TA 4MG3A 2BXUH 1HIAB 1EJMA 1W7GH 3QO6A 1AUTC 1G36A 1YPLH 3AVZA 1RTLA 2XXLA 1AB9B 4B75A 1SMFE 1TGCA 2BQWB 2BYAX 5LPFA 1FMGA 1AVGH 1C1SA 1GJBB 2Y81A 4IGDA 3TH4H 4FUEA 3MO9A 1GBBA 1PQ5A 3UUZA 5FPSA 2AGEX 1FLEE 3T28A 1GVLA 2BLQA 1BITA 1HXEH 3LGIA 4X1NU 1L0ZA 1F7ZA 1C2IA 4X2VA 1YPHC 3K65B 2OBQA 3V7TA 4OS1A 1G3EA 3GCNA 2ZTXA 4IC6A 5EQQA 1C4V2 3RC6A 2BOKA 3UNRA 1P04A 1NFXA 5I25A 4INHA 2C8YB 1C5VA 1RXPA 1W11U 5TCCA 1P03A 1ANBA 2BB4A 3A81A 1GI9B 1LMWB 3BTME 3SUEA 2P59A 4I8KA 1GCDA 1Y5BT 1FNIA 4YLUA 1BBRK 3HPTB 1GHZA 5LH8A 4DURA 4FUDA 2VWOA 5FPYA 1SHYA 1SVPA 2ZDNA 4AYYB 2BQ6B 2B9LA 1YLCA 3UPEA 1VJAU 1VR1H 1VITG 3MU4A 1JXPA 2PSYA 2A4RA 4I8GA 1JBUH 1GHYH 2NU3E 1VCWA 3F68H 1G37A 1MH0A 3TK9A 3CP7A 3UWJH 4NZQA 1T8LA 3DFJA 2VGCB 5DK1A 3LJOA 4NA8A 1FAXA 1IQFA 2DE9A 5DJ7A 3RXAA 4CRGA 2R3YA 1W3CA 3RMNH 1L1GA 1V3XA 1AUJA 4DJZB 3MOCA 1MTVA 3E8LA 5J4QA 1HAOH 1ZTLA 1RD3B 1BBRH 1C2KA 2ZTYA 1HXFH 4X1PU 3ZZBA 4YOGA 2SGPE 4B2AA 3VB5A 1D6RA 1L4DA 3SZNA 3SJ9A 1DE7H 2FLBH 3VB4A 1TNIA 3MU0A 1W12U 3GCOA 2BZAA 5EQRA 1O3MA 3O8CA 1TLDA 2WPMS 3EGKH 4NFFA 5LPRA 1MU8B 1EATA 1AZZA 3RP2A 1F0RA 1O38A 1GVZA 3LC5A 2G8TA 1GJ4H 2A1DB 1A5HA 2WPIS 2Z9KA 1OKXA 2P93A 1MCTA 1O2NA 4FUCA 4D7FA 1NFWA 1LHCH 1Y3UA 3PO1B 1HDTH 4Y8YA 1DVAH 1KTTB 2QAAA 4Y7AA 1F2SE 4BXSA 4UONA 5CE1A 2ZHEH 1H9IE 3RU4T 1GBMA 1EP5A 3RXPA 1G3DA 1K1LA 1BHXF 3V13A 4BANB 2BVXH 4X1QU 2I6QA 2ZGHA 3KIDU 3ZZ8A 1EOLA 4WF8A 1MUEB 2AIPA 5SGAE 1NRQH 1FPCH 4BAKB 3SHCH 4A5TS 5T6DA 4INLA 5FXLA 1KLIH 5L30H 4IMQA 5HXFA 4YZUA 4X2XA 1KXFA 5LPEA 1PPZA 3UIRA 1ANDA 1Y8TA 4JK5A 1O3BA 1F5LA 1SOTA 2Z6BD 1D3DB 1SPJA 1HBTH 1ELAA 4AFQA 1VJ9U 1MD8A 1C5NH 2BQ7B 3VB7A 1O3EA 5FBEA 1F5KU 3F6UH 2FOMB 2FOCA 3TIUA 1BJVA 2XBVA 2CV3A 1C9TA 3RMLH 1LDTT 4HGCA 2F9BH 1ETRH 2F9VA 5BRRE 1CGIE 3B9FH 1WQSA 2OINA 2PTNA 4DIIH 1TMTH 2XCNA 1G2LA 2A5AA 1TABE 3ATWA 3E6PH 1SGPE 1SQAA 1KXAA 4Y8XA 3W94A 2K1QA 1W2KH 1LVYA 3O8RA 5E2PA 1TNLA 3P8NA 1O5FH 1UK3A 1MBMA 1O3LA 3PO1C 5JYIA 3QTVH 1C5MD 1OYQA 3NKKA 4ZKOU 8ESTE 1C5SA 1O2KA 5HGGA 1V2NT 1PQ8A 2ZDAH 4DW2U 1GJ7B 1F0TA 2C4FH 1ZMLA 3MI4A 1UTMA 2P8OB 4FUJA 2ZDKA 4JYVH 1XVMA 4ZHLU 1A3BH 2ZU5A 7GCHF 3UQVA 2JH5D 3M36A 3TH2H 2JETB 1KIGH 2O8UA 1XMNB 5JDUB 1P0SH 5E8EH 4MTBA 5DP5A 2VWNA 2D26C 2AFQB 1D3QB 1TNKA 1EAXA 1SGEE 4AGJA 2BHGA 1UCYK 3BG8A 4PROA 1QURH 2J38A 1FZZA 4ABAA 3TJUA 1C1UH 1O2RA 3EA8A 1DX5M 3M5LA 3M35A 4MPVA 3KQCA 1TBRH 2IN2A 2C8ZB 2XYAA 3GDVA 3KL6A 2B7DH 1GMDF 1EOJA 2XNIA 2QY0B 3GISB 3E0NB 4ABJA 3H7OA 3M5OA 1QRWA 4B74A 2QF0A 3K6YA 1CBWC 3B23B 4DOQA 5DP9A 2QF3A 4MPWA 5A8XA 2BVSH 2AGIX 4J1YA 2VJ1A 1P9SA 1HJAC 4CRFA 2O8MA 1THPB 3CS7A 1AN1E 1OP2A 1SGIB 4I8LA 2TGPZ 3U1IB 1PPHE 4DVAU 5EODA 3U98H 3ZVFA 1MCVA 1Q3XA 4HFPB 5FAHA 1PJPA 3OU0A 1OPHB 3M3SA 2ZPRA 4BNRA 1MBQA 3MNCA 3BIVH 4Y79A 1C5OH 1RFNA 1GI5A 3ENSB 4GLYA 5C20A 1HIAA 1O5CB 1MTUA 4JZ1A 3SU6A 3BTGE 4NSVA 3RXGA 3BTQE 5DP7A 4I7YH 4Y8ZA 2BLOA 1O3CA 1THSH 5EW1H 1LHDH 2VH6A 3SQHE 1SR5C 3NPSA 4WH6A 2CJIA 1P05A 1LVOA 1XX9A 4GAWA 3A88A 1YPMH 4Y71A 1C2JA 4FUBA 3SJKA 2QXJA 3A7YA 4FUIA 1BJUA 1TOMH 4I32A 4ABEA 5A0AE 1BTXA 3QGNB 1PPGE 1K9OE 2ZU1A 1DY8A 3OSYA 4E05H 4HZHA 2B5TB 3RXRA 9ESTA 1XUJA 1IOEA 2JETC 3RM2H 1QL8A 2NU2E 3URDA 1WCZA 3LPRA 4AORA 1ZHMA 2TRMA 3PYHA 2VB0A 2GZ9A 1OWKA 1DS2E 1TGNA 4XSKU 2FMJA 2A32A 2A4GA 1C2DA 1SHHB 2FOAA 1PQ7A 3M5NA 2YOLA 1AO5A 2PSXA 1HJ9A 3DUXH 5TJXA 5DP6A 1GHAF 1XUFA 1EPTC 1O2JA 1ABIH 2CMYA 1G2MA 3AAVA 2KAIB 1YPHE 1ZGVA 3BG4C 1DSTA 1QGFA 4ISOA 2ANMH 3U8RH 3Q3XA 1YM0A 2B0FA 2G51A 1QB1A 1QRXA 1SOZA 4RN6A 1MQ6A 5AF9H 4GUXA 1NM6A 3RXVA 1OYTH 4M7GA 2EC9H 1H9HE 2H6MA 2J95A 3MO6A 1GBEA 3SV8A 1GHAG 4X8TH 1UK4A 7LPRA 3PV4A 1O5DH 3JZ1B 4ABHA 1BIOA 4X8VH 1GDUA 3SUFA 3SU5A 2BVRH 1BA8B 4NWKA 3H5CB 4K8BA 1K1NA 3QUMP 2OD3B 2OC8A 3SNEA 7KMEH 1J15A 1FY8E 2STBE 1ESAA 1O2LA 2FEQH 2FDAA 2GV6A 2HNTC 1TNGA 4JCNA 1SI5H 4U01A 3MH5A 2H5DA 3BTEE 4D76A 4WY3A 3FFGA 1C2EA 1V2TT 1M9UA 2HGTH 2ZF0H 4DY7B
chains in the Genus database with same CATH superfamily
4F49A 1FUJA 4CRAA 2ZU4A 1V2KT 3SNAA 2M2AA 3A7XA 1IQGA 2YMSC 3SGBE 1A2CH 3D62A 4Y11E 1TQ0B 1OHHD 1MZDA 3MNBA 2OLGA 1CT2E 3RXSA 2ZPSA 1DFPA 1O2UA 3EA9A 3MTYA 1N1LA 4Y7BA 1C5LH 1FONA 4JYTA 1FIWA 2ZA5A 1THRH 1AKSA 4UE7H 1S85A 3MYWA 5A0BA 1D9IA 1LKBA 3MNXA 3M61U 1BCUH 1NTPA 5HYOA 1SQRA 3F9GA 4KTSA 4OGXA 1YPEH 3QDZB 4H6SB 3U9AH 1CGJE 2QV1A 2PLXA 2XWAA 1DXWA 1KDQA 2RCEA 3NXPA 1WYKA 1DDJA 2KCOA 1KXCA 3BTKE 1DWEH 4AFUA 4ZROA 3QN7A 2BDIA 5C67A 2QIQA 1Z8IB 4IBLH 2ZIQH 3CNRA 1OWEA 2FOBA 4VGCB 1UVTH 5EGMA 5EIYA 4P02A 4TPIZ 1SG8B 3EA7A 5B6OA 1CQQA 1IQEA 2W3IA 5EQSA 1C4Y2 3TNSA 2ANKH 4XDEA 3DA9B 4X6MA 2P3FH 3S7KB 2GCHG 1W0YH 2F9NA 1NZQH 2CN0H 1EB1H 1O3HA 2BD4A 3PV5A 2HPPH 1GMDG 1TNJA 3BTWE 4I8HA 1AFQB 2BD7A 1YCPH 7ESTE 5L6NH 2P3UB 2W26A 1P02A 4Y0ZE 1G30B 2BX3A 1DWCH 1AI8H 2UWPA 2PUQH 3PTBA 4KP0A 3WWFA 4F4OC 2IJOB 2A7HA 5F6MA 3VXFH 1Z1JA 2A31A 2JH6D 5C3NA 4I33A 4NIWA 1QQ4A 5JPMH 1GMCF 3BEIB 2ZU3A 1GI7B 3OE7D 4KELA 1ACBE 2NU4E 2IOTA 2W3KA 4Y76A 2FI5E 1DY9A 4NA7A 1ZZZA 4OGYA 2AERH 3ZIAD 3UR6A 4TT3D 1O3OA 3A83A 4DGJA 1GHBG 1YCPK 3A85A 1P06A 1SLUB 1SGQE 2VVCA 4XRNA 1GBCA 2ULLA 1GHWH 4B6EA 1VITF 1ZJKA 4WXVA 2A5IA 1QA0A 3DFLA 4X6OA 1SGYE 3TK5A 4UD9H 1P09A 1O3JA 1GJ9B 2FO9A 3VG8A 1QB9A 4B6FA 1SFQB 1J8AA 2ODYB 5E0HA 3Q77A 1KXEA 3ELAH 4NIYA 2F4LA 4K60A 3RU4E 1XXFA 3SV2H 4IN1A 3RXIA 5C2ZA 3HKJB 1C5WB 4FUGA 4UDWH 1S84A 4K2YA 3OEHD 3H09A 1AFEH 2PKAB 2J34A 1W0ZU 3P92A 4Q7XA 1K1PA 3FANA 4F48B 4OS4A 1EPTB 3OEED 5FCKA 3H7TA 2Y5HA 3RUOA 1TMBH 1UTLM 2Z9GA 4H42U 4X6NA 1QL7A 1UTQA 1O2MA 3BTHE 1B0FA 4BAOB 3PLPA 2XBWA 3EQ0H 2ZCKP 2SNVA 2VGCC 1ANEA 4NFEA 1ZGIA 4Q80A 4YM9A 1TRYA 1QJ7B 2OK5A 1QJ1B 2XTTB 1C2LA 3GOVB 3UR9A 4Q2KA 2FP7B 4WMEA 3BTDE 3TGJE 1KTSB 2F91A 4HTCH 3A7ZA 5I46H 4ABDA 3Q00A 4MNYA 1C1WH 3L6PA 2FX4A 3LGWA 1HLTH 4CHAB 1EZXC 1ZSJA 4ESTE 1DT2A 2CGAA 2BY9X 1FX0B 1F5RA 4YT7H 1QY6A 2Y7ZA 1C1MA 1YLDA 2C3SA 2XC0A 3FKSD 2GT7A 5B6LA 2EQNA 3SU4A 4B71A 1NRNH 3GY7A 1BMLA 2DE8A 1TPSA 1SLXB 1SC8U 2Q6GA 3LKWA 2JKHA 3ZVCA 2J97A 3LC3A 2BY8X 3KEEA 3RLYH 3A8DA 2EA3A 1E35B 4OS5A 4X6PA 3LOXA 2HOBA 5CHAB 3ZZ9A 1ABJH 1AHTH 1P2MA 1O2WA 2FX6A 3KYFA 1LQEA 2I6SA 1G9IE 2P3TB 4YO9A 2WYJA 1MTWA 3LGVA 1ZPZA 1O5BB 1MTSA 4KTUA 3K9XB 3QZQA 3FOAA 3KNXA 1Z7KA 4FU9A 1BMMH 1T4VH 1ID5H 4RT1A 1BRCE 1KYNA 3PWBA 2ZCHP 3DSPA 3SYJA 5JBAS 4WJG2 1J9CH 4D7GA 3A7TA 3U8OH 1A0LA 5E2OA 1V2ST 2ASUB 3SW2B 1CHGA 5BPEA 3GS9A 4WMDA 1UHBB 2BY6X 1Z8GA 2D8WA 1Y3VA 4YTAA 3RXLA 2Z7FE 2FTLE 5T1VA 1TGSZ 4FXGH 4YXWD 1O3KA 2J2UA 3S7HB 1O2OA 4ZXYH 4WXIA 1SLWB 5EPYA 4NIXA 3GY2A 1O2ZA 2OP9A 1AFQC 1FY4A 1YYY1 2R9PA 3S9BA 2KZ4A 1P12E 2VWLA 3GY4A 2QXIA 1A3EH 2DUCA 2G81E 1O2SA 4MVNA 1GI2A 2BDGA 1SLVB 2ANWA 1NRSH 4RI0A 1XXDA 4DG4A 3LH1A 3SV6A 1PPCE 1PPBH 3BN9A 5KGOA 4U2WA 2F9PA 3SI4H 1YGCH 5GDSH 1WTGH 1T32A 2ODPA 3W95A 3QGJA 3GCTF 1N8OB 1ZTKA 2BTCE 1UVUH 1O3GA 1H8HD 2QA9E 2KCYA 2VNTA 1HAVA 3LT3A 1O2GH 1FN8A 1QBNA 1AE8H 2RG3A 1FY5A 5A0CA 6ESTA 1OP8A 3OY5U 3PMJA 1Z6EA 2VBCA 3RXQA 1SGTA 1RTKA 3T2NA 1BTHH 1HAYB 2HNTE 3BG4B 2GT8A 2HLCA 3KF2A 8GCHF 3C1KA 3SJ8A 1GBDA 3A8AA 3SN8A 1GBKA 2FOHA 4MQAA 4ASHA 4ZKSU 2BDCA 1L1JA 3E1XB 1O2IA 2K0QA 1QCPA 1E38B 4I31A 2BMGB 2OTVA 3QX5H 3URCA 2GX4A 1HNEE 3S9CA 5C94A 3ZZ5A 5ABWA 4FVDA 4J2YB 4YOIA 8GCHG 4Z1MD 1VITH 3EYDA 2GCTC 3NCLA 3SUGA 4Z6AH 2XC5A 1AGJA 1PYTC 3O8DA 4TWYA 1O5GH 1QB6A 2AEIH 1P8VC 2A5KA 3UB0A 4KTCA 4CR9A 3E91A 2WV5A 1IQHA 1RRKA 3DSOA 1TRMA 4RKJB 1A7SA 4AX9H 2YMSB 1K1OA 2H9EH 4I8JA 4HI3A 1MMJN 1ZHPA 5T6FA 2ZDMA 3RXEA 3OAAD 1S5SA 1UTPA 3SNBA 4K3JA 5FX6A 4IC5A 1TBQH 1UCYH 2UUFB 3MH4A 1NC6A 1UK2A 3STJA 1AB9C 5A8YA 1S6FA 2SGEE 4D8NA 2R0LA 3SU1A 3S69A 3WY8A 5GPIB 5CHAC 2UUKB 3TLOA 1D3PB 1C5XB 2GDDA 1XUIA 1ELBA 3ZZ3A 2W7SA 1Z6JH 2PKSC 1TAWA 2CHAC 3F1SB 2M5TA 7GCHG 1O31A 1GJAB 1S6HA 1CHOG 2R2MB 8KME2 1QR3E 1J16A 4XBCA 1CT4E 2SGFE 4BAQB 1VCPA 2V6NA 1UMAH 1ZRKA 2FM2A 3RXCA 1AMHA 3U28C 5A8ZA 4KKDA 1KY9A 2BOHB 4H6TA 2A4OA 3F2FA 2ZECA 4Y6DA 1GI1A 2K8IA 1V2LT 3SU2A 1RS0A 3GDUA 1SGFA 3AW0A 5ESBA 4UFEH 3O8BA 1VGCB 1FDPA 5C17A 4CHAC 4AG1A 1YC0A 5F8XA 2FI3E 1NS3A 1LPGB 3EAJA 3TJNA 1YWUA 3I29A 2FS9A 3F0PA 1KXBA 4GCHG 4CRCA 1UVPA 1O2PA 4SGAE 1GJ6A 4Q7ZA 1QFKH 5GWZA 1ESTA 3M3VA 1GG6B 4K5ZA 1IQLA 2C90B 1S83A 1GBAA 1T4UH 2G4TA 4AOQA 4O3TA 1N8OC 1HRTH 4CH8B 4RT0A 4MDSA 3KQEA 4Y10E 2PGQB 1TX8A 3SZEA 1GHXH 3F9FA 4TY7A 2A45B 1GDQA 4IN2A 3B8JA 1EP6A 1WBGB 2FYQA 2H9TH 1VGCC 3CS0A 1TYNA 1EUFA 2Z3EA 1KXDA 1G3CA 1SQTA 5C5OA 3MNSA 1BRAA 5PTPA 3ATMA 1BZXE 2ODQA 2PFEA 1BBRE 4CREA 2Z3CA 1OOKB 1SBWA 4WH8A 3GCHC 2FODA 1C5QA 2Q6FA 2OQUA 1EJNA 3SBKA 1NFUA 3NZIA 2AS9A 1JRTA 1HAGE 2KFWA 4BAHB 1C2MA 1KDQB 1L1NA 3ZZDA 1CT0E 3I78A 2Z9JA 2ZDLA 3P95A 1QHRB 1BOQA 2ZO3H 5KEDA 5TCAA 1JOUB 1ZR0A 2A7JA 1OWDA 3TGIE 2AGGX 1SFIA 3G01A 5AVDA 2GCHF 1E34B 1V2RT 1UW7A 1U6QA 5E0JA 2XW9A 2ZGXH 1C5ZB 4NSYA 1IQJA 1OWIA 4BTTB 3HGPA 5EW2H 1ETSH 1MTNC 5F03A 2HWLB 5IYTA 5EXNA 1V2MT 1ZYOA 1BUIA 1QJ6B 4ZXXH 1BMNH 3GCTG 1TQ7B 1Y5AT 3ZYDA 2PKAA 4JZEH 1PPEE 3UQOA 2B8OH 1SL3A 5DGJA 1LKAA 3SV9A 2PKSB 4CR5A 1OXGA 2ZDVH 1Z71A 1E0FD 1FV9A 1HCGA 2BY7X 1LCYA 1HAVB 5T6GA 3RMMH 1IQKA 1GI6A 1UVOA 5DSFA 1GBHA 3GICB 3Q76A 2GCTB 3DD2H 3M7TA 4Q4LA 3MH6A 3L33A 3MMGA 4A1VA 1GBLA 4VGCC 1WV7H 1Y59T 3AAUA 1CU1A 5GIBA 4TSFD 1IQMA 2BD2A 2EI8A 1DLKB 1DITH 4IW4E 3FP8E 1DWDH 3QWCH 1G3BA 1LVBA 5H4IB 1GMCG 4ISNA 5FPTA 2ZTZA 3U8TH 1OP0A 2GD4B 1NN6A 2A4QA 3SUDA 3BV9B 2OC7A 2HRVA 2QN5T 4JZFH 4AG2A 3P8FA 4CH2B 1EZQA 1E37B 1GJDB 2HPQH 3A86A 3PROA 5FCRA 2Z94A 4B2BA 1QBOA 1O36A 5A2MH 2STAE 2VU8E 2BLWA 5L2YH 2BD9A 1RGQA 2D1JA 2ZKSA 3GYLB 3K2UA 1P2KA 3IITA 1GJ5H 1O34A 1NPMA 1O2QA 3WW7A 3LONA 2SNWA 1KSNA 3AW1A 4OS7A 1ZRBA 5ETXA 5AFYH 4SGBE 1PFXC 2ZZUH 4UFFH 2W6ID 2WUBA 1DICA 4MLFB 1YF4A 1BB0B 2GKVE 1Y5UT 5EJLA 4LZ1H 3BTTE 3BF6H 2TIOA 1ELGA 3HK3B 5DP8A 2BD5A 5E0GA 3LGYA 1BMAA 2D2DA 1GI4A 4D9QA 1QL9A 5G4BA 1FI8A 2ZCLP 2J92A 2R0KA 2ESTE 4BOHA 4CRDA 4E7RG 1C5RA 2KX4A 5JB8S 1MAYA 3TITA 2FI4E 2BM2A 1RTFB 4JMYA 4YLQH 3SO3A 1AIXH 3U69H 3VFEA 1CA0C 4Y0YE 1DUAA 3KHVA 3UY9A 2FLRH 1LHEH 1TB6H 3TK6A 3M7UA 1E1RD 1OWHA 1B0EA 2NU1E 2OXSA 3A8BA 2CXVA 1P9UA 3JZ2B 4X0WU 2PHBA 1HUTH 3P6ZB 1LVMA 4FETA 3E0PB 2Q6DA 3R3GB 5K7RA 1S0QA 2ZFTA 3Q3KA 9LPRA 3BSQA 1IHTH 3MHWU 1ELFA 1SGRE 4K69A 1D3TB 3M3TA 1FQ3A 2FXRA 1UTJA 2F43B 3T27A 1TX7A 4K1TA 3SORA 1JIMA 5C5NA 4LOYH 1TOCB 2RDLA 1XUGA 1PYTD 4TYDA 3F9HA 3IG6B 1NT1A 4QT8C 4GHTA 1IAUA 1W0KD 1HGTH 4IS5A 5HIZA 3VGCC 5DG6A 2GGVB 2JJ2D 1F0UA 2WINI 1C1TA 1H4WA 3NK8A 3UREA 1JRSA 2C93B 2P8OC 1EPTA 1O3IA 2LNCA 1O0DH 2AIQA 2EY4C 1LHFH 1EAUA 5C1XA 1SSXA 2ALVA 4XFQA 2G5NA 1V2QT 1EX3A 4NCYA 4CRBA 3AK5A 2P16A 2R2WU 1BMFD 1Z8RA 1ANCA 4O97A 3RM0H 1MKXH 1C5TA 1F0SA 1EKBB 2Q1JA 2ZGCA 3BTFE 2V3OH 1Q31A 4UFGH 1C5UA 2O8WA 4AZ2B 2ZWLH 1TGTA 2AMPA 1LO6A 3MU5A 1O3FA 2ZEBA 1KLJH 2RA0A 3VEQB 1CGHA 1GMHG 1O37A 1TA2A 2BD8A 1UTOA 3R0FA 3HGNA 1GDNA 5F8TA 5FX5A 2RA3A 3D65E 2XCFA 1O2YA 1A1RA 2WPKS 2SGAA 5HM9A 1K1JA 1EXFA 1S0RA 3GY5A 1DANH 1UO6A 3T25A 3VB6A 1MKXK 6CHAC 3VPKA 5C1UA 2AH4X 3RXTA 2OBOA 3V3MA 1IHSH 3RXMA 5FHTA 3K6ZA 4ZH8A 1IQNA 1K22H 1Y3XA 1CA0B 2F83A 1XVOA 1Y3YA 3E16B 3NWUA 2SFAA 2PWXA 3Q3YA 3RXDA 4XD7D 4X8UH 4ZCNA 3ZV8A 2ZFFH 2J4IA 5IK2D 2ZU2A 1GJ8B 2PP6A 3RXJA 1TRNA 2QC2A 3IWMA 4MPXA 3KQ5A 3D49H 3M5MA 4A92A 3V12A 1TMUH 4YESB 1C1PA 3RXFA 2KAIA 1KLTA 2UUJB 3LIWA 4XBBA 1EASA 3I77A 1QRZA 3STIA 3M7QA 2TBSA 5LGOA 3DT0H 5EXLA 2H2ZA 3FVFB 1SGCA 2TGAA 5GCHF 3A80A 1ARCA 1GBTA 1V2JT 3OY6U 5DP3A 5FBIA 1T7CA 4CBNA 1MKWH 1O2TA 1WQVH 3PTNA 1HPGA 1ZSLA 4GVUA 5GJ4B 3PLBA 1WU1A 1EJAA 3ZZCA 4Q7YA 1T31A 1QTFA 3ATIA 3C27B 2GMTB 1FIZA 3N7DA 1NRRH 4FOUC 4P00A 1H9LB 4BXWA 1T8MA 2VIWA 1SGDE 2Y82A 3ZYEA 3DSGA 3ZV9A 2GZ8A 1ETTH 1Z1IA 4B73A 2EI7A 3UFAA 4OS2A 1EZUC 1P2JA 1AWFH 1VZQH 1P3EA 1QNJA 2WPHS 3SNDA 1AU8A 1TNHA 3MU1A 3P8GA 4XE4A 2H9HA 2TGDA 1HAXB 2O8LA 4Q63A 3TVJB 1DM4B 5CMXH 5EOKA 1WDIA 2ZHFH 3ZVAA 3LH3A 3VGCB 1GI8B 2WUCA 2VIOA 1B5GH 3M37A 4ZKNU 1WTHD 2UWOA 2Z9LA 4U32A 1BQYA 6GCHF 2W5EA 1GBJA 1OX1A 1ZMNA 1W10U 1W14U 1C5PA 1AKSB 1EQ9A 2C8WB 3GCHB 1UTKA 3RC4A 5IDKA 2H1UA 5EG4A 4LZ4B 3RU4D 1K28D 1O30A 3ESTA 3PLKA 1GWAA 1K2I1 1P2QA 4UEHH 1FY1A 3ZZ4A 4X2WA 5L2ZH 3DHKH 4X1SU 4KGAA 1V2UT 2ZFQH 1HJ8A 3A87A 3E90B 3TJVA 1Z8JB 4D9RA 2OQ5A 3LJJA 2OC1A 4X8SH 2ZPQA 1O2HA 3A8CA 1GHVH 1GI0A 3OTPA 5HKKD 1TPAE 3SI3H 3T29A 4XOJA 2GDEH 2ZGJA 3KN2A 4K8YA 1DXPA 2GP9B 2Z3DA 1W8BH 1GL1A 2ZHQH 3OYPA 4ZUHA 4GCHF 3GY6A 4ZMAH 5HIYA 2OUAA 2A7CA 2J9NA 3BEFB 1UTNA 4ZHAA 3TNTA 2G5VA 4F55A 4U30A 1C2HA 2ZQ1A 2BDAA 1V2PT 1C1OA 1GMHF 1LHGH 4AFSA 1YPGH 5JBTA 4R8TB 2ZHWH 4OM9A 3S0NA 2SGQE 2XBYA 3A84A 3SGQE 1GPZA 3A89A 1QBVH 1RIWC 1P11E 1T8OA 2P95A 5AHGH 1YPKH 2FOFA 2FOEA 2XRCA 1A61H 3U1JB 4E7NA 1O3AA 1CO7E 1YKTA 3LGTA 4AN7A 2P94A 2GVFA 1K21H 2Y5FA 1UHBA 3OX7U 2WPLS 1MU6B 3P17H 2HVXA 5DN6D 2FZZA 4AB8A 1HJAB 3LDXH 4GSOA 3MH7A 3SNCA 3HK6B 2EEKA 3GYMA 4RKOB 1BRUP 1BTYA 1VCQA 2GTBA 2L6OA 4O3UA 1H8ED 2FIRH 3PB1E 3ATKA 2QCYA 3ZVGA 3VXEH 2TPIZ 2ZFRH 1EB2A 3QK1A 1HAHH 3ZVEA 1TA6A 1TE0A 4Z0KA 2GV7A 1CSOE 5EJZA 5GXPA 2BLVA 1S6LA 1A4WH 5JB9S 1TGBA 1SB1H 4YOJA 4ISIH 1GG6C 2QXHA 2XBXA 2KR7A 4NZLA 4X2YA 4ISHH 4A6LA 2FS8A 4WVPE 3SOSA 2QXGA 1MZAA 1A5GH 1O2VA 2Z9IA 3ATLA 1INCA 4OS6A 3BEUA 1YP9A 1EFRD 1FAKH 1FXYA 5EU8A 2PV9B 1TALA 1SGFG 3RLWH 1AE5A 4X1RU 1GI3A 3EE0B 1BTUA 3FAOA 3KGPA 1ORFA 2CF9H 3FZDA 4B1TA 1BT7A 1DUEA 2KCAA 2PR3A 1D4PB 1GL0E 2WYGA 1GCTB 1FN6A 2FOGA 4MPUA 1DPOA 1TPOA 1N6YA 2G4UA 2J5UA 1BHXB 1P01A 4NWLA 1EAIA 1UCYE 3QZRA 1ZLRA 4NA9H 2YNBA 1ELTA 3ZZ7A 3N7EA 4JYUH 1P57B 3SV7A 4CBOA 2F3CE 1TX6A 5HM2A 4MNXA 1CBWB 2A2QH 1HFDA 3S9AA 1BTPA 3A7VA 2LPRA 4ABBA 4UFDH 5J4SA 2ZHDA 2BDYA 1CVWH 2VIQA 4ASUD 4BTUB 1C4U2 1FPHH 2ZQ2A 2WPJS 1MTNB 3LGUA 4ISLA 1QIXB 2BY5X 5JBCS 5T3HA 2YMSD 3AASA 1AVXA 1MQ5A 1LQDB 2IJD1 1ZTJA 4AC9A 1H8DH 4ABGA 4TWWA 2IPHA 4GPGA 3W1EA 1C1VH 4O9VA 2CF8H 3MQKC 5A09A 2ILNA 3F2GA 1AVWA 1LTOA 1C1QA 4JZIA 1ZSKA 2F9OA 1DWBH 4INKA 2RDEA 2PTCE 6CHAB 2FPZA 1W0JD 1V6DA 1V2OT 2XWBI 1ELCA 3F3BA 3UNSA 3ZVDA 2OCVB 3A7WA 4AFZA 1AD8H 4H4FA 1O33A 3P8OA 3PWCA 2A0QB 2Y7XA 3BIUH 5CHBA 1O2XA 3ITIA 1DLEA 2BDBA 4TY6A 2O9QA 4A7IB 1XM1A 5EJ1A 1C1RA 3D23A 3FP7E 3SU0A 5F8ZA 2BZ6H 2J94A 1X7AC 3ZVBA 4LK4A 3LU9B 4DCDA 1L4ZA 3T26A 4ACBA 3SU3A 2C8XB 1H8IH 3SQEE 1WAYB 2ZI2H 5CDFE 1WOFA 2ZP0H 4JK6A 2J98B 3ZZ6A 1SGNE 2V3MA 1O35A 5GCHG 1O3DA 1LPKB 1ZOMA 1HYLA 3ODDA 1GVKB 1B7XB 1QA7A 1K1MA 1GGDB 1H1BA 1Q2WA 3VB3A 2V35A 1AZ8A 2WZQA 1D6WA 1TPPA 3TGKE 3KQBA 1XUKA 2PW8H 4ABFA 3RXBA 2FTMA 4MNWA 2XNDD 1DOJA 3N7OA 1G32B 3KCGH 2PUXB 1S82A 2G52A 3RMOH 1OSSA 3ODFA 5HMAA 1A0JA 3MFJA 1E36B 1YBWA 2ZFSA 4FVBA 1OWJA 2VIVA 1J14A 2QGRA 3MU8A 4YT6H 2R3UA 1GJCB 4K1EA 1HAIH 1TBZH 1BDAA 1TFXA 4M9FA 1HB0B 1N6XA 4ABIA 4B2CA 3FZZA 1XKBC 2WPDD 2PGBB 1O32A 4XBDA 1A46H 1IQIA 2VIDA 2AHME 1EZSC 2W6JD 2QE7D 1YCPM 1A0HB 2HALA 1P10A 5DP4A 2BD3A 3FN8A 5FL7D 1A5IA 4B76A 2CHAB 2OC0A 1J17T 1PPFE 2THFB 5GNDA 1SQOA 2F9UA 1GCTC 1AQ7A 1NU7B 4R0IA 5JBBS 3V0XA 3QTOH 2BXTH 3A82A 3RXUA 2ZNKH 1ESBA 2YNAA 4O03A 1YPJH 4FUFA 3RXHA 1C2FA 3T5FH 1NRPH 2QYIA 1Y3WA 3UWIA 1V2VT 2ZG0H 2V0BA 3SGAE 1XUHA 1QQUA 1ZMJA 5C1YA 2BDHA 2UWLA 3F9EA 2WV9A 1UJ1A 2Y80A 1LPZB 1UVSH 1ZPCA 3FP6E 3F0OA 2JH0D 2GZ7A 1TIOA 4ZAEA 5DO4H 4TPYA 1O5EH 2V3HH 1MKWK 2WV4A 1O3PB 2NWNA 4RSPA 4A1XA 3UOPA 1GBFA 1V2WT 1WSSH 4IMZA 4AB9A 1NO9H 3OFND 1XKAC 2FWWA 2VINA 3HKIB 1P2OA 3RXKA 1ZPBA 4THNH 4AYVB 2V7QD 4NIVA 1CE5A 3CENA 2TGTA 2ZGBH 3GY8A 1WUNH 1DSUA 2AMDA 3TPIZ 1L2EA 3MWIU 1GBIA 2VH0A 1GGDC 3FO8D 3RXOA 1GHBF 1YY3A 2A2XH 2HNTF 1ZJDA 1JWTA 2SGDE 2G00A 2W7UA 3MO3A 1TONA 1FJSA 2AYWA 4GHQA 4LXBH 4MNVA 2NU0E 1ELEE 1BTWA 2XC4A 3PMBB 5EPNA 1HV7A 3OTJE 1S81A 1YLNA 2WHXA 4WMFA 2Y6TA 1ELVA 3HATH 1F92A 3TU7H 1FY3A 4FU8A 1JMOH 1C5YB 2Y5GA 3N99A 2UUYA 1PQAA 4NG9H 4AGKA 2FYRA 4JZDH 4WWYA 3QLPH 5K0HA 4ZKRU 1W13U 1RJXB 3WWBA 2AMQA 1OS8A 2BX4A 2H5CA 1CHOF 8LPRA 1AWHB 1HAZB 1NFYA 3ZZAA 3KQDA 2ZC9H 3L3TA 3SJOA 2ALPA 1BTZA 1AY6H 4DT7B 3PMAB 1O5AB 4DIHH 2ZFPH 5DPAA 1BRBE 1CA8B 2ANYA 1MD7A 2G55A 3UOUA 1C1NA 6GCHG 1P2IA 1ZHRA 2VVUA 4FU7A 3TJOA 2VIPA 3PMHB 5ESTE 3RC5A 1HAPH 1NY22 1NU9A 2VWMA 5C0UA 1TWXB 3NUMA 1MAXA 2KCPA 1W7XH 1NESE 4FUHA 1T8NA 3UTUH 3TH3H 5AFZH 4NGAH 2VVVA 4K1SA 2FESH 1ELDE 1RIWB 3T62A 1NROH 3RDZA 2GMTC 2O8TA 6LPRA 1C9PA 3EDXB 3PM3A 3SJIA 1JIRA 1P3CA 1K1IA 2JJ1D 3SHAH 1P2NA 1O3NA 3GDSA 1EAWA 1O39A 3UNQA 4ZHMU 1ARBA 4A1TA 5EXMA 3GY3A 5DKMA 2EI6A 1C2GA 3P70B 4E06H 4BAMB 4BTIB 3E3TA 4MG3A 2BXUH 5F53A 1HIAB 1EJMA 1W7GH 3QO6A 1AUTC 1G36A 1YPLH 2XOKD 3AVZA 1RTLA 2XXLA 1AB9B 4B75A 1SMFE 1TGCA 2BQWB 2BYAX 5LPFA 1FMGA 1AVGH 1C1SA 1GJBB 2Y81A 4IGDA 3TH4H 4FUEA 3MO9A 1GBBA 1PQ5A 3UUZA 2CK3D 5FPSA 1K0HA 2AGEX 1FLEE 3T28A 1GVLA 2BLQA 1BITA 1HXEH 3LGIA 4X1NU 1L0ZA 1F7ZA 1C2IA 4X2VA 1YPHC 3K65B 2OBQA 3V7TA 4OS1A 1G3EA 3GCNA 2ZTXA 4IC6A 5EQQA 1C4V2 3RC6A 2BOKA 3UNRA 1P04A 1NFXA 5I25A 4INHA 2C8YB 1C5VA 1RXPA 1W11U 5TCCA 1P03A 1ANBA 2BB4A 3A81A 1GI9B 1LMWB 3BTME 3SUEA 2P59A 4HG6A 4I8KA 1GCDA 1Y5BT 1NBMD 2QF5A 1FNIA 4YLUA 1BBRK 3HPTB 1GHZA 5LH8A 4DURA 4FUDA 2VWOA 5FPYA 1SHYA 1SVPA 2ZDNA 4AYYB 2BQ6B 2B9LA 1YLCA 3UPEA 1VJAU 1VR1H 1VITG 3MU4A 1JXPA 2PSYA 2A4RA 4I8GA 1JBUH 1GHYH 2NU3E 1VCWA 3F68H 1G37A 1MH0A 3TK9A 3CP7A 3UWJH 4NZQA 1T8LA 3DFJA 2VGCB 5DK1A 3LJOA 4NA8A 1FAXA 1IQFA 2DE9A 5DJ7A 3RXAA 4CRGA 2R3YA 1W3CA 3RMNH 1L1GA 1V3XA 1AUJA 2LELA 4DJZB 3MOCA 1MTVA 3E8LA 5J4QA 1HAOH 1ZTLA 1RD3B 1BBRH 1C2KA 2ZTYA 1HXFH 4X1PU 3ZZBA 4YOGA 2SGPE 4B2AA 3VB5A 1D6RA 1L4DA 3SZNA 3SJ9A 1DE7H 2FLBH 3VB4A 1TNIA 3MU0A 1W12U 3GCOA 2BZAA 5EQRA 1O3MA 3O8CA 1TLDA 2WPMS 3EGKH 4NFFA 5LPRA 1MU8B 1EATA 1AZZA 3RP2A 1F0RA 1O38A 1GVZA 3LC5A 3PV2A 2G8TA 1GJ4H 2A1DB 1A5HA 2WPIS 2Z9KA 1OKXA 2P93A 1MCTA 1O2NA 4FUCA 4I86A 4D7FA 1NFWA 1LHCH 1Y3UA 3PO1B 2HVYB 1HDTH 4Y8YA 1DVAH 1KTTB 2QAAA 4Y7AA 1F2SE 4BXSA 4UONA 5CE1A 2ZHEH 1H9IE 3RU4T 1GBMA 1EP5A 3RXPA 1G3DA 1K1LA 3NRLA 1BHXF 3V13A 4BANB 2RFKC 2BVXH 2WSSD 4X1QU 2I6QA 2ZGHA 3KIDU 3ZZ8A 1EOLA 4WF8A 1MUEB 2AIPA 5SGAE 1NRQH 1FPCH 4BAKB 3SHCH 4A5TS 5T6DA 4INLA 3PRDA 5FXLA 1KLIH 5L30H 4IMQA 5HXFA 4YZUA 4X2XA 1KXFA 5LPEA 1PPZA 3UIRA 1ANDA 1Y8TA 4JK5A 1O3BA 1F5LA 1SOTA 2Z6BD 1NBME 1D3DB 1SPJA 3UAIC 1HBTH 1ELAA 4AFQA 1VJ9U 1MD8A 1C5NH 2BQ7B 3VB7A 1O3EA 5FBEA 1F5KU 3F6UH 2FOMB 2FOCA 3TIUA 1BJVA 2XBVA 2CV3A 1C9TA 3RMLH 1LDTT 4HGCA 2F9BH 1ETRH 2F9VA 5BRRE 1CGIE 3B9FH 1WQSA 2OINA 2PTNA 4DIIH 1TMTH 2XCNA 1G2LA 2A5AA 1WXRA 1TABE 5KECA 3ATWA 3E6PH 1SGPE 1SQAA 1KXAA 4Y8XA 3W94A 2K1QA 1QZ8A 1W2KH 1LVYA 3O8RA 5E2PA 1TNLA 3P8NA 1O5FH 1UK3A 1MBMA 1O3LA 3PO1C 5JYIA 3QTVH 1C5MD 1OYQA 3NKKA 4ZKOU 8ESTE 3F2HA 1C5SA 1O2KA 5HGGA 1V2NT 1VKYA 1PQ8A 2ZDAH 4DW2U 1GJ7B 1F0TA 2C4FH 1ZMLA 3MI4A 1UTMA 2P8OB 4ACAA 4FUJA 2ZDKA 4JYVH 1XVMA 4ZHLU 1A3BH 2ZU5A 7GCHF 3UQVA 2LP6A 2JH5D 3M36A 3TH2H 2JETB 1KIGH 2O8UA 1XMNB 5JDUB 1P0SH 5E8EH 4MTBA 5DP5A 2VWNA 2D26C 2AFQB 1D3QB 1TNKA 1EAXA 1SGEE 4AGJA 2BHGA 1UCYK 3BG8A 4PROA 1QURH 2J38A 1FZZA 4ABAA 3TJUA 1C1UH 1O2RA 3EA8A 1DX5M 3M5LA 3M35A 4MPVA 3KQCA 1TBRH 2IN2A 2C8ZB 2XYAA 3GDVA 3KL6A 2B7DH 1GMDF 1EOJA 2XNIA 2QY0B 3GISB 2IPQX 3E0NB 4ABJA 3H7OA 3M5OA 1QRWA 4B74A 2QF0A 3K6YA 1CBWC 3B23B 4DOQA 5DP9A 1MABB 1KMHB 2QF3A 4MPWA 5A8XA 2BVSH 2AGIX 4J1YA 2VJ1A 1P9SA 1HJAC 4CRFA 2O8MA 1THPB 3CS7A 1AN1E 1OP2A 1SGIB 4I8LA 2TGPZ 3U1IB 1SKYE 1PPHE 4DVAU 5EODA 3U98H 3ZVFA 1MCVA 1Q3XA 4HFPB 5FAHA 1PJPA 3OU0A 1OPHB 3M3SA 2ZPRA 4BNRA 1MBQA 3MNCA 3BIVH 4Y79A 1C5OH 1RFNA 1GI5A 3ENSB 4GLYA 5C20A 1HIAA 1O5CB 2GJGA 5C0TA 1MTUA 4JZ1A 3SU6A 3BTGE 4NSVA 3RXGA 3BTQE 5DP7A 4I7YH 4Y8ZA 2BLOA 3DCLA 1O3CA 1THSH 5EW1H 1LHDH 2VH6A 3SQHE 1SR5C 3NPSA 4WH6A 2QF4A 2CJIA 1P05A 1LVOA 1XX9A 4GAWA 3EE7A 3A88A 1YPMH 4Y71A 1C2JA 2JDID 4FUBA 3SJKA 2QXJA 3A7YA 4FUIA 1BJUA 1TOMH 4I32A 4ABEA 5A0AE 1BTXA 3QGNB 1PPGE 1K9OE 2ZU1A 1DY8A 3OSYA 4E05H 4HZHA 2B5TB 3RXRA 9ESTA 1XUJA 1IOEA 2JETC 3RM2H 1QL8A 2NU2E 3URDA 1WCZA 3LPRA 4AORA 1ZHMA 2TRMA 3PYHA 2VB0A 2GZ9A 1OWKA 1DS2E 1TGNA 4XSKU 2FMJA 2A32A 2A4GA 1C2DA 1SHHB 2FOAA 1PQ7A 3M5NA 2YOLA 1AO5A 2PSXA 1HJ9A 3DUXH 5TJXA 5DP6A 1GHAF 1XUFA 4DT4A 1COWD 1EPTC 1O2JA 1ABIH 2CMYA 1G2MA 3AAVA 2KAIB 1YPHE 1ZGVA 3BG4C 1DSTA 1QGFA 4ISOA 2ANMH 3U8RH 3Q3XA 1YM0A 2B0FA 2G51A 1QB1A 1QRXA 1SOZA 4RN6A 1MQ6A 1E79D 5AF9H 4GUXA 1NM6A 3RXVA 1OYTH 3PRBA 2EC9H 1H9HE 2H6MA 4M7GA 2J95A 3MO6A 1GBEA 3KYGA 3SV8A 1GHAG 4X8TH 1UK4A 7LPRA 3PV4A 1O5DH 3JZ1B 4ABHA 1BIOA 4X8VH 1GDUA 3SUFA 3SU5A 2BVRH 1BA8B 4NWKA 3H5CB 1E1QD 4K8BA 1K1NA 3QUMP 2OD3B 2OC8A 3SNEA 7KMEH 1J15A 1FY8E 2L74A 2STBE 1ESAA 1O2LA 2FEQH 2FDAA 2GV6A 2HNTC 1TNGA 4JCNA 2JIZD 1SI5H 4U01A 3MH5A 2H5DA 3BTEE 2HLDD 4D76A 4WY3A 2KM0A 3FFGA 1C2EA 1V2TT 1M9UA 2J98A 2HGTH 2ZF0H 4DY7B
chains in the Genus database with same CATH topology
4F49A 1FUJA 4CRAA 2ZU4A 1V2KT 3SNAA 3A7XA 1IQGA 3SGBE 1A2CH 3D62A 4Y11E 1TQ0B 1MZDA 3MNBA 2OLGA 1CT2E 3RXSA 2ZPSA 1DFPA 1O2UA 3EA9A 3MTYA 1N1LA 4Y7BA 1C5LH 1FONA 4JYTA 1FIWA 2ZA5A 1THRH 1AKSA 4UE7H 1S85A 3MYWA 5A0BA 1D9IA 1LKBA 3MNXA 3M61U 1BCUH 1NTPA 5HYOA 3F9GA 4KTSA 4OGXA 1YPEH 3QDZB 4H6SB 3U9AH 1CGJE 2QV1A 2PLXA 2XWAA 1DXWA 1KDQA 2RCEA 3NXPA 1WYKA 1DDJA 1KXCA 3BTKE 1DWEH 4AFUA 4ZROA 3QN7A 2BDIA 5C67A 2QIQA 1Z8IB 4IBLH 2ZIQH 1OWEA 2FOBA 4VGCB 1UVTH 5EGMA 4TPIZ 1SG8B 3EA7A 5B6OA 1CQQA 1IQEA 2W3IA 5EQSA 1C4Y2 3TNSA 2ANKH 4XDEA 3DA9B 4X6MA 2P3FH 3S7KB 2GCHG 1W0YH 2F9NA 1NZQH 2CN0H 1EB1H 1O3HA 2BD4A 2HPPH 1GMDG 1TNJA 3BTWE 4I8HA 1AFQB 2BD7A 1YCPH 7ESTE 5L6NH 2P3UB 2W26A 1P02A 4Y0ZE 1G30B 2BX3A 1DWCH 1AI8H 2UWPA 2PUQH 3PTBA 4KP0A 4F4OC 2IJOB 2A7HA 5F6MA 3VXFH 1Z1JA 2A31A 2JH6D 5C3NA 4I33A 4NIWA 1QQ4A 5JPMH 1GMCF 3BEIB 2ZU3A 1GI7B 4KELA 1ACBE 2NU4E 2IOTA 2W3KA 4Y76A 2FI5E 1DY9A 4NA7A 1ZZZA 4OGYA 2AERH 3UR6A 1O3OA 3A83A 4DGJA 1GHBG 1YCPK 3A85A 1P06A 1SLUB 1SGQE 2VVCA 1GBCA 2ULLA 1GHWH 1VITF 1ZJKA 4WXVA 2A5IA 1QA0A 3DFLA 4X6OA 1SGYE 3TK5A 4UD9H 1P09A 1O3JA 1GJ9B 2FO9A 1QB9A 1SFQB 1J8AA 2ODYB 5E0HA 3Q77A 1KXEA 3ELAH 4NIYA 4K60A 3RU4E 1XXFA 3SV2H 4IN1A 3RXIA 5C2ZA 3HKJB 1C5WB 4FUGA 4UDWH 1S84A 4K2YA 1AFEH 2PKAB 2J34A 1W0ZU 3P92A 4Q7XA 1K1PA 3FANA 4OS4A 1EPTB 5FCKA 3H7TA 2Y5HA 3RUOA 1TMBH 1UTLM 2Z9GA 4H42U 4X6NA 1QL7A 1UTQA 1O2MA 3BTHE 1B0FA 4BAOB 3PLPA 2XBWA 3EQ0H 2ZCKP 2SNVA 2VGCC 1ANEA 4NFEA 1ZGIA 4Q80A 4YM9A 1TRYA 1QJ7B 1QJ1B 2XTTB 1C2LA 3GOVB 3UR9A 4Q2KA 2FP7B 4WMEA 3BTDE 3TGJE 1KTSB 2F91A 4HTCH 3A7ZA 5I46H 4ABDA 3Q00A 4MNYA 1C1WH 3L6PA 2FX4A 3LGWA 1HLTH 4CHAB 1EZXC 1ZSJA 4ESTE 1DT2A 2CGAA 2BY9X 1F5RA 4YT7H 1QY6A 2Y7ZA 1C1MA 1YLDA 2C3SA 2XC0A 2GT7A 3SU4A 4B71A 1NRNH 3GY7A 1BMLA 2DE8A 1TPSA 1SLXB 1SC8U 2Q6GA 3LKWA 2JKHA 3ZVCA 3LC3A 2BY8X 3KEEA 3RLYH 3A8DA 2EA3A 1E35B 4OS5A 4X6PA 3LOXA 2HOBA 5CHAB 3ZZ9A 1ABJH 1AHTH 1P2MA 1O2WA 2FX6A 1LQEA 2I6SA 1G9IE 2P3TB 4YO9A 2WYJA 1MTWA 3LGVA 1ZPZA 1O5BB 1MTSA 4KTUA 3K9XB 3QZQA 3KNXA 1Z7KA 4FU9A 1BMMH 1T4VH 1ID5H 1BRCE 1KYNA 3PWBA 2ZCHP 5JBAS 4WJG2 1J9CH 4D7GA 3A7TA 3U8OH 1A0LA 5E2OA 1V2ST 2ASUB 3SW2B 1CHGA 5BPEA 4WMDA 1UHBB 2BY6X 1Z8GA 2D8WA 1Y3VA 4YTAA 3RXLA 2Z7FE 2FTLE 1TGSZ 4FXGH 1O3KA 2J2UA 3S7HB 1O2OA 4ZXYH 4WXIA 1SLWB 5EPYA 4NIXA 3GY2A 1O2ZA 2OP9A 1AFQC 1FY4A 1YYY1 2R9PA 3S9BA 1P12E 2VWLA 3GY4A 2QXIA 1A3EH 2DUCA 2G81E 1O2SA 4MVNA 1GI2A 2BDGA 1SLVB 2ANWA 1NRSH 1XXDA 4DG4A 3LH1A 3SV6A 1PPCE 1PPBH 3BN9A 4U2WA 2F9PA 3SI4H 1YGCH 5GDSH 1WTGH 1T32A 2ODPA 3W95A 3QGJA 3GCTF 1N8OB 1ZTKA 1UVUH 1O3GA 2BTCE 2VNTA 2QA9E 3LT3A 1HAVA 1O2GH 1FN8A 1QBNA 1AE8H 2RG3A 1FY5A 5A0CA 6ESTA 1OP8A 3OY5U 3PMJA 1Z6EA 3RXQA 1SGTA 1RTKA 3T2NA 1BTHH 1HAYB 2HNTE 3BG4B 2GT8A 2HLCA 3KF2A 8GCHF 3C1KA 3SJ8A 1GBDA 3A8AA 3SN8A 1GBKA 2FOHA 4MQAA 4ASHA 4ZKSU 2BDCA 1L1JA 3E1XB 1O2IA 1QCPA 1E38B 4I31A 2BMGB 2OTVA 3QX5H 3URCA 2GX4A 1HNEE 3S9CA 3ZZ5A 5ABWA 4FVDA 4J2YB 4YOIA 8GCHG 1VITH 3EYDA 2GCTC 3NCLA 3SUGA 4Z6AH 2XC5A 1AGJA 1PYTC 3O8DA 4TWYA 1O5GH 1QB6A 2AEIH 1P8VC 2A5KA 4KTCA 4CR9A 3E91A 2WV5A 1IQHA 1RRKA 1TRMA 4RKJB 1A7SA 4AX9H 1K1OA 2H9EH 4I8JA 4HI3A 1MMJN 1ZHPA 5T6FA 2ZDMA 3RXEA 3SNBA 1S5SA 1UTPA 4K3JA 5FX6A 4IC5A 1TBQH 1UCYH 2UUFB 3MH4A 1NC6A 1UK2A 3STJA 1AB9C 5A8YA 1S6FA 2SGEE 4D8NA 2R0LA 3SU1A 3S69A 3WY8A 5GPIB 5CHAC 2UUKB 3TLOA 1D3PB 1C5XB 2GDDA 1XUIA 1ELBA 3ZZ3A 2W7SA 1Z6JH 2PKSC 1TAWA 2CHAC 3F1SB 2M5TA 7GCHG 1O31A 1GJAB 1S6HA 1CHOG 2R2MB 8KME2 1QR3E 1J16A 4XBCA 1CT4E 2SGFE 4BAQB 1VCPA 2V6NA 1UMAH 1ZRKA 2FM2A 3RXCA 1AMHA 5A8ZA 4KKDA 1KY9A 2BOHB 4H6TA 2A4OA 2ZECA 4Y6DA 1GI1A 1V2LT 3SU2A 1RS0A 3GDUA 1SGFA 3AW0A 5ESBA 4UFEH 3O8BA 1VGCB 1FDPA 4CHAC 4AG1A 1YC0A 5F8XA 2FI3E 1NS3A 1LPGB 3EAJA 3TJNA 3I29A 2FS9A 1KXBA 4GCHG 4CRCA 1UVPA 1O2PA 4SGAE 1GJ6A 4Q7ZA 1QFKH 5GWZA 1ESTA 3M3VA 1GG6B 4K5ZA 1IQLA 2C90B 1S83A 1GBAA 1T4UH 2G4TA 4AOQA 4O3TA 1N8OC 1HRTH 4CH8B 4MDSA 3KQEA 4Y10E 2PGQB 1TX8A 1GHXH 3F9FA 4TY7A 2A45B 1GDQA 4IN2A 3B8JA 1EP6A 1WBGB 2FYQA 2H9TH 1VGCC 3CS0A 1TYNA 1EUFA 2Z3EA 1KXDA 1G3CA 1SQTA 5C5OA 3MNSA 1BRAA 5PTPA 3ATMA 1BZXE 2ODQA 2PFEA 1BBRE 4CREA 2Z3CA 1OOKB 1SBWA 4WH8A 3GCHC 2FODA 1C5QA 2Q6FA 2OQUA 1EJNA 3SBKA 1NFUA 3NZIA 2AS9A 1JRTA 1HAGE 4BAHB 1C2MA 1KDQB 1L1NA 3ZZDA 1CT0E 3I78A 2Z9JA 2ZDLA 3P95A 1QHRB 1BOQA 2ZO3H 5TCAA 1JOUB 1ZR0A 2A7JA 1OWDA 3TGIE 2AGGX 1SFIA 3G01A 5AVDA 2GCHF 1E34B 1V2RT 1U6QA 5E0JA 2XW9A 2ZGXH 1C5ZB 4NSYA 1IQJA 1OWIA 4BTTB 3HGPA 5EW2H 1ETSH 1MTNC 5F03A 2HWLB 5IYTA 5EXNA 1V2MT 1ZYOA 1BUIA 1QJ6B 4ZXXH 1BMNH 3GCTG 1TQ7B 1Y5AT 3ZYDA 2PKAA 4JZEH 1PPEE 3UQOA 2B8OH 1SL3A 5DGJA 1LKAA 3SV9A 2PKSB 4CR5A 1OXGA 2ZDVH 1Z71A 1E0FD 1FV9A 1HCGA 2BY7X 1LCYA 1HAVB 5T6GA 3RMMH 1IQKA 1GI6A 1UVOA 1GBHA 3GICB 3Q76A 2GCTB 3DD2H 3M7TA 3MH6A 3L33A 3MMGA 4A1VA 1GBLA 4VGCC 1WV7H 1Y59T 3AAUA 1CU1A 5GIBA 1IQMA 2BD2A 2EI8A 1DLKB 1DITH 4IW4E 3FP8E 1DWDH 3QWCH 1G3BA 1LVBA 5H4IB 1GMCG 4ISNA 5FPTA 2ZTZA 3U8TH 1OP0A 2GD4B 1NN6A 2A4QA 3SUDA 3BV9B 2OC7A 2HRVA 2QN5T 4JZFH 4AG2A 3P8FA 4CH2B 1EZQA 1E37B 1GJDB 2HPQH 3A86A 3PROA 5FCRA 2Z94A 4B2BA 1QBOA 1O36A 5A2MH 2STAE 2VU8E 2BLWA 5L2YH 2BD9A 1RGQA 2D1JA 2ZKSA 3GYLB 3K2UA 1P2KA 3IITA 1GJ5H 1O34A 1NPMA 1O2QA 3LONA 2SNWA 1KSNA 3AW1A 4OS7A 1ZRBA 5ETXA 5AFYH 4SGBE 1PFXC 2ZZUH 4UFFH 2WUBA 1DICA 4MLFB 1YF4A 1BB0B 2GKVE 1Y5UT 4LZ1H 3BTTE 3BF6H 2TIOA 1ELGA 3HK3B 5DP8A 2BD5A 5E0GA 3LGYA 1BMAA 2D2DA 1GI4A 4D9QA 1QL9A 5G4BA 1FI8A 2ZCLP 2J92A 2R0KA 2ESTE 4BOHA 4CRDA 4E7RG 1C5RA 5JB8S 1MAYA 3TITA 2FI4E 2BM2A 1RTFB 4JMYA 4YLQH 3SO3A 1AIXH 3U69H 3VFEA 1CA0C 4Y0YE 1DUAA 3KHVA 3UY9A 2FLRH 1LHEH 1TB6H 3TK6A 3M7UA 1OWHA 1B0EA 2NU1E 2OXSA 3A8BA 2CXVA 1P9UA 3JZ2B 4X0WU 2PHBA 1HUTH 3P6ZB 1LVMA 3E0PB 2Q6DA 3R3GB 5K7RA 1S0QA 2ZFTA 3Q3KA 9LPRA 3BSQA 1IHTH 3MHWU 1ELFA 1SGRE 4K69A 1D3TB 3M3TA 1FQ3A 2FXRA 1UTJA 3T27A 1TX7A 4K1TA 3SORA 1JIMA 5C5NA 4LOYH 1TOCB 2RDLA 1XUGA 1PYTD 4TYDA 3F9HA 3IG6B 1NT1A 4QT8C 4GHTA 1IAUA 4IS5A 1HGTH 3VGCC 5DG6A 2GGVB 1F0UA 2WINI 1C1TA 1H4WA 3NK8A 3UREA 1JRSA 2C93B 2P8OC 1EPTA 1O3IA 2LNCA 1O0DH 2AIQA 1LHFH 1EAUA 5C1XA 1SSXA 2ALVA 4XFQA 2G5NA 1V2QT 1EX3A 4NCYA 4CRBA 2P16A 2R2WU 1Z8RA 1ANCA 4O97A 3RM0H 1MKXH 1C5TA 1F0SA 1EKBB 2Q1JA 2ZGCA 3BTFE 2V3OH 1Q31A 4UFGH 1C5UA 2O8WA 4AZ2B 2ZWLH 1TGTA 2AMPA 1LO6A 3MU5A 1O3FA 2ZEBA 1KLJH 2RA0A 3VEQB 1CGHA 1GMHG 1O37A 1TA2A 2BD8A 1UTOA 3R0FA 3HGNA 1GDNA 5F8TA 5FX5A 2RA3A 3D65E 2XCFA 1O2YA 1A1RA 2WPKS 2SGAA 5HM9A 1K1JA 1EXFA 1S0RA 3GY5A 1DANH 1UO6A 3T25A 3VB6A 1MKXK 6CHAC 3VPKA 5C1UA 2AH4X 3RXTA 2OBOA 3V3MA 1IHSH 3RXMA 5FHTA 3K6ZA 4ZH8A 1IQNA 1K22H 1Y3XA 1CA0B 2F83A 1XVOA 1Y3YA 3E16B 3NWUA 2SFAA 2PWXA 3Q3YA 3RXDA 4X8UH 3ZV8A 2ZFFH 2J4IA 2ZU2A 1GJ8B 3RXJA 1TRNA 2QC2A 3IWMA 4MPXA 3D49H 3M5MA 4A92A 3V12A 1TMUH 4YESB 1C1PA 3RXFA 2KAIA 1KLTA 2UUJB 3LIWA 4XBBA 1EASA 3I77A 1QRZA 3STIA 3M7QA 2TBSA 5LGOA 3DT0H 5EXLA 2H2ZA 3FVFB 1SGCA 2TGAA 5GCHF 3A80A 1ARCA 1GBTA 1V2JT 3OY6U 5DP3A 5FBIA 1T7CA 4CBNA 1MKWH 1O2TA 1WQVH 3PTNA 1HPGA 1ZSLA 4GVUA 5GJ4B 3PLBA 1WU1A 1EJAA 3ZZCA 4Q7YA 1T31A 1QTFA 3ATIA 3C27B 2GMTB 1FIZA 1NRRH 1H9LB 4BXWA 1T8MA 2VIWA 1SGDE 2Y82A 3ZYEA 3ZV9A 2GZ8A 1ETTH 1Z1IA 4B73A 2EI7A 3UFAA 4OS2A 1EZUC 1P2JA 1AWFH 1VZQH 1P3EA 1QNJA 2WPHS 3SNDA 1AU8A 1TNHA 3MU1A 3P8GA 4XE4A 2H9HA 2TGDA 1HAXB 2O8LA 3TVJB 1DM4B 5CMXH 5EOKA 2ZHFH 3ZVAA 3LH3A 3VGCB 1GI8B 2WUCA 2VIOA 1B5GH 3M37A 4ZKNU 1WTHD 2UWOA 2Z9LA 4U32A 1BQYA 6GCHF 2W5EA 1GBJA 1OX1A 1ZMNA 1W10U 1W14U 1C5PA 1AKSB 1EQ9A 2C8WB 3GCHB 1UTKA 3RC4A 5IDKA 2H1UA 5EG4A 4LZ4B 3RU4D 1K28D 1O30A 3ESTA 3PLKA 1GWAA 1K2I1 1P2QA 4UEHH 1FY1A 3ZZ4A 4X2WA 5L2ZH 3DHKH 4X1SU 4KGAA 1V2UT 2ZFQH 1HJ8A 3A87A 3E90B 3TJVA 1Z8JB 4D9RA 2OQ5A 3LJJA 2OC1A 4X8SH 2ZPQA 1O2HA 3A8CA 1GHVH 1GI0A 1TPAE 3SI3H 3T29A 4XOJA 2GDEH 2ZGJA 3KN2A 4K8YA 1DXPA 2GP9B 2Z3DA 1W8BH 1GL1A 2ZHQH 3OYPA 4ZUHA 4GCHF 3GY6A 4ZMAH 2OUAA 2A7CA 2J9NA 3BEFB 1UTNA 4ZHAA 3TNTA 2G5VA 4U30A 1C2HA 2ZQ1A