1K1JA

Bovine trypsin-inhibitor complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRYPSIN
publication title Factorising ligand affinity: a combined thermodynamic and crystallographic study of trypsin and thrombin inhibition.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1jA02
1BTHH 1GCTC 3RLWH 2XYAA 1GMDF 2KAIB 1INCA 1C9PA 3S69A 2IN2A 4E05H 2PKSC 1QL8A 4ZH8A 1SQAA 2UUFB 3ZYDA 3GYMA 1W3CA 1WTHD 4MG3A 5TCAA 3E0NB 3QX5H 3BTKE 3G01A 3BTME 1GVKB 2ZDMA 3RXJA 1VGCB 4ABBA 1P11E 2OC7A 1UTJA 3GY5A 1QB9A 2GGVB 3E6PH 2Z94A 4Y8YA 1XUIA 1HAIH 4FU8A 4UFEH 1ZSLA 4FUFA 4GCHF 1ETRH 4ZUHA 2O8LA 3QLPH 1D9IA 5EODA 2ZGXH 1FXYA 4JYTA 4YT6H 1YPJH 4Y79A 2ZG0H 2Z9KA 3SNBA 2A2XH 5LH8A 4K8BA 4AFZA 1A5IA 5LPEA 3RXLA 4TY6A 1V2VT 3MNCA 1YGCH 1YC0A 4MNVA 1V2PT 3RXRA 5FPTA 3RXVA 3KCGH 2AGEX 1BBRK 3BTEE 4CRAA 1BTUA 1O2KA 1UMAH 2TPIZ 1Y3YA 5J4QA 5DKMA 3BTGE 1ELDE 2VNTA 4I8KA 4WH6A 5PTPA 2H9HA 2A32A 4GUXA 4INHA 4KTSA 5DP9A 2P8OB 3A83A 3GCNA 3NUMA 2FODA 1LHEH 2F9VA 5ETXA 1GCTB 1FLEE 1W12U 1Y8TA 1P57B 4WXIA 2PKSB 1IAUA 1O2JA 4TY7A 3PO1C 2XBWA 4UEHH 5JB9S 2P3TB 1W14U 1NPMA 4IMZA 2OBQA 1C1RA 2XC0A 2ZHFH 2AMDA 1AO5A 5F8TA 5C20A 4AORA 5T6GA 3ESTA 1K28D 3FP6E 1QL7A 5TCCA 3NWUA 4M7GA 1LDTT 4YT7H 1HAVB 4AN7A 4I31A 2Q6GA 4X2VA 5DJ7A 1JRTA 3CENA 2FM2A 1TIOA 2BM2A 1ELBA 1FY5A 1F7ZA 2ZO3H 3W94A 4AFSA 1F0UA 3F9FA 3U69H 3RC4A 7LPRA 3UUZA 2YNBA 4F4OC 5GIBA 3WY8A 1W2KH 1HAPH 4ABHA 2ASUB 2CJIA 2HOBA 3U1JB 1DFPA 1O5GH 1SGYE 4O03A 3BN9A 5DP8A 1GI0A 3QTVH 4X8UH 4HFPB 2O8MA 3F9EA 3FFGA 3QO6A 4CR5A 3RXFA 1YCPH 2CMYA 3CP7A 1NU9A 4UFGH 3QDZB 1AKSB 1P2NA 2ZGJA 2B9LA 3O8RA 1P06A 5GPIB 4OGYA 5C2ZA 1FIWA 3IG6B 5DG6A 1ABJH 2A31A 1S6FA 1GHAF 2R9PA 2Y82A 2ZGHA 1LKAA 1FIZA 3RP2A 2BLOA 1PPHE 2TGAA 1K1NA 3VPKA 1IOEA 3PMHB 4OS1A 3LGTA 1AGJA 5EQSA 1Q2WA 1LHDH 1G32B 2B8OH 3S9AA 4CH8B 1G3CA 1F92A 2ZGCA 5FCKA 1QGFA 1CBWC 4FUBA 3LGUA 1W13U 1O5BB 1EB2A 1UTMA 1H9LB 1BTYA 1BMNH 3HK6B 2AGIX 1AMHA 3A89A 1VCWA 1EASA 1LPZB 3QZQA 1NESE 1D3QB 1EATA 3KQCA 2JETC 3UQOA 1AB9C 1YKTA 2GV7A 4RN6A 4I8GA 1MTNB 3E16B 1OWJA 1H9HE 2M5TA 5DO4H 2VVUA 2A7CA 1GJCB 1P9UA 1DITH 2Z9LA 1ZJDA 3SJ8A 1P10A 2G4UA 1AQ7A 1YM0A 1O2YA 3SV8A 5A2MH 1KY9A 1SMFE 1ZGVA 1HJAC 3ODFA 4ABFA 7KMEH 1BBRE 1MKWH 1DSTA 2AYWA 1MAXA 3PM3A 1IHTH 1BB0B 3LU9B 1DT2A 1O33A 3MU1A 4ZKRU 3LGYA 1FMGA 1MH0A 1ZYOA 1JWTA 2QGRA 3GDSA 1K1LA 1OOKB 5DP5A 3ZZ7A 2EA3A 3KGPA 1A5HA 2ZFFH 1EKBB 3TNTA 1UVSH 1GHVH 3IITA 5AFZH 3D62A 4CBOA 1C5QA 5CHAB 1HAOH 5EOKA 4CRGA 2VU8E 1GPZA 1UTOA 4YTAA 5CE1A 5EW2H 3TK9A 3K2UA 2GDEH 3AW0A 1P12E 2R2MB 3SZNA 2FO9A 3V12A 1SGIB 2HGTH 1BQYA 3A8CA 1GJ7B 3MNXA 4FXGH 1C1PA 1D6WA 1QCPA 4DT7B 2BDHA 1O5CB 1RIWC 4IGDA 1FI8A 3SU4A 1C4Y2 2BQ6B 2ZNKH 3BEIB 3UNSA 3P92A 5F8XA 4WF8A 1L4ZA 1GDUA 3TJOA 1SLXB 1K2I1 2FESH 1X7AC 2ZPSA 1BRCE 3MH5A 1V2LT 4B74A 2STAE 3RXOA 1L2EA 4Y10E 2W26A 3M5OA 3O8BA 1XUJA 1YPHE 3M5NA 1XKAC 3LDXH 3SU5A 4FUGA 2BOKA 3ZYEA 5SGAE 1ELGA 5ABWA 2BLVA 1ZHPA 4AGJA 3ATIA 1TPSA 1HGTH 5DK1A 1QURH 1GJAB 1S83A 3P8OA 4K69A 3SQHE 3TH2H 1C5ZB 8GCHF 1UCYH 1YLCA 4D76A 5JBCS 1XUKA 1UTPA 3MWIU 2B7DH 1P05A 1V2UT 2CGAA 3HPTB 2FOEA 3LONA 4Y6DA 4Y76A 2JH5D 3QTOH 3SGAE 5JYIA 1AZ8A 1C1SA 1AY6H 3TJUA 3VB4A 1SGFG 2J2UA 3L33A 3SU2A 1NT1A 3E0PB 3AASA 4XFQA 3SNDA 1XX9A 4E06H 1V2WT 3D23A 5C67A 3Q76A 2VGCC 1D3TB 3KIDU 2HRVA 3TH4H 4HZHA 2C93B 1BTWA 4HTCH 2BHGA 2F9BH 2GCHG 3KNXA 1T4UH 1IQFA 4K1EA 2AH4X 3UWIA 2CN0H 1GI9B 3S7KB 5JBTA 1CT0E 3GY2A 1C5NH 2ZU2A 3MU0A 2UWOA 1NM6A 3MH6A 4MPUA 4I8LA 4XBDA 2GMTB 4A6LA 4XE4A 1F0SA 2OC1A 1RIWB 1P2KA 2CF8H 3URDA 4XBCA 1LPGB 1TMUH 1PPZA 3ZZ8A 3KQDA 1YPMH 3TJNA 4Q7XA 1FPHH 2ANWA 1QBNA 1H4WA 2LPRA 4DW2U 1A0LA 2EEKA 3ZZBA 1GI1A 4IC5A 2W3IA 3GCHC 3FZZA 3R3GB 1RTKA 1DM4B 3OY5U 4NSYA 1UK2A 4FUJA 1FY3A 2AS9A 4AZ2B 1XVMA 4X6NA 4Y0YE 3RXCA 1BMAA 4NA9H 1LCYA 3NK8A 3M5MA 2GD4B 4JYUH 1QBOA 2SFAA 2XWAA 4QT8C 4AG2A 1BHXF 4MLFB 5JB8S 5J4SA 2BD4A 2CHAC 3BIUH 4KTCA 1G2LA 2ZU1A 2ZDLA 3IWMA 1Y3XA 5JBBS 1XM1A 4H4FA 1Z7KA 3A7VA 1UTKA 1ZLRA 2P93A 1IQNA 2XCFA 2I6SA 3LGIA 2UUYA 2IJOB 5CMXH 4DG4A 4UFFH 2WV4A 2VVCA 3TK5A 5A8ZA 4F49A 4TPYA 1SGPE 1BIOA 4Y11E 3KEEA 1TPAE 2BX4A 1W7GH 2F9PA 2OCVB 3SUGA 5EQRA 1UVUH 2R0KA 3A80A 3RM0H 1XMNB 2SNVA 3MO9A 1MZDA 3RDZA 2H6MA 3A84A 3KF2A 2CV3A 5JPMH 1O2HA 3GDVA 1AVGH 1L4DA 2TIOA 2FI3E 1HAHH 2ZFRH 2VWLA 4JYVH 3VEQB 5L2YH 4HI3A 3A81A 3PMAB 5GCHF 2G5NA 2BY8X 2W7UA 3RXKA 1QQUA 4B76A 2HPPH 2HWLB 1TNKA 1VJ9U 2ZTXA 1RD3B 3T62A 7GCHF 1FUJA 4GCHG 2ZTYA 4YESB 4CH2B 3GCHB 4D8NA 1F5KU 4BXWA 4K8YA 3A8AA 3A8BA 1GI4A 3TGIE 5GJ4B 2HNTC 1P09A 2FOAA 1V2OT 3F6UH 1SBWA 1DSUA 4ABJA 3B8JA 3RMNH 4AB8A 4B2AA 3M37A 1T32A 4ZHMU 4NWLA 3ZZ4A 2F9OA 3T5FH 1TX8A 1E0FD 2CHAB 3ZZAA 4O97A 4BANB 4IBLH 1DWCH 3U8RH 1VJAU 3E8LA 3H7OA 1GWAA 1TBQH 1BUIA 1BTPA 1J14A 1TNJA 1CGIE 1C1QA 1UTNA 3TLOA 2V6NA 1SOTA 3AVZA 3P70B 1W0ZU 2HVXA 9ESTA 3UR9A 3EDXB 1YF4A 1PPEE 1QBVH 4B2CA 1O5AB 3NKKA 2QIQA 3C27B 1SGTA 5FX6A 1PYTD 4WH8A 4Y7BA 1O3CA 1XUFA 1EOJA 1NTPA 1TLDA 4MQAA 5F03A 3T2NA 3SUEA 2IOTA 3CS7A 1VGCC 4CHAB 1BRUP 2OTVA 1QQ4A 1MKXH 1P3EA 2AIPA 2DE9A 3DD2H 3A7ZA 3DUXH 3L3TA 5EPNA 3QK1A 1YPEH 2WV5A 2FS8A 1C1UH 1G3DA 2NU3E 3QUMP 4ASHA 2O8TA 4Y8XA 2G5VA 4B2BA 2D26C 1C2EA 3MH7A 4DJZB 1P2MA 3BG4B 1AFQC 1QR3E 1VITF 3SORA 2XW9A 2QC2A 2C8XB 2QXJA 3GCTF 1G2MA 2CF9H 3S9BA 2OLGA 2ZDAH 1KXDA 5FXLA 3Q3KA 2OC0A 1Y3UA 3LOXA 1O3JA 1OWHA 5C5NA 2ILNA 3RXEA 3ZVEA 4RSPA 3UY9A 3HGNA 3KHVA 1FZZA 1A0JA 1MQ5A 5I25A 4MNWA 1P2OA 2R3YA 2ZFSA 4JZIA 4X6PA 1L1JA 1GGDB 3TPIZ 3BIVH 1FAXA 4CR9A 3P95A 2GT7A 3HK3B 3P8FA 4O3UA 2ZGBH 1TAWA 2W7SA 1MUEB 3Q00A 3ZZCA 2PKAA 1EUFA 3U8TH 1WUNH 4K5ZA 4NWKA 4AYVB 9LPRA 4BNRA 5T3HA 4D7FA 1TONA 5AF9H 1ABIH 3D65E 1GBLA 3LJJA 4YZUA 3MU4A 1O39A 2ZQ1A 2ZQ2A 5DGJA 1OS8A 5ESTE 2FWWA 1PPFE 1KXCA 2FOGA 3SJIA 1CGJE 1NU7B 1OSSA 1GDNA 3TIUA 4AFUA 1GI2A 3VXFH 3HGPA 1PYTC 4A7IB 1FDPA 1D6RA 2CXVA 3OSYA 3U1IB 4B75A 2FOBA 3DFJA 1NFUA 2G00A 2BD3A 3GISB 1EJMA 1O3HA 1V2JT 2RDLA 3O8DA 3SQEE 1AFQB 1O3MA 2G51A 2G8TA 2QXGA 1C2FA 5BPEA 3SHAH 1EP6A 5EU8A 1ARCA 2BX3A 1EZSC 2UWLA 2ZDVH 4FUCA 2OUAA 1C5TA 1NY22 1F0RA 1O2QA 5FPSA 1TGCA 4I33A 2RCEA 3NPSA 1KXFA 1HAGE 3RXPA 4GPGA 1O2TA 1AD8H 2QXHA 1P2IA 5HMAA 4BTTB 3BTQE 2ANYA 2FZZA 1PQAA 1IQJA 4NIVA 4K1TA 3V0XA 1SGFA 1Y3WA 3BG8A 1EZXC 1EJAA 1L1NA 5A0CA 1O37A 1ZMJA 1C1MA 4IN2A 4NCYA 1C2LA 4WVPE 4YM9A 1AWHB 2ANKH 3U98H 1AVWA 1C2DA 3A7YA 4MPVA 1GCDA 4OS5A 4NG9H 4JK6A 1F5RA 1ZTJA 2FX4A 2P3UB 3R0FA 4GHTA 4YOIA 2GKVE 4JZ1A 2EI8A 1SHHB 4IS5A 1O5EH 4GVUA 3ENSB 1CA0C 1C1OA 4X2XA 1OKXA 3P8NA 1GMCF 3RXHA 5EG4A 1O3IA 4JZFH 1KIGH 1P02A 1SSXA 3SU0A 3T27A 3SW2B 1GJBB 3RXUA 4NA7A 3F68H 1TGBA 3UR6A 1GMHF 3SBKA 1QA0A 4A1XA 2FIRH 1NRQH 1QNJA 2Y6TA 3MYWA 1EQ9A 1FN8A 1PQ8A 2ZFQH 1MTNC 1KTSB 1THPB 2QA9E 2GCTB 1DX5M 3M3VA 2FDAA 2OBOA 2V3HH 1DE7H 2C8WB 2BD9A 1HDTH 1UHBA 4A1VA 2AMPA 3EQ0H 1ID5H 2SGAA 1NRPH 1S0QA 2EI7A 3LPRA 5H4IB 3ZVGA 3ZZ6A 1AFEH 8GCHG 1N6XA 1UTLM 1S6HA 1NFYA 2ODYB 3DHKH 1XUHA 5G4BA 1N8OB 2ZU5A 4YO9A 1ETTH 1WOFA 3K6YA 4TPIZ 3TVJB 1LPKB 2H5CA 3A87A 2BDAA 1QRWA 2FOHA 1P9SA 2QF3A 1EXFA 1XUGA 5HYOA 4K1SA 1GJ5H 5CHAC 4DVAU 1ANDA 3TU7H 1QY6A 1KSNA 3A82A 3T25A 1P2JA 1HBTH 1P3CA 2A5AA 4XSKU 1CA0B 1CA8B 1SLUB 2AFQB 1OWKA 3QZRA 3TITA 4ZHAA 3MNBA 5TJXA 3SI4H 1SHYA 2BYAX 2GVFA 3OTJE 5EW1H 3PMBB 1GDQA 1ZHRA 3BTDE 3DA9B 1HRTH 1SFQB 3P6ZB 1GL1A 2ANMH 2BOHB 1Z8RA 1C4V2 2BVXH 4ZXXH 1GI8B 1W7XH 2Y81A 4NFEA 1ESTA 1E34B 1ZZZA 5LPRA 4D9RA 1LKBA 3K65B 2ZI2H 3B23B 3FP8E 1OYTH 1LVYA 1IHSH 2ZHQH 2H9TH 1FNIA 1DLKB 1DPOA 2TGPZ 8KME2 3VFEA 1ZRKA 1YP9A 1D3PB 1O2XA 4U2WA 1LHFH 4O3TA 5I46H 1HXEH 1UJ1A 2UWPA 4BTIB 2FS9A 2O8UA 3I77A 1GI6A 3ZVBA 2SNWA 3PTNA 5BRRE 1G30B 2Z7FE 1LVOA 2C8ZB 3BV9B 3RXAA 2Y5FA 4Y0ZE 2WPKS 1FONA 1C2GA 2BMGB 2JH6D 1EAXA 4NGAH 2PHBA 6GCHF 1GJ4H 1LQEA 4K3JA 1EAIA 2GT8A 3F9HA 5EQQA 5L30H 1BJVA 1T8OA 4Q7ZA 1HIAA 1EX3A 4X8VH 2F83A 1SPJA 1W11U 1MCTA 2VIVA 1TBRH 4X6MA 1OWEA 1GBBA 1TQ7B 2OD3B 3M61U 3BTHE 2GMTC 2I6QA 2Z3DA 4ZMAH 2WPLS 2BZAA 4B73A 4ZKOU 1MZAA 1V6DA 1O3LA 1YYY1 3ATKA 2JKHA 1Q3XA 2HLCA 1RGQA 5GCHG 1HAYB 3M36A 4ABGA 3ZVCA 7ESTE 1GVZA 3MNSA 4KGAA 2GX4A 2VJ1A 6ESTA 2GDDA 1GHBF 2F3CE 3BEUA 1C5SA 3EA9A 4BXSA 5K0HA 2FX6A 2Y7ZA 3M3SA 4CRFA 1MMJN 2ZIQH 5DP3A 2A7JA 3JZ1B 2PKAB 4J2YB 1HV7A 1SL3A 3STIA 1W10U 4WXVA 1T8MA 3ZZ5A 1UK3A 1ZPBA 2O9QA 4INKA 3ZV9A 2STBE 4HGCA 2ZCHP 2ALPA 4FVBA 2A45B 5DP6A 1HFDA 1QTFA 2SGQE 1FY4A 1IQIA 3I78A 2FXRA 3RXDA 3LJOA 2ZZUH 1FV9A 3MOCA 1O2WA 3GY7A 2JH0D 4CRDA 1GBMA 3Q77A 4SGAE 1C5XB 1UVTH 1EAUA 1C5LH 2NWNA 2V0BA 1AHTH 1GBKA 3QGNB 2J4IA 3A7WA 1O3PB 3RU4T 1TABE 1SC8U 4IN1A 3NZIA 4Y8ZA 3GCOA 1O3OA 3STJA 1TA2A 4YOGA 2P3FH 5FPYA 4NIWA 2TBSA 1OWIA 2H5DA 2RA0A 3LGWA 5E0HA 2TRMA 4NA8A 4Q7YA 1C1VH 5E8EH 2ZU3A 2PTNA 1G37A 1OXGA 1C5YB 1BITA 1EPTA 3V3MA 1CO7E 2GP9B 2XRCA 1HLTH 1OP0A 3A86A 1Y5BT 1NRNH 4KKDA 5EXNA 1A46H 1AN1E 3VB6A 1KYNA 6CHAC 1FN6A 1YCPK 1TA6A 1OP8A 1O36A 2TGDA 5FAHA 1P0SH 2A2QH 5T6FA 2J94A 1TMBH 2FYRA 3AW1A 3GY4A 1TYNA 1NC6A 3O8CA 2BY5X 3E91A 1BA8B 1S85A 3FANA 2BDGA 1C1TA 1S0RA 1SGQE 1VITG 5HM2A 4ABIA 3MI4A 1SVPA 3NCLA 4ZXYH 4PROA 2PR3A 1GBHA 2PGBB 4GHQA 1C2JA 3OY6U 1GJ8B 4O9VA 2OINA 1QA7A 1T8NA 4MTBA 1DXPA 3M5LA 1J17T 4ESTE 4CRCA 1GHYH 1CHOF 4DCDA 1WTGH 3UOUA 1P04A 1O34A 1BMLA 1IQEA 4K2YA 2VIWA 3ITIA 4X1NU 2GTBA 2ZFTA 2QYIA 4LXBH 2BZ6H 4X2YA 1V2TT 4NFFA 3A7XA 3UPEA 1IQLA 1O2RA 3HKIB 1WV7H 2IPHA 3A7TA 2FEQH 4CRBA 1ZPCA 3TK6A 4TWYA 3M3TA 2HNTE 1GMDG 2GV6A 1ELTA 1K21H 1RJXB 3V13A 2QXIA 5C1UA 2Z9JA 3SV2H 1EZUC 1T8LA 3E3TA 1ZTLA 4NIYA 1P01A 2R0LA 1IQHA 2B5TB 2PUXB 4CHAC 3F1SB 3SHCH 2ULLA 3A8DA 1EZQA 1MKWK 4AOQA 4MNXA 1FQ3A 1ELVA 1N1LA 6CHAB 4XOJA 1J16A 2WPIS 1O32A 1T7CA 4UFDH 1VR1H 2A7HA 3LC5A 1MAYA 2BQ7B 3RC6A 2BXUH 4DGJA 1SQOA 4RKJB 3URCA 1YBWA 2F91A 5B6OA 3BG4C 4XBBA 3SNCA 3VB5A 3ZZ9A 4OGXA 3KQBA 4NSVA 1ORFA 1ELAA 3RC5A 1PPCE 1YPGH 3E1XB 3K9XB 5EPYA 2RG3A 1AZZA 1NO9H 4AG1A 1XKBC 4FU7A 1V2ST 3SJ9A 4Q80A 1Y3VA 4I32A 2C90B 3RMOH 2ODQA 1G36A 1GGDC 3RU4D 1QIXB 1V2NT 4AGKA 3N7OA 1O2ZA 1DS2E 4FUDA 1O2IA 1SQTA 4TWWA 1KXEA 1N6YA 2FOCA 3LT3A 1HJ8A 1A3EH 3TGJE 4X0WU 2LNCA 4ISNA 3LH3A 1TGSZ 2XNIA 3T29A 1F5LA 1P03A 2FYQA 1CU1A 1LQDB 2PSYA 2BVRH 1CGHA 4IW4E 4R8TB 3CS0A 2WUCA 3ZVFA 5HM9A 1GI7B 4A1TA 1DY8A 2PUQH 5A8YA 2QAAA 1SLWB 2P95A 4BOHA 5EGMA 2ZHWH 1PQ5A 1VITH 3SU1A 3TGKE 2V3OH 2OQUA 1DLEA 1WBGB 1GMCG 3PTBA 1H1BA 4I8JA 1UCYK 3VB3A 1E38B 1KLJH 2P16A 1L1GA 3NXPA 1S84A 1TRMA 1GMHG 2ZHEH 3MH4A 1O5DH 2FLRH 2PV9B 1CT4E 1MTUA 1CT2E 3RU4E 2AGGX 4DURA 1ZPZA 2A0QB 3QGJA 1BMMH 2BY6X 1B0FA 3FP7E 1WQSA 1AU8A 1S81A 3OX7U 3A88A 2FPZA 1K1MA 1MBMA 2QY0B 4WMFA 1HIAB 2AMQA 4JZEH 4KP0A 1SLVB 2XC5A 1P8VC 2A1DB 5AFYH 2OXSA 3GY6A 2A4QA 4VGCB 2ZPQA 3PWBA 3SNEA 1CVWH 2VH6A 2Y80A 1BCUH 1OX1A 4UE7H 1K9OE 3EA7A 2AIQA 2Q1JA 3ELAH 4E7RG 2C3SA 3H5CB 5C1XA 3BTFE 4IMQA 2J34A 1O2GH 3M7UA 1GBFA 1GHAG 2VIPA 4X8SH 1GI3A 1MU6B 4AB9A 2ZECA 1YPLH 1ZOMA 2SGDE 5LGOA 2YOLA 1WSSH 1KLTA 1KLIH 2BTCE 1ARBA 1LHGH 1GG6C 5FBEA 3SV7A 4A5TS 1Q31A 1O2MA 2ESTE 1J9CH 2K1QA 1SGCA 1ZSJA 4AYYB 1D4PB 1DWEH 1SR5C 2HPQH 1XXDA 3FAOA 5F8ZA 1LO6A 4IC6A 2OQ5A 2ZC9H 1GHXH 3SV6A 2FTMA 3SJKA 4BAQB 2XXLA 1KDQA 3QN7A 2EI6A 3W95A 4JK5A 1TGTA 3ODDA 3K6ZA 2GCTC 4NZLA 1UVPA 2ZF0H 2EC9H 5K7RA 3U8OH 1SGNE 3ATWA 3TH3H 1JIRA 1VCQA 2NU1E 2BD5A 4Q2KA 5AHGH 4A92A 1TNIA 4AFQA 5GXPA 1MTWA 1WYKA 1VZQH 4I7YH 1TNHA 4KTUA 1OP2A 3MO3A 5JBAS 2QV1A 4ZAEA 2VIQA 4B1TA 1N8OC 3EAJA 1RRKA 1EPTB 1B0EA 1C2MA 1THSH 3HATH 2W3KA 3QWCH 2A5KA 1O30A 1JRSA 1K1IA 3H7TA 3P17H 1F2SE 1K1PA 1O3DA 1ELCA 1Z6JH 5DP4A 2VWNA 1ANBA 3PMJA 5DPAA 4BAHB 1V2QT 5E2PA 2VIOA 2R2WU 5FX5A 3HKJB 2XBYA 1GBTA 2O8WA 2FP7B 4SGBE 6GCHG 1FPCH 1LVBA 5E0JA 2GZ7A 1IQMA 1ZGIA 2BQWB 2XC4A 5HGGA 2HNTF 5A0AE 1RS0A 5E0GA 1GG6B 2TGTA 2XWBI 1GBDA 2QF0A 3PWCA 1E36B 1UCYE 1ZMNA 5EXMA 4ABAA 1QL9A 1M9UA 5JDUB 1KXAA 3SO3A 3GY8A 1GVLA 1NZQH 3RXMA 4AX9H 2J38A 1DANH 1RTFB 4JCNA 1W0YH 1JBUH 1KXBA 1OYQA 3SUDA 1GHBG 1SG8B 2J9NA 4LOYH 4WWYA 1ZHMA 2BDCA 1GBIA 1DICA 3RUOA 3RXIA 4X1RU 2BLWA 1ZRBA 2GZ9A 4FU9A 5A8XA 1T31A 2A4OA 2PW8H 1SGRE 1NFXA 1WAYB 4UD9H 3TJVA 2C8YB 3PB1E 3RXTA 3VB7A 4CREA 4R0IA 2PGQB 1GBAA 3LH1A 5IYTA 3MMGA 1Z8JB 2PWXA 4H42U 2ZHDA 1QHRB 5C1YA 1C5VA 1TX7A 2C4FH 5L2ZH 1AE8H 1BTXA 1A2CH 1EB1H 2XTTB 1HUTH 1IQGA 3GY3A 1ELFA 4YLQH 1C1WH 1NROH 1MKXK 1BTZA 1O3GA 2G55A 1BJUA 5FCRA 1O3FA 4WY3A 1Z8GA 3P8GA 1MD8A 2NU4E 2W5EA 1BDAA 1YPKH 4DIHH 3LKWA 3VGCC 5IDKA 1C9TA 1ELEE 1MCVA 2R3UA 4MDSA 1O2UA 3UFAA 1DVAH 1TGNA 1S82A 4GLYA 1WQVH 2V35A 3KN2A 1CE5A 2Z3EA 1UVOA 4H6TA 3UNRA 4OS2A 3T26A 1DY9A 3PO1B 1E37B 1O3NA 4FUHA 1GHWH 4ABEA 2ZTZA 1ZMLA 1XVOA 2SGPE 4ZKNU 2H1UA 1LTOA 1ZR0A 2FTLE 1TRNA 2FOFA 1O0DH 1VCPA 1Z6EA 1QFKH 3GDUA 3BTWE 1NS3A 1O2OA 1SFIA 1ZJKA 3B9FH 4NZQA 3UREA 2BB4A 1C1NA 1TE0A 4Z6AH 2D8WA 1O35A 1PPGE 3F9GA 3PLKA 1B7XB 4BAKB 1CHOG 3UQVA 2FLBH 4Y71A 3BSQA 4OS6A 1QRXA 4RKOB 2Q6FA 1DXWA 1HNEE 3ZVDA 1JOUB 1V3XA 2FI4E 1NRSH 2P94A 1Z1JA 3SGBE 1TBZH 1RFNA 3UOPA 1CSOE 1GBEA 1HYLA 3VGCB 1SI5H 4X1PU 1QJ6B 4NIXA 3EA8A 1O3AA 1CQQA 1MD7A 4U01A 4UONA 1W8BH 2RA3A 1Y5UT 2Q6DA 1FY1A 2BD2A 2OC8A 1QJ7B 4OS7A 2BD7A 4DIIH 1BT7A 4INLA 2PTCE 4U32A 3OYPA 1GJ9B 5FHTA 1NFWA 1SB1H 1AE5A 1BHXB 1HXFH 1O2SA 1DDJA 1JIMA 3SUFA 1NRRH 1BRAA 1CBWB 1QB1A 1YCPM 1QRZA 7GCHG 3S0NA 1G9IE 3ZZ3A 2G81E 1V2MT 3PV4A 4DY7B 1RTLA 1EJNA 2ZDNA 2VWMA 1A61H 1DWBH 4ISIH 4ABDA 1KTTB 2JETB 1AB9B 3M7TA 5LPFA 1LVMA 1MQ6A 2B0FA 1A0HB 3Q3XA 1QJ1B 1DOJA 2KAIA 1TPOA 1A1RA 3DFLA 1ZSKA 3U9AH 2P59A 2VB0A 4X1QU 3LGVA 4B71A 3GICB 3MFJA 2AERH 2G52A 1ACBE 2H9EH 3PLPA 3DT0H 3RMLH 4Z0KA 1U6QA 1HJAB 1BZXE 3V7TA 1FJSA 1GI5A 2QCYA 4K60A 1TB6H 4Y7AA 2Z9GA 1TALA 4J1YA 1MBQA 4YOJA 1SGEE 4BAMB 2ALVA 4WJG2 3FVFB 1KDQB 3LC3A 4GAWA 3SU6A 1Z8IB 1C2HA 4D7GA 1J8AA 2A4GA 2ZP0H 1PFXC 3L6PA 2H2ZA 2THFB 1ETSH 5AVDA 3VXEH 3M35A 1YPHC 1A7SA 2BXTH 1PQ7A 4X8TH 4MNYA 1WU1A 1C2IA 1RXPA 2J95A 2A4RA 3RXGA 1A3BH 2J92A 2ZCKP 3MU5A 1V2RT 3SU3A 3RMMH 3BF6H 5HXFA 4H6SB 1C5UA 3EYDA 1MTSA 3EE0B 2SGFE 3GCTG 2VH0A 3SI3H 1PJPA 6LPRA 3LIWA 4XDEA 1O38A 1GHZA 1HB0B 2GZ8A 3E90B 1TFXA 1Z71A 1HCGA 2VVVA 2WPMS 4JZDH 4OS4A 3Q3YA 4MPWA 5C5OA 1O2LA 4BAOB 4LZ4B 5EXLA 3ZVAA 3RXSA 2WYGA 1OPHB 4D9QA 3SV9A 3C1KA 3PLBA 8LPRA 3UIRA 1TMTH 1O3EA 1LHCH 5GDSH 1YLDA 1C5WB 1D3DB 1TNGA 1HAVA 1BOQA 1TQ0B 2PLXA 1CHGA 1JXPA 4X6OA 2ODPA 3ZZDA 1Y59T 1A4WH 2WPJS 1G3EA 2BLQA 3RM2H 2ZEBA 4X1SU 1GBJA 1GL0E 2D1JA 1ANCA 5A09A 1C2KA 1TOCB 1AUJA 2FOMB 2VGCB 1UHBB 1H9IE 1UK4A 2BY9X 3MU8A 3D49H 2FI5E 1G3BA 1Y5AT 4YLUA 1C5MD 4ISHH 1J15A 1TOMH 1BBRH 1EOLA 3MO6A 1NN6A 4BTUB 3ATMA 1AKSA 2ZWLH 3BEFB 1O5FH 4THNH 1O2PA 2A5IA 4FVDA 1GJ6A 2DE8A 1UO6A 1QB6A 3KL6A 2AEIH 4E7NA 2XCNA 2F9UA 3S9CA 1FY8E 1H8DH 1DWDH 1HPGA 1AVXA 4ZKSU 1FAKH 3OU0A 1EAWA 4KELA 5GWZA 1GJDB 4FUEA 4I8HA 3JZ2B 1H8IH 1WCZA 1JMOH 5L6NH 1SOZA 2VWOA 2OP9A 1HAZB 3ZV8A 1T4VH 1OWDA 5E2OA 2BDBA 5ESBA 1ESBA 1SGDE 4CBNA 4VGCC 1AUTC 1A5GH 4TYDA 2WPHS 2ZKSA 4U30A 1UTQA 1DUAA 1B5GH 1GBCA 3T28A 4LK4A 1O2NA 4FUIA 1MTVA 4JMYA 1C5OH 4WMEA 3I29A 3MHWU 3UTUH 1F0TA 2UUKB 1PPBH 1ANEA 2WUBA 4MPXA 1ESAA 2QN5T 5FBIA 2PSXA 3RLYH 2XBXA 1AIXH 1E35B 3S7HB 1O31A 3FZDA 3M7QA 5T6DA 2DUCA 2GCHF 1O2VA 3SN8A 1C5PA 2Y5GA 1C4U2 3SGQE 2ZPRA 3TNSA 1TRYA 2VIDA 8ESTE 3AAVA 1K1OA 2FMJA 1ZTKA 2NU0E 3UNQA 4X2WA 2BDIA 1THRH 2ZFPH 2BVSH 4GSOA 2ZCLP 1O3KA 1K22H 2BDYA 2XBVA 1TPPA 1O3BA 4DOQA 1LMWB 1EP5A 3SJOA 1Z1IA 5A0BA 4WMDA 2YNAA 1IQKA 2WYJA 2G4TA 3GYLB 2VINA 3ATLA 1L0ZA 2F9NA 2UUJB 2D2DA 1V2KT 1TWXB 3AAUA 1MU8B 1HJ9A 5C3NA 4ZROA 2Z3CA 1TNLA 5F6MA 5DP7A 2WINI 3PYHA 1EPTC 1TX6A 4ISOA 3SNAA 2ZDKA 2ZU4A 3BTTE 4LZ1H 2Y7XA 2SGEE 2ZA5A 3RXBA 1K1JA 3UWJH 1AI8H 3KQEA 3A85A 3MTYA 1C5RA 1BRBE 2Z9IA 4UDWH 2NU2E 1DUEA 2HALA 1P2QA 4MVNA 1AWFH 1S5SA 3GOVB 1XXFA 4ISLA 3PROA 3SOSA 4ZHLU 2Z6BD 2PFEA 2BD8A 2Y5HA 3EGKH 3RXQA 2BY7X 1HAXB 2P8OC
chains in the Genus database with same CATH superfamily
1BTHH 3FOAA 1GCTC 3RLWH 2HLDD 1GMDF 2XYAA 2KAIB 1INCA 1C9PA 3S69A 5DN6D 2IN2A 4E05H 2PKSC 1QL8A 4ZH8A 1SQAA 2UUFB 3ZYDA 3GYMA 1W3CA 1WTHD 4MG3A 5TCAA 3E0NB 3QX5H 3BTKE 3G01A 3BTME 1GVKB 2ZDMA 3RXJA 1VGCB 4ABBA 1P11E 2OC7A 1UTJA 3GY5A 2RDEA 1QB9A 2GGVB 3E6PH 2Z94A 4Y8YA 1XUIA 1HAIH 4FU8A 4UFEH 1ZSLA 4FUFA 4GCHF 1ETRH 1W0KD 1WDIA 4ZUHA 2O8LA 3QLPH 1D9IA 5EODA 2ZGXH 1FXYA 4JYTA 4YT6H 1YPJH 4Y79A 2ZG0H 2Z9KA 3SNBA 3F2FA 2A2XH 5LH8A 4K8BA 5HIYA 4AFZA 1A5IA 5LPEA 3RXLA 4TY6A 1V2VT 3MNCA 1YGCH 1YC0A 4MNVA 1V2PT 3RXRA 5FPTA 3RXVA 3KCGH 2AGEX 1BBRK 3BTEE 4CRAA 1BTUA 1O2KA 1UMAH 2TPIZ 1Y3YA 5J4QA 5DKMA 3BTGE 1ELDE 2VNTA 4I8KA 4WH6A 5PTPA 1H8ED 2H9HA 2A32A 4GUXA 4INHA 4KTSA 5DP9A 2P8OB 3A83A 3GCNA 3F2HA 3NUMA 2FODA 1LHEH 2F9VA 5ETXA 1GCTB 1FLEE 1W12U 1Y8TA 1P57B 4WXIA 2PKSB 1IAUA 1O2JA 4TY7A 3PO1C 2XBWA 4UEHH 5JB9S 2P3TB 1W14U 1NPMA 4IMZA 2OBQA 1C1RA 2XC0A 2ZHFH 4RT0A 2AMDA 1AO5A 5F8TA 5C20A 4AORA 5T6GA 3ESTA 1K28D 3FP6E 1QL7A 5TCCA 3NWUA 4M7GA 1LDTT 4YT7H 1HAVB 4AN7A 4I31A 2Q6GA 5EJLA 4X2VA 5DJ7A 1JRTA 2EQNA 3CENA 2FM2A 1TIOA 2BM2A 1ELBA 1FY5A 1F7ZA 2ZO3H 3W94A 4AFSA 1F0UA 3FO8D 3F9FA 3U69H 3RC4A 7LPRA 3UUZA 2YNBA 4F4OC 5GIBA 3WY8A 1W2KH 1HAPH 4ABHA 2ASUB 2CJIA 2HOBA 3U1JB 1DFPA 1O5GH 1SGYE 4O03A 3BN9A 5DP8A 1GI0A 3QTVH 4X8UH 4HFPB 2O8MA 3F9EA 3FFGA 3QO6A 4CR5A 3RXFA 1YCPH 2CMYA 5C17A 3CP7A 1NU9A 4UFGH 3QDZB 1AKSB 1P2NA 2ZGJA 2B9LA 3O8RA 1P06A 5GPIB 4OGYA 5C2ZA 1FIWA 3IG6B 5DG6A 1ABJH 2A31A 1S6FA 1GHAF 2R9PA 2Y82A 3F0PA 2ZGHA 1LKAA 1FIZA 3RP2A 2BLOA 1PPHE 2TGAA 1K1NA 1S6LA 3VPKA 1IOEA 3PMHB 4OS1A 3LGTA 1AGJA 5EQSA 1Q2WA 1LHDH 1G32B 2B8OH 3S9AA 3WWFA 4CH8B 1G3CA 1F92A 2ZGCA 5FCKA 1QGFA 1CBWC 4FUBA 3LGUA 1W13U 1O5BB 1EB2A 1UTMA 1H9LB 1BTYA 1BMNH 3DSOA 2AGIX 1AMHA 3A89A 3HK6B 1VCWA 1EASA 1LPZB 3QZQA 1NESE 1D3QB 1EATA 3KQCA 2JETC 3UQOA 1AB9C 1YKTA 2GV7A 2V3MA 4RN6A 4I8GA 1MTNB 3E16B 1OWJA 1H9HE 2M5TA 5DO4H 2VVUA 2A7CA 1GJCB 1P9UA 1DITH 2Z9LA 1ZJDA 3SJ8A 1P10A 2G4UA 1AQ7A 1YM0A 1O2YA 3SV8A 5A2MH 1KY9A 1SMFE 1ZGVA 1HJAC 3ODFA 4ABFA 7KMEH 1BBRE 1MKWH 1DSTA 2AYWA 1MAXA 3PM3A 1IHTH 1BB0B 3LU9B 1DT2A 1O33A 3MU1A 4ZKRU 3LGYA 1FMGA 1MH0A 1ZYOA 1JWTA 2QGRA 3N7DA 3GDSA 1K1LA 1OOKB 5DP5A 3ZZ7A 2EA3A 3KGPA 1A5HA 2ZFFH 1EKBB 3TNTA 1UVSH 1GHVH 3IITA 5AFZH 3D62A 4CBOA 1C5QA 5CHAB 1HAOH 5EOKA 4CRGA 2VU8E 1GPZA 1UTOA 4YTAA 5CE1A 2F43B 5EW2H 3TK9A 3K2UA 2GDEH 3AW0A 1P12E 3KQ5A 2R2MB 3SZNA 2FO9A 3V12A 1SGIB 2HGTH 1BQYA 3A8CA 1GJ7B 3MNXA 4FXGH 1C1PA 1D6WA 3OFND 1QCPA 4DT7B 2BDHA 1O5CB 1RIWC 5HKKD 4IGDA 1FI8A 3SU4A 5KECA 1C4Y2 2BQ6B 2ZNKH 3BEIB 3UNSA 3P92A 5F8XA 4WF8A 4I86A 1L4ZA 1GDUA 3TJOA 1SLXB 1K2I1 2FESH 1X7AC 2ZPSA 1BRCE 3MH5A 1V2LT 4B74A 2STAE 3RXOA 1L2EA 4Y10E 2W26A 3M5OA 3O8BA 1XUJA 1YPHE 3M5NA 1XKAC 3LDXH 3SU5A 4FUGA 2BOKA 3ZYEA 5SGAE 1ELGA 5ABWA 2BLVA 1ZHPA 4AGJA 3ATIA 1TPSA 1HGTH 5DK1A 1QURH 1GJAB 1S83A 3P8OA 4K69A 3SQHE 3TH2H 1C5ZB 8GCHF 1UCYH 1YLCA 4D76A 5JBCS 1XUKA 1UTPA 3MWIU 2B7DH 1P05A 1V2UT 2CGAA 2KCAA 3HPTB 2FOEA 3LONA 4Y6DA 4Y76A 2JH5D 3QTOH 3SGAE 5JYIA 1AZ8A 1C1SA 1AY6H 3TJUA 3VB4A 1SGFG 2J2UA 3L33A 3SU2A 1NT1A 3E0PB 3AASA 4XFQA 3SNDA 1XX9A 4E06H 1V2WT 3D23A 5C67A 3Q76A 2VGCC 1D3TB 3KIDU 2HRVA 3TH4H 4HZHA 2C93B 1BTWA 4HTCH 4B6EA 2BHGA 2F9BH 2GCHG 3KNXA 1T4UH 1IQFA 4K1EA 2AH4X 3UWIA 2CN0H 1GI9B 3S7KB 5JBTA 1CT0E 3GY2A 1C5NH 2KZ4A 2ZU2A 3MU0A 2UWOA 1NM6A 3MH6A 4MPUA 1W0JD 4I8LA 4XBDA 2GMTB 4A6LA 4XE4A 1F0SA 2OC1A 1RIWB 1P2KA 2CF8H 3URDA 4XBCA 1LPGB 5DSFA 1TMUH 1PPZA 3ZZ8A 3KQDA 1YPMH 3TJNA 4Q7XA 1FPHH 2ANWA 1QBNA 1H4WA 2LPRA 4DW2U 1A0LA 2EEKA 3ZZBA 1GI1A 4IC5A 2W3IA 3GCHC 3FZZA 3R3GB 1RTKA 1DM4B 3OY5U 4NSYA 1UK2A 4FUJA 1FY3A 2AS9A 4AZ2B 3PRBA 1XVMA 4X6NA 4Y0YE 3RXCA 1BMAA 4NA9H 1LCYA 3NK8A 3M5MA 2GD4B 4JYUH 1QBOA 2SFAA 2XWAA 4QT8C 4AG2A 1BHXF 4MLFB 5JB8S 5J4SA 2BD4A 2CHAC 3BIUH 4KTCA 1G2LA 2ZU1A 2ZDLA 3IWMA 1Y3XA 5JBBS 1XM1A 4H4FA 1Z7KA 3A7VA 1UTKA 3KYFA 1ZLRA 2P93A 4AC9A 1IQNA 2XCFA 2I6SA 3LGIA 2UUYA 2IJOB 5CMXH 4DG4A 4UFFH 2WV4A 2VVCA 3TK5A 5A8ZA 4F49A 4TPYA 1SGPE 1BIOA 4Y11E 3KEEA 1TPAE 2BX4A 1W7GH 2F9PA 2OCVB 3SUGA 5EQRA 1UVUH 1QZ8A 2R0KA 3A80A 3RM0H 1XMNB 2SNVA 3AK5A 3MO9A 1MZDA 3RDZA 2H6MA 5F53A 3A84A 3KF2A 2CV3A 5JPMH 1O2HA 3GDVA 1AVGH 1L4DA 2TIOA 2FI3E 1HAHH 2ZFRH 2VWLA 4JYVH 3VEQB 5L2YH 4HI3A 3A81A 3DSPA 3PMAB 5GCHF 2G5NA 2BY8X 2W7UA 3RXKA 1QQUA 4B76A 2HPPH 2HWLB 1TNKA 1VJ9U 2ZTXA 3ZIAD 1SQRA 1RD3B 3T62A 7GCHF 1FUJA 4GCHG 2ZTYA 4YESB 4CH2B 3GCHB 4D8NA 1F5KU 2QF4A 4BXWA 4K8YA 3A8AA 3A8BA 1GI4A 3TGIE 5GJ4B 2HNTC 1P09A 2FOAA 1V2OT 3F6UH 1SBWA 1DSUA 4ABJA 3B8JA 3RMNH 4AB8A 4B2AA 3M37A 1T32A 4ZHMU 4NWLA 3ZZ4A 2F9OA 3T5FH 1TX8A 1E0FD 2CHAB 3ZZAA 4O97A 4BANB 4IBLH 1DWCH 3U8RH 1VJAU 3E8LA 3H7OA 1GWAA 1TBQH 1BUIA 1BTPA 1J14A 1TNJA 1CGIE 1C1QA 1UTNA 3TLOA 2V6NA 1SOTA 3AVZA 3P70B 1W0ZU 2HVXA 9ESTA 3UR9A 3EDXB 1YF4A 1PPEE 1QBVH 4B2CA 1O5AB 3NKKA 2QIQA 3C27B 3SZEA 1SGTA 5FX6A 1PYTD 4WH8A 4Y7BA 1O3CA 1XUFA 1EOJA 1NTPA 1TLDA 4MQAA 5F03A 3T2NA 3SUEA 2IOTA 3CS7A 1VGCC 4CHAB 1BRUP 2OTVA 1QQ4A 1MKXH 1P3EA 2AIPA 2DE9A 3DD2H 3A7ZA 3DUXH 3L3TA 5EPNA 3QK1A 1YPEH 2GJGA 2WV5A 2FS8A 1C1UH 1G3DA 2NU3E 3QUMP 4ASHA 2O8TA 4Y8XA 2G5VA 4B2BA 2D26C 1C2EA 3MH7A 4DJZB 1P2MA 3BG4B 1AFQC 3F0OA 1QR3E 1VITF 3SORA 2XW9A 2QC2A 2C8XB 2QXJA 3GCTF 1G2MA 2CF9H 4OM9A 3S9BA 2OLGA 2ZDAH 2JIZD 1KXDA 5FXLA 3Q3KA 2OC0A 1Y3UA 3LOXA 1O3JA 1OWHA 5C5NA 2ILNA 3RXEA 3ZVEA 4RSPA 3UY9A 3HGNA 3KHVA 1FZZA 1A0JA 1MQ5A 2KFWA 5I25A 4MNWA 1WXRA 1P2OA 2R3YA 2ZFSA 4JZIA 4X6PA 1L1JA 1GGDB 2JJ1D 3BIVH 3TPIZ 1FAXA 1BMFD 4CR9A 2J98A 3P95A 2GT7A 3HK3B 3P8FA 4O3UA 2ZGBH 1TAWA 2W7SA 1MUEB 3Q00A 3ZZCA 2PKAA 1EUFA 3U8TH 1WUNH 4K5ZA 4NWKA 4AYVB 9LPRA 4BNRA 5T3HA 4D7FA 1TONA 5AF9H 1ABIH 3D65E 1GBLA 2M2AA 3LJJA 4YZUA 3MU4A 1O39A 2ZQ1A 2ZQ2A 5DGJA 1OS8A 5ESTE 2FWWA 1PPFE 1KXCA 2FOGA 3SJIA 3PRDA 1CGJE 1NU7B 1OSSA 1GDNA 2P8OC 3TIUA 4AFUA 1GI2A 3VXFH 3HGPA 1PYTC 4A7IB 1FDPA 1D6RA 2CXVA 3OSYA 3U1IB 4B75A 2FOBA 3DFJA 1NFUA 2G00A 2BD3A 3GISB 4B6FA 1EJMA 1O3HA 1V2JT 2RDLA 3O8DA 3SQEE 1AFQB 1O3MA 2G51A 2G8TA 2QXGA 1C2FA 5BPEA 3SHAH 4M9FA 1EP6A 5EU8A 1ARCA 2BX3A 1EZSC 2UWLA 2ZDVH 4FUCA 2OUAA 3N7EA 1C5TA 1NY22 1F0RA 1O2QA 5FPSA 1TGCA 4I33A 2RCEA 3NPSA 1KXFA 1HAGE 5T1VA 3RXPA 4GPGA 3U28C 1O2TA 1AD8H 2QXHA 1P2IA 5HMAA 4BTTB 3BTQE 2ANYA 2FZZA 1PQAA 1IQJA 3N99A 4NIVA 4K1TA 3V0XA 1SGFA 1Y3WA 3BG8A 1EZXC 1EJAA 1L1NA 5A0CA 1O37A 1ZMJA 1C1MA 4IN2A 4NCYA 1C2LA 4WVPE 4YM9A 1AWHB 2ANKH 4ZCNA 3U98H 1AVWA 1C2DA 3A7YA 4MPVA 1UW7A 1GCDA 4OS5A 4NG9H 4JK6A 1F5RA 1ZTJA 2FX4A 2P3UB 3R0FA 4GHTA 4YOIA 2GKVE 4JZ1A 2EI8A 1SHHB 4IS5A 1O5EH 4GVUA 5HIZA 3ENSB 1CA0C 1C1OA 4X2XA 1OKXA 3P8NA 4Q63A 1GMCF 1E1QD 3RXHA 5EG4A 1O3IA 4JZFH 1KIGH 1P02A 3FKSD 1SSXA 3SU0A 3T27A 3SW2B 1GJBB 3RXUA 4NA7A 3F68H 1TGBA 3UR6A 1GMHF 3SBKA 1QA0A 4A1XA 2FIRH 1NRQH 1QNJA 2Y6TA 3KYGA 3MYWA 1EQ9A 1FN8A 1PQ8A 2ZFQH 1MTNC 1KTSB 1THPB 2QA9E 2GCTB 1DX5M 3M3VA 2FDAA 2OBOA 2V3HH 1SKYE 1DE7H 2C8WB 4F55A 2BD9A 1HDTH 1UHBA 3NRLA 4A1VA 2AMPA 3EQ0H 1ID5H 2SGAA 5C0UA 1NRPH 1S0QA 2EI7A 3LPRA 5H4IB 3ZVGA 3ZZ6A 1AFEH 8GCHG 1N6XA 1UTLM 2OK5A 1S6HA 1NFYA 2ODYB 3DHKH 1XUHA 5G4BA 1N8OB 2ZU5A 4YO9A 1ETTH 1WOFA 3K6YA 4TPIZ 3TVJB 1LPKB 2H5CA 3A87A 2BDAA 1QRWA 2FOHA 1P9SA 2QF3A 1EXFA 1XUGA 5HYOA 4K1SA 5IK2D 1GJ5H 5CHAC 4DVAU 1ANDA 3TU7H 1QY6A 1KSNA 3A82A 3T25A 1P2JA 1HBTH 1P3CA 2A5AA 4XSKU 1CA0B 1CA8B 1SLUB 2AFQB 1OWKA 3QZRA 5C94A 3TITA 4ZHAA 3MNBA 5TJXA 3SI4H 1SHYA 1H8HD 2BYAX 2GVFA 3OTJE 5EW1H 3PMBB 1GDQA 2KCPA 1ZHRA 3BTDE 3DA9B 1HRTH 1SFQB 3P6ZB 1GL1A 2ANMH 2BOHB 1Z8RA 1C4V2 2BVXH 4ZXXH 1GI8B 1K0HA 2JDID 1W7XH 2Y81A 4NFEA 1ESTA 1E34B 1ZZZA 2L6OA 5LPRA 4D9RA 1LKBA 3K65B 2ZI2H 3B23B 3FP8E 1OYTH 1LVYA 1IHSH 2ZHQH 2H9TH 1FNIA 1DLKB 1DPOA 2TGPZ 8KME2 3VFEA 1ZRKA 1YP9A 1D3PB 1O2XA 4U2WA 1LHFH 4O3TA 5I46H 1HXEH 1UJ1A 2UWPA 4BTIB 2FS9A 2O8UA 3I77A 1GI6A 3ZVBA 2SNWA 2K8IA 3PTNA 5BRRE 1G30B 2Z7FE 2J97A 1LVOA 2C8ZB 3BV9B 3RXAA 2Y5FA 4Y0ZE 2WPKS 1FONA 1C2GA 2BMGB 2JH6D 5B6LA 1EAXA 4NGAH 2PHBA 3F3BA 6GCHF 1GJ4H 1LQEA 4K3JA 1EAIA 2GT8A 3F9HA 5EQQA 5L30H 1BJVA 1T8OA 4Q7ZA 1HIAA 1EX3A 4X8VH 2F83A 1SPJA 1W11U 1MCTA 2VIVA 1TBRH 4X6MA 1OWEA 1GBBA 1TQ7B 2OD3B 3M61U 3BTHE 2GMTC 2I6QA 2Z3DA 4ZMAH 2WPLS 2BZAA 4B73A 4ZKOU 1MZAA 1V6DA 1O3LA 1YYY1 3ATKA 2JKHA 1Q3XA 2HLCA 1RGQA 5GCHG 1HAYB 3M36A 4ABGA 3ZVCA 7ESTE 1GVZA 3MNSA 4KGAA 2GX4A 2J98B 2VJ1A 6ESTA 4XRNA 2GDDA 1GHBF 2F3CE 3BEUA 1C5SA 2QF5A 3EA9A 4BXSA 5K0HA 2FX6A 2Y7ZA 3M3SA 4CRFA 2W6JD 1MMJN 2ZIQH 5DP3A 2A7JA 3JZ1B 2PKAB 4J2YB 1HV7A 1SL3A 3STIA 1W10U 4WXVA 1T8MA 2CK3D 3ZZ5A 1UK3A 1ZPBA 2O9QA 4INKA 1YY3A 3ZV9A 5CDFE 4F48B 2STBE 4HGCA 2ZCHP 2ALPA 4FVBA 2A45B 4ACBA 5DP6A 1HFDA 1QTFA 2SGQE 1FY4A 1IQIA 3I78A 2FXRA 3RXDA 3LJOA 2ZZUH 1FV9A 3MOCA 1O2WA 3GY7A 2WSSD 2JH0D 4CRDA 1GBMA 3Q77A 4SGAE 1C5XB 1UVTH 1EAUA 1C5LH 2NWNA 2V0BA 1AHTH 1GBKA 3QGNB 2J4IA 3A7WA 4HG6A 1O3PB 3RU4T 1TABE 1SC8U 4IN1A 3NZIA 4FOUC 4Y8ZA 3GCOA 5KEDA 1O3OA 3STJA 1TA2A 4YOGA 2P3FH 5FPYA 4NIWA 2TBSA 1OWIA 2H5DA 2RA0A 3LGWA 5E0HA 2TRMA 4NA8A 4P00A 1C1VH 4Q7YA 5E8EH 2ZU3A 2PTNA 1G37A 1OXGA 1C5YB 1BITA 1EPTA 3PV5A 3V3MA 1CO7E 2GP9B 2XRCA 1HLTH 1OP0A 3A86A 5FL7D 1Y5BT 1NRNH 4KKDA 5EXNA 1A46H 1AN1E 3VB6A 1KYNA 6CHAC 1FN6A 1YCPK 1TA6A 1OP8A 1O36A 2TGDA 5FAHA 1P0SH 2A2QH 3PV2A 5T6FA 2J94A 1TMBH 2FYRA 3AW1A 3GY4A 1TYNA 1NC6A 3O8CA 2BY5X 3E91A 1BA8B 1S85A 3FANA 2BDGA 1C1TA 1S0RA 1SGQE 1VITG 5HM2A 4ABIA 3MI4A 1SVPA 3NCLA 4ZXYH 4PROA 2PR3A 1GBHA 2PGBB 4GHQA 1C2JA 3OY6U 1GJ8B 4O9VA 2OINA 1EFRD 1QA7A 3H09A 1T8NA 4MTBA 1DXPA 3M5LA 1J17T 4ESTE 4CRCA 1GHYH 1CHOF 4DCDA 1WTGH 3UOUA 1P04A 1O34A 1BMLA 1IQEA 4K2YA 2VIWA 3ITIA 4X1NU 2GTBA 2ZFTA 2QYIA 4LXBH 2BZ6H 4X2YA 1V2TT 4NFFA 2XOKD 3A7XA 3UPEA 1IQLA 1O2RA 3HKIB 1WV7H 2IPHA 3A7TA 2FEQH 2JJ2D 4CRBA 1ZPCA 3TK6A 2YMSB 4TWYA 3M3TA 1GMDG 2GV6A 2HNTE 1ELTA 1K21H 1RJXB 3V13A 2QXIA 5C1UA 2Z9JA 3SV2H 1EZUC 1T8LA 3E3TA 1ZTLA 4NIYA 1P01A 2R0LA 1IQHA 2B5TB 2PUXB 4CHAC 3F1SB 3SHCH 1E79D 2ULLA 3A8DA 1EZQA 1MKWK 4AOQA 4MNXA 1FQ3A 1ELVA 1N1LA 6CHAB 4XOJA 1J16A 2WPIS 1O32A 3DCLA 1T7CA 4UFDH 1VR1H 2A7HA 3LC5A 1MAYA 2BQ7B 3RC6A 2BXUH 4DGJA 1SQOA 4RKJB 3URCA 1YBWA 2F91A 2PP6A 5B6OA 3BG4C 4XBBA 3SNCA 3VB5A 3ZZ9A 4OGXA 3KQBA 4NSVA 1ORFA 1ELAA 3RC5A 1PPCE 1YPGH 3E1XB 3K9XB 5EPYA 2RG3A 2L74A 1AZZA 1KMHB 1NO9H 4AG1A 1XKBC 4FU7A 1V2ST 3SJ9A 4Q80A 1Y3VA 4I32A 2C90B 3RMOH 2ODQA 1G36A 1GGDC 3FN8A 1QIXB 3RU4D 1V2NT 4AGKA 3CNRA 3N7OA 1O2ZA 1DS2E 4FUDA 1O2IA 1SQTA 4TWWA 1KXEA 1N6YA 2FOCA 3LT3A 1HJ8A 1A3EH 3TGJE 4X0WU 2LNCA 4ISNA 3LH3A 1TGSZ 2XNIA 3T29A 1F5LA 1P03A 2FYQA 1CU1A 1LQDB 2PSYA 2BVRH 1CGHA 4IW4E 4R8TB 3CS0A 2WUCA 3ZVFA 5HM9A 1GI7B 4A1TA 1DY8A 2PUQH 5A8YA 2QAAA 1SLWB 2P95A 4BOHA 5EGMA 2ZHWH 1PQ5A 1VITH 3SU1A 3TGKE 2V3OH 2OQUA 1DLEA 1WBGB 1GMCG 3PTBA 1H1BA 2KR7A 4I8JA 1UCYK 3VB3A 1E38B 1KLJH 2P16A 1L1GA 3NXPA 1S84A 2RFKC 1TRMA 2HVYB 1GMHG 2ZHEH 3MH4A 1O5DH 2FLRH 2PV9B 1CT4E 1MTUA 1CT2E 3RU4E 2AGGX 4DURA 1ZPZA 2A0QB 3QGJA 1BMMH 2BY6X 1B0FA 3FP7E 1WQSA 1AU8A 1S81A 3OX7U 3A88A 2FPZA 1K1MA 1MBMA 2QY0B 4WMFA 1HIAB 2AMQA 4JZEH 4KP0A 1SLVB 2XC5A 1P8VC 2A1DB 5AFYH 2OXSA 3GY6A 2A4QA 4VGCB 2QE7D 2ZPQA 3PWBA 3SNEA 2VH6A 2Y80A 1BCUH 1OX1A 4UE7H 1K9OE 3EA7A 2AIQA 2Q1JA 3ELAH 4E7RG 2C3SA 3H5CB 5C1XA 3BTFE 4IMQA 2J34A 1O2GH 3M7UA 1GBFA 1GHAG 2VIPA 4X8SH 1GI3A 1MU6B 4AB9A 2WV9A 2ZECA 1YPLH 1ZOMA 5CHBA 2SGDE 5LGOA 2YOLA 1WSSH 1KLTA 1KLIH 2BTCE 1ARBA 1LHGH 1GG6C 5FBEA 3SV7A 4A5TS 1Q31A 1O2MA 3VG8A 2ESTE 4XD7D 1J9CH 2K1QA 1SGCA 1ZSJA 4AYYB 1D4PB 4YXWD 1DWEH 1SR5C 2HPQH 1XXDA 3FAOA 5F8ZA 1LO6A 4IC6A 2OQ5A 2ZC9H 1GHXH 3SV6A 2FTMA 3SJKA 4BAQB 2XXLA 1KDQA 1OHHD 3QN7A 2IJD1 2EI6A 3W95A 4JK5A 1TGTA 3ODDA 3K6ZA 2GCTC 4NZLA 1UVPA 2ZF0H 2K0QA 4RT1A 2EC9H 5K7RA 3OTPA 3U8OH 1SGNE 3ATWA 3TH3H 1JIRA 3OEED 1VCQA 2NU1E 2BD5A 4Q2KA 3OAAD 5AHGH 1TNIA 4AFQA 4A92A 5GXPA 1MTWA 1WYKA 1VZQH 4I7YH 1TNHA 4KTUA 1OP2A 3MO3A 5JBAS 2QV1A 4ZAEA 2VIQA 4B1TA 1N8OC 3EAJA 1RRKA 1EPTB 1B0EA 1C2MA 1THSH 3HATH 2W3KA 3QWCH 2A5KA 2VBCA 1O30A 2WPDD 1JRSA 1K1IA 3H7TA 3P17H 1F2SE 1K1PA 1O3DA 1ELCA 1Z6JH 5DP4A 1COWD 2VWNA 1ANBA 3PMJA 5DPAA 4BAHB 1V2QT 5E2PA 2VIOA 2R2WU 5FX5A 3HKJB 2XBYA 1GBTA 2O8WA 2FP7B 4SGBE 6GCHG 1FPCH 1LVBA 5E0JA 2GZ7A 1IQMA 1ZGIA 2BQWB 2XC4A 5HGGA 2HNTF 5A0AE 1RS0A 5E0GA 1GG6B 3OEHD 2TGTA 2XWBI 1GBDA 2QF0A 3PWCA 1E36B 1UCYE 1ZMNA 5EXMA 4ABAA 2WZQA 1QL9A 1M9UA 5JDUB 1KXAA 3SO3A 3GY8A 1GVLA 1NZQH 3RXMA 4AX9H 2J38A 3W1EA 1DANH 1RTFB 2KX4A 4JCNA 1W0YH 1JBUH 1KXBA 1OYQA 3SUDA 1GHBG 1SG8B 2J9NA 4LOYH 4WWYA 1ZHMA 2BDCA 1GBIA 1DICA 3RUOA 3RXIA 4X1RU 2BLWA 1ZRBA 2GZ9A 4FU9A 4ACAA 5A8XA 1T31A 2A4OA 2PW8H 1SGRE 1NFXA 1WAYB 4UD9H 3TJVA 2C8YB 2KCOA 3PB1E 3RXTA 3VB7A 4CREA 4R0IA 2PGQB 1GBAA 3LH1A 5IYTA 3MMGA 1Z8JB 2PWXA 3WW7A 4H42U 2ZHDA 1QHRB 5C1YA 1C5VA 5C0TA 1TX7A 2C4FH 5L2ZH 1AE8H 1BTXA 1A2CH 1EB1H 2XTTB 1HUTH 1IQGA 3GY3A 1ELFA 4YLQH 1C1WH 1NROH 1MKXK 4Z1MD 1BTZA 1O3GA 2G55A 1BJUA 5FCRA 1O3FA 4WY3A 1FX0B 1Z8GA 3P8GA 1MD8A 2NU4E 2W5EA 1BDAA 1YPKH 4DIHH 3LKWA 3VGCC 5IDKA 2LP6A 1C9TA 1ELEE 1MCVA 2R3UA 4MDSA 1O2UA 3UFAA 1DVAH 2IPQX 1TGNA 1S82A 4GLYA 1WQVH 2V35A 3KN2A 1CE5A 3SYJA 2Z3EA 1UVOA 4H6TA 3UNRA 4OS2A 3T26A 1DY9A 3PO1B 1E37B 1O3NA 4FUHA 2WHXA 1GHWH 4ABEA 2ZTZA 3MQKC 1ZMLA 1XVOA 2SGPE 4ZKNU 2H1UA 1LTOA 1ZR0A 2XNDD 2FTLE 1TRNA 2FOFA 1O0DH 1VCPA 1Z6EA 1QFKH 3GDUA 3BTWE 1NS3A 1O2OA 1SFIA 1ZJKA 3B9FH 4NZQA 3UREA 4ASUD 2BB4A 1C1NA 1TE0A 5EIYA 4Z6AH 2D8WA 1O35A 1PPGE 3F9GA 3PLKA 1B7XB 4BAKB 1CHOG 3UQVA 2FLBH 4Y71A 3BSQA 4OS6A 4DT4A 1QRXA 2YMSD 4RKOB 2Q6FA 1DXWA 1HNEE 3ZVDA 1JOUB 1V3XA 2FI4E 1NRSH 4RI0A 2P94A 1Z1JA 3SGBE 1TBZH 1RFNA 3UOPA 1CSOE 1GBEA 1HYLA 3VGCB 1SI5H 4X1PU 1QJ6B 4NIXA 3EA8A 1O3AA 1CQQA 4P02A 1MD7A 4U01A 4UONA 1W8BH 2RA3A 1Y5UT 2Q6DA 1FY1A 2BD2A 2OC8A 1QJ7B 4OS7A 2BD7A 4DIIH 1BT7A 4INLA 2PTCE 4U32A 3OYPA 1GJ9B 5FHTA 1E1RD 1NFWA 1SB1H 1AE5A 1BHXB 1HXFH 1O2SA 1DDJA 1JIMA 3SUFA 1NRRH 1BRAA 1CBWB 1QB1A 1YCPM 1QRZA 7GCHG 3S0NA 1G9IE 3ZZ3A 2G81E 1V2MT 3PV4A 4DY7B 1RTLA 1EJNA 2ZDNA 2VWMA 1A61H 1DWBH 4ISIH 4ABDA 1KTTB 2JETB 1AB9B 3M7TA 5LPFA 1LVMA 1MQ6A 2B0FA 1A0HB 3Q3XA 1QJ1B 5KGOA 1DOJA 2KAIA 1TPOA 5GNDA 1A1RA 3DFLA 1ZSKA 3U9AH 2P59A 2VB0A 4X1QU 3LGVA 4B71A 3GICB 3MFJA 2AERH 2G52A 1ACBE 2H9EH 3PLPA 3DT0H 3RMLH 4Z0KA 1U6QA 1HJAB 1BZXE 3V7TA 1FJSA 1GI5A 2QCYA 4K60A 1TB6H 4Y7AA 2Z9GA 1TALA 4J1YA 1MBQA 4YOJA 1SGEE 4BAMB 2YMSC 2ALVA 4WJG2 3FVFB 1KDQB 3LC3A 4GAWA 3SU6A 1Z8IB 1C2HA 4D7GA 1J8AA 2A4GA 2KM0A 2ZP0H 1PFXC 3L6PA 2H2ZA 2THFB 1ETSH 5AVDA 3VXEH 2F4LA 3M35A 1YPHC 1A7SA 2BXTH 1PQ7A 4X8TH 4MNYA 1WU1A 3OE7D 1C2IA 1RXPA 2J95A 2A4RA 3UB0A 3RXGA 1A3BH 2J92A 5EJZA 2ZCKP 3MU5A 1V2RT 3GS9A 3SU3A 3RMMH 3BF6H 5HXFA 4H6SB 1C5UA 1NBMD 3EYDA 1MTSA 3EE0B 2SGFE 3GCTG 2VH0A 4Q4LA 3SI3H 1PJPA 6LPRA 3LIWA 4XDEA 1O38A 1GHZA 1HB0B 4TT3D 2GZ8A 3E90B 1TFXA 1Z71A 1HCGA 2VVVA 2WPMS 4JZDH 4OS4A 3Q3YA 4MPWA 5C5OA 1O2LA 4BAOB 4LZ4B 5EXLA 3ZVAA 3RXSA 2WYGA 1OPHB 4D9QA 3SV9A 3C1KA 3PLBA 8LPRA 3UIRA 1TMTH 1O3EA 1LHCH 5GDSH 1YLDA 1C5WB 1D3DB 1TNGA 1HAVA 1BOQA 1TQ0B 2PLXA 1CHGA 1JXPA 3DSGA 4X6OA 4FETA 2ODPA 3ZZDA 1Y59T 1A4WH 2WPJS 1G3EA 2BLQA 3RM2H 2ZEBA 4X1SU 1GBJA 1GL0E 2D1JA 1ANCA 5A09A 1C2KA 1TOCB 1AUJA 2FOMB 2VGCB 1UHBB 1H9IE 1UK4A 2BY9X 3MU8A 3D49H 1NBME 2FI5E 1G3BA 1Y5AT 4YLUA 1C5MD 3EE7A 4ISHH 3UAIC 2AHME 1J15A 1TOMH 1BBRH 4TSFD 1EOLA 3MO6A 1NN6A 4BTUB 3ATMA 1AKSA 2ZWLH 3BEFB 1YWUA 1O5FH 4THNH 1O2PA 2A5IA 4FVDA 1GJ6A 2DE8A 1UO6A 1QB6A 3KL6A 2AEIH 4E7NA 2XCNA 2F9UA 3S9CA 1FY8E 1H8DH 1DWDH 1HPGA 1AVXA 4ZKSU 1FAKH 3OU0A 1EAWA 4KELA 5GWZA 1GJDB 4FUEA 4I8HA 3JZ2B 1H8IH 1WCZA 1JMOH 5L6NH 1SOZA 2VWOA 2OP9A 1HAZB 3ZV8A 1T4VH 1OWDA 3F2GA 5E2OA 2BDBA 5ESBA 1ESBA 1SGDE 4CBNA 4VGCC 1AUTC 1A5GH 4TYDA 2WPHS 2ZKSA 4U30A 1UTQA 1DUAA 1B5GH 1GBCA 1MABB 3T28A 4LK4A 1O2NA 4FUIA 1MTVA 4JMYA 1C5OH 4WMEA 3I29A 3MHWU 3UTUH 1F0TA 5EJ1A 2UUKB 1PPBH 1ANEA 2WUBA 4MPXA 1ESAA 2QN5T 5FBIA 2PSXA 3RLYH 2XBXA 1AIXH 1E35B 3S7HB 1O31A 3FZDA 3M7QA 5T6DA 2DUCA 2GCHF 1O2VA 2LELA 3SN8A 2W6ID 1C5PA 2Y5GA 1C4U2 3SGQE 2ZPRA 3TNSA 1TRYA 3WWBA 2VIDA 8ESTE 3AAVA 1K1OA 2FMJA 1ZTKA 2NU0E 3UNQA 4X2WA 2BDIA 1THRH 2ZFPH 2BVSH 4GSOA 2ZCLP 1YLNA 1O3KA 1K22H 2BDYA 2XBVA 1TPPA 1O3BA 4DOQA 1VKYA 1LMWB 1EP5A 3SJOA 1Z1IA 2KCYA 5A0BA 4WMDA 2YNAA 1IQKA 2WYJA 2G4TA 2V7QD 3GYLB 2VINA 3ATLA 2J5UA 1L0ZA 2F9NA 2UUJB 2D2DA 1V2KT 1TWXB 3AAUA 1MU8B 1HJ9A 5C3NA 4ZROA 2Z3CA 1TNLA 5F6MA 5DP7A 2WINI 3PYHA 1EPTC 1TX6A 4ISOA 3SNAA 2ZDKA 2ZU4A 3BTTE 4LZ1H 2Y7XA 2SGEE 2ZA5A 3RXBA 1K1JA 2EY4C 3UWJH 1AI8H 3KQEA 3A85A 3MTYA 1C5RA 1BRBE 2Z9IA 4UDWH 2NU2E 1DUEA 2HALA 1P2QA 4MVNA 1AWFH 1S5SA 3GOVB 1XXFA 4ISLA 3PROA 3SOSA 4ZHLU 2Z6BD 2PFEA 2BD8A 2Y5HA 3EGKH 3RXQA 2BY7X 1HAXB 1CVWH
chains in the Genus database with same CATH topology
1BTHH 1GCTC 3RLWH 2XYAA 1GMDF 2KAIB 1INCA 1C9PA 3S69A 2IN2A 4E05H 2PKSC 1QL8A 4ZH8A 1SQAA 2UUFB 3ZYDA 3GYMA 1W3CA 1WTHD 4MG3A 5TCAA 3E0NB 3QX5H 3BTKE 3G01A 3BTME 1GVKB 2ZDMA 3RXJA 1VGCB 4ABBA 1P11E 2OC7A 1UTJA 3GY5A 1QB9A 2GGVB 3E6PH 2Z94A 4Y8YA 1XUIA 1HAIH 4FU8A 4UFEH 1ZSLA 4FUFA 4GCHF 1ETRH 4ZUHA 2O8LA 3QLPH 1D9IA 5EODA 2ZGXH 1FXYA 4JYTA 4YT6H 1YPJH 4Y79A 2ZG0H 2Z9KA 3SNBA 2A2XH 5LH8A 4K8BA 4AFZA 1A5IA 5LPEA 3RXLA 4TY6A 1V2VT 3MNCA 1YGCH 1YC0A 4MNVA 1V2PT 3RXRA 5FPTA 3RXVA 3KCGH 2AGEX 1BBRK 3BTEE 4CRAA 1BTUA 1O2KA 1UMAH 2TPIZ 1Y3YA 5J4QA 5DKMA 3BTGE 1ELDE 2VNTA 4I8KA 4WH6A 5PTPA 2H9HA 2A32A 4GUXA 4INHA 4KTSA 5DP9A 2P8OB 3A83A 3GCNA 3NUMA 2FODA 1LHEH 2F9VA 5ETXA 1GCTB 1FLEE 1W12U 1Y8TA 1P57B 4WXIA 2PKSB 1IAUA 1O2JA 4TY7A 3PO1C 2XBWA 4UEHH 5JB9S 2P3TB 1W14U 1NPMA 4IMZA 2OBQA 1C1RA 2XC0A 2ZHFH 2AMDA 1AO5A 5F8TA 5C20A 4AORA 5T6GA 3ESTA 1K28D 3FP6E 1QL7A 5TCCA 3NWUA 4M7GA 1LDTT 4YT7H 1HAVB 4AN7A 4I31A 2Q6GA 4X2VA 5DJ7A 1JRTA 3CENA 2FM2A 1TIOA 2BM2A 1ELBA 1FY5A 1F7ZA 2ZO3H 3W94A 4AFSA 1F0UA 3F9FA 3U69H 3RC4A 7LPRA 3UUZA 2YNBA 4F4OC 5GIBA 3WY8A 1W2KH 1HAPH 4ABHA 2ASUB 2CJIA 2HOBA 3U1JB 1DFPA 1O5GH 1SGYE 4O03A 3BN9A 5DP8A 1GI0A 3QTVH 4X8UH 4HFPB 2O8MA 3F9EA 3FFGA 3QO6A 4CR5A 3RXFA 1YCPH 2CMYA 3CP7A 1NU9A 4UFGH 3QDZB 1AKSB 1P2NA 2ZGJA 2B9LA 3O8RA 1P06A 5GPIB 4OGYA 5C2ZA 1FIWA 3IG6B 5DG6A 1ABJH 2A31A 1S6FA 1GHAF 2R9PA 2Y82A 2ZGHA 1LKAA 1FIZA 3RP2A 2BLOA 1PPHE 2TGAA 1K1NA 3VPKA 1IOEA 3PMHB 4OS1A 3LGTA 1AGJA 5EQSA 1Q2WA 1LHDH 1G32B 2B8OH 3S9AA 4CH8B 1G3CA 1F92A 2ZGCA 5FCKA 1QGFA 1CBWC 4FUBA 3LGUA 1W13U 1O5BB 1EB2A 1UTMA 1H9LB 1BTYA 1BMNH 3HK6B 2AGIX 1AMHA 3A89A 1VCWA 1EASA 1LPZB 3QZQA 1NESE 1D3QB 1EATA 3KQCA 2JETC 3UQOA 1AB9C 1YKTA 2GV7A 4RN6A 4I8GA 1MTNB 3E16B 1OWJA 1H9HE 2M5TA 5DO4H 2VVUA 2A7CA 1GJCB 1P9UA 1DITH 2Z9LA 1ZJDA 3SJ8A 1P10A 2G4UA 1AQ7A 1YM0A 1O2YA 3SV8A 5A2MH 1KY9A 1SMFE 1ZGVA 1HJAC 3ODFA 4ABFA 7KMEH 1BBRE 1MKWH 1DSTA 2AYWA 1MAXA 3PM3A 1IHTH 1BB0B 3LU9B 1DT2A 1O33A 3MU1A 4ZKRU 3LGYA 1FMGA 1MH0A 1ZYOA 1JWTA 2QGRA 3GDSA 1K1LA 1OOKB 5DP5A 3ZZ7A 2EA3A 3KGPA 1A5HA 2ZFFH 1EKBB 3TNTA 1UVSH 1GHVH 3IITA 5AFZH 3D62A 4CBOA 1C5QA 5CHAB 1HAOH 5EOKA 4CRGA 2VU8E 1GPZA 1UTOA 4YTAA 5CE1A 5EW2H 3TK9A 3K2UA 2GDEH 3AW0A 1P12E 2R2MB 3SZNA 2FO9A 3V12A 1SGIB 2HGTH 1BQYA 3A8CA 1GJ7B 3MNXA 4FXGH 1C1PA 1D6WA 1QCPA 4DT7B 2BDHA 1O5CB 1RIWC 4IGDA 1FI8A 3SU4A 1C4Y2 2BQ6B 2ZNKH 3BEIB 3UNSA 3P92A 5F8XA 4WF8A 1L4ZA 1GDUA 3TJOA 1SLXB 1K2I1 2FESH 1X7AC 2ZPSA 1BRCE 3MH5A 1V2LT 4B74A 2STAE 3RXOA 1L2EA 4Y10E 2W26A 3M5OA 3O8BA 1XUJA 1YPHE 3M5NA 1XKAC 3LDXH 3SU5A 4FUGA 2BOKA 3ZYEA 5SGAE 1ELGA 5ABWA 2BLVA 1ZHPA 4AGJA 3ATIA 1TPSA 1HGTH 5DK1A 1QURH 1GJAB 1S83A 3P8OA 4K69A 3SQHE 3TH2H 1C5ZB 8GCHF 1UCYH 1YLCA 4D76A 5JBCS 1XUKA 1UTPA 3MWIU 2B7DH 1P05A 1V2UT 2CGAA 3HPTB 2FOEA 3LONA 4Y6DA 4Y76A 2JH5D 3QTOH 3SGAE 5JYIA 1AZ8A 1C1SA 1AY6H 3TJUA 3VB4A 1SGFG 2J2UA 3L33A 3SU2A 1NT1A 3E0PB 3AASA 4XFQA 3SNDA 1XX9A 4E06H 1V2WT 3D23A 5C67A 3Q76A 2VGCC 1D3TB 3KIDU 2HRVA 3TH4H 4HZHA 2C93B 1BTWA 4HTCH 2BHGA 2F9BH 2GCHG 3KNXA 1T4UH 1IQFA 4K1EA 2AH4X 3UWIA 2CN0H 1GI9B 3S7KB 5JBTA 1CT0E 3GY2A 1C5NH 2ZU2A 3MU0A 2UWOA 1NM6A 3MH6A 4MPUA 4I8LA 4XBDA 2GMTB 4A6LA 4XE4A 1F0SA 2OC1A 1RIWB 1P2KA 2CF8H 3URDA 4XBCA 1LPGB 1TMUH 1PPZA 3ZZ8A 3KQDA 1YPMH 3TJNA 4Q7XA 1FPHH 2ANWA 1QBNA 1H4WA 2LPRA 4DW2U 1A0LA 2EEKA 3ZZBA 1GI1A 4IC5A 2W3IA 3GCHC 3FZZA 3R3GB 1RTKA 1DM4B 3OY5U 4NSYA 1UK2A 4FUJA 1FY3A 2AS9A 4AZ2B 1XVMA 4X6NA 4Y0YE 3RXCA 1BMAA 4NA9H 1LCYA 3NK8A 3M5MA 2GD4B 4JYUH 1QBOA 2SFAA 2XWAA 4QT8C 4AG2A 1BHXF 4MLFB 5JB8S 5J4SA 2BD4A 2CHAC 3BIUH 4KTCA 1G2LA 2ZU1A 2ZDLA 3IWMA 1Y3XA 5JBBS 1XM1A 4H4FA 1Z7KA 3A7VA 1UTKA 1ZLRA 2P93A 1IQNA 2XCFA 2I6SA 3LGIA 2UUYA 2IJOB 5CMXH 4DG4A 4UFFH 2WV4A 2VVCA 3TK5A 5A8ZA 4F49A 4TPYA 1SGPE 1BIOA 4Y11E 3KEEA 1TPAE 2BX4A 1W7GH 2F9PA 2OCVB 3SUGA 5EQRA 1UVUH 2R0KA 3A80A 3RM0H 1XMNB 2SNVA 3MO9A 1MZDA 3RDZA 2H6MA 3A84A 3KF2A 2CV3A 5JPMH 1O2HA 3GDVA 1AVGH 1L4DA 2TIOA 2FI3E 1HAHH 2ZFRH 2VWLA 4JYVH 3VEQB 5L2YH 4HI3A 3A81A 3PMAB 5GCHF 2G5NA 2BY8X 2W7UA 3RXKA 1QQUA 4B76A 2HPPH 2HWLB 1TNKA 1VJ9U 2ZTXA 1RD3B 3T62A 7GCHF 1FUJA 4GCHG 2ZTYA 4YESB 4CH2B 3GCHB 4D8NA 1F5KU 4BXWA 4K8YA 3A8AA 3A8BA 1GI4A 3TGIE 5GJ4B 2HNTC 1P09A 2FOAA 1V2OT 3F6UH 1SBWA 1DSUA 4ABJA 3B8JA 3RMNH 4AB8A 4B2AA 3M37A 1T32A 4ZHMU 4NWLA 3ZZ4A 2F9OA 3T5FH 1TX8A 1E0FD 2CHAB 3ZZAA 4O97A 4BANB 4IBLH 1DWCH 3U8RH 1VJAU 3E8LA 3H7OA 1GWAA 1TBQH 1BUIA 1BTPA 1J14A 1TNJA 1CGIE 1C1QA 1UTNA 3TLOA 2V6NA 1SOTA 3AVZA 3P70B 1W0ZU 2HVXA 9ESTA 3UR9A 3EDXB 1YF4A 1PPEE 1QBVH 4B2CA 1O5AB 3NKKA 2QIQA 3C27B 1SGTA 5FX6A 1PYTD 4WH8A 4Y7BA 1O3CA 1XUFA 1EOJA 1NTPA 1TLDA 4MQAA 5F03A 3T2NA 3SUEA 2IOTA 3CS7A 1VGCC 4CHAB 1BRUP 2OTVA 1QQ4A 1MKXH 1P3EA 2AIPA 2DE9A 3DD2H 3A7ZA 3DUXH 3L3TA 5EPNA 3QK1A 1YPEH 2WV5A 2FS8A 1C1UH 1G3DA 2NU3E 3QUMP 4ASHA 2O8TA 4Y8XA 2G5VA 4B2BA 2D26C 1C2EA 3MH7A 4DJZB 1P2MA 3BG4B 1AFQC 1QR3E 1VITF 3SORA 2XW9A 2QC2A 2C8XB 2QXJA 3GCTF 1G2MA 2CF9H 3S9BA 2OLGA 2ZDAH 1KXDA 5FXLA 3Q3KA 2OC0A 1Y3UA 3LOXA 1O3JA 1OWHA 5C5NA 2ILNA 3RXEA 3ZVEA 4RSPA 3UY9A 3HGNA 3KHVA 1FZZA 1A0JA 1MQ5A 5I25A 4MNWA 1P2OA 2R3YA 2ZFSA 4JZIA 4X6PA 1L1JA 1GGDB 3TPIZ 3BIVH 1FAXA 4CR9A 3P95A 2GT7A 3HK3B 3P8FA 4O3UA 2ZGBH 1TAWA 2W7SA 1MUEB 3Q00A 3ZZCA 2PKAA 1EUFA 3U8TH 1WUNH 4K5ZA 4NWKA 4AYVB 9LPRA 4BNRA 5T3HA 4D7FA 1TONA 5AF9H 1ABIH 3D65E 1GBLA 3LJJA 4YZUA 3MU4A 1O39A 2ZQ1A 2ZQ2A 5DGJA 1OS8A 5ESTE 2FWWA 1PPFE 1KXCA 2FOGA 3SJIA 1CGJE 1NU7B 1OSSA 1GDNA 3TIUA 4AFUA 1GI2A 3VXFH 3HGPA 1PYTC 4A7IB 1FDPA 1D6RA 2CXVA 3OSYA 3U1IB 4B75A 2FOBA 3DFJA 1NFUA 2G00A 2BD3A 3GISB 1EJMA 1O3HA 1V2JT 2RDLA 3O8DA 3SQEE 1AFQB 1O3MA 2G51A 2G8TA 2QXGA 1C2FA 5BPEA 3SHAH 1EP6A 5EU8A 1ARCA 2BX3A 1EZSC 2UWLA 2ZDVH 4FUCA 2OUAA 1C5TA 1NY22 1F0RA 1O2QA 5FPSA 1TGCA 4I33A 2RCEA 3NPSA 1KXFA 1HAGE 3RXPA 4GPGA 1O2TA 1AD8H 2QXHA 1P2IA 5HMAA 4BTTB 3BTQE 2ANYA 2FZZA 1PQAA 1IQJA 4NIVA 4K1TA 3V0XA 1SGFA 1Y3WA 3BG8A 1EZXC 1EJAA 1L1NA 5A0CA 1O37A 1ZMJA 1C1MA 4IN2A 4NCYA 1C2LA 4WVPE 4YM9A 1AWHB 2ANKH 3U98H 1AVWA 1C2DA 3A7YA 4MPVA 1GCDA 4OS5A 4NG9H 4JK6A 1F5RA 1ZTJA 2FX4A 2P3UB 3R0FA 4GHTA 4YOIA 2GKVE 4JZ1A 2EI8A 1SHHB 4IS5A 1O5EH 4GVUA 3ENSB 1CA0C 1C1OA 4X2XA 1OKXA 3P8NA 1GMCF 3RXHA 5EG4A 1O3IA 4JZFH 1KIGH 1P02A 1SSXA 3SU0A 3T27A 3SW2B 1GJBB 3RXUA 4NA7A 3F68H 1TGBA 3UR6A 1GMHF 3SBKA 1QA0A 4A1XA 2FIRH 1NRQH 1QNJA 2Y6TA 3MYWA 1EQ9A 1FN8A 1PQ8A 2ZFQH 1MTNC 1KTSB 1THPB 2QA9E 2GCTB 1DX5M 3M3VA 2FDAA 2OBOA 2V3HH 1DE7H 2C8WB 2BD9A 1HDTH 1UHBA 4A1VA 2AMPA 3EQ0H 1ID5H 2SGAA 1NRPH 1S0QA 2EI7A 3LPRA 5H4IB 3ZVGA 3ZZ6A 1AFEH 8GCHG 1N6XA 1UTLM 1S6HA 1NFYA 2ODYB 3DHKH 1XUHA 5G4BA 1N8OB 2ZU5A 4YO9A 1ETTH 1WOFA 3K6YA 4TPIZ 3TVJB 1LPKB 2H5CA 3A87A 2BDAA 1QRWA 2FOHA 1P9SA 2QF3A 1EXFA 1XUGA 5HYOA 4K1SA 1GJ5H 5CHAC 4DVAU 1ANDA 3TU7H 1QY6A 1KSNA 3A82A 3T25A 1P2JA 1HBTH 1P3CA 2A5AA 4XSKU 1CA0B 1CA8B 1SLUB 2AFQB 1OWKA 3QZRA 3TITA 4ZHAA 3MNBA 5TJXA 3SI4H 1SHYA 2BYAX 2GVFA 3OTJE 5EW1H 3PMBB 1GDQA 1ZHRA 3BTDE 3DA9B 1HRTH 1SFQB 3P6ZB 1GL1A 2ANMH 2BOHB 1Z8RA 1C4V2 2BVXH 4ZXXH 1GI8B 1W7XH 2Y81A 4NFEA 1ESTA 1E34B 1ZZZA 5LPRA 4D9RA 1LKBA 3K65B 2ZI2H 3B23B 3FP8E 1OYTH 1LVYA 1IHSH 2ZHQH 2H9TH 1FNIA 1DLKB 1DPOA 2TGPZ 8KME2 3VFEA 1ZRKA 1YP9A 1D3PB 1O2XA 4U2WA 1LHFH 4O3TA 5I46H 1HXEH 1UJ1A 2UWPA 4BTIB 2FS9A 2O8UA 3I77A 1GI6A 3ZVBA 2SNWA 3PTNA 5BRRE 1G30B 2Z7FE 1LVOA 2C8ZB 3BV9B 3RXAA 2Y5FA 4Y0ZE 2WPKS 1FONA 1C2GA 2BMGB 2JH6D 1EAXA 4NGAH 2PHBA 6GCHF 1GJ4H 1LQEA 4K3JA 1EAIA 2GT8A 3F9HA 5EQQA 5L30H 1BJVA 1T8OA 4Q7ZA 1HIAA 1EX3A 4X8VH 2F83A 1SPJA 1W11U 1MCTA 2VIVA 1TBRH 4X6MA 1OWEA 1GBBA 1TQ7B 2OD3B 3M61U 3BTHE 2GMTC 2I6QA 2Z3DA 4ZMAH 2WPLS 2BZAA 4B73A 4ZKOU 1MZAA 1V6DA 1O3LA 1YYY1 3ATKA 2JKHA 1Q3XA 2HLCA 1RGQA 5GCHG 1HAYB 3M36A 4ABGA 3ZVCA 7ESTE 1GVZA 3MNSA 4KGAA 2GX4A 2VJ1A 6ESTA 2GDDA 1GHBF 2F3CE 3BEUA 1C5SA 3EA9A 4BXSA 5K0HA 2FX6A 2Y7ZA 3M3SA 4CRFA 1MMJN 2ZIQH 5DP3A 2A7JA 3JZ1B