1K1JA

Bovine trypsin-inhibitor complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Factorising ligand affinity: a combined thermodynamic and crystallographic study of trypsin and thrombin inhibition.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1jA02
1ELFA 1PPFE 3VXEH 3A7VA 1BJUA 3ZV8A 1JIMA 1LHDH 3O8RA 1CT4E 1SGRE 1EJMA 1TALA 2YNAA 2GT7A 1NRSH 5G4BA 1GHVH 4ZKSU 1O3DA 1OP0A 1MKXK 3GY8A 3SNDA 2CJIA 4H42U 2BY9X 2CHAC 1AFEH 1LCYA 1YLDA 2XWBI 3A8DA 1EJNA 4HTCH 1ELVA 5EGMA 4CREA 2ZGCA 4B75A 3LC5A 1AWHB 3MI4A 1DSUA 1GJ5H 2WPJS 8GCHG 4D9RA 1OP8A 1MCVA 1PQ8A 1BMMH 2EA3A 2P95A 2BDIA 1HAHH 1O32A 2A0QB 2GZ8A 1DPOA 2Y5GA 1MD7A 1MTSA 1VGCB 3S9BA 4UD9H 5FPSA 1NM6A 3PWCA 1KXCA 1PJPA 4DW2U 2PKAA 2A31A 1TNJA 1O37A 1SGFA 5HXFA 2VGCC 1ANCA 1HNEE 3EA7A 3BG4C 2ZFPH 2H2ZA 3L6PA 4XE4A 1UMAH 4B71A 1QB6A 1LHCH 4H4FA 3S9CA 1WUNH 3STJA 4QT8C 3BSQA 1ABJH 2RA0A 1P57B 3P70B 1GBAA 1ESTA 3TK6A 3SNCA 1SVPA 1GJ4H 1NY22 2B0FA 1IQGA 5F8XA 4DG4A 3SJIA 1HAOH 1Z8GA 4X8UH 1WQSA 5PTPA 3SU3A 2AIPA 2ZI2H 3A83A 3QTVH 1GHBG 2PSXA 1MBQA 1TA2A 5LH8A 1P11E 1XKAC 1L1GA 1TABE 2VVCA 3MNBA 3CENA 3E90B 2TBSA 3LC3A 3NPSA 3STIA 2P3FH 1O36A 4JZFH 3RM0H 1GGDB 3V12A 4ZKOU 1GBCA 2V3OH 3GICB 2O9QA 5JBBS 5GPIB 1GBTA 2ANKH 3BTQE 1O5AB 1T8OA 4IMZA 3QGJA 5DP4A 1HB0B 4Y6DA 2BD7A 1ZPBA 2J2UA 3LGVA 2H9EH 2HLCA 4ZROA 3M36A 1BDAA 3MH4A 1SFIA 4X8VH 2TGDA 3KQEA 1ZMNA 4IMQA 3KN2A 1BT7A 3RMLH 5GIBA 1T8LA 1NN6A 1SGTA 1GBDA 2BOKA 5ABWA 1LPZB 3ITIA 4OS4A 4CRAA 3SOSA 2WINI 2EEKA 3HATH 2FTMA 4JZ1A 3SO3A 2ZC9H 2GMTC 1MD8A 2ZGXH 3SU5A 1C5WB 4K1SA 3JZ2B 3MH5A 3T25A 1FXYA 1D3QB 3TIUA 1HAYB 5A0BA 1KXEA 3O8CA 2ZQ1A 1ELAA 1GBKA 1CQQA 1YCPM 3EAJA 3PO1C 1GVZA 2FX6A 4FXGH 1KDQA 1EPTC 1Q3XA 2P3UB 1SLVB 2STBE 3RXTA 1NO9H 1LVBA 1UTMA 3QTOH 1EASA 1AKSB 4FUEA 4Q7YA 1XVOA 3UNQA 4KTSA 2WPKS 2XCNA 2VWOA 4UFFH 4TWYA 2C8YB 1GHBF 2ZDNA 3AVZA 3D49H 4MPVA 1QCPA 1MKWH 1FN8A 1SOZA 1O3JA 3URCA 1P2JA 1A0HB 2J4IA 2HNTC 1GI3A 2BLOA 3GDVA 1GHAG 2GTBA 3H7TA 3QWCH 1W8BH 1QFKH 1GDQA 1TOMH 3GY4A 4TY6A 2Y80A 2B5TB 1AFQB 4MNYA 3QUMP 1QL7A 3RXRA 1C2GA 4WH8A 1QQ4A 1P3CA 4NG9H 1C1TA 4I8HA 4O97A 4DURA 5DP5A 2Z3DA 5HM2A 5DP8A 2FS9A 2BLVA 1EQ9A 1J9CH 5A8XA 1B7XB 4F49A 2VVUA 2ZHFH 1GCTC 1QA7A 1C2KA 2SNWA 4XBBA 1NRRH 1VJAU 8ESTE 2F9BH 4NWKA 3A87A 3H7OA 3PMBB 2XNIA 3WY8A 1V2RT 4ABBA 1Y3UA 1BRCE 3M35A 3IWMA 3LKWA 5DKMA 1UTKA 4ISNA 1C9PA 1P09A 4AFSA 5A0CA 1AN1E 1A3BH 4WXVA 3RMOH 4CBNA 4ISOA 2QCYA 3U8TH 1HAZB 1V2UT 3NK8A 1RIWB 3MU0A 1DWEH 4YM9A 4MTBA 2ZP0H 3ZZDA 1BZXE 1EUFA 2J95A 4RSPA 1DITH 2HWLB 2BDBA 5EODA 5AVDA 2UUYA 4GLYA 2D1JA 6LPRA 2BVRH 1FIZA 2BXUH 2CHAB 1MQ6A 1CGJE 2CV3A 3I29A 1T31A 4YT6H 1QY6A 1D9IA 2QF3A 3SU1A 1GHAF 1V3XA 3VB6A 4BAOB 1EZQA 1F5RA 3RXLA 4BANB 2Y5FA 3SU6A 5JBCS 1YCPH 2NU2E 1TONA 4X2VA 1FAXA 5DO4H 4AGKA 5BPEA 3F9GA 3B8JA 4X2WA 2FOCA 1HXEH 4OGXA 3ATMA 3RU4D 2VGCB 3OU0A 3BF6H 1J16A 3P8NA 1W10U 2NU1E 4D7FA 2BD8A 2BX4A 2FLBH 2G55A 5HMAA 1MTVA 1K28D 4I31A 2QXHA 3MU8A 4XBCA 1UTNA 3T5FH 3BTME 1C5TA 4D8NA 3AAUA 1SGCA 5A0AE 3E1XB 1TX6A 2G81E 5L2ZH 4SGAE 3TNSA 1P2KA 2FOHA 1TA6A 1DWDH 4WMEA 3U1IB 3O8BA 2GDEH 3M3SA 1SFQB 1JRTA 4ABIA 2FI5E 3TGKE 1BTZA 1P0SH 1H8IH 3SV2H 1XUFA 2A5IA 1C2IA 1MAXA 3V13A 4KGAA 2ANMH 1V2WT 3ZZ6A 3A85A 5T6GA 1A0JA 1N8OC 3FVFB 2GZ7A 3N7OA 5CHAC 3PYHA 1AUTC 5TJXA 3S9AA 3QLPH 2C93B 1O5FH 1KXAA 2W3IA 1UJ1A 1SPJA 5JB9S 3ZVEA 3DA9B 1S81A 1EB1H 1FI8A 1ZGVA 1ZLRA 1C5SA 1AZZA 1SLXB 1BITA 4THNH 3GY3A 5AF9H 1Z6EA 1NU7B 1QJ7B 3M7UA 1AE8H 2Z9LA 6GCHF 3IG6B 1QR3E 1O5DH 5FPYA 2GMTB 1BTUA 2SNVA 1GBEA 3HGPA 3U98H 4VGCB 1FQ3A 1Z8IB 9LPRA 1F0UA 4JZIA 2ODQA 3RXMA 2A4OA 3PO1B 4CR9A 1G30B 4X1PU 4Q7XA 5AFZH 2FOFA 3TLOA 1BTWA 3RU4T 1O2MA 1EPTB 3PLBA 3U9AH 1UTLM 3UNSA 3UR6A 3PMJA 4NSVA 1FJSA 5CMXH 1TNLA 4AFUA 2I6SA 5EW2H 4I7YH 1P3EA 3ZVBA 3BTDE 3VGCC 3SNEA 4B76A 2R0LA 3PLKA 1VITH 2NU0E 3EQ0H 3RXAA 2G5NA 1XUHA 2GV6A 1C5VA 1CA0B 2CGAA 1OWIA 3Q00A 2FPZA 3SGBE 1DLKB 3TH3H 1ZJDA 1O2YA 4Y0ZE 2ZDAH 4BOHA 5E0JA 1SGIB 5FBEA 3SHCH 2BY7X 4H6SB 3A86A 8KME2 1F2SE 1MZAA 3TITA 1A4WH 3ZZBA 2FX4A 4MNVA 1H9LB 4U01A 2ZFTA 3RMNH 4DIHH 1EXFA 1GBIA 5B6OA 3OY5U 5F8TA 2PKAB 2OQ5A 1V2QT 1EAUA 4ZAEA 1SSXA 1SB1H 5GJ4B 4NIVA 1YPKH 3KNXA 1LTOA 2EI7A 1O2QA 3I77A 2H5DA 2Z9GA 2Z94A 3UUZA 1WTGH 1SL3A 1LDTT 2G4UA 1QBOA 1AB9C 1AY6H 2GV7A 1HJ9A 3O8DA 2R0KA 2W26A 4NCYA 4R8TB 2J94A 1GMCG 5T6FA 4INLA 2HPPH 1RXPA 5ESTE 3LONA 1SGNE 1GHXH 2H6MA 2KAIA 1ANBA 4Y8ZA 1A61H 1SBWA 2ZG0H 1YPLH 5LPFA 1TBRH 5L2YH 2OBOA 1TQ7B 5T3HA 1VZQH 1B5GH 3UFAA 3ZVGA 1BHXB 1KY9A 1GBHA 1C5ZB 3SV9A 1P9UA 1XUGA 3LT3A 1EZXC 2ZTZA 1KLIH 4D76A 4CHAC 3NXPA 3UR9A 1BTHH 3HGNA 5C5OA 1CO7E 1GBMA 1MUEB 1GHYH 1EKBB 4GVUA 5HYOA 1UK4A 1GI2A 3SJOA 3CP7A 1CBWB 5FCRA 5FX5A 4TY7A 3TNTA 1V2ST 1WSSH 1MQ5A 3MWIU 4Q80A 4X1SU 2A1DB 3LJJA 1EAWA 2GD4B 1UO6A 1AI8H 1FY5A 3MH6A 2OCVB 1EZSC 1K1IA 1UK2A 3SI3H 4FUIA 4AFZA 3AW0A 1C1UH 4I32A 1Y59T 1GPZA 1DICA 5BRRE 1A3EH 3G01A 5JBAS 1K1NA 4GHQA 3TGIE 3MO6A 4UFGH 5C1XA 4A1TA 4KTUA 4NIXA 2VWNA 4I8JA 4AOQA 5E2PA 1MBMA 3DHKH 4ABEA 3DFLA 3RXBA 1KDQB 1CHGA 4Q2KA 1P9SA 4Y8XA 4DGJA 2BMGB 1XUKA 1D4PB 3SV6A 3B23B 3UOPA 4NZQA 4HI3A 1KXFA 4B2BA 2OP9A 2AMQA 1GDUA 2QYIA 4KP0A 1C1RA 1F0SA 1C4Y2 4ZKNU 1IHSH 1TYNA 1SHYA 1GI6A 2ZO3H 1IQJA 4MDSA 3ZVDA 2IJOB 1G2MA 3M5LA 1P04A 1O3NA 1FZZA 5ETXA 4DIIH 2ESTE 3F9EA 1O0DH 3E0NB 1BQYA 1UVSH 2P3TB 1QB1A 1HJAB 1N8OB 2AGEX 3PROA 4X8TH 4DT7B 1MH0A 2G5VA 1GI4A 3LGTA 5LPRA 1QGFA 3RLYH 3L3TA 7KMEH 2XC0A 3TK9A 5FAHA 1RRKA 4RKOB 2VB0A 3UOUA 1CE5A 1W7XH 1V6DA 1O3FA 2Y7ZA 3OYPA 4Y79A 3SN8A 2J38A 3ENSB 1KXBA 1E35B 2BD2A 1HBTH 1W14U 5EXMA 4BTUB 1KTTB 1YBWA 3MO3A 2OUAA 4XOJA 4AYVB 1AD8H 4CR5A 1DS2E 4ZHLU 1Y3XA 1UK3A 1E34B 1C1SA 4WH6A 4MPXA 3ZZ4A 1HYLA 1AVGH 1DVAH 2O8WA 2ZGJA 2P59A 3UY9A 4AZ2B 2OD3B 5J4QA 1Y3YA 2ZGHA 4F4OC 4AG1A 2XTTB 4ZMAH 1O2WA 4B2CA 4BAHB 6ESTA 3A7ZA 3QK1A 1TGNA 3NUMA 2O8UA 2IOTA 2CN0H 4E06H 2V0BA 3UPEA 1ARBA 1HRTH 1QL9A 2BTCE 1V2JT 1GI9B 4IC5A 4UEHH 2Z6BD 2QF0A 1P2IA 3ZZAA 5H4IB 4OGYA 1TX7A 2OINA 1ETSH 1ZHMA 4NFFA 4A92A 2ZKSA 1J14A 1PQ7A 1RGQA 2ZU2A 1L0ZA 5CE1A 4KTCA 3RXGA 2Z3EA 4Y76A 1IAUA 1SGDE 2ZDLA 4E7RG 5TCAA 4ZH8A 1S85A 2FWWA 1L1NA 1C2LA 2P8OC 1YLCA 1RTKA 1WTHD 3AAVA 4LOYH 2UUKB 1B0EA 2WV4A 1GG6B 2GGVB 4FU7A 4JZEH 3AASA 3F1SB 4WMDA 1SGFG 2SGAA 1O3IA 7ESTE 2ZHDA 2QXJA 1XM1A 2QN5T 2CF8H 2F9PA 1FIWA 3K65B 3LGYA 3M3VA 2ZDKA 2B9LA 4FUCA 1NZQH 5FX6A 5FPTA 4BTTB 1L1JA 1PPCE 4JZDH 4O03A 3BTEE 1DWBH 1J17T 1C1MA 2ANWA 1DT2A 2W7UA 3EE0B 4MNXA 1ANEA 2QXGA 1N6YA 1QBNA 2A32A 2ZTXA 1TMBH 1UCYH 2BDYA 1PQAA 2BY5X 3KHVA 2R9PA 1S82A 3HPTB 4DY7B 1AVXA 1XUIA 1GMHF 1O3OA 2QA9E 1A0LA 1GJ9B 1YM0A 4FUHA 4FUFA 1ORFA 2FOGA 3A8AA 3B9FH 1DY9A 2RG3A 2Y81A 4X6MA 1KXDA 2HALA 1TPOA 2B8OH 2NU3E 2ZECA 3RXPA 1HV7A 1Y5BT 4WJG2 3SUEA 2JH0D 2GDDA 2K1QA 1GHZA 3HK3B 2AIQA 1GJAB 3GY6A 1UVPA 5EQRA 3PWBA 3D62A 2HNTF 4X6PA 1SC8U 3KGPA 4UONA 1C5OH 2G52A 1WU1A 1F5LA 4OS6A 4YOGA 4X1RU 1OOKB 1O2RA 1QJ6B 1U6QA 2B7DH 1OWJA 3PLPA 1O5CB 4YLUA 2ILNA 4HFPB 5I25A 3SUDA 4I8LA 2GCHF 1Z1IA 2ZTYA 2BVXH 2STAE 2ZHEH 3PTBA 2SGPE 1B0FA 3P6ZB 2ZEBA 2ZWLH 2LNCA 5EQQA 3RUOA 1C2DA 3SUGA 3H5CB 3MNSA 2PR3A 1CT2E 1O3AA 1ELEE 1GI7B 1V2NT 2XCFA 1ZOMA 1O3KA 1C2HA 1YPEH 2BOHB 1QL8A 2A2XH 2F9OA 1LKBA 1BTXA 3RMMH 1ESBA 1FONA 4Z6AH 4BNRA 1CA8B 3SHAH 3JZ1B 4IGDA 1ETRH 5LPEA 3TGJE 2TIOA 1P8VC 3ZVAA 4NFEA 4NIYA 1TGSZ 3EA8A 1YPGH 1MTNC 2BVSH 2WYJA 3BTKE 3RXHA 4YESB 3GDUA 1RTFB 1BHXF 2XW9A 1BA8B 1A5IA 2QV1A 3KEEA 5GDSH 1GHWH 1EOLA 3ATKA 1E36B 2UWLA 1P2MA 1TB6H 1O31A 3OX7U 2VH0A 2PKSC 1K1JA 2C8ZB 3FFGA 1IQIA 2IPHA 1ZTKA 4H6TA 1QNJA 1L2EA 1UVOA 4J2YB 4LK4A 2Y6TA 3BTWE 4A5TS 3LGIA 4O9VA 4FU9A 3SORA 5FXLA 4DVAU 3URDA 1TBZH 1L4ZA 3FP7E 4ZXXH 4Y8YA 2ZCLP 6GCHG 1A5HA 1JMOH 3HK6B 3QX5H 4FU8A 1G9IE 1EX3A 1P10A 3ZZCA 1VCQA 1EP6A 2OC7A 1NPMA 2FYRA 1CGIE 4X6NA 4MNWA 2KAIB 2PWXA 5IDKA 1T8NA 1C1QA 3BG4B 1S0QA 1S6FA 1OS8A 3GYLB 2XWAA 1LVMA 5A8ZA 1FUJA 1O35A 1IQHA 4X6OA 1G3EA 3P8FA 1GL1A 5F03A 1EJAA 3VB3A 1ELGA 3M61U 1SQAA 3ZYEA 4GSOA 1EAIA 1MKWK 4Y7AA 4R0IA 1C5MD 1JIRA 1O3EA 2XBXA 1EATA 2PFEA 3F6UH 1GWAA 1YP9A 2WPLS 4A6LA 2VIOA 3S0NA 4DOQA 3K6YA 3E8LA 1AQ7A 1TNIA 4ABFA 1O3PB 1DY8A 5DG6A 3UQVA 3ZZ8A 3VB7A 4AORA 5FCKA 1ETTH 2ZCHP 3LGUA 5JPMH 4INKA 1XXFA 4NA7A 1NROH 3VPKA 2BY6X 5T6DA 2SFAA 4X8SH 2P94A 2AYWA 1C5PA 1O2XA 1LVYA 4OS5A 4I8KA 1NFWA 1IQLA 1G2LA 1DSTA 1O2OA 1O2KA 2RCEA 4JYTA 1C1NA 4D9QA 2TRMA 3D65E 2BLQA 4HGCA 4ISIH 4ESTE 1AHTH 5EQSA 5F8ZA 1BRBE 1SLWB 2VIVA 1O39A 3SUFA 2FOAA 3TK5A 2G8TA 2PLXA 2FOBA 1HAGE 4WWYA 1V2TT 2R2WU 4B74A 1XUJA 2GKVE 2A2QH 4K8BA 4U30A 1FY4A 1O34A 1G3DA 3SU4A 2HNTE 1Z8JB 1HLTH 3T2NA 5AHGH 3AW1A 1INCA 3DD2H 2C90B 5K7RA 2Q6FA 1FLEE 1C5QA 1CVWH 3NWUA 3GISB 2RDLA 1GVKB 3RC6A 4K69A 2BQ6B 1O2IA 3NKKA 3A88A 2ZU4A 4FUBA 1VGCC 3L33A 2A45B 2ZHWH 4ISLA 3T28A 2CF9H 2OLGA 3ODFA 2Y5HA 4CBOA 1T4VH 3SW2B 2HVXA 1H4WA 4ABDA 2XC4A 1D3PB 1S5SA 1UTPA 2ODPA 1C1VH 3BN9A 7GCHG 2OC1A 2BDAA 2V3HH 1YCPK 1C1OA 3GCHC 2XC5A 2A5KA 1ZMJA 1GJ8B 1ANDA 4IC6A 1PPHE 4MG3A 1T8MA 4TWWA 4WVPE 5L30H 1G3BA 2WUBA 1WV7H 2TPIZ 2R3UA 2ZPSA 1MMJN 2F9UA 3UIRA 1VITG 4JYUH 2SGQE 4O3UA 4ZUHA 2FI4E 2Y7XA 2V6NA 3F9FA 1Q31A 3KF2A 1NFYA 3MNCA 1LO6A 4JK5A 2A4GA 1TNGA 1GBBA 1A5GH 1YC0A 4MVNA 4WXIA 5DP7A 2Z9KA 3SQEE 2D26C 2VH6A 3U8RH 2CMYA 1ZRKA 4RKJB 3A8BA 3ATLA 4X2XA 1GGDC 4I8GA 1BBRH 1UTJA 1UCYE 1IQFA 1GCTB 4YTAA 2V35A 4XSKU 2OQUA 5FBIA 4CRBA 3S69A 4YZUA 1C1PA 2ZU1A 2PV9B 2PHBA 3GCTG 1VJ9U 2ZPRA 3HKIB 1MTNB 2WYGA 1O2ZA 3BV9B 1NTPA 1MKXH 3A89A 1P2QA 1OKXA 1QRZA 3ZV9A 3TH2H 2J92A 4ASHA 3RXQA 1WQVH 1GJ7B 2BDGA 3T26A 1QIXB 1S0RA 1T32A 2OXSA 2C8XB 3CS7A 3SGAE 3FP6E 1UHBA 2ZHQH 3RU4E 1SGEE 2PKSB 1LHFH 1RTLA 7GCHF 1QBVH 1O33A 3KIDU 3VFEA 1BB0B 2ZU3A 2PTCE 1QTFA 1GJBB 1IOEA 1ELCA 1O5BB 1ZSLA 3BEUA 3K6ZA 4O3TA 1BRUP 3W95A 1JWTA 3LGWA 3BTHE 4KKDA 1FY1A 5DK1A 1VITF 1TGCA 1WOFA 1FY8E 4U32A 4BXWA 3TJUA 1P12E 1IQMA 1O2PA 1THRH 1V2VT 2YNBA 1OYQA 3GDSA 1K9OE 1TWXB 3BIUH 2UUFB 4Z0KA 3KQBA 1GVLA 5C1UA 4ZHMU 3V7TA 2OC0A 3LJOA 2BD4A 2F9VA 3ATIA 3EDXB 1C1WH 1WBGB 2QC2A 2JH5D 1HAVA 3DFJA 3CS0A 2I6QA 1NFUA 1PQ5A 2Z9IA 4AGJA 1XXDA 1QRXA 2JH6D 2FOEA 3SBKA 1YPMH 3GCTF 1HJ8A 1O2UA 2FLRH 2Z7FE 3SNBA 1NFXA 3KQDA 3MH7A 4X0WU 5ESBA 3FZZA 2G4TA 1GI0A 2LPRA 4AX9H 4U2WA 1MTUA 2ZPQA 1ZHRA 4Y7BA 3ZZ9A 5A09A 4ZXYH 1F0TA 6CHAC 1LVOA 4MLFB 3SGQE 4OS1A 4K1TA 3MMGA 2GZ9A 3OSYA 1AIXH 5CHAB 1O5GH 3F68H 3UWIA 2A4RA 1DM4B 4LZ4B 2FTLE 1OWEA 1TRYA 1TMTH 2GCTC 1Z8RA 3GOVB 1O3GA 3ZZ5A 2D8WA 2BHGA 3A84A 1F92A 1VR1H 5C67A 4LZ1H 1RIWC 2ZZUH 1KSNA 3MYWA 1SOTA 3QO6A 2C4FH 3Q3YA 1O3HA 3MTYA 5GXPA 2IN2A 4NSYA 1QB9A 1IQNA 1EB2A 4J1YA 2ZFSA 3QZRA 5EW1H 3MNXA 2AFQB 1GDNA 2Q6DA 1SG8B 3P92A 8LPRA 4GAWA 1BMLA 1P02A 2G00A 5GWZA 4NWLA 2AMPA 3GCNA 3FAOA 5EPNA 3VXFH 1GMHG 2A7HA 1GBFA 2SGEE 2PUQH 4Y11E 1V2LT 2SGDE 2YOLA 2CXVA 1Z71A 1DXWA 5A8YA 3BEIB 1J8AA 3RXJA 3VGCB 2PUXB 3Q76A 2FO9A 4UFEH 3BTTE 2FIRH 2VIWA 1GMDF 3GCHB 4WMFA 1O2TA 4NA9H 1RJXB 3A7TA 5GCHF 5L6NH 2JKHA 3K2UA 4CRFA 3MHWU 3EA9A 1DX5M 1TGBA 3P17H 1JBUH 1SLUB 1UVUH 4CRDA 4IBLH 2ZFQH 4E05H 2H9HA 3MOCA 1F7ZA 1ZSKA 2ANYA 5JDUB 1S6HA 2XBYA 1PPZA 1OXGA 3D23A 3V0XA 1TLDA 4CH8B 3ESTA 2GCHG 3E6PH 3RXFA 1ZTJA 1BOQA 4XBDA 1QURH 5DGJA 1KLTA 2OTVA 1O2HA 1ZZZA 3M3TA 3M7TA 3ODDA 3MO9A 1HIAA 1NT1A 2DUCA 1W11U 4TPIZ 3SNAA 1A1RA 4FUGA 2NWNA 1PPBH 1YKTA 2F9NA 1SGYE 1G32B 5C5NA 1KTSB 2BYAX 3I78A 5DP9A 1CHOG 3SV8A 4TYDA 1QQUA 3UTUH 1ELBA 4GPGA 3ATWA 1K1PA 4WY3A 3U1JB 1AB9B 1G36A 2HGTH 3RXCA 2VWMA 1W7GH 1Z7KA 2ZIQH 3DUXH 1O2VA 5J4SA 1Y5UT 1XKBC 1P2OA 2VINA 5C20A 1TE0A 2BDHA 2WV5A 3KCGH 8GCHF 4Y0YE 2BZAA 2VNTA 5E2OA 5JBTA 9ESTA 1OSSA 2Z3CA 1FPHH 3NCLA 2XXLA 1LQDB 4K3JA 3A7WA 2HOBA 3NZIA 4FVDA 3TJVA 1TRNA 1Y3VA 4K60A 5JB8S 3UNRA 2WPMS 3TJNA 2VIQA 3BTFE 3OTJE 1N6XA 1TNHA 3PTNA 1FN6A 1A2CH 1TPPA 1O3BA 3M7QA 4KELA 4CHAB 1F0RA 4VGCC 3QZQA 1YPHE 1AO5A 4AG2A 2PGQB 1OWKA 3M5MA 2G51A 3SJKA 1VCWA 1O3CA 1QHRB 5F6MA 1AE5A 1HAIH 2D2DA 4FVBA 1SI5H 1KYNA 3RM2H 3RP2A 2BXTH 1DANH 1C5NH 1GJDB 1MAYA 4IN1A 4A7IB 3R3GB 1YF4A 1W12U 3SV7A 1HAPH 1H1BA 1HUTH 1FV9A 2W3KA 1FY3A 1C5YB 1NESE 1K22H 1ESAA 1BBRE 1OX1A 2QY0B 1KIGH 1OPHB 2UWOA 2QIQA 2RA3A 1V2MT 1C9TA 2J9NA 2ZFFH 1AWFH 3BG8A 1CA0C 4MPUA 3C1KA 1DUEA 1MCTA 1K21H 3RXDA 3RXKA 2Q1JA 1K1OA 2M5TA 2O8TA 4AFQA 1PPEE 3PMAB 4JK6A 1CHOF 1DE7H 4AN7A 3GYMA 4BTIB 3BEFB 1O2GH 1TAWA 3BTGE 1A46H 1C5RA 1ZPCA 2BDCA 1O3MA 2F83A 1N1LA 2VU8E 3ZYDA 2VIDA 2NU4E 5K0HA 3W94A 1KLJH 1C2EA 1DOJA 3R0FA 2FMJA 2J34A 3E16B 3E0PB 2BX3A 2BD3A 4AB9A 4GUXA 4NA8A 1GBJA 2XRCA 6CHAB 3RDZA 4NGAH 3LH3A 4FUDA 5LGOA 1Y5AT 3T29A 1EP5A 2SGFE 4A1XA 1TGTA 3P95A 2FDAA 3RLWH 2GVFA 1K1LA 4CRCA 1GI5A 1ELDE 3KQCA 1C5UA 2WPHS 2GCTB 1P03A 5TCCA 3A7XA 1LQEA 2UWPA 3PM3A 5C3NA 2EC9H 1OWDA 3RXSA 1WYKA 2FM2A 3GY7A 4TPYA 1BTYA 3A7YA 1V2OT 1H9IE 3RXEA 1C5LH 4CRGA 1O2JA 1O2LA 2VIPA 1UCYK 1ZTLA 2ZA5A 2FEQH 1TPSA 2ULLA 2AGGX 2JETC 2ZCKP 1IQEA 2AERH 2WUCA 3KL6A 3GY5A 1O3LA 1ZR0A 4BAKB 1O38A 2O8MA 4LXBH 1WAYB 3LDXH 1D6WA 1DUAA 1DWCH 5IYTA 1ID5H 1CBWC 4X2YA 1EZUC 5AFYH 5EXLA 4CH2B 2H9TH 3PMHB 1C2JA 3LH1A 3RXIA 1LHGH 2ZDVH 2AS9A 1TMUH 2BD9A 1FNIA 5EOKA 1DFPA 5JYIA 1JRSA 1G3CA 2EI8A 1TRMA 3UQOA 1UHBB 4DCDA 2TGPZ 4BAQB 1GJ6A 4YO9A 1XMNB 4YOIA 1QJ1B 1ELTA 3T62A 1OWHA 5C1YA 1SMFE 1HXFH 3P8GA 5I46H 4K1EA 1W0ZU 1DXPA 1NU9A 3F9HA 1BCUH 1SGQE 2BQWB 1ZGIA 4ZKRU 2FP7B 1MU8B 1AGJA 3OY6U 1SGPE 1BMNH 1DDJA 3E3TA 1TPAE 1D6RA 1C4V2 3MU5A 5C2ZA 3ZVCA 1ABIH 1VCPA 1OYTH 4A1VA 2P8OB 3SJ9A 2BM2A 4DJZB 1ZYOA 5HGGA 1YYY1 1Z1JA 1YGCH 2QGRA 2R3YA 4JYVH 4ZHAA 1GI8B 1FDPA 3A81A 2Z9JA 5DJ7A 1AMHA 3LIWA 4YLQH 2BLWA 1JXPA 2XBVA 2ODYB 4X1QU 1SHHB 3RXVA 2FXRA 1GBLA 1ZPZA 1MZDA 2PGBB 1GJCB 2UUJB 4OS7A 4GCHG 4X1NU 1PPGE 2VJ1A 2AH4X 2XBWA 3Q3XA 1RS0A 1EAXA 2AGIX 4ABGA 1HAVB 1HJAC 2W7SA 1AKSA 1WCZA 3M5NA 1ARCA 2F91A 4XFQA 3A80A 1P2NA 4INHA 1LPGB 2FYQA 2BZ6H 1E38B 3A8CA 1JOUB 2BB4A 3Q77A 4ABJA 3FP8E 3MFJA 3VB4A 2EI6A 2ALPA 1C2FA 3TJOA 1GCDA 4OS2A 1YPJH 2GT8A 1HDTH 3P8OA 1CT0E 3SQHE 2H5CA 2A7CA 3SU2A 1Y3WA 1QA0A 3ELAH 1Y8TA 1TOCB 1O30A 4AB8A 4JMYA 4K5ZA 1W0YH 1SQTA 1P05A 1CU1A 2FZZA 4YT7H 3HKJB 2VWLA 1NS3A 1TIOA 3ZZ3A 1O2SA 1LKAA 4RN6A 4GHTA 1Q2WA 1THSH 3RXUA 4FUJA 1IHTH 3M37A 1LMWB 3IITA 4IW4E 3TH4H 5A2MH 3M5OA 2A4QA 3LOXA 1D3TB 3ZVFA 1FPCH 3K9XB 5E0HA 1BIOA 1XX9A 1THPB 2WPIS 2ZF0H 2P93A 4K2YA 4BXSA 4MPWA 2HPQH 2THFB 1S84A 2OBQA 4AYYB 1P01A 4GCHF 2FODA 2BQ7B 3UREA 4ISHH 3TVJB 4NIWA 3SU0A 3PV4A 3LU9B 2ZU5A 1W3CA 2ASUB 5E8EH 3T27A 1NC6A 3GCOA 5SGAE 2GP9B 4JCNA 3FANA 4Y71A 4M7GA 4I33A 4K8YA 1ZJKA 2PSYA 3EGKH 1GL0E 3LPRA 1T4UH 1GG6C 1IQKA 1ZHPA 1SR5C 2C8WB 3U69H 3U8OH 1BJVA 1C2MA 2R2MB 2ZDMA 4YOJA 1XVMA 4ABHA 2O8LA 3A82A 1NRNH 2TGTA 4IS5A 1AUJA 2FESH 4D7GA 2FOMB 1TQ0B 5DP3A 3GY2A 2GX4A 2AEIH 4XDEA 1ZSJA 5EG4A 1TX8A 1SQOA 2DE9A 2H1UA 1UTQA 1O2NA 4NZLA 3TPIZ 3RXOA 3MU1A 2P16A 3C27B 5DP6A 2W5EA 1LHEH 1BRAA 3BIVH 2ZGBH 2VVVA 5E0GA 2BD5A 2QAAA 1PFXC 3QN7A 1HIAB 1BUIA 2ZQ2A 4SGBE 1ACBE 1V2KT 1W13U 3SZNA 5EPYA 1M9UA 2ALVA 3ZZ7A 1ZRBA 1L4DA 4BAMB 4B73A 5EXNA 2JETB 1BTPA 1O5EH 4Q7ZA 2PTNA 1RFNA 1F5KU 1OP2A 2Y82A 4MQAA 1D3DB 1C4U2 3S7HB 1NRPH 7LPRA 2FS8A 5FHTA 2QXIA 1GI1A 1T7CA 3MU4A 1G37A 4B2AA 1X7AC 2PW8H 4UDWH 5HM9A 3SI4H 4IN2A 3RC5A 4PROA 4Y10E 3QDZB 1FMGA 3E91A 1K2I1 2Q6GA 1TBQH 1AFQC 1HPGA 1MU6B 1FAKH 2ZFRH 1CSOE 1UVTH 2ZNKH 3PB1E 1NRQH 1E37B 1H8DH 1A7SA 1HGTH 3VB5A 5DPAA 1MTWA 1CGHA 1C5XB 1YPHC 1J15A 4HZHA 2XYAA 1UTOA 3TU7H 1GMDG 3RC4A 1E0FD 1DLEA 1PYTD 4UFDH 2BY8X 5GCHG 1TFXA 2A5AA 3S7KB 1ZMLA 1S83A 3Q3KA 2TGAA 5EU8A 2AMDA 1AU8A 1PYTC 4B1TA 3FZDA 1HAXB 1H9HE 1HCGA 1AVWA 3EYDA 3DT0H 1GMCF 1HFDA 2FI3E 1LPKB 1K1MA 1RD3B 1QRWA 3SJ8A 1W2KH 4WF8A 1BBRK 1EOJA 1Z6JH 1TNKA 4ABAA 2HRVA 2F3CE 1V2PT 2DE8A 3UWJH 4E7NA 1AZ8A 2OC8A 4UE7H 2C3SA 3QGNB 1EPTA 2A7JA 3VEQB 1P06A 3V3MA 1BMAA
chains in the Genus database with same CATH superfamily
1ELFA 1PPFE 3VXEH 3A7VA 1BJUA 3ZV8A 1JIMA 1LHDH 3O8RA 1CT4E 1SGRE 1FX0B 1EJMA 1TALA 2YNAA 2GT7A 1NRSH 5G4BA 1GHVH 4ZKSU 1O3DA 1OP0A 1MKXK 3GY8A 3SNDA 2CJIA 4H42U 2BY9X 2CHAC 1AFEH 1LCYA 1YLDA 2XWBI 3A8DA 1EJNA 4HTCH 1ELVA 5EGMA 4CREA 2ZGCA 2V3MA 3LC5A 4B75A 1AWHB 3MI4A 1DSUA 1GJ5H 2WPJS 8GCHG 4D9RA 1OP8A 1MCVA 3KYGA 1PQ8A 1BMMH 2EA3A 2P95A 2BDIA 1HAHH 1O32A 2A0QB 2GZ8A 1DPOA 2Y5GA 1MD7A 1MTSA 1VGCB 3S9BA 4UD9H 5FPSA 2KM0A 1NM6A 3PWCA 1KXCA 1PJPA 4DW2U 2PKAA 2A31A 1TNJA 1O37A 1SGFA 5HXFA 2VGCC 1ANCA 1HNEE 3EA7A 3BG4C 2ZFPH 2H2ZA 3L6PA 4XE4A 4B6EA 1UMAH 4B71A 1QB6A 1LHCH 4H4FA 3S9CA 1WUNH 1YLNA 3STJA 4QT8C 3BSQA 1ABJH 2RA0A 1P57B 3P70B 1GBAA 1ESTA 3TK6A 3SNCA 1SVPA 1GJ4H 1NY22 2B0FA 1IQGA 5F8XA 4DG4A 3SJIA 1HAOH 1Z8GA 4X8UH 1WQSA 5PTPA 3SU3A 2AIPA 2ZI2H 3A83A 4M9FA 2WPDD 1GHBG 3QTVH 2PSXA 1MBQA 1TA2A 5LH8A 1P11E 1XKAC 1L1GA 1TABE 2VVCA 3MNBA 3CENA 3E90B 2TBSA 3LC3A 3NPSA 3STIA 2P3FH 1O36A 4JZFH 3RM0H 1GGDB 3V12A 4TT3D 4ZKOU 1GBCA 2V3OH 3GICB 2O9QA 5JBBS 5GPIB 1GBTA 2ANKH 3BTQE 1O5AB 1T8OA 4IMZA 2J5UA 3QGJA 5DP4A 1HB0B 4Y6DA 2BD7A 1ZPBA 2J2UA 3LGVA 2H9EH 2HLCA 4ZROA 3M36A 1BDAA 2IPQX 3MH4A 1SFIA 4X8VH 2TGDA 3KQEA 1ZMNA 4IMQA 3KN2A 1BT7A 3RMLH 5GIBA 1T8LA 1NN6A 1SGTA 1GBDA 2BOKA 5ABWA 1LPZB 3ITIA 4OS4A 4CRAA 3SOSA 2WINI 2EEKA 3HATH 2FTMA 3EE7A 4JZ1A 3SO3A 2ZC9H 2GMTC 1MD8A 2ZGXH 3SU5A 1C5WB 4K1SA 3JZ2B 3MH5A 3T25A 1FXYA 1D3QB 3TIUA 1HAYB 5A0BA 1KXEA 3O8CA 2ZQ1A 1ELAA 1GBKA 1CQQA 1YCPM 3EAJA 3PO1C 1GVZA 2FX6A 4FXGH 1KDQA 1EPTC 1Q3XA 2P3UB 1SLVB 2STBE 3RXTA 1NO9H 1LVBA 1UTMA 3QTOH 1EASA 1AKSB 4FUEA 4Q7YA 1XVOA 3UNQA 4KTSA 2WPKS 2XCNA 2VWOA 2WZQA 4UFFH 4TWYA 3F2FA 2C8YB 1GHBF 2EY4C 2ZDNA 3AVZA 3D49H 4MPVA 1QCPA 1MKWH 1FN8A 1SOZA 1O3JA 3URCA 1P2JA 1A0HB 2J4IA 2HNTC 1GI3A 2BLOA 3GDVA 3OTPA 2KCPA 1GHAG 2GTBA 3H7TA 3QWCH 2HVYB 1W8BH 1QFKH 1GDQA 1TOMH 2V7QD 3GY4A 2Y80A 2B5TB 4TY6A 1OHHD 1AFQB 4MNYA 3QUMP 1QL7A 3RXRA 1C2GA 4WH8A 1QQ4A 1P3CA 4NG9H 1C1TA 4I8HA 3FKSD 4O97A 4DURA 5DP5A 2Z3DA 5HM2A 5DP8A 2FS9A 2KR7A 2BLVA 1EQ9A 1J9CH 5A8XA 1B7XB 3F2HA 4F49A 3DCLA 2VVUA 2ZHFH 1GCTC 1QA7A 1C2KA 2SNWA 4XBBA 1NRRH 1VJAU 2L74A 8ESTE 2F9BH 4NWKA 3A87A 3H7OA 3PMBB 2XNIA 3WY8A 1V2RT 4ABBA 1Y3UA 1BRCE 3M35A 3IWMA 3LKWA 5DKMA 1UTKA 4ISNA 1C9PA 1P09A 4AFSA 5HKKD 4RT0A 5A0CA 1AN1E 1A3BH 4WXVA 3RMOH 4CBNA 4ISOA 2QCYA 3U8TH 1HAZB 1V2UT 3NK8A 1RIWB 3MU0A 1DWEH 4YM9A 4MTBA 2ZP0H 3ZZDA 1BZXE 1EUFA 2J95A 4RSPA 1DITH 2HWLB 2BDBA 5EODA 5AVDA 4OM9A 2UUYA 4GLYA 2D1JA 6LPRA 2BVRH 1FIZA 2BXUH 2CHAB 1MQ6A 1CGJE 2CV3A 3I29A 1T31A 4YXWD 4YT6H 1QY6A 1D9IA 2QF3A 3OEED 3PV2A 3SU1A 1GHAF 1V3XA 3VB6A 4BAOB 1EZQA 1F5RA 3RXLA 2JDID 4BANB 2Y5FA 3SU6A 5JBCS 1YCPH 2NU2E 1TONA 4X2VA 1FAXA 5DO4H 4AGKA 5BPEA 3F9GA 1H8ED 3B8JA 2FOCA 4X2WA 1HXEH 4OGXA 3ATMA 3RU4D 2VGCB 3OU0A 3BF6H 1J16A 3P8NA 1W10U 2NU1E 4D7FA 2BD8A 2BX4A 2FLBH 2G55A 5HMAA 1MTVA 2RFKC 1K28D 4I31A 2QXHA 3MU8A 4XBCA 1UTNA 3T5FH 3BTME 1YY3A 1C5TA 4D8NA 3AAUA 1SGCA 5A0AE 3E1XB 1TX6A 2G81E 5L2ZH 4SGAE 3TNSA 1P2KA 2FOHA 1TA6A 1DWDH 4WMEA 3U1IB 3O8BA 2GDEH 3M3SA 1SFQB 1JRTA 4ABIA 2FI5E 3TGKE 1BTZA 1P0SH 1H8IH 3SV2H 1XUFA 2A5IA 1C2IA 1MAXA 3V13A 4KGAA 2ANMH 1V2WT 3ZZ6A 3A85A 5T6GA 1A0JA 1N8OC 3FVFB 2GZ7A 3N7OA 5CHAC 3PYHA 1AUTC 5TJXA 3S9AA 3QLPH 2C93B 1O5FH 1KXAA 2W3IA 3PRDA 1UJ1A 1SPJA 3DSOA 5JB9S 3ZVEA 3DA9B 1S81A 1EB1H 1FI8A 1ZGVA 1ZLRA 1C5SA 1AZZA 1SLXB 1BITA 4THNH 3GY3A 5AF9H 1Z6EA 1NU7B 1QJ7B 3M7UA 1AE8H 2Z9LA 6GCHF 3IG6B 1QR3E 1O5DH 5FPYA 2GMTB 1BTUA 2SNVA 1GBEA 3HGPA 3U98H 4VGCB 1FQ3A 1Z8IB 9LPRA 1F0UA 4JZIA 2ODQA 3RXMA 2A4OA 3PO1B 4CR9A 1G30B 4X1PU 4Q7XA 5AFZH 2FOFA 3TLOA 1BTWA 3RU4T 2KCYA 1O2MA 1EPTB 3PLBA 3U9AH 1UTLM 3UNSA 3UR6A 3PMJA 4NSVA 2M2AA 1FJSA 5CMXH 1TNLA 4AFUA 2I6SA 5EW2H 4I7YH 1P3EA 3ZVBA 3BTDE 3VGCC 3SNEA 4B76A 2R0LA 3PLKA 1VITH 2NU0E 3EQ0H 3RXAA 2G5NA 1XUHA 2GV6A 1C5VA 1CA0B 2CGAA 1OWIA 3Q00A 2FPZA 3SGBE 1DLKB 3TH3H 1ZJDA 1O2YA 4Y0ZE 2ZDAH 4BOHA 5E0JA 1SGIB 1NBME 5FBEA 3SHCH 2BY7X 4H6SB 2IJD1 3A86A 8KME2 1F2SE 1MZAA 2J98B 3TITA 1A4WH 3ZZBA 2FX4A 3F0OA 4MNVA 1H9LB 4U01A 2ZFTA 3RMNH 5EJ1A 4DIHH 1EXFA 1GBIA 5B6OA 3OY5U 5F8TA 2PKAB 2OQ5A 1V2QT 1EAUA 4ZAEA 1SSXA 1SB1H 5GJ4B 4NIVA 1YPKH 1K0HA 3KNXA 3SYJA 1LTOA 2EI7A 1O2QA 3MQKC 2YMSD 3I77A 2H5DA 2Z9GA 2Z94A 3UUZA 1WTGH 1SL3A 1LDTT 2YMSC 2G4UA 1QBOA 1AB9C 1AY6H 2GV7A 1HJ9A 3O8DA 2R0KA 2W26A 4NCYA 4R8TB 2J94A 1GMCG 1MABB 5T6FA 4INLA 2HPPH 1RXPA 5ESTE 3LONA 1SGNE 1GHXH 2H6MA 2KAIA 1ANBA 4Y8ZA 1A61H 1SBWA 2ZG0H 1YPLH 3WWFA 5LPFA 1TBRH 5L2YH 2OBOA 1TQ7B 2KX4A 5T3HA 1VZQH 1B5GH 3UFAA 3ZVGA 1BHXB 1KY9A 1GBHA 1C5ZB 3SV9A 1P9UA 5C17A 1XUGA 3LT3A 1EZXC 4XD7D 2ZTZA 1KLIH 4D76A 2F43B 4CHAC 3NXPA 3UR9A 1BTHH 3HGNA 5C5OA 1CO7E 1GBMA 1MUEB 2KZ4A 1GHYH 1EKBB 4GVUA 5HYOA 1UK4A 1GI2A 3SJOA 3CP7A 1CBWB 5FCRA 5FX5A 4TY7A 3TNTA 1V2ST 1WSSH 1MQ5A 3MWIU 4Q80A 1E1RD 4X1SU 2A1DB 3LJJA 1EAWA 2GD4B 4RT1A 1UO6A 1AI8H 1FY5A 3MH6A 2OCVB 1EZSC 1K1IA 1UK2A 5FL7D 3SI3H 4FUIA 4AFZA 3AW0A 1C1UH 4I32A 1Y59T 1GPZA 1DICA 5BRRE 1A3EH 3G01A 5JBAS 1K1NA 1EFRD 4GHQA 3MO6A 4UFGH 3TGIE 5C1XA 4A1TA 4KTUA 4NIXA 2VWNA 4I8JA 4AOQA 5E2PA 1MBMA 3DHKH 4ABEA 3DFLA 3RXBA 1KDQB 1CHGA 2W6JD 4Q2KA 1P9SA 4Y8XA 4DGJA 2BMGB 1XUKA 1D4PB 3SV6A 3B23B 3UOPA 4NZQA 4HI3A 1KXFA 4B2BA 2OP9A 2AMQA 1GDUA 2QYIA 4KP0A 1C1RA 1F0SA 1C4Y2 4ZKNU 1IHSH 1TYNA 1SHYA 1GI6A 2ZO3H 1IQJA 4MDSA 3ZVDA 2IJOB 1G2MA 3M5LA 1P04A 1O3NA 1FZZA 5ETXA 4DIIH 2ESTE 3F9EA 1O0DH 3E0NB 1BQYA 1UVSH 2P3TB 1QB1A 2OK5A 1HJAB 1N8OB 2AGEX 3PROA 4X8TH 4DT7B 1MH0A 2G5VA 1GI4A 3LGTA 5LPRA 1QGFA 3RLYH 3KQ5A 3L3TA 7KMEH 2XC0A 3TK9A 5FAHA 1RRKA 4RKOB 2VB0A 3UOUA 1CE5A 1W7XH 1V6DA 1O3FA 2Y7ZA 3OYPA 4Y79A 3SN8A 2J38A 3ENSB 1KXBA 1E35B 2BD2A 1HBTH 1W14U 5EXMA 4BTUB 1KTTB 1YBWA 3MO3A 2OUAA 4XOJA 4AYVB 1AD8H 4CR5A 2J98A 1DS2E 4ZHLU 1Y3XA 1UK3A 1E34B 1C1SA 4WH6A 4MPXA 3DSGA 3ZZ4A 1HYLA 1AVGH 1DVAH 2O8WA 2ZGJA 2P59A 2XNDD 3UY9A 4AZ2B 2OD3B 5J4QA 1Y3YA 2ZGHA 4F4OC 4AG1A 2XTTB 5HIZA 4ZMAH 1O2WA 4B2CA 4BAHB 6ESTA 3A7ZA 3QK1A 1TGNA 3NUMA 2O8UA 2IOTA 2CN0H 4E06H 5HIYA 2V0BA 3UPEA 1ARBA 1HRTH 1QL9A 2BTCE 1V2JT 1GI9B 4IC5A 4UEHH 2Z6BD 2QF0A 1P2IA 3ZZAA 5H4IB 4OGYA 1TX7A 3UAIC 2OINA 1ETSH 1ZHMA 4NFFA 4A92A 2ZKSA 1WXRA 1J14A 1PQ7A 1RGQA 2ZU2A 1L0ZA 5CE1A 4KTCA 3RXGA 2Z3EA 4Q4LA 4Y76A 1IAUA 1SGDE 2ZDLA 4E7RG 5TCAA 4ZH8A 1S85A 2FWWA 1L1NA 1C2LA 2P8OC 1YLCA 1RTKA 1WTHD 3AAVA 4LOYH 2UUKB 1B0EA 5B6LA 2WV4A 2AHME 4ACAA 1GG6B 2GGVB 4FU7A 4JZEH 3AASA 3F1SB 4WMDA 1SGFG 2SGAA 1O3IA 7ESTE 2ZHDA 2QXJA 1XM1A 2QN5T 2CF8H 2F9PA 1FIWA 3K65B 3LGYA 3M3VA 2ZDKA 2B9LA 4FUCA 1NZQH 5FX6A 5FPTA 4BTTB 1L1JA 4Q63A 1PPCE 4JZDH 4O03A 3BTEE 1DWBH 1J17T 2YMSB 1C1MA 2ANWA 1DT2A 2W7UA 3EE0B 4MNXA 1ANEA 2QXGA 1N6YA 1QBNA 2A32A 2ZTXA 1TMBH 1UCYH 2BDYA 1PQAA 2BY5X 3KHVA 2R9PA 1S82A 3HPTB 4DY7B 1AVXA 1XUIA 1GMHF 1O3OA 2QA9E 1A0LA 1GJ9B 1YM0A 4FUHA 4FUFA 1ORFA 2FOGA 3A8AA 3B9FH 1UW7A 1DY9A 2RG3A 2Y81A 4X6MA 1KXDA 2HALA 1TPOA 2B8OH 2NU3E 2ZECA 3RXPA 1HV7A 1Y5BT 4WJG2 3SUEA 2JH0D 5C94A 2GDDA 2K1QA 1GHZA 3HK3B 2AIQA 1GJAB 3GY6A 1UVPA 5EQRA 3PWBA 3D62A 2HNTF 4X6PA 1SC8U 3KGPA 4UONA 1C5OH 2G52A 1WU1A 1F5LA 3N7DA 4OS6A 4YOGA 5C0TA 4X1RU 3F3BA 1OOKB 1O2RA 1QJ6B 2CK3D 1U6QA 2LP6A 2B7DH 1OWJA 3PLPA 1O5CB 4YLUA 2ILNA 4HFPB 5I25A 3SUDA 4I8LA 2GCHF 1Z1IA 2ZTYA 3U28C 2BVXH 2STAE 2ZHEH 3PTBA 2SGPE 2QF5A 1B0FA 3PRBA 3P6ZB 2ZEBA 2ZWLH 1COWD 2LNCA 5EQQA 3RUOA 1C2DA 3SUGA 3H5CB 3MNSA 2PR3A 3GS9A 1CT2E 1O3AA 1ELEE 1GI7B 1V2NT 2XCFA 1ZOMA 1O3KA 1C2HA 1YPEH 2BOHB 1QL8A 2A2XH 2F9OA 3W1EA 1LKBA 1BTXA 3RMMH 1ESBA 1FONA 4Z6AH 4BNRA 4FOUC 1CA8B 3SHAH 3JZ1B 4IGDA 1ETRH 5LPEA 2QE7D 3TGJE 2TIOA 1P8VC 3ZVAA 4NFEA 4NIYA 1TGSZ 3EA8A 1YPGH 1MTNC 2BVSH 2WYJA 3BTKE 3RXHA 2HLDD 4YESB 3GDUA 1RTFB 1BHXF 2XW9A 1BA8B 1A5IA 2QV1A 3KEEA 5GDSH 1GHWH 1EOLA 3ATKA 1E36B 2UWLA 1P2MA 1TB6H 1O31A 3OX7U 2VH0A 2PKSC 1K1JA 2C8ZB 3FFGA 1IQIA 2IPHA 1ZTKA 4H6TA 1QNJA 1L2EA 1UVOA 4J2YB 4LK4A 2Y6TA 3BTWE 4A5TS 3LGIA 4O9VA 4FU9A 3SORA 5FXLA 4DVAU 3URDA 1TBZH 1L4ZA 3FP7E 4ZXXH 4Y8YA 2ZCLP 6GCHG 1A5HA 1JMOH 3HK6B 3QX5H 4FU8A 1G9IE 1EX3A 2L6OA 1P10A 3ZZCA 1VCQA 1EP6A 2OC7A 1NPMA 2FYRA 1CGIE 4X6NA 4MNWA 2KAIB 2PWXA 5IDKA 1T8NA 1C1QA 3BG4B 1S0QA 1S6FA 1OS8A 3GYLB 2XWAA 1LVMA 5A8ZA 1FUJA 1O35A 1IQHA 4X6OA 1G3EA 3F2GA 3P8FA 1GL1A 5F03A 1EJAA 3VB3A 1ELGA 3M61U 1SQAA 3ZYEA 3WWBA 4GSOA 1EAIA 1MKWK 4Y7AA 4R0IA 4XRNA 1C5MD 1JIRA 1O3EA 2XBXA 1EATA 2PFEA 3F6UH 1GWAA 1YP9A 2QF4A 2WPLS 4A6LA 2VIOA 3S0NA 4DOQA 3K6YA 3E8LA 1AQ7A 1TNIA 4ABFA 1O3PB 1DY8A 5DG6A 3UQVA 3ZZ8A 3VB7A 4AORA 5FCKA 1ETTH 2ZCHP 3LGUA 5JPMH 4INKA 1XXFA 4NA7A 1NROH 3VPKA 2BY6X 1BMFD 5T6DA 2SFAA 4X8SH 2P94A 2AYWA 1C5PA 1O2XA 1LVYA 4OS5A 4I8KA 1NFWA 1IQLA 1G2LA 1DSTA 1O2OA 1O2KA 2RCEA 3FOAA 1C1NA 4JYTA 2EQNA 4D9QA 2TRMA 3D65E 2BLQA 4HGCA 4ISIH 4ESTE 1AHTH 5EQSA 5F8ZA 1BRBE 1SLWB 2VIVA 1O39A 3SUFA 2FOAA 3TK5A 2G8TA 2PLXA 2FOBA 1HAGE 3OEHD 4WWYA 1V2TT 2R2WU 4B74A 1XUJA 2GKVE 2K8IA 2A2QH 4K8BA 4U30A 3ZIAD 1FY4A 1O34A 1G3DA 3SU4A 2WHXA 2HNTE 1Z8JB 1HLTH 3T2NA 5AHGH 3AW1A 1INCA 3DD2H 2C90B 5K7RA 2Q6FA 1FLEE 1C5QA 1CVWH 3NWUA 3GISB 2RDLA 1GVKB 3RC6A 4K69A 2BQ6B 1O2IA 3NKKA 3A88A 2ZU4A 4FUBA 1VGCC 3L33A 2A45B 2ZHWH 4ISLA 3T28A 2CF9H 2OLGA 3ODFA 2Y5HA 4CBOA 1T4VH 3SW2B 2HVXA 1H4WA 4ABDA 2XC4A 1D3PB 1S5SA 1UTPA 2ODPA 1C1VH 3N7EA 3BN9A 7GCHG 2OC1A 2BDAA 3DSPA 2V3HH 1YCPK 1C1OA 2JJ2D 3GCHC 2XC5A 2A5KA 1ZMJA 1GJ8B 1ANDA 4IC6A 1PPHE 4MG3A 1T8MA 4TWWA 4WVPE 5L30H 1E79D 1G3BA 2WUBA 1WV7H 2TPIZ 2R3UA 1VKYA 2ZPSA 1MMJN 2F9UA 3UIRA 1VITG 4JYUH 2SGQE 4O3UA 4ZUHA 2FI4E 2Y7XA 2V6NA 3F9FA 1Q31A 3KF2A 1NFYA 3MNCA 1LO6A 4JK5A 2A4GA 1TNGA 1GBBA 1A5GH 1YC0A 4MVNA 4WXIA 5DP7A 2Z9KA 3SQEE 2D26C 2VH6A 3U8RH 2CMYA 1ZRKA 4RKJB 3A8BA 3ATLA 3OE7D 4X2XA 1GGDC 4I8GA 1BBRH 1UTJA 1UCYE 1IQFA 1GCTB 4YTAA 2V35A 4F48B 4XSKU 2OQUA 5FBIA 2JIZD 4CRBA 3S69A 4YZUA 1C1PA 2ZU1A 4ACBA 2PV9B 1W0JD 2PHBA 3GCTG 1VJ9U 2ZPRA 3HKIB 1MTNB 1SQRA 2WYGA 1O2ZA 3BV9B 1NTPA 1MKXH 3A89A 1P2QA 1OKXA 1QRZA 3ZV9A 3TH2H 2J92A 3F0PA 4ASHA 3RXQA 1WQVH 1GJ7B 2BDGA 3T26A 1QIXB 1S0RA 1T32A 2OXSA 2C8XB 3CS7A 3SGAE 3FP6E 1UHBA 3VG8A 2ZHQH 3RU4E 1SGEE 5CDFE 2PKSB 1LHFH 1RTLA 4RI0A 7GCHF 1QBVH 2F4LA 1O33A 3KIDU 3VFEA 1BB0B 2ZU3A 2PTCE 1QTFA 1GJBB 1IOEA 1ELCA 1O5BB 1ZSLA 3BEUA 3K6ZA 4O3TA 1BRUP 3W95A 1JWTA 3LGWA 3BTHE 3OFND 4KKDA 1FY1A 5DK1A 1VITF 1TGCA 1WOFA 1FY8E 4U32A 4BXWA 3TJUA 1P12E 1IQMA 1O2PA 1THRH 1V2VT 2YNBA 1OYQA 3GDSA 1K9OE 1TWXB 3BIUH 2UUFB 3FO8D 4Z0KA 3KQBA 1GVLA 5T1VA 5C1UA 4ZHMU 3V7TA 2OC0A 3LJOA 2BD4A 2F9VA 3ATIA 3EDXB 1C1WH 1WBGB 2QC2A 2JH5D 1HAVA 3DFJA 3CS0A 2I6QA 1NFUA 1PQ5A 2Z9IA 4AGJA 1XXDA 1QRXA 2JH6D 2FOEA 3SBKA 1YPMH 3GCTF 1HJ8A 1O2UA 2FLRH 2Z7FE 3SNBA 5F53A 1NFXA 3KQDA 3MH7A 4X0WU 5ESBA 3FZZA 2G4TA 1GI0A 2LPRA 4AX9H 4U2WA 1MTUA 2ZPQA 1ZHRA 4Y7BA 3ZZ9A 5A09A 4ZXYH 1F0TA 6CHAC 1LVOA 3N99A 4MLFB 3SGQE 4OS1A 4K1TA 3MMGA 2GZ9A 3OSYA 1AIXH 5CHAB 1O5GH 3F68H 3UWIA 2A4RA 1DM4B 4LZ4B 2FTLE 1OWEA 1TRYA 1TMTH 2GCTC 1Z8RA 3GOVB 1O3GA 3ZZ5A 2D8WA 2BHGA 3A84A 1F92A 1VR1H 5C67A 4LZ1H 1RIWC 2ZZUH 1KSNA 3MYWA 1SOTA 3QO6A 2C4FH 3Q3YA 1O3HA 3MTYA 5GXPA 2IN2A 4NSYA 1QB9A 1IQNA 1EB2A 4J1YA 2ZFSA 3QZRA 5EW1H 3MNXA 2AFQB 1GDNA 2Q6DA 1SG8B 3P92A 8LPRA 4GAWA 1BMLA 1P02A 2G00A 5GWZA 4NWLA 5KEDA 2AMPA 3GCNA 3FAOA 5EPNA 3VXFH 1GMHG 2A7HA 1GBFA 2SGEE 2PUQH 4Y11E 1V2LT 2SGDE 2YOLA 2CXVA 1Z71A 1DXWA 5A8YA 3BEIB 1J8AA 3RXJA 3VGCB 2PUXB 3Q76A 2FO9A 4UFEH 3BTTE 2FIRH 2VIWA 1GMDF 3GCHB 4WMFA 1O2TA 4NA9H 1RJXB 3A7TA 5GCHF 5L6NH 2JKHA 3K2UA 4CRFA 3MHWU 3EA9A 1DX5M 1TGBA 3P17H 1JBUH 1SLUB 1UVUH 4CRDA 4IBLH 2ZFQH 4E05H 2H9HA 3MOCA 1F7ZA 1ZSKA 2ANYA 5JDUB 1S6HA 2XBYA 1PPZA 1OXGA 3D23A 3V0XA 1TLDA 4CH8B 3ESTA 2GCHG 3E6PH 3RXFA 1ZTJA 1BOQA 4XBDA 1QURH 5DGJA 1KLTA 2OTVA 1O2HA 1ZZZA 3M3TA 3M7TA 3ODDA 2LELA 3MO9A 1HIAA 1NT1A 2DUCA 1W11U 4TPIZ 3SNAA 1A1RA 4FUGA 2NWNA 1PPBH 1YKTA 2F9NA 1SGYE 1G32B 5C5NA 5IK2D 1KTSB 2BYAX 3I78A 4I86A 5DP9A 1CHOG 1E1QD 3SV8A 4TYDA 3SZEA 1QQUA 3UTUH 1ELBA 4GPGA 3ATWA 1K1PA 4WY3A 3U1JB 1AB9B 1G36A 2HGTH 3RXCA 2VWMA 1W7GH 1Z7KA 2ZIQH 3DUXH 1O2VA 5J4SA 1Y5UT 1XKBC 1P2OA 2VINA 5C20A 1TE0A 2BDHA 2WV5A 3KCGH 8GCHF 4Y0YE 2BZAA 2VNTA 5E2OA 5JBTA 9ESTA 1OSSA 5KGOA 2Z3CA 1FPHH 2KCAA 3NCLA 2XXLA 1LQDB 4K3JA 3A7WA 2HOBA 3NZIA 4FVDA 3TJVA 1TRNA 1Y3VA 4K60A 5JB8S 3UNRA 2WPMS 3TJNA 2VIQA 3BTFE 3OTJE 1N6XA 4F55A 1TNHA 3PTNA 1FN6A 1A2CH 4DT4A 1TPPA 1O3BA 3M7QA 4KELA 4CHAB 1F0RA 4VGCC 3QZQA 1YPHE 1AO5A 4AG2A 2PGQB 1OWKA 3M5MA 2G51A 3SJKA 1VCWA 1O3CA 1QHRB 5F6MA 1AE5A 1HAIH 2D2DA 4FVBA 1SI5H 1KYNA 3WW7A 3RM2H 3RP2A 2BXTH 1DANH 1C5NH 1GJDB 1MAYA 4IN1A 4A7IB 3R3GB 1YF4A 1W12U 3SV7A 1HAPH 1H1BA 1HUTH 1FV9A 2W3KA 1FY3A 1C5YB 1NESE 1K22H 1ESAA 1BBRE 1OX1A 2QY0B 1KIGH 1OPHB 2UWOA 2QIQA 2RA3A 1V2MT 1C9TA 2J9NA 2ZFFH 4AC9A 1AWFH 3BG8A 1CA0C 4MPUA 2GJGA 1YWUA 3C1KA 1DUEA 1MCTA 1K21H 3RXDA 3RXKA 2Q1JA 1K1OA 2M5TA 2O8TA 4AFQA 1PPEE 3PMAB 4JK6A 2XOKD 1CHOF 1DE7H 4AN7A 2RDEA 3GYMA 4BTIB 3BEFB 1O2GH 1TAWA 3BTGE 1A46H 1C5RA 1ZPCA 2BDCA 3OAAD 1O3MA 2F83A 1N1LA 2VU8E 3ZYDA 2VIDA 2NU4E 5K0HA 3W94A 1KLJH 1C2EA 1DOJA 3R0FA 2FMJA 2J34A 3E16B 3E0PB 2BX3A 2BD3A 4AB9A 4GUXA 4NA8A 1GBJA 2XRCA 6CHAB 3RDZA 4NGAH 3LH3A 4FUDA 5LGOA 1NBMD 1Y5AT 2W6ID 1EP5A 2SGFE 3T29A 1TGTA 4A1XA 3P95A 2FDAA 3RLWH 2GVFA 1K1LA 4CRCA 1GI5A 1ELDE 2KFWA 3KQCA 1C5UA 2WPHS 2GCTB 1P03A 5TCCA 3A7XA 2VBCA 3FN8A 5DSFA 1LQEA 2UWPA 3PM3A 5C3NA 2EC9H 1OWDA 3RXSA 1WYKA 2FM2A 3GY7A 4TPYA 1BTYA 3A7YA 1V2OT 1H9IE 3RXEA 1C5LH 4CRGA 1O2JA 1O2LA 2VIPA 1UCYK 1ZTLA 2ZA5A 2FEQH 1TPSA 2ULLA 2AGGX 2JETC 2ZCKP 1IQEA 2AERH 2WUCA 3AK5A 2WV9A 3KL6A 3PV5A 3GY5A 1O3LA 1ZR0A 4BAKB 2PP6A 1O38A 2O8MA 4LXBH 1WAYB 3LDXH 1D6WA 1DUAA 1DWCH 5IYTA 1ID5H 1CBWC 4X2YA 1EZUC 5AFYH 5EXLA 4CH2B 2H9TH 3PMHB 1C2JA 3LH1A 3RXIA 1LHGH 2ZDVH 2AS9A 1TMUH 2WSSD 2BD9A 1FNIA 5EOKA 1DFPA 5JYIA 1JRSA 1G3CA 2EI8A 1TRMA 3UQOA 1UHBB 4DCDA 2TGPZ 4BAQB 1GJ6A 4YO9A 1XMNB 4YOIA 2K0QA 1QJ1B 1ELTA 3T62A 1OWHA 5C1YA 1SMFE 1HXFH 3P8GA 5DN6D 4K1EA 5GNDA 5I46H 1W0ZU 1DXPA 1NU9A 3F9HA 1BCUH 1SGQE 2BQWB 1ZGIA 4P02A 4ZKRU 2FP7B 1MU8B 1AGJA 3OY6U 1SGPE 1BMNH 1DDJA 3E3TA 1TPAE 1D6RA 1C4V2 1H8HD 3NRLA 3MU5A 5C2ZA 3ZVCA 1ABIH 1VCPA 1OYTH 4A1VA 2P8OB 3SJ9A 2BM2A 4DJZB 1ZYOA 5HGGA 1YYY1 1Z1JA 1YGCH 2QGRA 2R3YA 4JYVH 4ZHAA 1GI8B 1FDPA 3A81A 2Z9JA 5DJ7A 1AMHA 3LIWA 4YLQH 2BLWA 1JXPA 2XBVA 2ODYB 4X1QU 1SHHB 3RXVA 2FXRA 1GBLA 1ZPZA 1MZDA 2PGBB 1GJCB 2UUJB 4OS7A 4GCHG 4X1NU 1PPGE 2VJ1A 2AH4X 2XBWA 3Q3XA 1RS0A 1EAXA 2AGIX 4ABGA 1HAVB 1HJAC 2W7SA 1AKSA 1WCZA 3M5NA 1ARCA 2F91A 4XFQA 3A80A 1P2NA 4INHA 1LPGB 2FYQA 2BZ6H 1E38B 3A8CA 1JOUB 2BB4A 3Q77A 4ABJA 3FP8E 3MFJA 3VB4A 5C0UA 2EI6A 2ALPA 1C2FA 3TJOA 1GCDA 4OS2A 1YPJH 2GT8A 1HDTH 3P8OA 1CT0E 2KCOA 1W0KD 2H5CA 3SQHE 2A7CA 3SU2A 3KYFA 1S6LA 1Y3WA 1QA0A 3ELAH 1Y8TA 1SKYE 1TOCB 1O30A 4AB8A 4JMYA 4K5ZA 1W0YH 1SQTA 1P05A 1CU1A 2FZZA 4YT7H 3HKJB 2VWLA 1NS3A 1TIOA 3ZZ3A 4FETA 5EIYA 1O2SA 1LKAA 4RN6A 4GHTA 1Q2WA 1THSH 3RXUA 4FUJA 1IHTH 3M37A 4Z1MD 1LMWB 3IITA 4IW4E 5EJLA 3TH4H 5A2MH 3M5OA 2A4QA 3LOXA 1D3TB 4TSFD 3ZVFA 5KECA 1FPCH 3K9XB 5E0HA 1BIOA 1XX9A 1THPB 4ZCNA 2WPIS 2ZF0H 2P93A 4K2YA 4BXSA 4MPWA 2HPQH 2THFB 1S84A 2OBQA 4AYYB 1P01A 4GCHF 1KMHB 2FODA 2BQ7B 3UREA 4ISHH 3TVJB 4NIWA 3SU0A 3PV4A 3LU9B 2JJ1D 1W3CA 2ASUB 2ZU5A 5E8EH 3T27A 1NC6A 3GCOA 5SGAE 2GP9B 4JCNA 3FANA 4Y71A 4M7GA 4I33A 4K8YA 1ZJKA 2PSYA 3EGKH 1GL0E 3LPRA 1T4UH 1GG6C 1IQKA 1ZHPA 1SR5C 2C8WB 3U69H 3U8OH 1BJVA 1C2MA 2R2MB 2ZDMA 4YOJA 1XVMA 4ABHA 2O8LA 3A82A 1NRNH 2TGTA 4IS5A 1AUJA 2FESH 4D7GA 2FOMB 1TQ0B 5DP3A 3GY2A 2GX4A 3H09A 2AEIH 4XDEA 1ZSJA 5EG4A 1TX8A 1SQOA 2DE9A 2H1UA 1UTQA 1O2NA 4NZLA 3TPIZ 3RXOA 3MU1A 2P16A 3C27B 5DP6A 2W5EA 1LHEH 1BRAA 3BIVH 2ZGBH 2VVVA 5E0GA 2BD5A 2QAAA 5EJZA 1PFXC 3QN7A 1HIAB 4ASUD 1BUIA 2ZQ2A 4SGBE 1ACBE 1V2KT 1W13U 3SZNA 5EPYA 1M9UA 2ALVA 3ZZ7A 1ZRBA 1L4DA 4BAMB 4B73A 5EXNA 2JETB 1BTPA 1O5EH 4Q7ZA 2PTNA 1RFNA 2J97A 1F5KU 1OP2A 2Y82A 4MQAA 1D3DB 1C4U2 3S7HB 1NRPH 7LPRA 1WDIA 2FS8A 5FHTA 2QXIA 1GI1A 1T7CA 3MU4A 1G37A 4B2AA 1X7AC 4HG6A 2PW8H 4UDWH 5HM9A 3SI4H 4IN2A 3RC5A 4PROA 4Y10E 3QDZB 1FMGA 3E91A 1K2I1 2Q6GA 1TBQH 1AFQC 1HPGA 1MU6B 1FAKH 2ZFRH 4B6FA 1CSOE 1UVTH 2ZNKH 3PB1E 1NRQH 1E37B 1H8DH 1A7SA 1HGTH 3VB5A 5DPAA 1MTWA 1CGHA 1C5XB 1YPHC 1J15A 4HZHA 2XYAA 1UTOA 3TU7H 1GMDG 3RC4A 1E0FD 5CHBA 1DLEA 1PYTD 4UFDH 2BY8X 5GCHG 1TFXA 2A5AA 3S7KB 1ZMLA 1S83A 3Q3KA 2TGAA 3UB0A 5EU8A 2AMDA 1AU8A 1PYTC 4B1TA 3FZDA 1HAXB 1H9HE 1HCGA 1AVWA 3EYDA 3DT0H 1GMCF 1HFDA 2FI3E 1LPKB 1K1MA 1RD3B 4P00A 1QRWA 3SJ8A 1W2KH 4WF8A 1BBRK 1EOJA 1Z6JH 1TNKA 4ABAA 2HRVA 2F3CE 3CNRA 1V2PT 2DE8A 3UWJH 4E7NA 1AZ8A 2OC8A 4UE7H 1QZ8A 2C3SA 3QGNB 1EPTA 2A7JA 3VEQB 1P06A 3V3MA 1BMAA
chains in the Genus database with same CATH topology
1ELFA 1PPFE 3VXEH 3A7VA 1BJUA 3ZV8A 1JIMA 1LHDH 3O8RA 1CT4E 1SGRE 1EJMA 1TALA 2YNAA 2GT7A 1NRSH 5G4BA 1GHVH 4ZKSU 1O3DA 1OP0A 1MKXK 3GY8A 3SNDA 2CJIA 4H42U 2BY9X 2CHAC 1AFEH 1LCYA 1YLDA 2XWBI 3A8DA 1EJNA 4HTCH 1ELVA 5EGMA 4CREA 2ZGCA 4B75A 3LC5A 1AWHB 3MI4A 1DSUA 1GJ5H 2WPJS 8GCHG 4D9RA 1OP8A 1MCVA 1PQ8A 1BMMH 2EA3A 2P95A 2BDIA 1HAHH 1O32A 2A0QB 2GZ8A 1DPOA 2Y5GA 1MD7A 1MTSA 1VGCB 3S9BA 4UD9H 5FPSA 1NM6A 3PWCA 1KXCA 1PJPA 4DW2U 2PKAA 2A31A 1TNJA 1O37A 1SGFA 5HXFA 2VGCC 1ANCA 1HNEE 3EA7A 3BG4C 2ZFPH 2H2ZA 3L6PA 4XE4A 1UMAH 4B71A 1QB6A 1LHCH 4H4FA 3S9CA 1WUNH 3STJA 4QT8C 3BSQA 1ABJH 2RA0A 1P57B 3P70B 1GBAA 1ESTA 3TK6A 3SNCA 1SVPA 1GJ4H 1NY22 2B0FA 1IQGA 5F8XA 4DG4A 3SJIA 1HAOH 1Z8GA 4X8UH 1WQSA 5PTPA 3SU3A 2AIPA 2ZI2H 3A83A 3QTVH 1GHBG 2PSXA 1MBQA 1TA2A 5LH8A 1P11E 1XKAC 1L1GA 1TABE 2VVCA 3MNBA 3CENA 3E90B 2TBSA 3LC3A 3NPSA 3STIA 2P3FH 1O36A 4JZFH 3RM0H 1GGDB 3V12A 4ZKOU 1GBCA 2V3OH 3GICB 2O9QA 5JBBS 5GPIB 1GBTA 2ANKH 3BTQE 1O5AB 1T8OA 4IMZA 3QGJA 5DP4A 1HB0B 4Y6DA 2BD7A 1ZPBA 2J2UA 3LGVA 2H9EH 2HLCA 4ZROA 3M36A 1BDAA 3MH4A 1SFIA 4X8VH 2TGDA 3KQEA 1ZMNA 4IMQA 3KN2A 1BT7A 3RMLH 5GIBA 1T8LA 1NN6A 1SGTA 1GBDA 2BOKA 5ABWA 1LPZB 3ITIA 4OS4A 4CRAA 3SOSA 2WINI 2EEKA 3HATH 2FTMA 4JZ1A 3SO3A 2ZC9H 2GMTC 1MD8A 2ZGXH 3SU5A 1C5WB 4K1SA 3JZ2B 3MH5A 3T25A 1FXYA 1D3QB 3TIUA 1HAYB 5A0BA 1KXEA 3O8CA 2ZQ1A 1ELAA 1GBKA 1CQQA 1YCPM 3EAJA 3PO1C 1GVZA 2FX6A 4FXGH 1KDQA 1EPTC 1Q3XA 2P3UB 1SLVB 2STBE 3RXTA 1NO9H 1LVBA 1UTMA 3QTOH 1EASA 1AKSB 4FUEA 4Q7YA 1XVOA 3UNQA 4KTSA 2WPKS 2XCNA 2VWOA 4UFFH 4TWYA 2C8YB 1GHBF 2ZDNA 3AVZA 3D49H 4MPVA 1QCPA 1MKWH 1FN8A 1SOZA 1O3JA 3URCA 1P2JA 1A0HB 2J4IA 2HNTC 1GI3A 2BLOA 3GDVA 1GHAG 2GTBA 3H7TA 3QWCH 1W8BH 1QFKH 1GDQA 1TOMH 3GY4A 4TY6A 2Y80A 2B5TB 1AFQB 4MNYA 3QUMP 1QL7A 3RXRA 1C2GA 4WH8A 1QQ4A 1P3CA 4NG9H 1C1TA 4I8HA 4O97A 4DURA 5DP5A 2Z3DA 5HM2A 5DP8A 2FS9A 2BLVA 1EQ9A 1J9CH 5A8XA 1B7XB 4F49A 2VVUA 2ZHFH 1GCTC 1QA7A 1C2KA 2SNWA 4XBBA 1NRRH 1VJAU 8ESTE 2F9BH 4NWKA 3A87A 3H7OA 3PMBB 2XNIA 3WY8A 1V2RT 4ABBA 1Y3UA 1BRCE 3M35A 3IWMA 3LKWA 5DKMA 1UTKA 4ISNA 1C9PA 1P09A 4AFSA 5A0CA 1AN1E 1A3BH 4WXVA 3RMOH 4CBNA 4ISOA 2QCYA 3U8TH 1HAZB 1V2UT 3NK8A 1RIWB 3MU0A 1DWEH 4YM9A 4MTBA 2ZP0H 3ZZDA 1BZXE 1EUFA 2J95A 4RSPA 1DITH 2HWLB 2BDBA 5EODA 5AVDA 2UUYA 4GLYA 2D1JA 6LPRA 2BVRH 1FIZA 2BXUH 2CHAB 1MQ6A 1CGJE 2CV3A 3I29A 1T31A 4YT6H 1QY6A 1D9IA 2QF3A 3SU1A 1GHAF 1V3XA 3VB6A 4BAOB 1EZQA 1F5RA 3RXLA 4BANB 2Y5FA 3SU6A 5JBCS 1YCPH 2NU2E 1TONA 4X2VA 1FAXA 5DO4H 4AGKA 5BPEA 3F9GA 3B8JA 4X2WA 2FOCA 1HXEH 4OGXA 3ATMA 3RU4D 2VGCB 3OU0A 3BF6H 1J16A 3P8NA 1W10U 2NU1E 4D7FA 2BD8A 2BX4A 2FLBH 2G55A 5HMAA 1MTVA 1K28D 4I31A 2QXHA 3MU8A 4XBCA 1UTNA 3T5FH 3BTME 1C5TA 4D8NA 3AAUA 1SGCA 5A0AE 3E1XB 1TX6A 2G81E 5L2ZH 4SGAE 3TNSA 1P2KA 2FOHA 1TA6A 1DWDH 4WMEA 3U1IB 3O8BA 2GDEH 3M3SA 1SFQB 1JRTA 4ABIA 2FI5E 3TGKE 1BTZA 1P0SH 1H8IH 3SV2H 1XUFA 2A5IA 1C2IA 1MAXA 3V13A 4KGAA 2ANMH 1V2WT 3ZZ6A 3A85A 5T6GA 1A0JA 1N8OC 3FVFB 2GZ7A 3N7OA 5CHAC 3PYHA 1AUTC 5TJXA 3S9AA 3QLPH 2C93B 1O5FH 1KXAA 2W3IA 1UJ1A 1SPJA 5JB9S 3ZVEA 3DA9B 1S81A 1EB1H 1FI8A 1ZGVA 1ZLRA 1C5SA 1AZZA 1SLXB 1BITA 4THNH 3GY3A 5AF9H 1Z6EA 1NU7B 1QJ7B 3M7UA 1AE8H 2Z9LA 6GCHF 3IG6B 1QR3E 1O5DH 5FPYA 2GMTB 1BTUA 2SNVA 1GBEA 3HGPA 3U98H 4VGCB 1FQ3A 1Z8IB 9LPRA 1F0UA 4JZIA 2ODQA 3RXMA 2A4OA 3PO1B 4CR9A 1G30B 4X1PU 4Q7XA 5AFZH 2FOFA 3TLOA 1BTWA 3RU4T 1O2MA 1EPTB 3PLBA 3U9AH 1UTLM 3UNSA 3UR6A 3PMJA 4NSVA 1FJSA 5CMXH 1TNLA 4AFUA 2I6SA 5EW2H 4I7YH 1P3EA 3ZVBA 3BTDE 3VGCC 3SNEA 4B76A 2R0LA 3PLKA 1VITH 2NU0E 3EQ0H 3RXAA 2G5NA 1XUHA 2GV6A 1C5VA 1CA0B 2CGAA 1OWIA 3Q00A 2FPZA 3SGBE 1DLKB 3TH3H 1ZJDA 1O2YA 4Y0ZE 2ZDAH 4BOHA 5E0JA 1SGIB 5FBEA 3SHCH 2BY7X 4H6SB 3A86A 8KME2 1F2SE 1MZAA 3TITA 1A4WH 3ZZBA 2FX4A 4MNVA 1H9LB 4U01A 2ZFTA 3RMNH 4DIHH 1EXFA 1GBIA 5B6OA 3OY5U 5F8TA 2PKAB 2OQ5A 1V2QT 1EAUA 4ZAEA 1SSXA 1SB1H 5GJ4B 4NIVA 1YPKH 3KNXA 1LTOA 2EI7A 1O2QA 3I77A 2H5DA 2Z9GA 2Z94A 3UUZA 1WTGH 1SL3A 1LDTT 2G4UA 1QBOA 1AB9C 1AY6H 2GV7A 1HJ9A 3O8DA 2R0KA 2W26A 4NCYA 4R8TB 2J94A 1GMCG 5T6FA 4INLA 2HPPH 1RXPA 5ESTE 3LONA 1SGNE 1GHXH 2H6MA 2KAIA 1ANBA 4Y8ZA 1A61H 1SBWA 2ZG0H 1YPLH 5LPFA 1TBRH 5L2YH 2OBOA 1TQ7B 5T3HA 1VZQH 1B5GH 3UFAA 3ZVGA 1BHXB 1KY9A 1GBHA 1C5ZB 3SV9A 1P9UA 1XUGA 3LT3A 1EZXC 2ZTZA 1KLIH 4D76A 4CHAC 3NXPA 3UR9A 1BTHH 3HGNA 5C5OA 1CO7E 1GBMA 1MUEB 1GHYH 1EKBB 4GVUA 5HYOA 1UK4A 1GI2A 3SJOA 3CP7A 1CBWB 5FCRA 5FX5A 4TY7A 3TNTA 1V2ST 1WSSH 1MQ5A 3MWIU 4Q80A 4X1SU 2A1DB 3LJJA 1EAWA 2GD4B 1UO6A 1AI8H 1FY5A 3MH6A 2OCVB 1EZSC 1K1IA 1UK2A 3SI3H 4FUIA 4AFZA 3AW0A 1C1UH 4I32A 1Y59T 1GPZA 1DICA 5BRRE 1A3EH 3G01A 5JBAS 1K1NA 4GHQA 3TGIE 3MO6A 4UFGH 5C1XA 4A1TA 4KTUA 4NIXA 2VWNA 4I8JA 4AOQA 5E2PA 1MBMA 3DHKH 4ABEA 3DFLA 3RXBA 1KDQB 1CHGA 4Q2KA 1P9SA 4Y8XA 4DGJA 2BMGB 1XUKA 1D4PB 3SV6A 3B23B 3UOPA 4NZQA 4HI3A 1KXFA 4B2BA 2OP9A 2AMQA 1GDUA 2QYIA 4KP0A 1C1RA 1F0SA 1C4Y2 4ZKNU 1IHSH 1TYNA 1SHYA 1GI6A 2ZO3H 1IQJA 4MDSA 3ZVDA 2IJOB 1G2MA 3M5LA 1P04A 1O3NA 1FZZA 5ETXA 4DIIH 2ESTE 3F9EA 1O0DH 3E0NB 1BQYA 1UVSH 2P3TB 1QB1A 1HJAB 1N8OB 2AGEX 3PROA 4X8TH 4DT7B 1MH0A 2G5VA 1GI4A 3LGTA 5LPRA 1QGFA 3RLYH 3L3TA 7KMEH 2XC0A 3TK9A 5FAHA 1RRKA 4RKOB 2VB0A 3UOUA 1CE5A 1W7XH 1V6DA 1O3FA 2Y7ZA 3OYPA 4Y79A 3SN8A 2J38A 3ENSB 1KXBA 1E35B 2BD2A 1HBTH 1W14U 5EXMA 4BTUB 1KTTB 1YBWA 3MO3A 2OUAA 4XOJA 4AYVB 1AD8H 4CR5A 1DS2E 4ZHLU 1Y3XA 1UK3A 1E34B 1C1SA 4WH6A 4MPXA 3ZZ4A 1HYLA 1AVGH 1DVAH 2O8WA 2ZGJA 2P59A 3UY9A 4AZ2B 2OD3B 5J4QA 1Y3YA 2ZGHA 4F4OC 4AG1A 2XTTB 4ZMAH 1O2WA 4B2CA 4BAHB 6ESTA 3A7ZA 3QK1A 1TGNA 3NUMA 2O8UA 2IOTA 2CN0H 4E06H 2V0BA 3UPEA 1ARBA 1HRTH 1QL9A 2BTCE 1V2JT 1GI9B 4IC5A 4UEHH 2Z6BD 2QF0A 1P2IA 3ZZAA 5H4IB 4OGYA 1TX7A 2OINA 1ETSH 1ZHMA 4NFFA 4A92A 2ZKSA 1J14A 1PQ7A 1RGQA 2ZU2A 1L0ZA 5CE1A 4KTCA 3RXGA 2Z3EA 4Y76A 1IAUA 1SGDE 2ZDLA 4E7RG 5TCAA 4ZH8A 1S85A 2FWWA 1L1NA 1C2LA 2P8OC 1YLCA 1RTKA 1WTHD 3AAVA 4LOYH 2UUKB 1B0EA 2WV4A 1GG6B 2GGVB 4FU7A 4JZEH 3AASA 3F1SB 4WMDA 1SGFG 2SGAA 1O3IA 7ESTE 2ZHDA 2QXJA 1XM1A 2QN5T 2CF8H 2F9PA 1FIWA 3K65B 3LGYA 3M3VA 2ZDKA 2B9LA 4FUCA 1NZQH 5FX6A 5FPTA 4BTTB 1L1JA 1PPCE 4JZDH 4O03A 3BTEE 1DWBH 1J17T 1C1MA 2ANWA 1DT2A 2W7UA 3EE0B 4MNXA 1ANEA 2QXGA 1N6YA 1QBNA 2A32A 2ZTXA 1TMBH 1UCYH 2BDYA 1PQAA 2BY5X 3KHVA 2R9PA 1S82A 3HPTB 4DY7B 1AVXA 1XUIA 1GMHF 1O3OA 2QA9E 1A0LA 1GJ9B 1YM0A 4FUHA 4FUFA 1ORFA 2FOGA 3A8AA 3B9FH 1DY9A 2RG3A 2Y81A 4X6MA 1KXDA 2HALA 1TPOA 2B8OH 2NU3E 2ZECA 3RXPA 1HV7A 1Y5BT 4WJG2 3SUEA 2JH0D 2GDDA 2K1QA 1GHZA 3HK3B 2AIQA 1GJAB 3GY6A 1UVPA 5EQRA 3PWBA 3D62A 2HNTF 4X6PA 1SC8U 3KGPA 4UONA 1C5OH 2G52A 1WU1A 1F5LA 4OS6A 4YOGA 4X1RU 1OOKB 1O2RA 1QJ6B 1U6QA 2B7DH 1OWJA 3PLPA 1O5CB 4YLUA 2ILNA 4HFPB 5I25A 3SUDA 4I8LA 2GCHF 1Z1IA 2ZTYA 2BVXH 2STAE 2ZHEH 3PTBA 2SGPE 1B0FA 3P6ZB 2ZEBA 2ZWLH 2LNCA 5EQQA 3RUOA 1C2DA 3SUGA 3H5CB 3MNSA 2PR3A 1CT2E 1O3AA 1ELEE 1GI7B 1V2NT 2XCFA 1ZOMA 1O3KA 1C2HA 1YPEH 2BOHB 1QL8A 2A2XH 2F9OA 1LKBA 1BTXA 3RMMH 1ESBA 1FONA 4Z6AH 4BNRA 1CA8B 3SHAH 3JZ1B 4IGDA 1ETRH 5LPEA 3TGJE 2TIOA 1P8VC 3ZVAA 4NFEA 4NIYA 1TGSZ 3EA8A 1YPGH 1MTNC 2BVSH 2WYJA 3BTKE 3RXHA 4YESB 3GDUA 1RTFB 1BHXF 2XW9A 1BA8B 1A5IA 2QV1A 3KEEA 5GDSH 1GHWH 1EOLA 3ATKA 1E36B 2UWLA 1P2MA 1TB6H 1O31A 3OX7U 2VH0A 2PKSC 1K1JA 2C8ZB 3FFGA 1IQIA 2IPHA 1ZTKA 4H6TA 1QNJA 1L2EA 1UVOA 4J2YB 4LK4A 2Y6TA 3BTWE 4A5TS 3LGIA 4O9VA 4FU9A 3SORA 5FXLA 4DVAU 3URDA 1TBZH 1L4ZA 3FP7E 4ZXXH 4Y8YA 2ZCLP 6GCHG 1A5HA 1JMOH 3HK6B 3QX5H 4FU8A 1G9IE 1EX3A 1P10A 3ZZCA 1VCQA 1EP6A 2OC7A 1NPMA 2FYRA 1CGIE 4X6NA 4MNWA 2KAIB 2PWXA 5IDKA 1T8NA 1C1QA 3BG4B 1S0QA 1S6FA 1OS8A 3GYLB 2XWAA 1LVMA 5A8ZA 1FUJA 1O35A 1IQHA 4X6OA 1G3EA 3P8FA 1GL1A 5F03A 1EJAA 3VB3A 1ELGA 3M61U 1SQAA 3ZYEA 4GSOA 1EAIA 1MKWK 4Y7AA 4R0IA 1C5MD 1JIRA 1O3EA 2XBXA 1EATA 2PFEA 3F6UH 1GWAA 1YP9A 2WPLS 4A6LA 2VIOA 3S0NA 4DOQA 3K6YA 3E8LA 1AQ7A 1TNIA 4ABFA 1O3PB 1DY8A 5DG6A 3UQVA 3ZZ8A 3VB7A 4AORA 5FCKA 1ETTH 2ZCHP