1K1JA

Bovine trypsin-inhibitor complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Factorising ligand affinity: a combined thermodynamic and crystallographic study of trypsin and thrombin inhibition.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1jA02
1QJ6B 3BIUH 3HK6B 2G4TA 2BD3A 3W95A 1GBAA 3M7TA 2IPHA 2P8OB 4BTIB 4DW2U 3ZVEA 3BTKE 4ZROA 2QF0A 4E06H 5A8YA 1XVMA 3QTVH 1ZR0A 1D3QB 2OXSA 1GJ8B 3LC5A 1A0HB 1W12U 1RTFB 2H9HA 1DITH 1E0FD 2G81E 2FP7B 3O8CA 3DFLA 3PB1E 4UFGH 4AFQA 4Y7AA 1XMNB 4Y10E 1KXFA 1FNIA 1CHGA 2FIRH 2XBXA 4E7NA 1G36A 2OTVA 3QZRA 1GPZA 1EQ9A 1GG6C 1QL7A 2ZHEH 1ELCA 2ULLA 1EB2A 4A6LA 1CVWH 3SBKA 1C2JA 5FPTA 1FY1A 2AMQA 1SGEE 3SHCH 1SR5C 2ZGCA 1S82A 1G3EA 2YNAA 3V13A 1QL8A 2DE8A 1SQTA 3PMAB 5EQRA 2B8OH 3BV9B 5C5OA 2NU4E 4XOJA 3S7KB 1UO6A 3ZZ9A 1P2JA 1KYNA 1DWEH 3RXDA 2FO9A 1FQ3A 4NIVA 2BQWB 4XDEA 1AIXH 3PYHA 1TX8A 3M3SA 2H1UA 1SGQE 2VJ1A 1BQYA 3F9GA 3RXVA 1L4ZA 3ATKA 3SUEA 3GYLB 2FOHA 1SGTA 3I29A 1K1PA 4H42U 1D6WA 3RM2H 4DGJA 1V2RT 1EXFA 3RXAA 1GHAG 4H6TA 4SGAE 1DM4B 1CA0B 4NA8A 3HPTB 4ZKOU 2A31A 3ATWA 3RXQA 1GJBB 3WY8A 3GCOA 3GICB 4GCHF 3TPIZ 3EA8A 4WJG2 3BN9A 4AFUA 1GBJA 1DFPA 1BMAA 4TPIZ 1NFUA 4JMYA 1LMWB 3SU1A 1O3AA 2CHAC 1UVPA 2FYRA 3ZZ4A 2AS9A 3MNCA 1NC6A 3TJUA 3UQVA 4CBOA 4FUIA 2VNTA 1Y3VA 2XC5A 4KGAA 5AVDA 1C9TA 2ANYA 1L0ZA 1TPPA 3OU0A 1ZLRA 2W7SA 3QDZB 3KL6A 2Z6BD 3RXPA 4D8NA 4GUXA 1AHTH 4NIWA 1BMLA 3BTDE 1GGDC 2UUJB 5HM9A 1Y3UA 1G30B 2GV7A 1O2OA 1QRZA 4DJZB 1ZSLA 3ATLA 1FAKH 1GDUA 3RXJA 4IMZA 4A7IB 2HOBA 2R3UA 3KCGH 3NZIA 4GAWA 2AIPA 4GCHG 2VWNA 5EPNA 1YCPH 2GDDA 3UNSA 2OQ5A 3AAUA 2ZHFH 1JWTA 1NROH 3FZZA 2F9NA 3LKWA 6CHAB 1TMTH 2EI8A 1IHTH 3EA7A 1DX5M 5DG6A 3U8OH 1C1MA 1YP9A 5T6GA 1ZMLA 7LPRA 1HRTH 1OWKA 1QL9A 1P2OA 3Q3YA 1ZZZA 1DWDH 2VVVA 5L2ZH 1FI8A 4ABIA 3VGCC 2A4QA 4AG2A 4UONA 2ASUB 2STBE 3PLKA 1Y3YA 1NRRH 2HVXA 5LH8A 5LPFA 2VIWA 3FP7E 4ABBA 5PTPA 3KN2A 4NA7A 3QLPH 3QO6A 4FUCA 4I8GA 1O2YA 2ZFSA 1TABE 2K1QA 4ZHLU 2BQ6B 5F8XA 2ANKH 1P2IA 1B0FA 1O35A 4YOJA 2FZZA 3RXBA 4H6SB 5FCKA 4JCNA 4TYDA 2H9EH 1W3CA 2LPRA 3IITA 1AE5A 3K9XB 3GDVA 2ZWLH 2BDBA 4K3JA 2BMGB 3A7TA 2FX6A 1FZZA 2JH6D 2ZGHA 2HWLB 1EZSC 3TVJB 1C5UA 5C2ZA 3U1IB 1C2KA 4K8BA 5T6DA 4UD9H 3LGUA 3SUDA 2A4GA 5C20A 1Z7KA 1S6HA 1D3DB 3B9FH 2BY6X 4Y7BA 3SI4H 1KTTB 3A87A 4CRCA 2ALPA 1QBVH 4BOHA 4YOIA 1GCTB 1O2PA 2ZKSA 1A0JA 5EQQA 4B2BA 4ABJA 4X8SH 2ZC9H 4DG4A 8ESTE 2P3UB 1WQVH 5LPEA 3AW0A 1G2LA 1H8DH 2FX4A 2WINI 3MU8A 5DP5A 4MPWA 1GVKB 2WPKS 4Q80A 2BDCA 3ODDA 2BY9X 4PROA 1JIRA 3KEEA 4NA9H 4B1TA 1T8OA 1A3BH 2SFAA 3DT0H 1C5NH 3GY3A 4ESTE 5ETXA 4ZH8A 1A5IA 3UFAA 2OUAA 2AEIH 5A0CA 1GBMA 1MZDA 1XUFA 2Y7XA 3UR6A 2TBSA 4Z0KA 3OTJE 3MNXA 1E36B 1O31A 1O34A 2B7DH 4JYVH 3K6YA 1HAHH 5DP7A 2FI3E 1HIAB 1S6FA 5C3NA 2CN0H 1XXDA 1JBUH 1MKWH 3SV9A 3BTEE 1YLCA 2GMTC 1LQEA 2BD9A 1FY3A 1O3KA 3T27A 5FX5A 4IGDA 1Z8RA 1KXEA 2GCTC 3GY8A 5DGJA 1PQAA 1ZGIA 4INLA 3SI3H 4BAHB 4CR9A 1QHRB 1XKBC 4FU8A 1UHBA 1VGCB 3R3GB 1OYTH 5I46H 3BTFE 1GBLA 1E37B 2J38A 2R2MB 1UVSH 3RXEA 1MKXK 5FBIA 2FOGA 3LGTA 4X1SU 1QA0A 2HGTH 5L6NH 1IQMA 3ZZ8A 1RJXB 1GJDB 1O32A 4MNXA 1Q31A 4DIHH 2HPPH 1BHXF 1QB9A 1PPZA 2AYWA 2ZFRH 4YO9A 1SOZA 2A5IA 3LJOA 3ZVCA 4GVUA 1AQ7A 2QGRA 3ESTA 3TJOA 3ZVGA 1W11U 1ZHMA 1BOQA 3GISB 1MTWA 3SU6A 1HIAA 1O3DA 1PPCE 1O2XA 5DP4A 5F03A 3SV7A 2BLOA 1S81A 1F0RA 3ENSB 4Y79A 1SHYA 1SGCA 4Y8ZA 3VB5A 1O2KA 2OC7A 1CHOF 1MU6B 1WSSH 1DVAH 1G37A 1Z1JA 5C1YA 1O2GH 1FXYA 1SSXA 1P3CA 3RU4D 3ZZDA 4ZHMU 4E7RG 1MU8B 1ZOMA 2BDYA 1FJSA 3P8FA 3KHVA 2F9PA 2THFB 1O2TA 4I8JA 3SJKA 5C1UA 1D4PB 1XUGA 4X6NA 3A88A 2FS9A 1EP6A 3ZZCA 1T8LA 4HI3A 3SNAA 2BD4A 1LPZB 2F9VA 8LPRA 1FPHH 1SFIA 2W5EA 4HTCH 2D8WA 4DT7B 2VIPA 1OWEA 3FZDA 3TK6A 4IMQA 4F4OC 4MPVA 3AW1A 1TFXA 2RDLA 2PUXB 4NZLA 4Y0ZE 5GJ4B 2G5VA 4YT7H 1JMOH 2SNVA 4A1TA 2BYAX 3BEIB 1GI2A 1ZGVA 1Y8TA 4OS1A 1ZTJA 5A8XA 1CHOG 2FOEA 2STAE 1O5BB 2Q6FA 5FBEA 5FXLA 6ESTA 1ELDE 1MBMA 2A0QB 3M5LA 1LQDB 1P11E 1TGCA 1QRXA 3MYWA 1TNKA 1THSH 1BTUA 3ZVAA 4AX9H 4JZ1A 1ANBA 4WY3A 3M36A 3UPEA 2DE9A 5A0BA 1AVGH 2ZFQH 2WYJA 2A7HA 2ODQA 1BMNH 2VB0A 1HAOH 1UVUH 4ZMAH 4GHTA 1Y5UT 1P2KA 1NFWA 1SMFE 1GL1A 3UY9A 2NWNA 4AYVB 1O5DH 4IC5A 1P04A 4AB8A 4FUDA 3VB3A 1MAYA 4CR5A 1WOFA 3OX7U 2JETB 3TIUA 4BTUB 4CRDA 5BRRE 4WMDA 1LKBA 3A7VA 3U9AH 4FVBA 4WH8A 1EJMA 2QXHA 1HPGA 4X8VH 3TGKE 5TCAA 2TGDA 1KXDA 1OSSA 1JOUB 3BTQE 4ABDA 1QBNA 1PPHE 1AKSB 2RA3A 1O3PB 2G4UA 1KDQA 1P12E 3F6UH 1KSNA 3P95A 1SLXB 1C2LA 1F0TA 1MH0A 3ATMA 5BPEA 3IG6B 1FIWA 1UTPA 1LVMA 1HXFH 1LHFH 3SU5A 2O8UA 3UNRA 5K0HA 3A89A 2WYGA 4ISIH 4BTTB 4WXIA 3SJ9A 1O3OA 2R9PA 3U98H 4DVAU 1OP0A 1GHWH 1NU7B 4RSPA 3U69H 1N6YA 1YLDA 1A5HA 1L2EA 1QR3E 4J2YB 4RKOB 3SQEE 2FOMB 1XXFA 1A7SA 1VR1H 1QJ7B 3BTWE 5C67A 1MZAA 2BLQA 1OWIA 3CENA 3BTME 3LU9B 4OGYA 4AB9A 1C5QA 2TGAA 1O3IA 3SJ8A 1AKSA 2SGFE 5E2PA 1UJ1A 1XUJA 1ZTLA 2QIQA 3SGQE 1GMHF 2ANWA 3PV4A 1W14U 4TPYA 4ABGA 1GBKA 2C8WB 4B75A 3KF2A 1OP2A 1O2UA 1MUEB 2FI4E 2XCFA 1GI9B 1HAVB 3EDXB 2ZG0H 2R0LA 5E0HA 4MVNA 1UCYE 3EGKH 1ACBE 3QK1A 1C9PA 2FODA 1YPEH 3URCA 1WV7H 1IQNA 1QURH 4U2WA 1J15A 6GCHG 4I31A 1P57B 2PUQH 4B74A 2Y5GA 3CS7A 3LC3A 5EXNA 2BDIA 1UVTH 5DK1A 2FESH 3RXRA 2OBQA 1EX3A 1K9OE 4FVDA 1SL3A 4TY7A 1JRSA 1C5YB 3RMLH 1DPOA 4Q7ZA 1BT7A 1QIXB 1ZYOA 3C27B 2CXVA 2FPZA 3ZYEA 3BG8A 2G8TA 4FXGH 1DOJA 2BOKA 4JZFH 1EP5A 1O2IA 1V2TT 5LPRA 3MH5A 1GI5A 2VGCB 1EAIA 1XUIA 3SJOA 1MTUA 2OINA 2CF8H 1A61H 2ZDAH 1WCZA 2XWAA 1HAVA 1MKWK 2BOHB 1GMDF 1ZSKA 3RM0H 1BTPA 5FX6A 2CHAB 1K1MA 1SC8U 2TPIZ 2AGIX 4XBBA 1OWDA 4OS4A 3E0NB 1TA6A 4MPXA 3GCHC 3MOCA 2H6MA 3T62A 4JYTA 3U8TH 4LK4A 2PKSB 1O3CA 5TJXA 1H1BA 4DOQA 1GHVH 1TMUH 1EJAA 1BDAA 1O2RA 2H9TH 1MQ5A 4X8TH 2QCYA 3VXFH 4TY6A 1GGDB 1EPTC 1PQ7A 2B5TB 4D9RA 1MKXH 5FAHA 3PO1C 5FHTA 1Z6JH 3Q3KA 1VZQH 4D76A 4UEHH 3SUGA 1MTSA 3RXHA 2Y5HA 2ZP0H 1GMCG 2Z3EA 2UUYA 4OS6A 2BDGA 1GMDG 1VCWA 1SGFG 4AFSA 5JPMH 4BAOB 2QA9E 1TNHA 5EGMA 1UTLM 1SBWA 1KIGH 5TCCA 1GCDA 5EXLA 1OPHB 3K2UA 3NK8A 1ZHRA 3M7QA 3M61U 4FUHA 2FYQA 1SLVB 2G52A 2HALA 4K69A 3UIRA 2OC8A 3A84A 3VGCB 3UTUH 3EYDA 3QZQA 1DUAA 4X1QU 2PR3A 1QQ4A 1ANEA 2J2UA 4XFQA 1EZUC 1K21H 2WUBA 2V3OH 3FAOA 2A4OA 2R2WU 4CRFA 2PSYA 3PMBB 1TONA 1KY9A 1NM6A 3U1JB 1H9IE 2SGEE 2Z3DA 2AGGX 1ABJH 1F5RA 1NFXA 3A8DA 4A1XA 1ZPCA 2QXGA 1CU1A 3SUFA 1SLUB 2HNTF 2XRCA 3FANA 1J17T 3JZ1B 1GJ7B 2OLGA 3HGNA 2PTNA 4U01A 2UUKB 2W3IA 5IYTA 3GOVB 3NCLA 2AMDA 1MTVA 2ZDVH 1XKAC 2VH6A 3MFJA 4HZHA 5HXFA 3E90B 1TWXB 1ANDA 1V2JT 1H9HE 1WTGH 1P03A 1VITF 1BHXB 1BRCE 3RC5A 4BXWA 4WVPE 1SGYE 2FI5E 1AD8H 3E91A 1ZMNA 3NKKA 3E3TA 5T6FA 5ESBA 1XM1A 3ZZBA 1UTNA 3TU7H 5ESTE 1YGCH 1LHDH 4MLFB 2P93A 2PGBB 2ZU5A 3MU5A 2C8XB 1DANH 1C1PA 4LZ4B 3QN7A 2XC4A 3PM3A 1S0QA 2HPQH 1O5FH 1RTLA 2FOFA 1BTZA 1NRQH 1BIOA 1UCYH 3SGAE 1ZSJA 1C5WB 1O3LA 1YKTA 4ZKNU 1SGPE 2ZDNA 1ORFA 4I8KA 1BTHH 1QBOA 4GLYA 3A83A 4MNVA 1XX9A 2YOLA 2ZCKP 3RXSA 1LDTT 2EC9H 2P3FH 1LKAA 1SPJA 1CGJE 1TNLA 3HATH 1CBWC 2PW8H 1F5KU 3RLWH 2XTTB 1BITA 3S69A 1K1IA 3SV2H 1P3EA 4X6MA 3KNXA 1FLEE 5AF9H 1UTMA 2BX3A 2Z7FE 2BVRH 1ZPBA 4WMEA 1MD8A 1DLKB 3DA9B 4KTUA 3S0NA 1XVOA 4ZXXH 2GCTB 2P94A 1SFQB 2ZGXH 4X1PU 2PWXA 2WV5A 2RG3A 1Z8IB 3KQEA 1HAPH 1LPKB 5A09A 1JXPA 2AH4X 1Q2WA 3FFGA 4KKDA 1RD3B 1TQ7B 3S7HB 2YNBA 3GDSA 7GCHF 2F9OA 3BTTE 3LH3A 2AIQA 3TJNA 4AGJA 2A7JA 1IQGA 3A82A 3A7WA 3ELAH 1O3GA 1T32A 1AFQB 1HJAC 1A1RA 4NSVA 1KXBA 4AN7A 5CHAC 3LOXA 4TWWA 1O3BA 1SLWB 2BDHA 1TBQH 1V2UT 3RC4A 5GCHF 4BAQB 2A5AA 1BMMH 4O97A 2WV4A 2HNTE 2PLXA 2BD7A 3FP8E 3M3VA 2Z9LA 1GJ4H 2BLWA 1JRTA 2QXIA 4AG1A 3MO6A 4M7GA 4LXBH 3SNEA 2QC2A 2FS8A 1V6DA 1J8AA 1AGJA 2ZHDA 3NXPA 2CJIA 4ABHA 4RKJB 4CRGA 1GJAB 1AZZA 3F9EA 3A7XA 1A0LA 2CF9H 2A5KA 3ZZ5A 4CRAA 3A80A 3L6PA 1B7XB 1GJ9B 3R0FA 1E35B 1P10A 1V2MT 4CH8B 1O39A 1NO9H 1O5EH 1SOTA 3EQ0H 5EG4A 2BD2A 3NWUA 1GHBF 1F5LA 1AE8H 5EW2H 1F2SE 2NU2E 1RRKA 2GV6A 2QN5T 5EPYA 1P0SH 3N7OA 3OSYA 3VEQB 3TNSA 5GXPA 1W8BH 2Z94A 1O2WA 1O5GH 3OY6U 4X2WA 2OCVB 3RC6A 2A7CA 2GD4B 4R8TB 1G32B 3PWCA 1HGTH 5JDUB 3SNDA 4D7GA 4IS5A 2WPLS 3AVZA 4VGCC 3TGJE 2A32A 3MWIU 3BEFB 1MBQA 2C4FH 3MU1A 3DD2H 4JYUH 2TGPZ 4UFDH 4CRBA 1SB1H 1V2OT 1IHSH 2ALVA 1LVYA 2XC0A 1O2HA 2A2QH 1DE7H 1W0ZU 1GBBA 1EAXA 4I7YH 1BJUA 2O8LA 1OS8A 2A4RA 1T4VH 3RXUA 2Q1JA 1YF4A 4UFFH 1WU1A 3LPRA 2W26A 2ZIQH 3RXIA 2GCHF 5GIBA 5JB9S 1G3BA 2ZGBH 3M5NA 3O8BA 1IQKA 3ZZ7A 4NWKA 2QY0B 4YOGA 2M5TA 3GCNA 1ZHPA 1UK3A 1IQEA 3E1XB 2P95A 1UVOA 1THPB 1ZTKA 1QA7A 1BTYA 4YZUA 2P3TB 4X1RU 1SGIB 3RXTA 1EOLA 1RS0A 2FLBH 1INCA 5FPYA 3BF6H 1O0DH 1FUJA 4X1NU 2ZECA 2BD8A 3LGWA 1RGQA 3P17H 2FOCA 2RA0A 3L3TA 1HAIH 4MQAA 3A86A 4O03A 4CHAC 3UOPA 4ISOA 2ZHWH 1K1LA 1W7XH 2PSXA 3SU4A 1HV7A 2FLRH 1GBEA 3F9FA 1Q3XA 3SU3A 2ZPQA 3SU0A 2J92A 2AGEX 5EODA 1CQQA 3OYPA 4NSYA 4XBDA 3TITA 1NRPH 4CBNA 1HYLA 3RXCA 1WBGB 2ZHQH 2GP9B 2QV1A 2GVFA 4LZ1H 1RFNA 1MMJN 1FN8A 1O2SA 2FOAA 1GHYH 4ISNA 1BJVA 3SGBE 3TGIE 3MU4A 3P8OA 3U8RH 1QB1A 2OP9A 1QCPA 4K1TA 1SGFA 3MH7A 8GCHF 2A1DB 3GCTF 1HJ8A 3V7TA 1FY4A 1NY22 2Z3CA 4GHQA 1O2QA 4UE7H 1O30A 1RTKA 2ZFPH 1AWFH 2VVCA 1PYTD 3BG4C 3BSQA 3KIDU 1C5LH 3S9AA 2ZPSA 1UMAH 5A2MH 1YPHC 1L1JA 1UCYK 4IC6A 4B2CA 1C1TA 3H7TA 5C5NA 2OC0A 1UK4A 2H2ZA 1C2GA 5L30H 2VINA 2V3HH 2BZAA 1ELFA 3LGVA 5T3HA 3RUOA 4K2YA 4AZ2B 3LH1A 1CT0E 4I32A 3MO9A 1O3HA 1FY5A 2F3CE 2H5CA 2Y82A 2C93B 3ODFA 1GI8B 3ZZAA 1QQUA 3MO3A 3K65B 3RP2A 5DP3A 3BTHE 4FUGA 2XW9A 3GCTG 2GGVB 3PMHB 1DS2E 3SV6A 1RIWB 1ETTH 1G3CA 2FTMA 3GCHB 4I8LA 3HKIB 5JBTA 1BRAA 2ZFTA 3H5CB 1C5OH 1C1NA 1C1OA 4FUFA 1AI8H 3PROA 4A5TS 1NU9A 2J9NA 5JB8S 2GX4A 2A45B 3HKJB 3MU0A 1ID5H 1LPGB 2BY8X 4KELA 1P01A 2Q6DA 2PHBA 1FV9A 3B8JA 5HGGA 2UUFB 1EAUA 4B71A 3KGPA 1W13U 3M35A 1UTOA 1HBTH 4JZEH 1V2LT 1TE0A 1YC0A 1KLJH 3GY5A 3ZZ6A 2FDAA 2ZNKH 4A92A 3D49H 1G2MA 4X2VA 1LHGH 1NESE 4A1VA 4AGKA 2CGAA 5A8ZA 1GL0E 1DUEA 1D3TB 4NFFA 3LONA 4MPUA 1Y5BT 1W2KH 3RLYH 1GG6B 4IW4E 4X6OA 1ESTA 1ZPZA 2ZCLP 4BAKB 1ELEE 1DSTA 4B2AA 1AO5A 1EZXC 3RMMH 1V2PT 2F91A 4BANB 5EXMA 1W10U 1O2LA 4AYYB 2XBVA 1SI5H 5K7RA 2J95A 2ZQ1A 1PPGE 2VU8E 1FN6A 3RXKA 2ZF0H 2VIDA 5HM2A 1GBCA 1CE5A 2ZU3A 2UWPA 2AMPA 4K5ZA 1GI7B 2Q6GA 1H8IH 3ZVFA 1C4Y2 3SJIA 3M37A 4FU7A 2ZU1A 4XE4A 1AWHB 1CT2E 3SORA 5C1XA 1PPEE 1A3EH 4YTAA 1C2EA 3E0PB 4JZIA 1GMHG 2GT7A 2BZ6H 3DFJA 1DICA 2I6QA 1DWBH 1HAGE 3BEUA 2D2DA 4Q7YA 2C3SA 1O2NA 1LVBA 4Q2KA 3HK3B 8KME2 3E8LA 1K1JA 1PPBH 4HFPB 1A2CH 4ISHH 2PV9B 1PQ5A 1UK2A 1ETRH 3PTBA 2ZPRA 1V2NT 1QJ1B 1NTPA 3PLBA 3E16B 3UR9A 4ZXYH 1N8OC 2BX4A 1OWHA 1GBFA 3DUXH 1MD7A 4UDWH 1UTJA 4WXVA 1CGHA 2XNIA 1Z6EA 3PMJA 5JBCS 2V0BA 3SNBA 1QFKH 1AVWA 5GWZA 1ARCA 4LOYH 2JH0D 1S0RA 1VJAU 1GI6A 5ABWA 4B76A 1S85A 1VJ9U 3BTGE 1HAXB 1TNGA 5EU8A 4AORA 1CBWB 3D23A 1ZRBA 4Y71A 1VCPA 1N6XA 1MCVA 1IAUA 1GHXH 3VPKA 1QNJA 3Q77A 3RMOH 1GI3A 1V2KT 4YLQH 2ZCHP 1QGFA 2J4IA 2QAAA 1ELTA 1Y3WA 2BDAA 4J1YA 3RXOA 1QRWA 2FEQH 2UWOA 2QF3A 4BAMB 2H5DA 1J9CH 1U6QA 2A2XH 9LPRA 3QUMP 1H4WA 3L33A 2B0FA 3EE0B 1TB6H 1TGTA 1L1NA 2WPJS 2ZFFH 3LT3A 4INHA 1O2ZA 1AZ8A 1YPHE 2B9LA 2TIOA 1YCPM 3T29A 1EUFA 3GYMA 1HJAB 4AOQA 5CHAB 3A8AA 3VB4A 1RXPA 3AAVA 1DXWA 3O8DA 1C2HA 4X8UH 2ZZUH 1GBDA 1PJPA 1SGNE 1IQJA 4MNYA 2EA3A 2Z9GA 3PTNA 1K1OA 2BB4A 1F0UA 1O37A 3RMNH 1GHAF 3FVFB 2ILNA 4JZDH 1EAWA 4DCDA 1DSUA 1XUKA 3RDZA 1TRNA 1DWCH 3ZVDA 3LGYA 4JK5A 4AFZA 1L4DA 3MTYA 1GWAA 1GJCB 2SGPE 2ZU4A 2ZDKA 3T25A 2WPHS 1OYQA 1P02A 1FPCH 5AHGH 5CMXH 4ABFA 3GY6A 1O2JA 1W7GH 4DIIH 1DLEA 1YM0A 3ATIA 3TNTA 1KLIH 4U32A 2PKAB 1G3DA 2SGDE 1GI0A 1K2I1 1XUHA 4DY7B 1MTNC 5EQSA 2BD5A 3RXFA 1CT4E 1TX6A 1V2VT 1WQSA 4WMFA 3EA9A 3P8NA 1DY9A 1TMBH 1AB9C 1B0EA 1BTXA 1GDQA 5E2OA 4MNWA 1C4V2 1TX7A 2O9QA 2ZU2A 1TOMH 2VGCC 2BXUH 4D7FA 3AASA 3GY4A 1G9IE 1B5GH 3F68H 4XSKU 3P70B 5L2YH 2CV3A 1AY6H 3M5OA 1VITG 3TK5A 1P05A 1TOCB 1BCUH 1C4U2 2EI6A 2IOTA 4X2YA 1EKBB 2NU0E 4K1SA 3IWMA 2G00A 2G55A 4YT6H 2GKVE 3W94A 5B6OA 4VGCB 4ZAEA 5DP9A 1BA8B 1TRYA 5G4BA 4IBLH 2ZGJA 2GMTB 1IOEA 1GBTA 2PKAA 1T8NA 2PKSC 2Z9KA 5FPSA 2BTCE 4KTSA 1YPLH 1QY6A 1MCTA 1TNJA 2BVSH 1V2ST 1KXCA 2DUCA 1YYY1 1HFDA 4WH6A 3Q00A 2P8OC 1Y59T 4Y11E 4DURA 1T7CA 1NZQH 9ESTA 4OS7A 2XWBI 2V6NA 1TYNA 3E6PH 1F92A 1GDNA 3SNCA 1BBRK 1BZXE 4Y6DA 4Y8XA 3M3TA 3B23B 2XCNA 2F9BH 1O5AB 3URDA 1C5ZB 3I77A 3RXGA 1EZQA 3P8GA 2RCEA 1CSOE 2BXTH 3PLPA 1BRBE 3G01A 1M9UA 4GPGA 5E0GA 1P09A 2D26C 4BXSA 2VVUA 1C2MA 1QB6A 1A4WH 2VIQA 3P6ZB 1C5PA 1BB0B 1MAXA 2EEKA 4F49A 3LJJA 2ODYB 1NRSH 2D1JA 3CS0A 3SU2A 3T26A 1OXGA 2Y80A 4CH2B 1GVLA 1HJ9A 2UWLA 2WUCA 1PFXC 2ZTYA 4SGBE 1C5VA 1GJ6A 1OOKB 1ABIH 4I33A 1ESBA 3GDUA 3SZNA 2EI7A 1FAXA 3TJVA 3SHAH 4CHAB 3MI4A 2IN2A 7GCHG 1FDPA 1ZRKA 1EJNA 1D9IA 3JZ2B 5GDSH 4E05H 4THNH 1P2QA 2BM2A 3T5FH 1HCGA 2Y81A 4BNRA 2JH5D 3ZZ3A 5DPAA 2GT8A 5DP8A 5GCHG 1V3XA 1AMHA 1VCQA 1AUTC 3MH6A 1CA0C 3T28A 1GI4A 2OBOA 2OD3B 1C5RA 2BVXH 1ELGA 1CGIE 2ZTZA 5H4IB 1P8VC 1QTFA 1Z8JB 4RN6A 4OGXA 1H9LB 1NS3A 2BLVA 3UREA 3D65E 2NU1E 2O8TA 3OY5U 3A8CA 1C1RA 1D6RA 1UHBB 1PYTC 1P2NA 1TGBA 1CO7E 1IQLA 5AFYH 1NPMA 3TH3H 4YLUA 1BBRE 2CMYA 3BG4B 1PPFE 1C5SA 1IQIA 2BHGA 1HDTH 3UQOA 1FONA 2PGQB 1YPJH 3GY7A 1GHBG 1S84A 1KXAA 2KAIB 2W3KA 4MG3A 4B73A 2FMJA 5IDKA 1O2VA 5J4QA 4Z6AH 1K22H 2O8MA 1O33A 2F9UA 3CP7A 1P2MA 1OWJA 3SOSA 2SGQE 5F6MA 1V2WT 1ZMJA 4NCYA 1O3MA 3A8BA 6CHAC 1C2FA 1ELBA 1Z1IA 2HLCA 5FCRA 2WPMS 1AU8A 3RXLA 1GBHA 1LCYA 3LDXH 1Z71A 3VXEH 1V2QT 1Y3XA 4K1EA 3ZVBA 4GSOA 5LGOA 1BRUP 2GZ9A 2XBYA 1F0SA 4MTBA 2TGTA 5E0JA 1TPAE 1A5GH 2FXRA 1SVPA 1TALA 1SHHB 1L1GA 1AFQC 3HGPA 2KAIA 3SW2B 2F83A 3RU4T 5DJ7A 3MH4A 4YM9A 1SGDE 3QGNB 3T2NA 3TK9A 3TH2H 1HUTH 4I8HA 2GCHG 3V0XA 1ZJKA 2R3YA 2R0KA 3QWCH 2GZ8A 2XBWA 3GY2A 1YPKH 4FUBA 3MNSA 2QXJA 1GHZA 3QGJA 2ZDLA 1O3EA 1C1UH 5DP6A 2G51A 6LPRA 2ZDMA 1DY8A 3VFEA 2BQ7B 1TLDA 1LTOA 1KLTA 3PWBA 2ZO3H 1E34B 1S5SA 1GCTC 1O36A 3ZV8A 3STIA 1EOJA 2O8WA 1N1LA 4NGAH 3TH4H 1TQ0B 1HXEH 4IN1A 3M5MA 4K8YA 5CE1A 4D9QA 1LHEH 4ZUHA 1NN6A 2Y5FA 3H7OA 4OS5A 3BIVH 4JK6A 2J94A 1PQ8A 2BY7X 3SQHE 2TRMA 2GTBA 4FUEA 5HYOA 2ODPA 1WUNH 3F9HA 1LHCH 2ZEBA 2PFEA 4HGCA 4X2XA 1A46H 3UOUA 1VITH 4R0IA 1ESAA 2ZTXA 1HNEE 1P9SA 3NUMA 3V3MA 1TBRH 3K6ZA 3D62A 2ZQ2A 3MHWU 1GJ5H 1K1NA 2ESTE 2V35A 2FTLE 2VWMA 1KTSB 3UWIA 3A7YA 2FWWA 2Z9JA 1TGSZ 4KTCA 1KDQB 2C90B 4QT8C 1NFYA 4O9VA 3ITIA 1O3NA 2GDEH 1CA8B 1SQAA 1UTKA 2ANMH 2G5NA 1TBZH 2J34A 1SQOA 3RU4E 1TA2A 3MMGA 1GVZA 1HB0B 1AUJA 4Q7XA 1C1SA 1GBIA 2VWOA 4CREA 1Y5AT 1J16A 1D3PB 1WTHD 8GCHG 4FU9A 1T8MA 3SN8A 5JYIA 1OP8A 1N8OB 4YESB 1TGNA 1TNIA 5F8TA 1ETSH 2VH0A 3KQCA 1VGCC 3QTOH 3NPSA 4X0WU 5J4SA 1ELVA 1UTQA 4NG9H 4WF8A 4Y0YE 1C5MD 3VB6A 4NIXA 1C2IA 4U30A 4UFEH 3S9CA 1DT2A 1YCPK 2FM2A 4MDSA 1EPTB 4NWLA 5JBBS 3F1SB 7KMEH 3RXMA 1ARBA 1BBRH 4Y76A 3PO1B 2AFQB 2VIVA 4Y8YA 3UWJH 1T4UH 1WYKA 1EATA 2GZ7A 1GI1A 1O5CB 1JIMA 4NIYA 3UUZA 2VWLA 2C8YB 1DXPA 1FMGA 1F7ZA 2XXLA 1YPGH 1AVXA 1NRNH 4X6PA 1Z8GA 1AN1E 3QX5H 4NZQA 4ZKRU 4KP0A 1C2DA 5DO4H 3MNBA 1C1VH 2W7UA 3FP6E 3LGIA 5E8EH 2ZI2H 3V12A 6GCHF 1ELAA 5EW1H 5AFZH 2SGAA 2C8ZB 4O3TA 2VIOA 3KQDA 1TIOA 3P92A 4WWYA 3Q3XA 1EPTA 2JKHA 4ISLA 4ABEA 1HAYB 5I25A 1OKXA 2PTCE 3LIWA 1P06A 1FIZA 3EAJA 3SO3A 1X7AC 4INKA 3STJA 1FY8E 4IN2A 3I78A 4ZKSU 2P16A 2Z9IA 1EB1H 1TPSA 3VB7A 5GPIB 2SNWA 2QYIA 1ZJDA 2AERH 4TWYA 1C1QA 1P9UA 3S9BA 5F8ZA 3TLOA 4H4FA 1O3FA 1IQHA 1HAZB 3DHKH 2P59A 5JBAS 3O8RA 2Y6TA 2HRVA 1WAYB 2ZA5A 1IQFA 3SV8A 5A0AE 3KQBA 1W0YH 3UNQA 1TAWA 2OQUA 1O2MA 2OC1A 1LO6A 2IJOB 4K60A 1MTNB 1NT1A 4FUJA 1BUIA 1THRH 1OX1A 1AB9B 1SG8B 3Q76A 5EOKA 2LNCA 1MQ6A 1T31A 4OS2A 1C5XB 3C1KA 1BTWA 1EASA 3M7UA 1AFEH 2FOBA 5DKMA 3A81A 4XBCA 4O3UA 2JETC 1O3JA 1YBWA 2HNTC 2NU3E 1C5TA 1GMCF 5HMAA 1O38A 4ASHA 1YPMH 3ZV9A 2Y7ZA 4ABAA 1LVOA 7ESTE 1ANCA 4ZHAA 3ZYDA 2XYAA 1DDJA 1SGRE 1TRMA 1K28D 1E38B 4NFEA 2WPIS 2BY5X 3A85A 1RIWC 3A7ZA 1HLTH 1C1WH 2I6SA 1S83A 1J14A 5SGAE 1TPOA
chains in the Genus database with same CATH superfamily
1QJ6B 3BIUH 3HK6B 2G4TA 2BD3A 3W95A 1GBAA 3M7TA 2IPHA 2P8OB 4BTIB 4DW2U 3ZVEA 3BTKE 4ZROA 2QF0A 1UW7A 4E06H 5A8YA 1XVMA 3QTVH 1ZR0A 1D3QB 2J98B 2OXSA 1GJ8B 3LC5A 1A0HB 1W12U 1RTFB 2H9HA 1DITH 1E0FD 2G81E 1S6LA 2FP7B 3O8CA 3DFLA 3PB1E 4UFGH 4AFQA 4Y7AA 2RDEA 1XMNB 4Y10E 1KXFA 1FNIA 1CHGA 2V3MA 2FIRH 2XBXA 4E7NA 1G36A 2OTVA 3QZRA 1GPZA 1EQ9A 1GG6C 1QL7A 2ZHEH 1ELCA 2ULLA 1EB2A 4A6LA 1CVWH 3SBKA 1C2JA 5FPTA 1FY1A 2AMQA 1SGEE 3SHCH 1SR5C 2ZGCA 1S82A 1G3EA 2YNAA 3V13A 1QL8A 2DE8A 1SQTA 3PMAB 5EQRA 2B8OH 3BV9B 5C5OA 2NU4E 4XOJA 3S7KB 4M9FA 1UO6A 3ZZ9A 1P2JA 4RI0A 1KYNA 1DWEH 3RXDA 2FO9A 1FQ3A 4NIVA 2BQWB 4XDEA 1AIXH 3PYHA 4DT4A 1TX8A 3M3SA 2H1UA 1SGQE 2VJ1A 1BQYA 3F9GA 3RXVA 1L4ZA 3ATKA 3SUEA 3GYLB 2FOHA 1SGTA 3I29A 1K1PA 4H42U 1D6WA 3RM2H 4DGJA 1V2RT 1EXFA 3RXAA 1GHAG 4H6TA 4SGAE 1DM4B 1CA0B 4NA8A 3HPTB 4ZKOU 2A31A 3ATWA 3RXQA 1GJBB 3WY8A 3GCOA 3GICB 4GCHF 3TPIZ 5EJLA 3EA8A 4WJG2 3BN9A 4AFUA 1GBJA 1DFPA 1BMAA 4TPIZ 1NFUA 4JMYA 1LMWB 3SU1A 1O3AA 2CHAC 1UVPA 2FYRA 3ZZ4A 2AS9A 3MNCA 1NC6A 3TJUA 4P02A 3UQVA 4CBOA 4FUIA 2VNTA 1Y3VA 2XC5A 4KGAA 5AVDA 1C9TA 2ANYA 1L0ZA 1TPPA 3OU0A 1ZLRA 2W7SA 3QDZB 3KL6A 2Z6BD 3RXPA 4D8NA 4GUXA 1AHTH 4NIWA 1BMLA 3BTDE 1GGDC 2UUJB 5HM9A 1Y3UA 1G30B 2GV7A 1O2OA 1QRZA 4DJZB 1ZSLA 3ATLA 1FAKH 1GDUA 1NBME 3RXJA 4IMZA 4A7IB 2HOBA 2R3UA 3KCGH 3NZIA 4GAWA 2AIPA 4GCHG 2VWNA 5EPNA 1YCPH 2WV9A 2GDDA 3UNSA 2OQ5A 3AAUA 2ZHFH 1JWTA 1NROH 3FZZA 2F9NA 3LKWA 6CHAB 1TMTH 2F4LA 2EI8A 1IHTH 3EA7A 1DX5M 5DG6A 4TT3D 3U8OH 1C1MA 1YP9A 5T6GA 1ZMLA 7LPRA 1HRTH 1OWKA 1QL9A 1P2OA 3Q3YA 1ZZZA 1DWDH 2VVVA 5L2ZH 1FI8A 4ABIA 3VGCC 2A4QA 4AG2A 4UONA 2ASUB 2STBE 3PLKA 1Y3YA 1NRRH 2HVXA 2OK5A 5LH8A 5LPFA 2VIWA 3FP7E 4ABBA 4ASUD 5PTPA 3KN2A 4NA7A 3QLPH 3QO6A 4FUCA 4I8GA 1O2YA 2ZFSA 1TABE 2K1QA 4ZHLU 2BQ6B 5F8XA 2ANKH 1P2IA 1B0FA 1O35A 4YOJA 2FZZA 3RXBA 4H6SB 3OE7D 2K0QA 5FCKA 4JCNA 4TYDA 2H9EH 1W3CA 2LPRA 3IITA 4FETA 1AE5A 3K9XB 3GDVA 2ZWLH 2BDBA 3OTPA 4K3JA 2BMGB 3A7TA 2FX6A 1FZZA 2JH6D 2ZGHA 2HWLB 1EZSC 3TVJB 1C5UA 5C2ZA 3U1IB 1C2KA 4K8BA 5T6DA 4UD9H 3LGUA 3SUDA 2A4GA 5C20A 1Z7KA 1S6HA 1D3DB 3B9FH 2BY6X 4Y7BA 3SI4H 1KTTB 3A87A 4CRCA 2ALPA 1QBVH 4BOHA 5HIZA 4YOIA 1GCTB 1O2PA 2ZKSA 1A0JA 3FKSD 5EQQA 4B2BA 4ABJA 4X8SH 2ZC9H 4DG4A 8ESTE 2P3UB 1WQVH 5LPEA 3AW0A 1G2LA 5DSFA 1H8DH 2FX4A 2KX4A 2WINI 3MU8A 5DP5A 4MPWA 1GVKB 2WPKS 1BMFD 2BDCA 3ODDA 2BY9X 4PROA 1JIRA 3KEEA 4Q80A 4NA9H 4B1TA 1T8OA 1A3BH 2SFAA 3DT0H 1C5NH 3GY3A 4ESTE 5ETXA 4ZH8A 1A5IA 3UFAA 2OUAA 2AEIH 5A0CA 3DSPA 1GBMA 1MZDA 1XUFA 2Y7XA 3UR6A 5EJZA 2TBSA 4Z0KA 3OTJE 3MNXA 1E36B 1O31A 1O34A 2B7DH 4JYVH 3K6YA 1HAHH 5DP7A 5CDFE 2FI3E 1HIAB 1S6FA 5C3NA 2CN0H 1XXDA 1JBUH 1MKWH 3SV9A 3BTEE 1YLCA 2GMTC 1LQEA 2BD9A 1FY3A 1O3KA 3T27A 5FX5A 4IGDA 1Z8RA 1KXEA 2GCTC 3GY8A 5DGJA 1PQAA 1ZGIA 4INLA 3SI3H 4BAHB 4CR9A 1QHRB 1XKBC 4FU8A 1UHBA 1VGCB 3R3GB 1OYTH 5I46H 3BTFE 4I86A 1GBLA 1E37B 2J38A 2R2MB 1UVSH 3RXEA 1MKXK 5FBIA 2FOGA 3LGTA 4X1SU 1QA0A 2HGTH 5L6NH 1IQMA 3ZZ8A 4ACBA 1RJXB 1GJDB 1O32A 4MNXA 1Q31A 4DIHH 2HPPH 1BHXF 1QB9A 1PPZA 2LP6A 2AYWA 2ZFRH 4YO9A 1SOZA 2A5IA 3LJOA 3ZVCA 4GVUA 3CNRA 1AQ7A 2QGRA 3ESTA 3TJOA 3ZVGA 1W11U 1ZHMA 1BOQA 3GISB 1MTWA 3SU6A 1HIAA 1O3DA 1PPCE 1O2XA 5DP4A 5F03A 3UAIC 3SV7A 2BLOA 1S81A 1F0RA 2CK3D 3ENSB 4Y79A 1SHYA 1SGCA 4Y8ZA 3VB5A 5IK2D 1O2KA 2OC7A 2YMSD 1CHOF 1MU6B 1WSSH 1DVAH 1G37A 1Z1JA 5C1YA 1O2GH 1FXYA 1SSXA 1P3CA 3RU4D 3ZZDA 4ZHMU 2XNDD 4E7RG 1MU8B 1ZOMA 2J97A 2BDYA 2KR7A 1FJSA 3P8FA 3KHVA 2F9PA 2THFB 1O2TA 4I8JA 3SJKA 5C1UA 1D4PB 1XUGA 4X6NA 3A88A 2FS9A 1EP6A 3ZZCA 1T8LA 4HI3A 3SNAA 2BD4A 1LPZB 2F9VA 8LPRA 1FPHH 1SFIA 2W5EA 4HTCH 2D8WA 4DT7B 2VIPA 1OWEA 3FZDA 3TK6A 4IMQA 4F4OC 4MPVA 3AW1A 1TFXA 2RDLA 2PUXB 4NZLA 3U28C 4Y0ZE 5GJ4B 2G5VA 4YT7H 1JMOH 2SNVA 4A1TA 2BYAX 3BEIB 1GI2A 1ZGVA 1Y8TA 4OS1A 1ZTJA 5A8XA 1CHOG 2FOEA 2STAE 1O5BB 2Q6FA 5FBEA 5FXLA 6ESTA 1ELDE 1MBMA 2A0QB 3M5LA 1LQDB 1P11E 1TGCA 1QRXA 3MYWA 1VKYA 1TNKA 1THSH 1BTUA 3ZVAA 4AX9H 4JZ1A 1ANBA 4WY3A 3M36A 3UPEA 2DE9A 5A0BA 1AVGH 2ZFQH 2WYJA 2A7HA 2ODQA 1BMNH 2VB0A 1HAOH 1UVUH 4ZMAH 4GHTA 1Y5UT 1P2KA 1NFWA 1SMFE 1GL1A 3UY9A 2NWNA 4AYVB 1O5DH 4IC5A 4B6EA 1P04A 4AB8A 4FUDA 2KCPA 1MAYA 3VB3A 4CR5A 1WOFA 3OX7U 2JETB 3TIUA 4BTUB 4CRDA 5BRRE 4WMDA 1LKBA 3A7VA 3U9AH 2K8IA 4FVBA 3F3BA 4WH8A 1EJMA 2QXHA 3VG8A 1HPGA 4X8VH 3TGKE 5TCAA 2TGDA 1KXDA 1OSSA 1JOUB 3BTQE 4ABDA 1QBNA 1PPHE 1AKSB 2RA3A 4TSFD 1O3PB 2G4UA 1KDQA 1P12E 3F6UH 1KSNA 3P95A 1SLXB 1C2LA 1F0TA 1MH0A 3ATMA 5BPEA 3IG6B 1FIWA 1UTPA 1LVMA 1HXFH 1LHFH 3NRLA 3SU5A 2O8UA 3UNRA 5K0HA 3A89A 2WYGA 4ISIH 4BTTB 4WXIA 3SJ9A 1O3OA 2R9PA 3OFND 3U98H 4DVAU 1OP0A 1GHWH 1NU7B 4RSPA 3U69H 1N6YA 1YLDA 1A5HA 1L2EA 1QR3E 4J2YB 4RKOB 3SQEE 2FOMB 1XXFA 1A7SA 1VR1H 1QJ7B 3BTWE 2PP6A 1W0JD 5C67A 1MZAA 2BLQA 1OWIA 3F0OA 3CENA 3BTME 3LU9B 4OGYA 4AB9A 1C5QA 2TGAA 1O3IA 3SJ8A 1AKSA 2SGFE 5E2PA 1UJ1A 1XUJA 2EY4C 1ZTLA 2QIQA 3SGQE 1GMHF 2ANWA 3PV4A 1W14U 4TPYA 4ABGA 1GBKA 2C8WB 4B75A 3KF2A 1OP2A 1O2UA 1MUEB 2FI4E 2XCFA 1GI9B 1HAVB 3EDXB 2ZG0H 2R0LA 3SYJA 5E0HA 4MVNA 1UCYE 3EGKH 1ACBE 3QK1A 1C9PA 2FODA 1YPEH 3URCA 1WV7H 1IQNA 1QURH 4U2WA 1J15A 6GCHG 4I31A 1P57B 2PUQH 4B74A 2Y5GA 3CS7A 3LC3A 5EXNA 2BDIA 1UVTH 2XOKD 2FESH 5DK1A 2OBQA 3RXRA 1EX3A 1K9OE 4FVDA 1SL3A 4TY7A 1JRSA 1C5YB 3RMLH 1DPOA 4Q7ZA 1BT7A 1QIXB 3ZIAD 1ZYOA 3C27B 5C17A 2CXVA 2FPZA 3ZYEA 3BG8A 2G8TA 4FXGH 1DOJA 2BOKA 4JZFH 1EP5A 1O2IA 1V2TT 5LPRA 3MH5A 1GI5A 2VGCB 4ACAA 1EAIA 1XUIA 3SJOA 1MTUA 2OINA 2CF8H 1A61H 2ZDAH 1WCZA 2XWAA 4OM9A 1HAVA 1MKWK 2BOHB 1GMDF 1ZSKA 3RM0H 1BTPA 3F2GA 5FX6A 2CHAB 1K1MA 1SC8U 2TPIZ 2AGIX 4XBBA 1OWDA 4OS4A 3E0NB 1TA6A 4MPXA 3GCHC 3MOCA 2H6MA 3T62A 4JYTA 3U8TH 4LK4A 2PKSB 1O3CA 5TJXA 1H1BA 4DOQA 1GHVH 1TMUH 1EJAA 1BDAA 1O2RA 1YLNA 1MQ5A 2H9TH 4X8TH 2QCYA 1EFRD 3VXFH 4TY6A 1GGDB 1EPTC 1PQ7A 2B5TB 4D9RA 1MKXH 5FAHA 3PO1C 5FHTA 1Z6JH 3Q3KA 1VZQH 4D76A 4UEHH 3SUGA 1MTSA 5HIYA 3RXHA 2Y5HA 4RT0A 2ZP0H 1GMCG 2Z3EA 2UUYA 4OS6A 2BDGA 1GMDG 1VCWA 1SGFG 4AFSA 5JPMH 4BAOB 2QA9E 3H09A 1TNHA 5EGMA 1UTLM 1SBWA 1KIGH 5TCCA 1GCDA 5EXLA 1OPHB 3K2UA 3NK8A 1ZHRA 3M7QA 5DN6D 3M61U 4FUHA 2FYQA 1SLVB 2G52A 2HALA 4K69A 3UIRA 2OC8A 3OEHD 3A84A 3VGCB 3UTUH 3EYDA 3QZQA 1DUAA 4Q4LA 4X1QU 2PR3A 1QQ4A 1ANEA 2J2UA 4XFQA 1EZUC 1K21H 2WUBA 2V3OH 3FAOA 2A4OA 2R2WU 4CRFA 2PSYA 3PMBB 1TONA 1KY9A 1NM6A 3U1JB 1H9IE 2SGEE 2Z3DA 2AGGX 1ABJH 1F5RA 1NFXA 3A8DA 4A1XA 1ZPCA 2QXGA 1CU1A 3SUFA 1SLUB 2HNTF 2XRCA 3FANA 1J17T 3JZ1B 2J98A 1GJ7B 2WPDD 2OLGA 3HGNA 2PTNA 4U01A 2UUKB 2W3IA 5IYTA 3GOVB 2L6OA 3NCLA 2AMDA 1MTVA 2ZDVH 1XKAC 2VH6A 3MFJA 4HZHA 5HXFA 3E90B 1TWXB 1ANDA 1V2JT 1H9HE 1WTGH 3F2FA 1E79D 1P03A 1VITF 1BHXB 1BRCE 3RC5A 4BXWA 4WVPE 1SGYE 2FI5E 1AD8H 3E91A 1ZMNA 2M2AA 3NKKA 3E3TA 5T6FA 5ESBA 1XM1A 3ZZBA 1UTNA 3TU7H 5ESTE 1YGCH 1LHDH 4MLFB 2P93A 5GNDA 2PGBB 1SQRA 2ZU5A 3MU5A 2C8XB 1DANH 1C1PA 4LZ4B 3QN7A 1W0KD 2XC4A 3PM3A 1S0QA 2HPQH 1O5FH 1RTLA 2FOFA 5FL7D 1BTZA 1NRQH 1BIOA 1UCYH 3SGAE 1ZSJA 1C5WB 1O3LA 1YKTA 4ZKNU 1SGPE 2ZDNA 1ORFA 4I8KA 1BTHH 1QBOA 4GLYA 2JIZD 3A83A 4MNVA 1XX9A 2YOLA 2ZCKP 3RXSA 1LDTT 2EC9H 1LKAA 2P3FH 1SPJA 1CGJE 1TNLA 3HATH 1CBWC 2PW8H 1F5KU 3RLWH 2XTTB 1BITA 3S69A 1K1IA 3SV2H 1P3EA 4X6MA 3KNXA 1FLEE 5AF9H 1UTMA 2BX3A 2Z7FE 2BVRH 1ZPBA 4WMEA 3KQ5A 1MD8A 1DLKB 3DA9B 4KTUA 3S0NA 1XVOA 4ZXXH 2GCTB 2P94A 1SFQB 2ZGXH 4X1PU 2PWXA 2WV5A 2RG3A 1Z8IB 3KQEA 1HAPH 1LPKB 5A09A 1JXPA 2AH4X 1Q2WA 3FFGA 4KKDA 1RD3B 2RFKC 1TQ7B 3S7HB 2YNBA 3GDSA 7GCHF 2F9OA 3BTTE 3LH3A 2AIQA 3TJNA 4AGJA 2A7JA 1IQGA 3A82A 3A7WA 3ELAH 1O3GA 1T32A 1AFQB 3PRBA 1HJAC 1A1RA 4NSVA 1KXBA 4AN7A 5CHAC 3LOXA 4TWWA 2KCAA 1O3BA 1SLWB 2BDHA 1TBQH 1V2UT 3RC4A 5GCHF 4BAQB 2A5AA 1BMMH 4O97A 2WV4A 2HNTE 2PLXA 2BD7A 3FP8E 3M3VA 2Z9LA 1GJ4H 2BLWA 2YMSC 1JRTA 2QXIA 4AG1A 3MO6A 4M7GA 4LXBH 3SNEA 2QC2A 2FS8A 1V6DA 1J8AA 1AGJA 2ZHDA 3NXPA 2CJIA 4ABHA 4RKJB 4CRGA 1GJAB 1AZZA 3F9EA 3A7XA 1A0LA 2CF9H 2A5KA 3ZZ5A 4CRAA 3A80A 3L6PA 1B7XB 1GJ9B 3R0FA 1E35B 1P10A 1V2MT 4CH8B 1O39A 1NO9H 1O5EH 1SOTA 3EQ0H 5EG4A 2BD2A 3NWUA 3DSOA 3EE7A 1GHBF 1F5LA 1AE8H 5EW2H 1F2SE 2NU2E 1RRKA 2GV6A 2QN5T 5EPYA 1P0SH 3N7OA 3OSYA 3VEQB 3TNSA 3AK5A 5GXPA 1W8BH 2Z94A 1O2WA 1O5GH 2WSSD 3OY6U 4X2WA 2OCVB 3RC6A 2AHME 2A7CA 2GD4B 4R8TB 1G32B 3PWCA 1HGTH 5JDUB 3SNDA 4D7GA 4IS5A 4YXWD 2WPLS 3AVZA 4VGCC 3TGJE 2A32A 4ZCNA 3MWIU 3BEFB 1MBQA 2C4FH 3MU1A 3DD2H 4JYUH 2TGPZ 4UFDH 4CRBA 1SB1H 3DCLA 1V2OT 1IHSH 2ALVA 3FO8D 1LVYA 2XC0A 2F43B 1O2HA 2A2QH 3MQKC 1DE7H 1QZ8A 1W0ZU 1GBBA 1EAXA 4I7YH 1BJUA 2O8LA 1OS8A 2A4RA 1T4VH 3RXUA 2Q1JA 1YF4A 4UFFH 1WU1A 3LPRA 2W26A 2ZIQH 3RXIA 2GCHF 5GIBA 5JB9S 1G3BA 2ZGBH 3M5NA 3O8BA 1IQKA 3ZZ7A 4NWKA 2QY0B 4YOGA 2M5TA 3GCNA 1ZHPA 1UK3A 1IQEA 3E1XB 2P95A 1UVOA 1THPB 1ZTKA 1QA7A 1BTYA 4YZUA 2P3TB 2VBCA 4X1RU 1SGIB 3RXTA 3WWFA 1EOLA 1RS0A 2FLBH 1INCA 5FPYA 3BF6H 1O0DH 1FUJA 4X1NU 2ZECA 2BD8A 3LGWA 1RGQA 3P17H 2FOCA 2RA0A 3L3TA 1HAIH 4MQAA 3A86A 4O03A 4CHAC 3UOPA 4ISOA 2ZHWH 1K1LA 1W7XH 5KEDA 2PSXA 3SU4A 1HV7A 2JJ2D 2FLRH 1GBEA 3F9FA 1Q3XA 3SU3A 2ZPQA 3SU0A 2J92A 2AGEX 5EODA 3N7DA 1CQQA 3OYPA 4NSYA 4XBDA 5F53A 3TITA 1NRPH 4CBNA 4F48B 1HYLA 3RXCA 1WBGB 2ZHQH 2GP9B 2QV1A 2GVFA 3PV5A 4LZ1H 1RFNA 1MMJN 1FN8A 1O2SA 2FOAA 4RT1A 1GHYH 4ISNA 1BJVA 3SGBE 3TGIE 3MU4A 3P8OA 3U8RH 1QB1A 2OP9A 1QCPA 4K1TA 1SGFA 2EQNA 3MH7A 8GCHF 2A1DB 3GCTF 1HJ8A 3V7TA 1FY4A 1NY22 2Z3CA 4GHQA 2KZ4A 1O2QA 4UE7H 1O30A 1RTKA 2ZFPH 1AWFH 2VVCA 1PYTD 3BG4C 3BSQA 1WDIA 3KIDU 1C5LH 3S9AA 2ZPSA 1UMAH 5A2MH 1YPHC 1L1JA 1UCYK 4IC6A 4B2CA 1C1TA 3H7TA 5C5NA 2OC0A 1UK4A 2H2ZA 1C2GA 5L30H 2VINA 2V3HH 2BZAA 1ELFA 3LGVA 5T3HA 3RUOA 4K2YA 4AZ2B 3LH1A 3W1EA 1CT0E 4I32A 3MO9A 1O3HA 1FY5A 2F3CE 2H5CA 2IPQX 2Y82A 2C93B 3ODFA 1GI8B 3ZZAA 1QQUA 4XD7D 1H8ED 3MO3A 3K65B 3RP2A 5DP3A 3BTHE 4FUGA 2XW9A 3GCTG 2GGVB 3PMHB 1DS2E 3SV6A 4HG6A 1RIWB 1ETTH 1G3CA 2FTMA 3GCHB 4I8LA 3HKIB 5JBTA 1BRAA 2ZFTA 3H5CB 1C5OH 1C1NA 1C1OA 4FUFA 1AI8H 3PROA 4A5TS 1NU9A 2J9NA 5JB8S 2GX4A 2A45B 3HKJB 3MU0A 1ID5H 1LPGB 2BY8X 4KELA 1P01A 2Q6DA 2PHBA 1FV9A 3B8JA 5HGGA 2UUFB 1EAUA 4B71A 3KGPA 1W13U 3M35A 1UTOA 1HBTH 4JZEH 1V2LT 1TE0A 1YC0A 1KLJH 3GY5A 3ZZ6A 2FDAA 2ZNKH 4A92A 3D49H 1G2MA 4X2VA 1LHGH 1NESE 4A1VA 4AGKA 2CGAA 2W6ID 5CHBA 5A8ZA 1GL0E 2QF4A 1DUEA 1D3TB 4NFFA 3LONA 4MPUA 1Y5BT 1W2KH 3RLYH 1GG6B 4IW4E 4X6OA 1ESTA 1ZPZA 2ZCLP 4BAKB 1ELEE 1DSTA 4B2AA 1AO5A 1EZXC 3RMMH 1V2PT 2F91A 4BANB 5EXMA 1W10U 1O2LA 4AYYB 2XBVA 1SI5H 5K7RA 2J95A 2ZQ1A 1PPGE 2VU8E 1FN6A 3RXKA 2ZF0H 2VIDA 3OAAD 5HM2A 1GBCA 3DSGA 1CE5A 2ZU3A 2UWPA 2AMPA 4K5ZA 1GI7B 2Q6GA 1H8IH 3ZVFA 1C4Y2 3SJIA 3M37A 4FU7A 2ZU1A 4XE4A 1AWHB 1CT2E 3SORA 5C1XA 1PPEE 1A3EH 5KGOA 4YTAA 1C2EA 3E0PB 4JZIA 1GMHG 2GT7A 3F0PA 2BZ6H 3DFJA 1DICA 2I6QA 1DWBH 1HAGE 3BEUA 2D2DA 4Q7YA 2C3SA 1O2NA 1LVBA 4Q2KA 3HK3B 8KME2 4Q63A 2L74A 3E8LA 1K1JA 1PPBH 4HFPB 1A2CH 4ISHH 5C94A 2PV9B 1PQ5A 1UK2A 1ETRH 3PTBA 2ZPRA 1V2NT 1QJ1B 1NTPA 3PLBA 5EIYA 3E16B 3UR9A 4ZXYH 1N8OC 2BX4A 1OWHA 1GBFA 3DUXH 1MD7A 4UDWH 1UTJA 4WXVA 1CGHA 2XNIA 1Z6EA 3F2HA 3PMJA 5JBCS 2V0BA 3SNBA 4AC9A 1QFKH 1AVWA 5GWZA 1ARCA 4LOYH 2JH0D 1S0RA 1VJAU 1GI6A 5ABWA 4B76A 1S85A 2QF5A 1VJ9U 3BTGE 1HAXB 1TNGA 5EU8A 4AORA 3KYFA 1CBWB 3D23A 5HKKD 1ZRBA 4Y71A 1VCPA 1N6XA 3FOAA 1MCVA 1IAUA 1GHXH 3VPKA 1QNJA 3Q77A 3RMOH 1GI3A 1V2KT 4YLQH 2ZCHP 1QGFA 2J4IA 2QAAA 1ELTA 1Y3WA 2BDAA 4J1YA 3RXOA 1QRWA 2FEQH 2UWOA 2QF3A 4BAMB 2H5DA 1J9CH 1U6QA 2A2XH 9LPRA 3QUMP 1H4WA 3L33A 2B0FA 3EE0B 1TB6H 1TGTA 1L1NA 2WPJS 2ZFFH 3LT3A 4INHA 1O2ZA 1AZ8A 1YPHE 2B9LA 2TIOA 1YCPM 3T29A 1EUFA 3GYMA 3PV2A 1HJAB 4AOQA 5CHAB 3A8AA 3VB4A 1RXPA 3N7EA 3AAVA 1DXWA 3O8DA 1C2HA 4X8UH 2ZZUH 1GBDA 1PJPA 1SGNE 1IQJA 4MNYA 2EA3A 2HVYB 2Z9GA 3PTNA 1K1OA 2BB4A 1F0UA 1O37A 3RMNH 1GHAF 3FVFB 2ILNA 4JZDH 2YMSB 1EAWA 4DCDA 1DSUA 2W6JD 1XUKA 1NBMD 3RDZA 1TRNA 1DWCH 3ZVDA 3LGYA 4JK5A 4AFZA 1L4DA 3MTYA 1GWAA 1GJCB 2SGPE 2KCYA 2ZU4A 2ZDKA 3T25A 2WPHS 1OYQA 1P02A 1FPCH 5AHGH 5CMXH 4ABFA 3GY6A 1O2JA 1W7GH 4B6FA 4DIIH 1DLEA 1YM0A 3ATIA 5C0TA 3TNTA 1KLIH 4U32A 2PKAB 1G3DA 2SGDE 1GI0A 1K2I1 1XUHA 4DY7B 1MTNC 5EQSA 2BD5A 3RXFA 1CT4E 1TX6A 1V2VT 1WQSA 4WMFA 3EA9A 3P8NA 1DY9A 1TMBH 1AB9C 1B0EA 1BTXA 1GDQA 4P00A 5E2OA 4MNWA 1C4V2 1TX7A 2O9QA 2ZU2A 1TOMH 3PRDA 2VGCC 2BXUH 4D7FA 3AASA 3GY4A 1G9IE 1B5GH 3F68H 4XSKU 1E1QD 3P70B 5L2YH 2CV3A 1AY6H 3M5OA 1VITG 3TK5A 1P05A 1TOCB 1BCUH 1C4U2 2EI6A 2IOTA 1OHHD 4X2YA 1SKYE 1EKBB 2NU0E 4K1SA 3IWMA 2G00A 2G55A 4YT6H 2GKVE 3W94A 5B6OA 3SZEA 4VGCB 4ZAEA 5DP9A 1BA8B 1TRYA 5G4BA 4IBLH 2ZGJA 2GMTB 1IOEA 1GBTA 2PKAA 1T8NA 2PKSC 2Z9KA 5FPSA 2BTCE 4KTSA 1YPLH 1QY6A 1MCTA 1TNJA 2BVSH 1V2ST 1KXCA 2DUCA 1YYY1 1HFDA 4WH6A 3Q00A 2P8OC 1Y59T 4Y11E 4DURA 1T7CA 1NZQH 9ESTA 4FOUC 4OS7A 2XWBI 2V6NA 1TYNA 3E6PH 1F92A 1GDNA 3SNCA 1BBRK 1BZXE 4Y6DA 4Y8XA 3M3TA 3B23B 1COWD 2XCNA 2F9BH 1O5AB 3URDA 1C5ZB 3I77A 3RXGA 1EZQA 3P8GA 2RCEA 1CSOE 3WWBA 2BXTH 3PLPA 1BRBE 3G01A 1M9UA 4GPGA 5E0GA 1P09A 2D26C 2GJGA 4BXSA 2VVUA 1C2MA 1QB6A 1A4WH 2VIQA 3P6ZB 1C5PA 1BB0B 1MAXA 2EEKA 4F49A 3LJJA 2ODYB 1KMHB 1NRSH 2D1JA 2HLDD 3CS0A 3SU2A 3T26A 1OXGA 2Y80A 4CH2B 1GVLA 1HJ9A 2UWLA 2WUCA 1PFXC 2ZTYA 4SGBE 1C5VA 1GJ6A 1OOKB 1ABIH 4I33A 1ESBA 3GDUA 3SZNA 2EI7A 1FAXA 3TJVA 3SHAH 4CHAB 3MI4A 2IN2A 7GCHG 1FDPA 1ZRKA 1EJNA 1D9IA 3JZ2B 5GDSH 4E05H 4THNH 1P2QA 2BM2A 3T5FH 1HCGA 2Y81A 4BNRA 2JH5D 3ZZ3A 2JDID 5DPAA 2GT8A 5DP8A 5GCHG 1YY3A 1V3XA 1AMHA 1VCQA 1AUTC 3MH6A 1CA0C 3T28A 1GI4A 2OBOA 2OD3B 1C5RA 2BVXH 1ELGA 1CGIE 2ZTZA 5H4IB 1P8VC 1QTFA 1Z8JB 4F55A 4RN6A 4OGXA 1H9LB 1NS3A 2BLVA 3UREA 3D65E 2NU1E 2O8TA 3OY5U 3A8CA 1C1RA 1D6RA 1UHBB 1PYTC 1P2NA 1TGBA 1CO7E 1IQLA 5AFYH 1NPMA 3TH3H 4YLUA 1BBRE 2CMYA 3BG4B 1FX0B 1PPFE 1C5SA 1IQIA 2BHGA 1WXRA 1HDTH 3UQOA 1FONA 2PGQB 1YPJH 3GY7A 1GHBG 1S84A 1KXAA 2KAIB 2W3KA 4MG3A 4B73A 2FMJA 5IDKA 1O2VA 5J4QA 4Z6AH 4Z1MD 1K22H 2O8MA 1O33A 2F9UA 3CP7A 1P2MA 1OWJA 3SOSA 2SGQE 5F6MA 1V2WT 1ZMJA 4NCYA 1O3MA 3A8BA 6CHAC 1C2FA 1ELBA 1Z1IA 2HLCA 5FCRA 2WPMS 1AU8A 3RXLA 1GBHA 1LCYA 3LDXH 1Z71A 3VXEH 1V2QT 1Y3XA 4K1EA 3ZVBA 5C0UA 4GSOA 5LGOA 1BRUP 2GZ9A 2XBYA 1F0SA 4MTBA 2TGTA 5E0JA 1TPAE 1A5GH 2FXRA 1SVPA 1TALA 1SHHB 1L1GA 1AFQC 3HGPA 2KAIA 3SW2B 2F83A 3RU4T 5DJ7A 3MH4A 4YM9A 1SGDE 3QGNB 3T2NA 3TK9A 3TH2H 3GS9A 1HUTH 1K0HA 4I8HA 2GCHG 3V0XA 1YWUA 1ZJKA 3N99A 2R3YA 2R0KA 3QWCH 2GZ8A 2XBWA 3GY2A 1YPKH 4FUBA 3MNSA 2QXJA 1GHZA 1E1RD 3QGJA 2ZDLA 1O3EA 1C1UH 5DP6A 2G51A 6LPRA 2ZDMA 1DY8A 3VFEA 2BQ7B 1TLDA 1LTOA 1KLTA 3PWBA 2ZO3H 1E34B 1S5SA 1GCTC 1O36A 3ZV8A 3STIA 1EOJA 2O8WA 1N1LA 4NGAH 3TH4H 1TQ0B 1HXEH 2JJ1D 2QE7D 3M5MA 4IN1A 4K8YA 5CE1A 4D9QA 1LHEH 4ZUHA 1NN6A 2Y5FA 3H7OA 4OS5A 3BIVH 5B6LA 4JK6A 2J94A 1PQ8A 2BY7X 3SQHE 2TRMA 2GTBA 4FUEA 5HYOA 2ODPA 1WUNH 3F9HA 1LHCH 2ZEBA 2KFWA 2PFEA 4HGCA 4X2XA 1A46H 3UOUA 1VITH 4R0IA 4XRNA 1ESAA 2ZTXA 1HNEE 1P9SA 3NUMA 3V3MA 1TBRH 3K6ZA 3D62A 2ZQ2A 3MHWU 1GJ5H 1K1NA 2ESTE 2V35A 2FTLE 2VWMA 1KTSB 3UWIA 3A7YA 2FWWA 2Z9JA 1TGSZ 4KTCA 1KDQB 2C90B 4QT8C 1NFYA 4O9VA 3ITIA 1O3NA 2GDEH 1CA8B 1SQAA 1UTKA 2ANMH 2G5NA 1TBZH 2J34A 1SQOA 3RU4E 1TA2A 3MMGA 1GVZA 1HB0B 1AUJA 4Q7XA 1C1SA 1GBIA 2VWOA 4CREA 1Y5AT 1J16A 1D3PB 1WTHD 2V7QD 8GCHG 4FU9A 1T8MA 3SN8A 5JYIA 1OP8A 1N8OB 4YESB 1TGNA 2LELA 3WW7A 1MABB 1TNIA 5F8TA 2KM0A 1ETSH 2VH0A 3KQCA 1VGCC 2WHXA 3OEED 3QTOH 3NPSA 4X0WU 5J4SA 1ELVA 1UTQA 4NG9H 4WF8A 4Y0YE 1C5MD 3VB6A 4NIXA 3UB0A 1C2IA 4U30A 4UFEH 3S9CA 1DT2A 1YCPK 2FM2A 4MDSA 1EPTB 4NWLA 5JBBS 3F1SB 7KMEH 3RXMA 1H8HD 1ARBA 1BBRH 4Y76A 3PO1B 2AFQB 2VIVA 4Y8YA 3UWJH 1T4UH 1WYKA 1EATA 2GZ7A 1GI1A 1O5CB 1JIMA 4NIYA 3UUZA 2J5UA 2VWLA 2C8YB 1DXPA 1FMGA 1F7ZA 2XXLA 1YPGH 3FN8A 1AVXA 1NRNH 4X6PA 1Z8GA 1AN1E 3QX5H 4NZQA 4ZKRU 4KP0A 1C2DA 5DO4H 3MNBA 1C1VH 2IJD1 2W7UA 3FP6E 3LGIA 5E8EH 2ZI2H 3V12A 6GCHF 1ELAA 5EW1H 5AFZH 2SGAA 2C8ZB 4O3TA 2VIOA 3KQDA 1TIOA 3P92A 4WWYA 3Q3XA 1EPTA 2JKHA 4ISLA 4ABEA 5KECA 1HAYB 5I25A 1OKXA 2PTCE 3LIWA 1P06A 1FIZA 3EAJA 3SO3A 1X7AC 4INKA 3STJA 1FY8E 4IN2A 3I78A 4ZKSU 2P16A 2Z9IA 1EB1H 1TPSA 3VB7A 5GPIB 2SNWA 2QYIA 1ZJDA 2AERH 4TWYA 1C1QA 1P9UA 3S9BA 5F8ZA 3TLOA 4H4FA 1O3FA 1IQHA 1HAZB 3DHKH 2P59A 2KCOA 5JBAS 3O8RA 2Y6TA 2HRVA 1WAYB 2ZA5A 1IQFA 3SV8A 5A0AE 3KQBA 1W0YH 3UNQA 1TAWA 2OQUA 1O2MA 2OC1A 1LO6A 2IJOB 5EJ1A 4K60A 1MTNB 1NT1A 4FUJA 1BUIA 1THRH 1OX1A 1AB9B 1SG8B 3Q76A 5EOKA 2LNCA 1MQ6A 1T31A 2WZQA 4OS2A 1C5XB 3C1KA 1BTWA 1EASA 3M7UA 1AFEH 2FOBA 5DKMA 3A81A 4XBCA 4O3UA 2JETC 1O3JA 1YBWA 2HNTC 2NU3E 1C5TA 1GMCF 5HMAA 1O38A 4ASHA 1YPMH 3ZV9A 2Y7ZA 4ABAA 1LVOA 7ESTE 1ANCA 4ZHAA 3ZYDA 2XYAA 1DDJA 1SGRE 1TRMA 1K28D 1E38B 4NFEA 5T1VA 2WPIS 2BY5X 3A85A 1RIWC 3A7ZA 1HLTH 1C1WH 2I6SA 1S83A 3KYGA 1J14A 5SGAE 1TPOA
chains in the Genus database with same CATH topology
1QJ6B 3BIUH 3HK6B 2G4TA 2BD3A 3W95A 1GBAA 3M7TA 2IPHA 2P8OB 4BTIB 4DW2U 3ZVEA 3BTKE 4ZROA 2QF0A 4E06H 5A8YA 1XVMA 3QTVH 1ZR0A 1D3QB 2OXSA 1GJ8B 3LC5A 1A0HB 1W12U 1RTFB 2H9HA 1DITH 1E0FD 2G81E 2FP7B 3O8CA 3DFLA 3PB1E 4UFGH 4AFQA 4Y7AA 1XMNB 4Y10E 1KXFA 1FNIA 1CHGA 2FIRH 2XBXA 4E7NA 1G36A 2OTVA 3QZRA 1GPZA 1EQ9A 1GG6C 1QL7A 2ZHEH 1ELCA 2ULLA 1EB2A 4A6LA 1CVWH 3SBKA 1C2JA 5FPTA 1FY1A 2AMQA 1SGEE 3SHCH 1SR5C 2ZGCA 1S82A 1G3EA 2YNAA 3V13A 1QL8A 2DE8A 1SQTA 3PMAB 5EQRA 2B8OH 3BV9B 5C5OA 2NU4E 4XOJA 3S7KB 1UO6A 3ZZ9A 1P2JA 1KYNA 1DWEH 3RXDA 2FO9A 1FQ3A 4NIVA 2BQWB 4XDEA 1AIXH 3PYHA 1TX8A 3M3SA 2H1UA 1SGQE 2VJ1A 1BQYA 3F9GA 3RXVA 1L4ZA 3ATKA 3SUEA 3GYLB 2FOHA 1SGTA 3I29A 1K1PA 4H42U 1D6WA 3RM2H 4DGJA 1V2RT 1EXFA 3RXAA 1GHAG 4H6TA 4SGAE 1DM4B 1CA0B 4NA8A 3HPTB 4ZKOU 2A31A 3ATWA 3RXQA 1GJBB 3WY8A 3GCOA 3GICB 4GCHF 3TPIZ 3EA8A 4WJG2 3BN9A 4AFUA 1GBJA 1DFPA 1BMAA 4TPIZ 1NFUA 4JMYA 1LMWB 3SU1A 1O3AA 2CHAC 1UVPA 2FYRA 3ZZ4A 2AS9A 3MNCA 1NC6A 3TJUA 3UQVA 4CBOA 4FUIA 2VNTA 1Y3VA 2XC5A 4KGAA 5AVDA 1C9TA 2ANYA 1L0ZA 1TPPA 3OU0A 1ZLRA 2W7SA 3QDZB 3KL6A 2Z6BD 3RXPA 4D8NA 4GUXA 1AHTH 4NIWA 1BMLA 3BTDE 1GGDC 2UUJB 5HM9A 1Y3UA 1G30B 2GV7A 1O2OA 1QRZA 4DJZB 1ZSLA 3ATLA 1FAKH 1GDUA 3RXJA 4IMZA 4A7IB 2HOBA 2R3UA 3KCGH 3NZIA 4GAWA 2AIPA 4GCHG 2VWNA 5EPNA 1YCPH 2GDDA 3UNSA 2OQ5A 3AAUA 2ZHFH 1JWTA 1NROH 3FZZA 2F9NA 3LKWA 6CHAB 1TMTH 2EI8A 1IHTH 3EA7A 1DX5M 5DG6A 3U8OH 1C1MA 1YP9A 5T6GA 1ZMLA 7LPRA 1HRTH 1OWKA 1QL9A 1P2OA 3Q3YA 1ZZZA 1DWDH 2VVVA 5L2ZH 1FI8A 4ABIA 3VGCC 2A4QA 4AG2A 4UONA 2ASUB 2STBE 3PLKA 1Y3YA 1NRRH 2HVXA 5LH8A 5LPFA 2VIWA 3FP7E 4ABBA 5PTPA 3KN2A 4NA7A 3QLPH 3QO6A 4FUCA 4I8GA 1O2YA 2ZFSA 1TABE 2K1QA 4ZHLU 2BQ6B 5F8XA 2ANKH 1P2IA 1B0FA 1O35A 4YOJA 2FZZA 3RXBA 4H6SB 5FCKA 4JCNA 4TYDA 2H9EH 1W3CA 2LPRA 3IITA 1AE5A 3K9XB 3GDVA 2ZWLH 2BDBA 4K3JA 2BMGB 3A7TA 2FX6A 1FZZA 2JH6D 2ZGHA 2HWLB 1EZSC 3TVJB 1C5UA 5C2ZA 3U1IB 1C2KA 4K8BA 5T6DA 4UD9H 3LGUA 3SUDA 2A4GA 5C20A 1Z7KA 1S6HA 1D3DB 3B9FH 2BY6X 4Y7BA 3SI4H 1KTTB 3A87A 4CRCA 2ALPA 1QBVH 4BOHA 4YOIA 1GCTB 1O2PA 2ZKSA 1A0JA 5EQQA 4B2BA 4ABJA 4X8SH 2ZC9H 4DG4A 8ESTE 2P3UB 1WQVH 5LPEA 3AW0A 1G2LA 1H8DH 2FX4A 2WINI 3MU8A 5DP5A 4MPWA 1GVKB 2WPKS 4Q80A 2BDCA 3ODDA 2BY9X 4PROA 1JIRA 3KEEA 4NA9H 4B1TA 1T8OA 1A3BH 2SFAA 3DT0H 1C5NH 3GY3A 4ESTE 5ETXA 4ZH8A 1A5IA 3UFAA 2OUAA 2AEIH 5A0CA 1GBMA 1MZDA 1XUFA 2Y7XA 3UR6A 2TBSA 4Z0KA 3OTJE 3MNXA 1E36B 1O31A 1O34A 2B7DH 4JYVH 3K6YA 1HAHH 5DP7A 2FI3E 1HIAB 1S6FA 5C3NA 2CN0H 1XXDA 1JBUH 1MKWH 3SV9A 3BTEE 1YLCA 2GMTC 1LQEA 2BD9A 1FY3A 1O3KA 3T27A 5FX5A 4IGDA 1Z8RA 1KXEA 2GCTC 3GY8A 5DGJA 1PQAA 1ZGIA 4INLA 3SI3H 4BAHB 4CR9A 1QHRB 1XKBC 4FU8A 1UHBA 1VGCB 3R3GB 1OYTH 5I46H 3BTFE 1GBLA 1E37B 2J38A 2R2MB 1UVSH 3RXEA 1MKXK 5FBIA 2FOGA 3LGTA 4X1SU 1QA0A 2HGTH 5L6NH 1IQMA 3ZZ8A 1RJXB 1GJDB 1O32A 4MNXA 1Q31A 4DIHH 2HPPH 1BHXF 1QB9A 1PPZA 2AYWA 2ZFRH 4YO9A 1SOZA 2A5IA 3LJOA 3ZVCA 4GVUA 1AQ7A 2QGRA 3ESTA 3TJOA 3ZVGA 1W11U 1ZHMA 1BOQA 3GISB 1MTWA 3SU6A 1HIAA 1O3DA 1PPCE 1O2XA 5DP4A 5F03A 3SV7A 2BLOA 1S81A 1F0RA 3ENSB 4Y79A 1SHYA 1SGCA 4Y8ZA 3VB5A 1O2KA 2OC7A 1CHOF 1MU6B 1WSSH 1DVAH 1G37A 1Z1JA 5C1YA 1O2GH 1FXYA 1SSXA 1P3CA 3RU4D 3ZZDA 4ZHMU 4E7RG 1MU8B 1ZOMA 2BDYA 1FJSA 3P8FA 3KHVA 2F9PA 2THFB 1O2TA 4I8JA 3SJKA 5C1UA 1D4PB 1XUGA 4X6NA 3A88A 2FS9A 1EP6A 3ZZCA 1T8LA 4HI3A 3SNAA 2BD4A 1LPZB 2F9VA 8LPRA 1FPHH 1SFIA 2W5EA 4HTCH 2D8WA 4DT7B 2VIPA 1OWEA 3FZDA 3TK6A 4IMQA 4F4OC 4MPVA 3AW1A 1TFXA 2RDLA 2PUXB 4NZLA 4Y0ZE 5GJ4B 2G5VA 4YT7H 1JMOH 2SNVA 4A1TA 2BYAX 3BEIB 1GI2A 1ZGVA 1Y8TA 4OS1A 1ZTJA 5A8XA 1CHOG 2FOEA 2STAE 1O5BB 2Q6FA 5FBEA 5FXLA 6ESTA 1ELDE 1MBMA 2A0QB 3M5LA 1LQDB 1P11E 1TGCA 1QRXA 3MYWA 1TNKA 1THSH 1BTUA 3ZVAA 4AX9H 4JZ1A 1ANBA 4WY3A 3M36A 3UPEA 2DE9A 5A0BA 1AVGH 2ZFQH 2WYJA 2A7HA 2ODQA 1BMNH 2VB0A 1HAOH 1UVUH 4ZMAH 4GHTA 1Y5UT 1P2KA 1NFWA 1SMFE 1GL1A 3UY9A 2NWNA 4AYVB 1O5DH 4IC5A 1P04A 4AB8A 4FUDA 3VB3A 1MAYA 4CR5A 1WOFA 3OX7U 2JETB 3TIUA 4BTUB 4CRDA 5BRRE 4WMDA 1LKBA 3A7VA 3U9AH 4FVBA 4WH8A 1EJMA 2QXHA 1HPGA 4X8VH 3TGKE 5TCAA 2TGDA 1KXDA 1OSSA 1JOUB 3BTQE 4ABDA 1QBNA 1PPHE 1AKSB 2RA3A 1O3PB 2G4UA 1KDQA 1P12E 3F6UH 1KSNA 3P95A 1SLXB 1C2LA 1F0TA 1MH0A 3ATMA 5BPEA 3IG6B 1FIWA 1UTPA 1LVMA 1HXFH 1LHFH 3SU5A 2O8UA 3UNRA 5K0HA 3A89A 2WYGA 4ISIH 4BTTB 4WXIA 3SJ9A 1O3OA 2R9PA 3U98H 4DVAU 1OP0A 1GHWH 1NU7B 4RSPA 3U69H 1N6YA 1YLDA 1A5HA 1L2EA 1QR3E 4J2YB 4RKOB 3SQEE 2FOMB 1XXFA 1A7SA 1VR1H 1QJ7B 3BTWE 5C67A 1MZAA 2BLQA 1OWIA 3CENA 3BTME 3LU9B 4OGYA 4AB9A 1C5QA 2TGAA 1O3IA 3SJ8A 1AKSA 2SGFE 5E2PA 1UJ1A 1XUJA 1ZTLA 2QIQA 3SGQE 1GMHF 2ANWA 3PV4A 1W14U 4TPYA 4ABGA 1GBKA 2C8WB 4B75A 3KF2A 1OP2A 1O2UA 1MUEB 2FI4E 2XCFA 1GI9B 1HAVB 3EDXB 2ZG0H 2R0LA 5E0HA 4MVNA 1UCYE 3EGKH 1ACBE 3QK1A 1C9PA 2FODA 1YPEH 3URCA 1WV7H 1IQNA 1QURH 4U2WA 1J15A 6GCHG 4I31A 1P57B 2PUQH 4B74A 2Y5GA 3CS7A 3LC3A 5EXNA 2BDIA 1UVTH 5DK1A 2FESH 3RXRA 2OBQA 1EX3A 1K9OE 4FVDA 1SL3A 4TY7A 1JRSA 1C5YB 3RMLH 1DPOA 4Q7ZA 1BT7A 1QIXB 1ZYOA 3C27B 2CXVA 2FPZA 3ZYEA 3BG8A 2G8TA 4FXGH 1DOJA 2BOKA 4JZFH 1EP5A 1O2IA 1V2TT 5LPRA 3MH5A 1GI5A 2VGCB 1EAIA 1XUIA 3SJOA 1MTUA 2OINA 2CF8H 1A61H 2ZDAH 1WCZA 2XWAA 1HAVA 1MKWK 2BOHB 1GMDF 1ZSKA 3RM0H 1BTPA 5FX6A 2CHAB 1K1MA 1SC8U 2TPIZ 2AGIX 4XBBA 1OWDA 4OS4A 3E0NB 1TA6A 4MPXA 3GCHC 3MOCA 2H6MA 3T62A 4JYTA 3U8TH 4LK4A 2PKSB 1O3CA 5TJXA 1H1BA 4DOQA 1GHVH 1TMUH 1EJAA 1BDAA 1O2RA 2H9TH 1MQ5A 4X8TH 2QCYA 3VXFH 4TY6A 1GGDB 1EPTC 1PQ7A 2B5TB 4D9RA 1MKXH 5FAHA 3PO1C 5FHTA 1Z6JH 3Q3KA 1VZQH 4D76A 4UEHH 3SUGA 1MTSA 3RXHA 2Y5HA 2ZP0H 1GMCG 2Z3EA 2UUYA 4OS6A 2BDGA 1GMDG 1VCWA 1SGFG 4AFSA 5JPMH 4BAOB 2QA9E 1TNHA 5EGMA 1UTLM 1SBWA 1KIGH 5TCCA 1GCDA 5EXLA 1OPHB 3K2UA 3NK8A 1ZHRA 3M7QA 3M61U 4FUHA 2FYQA 1SLVB 2G52A 2HALA 4K69A 3UIRA 2OC8A 3A84A 3VGCB 3UTUH 3EYDA 3QZQA 1DUAA 4X1QU 2PR3A 1QQ4A 1ANEA 2J2UA 4XFQA 1EZUC 1K21H 2WUBA 2V3OH 3FAOA 2A4OA 2R2WU 4CRFA 2PSYA 3PMBB 1TONA 1KY9A 1NM6A 3U1JB 1H9IE 2SGEE 2Z3DA 2AGGX 1ABJH 1F5RA 1NFXA 3A8DA 4A1XA 1ZPCA 2QXGA 1CU1A 3SUFA 1SLUB 2HNTF 2XRCA 3FANA 1J17T 3JZ1B 1GJ7B 2OLGA 3HGNA 2PTNA 4U01A 2UUKB 2W3IA 5IYTA 3GOVB 3NCLA 2AMDA 1MTVA 2ZDVH 1XKAC 2VH6A 3MFJA 4HZHA 5HXFA 3E90B 1TWXB 1ANDA 1V2JT 1H9HE 1WTGH 1P03A 1VITF 1BHXB 1BRCE 3RC5A 4BXWA 4WVPE 1SGYE 2FI5E 1AD8H 3E91A 1ZMNA 3NKKA 3E3TA 5T6FA 5ESBA 1XM1A 3ZZBA 1UTNA 3TU7H 5ESTE 1YGCH 1LHDH 4MLFB 2P93A 2PGBB 2ZU5A 3MU5A 2C8XB 1DANH 1C1PA 4LZ4B 3QN7A 2XC4A 3PM3A 1S0QA 2HPQH 1O5FH 1RTLA 2FOFA 1BTZA 1NRQH 1BIOA 1UCYH 3SGAE 1ZSJA 1C5WB 1O3LA 1YKTA 4ZKNU 1SGPE 2ZDNA 1ORFA 4I8KA 1BTHH 1QBOA 4GLYA 3A83A 4MNVA 1XX9A 2YOLA 2ZCKP 3RXSA 1LDTT 2EC9H 2P3FH 1LKAA 1SPJA 1CGJE 1TNLA 3HATH 1CBWC 2PW8H 1F5KU 3RLWH 2XTTB 1BITA 3S69A 1K1IA 3SV2H 1P3EA 4X6MA 3KNXA 1FLEE 5AF9H 1UTMA 2BX3A 2Z7FE 2BVRH 1ZPBA 4WMEA 1MD8A 1DLKB 3DA9B 4KTUA 3S0NA 1XVOA 4ZXXH 2GCTB 2P94A 1SFQB 2ZGXH 4X1PU 2PWXA 2WV5A 2RG3A 1Z8IB 3KQEA 1HAPH 1LPKB 5A09A 1JXPA 2AH4X 1Q2WA 3FFGA 4KKDA 1RD3B 1TQ7B 3S7HB 2YNBA 3GDSA 7GCHF 2F9OA 3BTTE 3LH3A 2AIQA 3TJNA 4AGJA 2A7JA 1IQGA 3A82A 3A7WA 3ELAH 1O3GA 1T32A 1AFQB 1HJAC 1A1RA 4NSVA 1KXBA 4AN7A 5CHAC 3LOXA 4TWWA 1O3BA 1SLWB 2BDHA 1TBQH 1V2UT 3RC4A 5GCHF 4BAQB 2A5AA 1BMMH 4O97A 2WV4A 2HNTE 2PLXA 2BD7A 3FP8E 3M3VA 2Z9LA 1GJ4H 2BLWA 1JRTA 2QXIA 4AG1A 3MO6A 4M7GA 4LXBH 3SNEA 2QC2A 2FS8A 1V6DA 1J8AA 1AGJA 2ZHDA 3NXPA 2CJIA 4ABHA 4RKJB 4CRGA 1GJAB 1AZZA 3F9EA 3A7XA 1A0LA 2CF9H 2A5KA 3ZZ5A 4CRAA 3A80A 3L6PA 1B7XB 1GJ9B 3R0FA 1E35B 1P10A 1V2MT 4CH8B 1O39A 1NO9H 1O5EH 1SOTA 3EQ0H 5EG4A 2BD2A 3NWUA 1GHBF 1F5LA 1AE8H 5EW2H 1F2SE 2NU2E 1RRKA 2GV6A 2QN5T 5EPYA 1P0SH 3N7OA 3OSYA 3VEQB 3TNSA 5GXPA 1W8BH 2Z94A 1O2WA 1O5GH 3OY6U 4X2WA 2OCVB 3RC6A 2A7CA 2GD4B 4R8TB 1G32B 3PWCA 1HGTH 5JDUB 3SNDA 4D7GA 4IS5A 2WPLS 3AVZA 4VGCC 3TGJE 2A32A 3MWIU 3BEFB 1MBQA 2C4FH 3MU1A 3DD2H 4JYUH 2TGPZ 4UFDH 4CRBA 1SB1H 1V2OT 1IHSH 2ALVA 1LVYA 2XC0A 1O2HA 2A2QH 1DE7H 1W0ZU 1GBBA 1EAXA 4I7YH 1BJUA 2O8LA