1K1JA

Bovine trypsin-inhibitor complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Factorising ligand affinity: a combined thermodynamic and crystallographic study of trypsin and thrombin inhibition.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1jA02
1EB2A 2A2QH 3LC3A 1C5YB 1L1NA 4JZDH 1T4UH 2PSXA 2PLXA 2VIQA 3FP7E 2F83A 4JZIA 3GDUA 2FO9A 4GCHF 3UNRA 1Z8RA 1ZRBA 2RA0A 4JYUH 2ZGJA 4JMYA 4AFSA 2BLWA 1T8NA 1HLTH 1GL1A 5A2MH 3VFEA 1EAXA 2P8OB 2NWNA 4M7GA 5J4QA 3MWIU 1K21H 2SFAA 2BYAX 5EQRA 3ELAH 4JZ1A 1EXFA 4B74A 4AFUA 3TK6A 1CA8B 2BMGB 4VGCB 1SOTA 3A8AA 3QUMP 3A80A 1TGCA 1GDQA 3Q3KA 2VIVA 2NU3E 3SJIA 1KY9A 4PROA 1ZYOA 4OS1A 1QBVH 5LPFA 4X8VH 1V2KT 1M9UA 3H5CB 4ABEA 1V2JT 7KMEH 2WYJA 2OC1A 1OP0A 2FOBA 3RXDA 2UUYA 1EZQA 1KYNA 1F0RA 2TPIZ 1NESE 1IOEA 1NS3A 2QN5T 5EQSA 2V0BA 1V6DA 3A88A 3RXQA 4JZEH 1SPJA 1PPHE 1BJVA 3B8JA 1PQ8A 1YC0A 4UFGH 4RKJB 1PYTD 3S9CA 1FN6A 1RIWB 6GCHF 5A09A 5FCRA 3LGVA 1C5QA 3RXRA 5DP4A 2ODQA 3UFAA 2F9VA 2BD8A 2HNTC 1DWBH 2ZU4A 4CRGA 1FY5A 4QT8C 5A8YA 4FUBA 1LVBA 1BTHH 1SGIB 3ZVCA 3VB7A 1NU9A 2R2WU 2ZCLP 2ZU1A 1GPZA 2ZI2H 1ARCA 1IQLA 3D65E 2EI8A 3TGJE 4FUJA 4ZH8A 1TPSA 1V2VT 1S83A 4AGJA 3SJ8A 3PMBB 2FOAA 1CGIE 5FX5A 3PO1C 2G55A 1EUFA 1BITA 1O32A 4X2YA 1Z8GA 3SQEE 1XX9A 3M5LA 1QL9A 3QZQA 2CHAB 5JB9S 1E0FD 1YGCH 1SGCA 1ANEA 4XE4A 5T6DA 1KXBA 1W11U 1A2CH 2W7SA 1PPZA 1P04A 2DE9A 2JETC 2SGAA 2RA3A 1DY9A 5ESTE 1ZRKA 1WCZA 1IAUA 3DT0H 5PTPA 1EQ9A 4MDSA 4WH6A 1ELCA 3BF6H 3S9AA 3MNBA 3BG4B 4TYDA 4A1XA 1OSSA 4Q2KA 1MBQA 1ZZZA 3GY3A 4O03A 1P9UA 1O3LA 4E7RG 2FIRH 1S85A 2VVCA 2OBOA 3RXOA 1UJ1A 5FBIA 1DSTA 2OP9A 1UVPA 2HPQH 1THSH 3SO3A 1TPOA 3STJA 1O3DA 2BVXH 1ZPBA 2ZPRA 2UUFB 1TQ0B 1TRMA 1W8BH 2GP9B 4NWKA 1V2WT 4ISLA 4B75A 1C1PA 3IITA 1D3DB 3E91A 2ZFRH 5EXMA 2BD4A 4ZKRU 1HRTH 1SLXB 5LPEA 1G3BA 4AB8A 4BTIB 1GBIA 3RP2A 2J38A 3CS0A 1BQYA 2PGQB 5JYIA 4BTUB 1W2KH 1FMGA 1TYNA 1P57B 2R2MB 4X1RU 2IJOB 2FOGA 3QLPH 5BPEA 1G2LA 1ETSH 3TJUA 4HI3A 2W5EA 2VWOA 3OTJE 4B1TA 5F8XA 4B73A 1ELVA 1FQ3A 4ABFA 5GXPA 1HAYB 1Z71A 1BMNH 1SLUB 4Y76A 4IC6A 2QC2A 4Z0KA 3F68H 4O3TA 5LGOA 1XXFA 4U2WA 2XXLA 2J92A 1CA0B 1W7XH 3SBKA 4JYVH 1BCUH 3G01A 1C1UH 5LH8A 3ATIA 2WPMS 5F03A 3SV7A 2ZDKA 3SUFA 1DT2A 1O33A 3ITIA 2ESTE 3SUGA 4A7IB 1EJAA 4NIXA 1GBMA 3LOXA 1ELBA 1Q31A 2C8XB 1O3CA 1C5PA 4Q80A 3DFLA 3GY6A 2GCHG 1P2IA 4CRAA 1LDTT 1O2MA 1CHOF 2BD3A 3LIWA 1GHAG 1UVUH 3UREA 1C1WH 4NSVA 4U32A 1UVSH 2BD5A 2Z3EA 1TPPA 3K6YA 1H8DH 1FY3A 4JCNA 2PTCE 3MYWA 1GBHA 2AMPA 4Y0YE 3MO3A 3GDVA 2FOFA 3VXEH 4OS5A 1P2KA 1PPCE 9ESTA 1HAPH 1DWEH 1GMDG 5F8ZA 1OYQA 2RDLA 3TIUA 1A7SA 1Z6EA 1BBRE 1GJ9B 3TJVA 1QA7A 2Q6FA 3SJOA 4DOQA 1XMNB 1V2UT 4Y6DA 3AVZA 2GVFA 4AGKA 2SNWA 4YM9A 2QY0B 2BXUH 3OY5U 2VIWA 3ZZ3A 1MZAA 3FZDA 2BX4A 2WPJS 1P01A 3OSYA 1FLEE 2ALVA 2F9PA 1C5WB 3LU9B 3UWJH 2BLVA 4NA8A 3HGNA 3ZVBA 2VIOA 4I31A 1FDPA 2EI7A 3PROA 1EX3A 1UHBA 5E0GA 2DUCA 1MU8B 1CVWH 1SB1H 1XXDA 2OLGA 1GG6B 2EC9H 3P92A 3ZZCA 1B5GH 1GMHG 1LVYA 1AE5A 2Y80A 4D7GA 3A84A 2THFB 3BTFE 2C3SA 2BVSH 2VH0A 2FM2A 3P8OA 5K7RA 1HJAC 1F2SE 1ZMJA 3BEFB 1QFKH 4I33A 1LTOA 3MU0A 4LOYH 1EAIA 1GMCG 4JK5A 2OC7A 1W12U 2IOTA 3PTBA 4K1TA 2GX4A 5DP8A 1QIXB 3TPIZ 1MTVA 1JRTA 3RXCA 1K1NA 2VWMA 4ZKNU 3NXPA 1C5VA 2PGBB 5C3NA 2EI6A 1C5LH 1J8AA 2FOCA 1B0FA 2A7CA 3PWCA 1HAGE 5CHAC 1GHVH 1GHZA 1HFDA 2V3OH 1O3MA 2ZTXA 3M36A 1EOLA 1P8VC 1ORFA 5EU8A 1DDJA 1C1MA 1G3CA 3KQDA 4DIIH 3LH3A 1AQ7A 1HV7A 1ACBE 1NRRH 1D6WA 2G52A 4RSPA 1Y3YA 1VITG 2OC0A 1O2IA 4AX9H 3A89A 1ELEE 4Y71A 1THPB 4LZ1H 3K9XB 2A4RA 2H1UA 4E06H 2H9EH 1SGFA 2A4QA 1PPFE 1TB6H 1SHHB 1O3JA 3SW2B 3ZZ9A 2R3YA 1TA6A 1O2SA 1O2YA 1DWDH 3PV4A 2AGIX 4H4FA 1E37B 1THRH 5I25A 2PWXA 1JOUB 2J4IA 1Z7KA 2FI4E 4OGYA 4BNRA 2QXHA 4FU7A 2OXSA 4AZ2B 3E0NB 1MUEB 1ESTA 2HRVA 2A0QB 1QBNA 3BV9B 1DUEA 3QO6A 1AUTC 3OYPA 2BDHA 2G5NA 4DW2U 3SU0A 1AVGH 3A85A 3SI3H 1LHCH 5H4IB 1FONA 1CT2E 1TNJA 3HK3B 1GI4A 1LMWB 1MU6B 3UUZA 3KF2A 3V0XA 5B6OA 1QRWA 1C5SA 2CV3A 3JZ1B 4YZUA 1TNHA 3BTWE 3DFJA 3SGQE 1ZOMA 4X1PU 1ZSJA 3JZ2B 3ZZDA 1WOFA 3UTUH 1H1BA 1F0TA 4YOIA 5JBTA 2Y5HA 2VU8E 3ODDA 3RXUA 1CT0E 1LPZB 3O8BA 4CREA 1TBZH 1W7GH 4UE7H 4X8SH 1CA0C 1MAYA 3TNTA 3QTOH 3VGCC 1QY6A 5EODA 1KDQA 3V13A 3F9HA 2A1DB 2XBWA 1INCA 2BDIA 8KME2 2BZAA 1SHYA 4FUCA 1FPCH 2FTMA 1KXDA 1YYY1 1FJSA 1QJ7B 1O3NA 2A4OA 3S0NA 2ILNA 3ATMA 1AFQC 1MD7A 1MKWK 4K3JA 2ULLA 1HJ9A 1G3DA 1MCVA 5A0CA 1TBQH 4A92A 2GKVE 4DIHH 8GCHG 2VGCC 1UCYH 1LQEA 1LO6A 2Z94A 5GDSH 3M3TA 1HCGA 3GCHB 4OGXA 5TCCA 1K1OA 1TLDA 1TQ7B 3ZVDA 1A0HB 4Q7XA 4D8NA 2STBE 3MOCA 3U1IB 2FTLE 1H8IH 5E8EH 1Z6JH 2TIOA 4NFEA 3RXVA 1G30B 2ZNKH 4CR5A 5C2ZA 1IQHA 3BN9A 2OCVB 1Q2WA 3RDZA 1P2NA 1QQ4A 2GMTB 2XC4A 4AYVB 1F0UA 3LJJA 1LPKB 1C5TA 2TBSA 1HAOH 1DITH 4GHQA 1AHTH 1GGDB 1P02A 1WQVH 1G9IE 3ZZ4A 3L33A 4TWYA 1GBLA 5J4SA 3F9FA 4MNWA 1P03A 2W26A 1SBWA 5E0JA 1HJ8A 2M5TA 1EPTC 1MTNB 1NRNH 2A31A 1O0DH 4MNVA 3VPKA 1NT1A 4D9QA 2BOKA 1GHYH 1FY1A 1V2TT 1ZJKA 1BIOA 1QTFA 2GT7A 3W94A 4RKOB 4UFEH 3TJOA 1ANBA 1O39A 4MPWA 3UWIA 4NCYA 1TA2A 1Y3XA 1OOKB 2BQ7B 1DS2E 2AIQA 4YO9A 1RGQA 3LGWA 2P94A 1QHRB 2GD4B 1AY6H 4BAMB 1OXGA 1C1SA 1ID5H 2VB0A 1KXFA 3E90B 1AWFH 1V3XA 4K69A 4WY3A 1UTMA 4GHTA 1C5OH 4I8HA 1O3AA 5HMAA 1C9TA 4XBDA 2BQ6B 2PR3A 2A2XH 1BA8B 4I8JA 1BDAA 2EA3A 1OX1A 1GWAA 2GMTC 1XVOA 1K1PA 1G3EA 2CXVA 3SUDA 2HWLB 2H9HA 3NPSA 5EPYA 5HYOA 3A8CA 2G4UA 2BQWB 5A0BA 1O2XA 2A32A 1XKAC 1GDNA 2P3UB 4YOJA 1BTXA 3KQEA 1TONA 5AFYH 2I6SA 1YPJH 4I7YH 1GJ6A 4CH8B 2Y6TA 3EGKH 5FXLA 3GCNA 5T6FA 3KIDU 1O2ZA 2QIQA 3S9BA 1DPOA 1C4U2 1LPGB 1NPMA 5EXLA 1O35A 1C2DA 4K1SA 4E7NA 1SQAA 3U8OH 2OQUA 1HAIH 5JB8S 4HGCA 1C5RA 3HKIB 3O8CA 4KTSA 3SHCH 3M7UA 4THNH 1NTPA 1DICA 3S69A 2ZWLH 2LPRA 3Q76A 1SLWB 3E3TA 4IMZA 3KQCA 3RXIA 8LPRA 1CO7E 1DE7H 1E38B 4AG1A 1NN6A 2G00A 1HAHH 1LHGH 1SGYE 1BRBE 1N6YA 1PPEE 3ZVFA 1BJUA 2R0LA 3TU7H 2VNTA 3RXTA 2OINA 1ABJH 1GBEA 3PYHA 3H7OA 4J2YB 4WMEA 1P12E 2ZDAH 4DCDA 2HLCA 4MTBA 1BTUA 2ZU3A 1GI6A 4Q7YA 2FODA 4SGBE 4RN6A 2ZFQH 1F5LA 3GCTF 4IC5A 2P93A 1GI8B 3KEEA 5HXFA 3UR6A 4ABAA 1ZSLA 2O8LA 1BMAA 1ELAA 3BTDE 1GHWH 3LJOA 1SQOA 2ZGCA 2FX4A 1OP8A 3FZZA 4UDWH 3SU2A 3TJNA 4X1QU 3M5NA 1IQFA 1ELTA 1DUAA 3T29A 2Z9KA 1PQ7A 3AAVA 2GTBA 2A7JA 4E05H 2F9UA 1SGQE 1PPBH 3GY4A 1TNIA 1ZHPA 2GZ9A 3A7XA 3E16B 4X2XA 1HIAB 4ZHAA 3ENSB 2H5DA 4Y8ZA 1UK3A 5DP7A 3HK6B 1AZZA 1LKBA 1A61H 5JDUB 3M5OA 1P3CA 1S6FA 4O3UA 1ZTKA 3MNCA 2D2DA 2I6QA 2Z7FE 2Z6BD 4JZFH 3O8RA 3SV2H 1EJMA 1W0YH 2ZQ1A 1Y5UT 4NGAH 1J14A 4NZQA 2SGPE 2J9NA 3MMGA 2SNVA 5EPNA 2CF9H 1X7AC 2DE8A 1DXPA 1QRXA 5LPRA 1GBJA 3GICB 1Y3VA 2BM2A 4MPUA 5TCAA 2BB4A 1P11E 1XUJA 3RUOA 1FIWA 3CENA 2AMDA 4WXVA 1CT4E 3P8FA 3ZZ7A 2JH5D 2BY7X 3BEIB 1W13U 4D7FA 3UQVA 4UONA 2WPHS 2SGQE 3DD2H 1EAUA 4YLUA 1FNIA 4XFQA 1L1JA 3MU5A 1SMFE 4KP0A 2ZHDA 1K1JA 1XVMA 5G4BA 3T5FH 5BRRE 3L6PA 3NZIA 5FAHA 2CMYA 2QXIA 1ZMNA 3AASA 4IMQA 3SN8A 4D76A 1DY8A 2PUQH 1CHOG 4H6TA 1MH0A 2Z9GA 3D62A 3Q3YA 1LQDB 2HOBA 3LGIA 4ZXXH 1O3IA 1O2GH 1CSOE 3SHAH 2D8WA 1XKBC 1QCPA 1A4WH 3UQOA 3PB1E 4CBNA 4R0IA 3SV8A 2Z3CA 1HAZB 5HM2A 5JPMH 3HKJB 3S7KB 1GHBF 2ZGHA 2VIDA 2XBXA 3T2NA 1OWIA 4B2AA 1HYLA 5GWZA 1GBDA 2PKAA 4O9VA 3UOUA 1P9SA 1BRAA 4MPVA 4DGJA 5L30H 2ZFPH 4JK6A 3SV6A 1DX5M 3LC5A 3ZZ8A 1TBRH 4X1SU 3GOVB 3VB5A 1F92A 3FP6E 2ZDLA 2QF0A 5EOKA 1O2TA 3RXPA 2AFQB 2ZHFH 1A5HA 6CHAC 4JYTA 1DSUA 1O5EH 1JIMA 2NU1E 3A82A 5GPIB 3ATWA 1TOCB 1MKWH 3UY9A 1TX7A 4WJG2 3ATLA 3RXGA 1QBOA 1C2KA 3GY8A 1YPKH 3TGIE 4TY7A 3D23A 3FANA 3T27A 1GJ8B 1WQSA 5AVDA 1F5KU 1RTLA 4NFFA 3RMNH 4KKDA 1C1QA 1UCYK 3NKKA 3RXBA 3SNBA 1L0ZA 1SG8B 1T8OA 2A5AA 4OS4A 2XBVA 1BT7A 1PPGE 1A1RA 3ODFA 1GI3A 1WUNH 2TGDA 1TAWA 3UIRA 3EYDA 2G81E 1W3CA 3RLYH 1S82A 2O8WA 1CQQA 2BY6X 1G36A 1UK4A 1WTGH 1GDUA 2PUXB 3QN7A 3A8BA 1ZMLA 4BOHA 1HBTH 2R0KA 1D3QB 3MTYA 4TPYA 4BAKB 1O2QA 3ZVEA 2H2ZA 1ETRH 1WTHD 1YPEH 1BRCE 4X8UH 4B71A 1VR1H 1FXYA 1JMOH 2ZU5A 3ZVAA 2BDCA 3OX7U 2O8TA 2JETB 3RMMH 2A4GA 1QL7A 1GBFA 1SGRE 3RXSA 3RM2H 3QGNB 1EZSC 3ZV8A 2QXJA 4MVNA 5GJ4B 4K1EA 3QGJA 3GISB 1BZXE 2BDGA 3F9EA 1C1NA 2SGDE 1CGJE 3SJ9A 1TMBH 3RXHA 2B9LA 3Q77A 4J1YA 5EW2H 3BIUH 2Y7ZA 1SSXA 1C2HA 2GCTC 3VB4A 5E2OA 2Z9JA 1XUIA 1TABE 3RC6A 1DANH 4MQAA 4Y11E 3FFGA 5L6NH 3MHWU 2WV4A 1O3OA 1OWJA 1C5NH 5AF9H 1MCTA 1OWDA 3RU4T 3QTVH 3L3TA 4FUHA 4ZMAH 4NG9H 1QQUA 1E35B 2OQ5A 1IQIA 2OC8A 2AH4X 1EKBB 1C4Y2 2TGPZ 2XC0A 3LPRA 1RRKA 3RXJA 3A83A 1QNJA 3SGAE 4INKA 1AD8H 2FDAA 2NU4E 1RJXB 1YLDA 3RMLH 3SU5A 4CHAC 1KTTB 3TH3H 1UMAH 2P3TB 2C8ZB 1XM1A 2V35A 5HGGA 4K8BA 4I8GA 1TGSZ 2VJ1A 1DM4B 1GJ4H 4VGCC 1TPAE 4MG3A 3V12A 4BAHB 2BY9X 4MLFB 4INHA 1G37A 1O2OA 1L4DA 1LVOA 1WU1A 2ZO3H 2CF8H 2SGFE 4WWYA 3TNSA 1HAVB 1GMDF 1GVZA 1G2MA 1VJ9U 1W10U 2AGEX 3SQHE 5F8TA 2F9NA 1UHBB 3BEUA 2ZECA 2UUKB 3RXAA 1C4V2 3E1XB 2ZDNA 3N7OA 4X6MA 2XWAA 2V6NA 2XCNA 3PLPA 1A5IA 1ARBA 1OKXA 2FYRA 1O2NA 2HNTF 3KL6A 4GPGA 1TGNA 1Z1IA 2P3FH 7GCHF 5A0AE 1FPHH 1QA0A 2PSYA 5CMXH 4CRBA 1GMCF 1GBBA 3E8LA 1EP6A 3VXFH 1EATA 1D4PB 2WUBA 2FI3E 4HFPB 1C1TA 3SJKA 2ZPQA 1KXAA 1O31A 3M37A 1EAWA 2ZDMA 3O8DA 1UTPA 1LCYA 3GCTG 1TGTA 2A5KA 2FLRH 1SFQB 4X2VA 1SI5H 1HXFH 1V2LT 2G51A 4KTCA 2HVXA 1VJAU 3C27B 4OS2A 3BG4C 2V3HH 1FY8E 4UFDH 5GIBA 3ZYDA 2CHAC 2VIPA 3MH6A 3PMAB 2JH6D 2H6MA 1C1OA 4B76A 2FOHA 1DFPA 1YPMH 4BTTB 5IDKA 1DLEA 1O5DH 1TALA 1K28D 1WSSH 4FU8A 1O2LA 4UFFH 1NFXA 1ZTJA 1A3BH 1JWTA 4SGAE 3MH5A 4CRCA 2H5CA 5AFZH 1V2QT 4X8TH 3ZVGA 4A6LA 1DWCH 5EW1H 4YT6H 3K6ZA 5E0HA 2FESH 2PTNA 2UUJB 4DY7B 3SZNA 4Z6AH 3OU0A 1KTSB 3PTNA 1BMMH 1O37A 1OWEA 3KN2A 3EA8A 2P8OC 3P8GA 1Y3UA 1HJAB 1IQKA 8GCHF 1PFXC 1EPTA 2ZHQH 3BTGE 4LXBH 5ESBA 3PLKA 1P10A 1BTYA 1K9OE 4XBBA 1YF4A 2R9PA 2XBYA 1AN1E 1AWHB 1O5GH 2Y5FA 4FU9A 4BAQB 2BOHB 1P0SH 5L2ZH 1SLVB 1UTQA 1Y3WA 2Z9IA 2C93B 1QB9A 2XCFA 1HNEE 5FPTA 1C2IA 3FVFB 3SU3A 4X2WA 4ZHMU 1TRYA 2G4TA 3U9AH 1C2LA 1F5RA 4KELA 4YTAA 1XUHA 1PQ5A 3SUEA 4F4OC 4DT7B 1GI0A 4ABIA 1GI2A 1QJ6B 5GCHF 1XUFA 3SNCA 1E36B 4I32A 4ZKOU 3SI4H 1IQGA 2Q1JA 1MMJN 1NZQH 2QYIA 5EGMA 3EA9A 5DP6A 1ZLRA 4NIVA 4ABBA 3RXKA 2YNBA 1CHGA 1CBWC 2VH6A 4DVAU 1AIXH 2VVUA 3B9FH 3LH1A 1VGCB 1Z1JA 2BLOA 4Y7BA 4H42U 3GY7A 1EP5A 2BVRH 2FX6A 3SU1A 3ZZ6A 1O2VA 2OTVA 1GJAB 1RXPA 1O2JA 4ZUHA 3KNXA 1IQNA 3MH4A 1GCTC 1RFNA 1O3GA 1LHDH 1ZSKA 3BTQE 1GJCB 3AW1A 4WMFA 2ZP0H 1NRPH 4BANB 3A86A 3TK5A 4IS5A 1TNLA 1QR3E 1HAVA 2BD9A 1FUJA 1O2PA 1TWXB 1C5XB 1YKTA 3QZRA 1JIRA 1AKSB 3A7WA 2ZTZA 1K1IA 2F91A 4TY6A 1O2RA 3Q3XA 4X6OA 2KAIA 2Z3DA 2ZHEH 1HGTH 5EXNA 4MNYA 3LT3A 1O3EA 1O3FA 4FUIA 2C8YB 2BLQA 1MQ5A 3LGYA 5DK1A 2ZCHP 1ELDE 1C2EA 1UCYE 3A7VA 3NUMA 7GCHG 2G5VA 1O2KA 3BSQA 2WYGA 4ZXYH 3RXMA 1C9PA 1P2QA 1GI9B 1UVTH 1C5MD 1CBWB 2ZF0H 3ESTA 2AMQA 4UEHH 2FMJA 1T7CA 1UTNA 1V2MT 2AEIH 2O8UA 2FWWA 3GY5A 3MH7A 1PJPA 1P05A 4BXSA 1TFXA 4D9RA 3NK8A 4CH2B 1GCTB 1WAYB 3UR9A 3GYLB 1H4WA 2FYQA 1O5AB 5ETXA 5FCKA 1AFQB 3UPEA 3M7QA 4A1VA 1NC6A 4NA7A 3RLWH 1BUIA 4KGAA 4Y8YA 3P95A 2C90B 1ETTH 3W95A 7LPRA 3KCGH 3LDXH 1AMHA 1MBMA 4NA9H 3GCHC 1GI1A 1AVXA 3M61U 4AOQA 2A5IA 3HATH 1O30A 3K2UA 1C2FA 1GVLA 2ZGBH 5TJXA 2ZPSA 2QCYA 4HTCH 1S0RA 4WVPE 3TGKE 1AI8H 1UTOA 1YBWA 3BTEE 3F6UH 1QB6A 1UK2A 1MTSA 1OWKA 1W14U 1IQJA 1EZXC 1GBAA 1O3BA 2FI5E 6ESTA 1OS8A 1EJNA 4ISIH 3U8RH 3I29A 4GSOA 4WXIA 2PFEA 4OS6A 1V2OT 1AGJA 4I8KA 2SGEE 1OP2A 2IPHA 1J17T 5ABWA 2A7HA 1QURH 5DO4H 1U6QA 1ZGIA 3DA9B 2OBQA 1S84A 4AN7A 3SU6A 1MTNC 3KHVA 4IN1A 1QL8A 3RC4A 1YPHC 3RXLA 1NRSH 1ANCA 2GV7A 1HXEH 1P06A 2OUAA 1MZDA 1F0SA 1A0LA 1W0ZU 1P2JA 3P70B 2XYAA 3PMHB 4DG4A 2ZFSA 2B7DH 3BG8A 3TH4H 5E2PA 3OY6U 4IGDA 4UD9H 1AB9B 1E34B 3U98H 3IWMA 2BDYA 1YLCA 1FAXA 1Z8IB 1MD8A 2FXRA 4BAOB 9LPRA 4FUFA 4GVUA 1ELGA 4WH8A 2NU0E 3U69H 2QV1A 1RD3B 2Y5GA 4NIYA 2PKAB 4Y10E 1O3KA 1KLTA 1O2WA 2GDEH 3CP7A 3P8NA 1NM6A 2D26C 1PQAA 4TWWA 3LKWA 5FX6A 2RG3A 1C1RA 1NFWA 2UWPA 1SQTA 1KLIH 3VGCB 3UNQA 1GBCA 3A8DA 1LHFH 3M3SA 2AGGX 1FZZA 1TGBA 2WPLS 3LGUA 2F9OA 2J2UA 2BDAA 1H9LB 4GCHG 2VWLA 4AFQA 4ISNA 4YOGA 3AAUA 3SORA 5SGAE 1BMLA 1GG6C 3ZZBA 3RU4D 1S81A 2HNTE 2FLBH 3NCLA 3EQ0H 3MO9A 2FPZA 1AB9C 1SFIA 1VGCC 2J94A 1IHTH 1JBUH 1B0EA 2W7UA 4Y7AA 2STAE 3TK9A 2CGAA 3MNXA 1ELFA 1UTLM 1SGFG 1KDQB 1MTUA 1QRZA 1Y59T 3A7TA 3C1KA 1HPGA 1UVOA 3BTKE 2PW8H 4A1TA 1GHAF 2TGTA 1VZQH 1QGFA 2G8TA 3MU4A 1TMTH 1S6HA 1LKAA 4AORA 2FOEA 4Y0ZE 3UNSA 2TRMA 1S5SA 5DP9A 4ISOA 1P3EA 3VB6A 3F9GA 1Y8TA 3MI4A 1H9IE 2PV9B 2ZEBA 1GVKB 2Q6GA 2GT8A 2BDBA 1D3PB 4HZHA 1P2OA 4IN2A 2ZC9H 1FIZA 5CHAB 3GY2A 1HIAA 2AYWA 4ABHA 1JRSA 4ABGA 2CN0H 4WMDA 3KGPA 1O2HA 4ASHA 1GMHF 2AIPA 5C5NA 2BXTH 4ZKSU 2XW9A 4FVDA 3BIVH 5GCHG 3SU4A 4CRFA 1YCPM 4CBOA 3A7ZA 3LGTA 2QA9E 1C5ZB 3TVJB 1GCDA 1SVPA 1TOMH 2Z9LA 1GGDC 1GL0E 3PM3A 1ZPZA 2VWNA 2IN2A 3HGPA 4X0WU 1K2I1 4BXWA 1EASA 2XTTB 1ZTLA 1A5GH 1EPTB 1UTJA 2Y81A 2ZKSA 3RM0H 1O34A 4XDEA 2F9BH 3M7TA 5L2YH 1QB1A 1EOJA 3PLBA 1WBGB 4K5ZA 1Y5AT 1V2ST 3EA7A 1FAKH 1O38A 3A81A 1FY4A 1V2PT 1YPHE 4U01A 1L2EA 1N8OC 1NFUA 3QDZB 5A8ZA 3STIA 2Y7XA 2ZCKP 4R8TB 2P16A 4FXGH 1DXWA 5C67A 3EAJA 2EEKA 1VCWA 4DJZB 3TITA 7ESTE 1K1LA 1IHSH 4Y79A 5FBEA 2FS8A 1CGHA 2YNAA 1VITF 1SL3A 5I46H 4NWLA 1TNGA 3RU4E 2ZHWH 5DGJA 5DP3A 1HB0B 1RTKA 1KSNA 2JH0D 1BTWA 1KXEA 2AS9A 1RTFB 2CJIA 2ANYA 4H6SB 1JXPA 1AO5A 3MO6A 2C8WB 1GJBB 4YLQH 1OYTH 2ANMH 1NU7B 1HAXB 2ZFFH 3EDXB 1VITH 2LNCA 1O3PB 3S7HB 2BTCE 3SOSA 1QJ1B 1J15A 1KIGH 4MNXA 1YCPH 1A46H 4B2BA 3WY8A 3UOPA 1NROH 4XBCA 3M5MA 5EG4A 5DG6A 2P59A 2BX3A 5T6GA 2OD3B 2C4FH 3ZZAA 2QAAA 1D9IA 1C2MA 1AFEH 4NIWA 3MU8A 4XOJA 4AG2A 1ZHMA 1PYTC 1BRUP 1TRNA 2AERH 1T8MA 1Z8JB 1YP9A 1GBTA 4A5TS 1WYKA 1J16A 2B5TB 1C2GA 2GV6A 4FUEA 2VGCB 3GDSA 1BTZA 2HGTH 3VB3A 1YPGH 2FOMB 4KTUA 1Y5BT 3URCA 5A8XA 2WPIS 3RC5A 2WV5A 1GJ7B 1S0QA 3I77A 2P95A 2HPPH 4Y8XA 1AZ8A 5HM9A 4U30A 2FP7B 1NO9H 1D3TB 6CHAB 1NFYA 3F1SB 5F6MA 1N6XA 5C5OA 1MKXH 4IBLH 1T8LA 3TLOA 1BHXF 2WINI 2PKSB 2GCHF 1H9HE 3GYMA 2ODYB 4LZ4B 1MKXK 2QXGA 6LPRA 3DUXH 1AKSA 1GI5A 1NRQH 3U1JB 1L4ZA 4K60A 8ESTE 2J34A 4WF8A 5C1UA 3BTTE 4ABDA 2RCEA 1KXCA 2VINA 4FUGA 1OWHA 1BOQA 2VVVA 2XRCA 1SGDE 3VEQB 1IQEA 2O9QA 1SGNE 2ZTYA 3ATKA 2GGVB 3KQBA 1P2MA 3BTHE 1T32A 5K0HA 1BB0B 2XC5A 1K22H 2ZFTA 4FUDA 1VCQA 2ZQ2A 2XNIA 1AE8H 1GJDB 4ZHLU 1O5BB 1ZR0A 2R3UA 2FS9A 3IG6B 1EB1H 1EZUC 1BTPA 1DVAH 1MAXA 2PHBA 2W3KA 4X6PA 1TNKA 1A3EH 1SGTA 3ZV9A 1HUTH 5EQQA 1XUGA 5DP5A 3SGBE 3M35A 3SNEA 4AB9A 3HPTB 1P09A 2ZA5A 2A45B 1AU8A 1ANDA 1GJ5H 2ANKH 2GZ7A 1ESBA 4X1NU 4NSYA 4FVBA 3T26A 3E6PH 1LHEH 3B23B 3SV9A 5IYTA 1FI8A 2WUCA 1L1GA 3FAOA 4LK4A 1KLJH 1IQMA 1TMUH 1V2NT 1RIWC 1GBKA 2PKSC 3MU1A 3ZZ5A 1ZGVA 1O5CB 2ZG0H 2HALA 2ZDVH 2GCTB 4GLYA 1O36A 2ZZUH 2ZU2A 2YOLA 3FP8E 4ISHH 5JBAS 3ZYEA 5FPSA 1V2RT 3QK1A 3SNDA 5JBCS 1K1MA 4B2CA 2O8MA 2BZ6H 4GAWA 5C20A 1LVMA 5CE1A 2QGRA 2BY8X 5DKMA 1B7XB 1GHXH 3DHKH 4ABJA 3H7TA 3A7YA 1YPLH 3RXEA 1UTKA 3PO1B 4MPXA 3V7TA 4AFZA 2TGAA 3R0FA 2B0FA 1TE0A 1C1VH 1BBRH 5FPYA 3QX5H 4I8LA 2J95A 4CHAB 4ESTE 1TIOA 2UWOA 3SNAA 1SGPE 1DLKB 1GHBG 3R3GB 3TH2H 2B8OH 4DURA 2W3IA 1MQ6A 1O5FH 1CE5A 1C2JA 1ZJDA 4OS7A 3LONA 4F49A 1YM0A 4NZLA 2FZZA 2K1QA 4ZAEA 5T3HA 1GI7B 3K65B 6GCHG 1DOJA 2Q6DA 1N8OB 1ZHRA 2F3CE 4O97A 2WPKS 1YCPK 3URDA 1OPHB 1SOZA 3NWUA 3PMJA 4K2YA 4CR9A 3A87A 1HDTH 3T25A 2Y82A 3RXFA 3RMOH 2BHGA 2GDDA 1TX8A 1WV7H 4YESB 3T62A 1MTWA 2ZGXH 3P6ZB 3AW0A 2BY5X 1CU1A 3I78A 1SC8U 5JBBS 3T28A 2FEQH 1C5UA 3PWBA 4XSKU 1SGEE 1RS0A 5DPAA 2KAIB 5DJ7A 5C1YA 3QWCH 3GCOA 1AUJA 2ZIQH 1O3HA 1XUKA 1ESAA 1FV9A 3U8TH 4CRDA 1VCPA 4K8YA 4Q7ZA 3CS7A 1ZPCA 4GUXA 4X6NA 1ABIH 3E0PB 1N1LA 1D6RA 4INLA 3P17H 2NU2E 1F7ZA 3MFJA 3EE0B 1TX6A 2BD7A 1AVWA 1BHXB 1T31A 1A0JA 2ANWA 3V3MA 3M3VA 2UWLA 1SR5C 1O2UA 2GZ8A 5AHGH 2XWBI 2JKHA 5C1XA 1G32B 1FN8A 3Q00A 1BBRK 2H9TH 1T4VH 1UO6A 1J9CH 2BD2A 4TPIZ 1Q3XA 2ALPA 2QF3A 2ODPA 4IW4E 2ASUB 2D1JA 5FHTA 3D49H 4AYYB 4ZROA 3BTME 3MNSA 4YT7H 1NY22
chains in the Genus database with same CATH superfamily
1EB2A 2A2QH 1QZ8A 3LC3A 1E1QD 1C5YB 1L1NA 4JZDH 1T4UH 2PSXA 2PLXA 2VIQA 3FP7E 2F83A 4JZIA 3GDUA 2FO9A 4GCHF 3UNRA 1Z8RA 1ZRBA 2RA0A 4JYUH 2ZGJA 4JMYA 4AFSA 2BLWA 1T8NA 1HLTH 1GL1A 5A2MH 2W6JD 3VFEA 1EAXA 2P8OB 2NWNA 4M7GA 2KCAA 5J4QA 3MWIU 1K21H 2SFAA 2BYAX 5EQRA 3ELAH 4JZ1A 1EXFA 4B74A 4AFUA 3TK6A 1CA8B 2BMGB 4VGCB 1SOTA 3A8AA 3QUMP 3A80A 1TGCA 1GDQA 3Q3KA 3N99A 2VIVA 2NU3E 3SJIA 1KY9A 4PROA 1ZYOA 4OS1A 1QBVH 5LPFA 4X8VH 1V2KT 1M9UA 3H5CB 4ABEA 1V2JT 7KMEH 2WYJA 2OC1A 1OP0A 2FOBA 3RXDA 2UUYA 1EZQA 1KYNA 1F0RA 2TPIZ 1NESE 1IOEA 1NS3A 2QN5T 5EQSA 2V0BA 1V6DA 3A88A 3RXQA 4JZEH 1SPJA 1PPHE 1BJVA 3B8JA 1PQ8A 1YC0A 4UFGH 4RKJB 1PYTD 3S9CA 1FN6A 1RIWB 6GCHF 1OHHD 5HIYA 5A09A 5FCRA 3LGVA 1C5QA 3RXRA 5DP4A 2ODQA 3UFAA 2F9VA 1NBMD 2BD8A 2HNTC 1DWBH 2ZU4A 4CRGA 1FY5A 4QT8C 5A8YA 4FUBA 1LVBA 1BTHH 1SGIB 3ZVCA 3VB7A 1NU9A 2R2WU 2ZCLP 2ZU1A 1GPZA 2ZI2H 1ARCA 1IQLA 3D65E 2EI8A 3TGJE 4FUJA 4ZH8A 1TPSA 1V2VT 1S83A 4AGJA 3SJ8A 3PMBB 2FOAA 1CGIE 5FX5A 3PO1C 2G55A 1EUFA 1BITA 2RFKC 1O32A 4X2YA 1Z8GA 3SQEE 1XX9A 3M5LA 1QL9A 3QZQA 2CHAB 5JB9S 1E0FD 1YGCH 1SGCA 1ANEA 3KQ5A 4XE4A 5T6DA 1KXBA 1W11U 1A2CH 2W7SA 2KZ4A 1PPZA 1P04A 2DE9A 2JETC 2SGAA 4ZCNA 2RA3A 1DY9A 5ESTE 1ZRKA 1WCZA 1IAUA 3DT0H 5PTPA 1EQ9A 4MDSA 4WH6A 1ELCA 3BF6H 3S9AA 3MNBA 3BG4B 4TYDA 4A1XA 1OSSA 4Q2KA 1MBQA 1ZZZA 3GY3A 4O03A 1P9UA 1O3LA 4E7RG 2FIRH 1S85A 2VVCA 2OBOA 3RXOA 1UJ1A 5FBIA 1DSTA 2OP9A 1UVPA 2HPQH 1THSH 3SO3A 1TPOA 3STJA 2CK3D 4Z1MD 1O3DA 2BVXH 1ZPBA 2ZPRA 2UUFB 1TQ0B 1TRMA 1W8BH 2GP9B 4NWKA 1V2WT 3FOAA 4ISLA 4B75A 1C1PA 3IITA 1D3DB 3E91A 2ZFRH 5EXMA 2BD4A 4ZKRU 1HRTH 1SLXB 5LPEA 1G3BA 4AB8A 4BTIB 1GBIA 3RP2A 2J38A 3CS0A 1BQYA 2PGQB 5JYIA 4BTUB 1W2KH 1FMGA 1TYNA 1P57B 2R2MB 4X1RU 2IJOB 5HIZA 2FOGA 3QLPH 5BPEA 1G2LA 1ETSH 3TJUA 2EQNA 4HI3A 2W5EA 2VWOA 3OTJE 1W0JD 4B1TA 5F8XA 3DSGA 4B73A 1ELVA 1FQ3A 4ABFA 5GNDA 5GXPA 1HAYB 1Z71A 1BMNH 3PV2A 1SLUB 4Y76A 4IC6A 2QC2A 4Z0KA 3F68H 4O3TA 5LGOA 1XXFA 4U2WA 2XXLA 2J92A 1CA0B 1W7XH 3SBKA 4JYVH 1BCUH 3G01A 1C1UH 5LH8A 3ATIA 2WPMS 5F03A 3SV7A 2ZDKA 3SUFA 1DT2A 1O33A 3ITIA 2ESTE 3SUGA 4A7IB 1EJAA 4NIXA 1GBMA 3LOXA 1ELBA 1Q31A 2C8XB 1O3CA 1C5PA 4Q80A 3DFLA 3GY6A 2KCYA 2GCHG 1P2IA 4CRAA 1LDTT 1O2MA 1CHOF 2BD3A 3LIWA 1GHAG 1UVUH 3UREA 1C1WH 4NSVA 4U32A 1UVSH 2BD5A 2Z3EA 1TPPA 3K6YA 1H8DH 1FY3A 4JCNA 2PTCE 3MYWA 1GBHA 2AMPA 3NRLA 4Y0YE 3MO3A 3GDVA 2FOFA 3VXEH 1S6LA 4OS5A 1P2KA 1PPCE 9ESTA 1HAPH 1DWEH 1GMDG 5F8ZA 1OYQA 2RDLA 3TIUA 1A7SA 1Z6EA 1BBRE 1GJ9B 3TJVA 1QA7A 2Q6FA 3SJOA 4DOQA 1XMNB 1V2UT 4Y6DA 3AVZA 2GVFA 4AGKA 2SNWA 4YM9A 2QY0B 2BXUH 3OY5U 2VIWA 3ZZ3A 2KCOA 1MZAA 3FZDA 2BX4A 2WPJS 1P01A 3OSYA 1FLEE 2ALVA 2F9PA 1C5WB 3LU9B 3UWJH 2BLVA 4NA8A 3HGNA 3ZVBA 2VIOA 4I31A 1FDPA 2EI7A 2L6OA 3PROA 1EX3A 1UHBA 5E0GA 2DUCA 1MU8B 1CVWH 1SB1H 1XXDA 2OLGA 1GG6B 2EC9H 3P92A 3ZZCA 2J98A 3FO8D 3WWFA 2V3MA 1B5GH 1GMHG 1LVYA 1AE5A 2Y80A 4D7GA 3A84A 2THFB 3BTFE 2C3SA 2BVSH 2VH0A 2FM2A 3P8OA 5K7RA 1HJAC 1F2SE 1ZMJA 3BEFB 1QFKH 4I33A 1LTOA 3MU0A 4LOYH 1EAIA 1GMCG 4JK5A 4Q4LA 2KCPA 2OC7A 1W12U 2IOTA 3PTBA 4K1TA 2GX4A 5DP8A 1QIXB 3TPIZ 1MTVA 1JRTA 3RXCA 1K1NA 2VWMA 4ZKNU 3NXPA 1C5VA 2PGBB 3OAAD 5C3NA 2EI6A 1C5LH 5FL7D 1J8AA 2FOCA 1B0FA 2A7CA 3PWCA 1HAGE 5CHAC 1GHVH 1GHZA 1HFDA 2V3OH 1O3MA 2ZTXA 3M36A 1EOLA 1P8VC 1ORFA 5EU8A 1DDJA 1C1MA 1G3CA 3KQDA 4DIIH 3LH3A 1AQ7A 1HV7A 1ACBE 1NRRH 1D6WA 2G52A 4RSPA 1Y3YA 3OTPA 1VITG 2OC0A 1O2IA 4AX9H 3A89A 1ELEE 4Y71A 1THPB 4LZ1H 3K9XB 2A4RA 2H1UA 4E06H 2H9EH 1SGFA 2A4QA 1PPFE 1TB6H 1SHHB 1O3JA 3SW2B 3ZZ9A 2R3YA 1TA6A 1O2SA 4XD7D 1O2YA 1DWDH 3PV4A 2AGIX 4H4FA 1E37B 1THRH 5I25A 2PWXA 1JOUB 2J4IA 1Z7KA 2FI4E 4OGYA 4BNRA 2QXHA 4FU7A 2OXSA 4AZ2B 3E0NB 1MUEB 1ESTA 2HRVA 2A0QB 1QBNA 3BV9B 1DUEA 1WDIA 3QO6A 1AUTC 3OYPA 2BDHA 2G5NA 4DW2U 3SU0A 1AVGH 1FX0B 3A85A 3SI3H 1LHCH 5H4IB 1FONA 1CT2E 1TNJA 3HK3B 1GI4A 1LMWB 1MU6B 3UUZA 3KF2A 3V0XA 5B6OA 1QRWA 1C5SA 2CV3A 5EJZA 3JZ1B 4YZUA 1TNHA 3BTWE 3DFJA 3SGQE 1ZOMA 4X1PU 2K8IA 1ZSJA 3JZ2B 3ZZDA 1WOFA 3UTUH 1H1BA 1F0TA 4YOIA 5JBTA 2Y5HA 2VU8E 3ODDA 3RXUA 1CT0E 1LPZB 3O8BA 2XOKD 4CREA 1TBZH 1W7GH 4UE7H 4X8SH 1CA0C 3F2HA 1MAYA 3UAIC 3TNTA 3DSOA 3QTOH 1QY6A 3VGCC 5EODA 1KDQA 3V13A 3F9HA 2A1DB 2XBWA 1INCA 2BDIA 8KME2 2BZAA 1SHYA 4FUCA 1FPCH 2FTMA 1KXDA 1YYY1 1FJSA 1QJ7B 1O3NA 2A4OA 3S0NA 2ILNA 3F3BA 3ATMA 1AFQC 1MD7A 1MKWK 4K3JA 2ULLA 1HJ9A 1G3DA 1MCVA 5A0CA 1TBQH 4A92A 2GKVE 4DIHH 8GCHG 2VGCC 1UCYH 1LQEA 1LO6A 2Z94A 5GDSH 3M3TA 1HCGA 3GCHB 4OGXA 5TCCA 1K1OA 1TLDA 1TQ7B 3ZVDA 1A0HB 4Q7XA 4D8NA 2STBE 3MOCA 3U1IB 2FTLE 1H8IH 5E8EH 1Z6JH 2TIOA 4NFEA 3RXVA 1G30B 2ZNKH 4CR5A 5C2ZA 1IQHA 3BN9A 2OCVB 1Q2WA 3RDZA 2W6ID 1P2NA 1QQ4A 2GMTB 2XC4A 4AYVB 1F0UA 3LJJA 2XNDD 1LPKB 1C5TA 2TBSA 1HAOH 1DITH 5KEDA 4GHQA 1AHTH 1GGDB 1P02A 1WQVH 1G9IE 3ZZ4A 3L33A 4TWYA 1GBLA 5J4SA 3F9FA 4MNWA 1P03A 2W26A 1SBWA 5E0JA 1HJ8A 2M5TA 1EPTC 1MTNB 1NRNH 2A31A 5B6LA 1O0DH 4MNVA 3VPKA 1NT1A 2QE7D 4D9QA 2BOKA 1GHYH 1FY1A 1V2TT 1ZJKA 1BIOA 1QTFA 2GT7A 3W94A 4RKOB 4TT3D 4UFEH 3TJOA 1ANBA 1O39A 4MPWA 3UWIA 4NCYA 1TA2A 1Y3XA 1OOKB 2BQ7B 1DS2E 2AIQA 4YO9A 1RGQA 3LGWA 2WSSD 2P94A 1QHRB 2GD4B 1AY6H 4BAMB 1OXGA 4YXWD 1C1SA 1ID5H 2VB0A 1KXFA 3E90B 4M9FA 1AWFH 1V3XA 4K69A 4WY3A 3SZEA 1UTMA 4GHTA 1C5OH 4I8HA 1O3AA 5HMAA 1C9TA 4XBDA 2BQ6B 2PR3A 1YWUA 2A2XH 1BA8B 4I8JA 1BDAA 2V7QD 2EA3A 1OX1A 3PRBA 1GWAA 2GMTC 1XVOA 1K1PA 1G3EA 2CXVA 3SUDA 2HWLB 2H9HA 3NPSA 5EPYA 5HYOA 3A8CA 2G4UA 2BQWB 5A0BA 1O2XA 2A32A 1XKAC 1GDNA 2P3UB 4YOJA 1BTXA 3KQEA 1TONA 5AFYH 2I6SA 1YPJH 4I7YH 1GJ6A 4CH8B 2Y6TA 3EGKH 5FXLA 3GCNA 5T6FA 3KIDU 2RDEA 1O2ZA 2QIQA 3S9BA 1DPOA 1C4U2 1LPGB 1NPMA 5EXLA 1O35A 1C2DA 2LELA 4K1SA 4E7NA 1H8ED 1SQAA 3U8OH 2OQUA 1HAIH 5JB8S 4HGCA 1C5RA 3HKIB 3O8CA 4KTSA 3SHCH 3M7UA 4F48B 4THNH 1NTPA 1DICA 3S69A 2ZWLH 2LPRA 3Q76A 1SLWB 3E3TA 3N7DA 4IMZA 5IK2D 3KQCA 4ACAA 3RXIA 8LPRA 1CO7E 1DE7H 1E38B 4AG1A 1NN6A 5KECA 2G00A 1HAHH 1LHGH 1SGYE 1BRBE 3W1EA 1N6YA 1PPEE 3ZVFA 1BJUA 2R0LA 3TU7H 2VNTA 3RXTA 2OINA 1ABJH 2J97A 1GBEA 3FKSD 3PYHA 3H7OA 4J2YB 4WMEA 1P12E 2ZDAH 4DCDA 2HLCA 4MTBA 1BTUA 2ZU3A 1GI6A 4Q7YA 2FODA 4SGBE 4RN6A 2ZFQH 1F5LA 3GCTF 4IC5A 2P93A 1GI8B 3KEEA 5HXFA 3UR6A 4ABAA 1ZSLA 2O8LA 1BMAA 1ELAA 3BTDE 1GHWH 3LJOA 1SQOA 2ZGCA 2FX4A 1OP8A 3FZZA 4UDWH 3SU2A 3H09A 3TJNA 4X1QU 3M5NA 1IQFA 1ELTA 1DUAA 3T29A 2Z9KA 1PQ7A 3AAVA 2GTBA 2A7JA 4E05H 2F9UA 1SGQE 1PPBH 3GY4A 1TNIA 1ZHPA 1COWD 2GZ9A 3A7XA 3E16B 4X2XA 1HIAB 4ZHAA 3ENSB 2H5DA 4Y8ZA 1UK3A 5DP7A 3HK6B 1AZZA 1LKBA 1A61H 5JDUB 4OM9A 3M5OA 1P3CA 1S6FA 4O3UA 1ZTKA 2YMSC 3MNCA 2D2DA 2I6QA 2Z7FE 2Z6BD 4JZFH 3O8RA 3SV2H 1EJMA 1W0YH 2ZQ1A 1Y5UT 4NGAH 1J14A 4NZQA 2SGPE 2J9NA 3MMGA 2SNVA 2AHME 3OEHD 5EPNA 2CF9H 1X7AC 2DE8A 1DXPA 1QRXA 5LPRA 3SYJA 1GBJA 3GICB 4RI0A 1Y3VA 2BM2A 4MPUA 5TCAA 2BB4A 1P11E 1XUJA 3RUOA 1FIWA 2HVYB 3CENA 2AMDA 4WXVA 1CT4E 3P8FA 2EY4C 2JH5D 3ZZ7A 2BY7X 3BEIB 1W13U 4D7FA 3UQVA 4UONA 2WPHS 2SGQE 3PV5A 1EAUA 3DD2H 4YLUA 1FNIA 4XFQA 1L1JA 3MU5A 1SMFE 4KP0A 2ZHDA 1K1JA 1XVMA 5G4BA 4Q63A 3T5FH 5BRRE 3L6PA 3NZIA 5FAHA 2CMYA 2QXIA 1ZMNA 3AASA 4IMQA 3SN8A 4D76A 1DY8A 2PUQH 1CHOG 4H6TA 1MH0A 2Z9GA 3D62A 3Q3YA 1LQDB 2HOBA 3LGIA 4ZXXH 1O3IA 1O2GH 1CSOE 3SHAH 2D8WA 1XKBC 1QCPA 1A4WH 3UQOA 3PB1E 4CBNA 4R0IA 3SV8A 2Z3CA 1HAZB 5HM2A 5JPMH 3HKJB 3S7KB 1GHBF 2ZGHA 2VIDA 2XBXA 3T2NA 1OWIA 4B2AA 1HYLA 5GWZA 1GBDA 2PKAA 4O9VA 3UOUA 1P9SA 1BRAA 4MPVA 4DGJA 5L30H 2ZFPH 4JK6A 3SV6A 1DX5M 3LC5A 3ZZ8A 1TBRH 4X1SU 3GOVB 3VB5A 1F92A 3FP6E 2ZDLA 2QF0A 5EOKA 1O2TA 3RXPA 2AFQB 2ZHFH 1A5HA 3OE7D 6CHAC 4JYTA 1DSUA 1O5EH 1JIMA 2NU1E 3A82A 5GPIB 3ATWA 1TOCB 1MKWH 3UY9A 1TX7A 4WJG2 3ATLA 3RXGA 1QBOA 1C2KA 3GY8A 1YPKH 3TGIE 3UB0A 4TY7A 3D23A 3FANA 3T27A 1GJ8B 1WQSA 5AVDA 1F5KU 1RTLA 4NFFA 2KR7A 3RMNH 4KKDA 1C1QA 1UCYK 3NKKA 3RXBA 3SNBA 2GJGA 1L0ZA 1SG8B 1T8OA 2A5AA 4OS4A 2XBVA 1BT7A 1PPGE 3WWBA 1A1RA 3ODFA 1GI3A 1WUNH 1YLNA 2TGDA 2JJ2D 1TAWA 3UIRA 3EYDA 2G81E 1W3CA 3RLYH 1S82A 2O8WA 1CQQA 2BY6X 1G36A 1UK4A 1WTGH 1GDUA 2PUXB 3QN7A 3A8BA 1ZMLA 4BOHA 1HBTH 2R0KA 1D3QB 3MTYA 4TPYA 4BAKB 1O2QA 3ZVEA 2H2ZA 1ETRH 1WTHD 1YPEH 1BRCE 4X8UH 2F43B 4B71A 1VR1H 1FXYA 1JMOH 2ZU5A 3ZVAA 2BDCA 3OX7U 2O8TA 2JETB 3RMMH 2A4GA 1QL7A 1GBFA 1SGRE 3RXSA 3RM2H 3QGNB 1EZSC 5EJLA 3ZV8A 2QXJA 3EE7A 4MVNA 5GJ4B 4K1EA 3QGJA 3GISB 1BZXE 2BDGA 3F9EA 1C1NA 2SGDE 1CGJE 3SJ9A 1TMBH 3RXHA 2B9LA 3Q77A 4J1YA 2VBCA 5EW2H 5C17A 3BIUH 2Y7ZA 1SSXA 3FN8A 1C2HA 2GCTC 3VB4A 5E2OA 2Z9JA 1XUIA 1TABE 3RC6A 1DANH 4MQAA 4Y11E 3FFGA 5L6NH 3MHWU 2WV4A 1O3OA 1OWJA 1C5NH 5AF9H 1MCTA 1OWDA 3RU4T 3QTVH 3L3TA 4XRNA 1E79D 4FUHA 4ZMAH 4NG9H 1QQUA 1E35B 2OQ5A 1IQIA 2OC8A 2AH4X 1EKBB 1C4Y2 2TGPZ 2XC0A 3LPRA 1RRKA 3DCLA 3RXJA 3A83A 1QNJA 3SGAE 4INKA 1AD8H 2FDAA 2NU4E 1RJXB 1YLDA 2WHXA 3RMLH 3SU5A 4CHAC 1KTTB 3TH3H 1UMAH 2P3TB 2C8ZB 1XM1A 1W0KD 2V35A 5HGGA 3KYFA 4K8BA 4I8GA 1TGSZ 2VJ1A 1DM4B 1GJ4H 4VGCC 1TPAE 1H8HD 4MG3A 3V12A 4BAHB 2BY9X 4MLFB 4INHA 1G37A 1O2OA 1L4DA 1LVOA 1WU1A 2ZO3H 2CF8H 2SGFE 4WWYA 3TNSA 1HAVB 1GMDF 1GVZA 1G2MA 1VJ9U 1W10U 2AGEX 2K0QA 3SQHE 5F8TA 2F9NA 1UHBB 3BEUA 2WZQA 2ZECA 2UUKB 3RXAA 1C4V2 3E1XB 2ZDNA 3N7OA 4X6MA 1UW7A 2XWAA 2V6NA 2XCNA 3PLPA 1A5IA 1ARBA 1OKXA 2FYRA 1O2NA 2HNTF 3KL6A 4GPGA 1TGNA 1Z1IA 2P3FH 7GCHF 5A0AE 1FPHH 1QA0A 2PSYA 5CMXH 4CRBA 1GMCF 1GBBA 3E8LA 1EP6A 3VXFH 1EATA 1D4PB 2WUBA 2FI3E 4HFPB 1C1TA 3SJKA 2ZPQA 1KXAA 1O31A 3M37A 1EAWA 2ZDMA 3F0OA 1UTPA 3O8DA 1LCYA 3GCTG 1TGTA 2A5KA 2FLRH 1SFQB 5C0TA 4X2VA 1SI5H 1HXFH 1V2LT 2G51A 4KTCA 2HVXA 1VJAU 3C27B 4OS2A 3BG4C 2L74A 2V3HH 1FY8E 4UFDH 5GIBA 3ZYDA 2CHAC 2VIPA 3MH6A 3PMAB 2JH6D 2H6MA 1C1OA 4B76A 2FOHA 1DFPA 1YPMH 4BTTB 5IDKA 4FETA 1DLEA 1O5DH 1TALA 1K28D 5DN6D 1WSSH 4FU8A 1O2LA 4UFFH 1NFXA 1ZTJA 1A3BH 1JWTA 4SGAE 3MH5A 4CRCA 2H5CA 5AFZH 1V2QT 4X8TH 3ZVGA 4A6LA 3U28C 1DWCH 5EW1H 4YT6H 3K6ZA 5C94A 5E0HA 2FESH 2PTNA 2UUJB 4DY7B 3SZNA 4Z6AH 3OU0A 1KTSB 3PTNA 1BMMH 1O37A 1OWEA 2JIZD 3KN2A 3EA8A 2P8OC 3P8GA 1Y3UA 1KMHB 1HJAB 4F55A 1IQKA 8GCHF 1PFXC 1EPTA 2ZHQH 3BTGE 4LXBH 5ESBA 3PLKA 1P10A 1BTYA 1K9OE 4XBBA 1YF4A 2R9PA 2XBYA 1AN1E 1AWHB 1O5GH 2Y5FA 3F2GA 4FU9A 4BAQB 2BOHB 3AK5A 5DSFA 3GS9A 1P0SH 5L2ZH 1SLVB 1UTQA 1Y3WA 2Z9IA 2C93B 1QB9A 4B6FA 2XCFA 1HNEE 5FPTA 1C2IA 3FVFB 3SU3A 4X2WA 4ZHMU 1TRYA 2G4TA 3U9AH 1C2LA 1F5RA 4KELA 4YTAA 3ZIAD 1XUHA 1PQ5A 3SUEA 4F4OC 4DT7B 1GI0A 4ABIA 1GI2A 1QJ6B 2YMSD 5GCHF 1XUFA 3SNCA 1E36B 4I32A 4ZKOU 3SI4H 1IQGA 2QF5A 2Q1JA 1MMJN 1NZQH 2QYIA 5EGMA 3EA9A 5DP6A 1ZLRA 4NIVA 4ABBA 3RXKA 2YNBA 1CHGA 1CBWC 2VH6A 4HG6A 4DVAU 1AIXH 2VVUA 3B9FH 1SKYE 3LH1A 1VGCB 1Z1JA 2BLOA 4Y7BA 4H42U 3GY7A 1EP5A 2BVRH 2KX4A 2FX6A 3SU1A 3ZZ6A 1O2VA 2OTVA 1GJAB 1RXPA 1O2JA 4ZUHA 3KNXA 1IQNA 3MH4A 1GCTC 1RFNA 1O3GA 1LHDH 1ZSKA 3BTQE 1GJCB 3AW1A 4WMFA 2ZP0H 1NRPH 4BANB 3A86A 3TK5A 4IS5A 1TNLA 1QR3E 1HAVA 5KGOA 2BD9A 1FUJA 1O2PA 1TWXB 1C5XB 1YKTA 3QZRA 1JIRA 1AKSB 3A7WA 2ZTZA 2QF4A 1K1IA 2F91A 4TY6A 1O2RA 3Q3XA 4X6OA 2KAIA 3DSPA 2Z3DA 2ZHEH 2M2AA 1HGTH 5EXNA 4MNYA 3LT3A 1O3EA 1O3FA 5T1VA 4FUIA 2C8YB 2BLQA 1MQ5A 3LGYA 5DK1A 2ZCHP 1ELDE 1C2EA 1UCYE 3A7VA 3NUMA 5EJ1A 7GCHG 2G5VA 1O2KA 3BSQA 2WYGA 4ZXYH 3RXMA 1C9PA 1P2QA 1GI9B 1UVTH 1C5MD 1CBWB 2ZF0H 3ESTA 2AMQA 4UEHH 2FMJA 1T7CA 1UTNA 1V2MT 2AEIH 2O8UA 2FWWA 3GY5A 3MH7A 1PJPA 1P05A 4BXSA 1TFXA 4D9RA 3NK8A 4CH2B 1GCTB 1WAYB 3UR9A 3GYLB 1H4WA 2FYQA 1O5AB 3F2FA 5ETXA 1E1RD 5FCKA 1AFQB 3UPEA 3M7QA 4A1VA 1NC6A 4NA7A 3RLWH 1BUIA 4KGAA 4Y8YA 3P95A 2C90B 1ETTH 3W95A 7LPRA 3KCGH 3LDXH 1AMHA 1MBMA 4NA9H 3GCHC 1GI1A 1AVXA 3M61U 4AOQA 2A5IA 3HATH 1O30A 3K2UA 1C2FA 1GVLA 2ZGBH 5TJXA 2ZPSA 2QCYA 1NBME 4HTCH 1S0RA 3CNRA 4WVPE 3TGKE 1AI8H 1UTOA 1YBWA 3BTEE 3F6UH 1WXRA 1QB6A 1UK2A 1MTSA 1OWKA 1W14U 1IQJA 1EZXC 1GBAA 1O3BA 2FI5E 2KM0A 1OS8A 6ESTA 1EJNA 4ISIH 3U8RH 3I29A 4GSOA 4WXIA 2PFEA 4OS6A 1V2OT 1AGJA 4I8KA 2SGEE 1OP2A 2IPHA 1J17T 5ABWA 2A7HA 1QURH 5DO4H 1U6QA 1ZGIA 3DA9B 2OBQA 4AC9A 1S84A 4AN7A 3SU6A 1MTNC 4TSFD 3KHVA 4IN1A 1QL8A 2PP6A 3RC4A 1YPHC 3RXLA 1NRSH 1ANCA 2GV7A 1HXEH 1P06A 2OUAA 1MZDA 1F0SA 1A0LA 1W0ZU 1P2JA 3P70B 2XYAA 3PMHB 4DG4A 2ZFSA 2B7DH 3BG8A 3TH4H 5E2PA 3OY6U 4IGDA 4UD9H 1AB9B 1E34B 3U98H 3IWMA 2BDYA 1YLCA 3PRDA 1FAXA 1Z8IB 1VKYA 1MD8A 2FXRA 4BAOB 9LPRA 4FUFA 4GVUA 1ELGA 3N7EA 4WH8A 2NU0E 3U69H 3WW7A 2QV1A 1RD3B 2Y5GA 4NIYA 2PKAB 4Y10E 1O3KA 1KLTA 1O2WA 2GDEH 3CP7A 3P8NA 1NM6A 2D26C 2J98B 1PQAA 4TWWA 3LKWA 5FX6A 2RG3A 1C1RA 4DT4A 1NFWA 2UWPA 1SQTA 1KLIH 3VGCB 3UNQA 1GBCA 3A8DA 1LHFH 3M3SA 2AGGX 1FZZA 1TGBA 2WPLS 3LGUA 5HKKD 2F9OA 2J2UA 2BDAA 1H9LB 4GCHG 2VWLA 4AFQA 4ISNA 4YOGA 3AAUA 3SORA 5SGAE 1BMLA 1GG6C 3ZZBA 3RU4D 1S81A 2HNTE 2FLBH 3NCLA 3EQ0H 2J5UA 3F0PA 3MO9A 2FPZA 1AB9C 1SFIA 1VGCC 2J94A 1IHTH 4FOUC 1JBUH 1B0EA 2W7UA 4Y7AA 2STAE 3TK9A 2CGAA 3MNXA 1ELFA 1UTLM 1SGFG 1KDQB 1MTUA 1QRZA 1Y59T 3A7TA 3C1KA 1HPGA 1UVOA 3BTKE 2PW8H 4A1TA 1GHAF 4B6EA 2TGTA 1VZQH 1QGFA 2G8TA 3MU4A 1TMTH 1S6HA 1LKAA 4AORA 2FOEA 4Y0ZE 3UNSA 2TRMA 1S5SA 5DP9A 4ISOA 1P3EA 3VB6A 3F9GA 1Y8TA 3MI4A 1H9IE 2PV9B 2ZEBA 1GVKB 2Q6GA 2GT8A 2BDBA 1MABB 1D3PB 4HZHA 1P2OA 4IN2A 2ZC9H 1FIZA 5CHAB 3GY2A 1HIAA 2AYWA 4ABHA 3OFND 1JRSA 4ABGA 2CN0H 4WMDA 3KGPA 1O2HA 4ASHA 1GMHF 2AIPA 5C5NA 2BXTH 3OEED 4ZKSU 2XW9A 4FVDA 3BIVH 5GCHG 3SU4A 4CRFA 1YCPM 4CBOA 3A7ZA 3LGTA 2QA9E 1C5ZB 3TVJB 1GCDA 1SVPA 1TOMH 2Z9LA 1GGDC 1GL0E 3PM3A 1ZPZA 2VWNA 2IN2A 3HGPA 4X0WU 4RT1A 1K2I1 4BXWA 1EASA 2XTTB 1ZTLA 1A5GH 1EPTB 1UTJA 2Y81A 2ZKSA 3RM0H 1O34A 1BMFD 4XDEA 2F9BH 1EFRD 3M7TA 5L2YH 1QB1A 1EOJA 3PLBA 1WBGB 4K5ZA 1Y5AT 1V2ST 3EA7A 1FAKH 1O38A 3A81A 1FY4A 1V2PT 1YPHE 4U01A 1L2EA 1N8OC 1NFUA 3QDZB 5A8ZA 3STIA 2Y7XA 2ZCKP 4R8TB 2P16A 4FXGH 1DXWA 5C67A 3EAJA 2EEKA 1VCWA 1K0HA 4DJZB 3TITA 7ESTE 1K1LA 1IHSH 4Y79A 5FBEA 2FS8A 1CGHA 2YNAA 1VITF 1SL3A 3MQKC 5I46H 4NWLA 1TNGA 3RU4E 2ZHWH 5DGJA 5DP3A 1HB0B 1RTKA 1KSNA 2JH0D 1BTWA 1KXEA 2AS9A 1RTFB 2CJIA 2ANYA 4H6SB 1JXPA 1AO5A 3MO6A 2C8WB 1GJBB 4YLQH 1OYTH 2ANMH 1NU7B 1HAXB 2ZFFH 3EDXB 1VITH 2LNCA 1O3PB 3S7HB 2BTCE 3SOSA 1QJ1B 5EIYA 1J15A 1KIGH 4MNXA 1YCPH 1A46H 4B2BA 3WY8A 3UOPA 1NROH 4XBCA 3M5MA 5EG4A 5DG6A 2P59A 2BX3A 2OK5A 5T6GA 2OD3B 2C4FH 3ZZAA 2QAAA 1D9IA 1C2MA 2WPDD 1AFEH 4NIWA 2LP6A 3MU8A 4XOJA 4AG2A 1ZHMA 1PYTC 1BRUP 1TRNA 2AERH 1T8MA 1Z8JB 1YP9A 1GBTA 4A5TS 1WYKA 1J16A 2B5TB 1C2GA 2GV6A 4FUEA 2VGCB 3GDSA 1BTZA 2HGTH 3VB3A 1YPGH 2FOMB 4KTUA 1Y5BT 3URCA 5A8XA 2WPIS 3RC5A 2WV5A 1GJ7B 1S0QA 3I77A 2P95A 2HPPH 4Y8XA 5F53A 1AZ8A 5HM9A 3VG8A 4U30A 2FP7B 1NO9H 4ACBA 1D3TB 6CHAB 1NFYA 3F1SB 5F6MA 1N6XA 5C5OA 1MKXH 4IBLH 1T8LA 3TLOA 1BHXF 2WINI 2PKSB 2GCHF 1H9HE 3GYMA 2ODYB 4LZ4B 1MKXK 2QXGA 6LPRA 3DUXH 1AKSA 1GI5A 1NRQH 3U1JB 1L4ZA 4K60A 8ESTE 2J34A 4WF8A 5C1UA 3BTTE 2KFWA 4ABDA 2RCEA 1KXCA 2VINA 4FUGA 1OWHA 1BOQA 2VVVA 2XRCA 1SGDE 3VEQB 1IQEA 2O9QA 1SGNE 2ZTYA 3ATKA 2GGVB 3KQBA 1P2MA 3BTHE 1T32A 5K0HA 1BB0B 2XC5A 1K22H 2ZFTA 4FUDA 1VCQA 2ZQ2A 2XNIA 1AE8H 5CDFE 1GJDB 4ZHLU 1O5BB 1ZR0A 2R3UA 2FS9A 3IG6B 1EB1H 1EZUC 1BTPA 1DVAH 1MAXA 2PHBA 2W3KA 4X6PA 1TNKA 1A3EH 1SGTA 3ZV9A 1HUTH 5EQQA 1XUGA 5DP5A 3SGBE 3M35A 3SNEA 4AB9A 3HPTB 1P09A 2ZA5A 2A45B 1AU8A 1ANDA 1GJ5H 2ANKH 2HLDD 2GZ7A 1ESBA 4X1NU 4NSYA 4FVBA 3T26A 3E6PH 1LHEH 3B23B 3SV9A 5IYTA 1FI8A 2WUCA 1L1GA 3FAOA 4LK4A 1KLJH 1IQMA 1TMUH 1V2NT 1RIWC 1GBKA 2PKSC 3MU1A 3ZZ5A 1ZGVA 1O5CB 2ZG0H 1YY3A 2HALA 2ZDVH 2GCTB 4I86A 4GLYA 1O36A 2ZZUH 2ZU2A 2YOLA 3FP8E 4ISHH 5JBAS 3ZYEA 5FPSA 1V2RT 3QK1A 3SNDA 5JBCS 1K1MA 4B2CA 2O8MA 2BZ6H 4GAWA 5C20A 1LVMA 5CE1A 2QGRA 2BY8X 5DKMA 1B7XB 1GHXH 3DHKH 4ABJA 3H7TA 3A7YA 1YPLH 3RXEA 1UTKA 3PO1B 4MPXA 3V7TA 4AFZA 2TGAA 3R0FA 2B0FA 1TE0A 1C1VH 1BBRH 5FPYA 3QX5H 4I8LA 2J95A 4CHAB 4ESTE 1TIOA 2UWOA 3SNAA 1SGPE 1DLKB 1GHBG 3R3GB 3TH2H 2B8OH 4DURA 2W3IA 1MQ6A 2IJD1 1O5FH 1CE5A 1C2JA 1ZJDA 4OS7A 3LONA 4F49A 1YM0A 1SQRA 4NZLA 2FZZA 2K1QA 4ZAEA 5T3HA 1GI7B 3K65B 6GCHG 1DOJA 2Q6DA 1N8OB 1ZHRA 2WV9A 2F3CE 4O97A 2WPKS 1YCPK 3URDA 1OPHB 1SOZA 3NWUA 3PMJA 4K2YA 2JJ1D 4CR9A 2F4LA 3A87A 1HDTH 3T25A 2Y82A 3RXFA 3RMOH 2BHGA 2GDDA 1TX8A 1WV7H 4YESB 3T62A 1MTWA 2ZGXH 3P6ZB 3AW0A 2BY5X 1CU1A 2JDID 3I78A 1SC8U 5CHBA 5JBBS 3T28A 4P00A 2FEQH 1C5UA 3PWBA 4XSKU 1SGEE 1RS0A 5DPAA 2KAIB 5DJ7A 5C1YA 3QWCH 3GCOA 1AUJA 2ZIQH 1O3HA 1XUKA 1ESAA 2IPQX 1FV9A 3U8TH 4CRDA 1VCPA 4K8YA 4Q7ZA 3CS7A 4RT0A 1ZPCA 4GUXA 4X6NA 1ABIH 3E0PB 1N1LA 1D6RA 4INLA 3KYGA 3P17H 2NU2E 1F7ZA 3MFJA 3EE0B 1TX6A 2BD7A 1AVWA 1BHXB 1T31A 1A0JA 2ANWA 3V3MA 3M3VA 2UWLA 1SR5C 1O2UA 2GZ8A 5AHGH 2XWBI 2JKHA 2YMSB 5C1XA 1G32B 1FN8A 3Q00A 1BBRK 2H9TH 1T4VH 1UO6A 4P02A 1J9CH 2BD2A 5C0UA 4TPIZ 1Q3XA 2ALPA 2QF3A 2ODPA 4IW4E 2ASUB 2D1JA 5FHTA 3D49H 4AYYB 4ZROA 3BTME 3MNSA 4YT7H 4ASUD 1NY22
chains in the Genus database with same CATH topology
1EB2A 2A2QH 3LC3A 1C5YB 1L1NA 4JZDH 1T4UH 2PSXA 2PLXA 2VIQA 3FP7E 2F83A 4JZIA 3GDUA 2FO9A 4GCHF 3UNRA 1Z8RA 1ZRBA 2RA0A 4JYUH 2ZGJA 4JMYA 4AFSA 2BLWA 1T8NA 1HLTH 1GL1A 5A2MH 3VFEA 1EAXA 2P8OB 2NWNA 4M7GA 5J4QA 3MWIU 1K21H 2SFAA 2BYAX 5EQRA 3ELAH 4JZ1A 1EXFA 4B74A 4AFUA 3TK6A 1CA8B 2BMGB 4VGCB 1SOTA 3A8AA 3QUMP 3A80A 1TGCA 1GDQA 3Q3KA 2VIVA 2NU3E 3SJIA 1KY9A 4PROA 1ZYOA 4OS1A 1QBVH 5LPFA 4X8VH 1V2KT 1M9UA 3H5CB 4ABEA 1V2JT 7KMEH 2WYJA 2OC1A 1OP0A 2FOBA 3RXDA 2UUYA 1EZQA 1KYNA 1F0RA 2TPIZ 1NESE 1IOEA 1NS3A 2QN5T 5EQSA 2V0BA 1V6DA 3A88A 3RXQA 4JZEH 1SPJA 1PPHE 1BJVA 3B8JA 1PQ8A 1YC0A 4UFGH 4RKJB 1PYTD 3S9CA 1FN6A 1RIWB 6GCHF 5A09A 5FCRA 3LGVA 1C5QA 3RXRA 5DP4A 2ODQA 3UFAA 2F9VA 2BD8A 2HNTC 1DWBH 2ZU4A 4CRGA 1FY5A 4QT8C 5A8YA 4FUBA 1LVBA 1BTHH 1SGIB 3ZVCA 3VB7A 1NU9A 2R2WU 2ZCLP 2ZU1A 1GPZA 2ZI2H 1ARCA 1IQLA 3D65E 2EI8A 3TGJE 4FUJA 4ZH8A 1TPSA 1V2VT 1S83A 4AGJA 3SJ8A 3PMBB 2FOAA 1CGIE 5FX5A 3PO1C 2G55A 1EUFA 1BITA 1O32A 4X2YA 1Z8GA 3SQEE 1XX9A 3M5LA 1QL9A 3QZQA 2CHAB 5JB9S 1E0FD 1YGCH 1SGCA 1ANEA 4XE4A 5T6DA 1KXBA 1W11U 1A2CH 2W7SA 1PPZA 1P04A 2DE9A 2JETC 2SGAA 2RA3A 1DY9A 5ESTE 1ZRKA 1WCZA 1IAUA 3DT0H 5PTPA 1EQ9A 4MDSA 4WH6A 1ELCA 3BF6H 3S9AA 3MNBA 3BG4B 4TYDA 4A1XA 1OSSA 4Q2KA 1MBQA 1ZZZA 3GY3A 4O03A 1P9UA 1O3LA 4E7RG 2FIRH 1S85A 2VVCA 2OBOA 3RXOA 1UJ1A 5FBIA 1DSTA 2OP9A 1UVPA 2HPQH 1THSH 3SO3A 1TPOA 3STJA 1O3DA 2BVXH 1ZPBA 2ZPRA 2UUFB 1TQ0B 1TRMA 1W8BH 2GP9B 4NWKA 1V2WT 4ISLA 4B75A 1C1PA 3IITA 1D3DB 3E91A 2ZFRH 5EXMA 2BD4A 4ZKRU 1HRTH 1SLXB 5LPEA 1G3BA 4AB8A 4BTIB 1GBIA 3RP2A 2J38A 3CS0A 1BQYA 2PGQB 5JYIA 4BTUB 1W2KH 1FMGA 1TYNA 1P57B 2R2MB 4X1RU 2IJOB 2FOGA 3QLPH 5BPEA 1G2LA 1ETSH 3TJUA 4HI3A 2W5EA 2VWOA 3OTJE 4B1TA 5F8XA 4B73A 1ELVA 1FQ3A 4ABFA 5GXPA 1HAYB 1Z71A 1BMNH 1SLUB 4Y76A 4IC6A 2QC2A 4Z0KA 3F68H 4O3TA 5LGOA 1XXFA 4U2WA 2XXLA 2J92A 1CA0B 1W7XH 3SBKA 4JYVH 1BCUH 3G01A 1C1UH 5LH8A 3ATIA 2WPMS 5F03A 3SV7A 2ZDKA 3SUFA 1DT2A 1O33A 3ITIA 2ESTE 3SUGA 4A7IB 1EJAA 4NIXA 1GBMA 3LOXA 1ELBA 1Q31A 2C8XB 1O3CA 1C5PA 4Q80A 3DFLA 3GY6A 2GCHG 1P2IA 4CRAA 1LDTT 1O2MA 1CHOF 2BD3A 3LIWA 1GHAG 1UVUH 3UREA 1C1WH 4NSVA 4U32A 1UVSH 2BD5A 2Z3EA 1TPPA 3K6YA 1H8DH 1FY3A 4JCNA 2PTCE 3MYWA 1GBHA 2AMPA 4Y0YE 3MO3A 3GDVA 2FOFA 3VXEH 4OS5A 1P2KA 1PPCE 9ESTA 1HAPH 1DWEH 1GMDG 5F8ZA 1OYQA 2RDLA 3TIUA 1A7SA 1Z6EA 1BBRE 1GJ9B 3TJVA 1QA7A 2Q6FA 3SJOA 4DOQA 1XMNB 1V2UT 4Y6DA 3AVZA 2GVFA 4AGKA 2SNWA 4YM9A 2QY0B 2BXUH 3OY5U 2VIWA 3ZZ3A 1MZAA 3FZDA 2BX4A 2WPJS 1P01A 3OSYA 1FLEE 2ALVA 2F9PA 1C5WB 3LU9B 3UWJH 2BLVA 4NA8A 3HGNA 3ZVBA 2VIOA 4I31A 1FDPA 2EI7A 3PROA 1EX3A 1UHBA 5E0GA 2DUCA 1MU8B 1CVWH 1SB1H 1XXDA 2OLGA 1GG6B 2EC9H 3P92A 3ZZCA 1B5GH 1GMHG 1LVYA 1AE5A 2Y80A 4D7GA 3A84A 2THFB 3BTFE 2C3SA 2BVSH 2VH0A 2FM2A 3P8OA 5K7RA 1HJAC 1F2SE 1ZMJA 3BEFB 1QFKH 4I33A 1LTOA 3MU0A 4LOYH 1EAIA 1GMCG 4JK5A 2OC7A 1W12U 2IOTA 3PTBA 4K1TA 2GX4A 5DP8A 1QIXB 3TPIZ 1MTVA 1JRTA 3RXCA 1K1NA 2VWMA 4ZKNU 3NXPA 1C5VA 2PGBB 5C3NA 2EI6A 1C5LH 1J8AA 2FOCA 1B0FA 2A7CA 3PWCA 1HAGE 5CHAC 1GHVH 1GHZA 1HFDA 2V3OH 1O3MA 2ZTXA 3M36A 1EOLA 1P8VC 1ORFA 5EU8A 1DDJA 1C1MA 1G3CA 3KQDA 4DIIH 3LH3A 1AQ7A 1HV7A 1ACBE 1NRRH 1D6WA 2G52A 4RSPA 1Y3YA 1VITG 2OC0A 1O2IA 4AX9H 3A89A 1ELEE 4Y71A 1THPB 4LZ1H 3K9XB 2A4RA 2H1UA 4E06H 2H9EH 1SGFA 2A4QA 1PPFE 1TB6H 1SHHB 1O3JA 3SW2B 3ZZ9A 2R3YA 1TA6A 1O2SA 1O2YA 1DWDH 3PV4A 2AGIX 4H4FA 1E37B 1THRH 5I25A 2PWXA 1JOUB 2J4IA 1Z7KA 2FI4E 4OGYA 4BNRA 2QXHA 4FU7A 2OXSA 4AZ2B 3E0NB 1MUEB 1ESTA 2HRVA 2A0QB 1QBNA 3BV9B 1DUEA 3QO6A 1AUTC 3OYPA 2BDHA 2G5NA 4DW2U 3SU0A 1AVGH 3A85A 3SI3H 1LHCH 5H4IB 1FONA 1CT2E 1TNJA 3HK3B 1GI4A 1LMWB 1MU6B 3UUZA 3KF2A 3V0XA 5B6OA 1QRWA 1C5SA 2CV3A 3JZ1B 4YZUA 1TNHA 3BTWE 3DFJA 3SGQE 1ZOMA 4X1PU 1ZSJA 3JZ2B 3ZZDA 1WOFA 3UTUH 1H1BA 1F0TA 4YOIA 5JBTA 2Y5HA 2VU8E 3ODDA 3RXUA 1CT0E 1LPZB 3O8BA 4CREA 1TBZH 1W7GH 4UE7H 4X8SH 1CA0C 1MAYA 3TNTA 3QTOH 3VGCC 1QY6A 5EODA 1KDQA 3V13A 3F9HA 2A1DB 2XBWA 1INCA 2BDIA 8KME2 2BZAA 1SHYA 4FUCA 1FPCH 2FTMA 1KXDA 1YYY1 1FJSA 1QJ7B 1O3NA 2A4OA 3S0NA 2ILNA 3ATMA 1AFQC 1MD7A 1MKWK 4K3JA 2ULLA 1HJ9A 1G3DA 1MCVA 5A0CA 1TBQH 4A92A 2GKVE 4DIHH 8GCHG 2VGCC 1UCYH 1LQEA 1LO6A 2Z94A 5GDSH 3M3TA 1HCGA 3GCHB 4OGXA 5TCCA 1K1OA 1TLDA 1TQ7B 3ZVDA 1A0HB 4Q7XA 4D8NA 2STBE 3MOCA 3U1IB 2FTLE 1H8IH 5E8EH 1Z6JH 2TIOA 4NFEA 3RXVA 1G30B 2ZNKH 4CR5A 5C2ZA 1IQHA 3BN9A 2OCVB 1Q2WA 3RDZA 1P2NA 1QQ4A 2GMTB 2XC4A 4AYVB 1F0UA 3LJJA 1LPKB 1C5TA 2TBSA 1HAOH 1DITH 4GHQA 1AHTH 1GGDB 1P02A 1WQVH 1G9IE 3ZZ4A 3L33A 4TWYA 1GBLA 5J4SA 3F9FA 4MNWA 1P03A 2W26A 1SBWA 5E0JA 1HJ8A 2M5TA 1EPTC 1MTNB 1NRNH 2A31A 1O0DH 4MNVA 3VPKA 1NT1A 4D9QA 2BOKA 1GHYH 1FY1A 1V2TT 1ZJKA 1BIOA 1QTFA 2GT7A 3W94A 4RKOB 4UFEH 3TJOA 1ANBA 1O39A 4MPWA 3UWIA 4NCYA 1TA2A 1Y3XA 1OOKB 2BQ7B 1DS2E 2AIQA 4YO9A 1RGQA 3LGWA 2P94A 1QHRB 2GD4B 1AY6H 4BAMB 1OXGA 1C1SA 1ID5H 2VB0A 1KXFA 3E90B 1AWFH 1V3XA 4K69A 4WY3A 1UTMA 4GHTA 1C5OH 4I8HA 1O3AA 5HMAA 1C9TA 4XBDA 2BQ6B 2PR3A 2A2XH 1BA8B 4I8JA 1BDAA 2EA3A 1OX1A 1GWAA 2GMTC 1XVOA 1K1PA 1G3EA 2CXVA 3SUDA 2HWLB 2H9HA 3NPSA 5EPYA 5HYOA 3A8CA 2G4UA 2BQWB 5A0BA 1O2XA 2A32A 1XKAC 1GDNA 2P3UB 4YOJA 1BTXA 3KQEA 1TONA 5AFYH 2I6SA 1YPJH 4I7YH 1GJ6A 4CH8B 2Y6TA 3EGKH 5FXLA 3GCNA 5T6FA 3KIDU 1O2ZA 2QIQA 3S9BA 1DPOA 1C4U2 1LPGB 1NPMA 5EXLA 1O35A 1C2DA 4K1SA 4E7NA 1SQAA 3U8OH 2OQUA 1HAIH 5JB8S 4HGCA 1C5RA 3HKIB 3O8CA 4KTSA 3SHCH 3M7UA 4THNH 1NTPA 1DICA 3S69A 2ZWLH 2LPRA 3Q76A 1SLWB 3E3TA 4IMZA 3KQCA 3RXIA 8LPRA 1CO7E 1DE7H 1E38B 4AG1A 1NN6A 2G00A 1HAHH 1LHGH 1SGYE 1BRBE 1N6YA 1PPEE 3ZVFA 1BJUA 2R0LA 3TU7H 2VNTA 3RXTA 2OINA 1ABJH 1GBEA 3PYHA 3H7OA 4J2YB 4WMEA 1P12E 2ZDAH 4DCDA 2HLCA 4MTBA 1BTUA 2ZU3A 1GI6A 4Q7YA 2FODA 4SGBE 4RN6A 2ZFQH 1F5LA 3GCTF 4IC5A 2P93A 1GI8B 3KEEA 5HXFA 3UR6A 4ABAA 1ZSLA 2O8LA 1BMAA 1ELAA 3BTDE 1GHWH 3LJOA 1SQOA 2ZGCA 2FX4A 1OP8A 3FZZA 4UDWH 3SU2A 3TJNA 4X1QU 3M5NA 1IQFA 1ELTA 1DUAA 3T29A 2Z9KA 1PQ7A 3AAVA 2GTBA 2A7JA 4E05H 2F9UA 1SGQE 1PPBH 3GY4A 1TNIA 1ZHPA 2GZ9A 3A7XA 3E16B 4X2XA 1HIAB 4ZHAA 3ENSB 2H5DA 4Y8ZA 1UK3A 5DP7A 3HK6B 1AZZA 1LKBA 1A61H 5JDUB 3M5OA 1P3CA 1S6FA 4O3UA 1ZTKA 3MNCA 2D2DA 2I6QA 2Z7FE 2Z6BD 4JZFH 3O8RA 3SV2H 1EJMA 1W0YH 2ZQ1A 1Y5UT 4NGAH 1J14A 4NZQA 2SGPE 2J9NA 3MMGA 2SNVA 5EPNA 2CF9H 1X7AC 2DE8A 1DXPA 1QRXA 5LPRA 1GBJA 3GICB 1Y3VA 2BM2A 4MPUA 5TCAA 2BB4A 1P11E 1XUJA 3RUOA 1FIWA 3CENA 2AMDA 4WXVA 1CT4E 3P8FA 3ZZ7A 2JH5D 2BY7X 3BEIB 1W13U 4D7FA 3UQVA 4UONA 2WPHS 2SGQE 3DD2H 1EAUA 4YLUA 1FNIA 4XFQA 1L1JA 3MU5A 1SMFE 4KP0A 2ZHDA 1K1JA 1XVMA 5G4BA 3T5FH 5BRRE 3L6PA 3NZIA 5FAHA 2CMYA 2QXIA 1ZMNA 3AASA 4IMQA 3SN8A 4D76A 1DY8A 2PUQH 1CHOG 4H6TA 1MH0A 2Z9GA 3D62A 3Q3YA 1LQDB 2HOBA 3LGIA 4ZXXH 1O3IA 1O2GH 1CSOE 3SHAH 2D8WA 1XKBC 1QCPA 1A4WH 3UQOA 3PB1E 4CBNA 4R0IA 3SV8A 2Z3CA 1HAZB 5HM2A 5JPMH 3HKJB 3S7KB 1GHBF 2ZGHA 2VIDA 2XBXA 3T2NA 1OWIA 4B2AA 1HYLA 5GWZA 1GBDA 2PKAA 4O9VA 3UOUA 1P9SA 1BRAA 4MPVA 4DGJA 5L30H 2ZFPH 4JK6A 3SV6A 1DX5M 3LC5A 3ZZ8A 1TBRH 4X1SU 3GOVB 3VB5A 1F92A 3FP6E 2ZDLA 2QF0A 5EOKA 1O2TA 3RXPA 2AFQB 2ZHFH 1A5HA 6CHAC 4JYTA 1DSUA 1O5EH 1JIMA 2NU1E 3A82A 5GPIB 3ATWA 1TOCB 1MKWH 3UY9A 1TX7A 4WJG2 3ATLA 3RXGA 1QBOA 1C2KA 3GY8A 1YPKH 3TGIE 4TY7A 3D23A 3FANA 3T27A 1GJ8B 1WQSA 5AVDA 1F5KU 1RTLA 4NFFA 3RMNH 4KKDA 1C1QA 1UCYK 3NKKA 3RXBA 3SNBA 1L0ZA 1SG8B 1T8OA 2A5AA 4OS4A 2XBVA 1BT7A 1PPGE 1A1RA 3ODFA 1GI3A 1WUNH 2TGDA 1TAWA 3UIRA 3EYDA 2G81E 1W3CA 3RLYH 1S82A 2O8WA 1CQQA 2BY6X 1G36A 1UK4A 1WTGH 1GDUA 2PUXB 3QN7A 3A8BA 1ZMLA 4BOHA 1HBTH 2R0KA 1D3QB 3MTYA 4TPYA 4BAKB 1O2QA 3ZVEA 2H2ZA 1ETRH 1WTHD 1YPEH 1BRCE 4X8UH 4B71A 1VR1H 1FXYA 1JMOH 2ZU5A 3ZVAA 2BDCA 3OX7U 2O8TA 2JETB 3RMMH 2A4GA 1QL7A 1GBFA 1SGRE 3RXSA 3RM2H 3QGNB 1EZSC 3ZV8A 2QXJA 4MVNA 5GJ4B 4K1EA 3QGJA 3GISB 1BZXE 2BDGA 3F9EA 1C1NA 2SGDE 1CGJE 3SJ9A 1TMBH 3RXHA 2B9LA 3Q77A 4J1YA 5EW2H 3BIUH 2Y7ZA 1SSXA 1C2HA 2GCTC 3VB4A 5E2OA 2Z9JA 1XUIA 1TABE 3RC6A 1DANH 4MQAA 4Y11E 3FFGA 5L6NH 3MHWU 2WV4A 1O3O