1K1JA

Bovine trypsin-inhibitor complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Factorising ligand affinity: a combined thermodynamic and crystallographic study of trypsin and thrombin inhibition.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1jA02
1G37A 3RXBA 4SGBE 2BHGA 7KMEH 1N1LA 3BEFB 1KLTA 2FOMB 2F91A 3MNSA 1QJ7B 3FP7E 3PO1C 2Z3EA 2ZC9H 1QTFA 1HAZB 1NU7B 3CENA 2Y5HA 4X2WA 2GMTC 1GPZA 2TPIZ 4NA8A 2ZDLA 1DFPA 2TRMA 2BLOA 2ZFTA 1CVWH 5FPYA 3OY6U 1GI2A 2ZCLP 2GV7A 1N6YA 4ABFA 3Q3YA 3E0NB 3LGVA 5JBBS 2PSYA 2DE8A 4NZLA 5EW1H 1BHXB 2ZECA 3AASA 3KNXA 4IMQA 4X6PA 3ZVAA 1VGCB 1AVWA 2FX4A 2XBXA 1ELDE 3SI3H 3EQ0H 1FN6A 2ZTZA 1O2GH 3VB7A 4O9VA 1TNIA 2PFEA 3BTFE 4FUFA 1S0RA 4X6OA 1O3PB 7ESTE 1T8LA 2XC0A 2SNWA 3ODFA 4ZHLU 1A0HB 1Y5BT 1MTNC 4MQAA 1OS8A 3M7UA 1PQ7A 5EOKA 3PM3A 4H6SB 1E36B 2OTVA 4ZH8A 2Z6BD 1GBHA 1KXBA 3QDZB 1L4ZA 1XMNB 2BDHA 3SGQE 4FUCA 4HTCH 2Z9KA 1ANEA 3A8BA 3BTEE 3SJKA 1K22H 2ANWA 3OTJE 4X6MA 3RXHA 4YO9A 1JMOH 3RXMA 2O9QA 3BTQE 2BD8A 1T8OA 4HFPB 3Q77A 2VU8E 5LPRA 2Z3CA 2VIQA 2B7DH 2SGPE 2STAE 5C1YA 1OP0A 2HNTE 1PJPA 4UFGH 5G4BA 4WMDA 5GXPA 4AGKA 1AB9B 4DOQA 1UTQA 4Q2KA 4X1QU 1AFQC 1LVOA 3LGIA 1S5SA 1LKBA 3KF2A 4MG3A 1C2DA 3SV6A 1FJSA 4OS7A 1RJXB 1AVXA 1V3XA 4X8TH 2TBSA 2J92A 3ZVEA 3AW1A 1YPHC 5A8ZA 1C4V2 3RXCA 1ZHRA 1TBQH 1EAWA 3A83A 4K3JA 1GBLA 1D3TB 1L0ZA 4UDWH 5I25A 3LJOA 3L33A 1Q31A 5DP6A 1FY3A 1TAWA 2BVSH 2R2WU 4UONA 3RDZA 2C8XB 5JPMH 1EPTC 1K1PA 3SBKA 1W14U 2RA3A 4ABJA 1BRBE 4K8BA 2B9LA 1GJ4H 2VWMA 2W3IA 1O36A 1GJCB 1TQ0B 1MKXK 1HGTH 1NC6A 5BRRE 2QXJA 1UTOA 1SGYE 3ENSB 1YYY1 4GSOA 1UTPA 2FZZA 2VGCB 4YOJA 3M5LA 5CHAC 1O2UA 1CT2E 2ZCKP 3KIDU 3ZZ9A 1ZSKA 5ETXA 1E0FD 2A0QB 1ZPZA 1P01A 4H42U 2ZGHA 2ZF0H 2GCHF 4ABDA 1DM4B 1T31A 3M3SA 1KXDA 1ELEE 1VR1H 4ABIA 4ZKSU 3ZVCA 2ALVA 1AUTC 1EAIA 3T62A 4XSKU 1Q3XA 1ABIH 4E05H 5DKMA 1C2KA 1GI3A 5DGJA 4CH2B 1IAUA 1O3HA 2H9HA 2WV5A 1CE5A 4Q7ZA 1Z8RA 1HAXB 4WH8A 4Q80A 3UNRA 4WXVA 1DWDH 2A4QA 3S9BA 3BTHE 3FP6E 1Z8JB 1IQHA 2CN0H 2ZHDA 1LCYA 2B8OH 3UUZA 1Z6EA 2SGAA 2BXUH 4Y76A 1SGEE 2G00A 1EXFA 1EZXC 1O2WA 3RXUA 1GI5A 3A88A 2F3CE 1F5LA 4CBOA 1P2OA 4AYYB 2BB4A 1FNIA 3RXLA 1ETTH 4LZ1H 5DP3A 2P59A 1UK4A 1TNLA 1AGJA 1O3NA 3SORA 2BZAA 1SFIA 4NIVA 2ZWLH 1DOJA 4BAMB 4NG9H 2Q6DA 1P2JA 5GPIB 3T26A 2G51A 1RD3B 2BD2A 1WCZA 4AZ2B 4LZ4B 1F5RA 4Y7AA 2H5DA 2ZFRH 3TIUA 1IQKA 1HCGA 2HGTH 2GP9B 3MH4A 4MVNA 4E7RG 1HJAB 3KQCA 4UFEH 3SI4H 2XTTB 2F9OA 3OU0A 1KXFA 2VIWA 1P2IA 2J34A 4HGCA 3ZZBA 2A4OA 3RC5A 3A7XA 2HWLB 1A46H 2GTBA 2R0LA 1O3MA 1ZGVA 2BY8X 4ZROA 3RXOA 3MOCA 1TNGA 1GL1A 2VIOA 5GWZA 3RLWH 1GDUA 4AG1A 3NK8A 1BMMH 4KTSA 1A5GH 4A6LA 1C1WH 1NS3A 3U8OH 3W94A 2P3FH 1TRNA 2VNTA 4B71A 2AGGX 1J16A 2ALPA 3QGNB 1BITA 1O2YA 1FPHH 4Y10E 1LVMA 4YM9A 3B23B 1THRH 3P8FA 1A5IA 1DDJA 2RG3A 1AWFH 3SUDA 5ESTE 1O3KA 3P92A 4KP0A 4X2XA 1K1JA 4CHAB 4CRBA 3FVFB 5DPAA 4NSVA 2HRVA 1SGQE 1CBWC 4A5TS 3TH4H 3UPEA 3MH7A 3ODDA 1V2TT 1NY22 1JBUH 4I7YH 4CH8B 3QX5H 1SLWB 1OWJA 1WQSA 3BIVH 5ESBA 1NU9A 3ZV8A 2VVVA 4ZHAA 3TJVA 1V2ST 1LQDB 1BJVA 1G9IE 4ISIH 3ZYDA 4KGAA 1YBWA 1FONA 1C2IA 2BX3A 1QL9A 3TGIE 1WAYB 1YPJH 1TGCA 1C1NA 2WPKS 1NT1A 2ZFFH 3PLKA 2BDIA 1CO7E 2ZIQH 1E34B 4CBNA 1FMGA 4Z0KA 4WJG2 2IJOB 3SU6A 1ZRBA 1P04A 1GBIA 4TWYA 1AI8H 3V0XA 4Q7YA 1ZYOA 1H8IH 2NWNA 2IOTA 5C1XA 1P02A 1DWCH 1ZPBA 4RN6A 1TBRH 1K21H 4NSYA 4MPVA 1MBQA 1TE0A 4I8LA 3RUOA 3NZIA 1P9SA 1UJ1A 5LH8A 1OX1A 3LGTA 1ZTLA 4WY3A 1BTXA 2A5KA 1KYNA 5DP4A 2V3HH 3STIA 1O2NA 3S69A 1QGFA 4TYDA 2G52A 1VITG 1TOMH 1AHTH 3T5FH 1EP5A 3LGWA 1D4PB 1F5KU 1HFDA 2OUAA 1SVPA 1TIOA 4MNVA 1MBMA 4JZEH 1GVLA 4B74A 1SL3A 2V35A 1QRZA 1YPGH 5FAHA 3L6PA 4D7GA 2A31A 1GMCG 3KEEA 1A1RA 3BTKE 1GI4A 1ZTKA 2BDAA 2ZHWH 2UWOA 4XE4A 1DLEA 1UTJA 1GBEA 1T7CA 3QZQA 3MNBA 3RM2H 2V6NA 1DT2A 5HYOA 3V7TA 1SLUB 1PYTC 4ISLA 3GCTG 5EXLA 3P8GA 1LKAA 3UY9A 1YLCA 2OC7A 3FP8E 1FZZA 2J4IA 2VGCC 1D3DB 3UWIA 5F8TA 3H5CB 4IN2A 1XVOA 1GI1A 3HGNA 4VGCB 3V12A 3M5NA 2G8TA 2QA9E 1JRSA 2PHBA 1V2UT 1WYKA 1ZJDA 1C5WB 2P8OB 2Z7FE 2P16A 2Y6TA 4U2WA 3T27A 4MNXA 2P8OC 1SG8B 2A4RA 1GI0A 5JYIA 2AEIH 1KLIH 3DA9B 4BTTB 2BZ6H 4BAHB 4TPYA 3MNXA 1Y3YA 3A7VA 3LDXH 3TK5A 2FO9A 2FOEA 2VVCA 1GI6A 3A7ZA 1HJ8A 3RXIA 2P3TB 9ESTA 1SGCA 1QJ6B 3VGCC 8ESTE 1JXPA 1MD8A 4U01A 1BMNH 1PFXC 3SU2A 1IQGA 3PROA 2VJ1A 3AW0A 3BTGE 2JH6D 3SV2H 1QR3E 1UO6A 1SGTA 2YOLA 2OD3B 3A87A 4KTCA 1D6RA 1V2KT 1Y59T 1FN8A 5C2ZA 2WINI 2Z9LA 1SGRE 2PKSC 4AYVB 2V0BA 1O3CA 2FEQH 3PYHA 4JZFH 1HYLA 4GCHF 3PB1E 1V6DA 2GDDA 1WUNH 1H4WA 4X1NU 2UUKB 4KELA 4E7NA 2I6SA 1C5QA 4ZXXH 3ZZ3A 1EPTB 2FTMA 4TWWA 1C5TA 1AD8H 1LPZB 4ZUHA 1O2ZA 4DGJA 1A4WH 1QY6A 1WU1A 1SBWA 2QAAA 2ZTXA 2ZU5A 1ELFA 1KLJH 3U1JB 3F68H 5GDSH 2FOBA 1QHRB 1GHYH 2NU4E 1RTLA 1DWEH 1U6QA 2XNIA 1T4VH 1O3IA 2BLVA 3P17H 3CP7A 1HV7A 1O34A 4SGAE 5CHAB 3GYMA 2EC9H 3ZZ7A 1BBRE 2A2XH 2BD3A 2C8WB 1MTUA 4FU8A 2ZDKA 2AMPA 4I32A 1GL0E 4JMYA 1HAYB 3TH3H 1RS0A 1W10U 4FVBA 4H4FA 1SMFE 1O2SA 1TB6H 1ZSLA 4JYTA 1GHAG 2PKSB 1CHOF 3KGPA 1FY8E 1MQ6A 3STJA 5HXFA 4R0IA 2OC0A 5FCRA 2PTNA 3ZVDA 4JYVH 5JB9S 2OINA 2ZPQA 4ABHA 4JZIA 3AAVA 1SGFA 2CV3A 3NUMA 1OWIA 2QYIA 3HK6B 1HJAC 1GJ7B 1PQAA 4WH6A 2NU2E 1A61H 2CHAB 1V2WT 1SQOA 1HJ9A 1QNJA 3UQVA 3F9EA 2G5NA 4AFZA 3UTUH 1AFQB 1PPEE 2OC1A 1LHEH 6CHAC 3LONA 1BZXE 1EB1H 5TJXA 2ZU1A 1EAUA 4K8YA 5A09A 1SOZA 3MNCA 1K1IA 1FXYA 4MDSA 3EDXB 1ZPCA 3K9XB 1RIWB 1O3LA 1F0SA 1C5OH 1CT4E 4X8VH 1C5SA 2VWOA 3A80A 1TMTH 2Q1JA 2ZO3H 3F1SB 5T6GA 3M37A 4I8HA 1V2MT 4VGCC 1HLTH 1ZLRA 1KXAA 5PTPA 1EJNA 2YNBA 3S9CA 1SGPE 1DE7H 4TPIZ 1FDPA 1GJBB 1A3EH 1HAVB 5EPNA 1TBZH 1AQ7A 3SUEA 5EXNA 2FLBH 2IPHA 3RU4E 2VIPA 1C1SA 1J8AA 1CGHA 3S9AA 1YP9A 1N6XA 1NZQH 1OWKA 1DUEA 1HBTH 1XUIA 1PPGE 1G2LA 4GLYA 1ID5H 1GHBF 3RXAA 2HNTC 3TJNA 1BIOA 1AN1E 3C27B 4OGYA 1C2JA 2GCTC 1S82A 1DLKB 5I46H 1P3CA 1JOUB 1IQJA 3MO6A 5A0BA 2SFAA 1S6FA 2ZDNA 1GWAA 2D8WA 3KN2A 2Z9JA 2HOBA 5AVDA 2ZDAH 1O2MA 4BAQB 5FBIA 2NU1E 2H2ZA 1HAIH 2F9VA 5GCHF 4K5ZA 3QZRA 3TK6A 3TH2H 4A1XA 1GJ9B 3ATIA 2ZPRA 1P2NA 1MQ5A 4CRGA 2GT8A 1AO5A 1QJ1B 2FYRA 4Y11E 2XCFA 1JIMA 3T2NA 2AIPA 4X1RU 1AKSA 2C4FH 3A7WA 1UVOA 2GMTB 3LIWA 4JK6A 4Y8ZA 2A2QH 1H9LB 3FAOA 2GGVB 2NU0E 2ANMH 3IITA 4YLUA 1BTUA 4JYUH 1P0SH 2F83A 2QV1A 1ANBA 2G5VA 1DXWA 2ZDVH 2VIVA 2WUBA 1S6HA 4X8SH 1BQYA 2CXVA 3RXVA 1EP6A 3GY2A 3TGKE 1FUJA 1ZHMA 2ZU3A 4FUBA 3HPTB 1O2JA 4O3UA 4NA9H 4ISNA 1VITF 5E2OA 1RTKA 4FXGH 1AY6H 3R0FA 2PGQB 2WPMS 3SN8A 4I8GA 1KDQA 5DK1A 5E0HA 1NFUA 1W13U 1SGIB 3EAJA 1NESE 3E91A 1TRMA 2JH0D 1OXGA 2BOHB 2A7HA 2AMQA 4BANB 4FU9A 2ZA5A 3QGJA 2QIQA 2JETB 1TYNA 2XRCA 3UREA 1P11E 3SGBE 1Y3VA 2ZFSA 3QUMP 3UR6A 1SFQB 1TFXA 1HIAB 3PLPA 1N8OB 3O8CA 2DE9A 3E16B 3LOXA 4JZDH 3N7OA 3RXEA 2Z94A 1HDTH 4R8TB 1W7XH 2FOFA 1EZUC 4ISOA 4IC6A 1SQAA 1CHOG 1GBFA 2GVFA 1DY9A 3FANA 3LT3A 1W11U 2B0FA 2VB0A 1HAPH 3ZVBA 2ZU2A 4INHA 2G4UA 3GCOA 1GDNA 1IQFA 1O3OA 2O8LA 2Z3DA 1V2OT 1SB1H 3LPRA 4ESTE 1IQLA 1J14A 5AHGH 1XUJA 2QXHA 8LPRA 4M7GA 1TONA 1C1VH 5DO4H 4YT7H 1TPAE 3EGKH 3LH3A 3PV4A 3P6ZB 3D49H 3SU4A 2A7JA 1O35A 1TALA 2G55A 3TNTA 1TGBA 1GJ5H 1FY1A 1QB9A 1TNJA 1CSOE 2EA3A 4GPGA 1EOJA 1LO6A 2QCYA 1UTNA 2P3UB 1YC0A 1OPHB 2WPHS 5JDUB 1P9UA 1ZZZA 3MH6A 1SSXA 1DWBH 4Z6AH 3M36A 2BQWB 2CJIA 1H8DH 3PLBA 3DFLA 3ZZ4A 1QB6A 1GHBG 1GBAA 3NPSA 2R9PA 3CS0A 1OKXA 1DS2E 1P57B 3DHKH 1XKBC 7LPRA 1XX9A 3VXFH 2YNAA 1AWHB 4YTAA 3SO3A 2R3UA 3NWUA 4DY7B 2B5TB 1S81A 4BTUB 1UVSH 4NZQA 4JK5A 3SNCA 3D65E 1O5CB 1IQIA 3VFEA 4UE7H 1GHWH 2PKAA 3KHVA 5F8ZA 2GDEH 2THFB 2BQ7B 1SQTA 1W7GH 1AE8H 4BXWA 3VB3A 1IHSH 5T6DA 2BY7X 1XXFA 3RMMH 1O33A 1YPEH 2LNCA 3ESTA 3BG4B 2GD4B 3PTNA 2FS9A 2K1QA 1F0RA 1RTFB 1QRWA 4IW4E 2F9UA 1GCTC 1V2VT 1DSTA 2PW8H 4K1TA 3D23A 1MAYA 2ZDMA 1ZHPA 5CMXH 1QBOA 2DUCA 1C5PA 1W0YH 5T3HA 4YT6H 2ODYB 1TPOA 2VWNA 1FIWA 1UCYK 3URCA 2CMYA 1Q2WA 1A0LA 1UMAH 1LVBA 1BBRH 2BTCE 5LPEA 3HATH 4B2AA 3M5MA 4CRFA 3TK9A 4I8JA 4DIIH 1TABE 1C2HA 1OP8A 4CRCA 2IN2A 1CGJE 1ARBA 1HB0B 2H5CA 5DP9A 2EEKA 3RXDA 1ELCA 5HM2A 1WQVH 1IQEA 4WMEA 1ZMNA 1O2HA 1EAXA 1IHTH 5C1UA 5HMAA 3RXTA 1QL7A 3MH5A 2P94A 1EKBB 1GHXH 1E37B 3TJUA 5DJ7A 1FY4A 1C1MA 3SUGA 5E0JA 4K69A 1RIWC 1GMCF 1PQ5A 1B0FA 1IOEA 1OWHA 3B9FH 4HI3A 5EU8A 3TPIZ 1C4Y2 1E38B 1W2KH 1NRPH 1BTWA 4MPXA 3UNQA 2ZGBH 4FUJA 3BV9B 4WWYA 1ELTA 1GHVH 5TCCA 1DUAA 2WV4A 1TNKA 1UK2A 3ZZCA 3GCTF 3Q3XA 1ZTJA 2PGBB 4AN7A 3F9FA 2FOHA 3K6YA 1O5GH 2GX4A 6GCHF 1SI5H 1ZR0A 1SC8U 2CF8H 3SHAH 5AFZH 2JETC 2XBWA 3UR9A 1WTHD 1PPBH 2FOGA 3PMHB 4OS4A 5GIBA 3QTVH 1G3CA 2A32A 2BYAX 3MU5A 4AG2A 3MU8A 1ELGA 2CGAA 1UTLM 2ZP0H 1SLXB 2Q6GA 2WPIS 4DVAU 3I77A 3GCHC 3Q76A 4ZHMU 1MMJN 4B75A 4K1EA 1K1NA 2ZFPH 4Y6DA 1EB2A 3U69H 1C1RA 8GCHF 1TX6A 5DP8A 1C5NH 5C20A 1P2QA 2D2DA 2QN5T 1GHZA 3V3MA 1HXEH 3OYPA 5EW2H 2OBOA 4QT8C 4OGXA 3SUFA 1O31A 1LVYA 1XXDA 2GKVE 1A5HA 1NRQH 2PTCE 2FI3E 3A7YA 3ZYEA 1SGFG 2SGEE 4D9QA 1G3EA 2PLXA 1DVAH 4I8KA 3W95A 1TA2A 1C2MA 1O30A 2J38A 1MZAA 1SHHB 3QLPH 1JRTA 1C2LA 1AVGH 1QQ4A 1A2CH 4X1PU 1CHGA 1GMDG 2BXTH 2ZFQH 1EQ9A 1VITH 3L3TA 1GCTB 1ZJKA 3SU5A 1QURH 2TGDA 2BD5A 1S85A 1C9TA 2XXLA 3LGUA 2ZZUH 4X0WU 1GMDF 1MU6B 1UVPA 1INCA 1MTSA 5JBCS 5E2PA 3ATLA 2UUFB 5H4IB 2F9NA 3U8TH 2FOCA 1LQEA 1AIXH 1OOKB 2BLQA 5FPTA 1JWTA 4FVDA 4Q7XA 5EXMA 5E0GA 5BPEA 3A86A 2Z9IA 3Q00A 2ESTE 1C5XB 3SOSA 4OS6A 3LH1A 2STBE 4FUGA 3RXQA 3SQHE 3S7HB 1C9PA 3C1KA 3TU7H 1NROH 1EX3A 1Z7KA 2FOAA 2FI5E 1FV9A 1BTZA 2BOKA 1LHFH 5L2YH 1FLEE 1RRKA 1QBNA 1VZQH 4LK4A 2H6MA 1BRAA 3RP2A 2LPRA 3E1XB 2FWWA 4FU7A 2SGFE 3BIUH 1O3FA 1NO9H 1F92A 4Y0YE 4ZAEA 2H1UA 4TY7A 1S0QA 2F9PA 2V3OH 3Q3KA 1LPGB 1CA0C 1A3BH 3QTOH 4JCNA 4CRDA 1D6WA 3JZ2B 5JBAS 4ASHA 1T4UH 3RXGA 1F7ZA 1YCPH 2PUXB 2P93A 4IGDA 2QXIA 3GY8A 3TLOA 2FESH 1AZ8A 2R2MB 4BAOB 1BMAA 1MUEB 1O5DH 1M9UA 3ATWA 3ZZ6A 2FMJA 2SGQE 3P70B 2TGTA 2QGRA 2VWLA 5F03A 1J17T 2WYJA 1FI8A 3TJOA 3MMGA 1E35B 4BAKB 4U32A 5GJ4B 2ILNA 1TRYA 1XUHA 2CHAC 1H1BA 1N8OC 4Y71A 2AGIX 3K65B 3A8DA 3SV7A 4NGAH 2R0KA 1EPTA 4DT7B 1VJ9U 4KTUA 2ANYA 3EYDA 5AFYH 4WVPE 3DD2H 2UWPA 1O5BB 2VH6A 3RMLH 2J2UA 1C4U2 1ORFA 3S0NA 1O3DA 3GY5A 1HAGE 4X6NA 4GUXA 1GI9B 2FP7B 1DSUA 2PV9B 1DICA 2FTLE 1QIXB 3T29A 1NPMA 1BHXF 1G3BA 1T32A 1W12U 1PPCE 1QA0A 1G30B 3GICB 4XFQA 3OY5U 1AFEH 2ASUB 2WPJS 1UHBA 3O8DA 3U8RH 3OSYA 4Y7BA 2UWLA 2C3SA 1GJ8B 3LJJA 1KXCA 5AF9H 3F9HA 2FLRH 2XC5A 1P06A 2XYAA 2P95A 1MD7A 2PR3A 5HGGA 1FPCH 3MU1A 3A84A 1ACBE 2BM2A 1BCUH 2VIDA 3VEQB 2UUJB 3GY7A 1BTHH 2ZCHP 1TLDA 1D3QB 1XUFA 2FYQA 4YOIA 1ETSH 1QRXA 2FXRA 1GJ6A 3VXEH 3RC6A 2TGAA 5SGAE 1DXPA 2Y7ZA 1G2MA 1C5LH 4INKA 1NFXA 3RC4A 3RXFA 2O8TA 4NCYA 1GVZA 3AAUA 3IG6B 1CGIE 4THNH 2GV6A 4F49A 4A1VA 3QO6A 4X2YA 1V2LT 1C5RA 1K1MA 2GCTB 1GBBA 4O03A 1RXPA 2BD7A 3GOVB 2VINA 3LGYA 5B6OA 1TQ7B 1F0UA 3RU4D 1C2GA 4X1SU 1PQ8A 5L2ZH 1QA7A 1ZMJA 1MH0A 2OLGA 3VPKA 1UVTH 3QWCH 1BRUP 4O3TA 1MTWA 3SV9A 1GBKA 2OCVB 1MZDA 1B5GH 3V13A 4UFFH 3RXSA 2FX6A 2BD9A 1GG6B 5K0HA 2HPPH 1PPFE 2C8ZB 1G3DA 3MO9A 1B7XB 1P12E 2J95A 4Y8XA 1NFWA 2ZNKH 4I33A 4YZUA 1PYTD 1O32A 1Y8TA 2BDYA 3ZZ8A 4X8UH 1P03A 3PMJA 4IS5A 1P09A 1UTKA 1C5ZB 4GCHG 1S84A 3NCLA 5EG4A 3U9AH 3MYWA 4Y79A 4BXSA 1C1UH 4AX9H 4PROA 4CREA 4D7FA 2QXGA 2OBQA 4OS5A 2SGDE 4DIHH 1T8NA 3I29A 3RMOH 1KIGH 1D3PB 2C93B 3HK3B 1TNHA 1L1NA 1O3GA 3PWCA 3M61U 1O5EH 1GBMA 2OQUA 2FS8A 1MTVA 2ODPA 2H9EH 1O2QA 4ZKRU 1O2KA 1V2QT 1LPKB 1WBGB 1J9CH 4OS2A 3BN9A 3MTYA 5J4SA 2EI7A 4WMFA 4FUHA 1HAOH 4OS1A 2H9TH 3BTME 3GDSA 1G32B 4D8NA 1Z1JA 1YCPK 4DURA 1C2EA 4NWKA 4RKOB 2BY6X 2F9BH 4IC5A 1Z8GA 5EQQA 1TPSA 3DFJA 1MCVA 4XOJA 3H7TA 1MAXA 5A0AE 4RSPA 1ZOMA 1HAHH 1A7SA 1MU8B 1Y5AT 4ABAA 2VH0A 2FM2A 3RXRA 4Y0ZE 2RA0A 3UIRA 4AOQA 3SNDA 2OC8A 2BLWA 3ZVGA 4FUDA 2BDCA 1C2FA 2WPLS 2XBVA 3SNAA 1P2MA 3AVZA 3PWBA 1O3EA 3M5OA 1X7AC 1F2SE 1NRRH 1K1OA 2UUYA 3MWIU 1YM0A 5T6FA 4AORA 1AU8A 3MU0A 2ZKSA 1THPB 3FFGA 1EZSC 2GT7A 1HNEE 5GCHG 1EUFA 2AH4X 1SHYA 3E8LA 1C1QA 1O2OA 3SJIA 2WUCA 4NIYA 1EASA 4XDEA 3NKKA 3PTBA 3SJ8A 3U1IB 3LU9B 4AB9A 2AERH 1OWEA 2FODA 1GI8B 3OX7U 5A0CA 3SU0A 4ZXYH 1NFYA 1XVMA 3MO3A 1AKSB 1NTPA 1GG6C 2PUQH 7GCHF 5C5OA 1GBTA 1TMUH 2ZU4A 1KY9A 1B0EA 2OP9A 3A82A 1UK3A 1Y3XA 3M7QA 2HLCA 1YPHE 1SR5C 1QBVH 2TIOA 3TITA 3ZVFA 2ZEBA 1BJUA 1Z8IB 3VB5A 5EODA 2Y5FA 3VGCB 1HRTH 3I78A 4TY6A 5DP5A 3U98H 1O2VA 2ZTYA 2XWBI 2Y82A 5A8XA 4NWLA 1OYTH 1JIRA 1YCPM 1OWDA 4A92A 1L4DA 2Y7XA 4I31A 2OQ5A 3UWJH 1HPGA 2O8WA 4UD9H 1BB0B 2G81E 1C5YB 4NIWA 1FQ3A 3M3TA 3BTTE 2GZ9A 2W7UA 1YKTA 3VB6A 2ULLA 1CA0B 3BSQA 5FX5A 1ARCA 1BTYA 2EI6A 1BUIA 4YOGA 5IDKA 1HAVA 3K2UA 1CBWB 1O3BA 3PMBB 9LPRA 2W5EA 2BMGB 3KQDA 4HZHA 1L1GA 3RXJA 4FUEA 1CU1A 1VCPA 4XBBA 3P8NA 1C5VA 1J15A 1NM6A 5FX6A 5L6NH 3KL6A 1UHBB 5C5NA 5DP7A 1ABJH 2RCEA 5EQSA 1GI7B 2ZPSA 4FUIA 4J1YA 3ZV9A 4K2YA 2ZHEH 1GHAF 3E3TA 1QQUA 1V2RT 4DW2U 5L30H 3SJ9A 2ANKH 2GZ7A 3H7OA 4IMZA 3NXPA 1K9OE 5IYTA 4AFQA 2R3YA 4H6TA 4K60A 4XBCA 1W0ZU 1FY5A 4DJZB 3SJOA 1C1OA 3ATMA 3MHWU 2BVRH 1YPKH 4RKJB 1C1TA 2QC2A 3E0PB 3TNSA 4F4OC 2XW9A 6GCHG 2BD4A 3SW2B 4D76A 2XBYA 2ZGJA 3K6ZA 1RGQA 3ZZ5A 5CE1A 1DX5M 2AMDA 2C8YB 1IQNA 3M7TA 1UVUH 1WTGH 4MPUA 4DCDA 1AZZA 1XKAC 1SOTA 2BX4A 1P3EA 1T8MA 1C5MD 3CS7A 1SGDE 4B76A 2BY5X 4Y8YA 2ODQA 5F6MA 3PO1B 2HALA 2ZGCA 2ZGXH 3A7TA 1DITH 4UEHH 4CHAC 1TPPA 4NFEA 1V2JT 1VCQA 4ABEA 1ELAA 1TX8A 4ZKOU 1Y5UT 2JH5D 1DPOA 4A1TA 3SU1A 1SLVB 3O8RA 4GHQA 1LDTT 3ZZAA 3GCNA 2ZHFH 3LC5A 1YF4A 1XUKA 1OSSA 3E6PH 1O38A 1O2XA 1LHGH 2BDBA 1GMHG 1GJDB 1FAKH 4X2VA 3GY3A 3F9GA 6ESTA 2I6QA 1AUJA 1BTPA 3EA8A 3GYLB 3SZNA 2OXSA 4AFUA 1YGCH 3IWMA 1ZGIA 3GDVA 1O3JA 3F6UH 1GBJA 2HNTF 2GCHG 2GZ8A 1ESBA 5JBTA 3BF6H 1BA8B 4JZ1A 1TA6A 1MCTA 2PWXA 4MPWA 2AIQA 1KTTB 1BT7A 4CRAA 5DG6A 1UCYE 3ATKA 3URDA 2VVUA 4A7IB 1BRCE 1OP2A 1UTMA 5FBEA 2Q6FA 1W3CA 4K1SA 1O5FH 2PKAB 2O8MA 1YPMH 1AE5A 3BTDE 2ZI2H 1LHDH 1MKXH 1KSNA 2FIRH 2BY9X 5C67A 1EOLA 1G36A 1KXEA 5EPYA 2SNVA 1TMBH 1V2PT 1QCPA 4MNWA 1VCWA 4GVUA 1CQQA 3QK1A 1V2NT 1KTSB 3EA7A 1VGCC 1O39A 1THSH 4AGJA 5EGMA 2AS9A 1MKWH 2BDGA 1O5AB 3EA9A 6LPRA 1ESTA 5J4QA 2RDLA 2C90B 2NU3E 2XCNA 3LC3A 1IQMA 2ZG0H 3A89A 3BG8A 3MFJA 4YLQH 1NRSH 1K2I1 1O37A 5LGOA 5A2MH 1CT0E 1TGSZ 4ABBA 2KAIB 1TX7A 3FZZA 3A8CA 1O2PA 5JB8S 4GHTA 4ABGA 1O2RA 1BOQA 4NA7A 3BTWE 1D9IA 8KME2 3GDUA 3ELAH 2D1JA 2CF9H 2FDAA 1AMHA 2W7SA 3SV8A 5F8XA 4U30A 4ZMAH 3PMAB 1K28D 3S7KB 3MI4A 3RMNH 5LPFA 1TWXB 4MTBA 1PPHE 1ESAA 4KKDA 3P8OA 2PSXA 2A5IA 3FZDA 1YPLH 4J2YB 1Z6JH 5TCAA 1QB1A 3UOUA 2QF3A 2HVXA 2AYWA 1O2IA 5FXLA 3GY4A 3RXPA 1FIZA 1HIAA 3DUXH 3SNEA 4IN1A 3T28A 3RLYH 1UCYH 1TGNA 1LTOA 3E90B 4LOYH 2JKHA 1TOCB 2G4TA 4AFSA 3R3GB 4WF8A 1P8VC 4CR5A 4IBLH 4B1TA 1W8BH 2ZHQH 1KDQB 1ETRH 4MNYA 2A1DB 3P95A 1P2KA 3RM0H 5C3NA 3GY6A 1WV7H 5E8EH 3RU4T 3HKJB 5ABWA 1Y3WA 3O8BA 1L1JA 1H9HE 1Y3UA 3DT0H 5EQRA 3SGAE 1Z71A 1SGNE 3HGPA 2FPZA 1QFKH 1NN6A 3TVJB 3ITIA 1GBDA 1ZSJA 2FI4E 1A0JA 3QN7A 1C1PA 3LKWA 1GVKB 1WOFA 1VJAU 2BVXH 3RXKA 2W26A 4MLFB 3WY8A 1DANH 4CR9A 1HUTH 1O2TA 2AFQB 3JZ1B 1RFNA 1PPZA 1GMHF 1K1LA 4NFFA 1LMWB 2A7CA 3GCHB 4B2CA 2ZQ2A 3KQEA 1EJMA 2W3KA 1GGDB 2A45B 3ZZDA 3B8JA 3BEUA 2Y81A 4B2BA 4DG4A 2WYGA 1TGTA 4UFDH 1CA8B 3SHCH 3T25A 1GGDC 2Y80A 1ZRKA 1ANCA 1QL8A 4WXIA 1C5UA 3GISB 3KQBA 3BEIB 1ANDA 1WSSH 3UQOA 1ELVA 1OYQA 3HKIB 2HPQH 3VB4A 4XBDA 4D9RA 4BOHA 3SNBA 1P10A 1SPJA 3UFAA 1XM1A 3UOPA 1GBCA 1BMLA 5K7RA 1LHCH 3KCGH 2QF0A 1GJAB 3G01A 6CHAB 1DY8A 4AB8A 4B73A 4ZKNU 2XC4A 4O97A 4YESB 4NIXA 1S83A 1EJAA 1Z1IA 1O0DH 1AB9C 1BBRK 1EATA 3UNSA 2TGPZ 3M3VA 5FCKA 4E06H 5A8YA 2ZQ1A 2A5AA 2BQ6B 5FHTA 3SQEE 2M5TA 2Y5GA 4BTIB 2KAIA 1GDQA 1MKWK 5HM9A 1F0TA 2J9NA 1ELBA 1NRNH 3SU3A 7GCHG 1H9IE 1HXFH 5FPSA 1P05A 3D62A 4GAWA 2QY0B 2XWAA 1EZQA 8GCHG 3BG4C 4INLA 3A81A 1BDAA 1XUGA 1L2EA 3M35A 4BNRA 2AGEX 2EI8A 3A85A 1FAXA 2Z9GA 2O8UA 1GCDA 1O3AA 3A8AA 3MU4A 4ISHH 2J94A 4LXBH 2D26C 2A4GA 3EE0B 3TGJE 1O2LA 1MTNB 1ZMLA 1YLDA
chains in the Genus database with same CATH superfamily
1G37A 3RXBA 4SGBE 2BHGA 7KMEH 1N1LA 3BEFB 1KLTA 1YWUA 2FOMB 2F91A 3MNSA 1QJ7B 3FP7E 3PO1C 2Z3EA 2ZC9H 1QTFA 1HAZB 1NU7B 3CENA 2Y5HA 4X2WA 2GMTC 1GPZA 2TPIZ 4NA8A 2ZDLA 1DFPA 2TRMA 2BLOA 2ZFTA 5KEDA 1CVWH 5FPYA 3OY6U 1GI2A 2ZCLP 2GV7A 1N6YA 4ABFA 3Q3YA 4I86A 3E0NB 3LGVA 5JBBS 2PSYA 3PV2A 1E79D 3PRDA 2DE8A 4NZLA 5EW1H 1BHXB 2ZECA 3AASA 3KNXA 3W1EA 4IMQA 4X6PA 3ZVAA 1VGCB 1AVWA 2FX4A 2XBXA 1ELDE 3SI3H 3EQ0H 1FN6A 2ZTZA 1O2GH 3VB7A 4O9VA 1TNIA 2PFEA 3BTFE 4FUFA 1S0RA 4X6OA 1O3PB 7ESTE 1T8LA 2XC0A 2SNWA 3ODFA 4ZHLU 1A0HB 1Y5BT 1MTNC 4MQAA 1OS8A 3M7UA 1PQ7A 2PP6A 5EOKA 3PM3A 4H6SB 1E36B 2OTVA 4ZH8A 2Z6BD 1GBHA 1KXBA 3QDZB 1L4ZA 1XMNB 2BDHA 3SGQE 4FUCA 4HTCH 2Z9KA 1ANEA 3A8BA 3BTEE 5C0UA 3SJKA 1K22H 2ANWA 3OTJE 4X6MA 3RXHA 4YO9A 1JMOH 3RXMA 2O9QA 3BTQE 2BD8A 2WZQA 1T8OA 4HFPB 3Q77A 2WHXA 2VU8E 5LPRA 2Z3CA 2VIQA 2B7DH 2IJD1 2SGPE 2STAE 5C1YA 1OP0A 2HNTE 1PJPA 4UFGH 5G4BA 4WMDA 5GXPA 4AGKA 1AB9B 4DOQA 1UTQA 4Q2KA 4X1QU 1AFQC 1LVOA 3LGIA 1S5SA 1LKBA 1SKYE 3KF2A 4MG3A 1C2DA 3SV6A 1FJSA 4OS7A 4M9FA 1RJXB 1AVXA 1V3XA 4X8TH 2TBSA 2J92A 3ZVEA 3AW1A 1YPHC 5A8ZA 1C4V2 3RXCA 1ZHRA 1TBQH 2F4LA 1EAWA 3A83A 4K3JA 1GBLA 1D3TB 1L0ZA 4UDWH 5I25A 3UAIC 3LJOA 3L33A 1Q31A 5DP6A 1FY3A 1TAWA 2BVSH 2R2WU 3EE7A 4UONA 3RDZA 2C8XB 5JPMH 1EPTC 1K1PA 3SBKA 1W14U 2RA3A 4ABJA 4RT1A 1BRBE 3F2FA 4K8BA 2B9LA 5EJLA 1GJ4H 2VWMA 2W3IA 1O36A 1GJCB 1TQ0B 1MKXK 1HGTH 1NC6A 5BRRE 2QXJA 1UTOA 1SGYE 3ENSB 1YYY1 4GSOA 1UTPA 2FZZA 2VGCB 4YOJA 3M5LA 5CHAC 1O2UA 1CT2E 2ZCKP 3KIDU 3ZZ9A 1ZSKA 5ETXA 1E0FD 1E1RD 2A0QB 1ZPZA 1P01A 4H42U 4ASUD 2ZGHA 2ZF0H 2GCHF 4ABDA 1DM4B 3GS9A 1T31A 3M3SA 1KXDA 1ELEE 1VR1H 2WSSD 4ZKSU 3ZVCA 4ABIA 2ALVA 1AUTC 4HG6A 1EAIA 3T62A 4XSKU 1Q3XA 1ABIH 4E05H 5DKMA 1C2KA 1GI3A 5DGJA 4CH2B 1IAUA 5FL7D 1O3HA 2H9HA 1CE5A 2WV5A 4Q7ZA 1Z8RA 1HAXB 4WH8A 4Q80A 3UNRA 4WXVA 1DWDH 2A4QA 3S9BA 3BTHE 3FP6E 1Z8JB 1IQHA 2CN0H 2ZHDA 1LCYA 2B8OH 3UUZA 1Z6EA 2SGAA 2BXUH 4Y76A 2YMSC 1SGEE 2G00A 1EXFA 1EZXC 1O2WA 3RXUA 1GI5A 3A88A 2F3CE 1F5LA 4CBOA 1P2OA 4AYYB 2BB4A 1FNIA 3RXLA 1ETTH 4LZ1H 1E1QD 5DP3A 2P59A 1UK4A 1TNLA 1AGJA 1O3NA 3SORA 2BZAA 1SFIA 4NIVA 2ZWLH 1DOJA 4BAMB 4NG9H 2Q6DA 1P2JA 5GPIB 3T26A 2G51A 1RD3B 2BD2A 1WCZA 4AZ2B 4LZ4B 1F5RA 4Y7AA 2H5DA 2ZFRH 3TIUA 1IQKA 1HCGA 2HGTH 2GP9B 3MH4A 4MVNA 4E7RG 1HJAB 3KQCA 4UFEH 3SI4H 2XTTB 2F9OA 3OU0A 1KXFA 2VIWA 1P2IA 2J34A 4HGCA 3ZZBA 5B6LA 2A4OA 3RC5A 3A7XA 2HWLB 1A46H 2GTBA 2R0LA 1O3MA 1ZGVA 2BY8X 4ZROA 3RXOA 3MOCA 1TNGA 1GL1A 2VIOA 5GWZA 3RLWH 1GDUA 4AG1A 3NK8A 1BMMH 4KTSA 1A5GH 4A6LA 1C1WH 1NS3A 3U8OH 3W94A 2P3FH 1TRNA 2VNTA 4B71A 2AGGX 1J16A 2ALPA 3QGNB 1BITA 1O2YA 1FPHH 4Y10E 1LVMA 4YM9A 3B23B 1THRH 3P8FA 1A5IA 1DDJA 2RG3A 1AWFH 3SUDA 5ESTE 1O3KA 3P92A 4KP0A 4X2XA 1K1JA 4CHAB 4CRBA 2J98A 3FVFB 5DPAA 4NSVA 2HRVA 1SGQE 1CBWC 4A5TS 3TH4H 3UPEA 3MH7A 3ODDA 1V2TT 1NY22 1JBUH 4I7YH 4CH8B 3QX5H 1SLWB 1OWJA 1WQSA 3BIVH 5ESBA 1NU9A 3ZV8A 2VVVA 4ZHAA 3TJVA 1V2ST 1LQDB 1BJVA 1G9IE 4ISIH 3ZYDA 4KGAA 1YBWA 1FONA 1C2IA 2F43B 2BX3A 1QL9A 2OK5A 3TGIE 1WAYB 1YPJH 1TGCA 1C1NA 2WPKS 1NT1A 2ZFFH 3PLKA 2BDIA 1CO7E 2ZIQH 1E34B 4CBNA 1FMGA 2JJ1D 2WV9A 2IJOB 4WJG2 4Z0KA 3SU6A 1ZRBA 1P04A 1GBIA 4TWYA 1AI8H 3V0XA 4Q7YA 1ZYOA 1BMFD 1H8IH 2NWNA 2IOTA 5C1XA 1P02A 1DWCH 1ZPBA 4RN6A 1TBRH 1K21H 4NSYA 4MPVA 1MBQA 1TE0A 4I8LA 3RUOA 2LELA 3NRLA 1P9SA 3NZIA 1UJ1A 5LH8A 1OX1A 3LGTA 1ZTLA 4WY3A 1BTXA 2A5KA 1KYNA 5DP4A 2V3HH 3STIA 4FETA 1O2NA 3S69A 2JJ2D 1QGFA 4TYDA 2G52A 1VITG 3U28C 1TOMH 1AHTH 3T5FH 1EP5A 5CDFE 3LGWA 1D4PB 1F5KU 1HFDA 2OUAA 1SVPA 1TIOA 4MNVA 1MBMA 4JZEH 1GVLA 4B74A 5T1VA 1SL3A 2V35A 1QRZA 1YPGH 5FAHA 3L6PA 4D7GA 2A31A 1GMCG 4TSFD 3KEEA 1A1RA 3BTKE 1GI4A 1ZTKA 2BDAA 2ZHWH 2UWOA 4XE4A 1DLEA 1WDIA 1UTJA 1GBEA 1T7CA 3QZQA 3MNBA 3RM2H 2V6NA 1DT2A 5HYOA 3V7TA 1SLUB 1PYTC 4ISLA 3GCTG 5EXLA 3P8GA 1LKAA 3UY9A 1YLCA 2OC7A 3FP8E 1FZZA 2J4IA 4F48B 2VGCC 1D3DB 3UWIA 5F8TA 3H5CB 4IN2A 1XVOA 1GI1A 3HGNA 4VGCB 3V12A 3M5NA 2G8TA 2QA9E 1JRSA 2KCYA 2PHBA 1V2UT 1WYKA 1ZJDA 1C5WB 2P8OB 2Z7FE 3DSPA 2P16A 2Y6TA 4U2WA 2QE7D 3T27A 4MNXA 4Q4LA 2P8OC 1SG8B 2A4RA 1GI0A 5JYIA 2AEIH 1KLIH 3DA9B 4BTTB 1YLNA 2BZ6H 4BAHB 4TPYA 3MNXA 1Y3YA 3A7VA 3LDXH 3TK5A 2FO9A 2FOEA 2VVCA 1GI6A 3A7ZA 1HJ8A 3RXIA 2P3TB 9ESTA 1SGCA 1QJ6B 3VGCC 8ESTE 1JXPA 1MD8A 4U01A 1BMNH 1PFXC 2J5UA 3SU2A 1IQGA 3PROA 2VJ1A 3AW0A 3BTGE 2JH6D 3SV2H 1QR3E 1UO6A 1SGTA 2YOLA 2OD3B 3A87A 4KTCA 1D6RA 1V2KT 1Y59T 1FN8A 5C2ZA 2WINI 2CK3D 2Z9LA 1SGRE 2PKSC 3UB0A 2AHME 4AYVB 2V0BA 1O3CA 2FEQH 3PYHA 1KMHB 2RDEA 4JZFH 1HYLA 4GCHF 3PB1E 1V6DA 2GDDA 1WUNH 1H4WA 4X1NU 2UUKB 4KELA 4E7NA 5EIYA 2I6SA 1C5QA 4ZXXH 3ZZ3A 1EPTB 2FTMA 4TWWA 1C5TA 4F55A 1AD8H 1LPZB 4ZUHA 1O2ZA 4DGJA 1A4WH 1QY6A 1WU1A 1SBWA 2QAAA 1SQRA 2ZTXA 2ZU5A 1ELFA 1KLJH 3U1JB 3F68H 5GDSH 1COWD 2FOBA 1QHRB 1GHYH 2NU4E 1RTLA 1DWEH 1U6QA 2XNIA 1T4VH 1O3IA 2BLVA 3P17H 3CP7A 1HV7A 1O34A 4SGAE 5CHAB 3GYMA 2EC9H 3ZZ7A 1BBRE 2A2XH 2BD3A 3F3BA 2C8WB 1MTUA 4FU8A 2ZDKA 5EJZA 2AMPA 4I32A 1GL0E 4JMYA 1HAYB 3TH3H 1RS0A 1W10U 4FVBA 4H4FA 1SMFE 1O2SA 1TB6H 1ZSLA 5KGOA 4JYTA 1GHAG 2PKSB 1CHOF 3KGPA 1FY8E 1MQ6A 3STJA 5HXFA 4R0IA 2OC0A 5FCRA 2PTNA 3ZVDA 4JYVH 5JB9S 2OINA 2ZPQA 4ABHA 4JZIA 3AAVA 1SGFA 2CV3A 3NUMA 1OWIA 2QYIA 3HK6B 1HJAC 1GJ7B 1PQAA 4WH6A 2NU2E 1A61H 2CHAB 3ZIAD 1V2WT 2L74A 1SQOA 1HJ9A 1QNJA 3UQVA 3F9EA 2G5NA 4AFZA 3UTUH 1AFQB 1PPEE 2OC1A 1LHEH 6CHAC 3LONA 1BZXE 1EB1H 5TJXA 2ZU1A 1EAUA 4K8YA 5A09A 1SOZA 3MNCA 1K1IA 1FXYA 4MDSA 3EDXB 1ZPCA 3K9XB 1RIWB 1O3LA 1F0SA 1C5OH 1CT4E 4X8VH 1C5SA 2VWOA 3A80A 1TMTH 2Q1JA 2ZO3H 3F1SB 5T6GA 3SZEA 3M37A 4I8HA 1V2MT 4VGCC 1HLTH 1ZLRA 1KXAA 5PTPA 1EJNA 2YNBA 3S9CA 1SGPE 1DE7H 4TPIZ 1FDPA 1GJBB 1A3EH 1HAVB 5EPNA 1TBZH 1AQ7A 3SUEA 5EXNA 2FLBH 2IPHA 3RU4E 2VIPA 1C1SA 1J8AA 1CGHA 3S9AA 1YP9A 1N6XA 1NZQH 1OWKA 1DUEA 1HBTH 1XUIA 1PPGE 1G2LA 4GLYA 1ID5H 1GHBF 3RXAA 2HNTC 3TJNA 1BIOA 1AN1E 3C27B 4OGYA 1C2JA 2GCTC 1S82A 1DLKB 5I46H 1P3CA 1JOUB 1IQJA 3MO6A 5A0BA 2SFAA 1S6FA 2ZDNA 1GWAA 2D8WA 3KN2A 2Z9JA 2HOBA 5AVDA 2ZDAH 1O2MA 4BAQB 5FBIA 2NU1E 2H2ZA 1HAIH 2F9VA 5GCHF 4K5ZA 3QZRA 3TK6A 3TH2H 4A1XA 2QF5A 1GJ9B 3ATIA 2ZPRA 1P2NA 1MQ5A 4CRGA 2GT8A 1AO5A 1QJ1B 2FYRA 4Y11E 1JIMA 2XCFA 3T2NA 2AIPA 1NBME 4X1RU 1AKSA 2C4FH 3A7WA 1UVOA 2GMTB 3LIWA 4JK6A 4Y8ZA 2A2QH 1H9LB 3FAOA 2GGVB 3DCLA 2NU0E 2ANMH 3IITA 4YLUA 1BTUA 4JYUH 1P0SH 2F83A 2QV1A 1ANBA 2G5VA 1DXWA 2XOKD 2ZDVH 2VIVA 2WUBA 1S6HA 4X8SH 1BQYA 2CXVA 1S6LA 1EP6A 3GY2A 3RXVA 3TGKE 1FUJA 1ZHMA 2ZU3A 4FUBA 3HPTB 1O2JA 4O3UA 4NA9H 4ISNA 1VITF 5E2OA 1RTKA 4FXGH 1AY6H 3R0FA 2PGQB 1NBMD 2WPMS 5C0TA 3SN8A 4I8GA 1KDQA 5DK1A 5E0HA 1NFUA 1W13U 1SGIB 3EAJA 1NESE 3E91A 1TRMA 2JH0D 1OXGA 2BOHB 2A7HA 2AMQA 4BANB 4FU9A 2ZA5A 3QGJA 2QIQA 2JETB 1TYNA 2XRCA 3UREA 1P11E 3SGBE 1Y3VA 2ZFSA 3QUMP 3UR6A 1SFQB 1TFXA 1HIAB 3PLPA 1N8OB 3O8CA 2DE9A 3E16B 3LOXA 4JZDH 3N7OA 3RXEA 2Z94A 1HDTH 4R8TB 1W7XH 2FOFA 1EZUC 4ISOA 4IC6A 1SQAA 1CHOG 1GBFA 2GVFA 1DY9A 3FANA 3LT3A 1W11U 2B0FA 2VB0A 1HAPH 3ZVBA 2ZU2A 4INHA 2G4UA 3GCOA 1GDNA 1IQFA 1O3OA 2O8LA 2Z3DA 1V2OT 1SB1H 3LPRA 4ESTE 2KM0A 1IQLA 1J14A 5AHGH 1XUJA 2QXHA 8LPRA 4M7GA 1TONA 1C1VH 5DO4H 2JIZD 4YT7H 1TPAE 3EGKH 3LH3A 3PV4A 3P6ZB 3D49H 3SU4A 2A7JA 1O35A 1TALA 2G55A 3TNTA 1TGBA 1GJ5H 1FY1A 1QB9A 1TNJA 1CSOE 2EA3A 4GPGA 1EOJA 1LO6A 2QCYA 4DT4A 1UTNA 2P3UB 1YC0A 1OPHB 2WPHS 5JDUB 1P9UA 1ZZZA 3MH6A 1SSXA 1DWBH 3WWBA 4Z6AH 3M36A 4P00A 2BQWB 2CJIA 1H8DH 3PLBA 3DFLA 3ZZ4A 1QB6A 1GHBG 1GBAA 3NPSA 2R9PA 3CS0A 1OKXA 1DS2E 1P57B 3DHKH 1XKBC 7LPRA 1XX9A 3VXFH 4RI0A 2YNAA 1AWHB 3OAAD 4YTAA 3SO3A 2R3UA 3NWUA 4DY7B 2B5TB 1S81A 4BTUB 1UVSH 4NZQA 2V7QD 4JK5A 3SNCA 3D65E 1O5CB 1IQIA 3VFEA 4UE7H 1GHWH 2PKAA 3KHVA 5F8ZA 2GDEH 2THFB 2BQ7B 1SQTA 1W7GH 1AE8H 4BXWA 3VB3A 1IHSH 5T6DA 2BY7X 1XXFA 3RMMH 1O33A 1YPEH 2LNCA 3ESTA 3BG4B 2GD4B 3PTNA 2FS9A 2K1QA 1F0RA 1W0KD 1RTFB 1QRWA 4IW4E 2F9UA 1GCTC 1V2VT 1DSTA 2PW8H 4K1TA 2K0QA 3D23A 4ZCNA 1MAYA 2ZDMA 1ZHPA 5CMXH 1QBOA 2DUCA 1C5PA 1W0YH 5T3HA 4YT6H 2ODYB 1TPOA 2VWNA 1FIWA 1UCYK 3URCA 2CMYA 1Q2WA 1A0LA 1UMAH 1LVBA 1BBRH 2BTCE 5LPEA 3HATH 4B2AA 3M5MA 4CRFA 3TK9A 4I8JA 4DIIH 1TABE 1C2HA 1OP8A 4CRCA 2IN2A 1CGJE 1ARBA 1HB0B 2H5CA 5DP9A 2EEKA 3RXDA 2HLDD 4RT0A 1ELCA 5HM2A 1WQVH 1IQEA 4WMEA 1ZMNA 4XRNA 1O2HA 1EAXA 1IHTH 3DSGA 5C1UA 1W0JD 5HMAA 3RXTA 1QL7A 3MH5A 2P94A 1EKBB 1GHXH 5HIYA 1E37B 3TJUA 5DJ7A 1FY4A 1C1MA 3SUGA 5E0JA 4K69A 1RIWC 1GMCF 1PQ5A 1B0FA 1IOEA 1OWHA 3B9FH 4HI3A 5EU8A 3TPIZ 1C4Y2 2KFWA 1E38B 1W2KH 1NRPH 1BTWA 4MPXA 3UNQA 2ZGBH 4FUJA 3BV9B 4WWYA 1ELTA 1GHVH 5TCCA 1DUAA 2WV4A 1TNKA 1UK2A 3ZZCA 4ACAA 3GCTF 3Q3XA 1ZTJA 2PGBB 4AN7A 3F9FA 2FOHA 3K6YA 1O5GH 2GX4A 6GCHF 1SI5H 1ZR0A 1SC8U 2CF8H 3SHAH 5AFZH 2JETC 2XBWA 3FO8D 3UR9A 1WTHD 1PPBH 2FOGA 3PMHB 4OS4A 5GIBA 3QTVH 1G3CA 2A32A 2BYAX 3MU5A 4AG2A 3MU8A 1ELGA 2CGAA 1UTLM 2ZP0H 1SLXB 2Q6GA 2WPIS 4DVAU 3I77A 3GCHC 3Q76A 4ZHMU 2KX4A 1MMJN 4B75A 4K1EA 1K1NA 2ZFPH 4Y6DA 1EB2A 1VKYA 3U69H 1C1RA 8GCHF 1TX6A 5DP8A 1C5NH 5C20A 1P2QA 2D2DA 2QN5T 1GHZA 3V3MA 1HXEH 3OYPA 5EW2H 2OBOA 4QT8C 4OGXA 3SUFA 1O31A 1LVYA 1XXDA 2GKVE 1A5HA 1NRQH 2PTCE 2FI3E 3A7YA 3ZYEA 1SGFG 2SGEE 4D9QA 1G3EA 2PLXA 1DVAH 4I8KA 3W95A 5DN6D 1TA2A 1C2MA 1O30A 2J38A 1MZAA 1SHHB 3QLPH 1JRTA 1C2LA 1AVGH 1QQ4A 1A2CH 4X1PU 1CHGA 1GMDG 2BXTH 2ZFQH 1EQ9A 1VITH 3L3TA 1GCTB 1ZJKA 3SU5A 1QURH 3PV5A 2TGDA 2BD5A 2JDID 1S85A 1C9TA 2XXLA 3LGUA 2ZZUH 4X0WU 1GMDF 1MU6B 1UVPA 1INCA 1MTSA 2J98B 5JBCS 5E2PA 3ATLA 2UUFB 5H4IB 2F9NA 3U8TH 2FOCA 1LQEA 1AIXH 1OOKB 2BLQA 5FPTA 1JWTA 4FVDA 4Q7XA 5EXMA 2M2AA 5E0GA 3A86A 5BPEA 2Z9IA 3Q00A 2ESTE 1C5XB 3SOSA 3FN8A 4OS6A 3LH1A 2STBE 4FUGA 3RXQA 3SQHE 3S7HB 1C9PA 3C1KA 3TU7H 1NROH 4YXWD 1EX3A 1Z7KA 2FOAA 2FI5E 1FV9A 1BTZA 2BOKA 1LHFH 5L2YH 1FLEE 1RRKA 1QBNA 1VZQH 4LK4A 2H6MA 1BRAA 4B6FA 3RP2A 2LPRA 3E1XB 2FWWA 3N7DA 4FU7A 2EQNA 2SGFE 3BIUH 1O3FA 1NO9H 1F92A 4Y0YE 4ZAEA 2H1UA 4TY7A 1S0QA 2F9PA 2V3OH 3Q3KA 1LPGB 1CA0C 1A3BH 3QTOH 4JCNA 4CRDA 1D6WA 3JZ2B 5JBAS 4ASHA 1T4UH 3RXGA 1F7ZA 1YCPH 2PUXB 2P93A 4IGDA 2QXIA 3GY8A 3TLOA 2FESH 1AZ8A 1YY3A 2R2MB 4BAOB 1BMAA 1MUEB 1O5DH 1M9UA 3ATWA 3ZZ6A 2FMJA 2SGQE 3P70B 2TGTA 2QGRA 2VWLA 5F03A 1J17T 2WYJA 1FI8A 3TJOA 3MMGA 1E35B 4BAKB 4U32A 5GJ4B 2ILNA 2KZ4A 1TRYA 1XUHA 3VG8A 2CHAC 1H1BA 1N8OC 4Y71A 2AGIX 2W6JD 3K65B 3A8DA 3N99A 3SV7A 4NGAH 2R0KA 1EPTA 4DT7B 1VJ9U 4KTUA 4AC9A 2ANYA 3EYDA 5AFYH 4WVPE 3DD2H 2UWPA 1O5BB 2GJGA 2VH6A 3RMLH 2J2UA 1C4U2 3WW7A 1ORFA 3S0NA 1O3DA 3GY5A 1HAGE 4X6NA 4GUXA 3OTPA 1GI9B 2FP7B 1DSUA 2PV9B 1OHHD 1DICA 2FTLE 1QIXB 3T29A 1NPMA 1BHXF 1G3BA 1T32A 1W12U 3OE7D 1PPCE 1QA0A 1G30B 2K8IA 3GICB 4XFQA 3OY5U 1AFEH 2ASUB 2WPJS 1UHBA 3O8DA 3U8RH 3OSYA 4Y7BA 2UWLA 2C3SA 1GJ8B 3LJJA 1KXCA 5AF9H 3F9HA 2FLRH 2XC5A 1P06A 2XYAA 2P95A 1MD7A 2PR3A 5HGGA 1FPCH 3MU1A 3A84A 1ACBE 2BM2A 1BCUH 2VIDA 1FX0B 3VEQB 2UUJB 3GY7A 1BTHH 2ZCHP 1TLDA 1D3QB 1XUFA 2FYQA 4YOIA 1ETSH 3DSOA 2KR7A 1QRXA 2FXRA 1GJ6A 1MABB 3VXEH 3RC6A 3F2GA 2TGAA 5KECA 5SGAE 1DXPA 2Y7ZA 3AK5A 1G2MA 1C5LH 4INKA 1NFXA 3RC4A 3RXFA 2O8TA 4NCYA 1GVZA 3AAUA 3IG6B 1CGIE 4THNH 2GV6A 4F49A 4A1VA 3QO6A 4X2YA 1V2LT 3KQ5A 1C5RA 1K1MA 2GCTB 1GBBA 5CHBA 4O03A 1RXPA 2BD7A 3GOVB 2VINA 3LGYA 5B6OA 1TQ7B 1F0UA 3RU4D 1C2GA 4X1SU 1PQ8A 5L2ZH 1QA7A 1ZMJA 1MH0A 2OLGA 4FOUC 3VPKA 1UVTH 3QWCH 1BRUP 1EFRD 4O3TA 1MTWA 3SV9A 1GBKA 2OCVB 1MZDA 1B5GH 3V13A 4UFFH 3RXSA 2FX6A 2BD9A 1GG6B 5K0HA 2HPPH 1PPFE 2C8ZB 1G3DA 3MO9A 1B7XB 1P12E 2J95A 4Y8XA 1NFWA 2ZNKH 4I33A 4YZUA 1PYTD 1O32A 1Y8TA 2BDYA 3ZZ8A 4X8UH 1P03A 3PMJA 4IS5A 1P09A 1UTKA 1C5ZB 4GCHG 1S84A 3NCLA 5IK2D 5EG4A 3U9AH 2J97A 3MYWA 2IPQX 4Y79A 4BXSA 1C1UH 4AX9H 4PROA 4CREA 4D7FA 2QXGA 5HIZA 2OBQA 4OS5A 2SGDE 5EJ1A 4DIHH 1T8NA 3I29A 3RMOH 1KIGH 1D3PB 2C93B 3HK3B 1TNHA 1L1NA 1O3GA 3PWCA 3M61U 1O5EH 1GBMA 2OQUA 2FS8A 1MTVA 2ODPA 2H9EH 1O2QA 4ZKRU 1O2KA 1V2QT 1LPKB 1WBGB 1J9CH 4OS2A 3BN9A 3MTYA 5J4SA 2EI7A 4WMFA 4FUHA 1HAOH 4OS1A 2H9TH 3BTME 3GDSA 1G32B 4D8NA 1Z1JA 1YCPK 4DURA 1C2EA 4NWKA 4RKOB 2BY6X 2F9BH 4IC5A 1Z8GA 5EQQA 1TPSA 3DFJA 1MCVA 4XOJA 3H7TA 3F2HA 1MAXA 5A0AE 4RSPA 1ZOMA 1HAHH 1A7SA 1MU8B 1Y5AT 4ABAA 2VH0A 2FM2A 3RXRA 2EY4C 4Y0ZE 2RA0A 3UIRA 4AOQA 3SNDA 2OC8A 2BLWA 3ZVGA 4FUDA 2BDCA 1C2FA 2WPLS 2XBVA 3SNAA 1P2MA 3AVZA 3PWBA 1O3EA 3KYFA 1X7AC 3M5OA 1F2SE 1NRRH 1K1OA 2UUYA 3MWIU 1YM0A 5T6FA 4AORA 1AU8A 3MU0A 2ZKSA 1THPB 3FFGA 1EZSC 2GT7A 1HNEE 5GCHG 1EUFA 2AH4X 3CNRA 1SHYA 3E8LA 1C1QA 1O2OA 3SJIA 2WUCA 4NIYA 1EASA 4XDEA 3NKKA 3PTBA 3OFND 3SJ8A 3U1IB 3LU9B 4AB9A 2AERH 1OWEA 2FODA 1GI8B 2LP6A 3OX7U 5A0CA 3SU0A 4ZXYH 1NFYA 1XVMA 3MO3A 1AKSB 1NTPA 1GG6C 2QF4A 2PUQH 4Q63A 7GCHF 5C5OA 1GBTA 1TMUH 2ZU4A 1KY9A 1B0EA 2OP9A 3A82A 1UK3A 1Y3XA 3M7QA 2HLCA 1YPHE 1SR5C 1QBVH 2TIOA 3TITA 2XNDD 3ZVFA 2ZEBA 1BJUA 1Z8IB 3VB5A 5EODA 2Y5FA 3VGCB 1HRTH 3I78A 4TY6A 5DP5A 3U98H 1O2VA 2ZTYA 2XWBI 2Y82A 5A8XA 4NWLA 1OYTH 1JIRA 1YCPM 4XD7D 1OWDA 4A92A 1L4DA 2Y7XA 4I31A 2OQ5A 3UWJH 1HPGA 2O8WA 3SYJA 4UD9H 1BB0B 2G81E 1C5YB 3H09A 4NIWA 1FQ3A 3M3TA 3BTTE 2GZ9A 2W7UA 5DSFA 1YKTA 3VB6A 2ULLA 1CA0B 3BSQA 5FX5A 1ARCA 1BTYA 2EI6A 1BUIA 3OEED 4YOGA 5IDKA 1HAVA 3K2UA 1CBWB 1WXRA 1O3BA 3PMBB 9LPRA 2W5EA 2BMGB 3KQDA 4HZHA 1L1GA 3RXJA 4FUEA 1CU1A 1VCPA 4XBBA 3P8NA 1C5VA 1J15A 1NM6A 5FX6A 4TT3D 5L6NH 3KL6A 2KCAA 1UHBB 5C5NA 5DP7A 1ABJH 2RCEA 5EQSA 1GI7B 2ZPSA 4FUIA 4J1YA 3F0PA 3ZV9A 4K2YA 2ZHEH 3WWFA 1GHAF 3E3TA 1QQUA 2HVYB 1V2RT 4DW2U 5L30H 3SJ9A 2ANKH 2GZ7A 3H7OA 4IMZA 3NXPA 4OM9A 1K9OE 5IYTA 4AFQA 2R3YA 4H6TA 4K60A 4XBCA 1W0ZU 1FY5A 4DJZB 3SJOA 1C1OA 3ATMA 3MHWU 2BVRH 1YPKH 2YMSB 4RKJB 1C1TA 2QC2A 3E0PB 3TNSA 4F4OC 2XW9A 6GCHG 2BD4A 3SW2B 4D76A 2XBYA 2ZGJA 3K6ZA 1RGQA 3ZZ5A 5CE1A 1DX5M 2AMDA 2C8YB 1IQNA 3M7TA 1UVUH 1WTGH 4MPUA 4DCDA 1AZZA 1XKAC 1SOTA 2BX4A 1P3EA 1T8MA 1C5MD 3CS7A 2V3MA 1QZ8A 1SGDE 4B76A 2BY5X 4Y8YA 2ODQA 5F6MA 3PO1B 2HALA 2ZGCA 2ZGXH 3A7TA 1DITH 4UEHH 4CHAC 1TPPA 4NFEA 1V2JT 1VCQA 4ABEA 1ELAA 1TX8A 4ZKOU 1Y5UT 2JH5D 1DPOA 4A1TA 3SU1A 1SLVB 3O8RA 4GHQA 1LDTT 3ZZAA 3GCNA 2ZHFH 2WPDD 3LC5A 1YF4A 1XUKA 1OSSA 3E6PH 1O38A 1O2XA 1LHGH 2BDBA 1GMHG 1GJDB 1FAKH 4X2VA 3GY3A 3F9GA 6ESTA 2I6QA 1AUJA 1BTPA 3EA8A 3GYLB 3SZNA 2OXSA 4AFUA 1YGCH 3IWMA 1ZGIA 3GDVA 1O3JA 3F6UH 1GBJA 2HNTF 2GCHG 2GZ8A 1ESBA 5JBTA 3BF6H 5GNDA 1BA8B 4JZ1A 1TA6A 1MCTA 2PWXA 4MPWA 2AIQA 1KTTB 3F0OA 1BT7A 4CRAA 5DG6A 1UCYE 3ATKA 3URDA 2VVUA 4A7IB 1BRCE 1OP2A 1UTMA 5FBEA 2Q6FA 1W3CA 4K1SA 1O5FH 2PKAB 2O8MA 1YPMH 1AE5A 3BTDE 2ZI2H 1LHDH 1MKXH 1KSNA 2FIRH 2BY9X 5C67A 1EOLA 1G36A 1KXEA 5EPYA 2SNVA 1TMBH 3FKSD 1V2PT 1QCPA 4MNWA 1VCWA 4GVUA 1CQQA 3QK1A 1V2NT 1KTSB 3EA7A 1VGCC 1O39A 1THSH 4AGJA 5EGMA 2AS9A 1MKWH 2BDGA 1O5AB 3EA9A 6LPRA 1ESTA 5J4QA 2RDLA 2C90B 2NU3E 2XCNA 3FOAA 3LC3A 1IQMA 2ZG0H 3A89A 3BG8A 3MFJA 4YLQH 2VBCA 2KCOA 1NRSH 1K2I1 1O37A 5LGOA 5A2MH 1CT0E 1TGSZ 4ABBA 2KAIB 4B6EA 1TX7A 3FZZA 3A8CA 1O2PA 5JB8S 4GHTA 3KYGA 4ABGA 1O2RA 1BOQA 4NA7A 3BTWE 1D9IA 8KME2 3GDUA 3ELAH 2D1JA 5F53A 2CF9H 2FDAA 1AMHA 2W7SA 3SV8A 5F8XA 4U30A 4ZMAH 3PMAB 1K28D 3S7KB 3MI4A 3RMNH 5LPFA 4ACBA 1TWXB 4MTBA 1PPHE 1ESAA 4KKDA 3P8OA 2PSXA 2A5IA 3FZDA 1YPLH 4J2YB 1Z6JH 5TCAA 1QB1A 3UOUA 2QF3A 2HVXA 2AYWA 1O2IA 5FXLA 3GY4A 3RXPA 1FIZA 1HIAA 3DUXH 3SNEA 4IN1A 3T28A 1H8HD 2RFKC 3RLYH 1UCYH 1TGNA 1LTOA 3E90B 4LOYH 3OEHD 2JKHA 1TOCB 3PRBA 5C17A 2KCPA 2G4TA 4AFSA 3R3GB 4WF8A 1P8VC 4CR5A 4IBLH 4B1TA 1W8BH 2ZHQH 1KDQB 5HKKD 1ETRH 4MNYA 2A1DB 3P95A 1P2KA 3RM0H 2L6OA 5C3NA 3GY6A 1WV7H 5E8EH 1K0HA 3RU4T 5C94A 3HKJB 5ABWA 1Y3WA 3O8BA 1L1JA 1H9HE 1Y3UA 3DT0H 5EQRA 3SGAE 1Z71A 1SGNE 2YMSD 3HGPA 2FPZA 1QFKH 1NN6A 3TVJB 3ITIA 4P02A 1GBDA 1ZSJA 2FI4E 1A0JA 3QN7A 1C1PA 3LKWA 1GVKB 1WOFA 1VJAU 2BVXH 3RXKA 2W26A 4MLFB 3WY8A 1DANH 4CR9A 3N7EA 1HUTH 1O2TA 2AFQB 3JZ1B 1RFNA 1PPZA 1GMHF 1K1LA 4NFFA 1LMWB 2A7CA 3MQKC 3GCHB 4B2CA 2ZQ2A 3KQEA 1EJMA 2W3KA 1GGDB 2A45B 3ZZDA 3B8JA 3BEUA 2Y81A 4B2BA 4DG4A 2WYGA 1TGTA 4UFDH 1CA8B 3SHCH 3T25A 1GGDC 2Y80A 1ZRKA 1ANCA 1QL8A 4WXIA 1C5UA 3GISB 3KQBA 3BEIB 1ANDA 1WSSH 2W6ID 3UQOA 1ELVA 1OYQA 3HKIB 2HPQH 3VB4A 4XBDA 4D9RA 4BOHA 3SNBA 1P10A 1SPJA 3UFAA 1UW7A 1XM1A 3UOPA 1GBCA 1BMLA 5K7RA 1LHCH 3KCGH 2QF0A 1GJAB 3G01A 6CHAB 1DY8A 4AB8A 4B73A 4ZKNU 2XC4A 4O97A 4YESB 4NIXA 1S83A 1EJAA 1Z1IA 1O0DH 1AB9C 1BBRK 1EATA 3UNSA 2TGPZ 3M3VA 5FCKA 4E06H 5A8YA 2ZQ1A 2A5AA 2BQ6B 5FHTA 3SQEE 2M5TA 2Y5GA 4BTIB 2KAIA 1GDQA 1MKWK 5HM9A 1F0TA 2J9NA 1ELBA 1NRNH 3SU3A 7GCHG 1H9IE 1HXFH 5FPSA 1P05A 3D62A 4GAWA 2QY0B 2XWAA 1EZQA 8GCHG 3BG4C 4INLA 3A81A 4Z1MD 1BDAA 1XUGA 1L2EA 3M35A 4BNRA 2AGEX 2EI8A 3A85A 1FAXA 2Z9GA 2O8UA 1GCDA 1O3AA 3A8AA 3MU4A 4ISHH 2J94A 4LXBH 2D26C 2A4GA 3EE0B 3TGJE 1O2LA 1H8ED 1MTNB 1ZMLA 1YLDA
chains in the Genus database with same CATH topology
1G37A 3RXBA 4SGBE 2BHGA 7KMEH 1N1LA 3BEFB 1KLTA 2FOMB 2F91A 3MNSA 1QJ7B 3FP7E 3PO1C 2Z3EA 2ZC9H 1QTFA 1HAZB 1NU7B 3CENA 2Y5HA 4X2WA 2GMTC 1GPZA 2TPIZ 4NA8A 2ZDLA 1DFPA 2TRMA 2BLOA 2ZFTA 1CVWH 5FPYA 3OY6U 1GI2A 2ZCLP 2GV7A 1N6YA 4ABFA 3Q3YA 3E0NB 3LGVA 5JBBS 2PSYA 2DE8A 4NZLA 5EW1H 1BHXB 2ZECA 3AASA 3KNXA 4IMQA 4X6PA 3ZVAA 1VGCB 1AVWA 2FX4A 2XBXA 1ELDE 3SI3H 3EQ0H 1FN6A 2ZTZA 1O2GH 3VB7A 4O9VA 1TNIA 2PFEA 3BTFE 4FUFA 1S0RA 4X6OA 1O3PB 7ESTE 1T8LA 2XC0A 2SNWA 3ODFA 4ZHLU 1A0HB 1Y5BT 1MTNC 4MQAA 1OS8A 3M7UA 1PQ7A 5EOKA 3PM3A 4H6SB 1E36B 2OTVA 4ZH8A 2Z6BD 1GBHA 1KXBA 3QDZB 1L4ZA 1XMNB 2BDHA 3SGQE 4FUCA 4HTCH 2Z9KA 1ANEA 3A8BA 3BTEE 3SJKA 1K22H 2ANWA 3OTJE 4X6MA 3RXHA 4YO9A 1JMOH 3RXMA 2O9QA 3BTQE 2BD8A 1T8OA 4HFPB 3Q77A 2VU8E 5LPRA 2Z3CA 2VIQA 2B7DH 2SGPE 2STAE 5C1YA 1OP0A 2HNTE 1PJPA 4UFGH 5G4BA 4WMDA 5GXPA 4AGKA 1AB9B 4DOQA 1UTQA 4Q2KA 4X1QU 1AFQC 1LVOA 3LGIA 1S5SA 1LKBA 3KF2A 4MG3A 1C2DA 3SV6A 1FJSA 4OS7A 1RJXB 1AVXA 1V3XA 4X8TH 2TBSA 2J92A 3ZVEA 3AW1A 1YPHC 5A8ZA 1C4V2 3RXCA 1ZHRA 1TBQH 1EAWA 3A83A 4K3JA 1GBLA 1D3TB 1L0ZA 4UDWH 5I25A 3LJOA 3L33A 1Q31A 5DP6A 1FY3A 1TAWA 2BVSH 2R2WU 4UONA 3RDZA 2C8XB 5JPMH 1EPTC 1K1PA 3SBKA 1W14U 2RA3A 4ABJA 1BRBE 4K8BA 2B9LA 1GJ4H 2VWMA 2W3IA 1O36A 1GJCB 1TQ0B 1MKXK 1HGTH 1NC6A 5BRRE 2QXJA 1UTOA 1SGYE 3ENSB 1YYY1 4GSOA 1UTPA 2FZZA 2VGCB 4YOJA 3M5LA 5CHAC 1O2UA 1CT2E 2ZCKP 3KIDU 3ZZ9A 1ZSKA 5ETXA 1E0FD 2A0QB 1ZPZA 1P01A 4H42U 2ZGHA 2ZF0H 2GCHF 4ABDA 1DM4B 1T31A 3M3SA 1KXDA 1ELEE 1VR1H 4ABIA 4ZKSU 3ZVCA 2ALVA 1AUTC 1EAIA 3T62A 4XSKU 1Q3XA 1ABIH 4E05H 5DKMA 1C2KA 1GI3A 5DGJA 4CH2B 1IAUA 1O3HA 2H9HA 2WV5A 1CE5A 4Q7ZA 1Z8RA 1HAXB 4WH8A 4Q80A 3UNRA 4WXVA 1DWDH 2A4QA 3S9BA 3BTHE 3FP6E 1Z8JB 1IQHA 2CN0H 2ZHDA 1LCYA 2B8OH 3UUZA 1Z6EA 2SGAA 2BXUH 4Y76A 1SGEE 2G00A 1EXFA 1EZXC 1O2WA 3RXUA 1GI5A 3A88A 2F3CE 1F5LA 4CBOA 1P2OA 4AYYB 2BB4A 1FNIA 3RXLA 1ETTH 4LZ1H 5DP3A 2P59A 1UK4A 1TNLA 1AGJA 1O3NA 3SORA 2BZAA 1SFIA 4NIVA 2ZWLH 1DOJA 4BAMB 4NG9H 2Q6DA 1P2JA 5GPIB 3T26A 2G51A 1RD3B 2BD2A 1WCZA 4AZ2B 4LZ4B 1F5RA 4Y7AA 2H5DA 2ZFRH 3TIUA 1IQKA 1HCGA 2HGTH 2GP9B 3MH4A 4MVNA 4E7RG 1HJAB 3KQCA 4UFEH 3SI4H 2XTTB 2F9OA 3OU0A 1KXFA 2VIWA 1P2IA 2J34A 4HGCA 3ZZBA 2A4OA 3RC5A 3A7XA 2HWLB 1A46H 2GTBA 2R0LA 1O3MA 1ZGVA 2BY8X 4ZROA 3RXOA 3MOCA 1TNGA 1GL1A 2VIOA 5GWZA 3RLWH 1GDUA 4AG1A 3NK8A 1BMMH 4KTSA 1A5GH 4A6LA 1C1WH 1NS3A 3U8OH 3W94A 2P3FH 1TRNA 2VNTA 4B71A 2AGGX 1J16A 2ALPA 3QGNB 1BITA 1O2YA 1FPHH 4Y10E 1LVMA 4YM9A 3B23B 1THRH 3P8FA 1A5IA 1DDJA 2RG3A 1AWFH 3SUDA 5ESTE 1O3KA 3P92A 4KP0A 4X2XA 1K1JA 4CHAB 4CRBA 3FVFB 5DPAA 4NSVA 2HRVA 1SGQE 1CBWC 4A5TS 3TH4H 3UPEA 3MH7A 3ODDA 1V2TT 1NY22 1JBUH 4I7YH 4CH8B 3QX5H 1SLWB 1OWJA 1WQSA 3BIVH 5ESBA 1NU9A 3ZV8A 2VVVA 4ZHAA 3TJVA 1V2ST 1LQDB 1BJVA 1G9IE 4ISIH 3ZYDA 4KGAA 1YBWA 1FONA 1C2IA 2BX3A 1QL9A 3TGIE 1WAYB 1YPJH 1TGCA 1C1NA 2WPKS 1NT1A 2ZFFH 3PLKA 2BDIA 1CO7E 2ZIQH 1E34B 4CBNA 1FMGA 4Z0KA 4WJG2 2IJOB 3SU6A 1ZRBA 1P04A 1GBIA 4TWYA 1AI8H 3V0XA 4Q7YA 1ZYOA 1H8IH 2NWNA 2IOTA 5C1XA 1P02A 1DWCH 1ZPBA 4RN6A 1TBRH 1K21H 4NSYA 4MPVA 1MBQA 1TE0A 4I8LA 3RUOA 3NZIA 1P9SA 1UJ1A 5LH8A 1OX1A 3LGTA 1ZTLA 4WY3A 1BTXA 2A5KA 1KYNA 5DP4A 2V3HH 3STIA 1O2NA 3S69A 1QGFA 4TYDA 2G52A 1VITG 1TOMH 1AHTH 3T5FH 1EP5A 3LGWA 1D4PB 1F5KU 1HFDA 2OUAA 1SVPA 1TIOA 4MNVA 1MBMA 4JZEH 1GVLA 4B74A 1SL3A 2V35A 1QRZA 1YPGH 5FAHA 3L6PA 4D7GA 2A31A 1GMCG 3KEEA 1A1RA 3BTKE 1GI4A 1ZTKA 2BDAA 2ZHWH 2UWOA 4XE4A 1DLEA 1UTJA 1GBEA 1T7CA 3QZQA 3MNBA 3RM2H 2V6NA 1DT2A 5HYOA 3V7TA 1SLUB 1PYTC 4ISLA 3GCTG 5EXLA 3P8GA 1LKAA 3UY9A 1YLCA 2OC7A 3FP8E 1FZZA 2J4IA 2VGCC 1D3DB 3UWIA 5F8TA 3H5CB 4IN2A 1XVOA 1GI1A 3HGNA 4VGCB 3V12A 3M5NA 2G8TA 2QA9E 1JRSA 2PHBA 1V2UT 1WYKA 1ZJDA 1C5WB 2P8OB 2Z7FE 2P16A 2Y6TA 4U2WA 3T27A 4MNXA 2P8OC 1SG8B 2A4RA 1GI0A 5JYIA 2AEIH 1KLIH 3DA9B 4BTTB 2BZ6H 4BAHB 4TPYA 3MNXA 1Y3YA 3A7VA 3LDXH 3TK5A 2FO9A 2FOEA 2VVCA 1GI6A 3A7ZA 1HJ8A 3RXIA 2P3TB 9ESTA 1SGCA 1QJ6B 3VGCC 8ESTE 1JXPA 1MD8A 4U01A 1BMNH 1PFXC 3SU2A 1IQGA 3PROA 2VJ1A 3AW0A 3BTGE 2JH6D 3SV2H 1QR3E 1UO6A 1SGTA 2YOLA 2OD3B 3A87A 4KTCA 1D6RA 1V2KT 1Y59T 1FN8A 5C2ZA 2WINI 2Z9LA 1SGRE 2PKSC 4AYVB 2V0BA 1O3CA 2FEQH 3PYHA 4JZFH 1HYLA 4GCHF 3PB1E 1V6DA 2GDDA 1WUNH 1H4WA 4X1NU 2UUKB 4KELA 4E7NA 2I6SA 1C5QA 4ZXXH 3ZZ3A 1EPTB 2FTMA 4TWWA 1C5TA 1AD8H 1LPZB 4ZUHA 1O2ZA 4DGJA 1A4WH 1QY6A 1WU1A 1SBWA 2QAAA 2ZTXA 2ZU5A 1ELFA 1KLJH 3U1JB 3F68H 5GDSH 2FOBA 1QHRB 1GHYH 2NU4E 1RTLA 1DWEH 1U6QA 2XNIA 1T4VH 1O3IA 2BLVA 3P17H 3CP7A 1HV7A 1O34A 4SGAE 5CHAB 3GYMA 2EC9H 3ZZ7A 1BBRE 2A2XH 2BD3A 2C8WB 1MTUA 4FU8A 2ZDKA 2AMPA 4I32A 1GL0E 4JMYA 1HAYB 3TH3H 1RS0A 1W10U 4FVBA 4H4FA 1SMFE 1O2SA 1TB6H 1ZSLA 4JYTA 1GHAG 2PKSB 1CHOF 3KGPA 1FY8E 1MQ6A 3STJA 5HXFA 4R0IA 2OC0A 5FCRA 2PTNA 3ZVDA 4JYVH 5JB9S 2OINA 2ZPQA 4ABHA 4JZIA 3AAVA 1SGFA 2CV3A 3NUMA 1OWIA 2QYIA 3HK6B 1HJAC 1GJ7B 1PQAA 4WH6A 2NU2E 1A61H 2CHAB 1V2WT 1SQOA 1HJ9A 1QNJA 3UQVA 3F9EA 2G5NA 4AFZA 3UTUH 1AFQB 1PPEE 2OC1A 1LHEH 6CHAC 3LONA 1BZXE 1EB1H 5TJXA 2ZU1A 1EAUA 4K8YA 5A09A 1SOZA 3MNCA 1K1IA 1FXYA 4MDSA 3EDXB 1ZPCA 3K9XB 1RIWB 1O3LA 1F0SA 1C5OH 1CT4E 4X8VH 1C5SA 2VWOA 3A80A 1TMTH 2Q1JA 2ZO3H 3F1SB 5T6GA 3M37A 4I8HA 1V2MT 4VGCC 1HLTH 1ZLRA 1KXAA 5PTPA 1EJNA 2YNBA 3S9CA 1SGPE 1DE7H 4TPIZ 1FDPA 1GJBB 1A3EH 1HAVB 5EPNA 1TBZH 1AQ7A 3SUEA 5EXNA 2FLBH 2IPHA 3RU4E 2VIPA 1C1SA 1J8AA 1CGHA 3S9AA 1YP9A 1N6XA 1NZQH 1OWKA 1DUEA 1HBTH 1XUIA 1PPGE 1G2LA 4GLYA 1ID5H 1GHBF 3RXAA 2HNTC 3TJNA 1BIOA 1AN1E 3C27B 4OGYA 1C2JA 2GCTC 1S82A 1DLKB 5I46H 1P3CA 1JOUB 1IQJA 3MO6A 5A0BA 2SFAA 1S6FA 2ZDNA 1GWAA 2D8WA 3KN2A 2Z9JA 2HOBA 5AVDA 2ZDAH 1O2MA 4BAQB 5FBIA 2NU1E 2H2ZA 1HAIH 2F9VA 5GCHF 4K5ZA 3QZRA 3TK6A 3TH2H 4A1XA 1GJ9B 3ATIA 2ZPRA 1P2NA 1MQ5A 4CRGA 2GT8A 1AO5A 1QJ1B 2FYRA 4Y11E 2XCFA 1JIMA 3T2NA 2AIPA 4X1RU 1AKSA 2C4FH 3A7WA 1UVOA 2GMTB 3LIWA 4JK6A 4Y8ZA 2A2QH 1H9LB 3FAOA 2GGVB 2NU0E 2ANMH 3IITA 4YLUA 1BTUA 4JYUH 1P0SH 2F83A 2QV1A 1ANBA 2G5VA 1DXWA 2ZDVH 2VIVA 2WUBA 1S6HA 4X8SH 1BQYA 2CXVA 3RXVA 1EP6A 3GY2A 3TGKE 1FUJA 1ZHMA 2ZU3A 4FUBA 3HPTB 1O2JA 4O3UA 4NA9H 4ISNA 1VITF 5E2OA 1RTKA 4FXGH 1AY6H 3R0FA 2PGQB 2WPMS 3SN8A 4I8GA 1KDQA 5DK1A 5E0HA 1NFUA 1W13U 1SGIB 3EAJA 1NESE 3E91A 1TRMA 2JH0D 1OXGA 2BOHB 2A7HA 2AMQA 4BANB 4FU9A 2ZA5A 3QGJA 2QIQA 2JETB 1TYNA 2XRCA 3UREA 1P11E 3SGBE 1Y3VA 2ZFSA 3QUMP 3UR6A 1SFQB 1TFXA 1HIAB 3PLPA 1N8OB 3O8CA 2DE9A 3E16B 3LOXA 4JZDH 3N7OA 3RXEA 2Z94A 1HDTH 4R8TB 1W7XH 2FOFA 1EZUC 4ISOA 4IC6A 1SQAA 1CHOG 1GBFA 2GVFA 1DY9A 3FANA 3LT3A 1W11U 2B0FA 2VB0A 1HAPH 3ZVBA 2ZU2A 4INHA 2G4UA 3GCOA 1GDNA 1IQFA 1O3OA 2O8LA 2Z3DA 1V2OT 1SB1H 3LPRA 4ESTE 1IQLA 1J14A 5AHGH 1XUJA 2QXHA 8LPRA 4M7GA 1TONA 1C1VH 5DO4H 4YT7H 1TPAE 3EGKH 3LH3A 3PV4A 3P6ZB 3D49H 3SU4A 2A7JA 1O35A 1TALA 2G55A 3TNTA 1TGBA 1GJ5H 1FY1A 1QB9A 1TNJA 1CSOE 2EA3A 4GPGA 1EOJA 1LO6A 2QCYA 1UTNA 2P3UB 1YC0A 1OPHB 2WPHS 5JDUB 1P9UA 1ZZZA 3MH6A 1SSXA 1DWBH 4Z6AH 3M36A 2BQWB 2CJIA 1H8DH 3PLBA 3DFLA 3ZZ4A 1QB6A 1GHBG 1GBAA 3NPSA 2R9PA 3CS0A 1OKXA 1DS2E 1P57B 3DHKH 1XKBC 7LPRA 1XX9A 3VXFH 2YNAA 1AWHB 4YTAA 3SO3A 2R3UA 3NWUA 4DY7B 2B5TB 1S81A 4BTUB 1UVSH 4NZQA 4JK5A 3SNCA 3D65E 1O5CB 1IQIA 3VFEA 4UE7H 1GHWH 2PKAA 3KHVA 5F8ZA 2GDEH 2THFB 2BQ7B 1SQTA 1W7GH 1AE8H 4BXWA 3VB3A 1IHSH 5T6DA 2BY7X 1XXFA 3RMMH 1O33A 1YPEH 2LNCA 3ESTA 3BG4B 2GD4B 3PTNA 2FS9A 2K1QA 1F0RA 1RTFB 1QRWA 4IW4E 2F9UA 1GCTC 1V2VT 1DSTA 2PW8H 4K1TA 3D23A 1MAYA 2ZDMA 1ZHPA 5CMXH 1QBOA 2DUCA 1C5PA 1W0YH 5T3HA 4YT6H 2ODYB 1TPOA 2VWNA 1FIWA 1UCYK 3URCA 2CMYA 1Q2WA 1A0LA 1UMAH 1LVBA 1BBRH 2BTCE 5LPEA 3HATH 4B2AA 3M5MA 4CRFA 3TK9A 4I8JA 4DIIH 1TABE 1C2HA 1OP8A 4CRCA 2IN2A 1CGJE 1ARBA 1HB0B 2H5CA 5DP9A 2EEKA 3RXDA 1ELCA 5HM2A 1WQVH 1IQEA 4WMEA 1ZMNA 1O2HA 1EAXA 1IHTH 5C1UA 5HMAA 3RXTA 1QL7A 3MH5A 2P94A 1EKBB 1GHXH 1E37B 3TJUA 5DJ7A 1FY4A 1C1MA 3SUGA 5E0JA 4K69A 1RIWC 1GMCF 1PQ5A 1B0FA 1IOEA 1OWHA 3B9FH 4HI3A 5EU8A 3TPIZ 1C4Y2 1E38B 1W2KH 1NRPH 1BTWA 4MPX