5FAHA

Kallikrein-7 in complex with compound1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
224
structure length
218
Chain Sequence
IIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVNSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Kallikrein-7
publication title Small-molecule factor D inhibitors targeting the alternative complement pathway.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 218
sequence length 224
ec nomenclature ec 3.4.21.117: Stratum corneum chymotryptic enzyme.
pdb deposition date 2015-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fahA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fahA02
1WBGB 1NFUA 1MTVA 1IQEA 1AMHA 1QRXA 1ANDA 1FV9A 3RXOA 5C1UA 1PPEE 3U1JB 1CA0C 1GCTB 3OU0A 2GVFA 3BG4C 2C93B 4JYTA 2V35A 1OX1A 3I29A 1BDAA 2Z7FE 5HM9A 1JRSA 3C27B 3B23B 1UVUH 3H7TA 2PTNA 1GHBF 2Y5HA 3RXUA 2B5TB 3SOSA 1H9HE 3A82A 3A88A 2A5IA 1O2VA 2FEQH 4GUXA 1DICA 5T6DA 3E16B 1SLUB 2FOEA 1C1TA 3LC5A 4OS2A 2A1DB 4K5ZA 2QF0A 3TGIE 3DA9B 2CN0H 3PO1C 1J14A 2OCVB 3PM3A 3VB7A 3ODFA 1XUJA 4B76A 1IQFA 1O3GA 1CVWH 1VITF 1W12U 2XBWA 1KXBA 2HPPH 1FY5A 2IN2A 3OSYA 1O2TA 5FX6A 1VGCC 3EGKH 3KQEA 1F5LA 2BLVA 3ATIA 1DUEA 1EAIA 1B5GH 4FXGH 5LGOA 1SPJA 1GVLA 2P8OB 2BDAA 3T28A 1C1QA 1K1IA 4RKJB 3A89A 3T26A 1CA0B 1L1GA 3BG4B 1V2PT 1UTNA 5EQRA 1IQIA 1MAYA 1V2KT 1O2LA 1V2QT 1XMNB 4Y0YE 3KHVA 1EOJA 6ESTA 2FOCA 4YM9A 1TGTA 1K22H 4PROA 3SV6A 2RA3A 2GT8A 4DIIH 4MQAA 1JMOH 3HPTB 1GBAA 1K1LA 1P2JA 1C2DA 4YOIA 1P2NA 1V2VT 1C1UH 1GHAF 2YNBA 3MU1A 4XE4A 3L33A 2UUKB 3MH6A 5SGAE 4GSOA 3W95A 1TA6A 1AZZA 1UVOA 1WV7H 5C20A 1C2GA 1GVZA 1ARCA 1YLDA 1EXFA 1ZPCA 3MMGA 1D3TB 3MNXA 5JDUB 1HV7A 4O9VA 1C9PA 1K28D 1TNKA 2ODQA 3KCGH 1H4WA 2BD9A 3MNBA 1EJNA 3VXFH 4AOQA 1C9TA 1BTPA 1C5XB 2KAIA 3MO6A 4WF8A 2FS8A 4TY6A 2VH6A 5F8TA 2CMYA 1RTFB 1NRRH 1FIWA 2W3IA 3BTGE 3KEEA 2P59A 5AFZH 1BA8B 4AZ2B 4NA7A 1HAIH 4FUDA 1ETRH 4X6MA 5E2PA 3KQCA 4Y7BA 4DW2U 3KF2A 1F0UA 1XKAC 1Y59T 3R3GB 1Q2WA 2AGGX 1DANH 1DWEH 4GHQA 4HTCH 3RXAA 4D8NA 6GCHF 3TJUA 3GISB 4MNXA 1A0LA 2BXUH 3S9AA 4YOGA 4X8VH 1A5IA 2OQ5A 2TPIZ 3SUGA 3MWIU 1GBHA 3FP6E 3I78A 3LGIA 1CGIE 3SNAA 3TVJB 1NN6A 1SC8U 4ASHA 1RJXB 2ANYA 2P93A 3S7HB 1GPZA 4ZKRU 5EQSA 2OLGA 1BBRK 3GY3A 2QV1A 1GMDG 1C1PA 1KXEA 1A5HA 1P8VC 1ABIH 3EQ0H 1J9CH 5T3HA 1BRUP 3VB4A 5I25A 1Y8TA 1O2QA 3BTTE 3O8CA 2FOBA 1AWFH 2PKSC 1SFQB 4CRCA 4NZLA 3HGPA 1PPFE 2F9PA 3NUMA 1ELGA 3P8FA 1F0SA 1KDQB 1YPGH 5J4SA 4O3TA 2DE8A 1PFXC 2CJIA 1W11U 1NO9H 1ZTLA 2GT7A 1NS3A 2ZECA 1EAUA 2BZAA 1BBRE 2GV6A 3P8OA 1GJ4H 1O3JA 4WMFA 1QRZA 3U8RH 2VJ1A 4BAQB 1TNHA 1SI5H 2ANWA 3RXIA 4CHAC 1HAHH 4AB8A 3P17H 2WPHS 2FXRA 1QJ6B 1RIWC 1YPHC 1O3KA 3SV7A 4U2WA 4IC5A 3ATWA 4O03A 4K1SA 5DPAA 1V2ST 4E05H 2BVRH 2ZGXH 3A7XA 1PQ7A 1M9UA 3OTJE 1MQ6A 3KNXA 4ISNA 1O3FA 3URCA 1TABE 1V2LT 1LTOA 1IOEA 4IN2A 1HXFH 3GCHB 4Y71A 1HPGA 1VITH 3LKWA 1PJPA 3M5LA 5JBTA 4CH2B 4XBBA 1O2OA 4AFUA 2QY0B 1VJ9U 4Y11E 1C1SA 4Y76A 3BV9B 1SBWA 4XBDA 1CHOF 1S84A 1P2IA 1KLTA 2PUXB 1UTJA 3ZZ8A 1C1NA 1L2EA 1RXPA 1QBOA 1SOTA 1ESBA 1O2YA 3UR6A 1OWJA 3U98H 3SU4A 1FY8E 2Z3EA 3E0PB 2BB4A 2W26A 1MTWA 1TYNA 1DFPA 4UONA 2RA0A 2G00A 3HKJB 5C2ZA 2FP7B 3SHCH 2GKVE 2BD8A 3A81A 1CE5A 1O2NA 1ORFA 1P3CA 1DWBH 1G3CA 4CHAB 1C2HA 1O3OA 2OC8A 1TQ7B 1BTWA 2EI8A 5DP4A 2ZU4A 3I77A 1QB1A 1ETSH 3Q3YA 3IG6B 3SI3H 4MTBA 2TRMA 3SU5A 4HGCA 1GHAG 4NG9H 4WH6A 2BD2A 1GI0A 1OYQA 1O5DH 1QRWA 3AAVA 2WINI 4GVUA 3UQVA 2WPLS 2ZU3A 5L30H 1AO5A 3QTVH 3QDZB 4YESB 4AYYB 1BTUA 2UWOA 1C2EA 1DWDH 3UQOA 2D2DA 3LGYA 5C5OA 2G52A 3CENA 3T25A 2WV4A 1L4DA 4CBNA 3RXLA 3VB6A 1BBRH 5GIBA 4AFSA 1AY6H 4NGAH 1LVYA 5F8XA 5HM2A 3ATMA 1DM4B 4UFFH 4I8KA 2AGIX 3SNCA 4TWYA 4FUHA 3A7TA 1RS0A 1C1RA 1A3BH 2F3CE 2H9HA 1LHGH 3GCTG 5L2ZH 3UFAA 1JRTA 1LDTT 3QUMP 1G3BA 2W7UA 1O36A 3KQDA 1BTYA 1WYKA 1YCPK 1KXAA 2FOGA 2Z3DA 1DOJA 1LO6A 3M3TA 1CT0E 3MU4A 3B9FH 3SU3A 4MPXA 1P01A 2BY5X 1P2OA 5K0HA 2ESTE 2SGDE 1AZ8A 4U32A 4KTSA 2HVXA 3ENSB 1GBEA 6GCHG 1FY4A 1ZHMA 2ANMH 1HAYB 1CBWB 2JETB 1TMBH 1H8DH 4I33A 1S5SA 1SQTA 4A5TS 2BTCE 3TK6A 2BMGB 1TX6A 4ZXYH 1HBTH 1J8AA 2F9UA 2ULLA 2BOKA 4WXIA 3RUOA 3SV9A 2FWWA 1XUKA 5DP9A 2OTVA 1QR3E 5EGMA 2VVUA 2QF3A 3BG8A 4FUCA 3UUZA 2WPMS 1QNJA 3CP7A 2VWMA 3E0NB 1A3EH 1QJ1B 4YLUA 3Q3XA 1CGJE 4GCHF 3DFLA 1PPHE 1P12E 1SQOA 4ABDA 4FU9A 1GGDC 2VNTA 3WY8A 3FZDA 3LJJA 3NXPA 1Z6JH 3Q3KA 2HLCA 1ZJKA 3SO3A 1SFIA 2OC1A 4NIXA 1UCYK 3TK5A 3QZQA 1O33A 8LPRA 1QGFA 4ZXXH 1H1BA 2G5NA 4NIVA 5ESTE 3SJ9A 1F92A 2ZQ1A 1YP9A 2D1JA 4Z0KA 5AF9H 4H6TA 1HXEH 3ODDA 4MNWA 3V0XA 1QTFA 3KN2A 2VWNA 3S69A 3EAJA 1BCUH 2EC9H 5CE1A 1NU7B 2ZZUH 1AFQB 2NU4E 5JB8S 1EPTA 4YT7H 2GZ7A 4NA9H 3LPRA 4X2VA 1TPOA 3TJVA 1KTSB 1UTLM 4F49A 2Y81A 2STAE 4O97A 1QA7A 2ZTXA 1HAGE 1HYLA 3SU0A 5A0CA 2C8WB 2A7JA 3BEUA 3E1XB 4WWYA 1ZMLA 4CBOA 1V2NT 3A7VA 4D76A 4X2XA 4ABBA 1C5TA 3RXBA 2ZPRA 1C2IA 3MU8A 4JZIA 1LVMA 1SB1H 1CHOG 1O5BB 4HZHA 2VIVA 3LU9B 3SZNA 3GDVA 4YLQH 5PTPA 3GCNA 1YF4A 1N8OC 8GCHF 4ZMAH 1T31A 1DLKB 4MPWA 2VH0A 1YCPH 3LH3A 4JYVH 2DE9A 3MH7A 4DVAU 3VFEA 4XBCA 3RXJA 1DX5M 2B7DH 3GY6A 1O2UA 1PYTD 3MNSA 1CQQA 2BQ6B 5A0AE 1G36A 4IGDA 1V6DA 3NKKA 4FUBA 4R8TB 2SGQE 2EA3A 1C5PA 4NSYA 1SGCA 5L6NH 3FZZA 1BTHH 1L0ZA 3LJOA 1GL0E 2UUJB 3RXGA 4JZEH 4NCYA 4UE7H 4JK5A 1O37A 1EZQA 1TBZH 2H9EH 1S6FA 1FJSA 1VCPA 4GPGA 1AUJA 5A8YA 1SSXA 3SI4H 2VGCC 1V2TT 5B6OA 4CRFA 1KXDA 1UTQA 2F9BH 2ZCLP 4OS7A 3E8LA 1TRNA 2Y6TA 2ZPQA 1T8NA 2ZDKA 1ZPZA 9ESTA 1BRAA 1UCYH 2FTLE 3ZZ5A 1RTKA 2SNWA 1MBQA 1YPLH 5FCKA 1N8OB 1ELFA 1GCTC 1A4WH 3O8BA 4MVNA 1EP6A 1JIMA 1BQYA 4JZ1A 1UVSH 2NU2E 1SGEE 2QN5T 1XUGA 1AN1E 1QHRB 1DUAA 2ODYB 3QGJA 3RDZA 4GHTA 4X1NU 2I6QA 2FM2A 1MD7A 1UHBB 1G9IE 1DDJA 2P3FH 5F03A 1ZGVA 3HGNA 3E6PH 2PHBA 5FPTA 1MQ5A 2PWXA 3P70B 1X7AC 1O2JA 3BTHE 3RLWH 3UWJH 3RLYH 1O34A 4ISOA 1F0RA 3CS7A 1QURH 4DY7B 2VGCB 3LGWA 1ZOMA 2A4OA 4FUGA 4ZUHA 1HNEE 2AMDA 4ZHLU 1C2KA 3QN7A 1V2UT 1NFYA 3PMAB 1AE5A 1HLTH 3TH3H 1GHZA 1XUIA 2Z9GA 3BTME 8KME2 3A80A 5G4BA 1NROH 1GJCB 5EODA 4MPVA 1O2RA 4BAHB 1EOLA 1W10U 4ZHAA 2B9LA 1UTMA 1ESTA 1V2RT 1O5FH 4A1TA 1MTUA 4HFPB 1ANBA 3F9GA 4YO9A 3ZYDA 2G55A 1VR1H 2XC0A 2BD4A 1Y5AT 2BVXH 1HIAB 3GDUA 1AI8H 1THPB 2VWLA 2V3HH 5ESBA 2QIQA 5I46H 2ZG0H 2BLOA 1G37A 3UREA 1O3AA 1DXPA 1WCZA 1GBJA 4ZAEA 1H8IH 1LPZB 2H1UA 1K9OE 3MNCA 1K1OA 2BM2A 2WPIS 1S6HA 1GI1A 1AKSB 1DPOA 2UWLA 2BY9X 2VVCA 4D7FA 2R9PA 4YZUA 3RMOH 2OUAA 1OOKB 1MH0A 2RCEA 4DURA 1YBWA 1BMNH 1FQ3A 1G30B 3RM2H 4MDSA 1NTPA 1ZHPA 1V3XA 2FDAA 2A4GA 5A0BA 1KXCA 1G3EA 2ZFTA 4BTIB 5FXLA 3TLOA 3MYWA 1GMHG 1GVKB 1SOZA 2C8ZB 2BX4A 1TAWA 2OC0A 3SUFA 1DSTA 1TB6H 2J4IA 4D9QA 3SU1A 2J94A 1O2ZA 1GJ8B 1QIXB 3SJIA 1GJ7B 1A5GH 3RXHA 2ZP0H 1QJ7B 1AWHB 3TH2H 4X6PA 4Y79A 3IWMA 3ATKA 3DD2H 1BUIA 1ZRKA 1NRNH 2P95A 4NA8A 1WUNH 3PROA 3BSQA 3EA9A 1A0HB 4WVPE 4Y8XA 5LPEA 2FZZA 1C5UA 1MZDA 1P2QA 4OS5A 4FVBA 2PFEA 4LK4A 3T27A 3SGAE 4D9RA 5LPFA 1TMTH 1G3DA 2Q1JA 1E38B 1EP5A 4ABAA 4JZDH 1QB9A 1GBTA 5JPMH 1C5WB 1HCGA 1JOUB 1IQKA 1GG6C 1GJDB 2OBQA 3U1IB 3GDSA 2BQ7B 2Q6FA 4KELA 1C2JA 2EEKA 5GPIB 3M7UA 2ZU2A 2PW8H 1GDNA 4I7YH 2GMTC 1QQ4A 5GDSH 5JBBS 2BLWA 2FODA 3LONA 1MTNC 4M7GA 3GY7A 1D4PB 5JYIA 2LPRA 3A8AA 1GWAA 4X1SU 2ANKH 1AVXA 1IQLA 4JYUH 4JK6A 1OP0A 1DY8A 3GYMA 3S9CA 2C4FH 2BVSH 3O8DA 1BRBE 1PQ5A 3ZV9A 4X0WU 2CHAC 4E7RG 2ZFQH 3BTQE 1GBDA 3VEQB 2UUFB 2UUYA 2HRVA 2PKAA 1E0FD 1O2XA 1SL3A 3RXKA 4WMDA 2O8WA 1BMAA 1GG6B 2FI3E 4Q7YA 2CF8H 1G32B 5C1XA 2XCNA 1C5QA 4K3JA 3GCHC 1A46H 2O8MA 1ELAA 1HAXB 1O3HA 4SGBE 1Y3XA 2IPHA 4AFQA 5FBEA 1GBLA 2ZI2H 1GJ9B 1OXGA 1S0RA 1LVBA 4E7NA 1WSSH 3BF6H 1KTTB 2GMTB 4NFEA 1HFDA 1IQHA 5DO4H 1D3PB 3SN8A 1O3BA 1SGNE 2R3UA 2XBXA 1MTNB 1BIOA 3QK1A 3MFJA 4Q7XA 3STIA 1SGFG 1GHBG 1QY6A 2K1QA 3PMHB 1O3NA 1ZTKA 2FLRH 2EI6A 4CRBA 3KGPA 5A09A 2Y82A 1OP2A 4GAWA 1EB1H 3BTKE 3DFJA 2R2WU 3V7TA 4B2AA 4ABGA 1ZTJA 1BTXA 1NM6A 1ELCA 1NFWA 1W0YH 2UWPA 2ZHFH 4CREA 1EAXA 1GBCA 1Y3WA 4MNVA 1AD8H 3QGNB 1TLDA 3A8BA 1XXFA 2Z94A 3UIRA 1ZSLA 1RRKA 1A7SA 1HGTH 4Y8ZA 1Q31A 1ELTA 2OP9A 2CHAB 1VITG 3BIVH 2GDEH 1ELEE 1TIOA 2Y7XA 2A7CA 1VZQH 3BTDE 2OBOA 2KAIB 4K2YA 3RXRA 3A7ZA 4ZROA 3SJKA 5HXFA 2NU0E 1QB6A 3BEIB 2BDHA 2ZO3H 1P2KA 1C4V2 1FXYA 3UNQA 1T4UH 3RXQA 5DGJA 1GI5A 1C5NH 1HAPH 3P92A 2ZGJA 2PGBB 1FPHH 2V3OH 2AMPA 3SUEA 3K6ZA 2ZHDA 2SGAA 1LHEH 6CHAC 3F9EA 4TYDA 3RMNH 1D6WA 1CT4E 1LPGB 3M3VA 1SGRE 2XBVA 2HALA 3F6UH 4ZH8A 1MCTA 1HJ9A 4IBLH 2FI4E 3VB5A 2BZ6H 2ILNA 1LPKB 2A4RA 2ZF0H 2Y5FA 1GMCF 3NPSA 2BYAX 2W5EA 4X2YA 2FMJA 1MD8A 2HNTE 1CBWC 2JETC 2XNIA 1XUFA 3GY8A 1S82A 1C5LH 3ZZ7A 1ZHRA 2F83A 4B73A 1C4U2 4OS1A 4OS4A 1L4ZA 2VVVA 1FPCH 4K69A 4IW4E 1GI2A 3T62A 2H9TH 4UEHH 1G2LA 2GTBA 5JBAS 3SV2H 4B1TA 5HMAA 3V13A 2ZCKP 2XYAA 3BTEE 1HAOH 1TOCB 3SBKA 5ETXA 3RXVA 1XM1A 2ZC9H 2OC7A 4NFFA 1C1WH 1XVOA 3D49H 1GJBB 2QXGA 1YKTA 5CMXH 1AB9B 1EASA 1ELDE 2VINA 6CHAB 5E0HA 3M5NA 1F7ZA 3TITA 4I8JA 2W7SA 3RMMH 1ELBA 4I8HA 1TNIA 2NU3E 4TY7A 3RU4T 1W7XH 5EPNA 3A7YA 1HAVA 1F5RA 4DIHH 5A8XA 2NWNA 3BN9A 2ZKSA 2RDLA 1AFQC 1DE7H 1THSH 4INLA 4YT6H 1FAKH 5E8EH 1QL7A 1S81A 2BQWB 2H5DA 4MLFB 3V3MA 1GBMA 3ZZ6A 3ZVBA 2ZU1A 4BAMB 2M5TA 2A5KA 3KL6A 3SU2A 7GCHF 4ABEA 5EQQA 4LOYH 4AG2A 3RM0H 3NZIA 1O2KA 2WYGA 1PYTC 2VIOA 1AIXH 8ESTE 2Z3CA 1UMAH 3ZV8A 1GJAB 5EW2H 3N7OA 1TALA 5IYTA 2PSYA 3TK9A 1C1OA 3HK6B 1B0FA 1EX3A 1JIRA 2PGQB 5TJXA 4CH8B 4K60A 2GD4B 3OYPA 2C3SA 1O2WA 1TX8A 1Z6EA 4ABIA 1DWCH 1MKWK 1FDPA 1UK2A 4DG4A 4INHA 2B0FA 4AYVB 4DJZB 2Q6DA 1ZJDA 1O32A 5FPYA 1FLEE 1QL9A 3Q00A 1V2JT 1U6QA 3MU5A 5AFYH 2VWOA 5J4QA 3TNTA 5JBCS 4XDEA 2BXTH 5EXMA 1O38A 3VGCC 4FU7A 1T8LA 3A84A 1QA0A 1ELVA 2QXIA 4ABFA 4FU8A 3LGVA 3LGUA 1ACBE 1UK3A 1YPKH 3E90B 3ZYEA 5DJ7A 3T5FH 4BXSA 1MAXA 1A61H 2AFQB 5AHGH 1YPMH 2G8TA 5ABWA 4B71A 1HJAC 2A45B 2YNAA 4RSPA 2O9QA 4DCDA 1TPPA 4B75A 2Z9IA 4ISHH 3QTOH 2BDBA 2VU8E 3IITA 2FX4A 1GHVH 1W14U 4Z6AH 2SFAA 5C1YA 2ZDVH 3AW0A 1TX7A 4AGKA 1UVPA 4AN7A 1TBRH 5GWZA 5FBIA 3MI4A 2OQUA 5DP5A 1ID5H 2WYJA 5A2MH 2TGDA 4Q7ZA 1O35A 7KMEH 1AVGH 1NT1A 1ZR0A 1GHXH 4BAOB 1N6YA 4A1XA 1BT7A 1P57B 3TU7H 3B8JA 2ZHWH 1EZXC 2XTTB 2Z6BD 2A31A 2P3UB 5DP8A 5HGGA 3RXDA 3UTUH 1MU8B 2FLBH 3M37A 4NWLA 3VGCB 2BY6X 3F9HA 3JZ2B 2ZTYA 1IQGA 1WU1A 1Z7KA 1BB0B 1NC6A 1MKXK 2ZWLH 3ATLA 4A7IB 4ESTE 4FUFA 3SQEE 2AEIH 3SJOA 1FN6A 2FOMB 2R2MB 3EA7A 3FAOA 4JMYA 5EW1H 1HAZB 1SGFA 1LQEA 2BD3A 2P94A 1CHGA 1HJAB 2G5VA 4HI3A 1Y3UA 1TA2A 4MNYA 2BLQA 2ODPA 4I8GA 2WUCA 3M61U 2GZ8A 2A4QA 2QYIA 1E35B 2ASUB 3RC5A 2J9NA 3GY5A 2XXLA 1FNIA 2ZFPH 4IC6A 3RXFA 1O39A 1EPTB 1ARBA 2I6SA 2XWAA 1TBQH 4GLYA 1QL8A 4K1EA 4LXBH 3SNDA 3SHAH 4AX9H 1YC0A 4VGCC 3QLPH 1AKSA 4D7GA 2AH4X 3QX5H 2A5AA 1FIZA 2ZDLA 1C5ZB 1BMMH 4J2YB 4QT8C 5IDKA 2ALPA 1BRCE 3RXEA 1TONA 3H5CB 3PMBB 5AVDA 4UD9H 1YCPM 3SNEA 3UNSA 1KLIH 1SHHB 2FX6A 1YM0A 4KTUA 4X2WA 4ZKOU 4GCHG 4OGXA 5H4IB 2TGAA 3MH4A 5TCAA 2GV7A 3ZVDA 3S0NA 1GI7B 1OYTH 1FAXA 2ZFRH 1AU8A 3K9XB 2Z9JA 1SGIB 2LNCA 2P3TB 3H7OA 4NWKA 1AUTC 4TWWA 3G01A 1HDTH 1GMDF 3A86A 3A7WA 1PQAA 1SGQE 2OD3B 1GL1A 4VGCB 1FONA 1F0TA 4FUEA 2R0LA 1SGYE 5GCHF 1O5CB 1KIGH 2C90B 1C5SA 1L1JA 1ZRBA 1C4Y2 2J95A 3ZVEA 1IQNA 1NPMA 1V2WT 4X1PU 1GBBA 1P9SA 3FP7E 1DS2E 3QWCH 1AFEH 2BDIA 1N6XA 3M7TA 3VPKA 4OGYA 1IAUA 2SGFE 3T2NA 2JH5D 2Z9LA 1DVAH 4MG3A 1MKXH 1GCDA 3KQBA 2H6MA 1P2MA 1O2IA 1C2MA 1P03A 1TGCA 1O2MA 1C2FA 1VJAU 4O3UA 1QBVH 2AS9A 4I32A 3ESTA 1EQ9A 1QCPA 1TGBA 1MTSA 3LOXA 3K2UA 3EDXB 1S0QA 3QO6A 3ZZ3A 2BOHB 3LIWA 4ABHA 1SMFE 3A85A 4B2BA 1P10A 2P16A 5BPEA 1D3DB 1TGNA 4U01A 4J1YA 1FUJA 2PTCE 2F91A 1LVOA 1XKBC 2TBSA 1LCYA 8GCHG 1INCA 1BJVA 2HPQH 4IMZA 4KTCA 1P05A 1ABJH 3ZVFA 1TPAE 1SLWB 3RXMA 5LH8A 2O8LA 5GXPA 2GP9B 1Q3XA 1KY9A 3DT0H 7LPRA 1Y5UT 4AORA 1IHTH 2ZFSA 5DKMA 3W94A 1O2GH 3VXEH 3SJ8A 6LPRA 3TJNA 3UNRA 2F9NA 1OS8A 2VIQA 2OXSA 1LQDB 1GJ6A 1J16A 3F9FA 3AASA 1O3EA 1LKBA 1ANEA 2GCTC 2ZDNA 1O30A 2ZHEH 1KLJH 3P95A 3URDA 1KDQA 1F2SE 3PLKA 2B8OH 3PWCA 2J38A 1IQMA 2BHGA 2HNTC 2JKHA 1WQSA 2FOAA 2Y80A 5C3NA 1EUFA 1YPEH 3UY9A 2STBE 1QBNA 1UO6A 5JB9S 5T6FA 3AAUA 2ZCHP 1OWIA 3SW2B 3FP8E 4ISLA 3PMJA 1E37B 1WOFA 3PO1B 3EA8A 1KXFA 5L2YH 1GI3A 4Y7AA 2ZTZA 1VGCB 4ZHMU 2VIDA 4XSKU 4CR9A 1K1NA 1K1MA 1QFKH 1DXWA 3GY2A 1W13U 2PSXA 3U9AH 1A2CH 1O0DH 4RN6A 2FO9A 1T32A 4X6NA 1GBKA 1NRQH 3GY4A 2QCYA 4JCNA 1SQAA 3SQHE 3E91A 1AE8H 1T8MA 1EKBB 2FIRH 2ZHQH 4WH8A 1OWKA 1WTHD 1UVTH 1P04A 2G51A 4KGAA 2A2XH 1EATA 3GCTF 2VIPA 1H9IE 3E3TA 2QXJA 3R0FA 5DP6A 2CGAA 1E34B 3AW1A 5C67A 2GCTB 1ZGIA 3NWUA 4TPIZ 3M35A 2SNVA 1C1VH 3D62A 5BRRE 1MUEB 4Y0ZE 1LKAA 4FUJA 4Y8YA 1OWDA 3L3TA 1FI8A 4BAKB 4ISIH 2V0BA 1NY22 1O3LA 2XCFA 4CRAA 2HNTF 4CR5A 2D8WA 2Y5GA 2QGRA 5FAHA 3O8RA 2SGPE 2ZNKH 2ZDMA 1K21H 4IS5A 5TCCA 1Z8JB 1ZLRA 3PV4A 1Z8IB 1RFNA 1W0ZU 2FYRA 4LZ1H 2FOFA 1SGDE 4K1TA 3F1SB 1P02A 3RXPA 3ZZBA 1SVPA 3NK8A 2PR3A 1GDQA 4KP0A 4JZFH 4AFZA 5EOKA 3RC4A 2D26C 3RU4D 3QZRA 1SLXB 1O5EH 3TIUA 5GCHG 1SGPE 1MZAA 4Y10E 4YOJA 4X1QU 2TIOA 1Z8RA 1THRH 5CHAC 1ESAA 1T4VH 3K65B 3ITIA 4F4OC 1H9LB 1CO7E 1YPJH 3P8NA 3TJOA 4OS6A 5DG6A 4AGJA 4I31A 1DT2A 1O5GH 4Q2KA 5HYOA 3ZZ4A 1UTOA 1C5OH 3UR9A 2GCHF 2V6NA 3EYDA 3A87A 3NCLA 2FESH 3M5OA 2HOBA 1AGJA 4XOJA 2SGEE 1O31A 1UTPA 1EZUC 3LGTA 4X8SH 1P11E 5EG4A 1IQJA 3A8DA 3U8TH 1GI8B 1AB9C 5A8ZA 5DP3A 2XW9A 1Z1IA 1SLVB 2AERH 2BDCA 2ZDAH 1P0SH 4ZKSU 1JBUH 1C1MA 1P3EA 1W2KH 2QAAA 2FOHA 1D9IA 1C5YB 2J92A 1LMWB 1ZMNA 3FANA 2AIQA 2PKSB 3D65E 1UTKA 1EZSC 3CS0A 1TQ0B 2W3KA 3SORA 1GI4A 5LPRA 5C5NA 1DSUA 3TH4H 3RU4E 4BTUB 5CHAB 1EAWA 3ZZCA 1O3CA 3SNBA 2QC2A 1O2PA 2PKAB 3D23A 3U69H 1D6RA 1JXPA 1BZXE 4INKA 1KSNA 1TOMH 2J2UA 3OX7U 1TE0A 4K8BA 4B2CA 2ZPSA 3PWBA 4SGAE 1ZYOA 2NU1E 1Z8GA 2O8UA 4R0IA 1C2LA 1PPGE 1RGQA 3UOPA 2A0QB 3BTFE 4BOHA 1CT2E 5T6GA 3TNSA 2FPZA 1RIWB 1P9UA 2AMQA 2BY7X 2H2ZA 3MTYA 1TNGA 1FY3A 4BNRA 1MCVA 1OSSA 1NU9A 1SG8B 3PB1E 1LHDH 1W3CA 4KKDA 2BDGA 4BXWA 2IJOB 3STJA 2EI7A 3A83A 3DUXH 5F8ZA 2VIWA 3ZZDA 2CF9H 3MH5A 3PLBA 1YGCH 4NIWA 1UJ1A 4X8TH 3M36A 4ZKNU 1O5AB 3SU6A 1DY9A 1GHWH 2BDYA 2CV3A 1TPSA 2JH6D 1XVMA 1XX9A 4Q80A 1GHYH 2PUQH 3MHWU 5EU8A 5K7RA 3ZVGA 1PQ8A 1S85A 3LDXH 4DOQA 4K8YA 1BTZA 1NFXA 4I8LA 1O3PB 1OKXA 1YYY1 2TGPZ 5E2OA 4WXVA 1BOQA 1Z71A 5FHTA 3RXTA 4H42U 3FFGA 1PPZA 3SGBE 4UDWH 2DUCA 1GJ5H 3P6ZB 2HGTH 4AB9A 1Y3VA 2GZ9A 4BTTB 1G2MA 1CA8B 2OINA 1MBMA 3L6PA 4DGJA 2AGEX 1JWTA 2ZFFH 1MU6B 3KIDU 3Q77A 5EXNA 2AIPA 3BEFB 3GICB 1W8BH 1CSOE 2BD7A 5FPSA 1VCQA 3V12A 4Y6DA 1B7XB 4CRGA 3PTBA 4E06H 1AQ7A 1CU1A 1TFXA 3RC6A 3MU0A 1A1RA 1J17T 1EB2A 1RTLA 3GYLB 2XC5A 3TPIZ 1NZQH 1ZMJA 4CRDA 1GI6A 3F68H 2Z9KA 4UFGH 1DLEA 3S9BA 3ZZAA 2FI5E 3A8CA 1OPHB 4NIYA 3MO3A 2A32A 1TRYA 1OP8A 1WQVH 1A0JA 5F6MA 1T8OA 2IOTA 2THFB 1NESE 2PLXA 2C8XB 1BJUA 1T7CA 5DP7A 1LHFH 1ZPBA 4LZ4B 1ETTH 1TRMA 1VCWA 2ZQ2A 1AHTH 5E0JA 1YPHE 3HK3B 4FVDA 3M3SA 2ALVA 2FTMA 1K2I1 1O2HA 2GCHG 1GBIA 1F5KU 1UCYE 2VB0A 2G4TA 1XUHA 1C5VA 2BX3A 4U30A 2FYQA 3C1KA 4A6LA 4UFEH 1KYNA 1TWXB 3TGJE 3SV8A 3RMLH 3LH1A 4IMQA 4IN1A 1TMUH 1CGHA 1P06A 1UHBA 2XBYA 1EJAA 1HAVB 2ZA5A 5E0GA 2QA9E 3LC3A 1E36B 3UPEA 1PPBH 1GGDB 1OWEA 1SR5C 2Y7ZA 2WV5A 1EPTC 1O3DA 3TGKE 4X1RU 1FZZA 1NRSH 2YOLA 1DITH 9LPRA 3VB3A 3U8OH 1GI9B 1GMCG 2GX4A 4THNH 5EXLA 1LHCH 1TNJA 1XXDA 1K1PA 4BANB 1FMGA 1NRPH 2GDDA 4ABJA 3GCOA 1RD3B 2ZU5A 2H5CA 1YLCA 1AVWA 3FVFB 4RKOB 1GMHF 1TNLA 3PYHA 5DK1A 3ZVAA 2O8TA 1P09A 2RG3A 4B74A 3RXCA 1S83A 2ZEBA 1MMJN 1SGTA 2Q6GA 3HKIB 3LT3A 4NSVA 5FX5A 3K6YA 3BIUH 3ZVCA 4YTAA 1O2SA 4X6OA 4H6SB 2ZIQH 2ZGHA 3PTNA 4WJG2 1BMLA 4A92A 2PV9B 1C5RA 1HIAA 3UWIA 1J15A 2WPKS 1HRTH 1V2MT 1ANCA 2R3YA 2A2QH 3MO9A 3SUDA 3GOVB 1ZZZA 1GBFA 3ELAH 2FS9A 1K1JA 5FCRA 2J34A 1FY1A 3ZZ9A 2BD5A 4A1VA 2BY8X 1HJ8A 7ESTE 2GGVB 1V2OT 3P8GA 3UOUA 1MKWH 2ZGBH 1WAYB 3Q76A 4MPUA 3PLPA 1HB0B 2TGTA 3BTWE 1EJMA 2AYWA 1W7GH 4AG1A 2F9VA 2CXVA 3HATH 1ZSKA 5GJ4B 4WY3A 2JH0D 3M7QA 2G4UA 1B0EA 1BHXB 2WUBA 3RP2A 7GCHG 1O3MA 2XRCA 4FUIA 2A7HA 1FN8A 1PPCE 4DT7B 1HUTH 2XC4A 1BHXF 2G81E 1C5MD 4WMEA 1UK4A 1O3IA 2R0KA 3OY5U 3DHKH 3T29A 2XWBI 1TGSZ 3MOCA 2C8YB 3M5MA 1IHSH 1Y5BT 4X8UH 4UFDH 1WTGH 1D3QB 2ZGCA 3JZ1B 1Z1JA 1QQUA 1OWHA 1ZSJA 4NZQA 2HWLB 1BITA 3AVZA 1GDUA 1N1LA 1SHYA 1Y3YA 4TPYA 2QXHA 2WPJS 4XFQA 3RXSA 5EPYA 3SGQE 3OY6U 2F9OA 3EE0B 3S7KB 4H4FA 2P8OC 1L1NA
chains in the Genus database with same CATH superfamily
1WBGB 1NFUA 1MTVA 1IQEA 1AMHA 1QRXA 1ANDA 1FV9A 3RXOA 5C1UA 1PPEE 3U1JB 1CA0C 1FX0B 1GCTB 3OU0A 2GVFA 3BG4C 2C93B 4JYTA 2V35A 1OX1A 3I29A 1BDAA 2Z7FE 5HM9A 1JRSA 3C27B 3B23B 1UVUH 1BMFD 3H7TA 2PTNA 1GHBF 2Y5HA 3RXUA 2B5TB 3SOSA 1H9HE 3A82A 3A88A 2A5IA 1O2VA 2FEQH 4ZCNA 4GUXA 1DICA 5T6DA 3E16B 1SLUB 2FOEA 1C1TA 3LC5A 4OS2A 2A1DB 4K5ZA 2QF0A 3TGIE 3DA9B 2CN0H 3PO1C 1J14A 2OCVB 3PM3A 3VB7A 3ODFA 1XUJA 4B76A 1IQFA 1O3GA 1CVWH 1VITF 1W12U 2XBWA 1KXBA 3OFND 2HPPH 1FY5A 2IN2A 3OSYA 1O2TA 5FX6A 1VGCC 3EGKH 3KQEA 1F5LA 2BLVA 3ATIA 1DUEA 1EAIA 1B5GH 4FXGH 5LGOA 1SPJA 1GVLA 2P8OB 2BDAA 3T28A 1C1QA 1K1IA 4RKJB 3A89A 3T26A 1CA0B 1L1GA 3BG4B 1V2PT 1UTNA 5EQRA 1IQIA 1MAYA 1V2KT 1O2LA 1V2QT 1XMNB 4Y0YE 3KHVA 3KYFA 1EOJA 6ESTA 2FOCA 4YM9A 1TGTA 3AK5A 1K22H 4PROA 3SV6A 2RA3A 2GT8A 4DIIH 4MQAA 1JMOH 3HPTB 1GBAA 1K1LA 1P2JA 1C2DA 4YOIA 1P2NA 1V2VT 1C1UH 1GHAF 2YNBA 3MU1A 4XE4A 3L33A 2UUKB 3MH6A 5SGAE 4TSFD 4GSOA 3W95A 1TA6A 1AZZA 1UVOA 1WV7H 5C20A 1C2GA 1GVZA 1ARCA 1MABB 1YLDA 1EXFA 1ZPCA 3MMGA 1D3TB 3MNXA 5JDUB 1HV7A 4O9VA 1C9PA 1K28D 1TNKA 2ODQA 3KCGH 1H4WA 2BD9A 3MNBA 1EJNA 3VXFH 4AOQA 1C9TA 1BTPA 1C5XB 2KAIA 3MO6A 4WF8A 2FS8A 4TY6A 2VH6A 5F8TA 2CMYA 1RTFB 1NRRH 1FIWA 2W3IA 3BTGE 3KEEA 2P59A 5AFZH 1BA8B 4AZ2B 4NA7A 1HAIH 4FUDA 1ETRH 4X6MA 1YLNA 5E2PA 3KQCA 4Y7BA 4DW2U 3OEED 3KF2A 1F0UA 1XKAC 3UB0A 1Y59T 3R3GB 1Q2WA 1KMHB 1DANH 1DWEH 2AGGX 4GHQA 4HTCH 3RXAA 4D8NA 6GCHF 3TJUA 3GISB 4MNXA 1A0LA 2BXUH 3S9AA 4YOGA 4X8VH 1A5IA 2OQ5A 2TPIZ 3SUGA 3MWIU 1GBHA 3FP6E 3I78A 3LGIA 1CGIE 3SNAA 3TVJB 1NN6A 1SC8U 4ASHA 1RJXB 2ANYA 2P93A 3S7HB 1GPZA 4ZKRU 5EQSA 2OLGA 1BBRK 3GY3A 2QV1A 1GMDG 1C1PA 1KXEA 1A5HA 1P8VC 1ABIH 4ASUD 3EQ0H 1J9CH 2JDID 5T3HA 1BRUP 3VB4A 1YWUA 1Y8TA 5I25A 1O2QA 3BTTE 3O8CA 2FOBA 1AWFH 2PKSC 1SFQB 4CRCA 4NZLA 3HGPA 1PPFE 2F9PA 3NUMA 1ELGA 3P8FA 1F0SA 1KDQB 1YPGH 5J4SA 4O3TA 2DE8A 1PFXC 2CJIA 1W11U 1NO9H 1ZTLA 2GT7A 1NS3A 2ZECA 1EAUA 2BZAA 1BBRE 2GV6A 3P8OA 1GJ4H 1O3JA 4WMFA 2XOKD 1QRZA 3U8RH 2VJ1A 4BAQB 1TNHA 1SI5H 5HIYA 2ANWA 3RXIA 4CHAC 1HAHH 4AB8A 3P17H 2WPHS 2FXRA 1QJ6B 1RIWC 1YPHC 1O3KA 3KQ5A 3SV7A 4U2WA 4IC5A 3ATWA 1EFRD 4O03A 4K1SA 5DPAA 1V2ST 4E05H 2BVRH 2ZGXH 3A7XA 1PQ7A 5HKKD 1M9UA 3OTJE 1MQ6A 3KNXA 4ISNA 1O3FA 3URCA 1TABE 1V2LT 1LTOA 1IOEA 5EJZA 4IN2A 1HXFH 3GCHB 4Y71A 1HPGA 1VITH 3LKWA 1PJPA 3M5LA 5JBTA 4CH2B 4XBBA 1O2OA 4AFUA 2QY0B 1VJ9U 4Y11E 2W6JD 1C1SA 4Y76A 3BV9B 1SBWA 4XBDA 1CHOF 1S84A 1P2IA 1KLTA 2PUXB 1UTJA 3ZZ8A 1C1NA 1L2EA 2J5UA 1RXPA 1QBOA 1SOTA 1ESBA 1O2YA 3UR6A 1OWJA 3U98H 3SU4A 1FY8E 2Z3EA 3E0PB 2BB4A 2W26A 1MTWA 1TYNA 1DFPA 4UONA 2RA0A 2G00A 3HKJB 5C2ZA 2FP7B 3SHCH 2GKVE 2BD8A 3A81A 1CE5A 1O2NA 1ORFA 1P3CA 1DWBH 1G3CA 4CHAB 1C2HA 1O3OA 2OC8A 1TQ7B 1BTWA 2EI8A 5DP4A 2ZU4A 3I77A 1QB1A 1ETSH 3Q3YA 3IG6B 3SI3H 4MTBA 2TRMA 3SU5A 4HGCA 1GHAG 4NG9H 4WH6A 2BD2A 1GI0A 1OYQA 1O5DH 1QRWA 3AAVA 2WINI 4GVUA 3UQVA 2WPLS 2ZU3A 3F2HA 5L30H 1AO5A 3QTVH 4DT4A 3DSOA 3QDZB 4YESB 4AYYB 1BTUA 2UWOA 1C2EA 1DWDH 3UQOA 2D2DA 3LGYA 5C5OA 2G52A 3CENA 2CK3D 3T25A 2WV4A 1L4DA 4CBNA 3RXLA 3VB6A 1BBRH 5GIBA 4AFSA 2KFWA 1AY6H 4NGAH 1LVYA 5F8XA 5HM2A 3ATMA 1DM4B 4UFFH 4I8KA 2AGIX 3SNCA 1E1QD 2M2AA 4TWYA 4FUHA 5IK2D 3A7TA 1RS0A 1C1RA 1A3BH 2F3CE 2H9HA 1LHGH 3GCTG 2J98A 5L2ZH 3UFAA 1JRTA 1LDTT 3QUMP 1G3BA 2W7UA 1O36A 3KQDA 1BTYA 1WYKA 1YCPK 1KXAA 2FOGA 2Z3DA 1DOJA 3WW7A 1LO6A 3M3TA 1CT0E 3MU4A 3B9FH 3SU3A 4MPXA 1P01A 2BY5X 1P2OA 5K0HA 2ESTE 2SGDE 1AZ8A 4U32A 4KTSA 2HVXA 3ENSB 1GBEA 6GCHG 1FY4A 1ZHMA 2ANMH 1HAYB 1CBWB 2JETB 1TMBH 1H8DH 4I33A 1S5SA 2YMSD 1SQTA 4A5TS 2BTCE 3TK6A 2BMGB 1TX6A 4ZXYH 1HBTH 1J8AA 2F9UA 2ULLA 1W0KD 2BOKA 4WXIA 3RUOA 3SV9A 2FWWA 1XUKA 5DP9A 2OTVA 1QR3E 5EGMA 2VVUA 2LELA 2QF3A 3BG8A 4FUCA 3UUZA 2WPMS 1QNJA 3CP7A 2VWMA 3E0NB 1A3EH 1QJ1B 4YLUA 3Q3XA 1CGJE 4GCHF 4B6FA 3DFLA 1PPHE 1P12E 1SQOA 4ABDA 4FU9A 1GGDC 2VNTA 3WY8A 3FZDA 3LJJA 3NXPA 1Z6JH 3Q3KA 2HLCA 1ZJKA 3SO3A 1SFIA 2OC1A 4NIXA 1UCYK 3TK5A 3QZQA 1O33A 1W0JD 8LPRA 1QGFA 4ZXXH 1H1BA 2G5NA 4NIVA 5ESTE 3SJ9A 1F92A 2ZQ1A 1YP9A 2D1JA 4Z0KA 5AF9H 4H6TA 1HXEH 3ODDA 5B6LA 4MNWA 3V0XA 1QTFA 3KN2A 2VWNA 3S69A 3EAJA 1BCUH 2EC9H 5CE1A 1NU7B 2ZZUH 1AFQB 2NU4E 5JB8S 1EPTA 4YT7H 2GZ7A 4NA9H 3LPRA 2WSSD 4X2VA 1TPOA 3TJVA 1KTSB 1UTLM 4F49A 2Y81A 2STAE 4O97A 1QA7A 2ZTXA 1HAGE 1HYLA 4RT1A 3SU0A 4B6EA 5A0CA 2C8WB 2A7JA 3BEUA 3E1XB 4WWYA 1ZMLA 4CBOA 1V2NT 3A7VA 4D76A 4P02A 4X2XA 4ABBA 1C5TA 3RXBA 2ZPRA 2AHME 1C2IA 3MU8A 4F55A 4JZIA 1LVMA 1SB1H 1CHOG 1O5BB 4HZHA 2VIVA 3LU9B 3SZNA 4P00A 3GDVA 4YLQH 5PTPA 3GCNA 1YF4A 1YY3A 1N8OC 8GCHF 4ZMAH 1T31A 1DLKB 5FL7D 4MPWA 2VH0A 1YCPH 3LH3A 4JYVH 2DE9A 3MH7A 4FOUC 4DVAU 3VFEA 4XBCA 3RXJA 1DX5M 2B7DH 3GY6A 1O2UA 1PYTD 3MNSA 1CQQA 2BQ6B 5A0AE 1G36A 3DSPA 4IGDA 1V6DA 3NKKA 4FUBA 4R8TB 2SGQE 2EA3A 1C5PA 4NSYA 1SGCA 5L6NH 3FZZA 1BTHH 1L0ZA 3LJOA 1GL0E 2UUJB 3RXGA 4JZEH 4NCYA 4UE7H 4JK5A 1O37A 1EZQA 1TBZH 2H9EH 1S6FA 1FJSA 1VCPA 4GPGA 1AUJA 5CHBA 5A8YA 1SSXA 3SI4H 2VGCC 1V2TT 5B6OA 4CRFA 1KXDA 1UTQA 2F9BH 2ZCLP 4OS7A 3E8LA 1TRNA 2Y6TA 2ZPQA 1T8NA 2ZDKA 1ZPZA 9ESTA 1BRAA 1UCYH 2FTLE 3ZZ5A 1RTKA 2SNWA 1MBQA 1YPLH 5FCKA 1N8OB 1ELFA 1GCTC 4AC9A 1A4WH 3O8BA 4Q63A 4MVNA 1EP6A 1JIMA 1BQYA 4JZ1A 1UVSH 2NU2E 1SGEE 2QN5T 1XUGA 1SQRA 1AN1E 1QHRB 1DUAA 2ODYB 3QGJA 3RDZA 4GHTA 4X1NU 2I6QA 2EQNA 2FM2A 1MD7A 1UHBB 1G9IE 1DDJA 2P3FH 5F03A 1ZGVA 3HGNA 3E6PH 2PHBA 5FPTA 1MQ5A 2PWXA 3P70B 1X7AC 3OAAD 1O2JA 3BTHE 3RLWH 3UWJH 3RLYH 1O34A 4ISOA 1F0RA 3CS7A 1QURH 4DY7B 2VGCB 3LGWA 1ZOMA 2A4OA 4FUGA 4ZUHA 1HNEE 2AMDA 4ZHLU 1C2KA 3QN7A 1V2UT 1NFYA 3PMAB 1AE5A 1HLTH 3TH3H 1GHZA 1XUIA 2Z9GA 3BTME 8KME2 3A80A 5G4BA 1NROH 1GJCB 1COWD 5EODA 2IPQX 4MPVA 1O2RA 4BAHB 1EOLA 1W10U 4ZHAA 2B9LA 1UTMA 1ESTA 1V2RT 1O5FH 4A1TA 1MTUA 5C17A 4HFPB 1ANBA 3F9GA 4YO9A 3ZYDA 2G55A 1VR1H 2XC0A 2BD4A 3N7EA 1Y5AT 3H09A 2BVXH 1HIAB 3GDUA 1AI8H 1THPB 2VWLA 2V3HH 5ESBA 2QIQA 5I46H 2ZG0H 2BLOA 1G37A 3UREA 1O3AA 1DXPA 1WCZA 1GBJA 4ZAEA 1H8IH 1LPZB 2H1UA 1K9OE 3MNCA 1K1OA 2BM2A 2WPIS 1S6HA 1GI1A 1AKSB 1DPOA 2UWLA 2BY9X 2VVCA 4D7FA 2R9PA 4YZUA 3RMOH 2OUAA 1OOKB 1MH0A 2RCEA 3W1EA 2HVYB 4DURA 1YBWA 1BMNH 1FQ3A 1G30B 2KM0A 3RM2H 4MDSA 1NTPA 1ZHPA 1V3XA 2FDAA 2A4GA 5A0BA 1KXCA 1G3EA 2ZFTA 4BTIB 5FXLA 3TLOA 3MYWA 1GMHG 1GVKB 1SOZA 2QF4A 2C8ZB 2BX4A 1TAWA 2OC0A 3SUFA 1DSTA 1TB6H 2J4IA 4D9QA 3SU1A 2J94A 1O2ZA 1GJ8B 1QIXB 3SJIA 1GJ7B 1A5GH 3RXHA 2ZP0H 1QJ7B 1AWHB 3TH2H 4X6PA 4Y79A 3IWMA 3ATKA 3DD2H 1BUIA 1ZRKA 1NRNH 2P95A 4NA8A 1WUNH 3PROA 3BSQA 3EA9A 1A0HB 4WVPE 3OE7D 4Y8XA 5LPEA 2FZZA 1C5UA 1MZDA 1P2QA 4OS5A 4FVBA 2PFEA 4LK4A 3T27A 3SGAE 4D9RA 5LPFA 1TMTH 1G3DA 2Q1JA 1E38B 1EP5A 2XNDD 4ABAA 4JZDH 1QB9A 1GBTA 5JPMH 1C5WB 1HCGA 1JOUB 1IQKA 1GG6C 1GJDB 2OBQA 3U1IB 3GDSA 2BQ7B 2Q6FA 4KELA 1C2JA 2EEKA 5GPIB 3WWFA 3M7UA 5EJLA 2ZU2A 2PW8H 5T1VA 1GDNA 4I7YH 2GMTC 1QQ4A 4Q4LA 5GDSH 5JBBS 2BLWA 2FODA 3LONA 1MTNC 4M7GA 3GY7A 1D4PB 5JYIA 1E1RD 2LPRA 3A8AA 1GWAA 4X1SU 2ANKH 5C0UA 5DSFA 3F2GA 3FKSD 1AVXA 1IQLA 4JYUH 4JK6A 1OP0A 1DY8A 3GYMA 3S9CA 2C4FH 4XD7D 2BVSH 3O8DA 1BRBE 1PQ5A 3ZV9A 4X0WU 2CHAC 4E7RG 3VG8A 2ZFQH 3BTQE 1GBDA 3VEQB 2UUFB 2UUYA 2HRVA 2PKAA 1E0FD 1O2XA 1SL3A 3RXKA 4WMDA 2O8WA 1BMAA 2JJ1D 1GG6B 1K0HA 2FI3E 4Q7YA 3EE7A 2CF8H 1G32B 5C1XA 2XCNA 1C5QA 4K3JA 3GCHC 1A46H 1O3HA 1ELAA 1HAXB 2O8MA 4SGBE 1Y3XA 2IPHA 4AFQA 5FBEA 1GBLA 2ZI2H 1GJ9B 1OXGA 1S0RA 1LVBA 4E7NA 1WSSH 3BF6H 1KTTB 2GMTB 4NFEA 1HFDA 1IQHA 5DO4H 1D3PB 3SN8A 1O3BA 1SGNE 2R3UA 2XBXA 1MTNB 1BIOA 3QK1A 3MFJA 4Q7XA 3STIA 1SGFG 1GHBG 1QY6A 2K1QA 3PMHB 1O3NA 1ZTKA 2FLRH 2EI6A 4CRBA 3KGPA 5A09A 2Y82A 1OP2A 4GAWA 1EB1H 3BTKE 3DFJA 2R2WU 3V7TA 4B2AA 4ABGA 1ZTJA 1BTXA 1NM6A 1ELCA 1NFWA 1W0YH 2UWPA 2ZHFH 4CREA 1EAXA 1GBCA 1Y3WA 4MNVA 1AD8H 3QGNB 1TLDA 3A8BA 1XXFA 2Z94A 3UIRA 1ZSLA 2GJGA 1RRKA 1A7SA 1HGTH 3FOAA 4Y8ZA 1Q31A 1ELTA 2OP9A 2CHAB 1VITG 3FO8D 3BIVH 2GDEH 1ELEE 1TIOA 2Y7XA 2A7CA 1VZQH 3BTDE 2OBOA 2KAIB 4K2YA 3RXRA 3A7ZA 4ZROA 3SJKA 5HXFA 2NU0E 1QB6A 3BEIB 2BDHA 2ZO3H 1P2KA 1C4V2 1FXYA 3UNQA 1T4UH 3RXQA 5DGJA 1GI5A 1C5NH 2YMSC 1HAPH 3P92A 2ZGJA 1H8ED 2PGBB 1FPHH 2V3OH 2AMPA 3NRLA 3SUEA 3K6ZA 2ZHDA 2SGAA 1LHEH 6CHAC 2WPDD 3F9EA 4TYDA 3RMNH 1D6WA 1QZ8A 1CT4E 1LPGB 3M3VA 1SGRE 2XBVA 2HALA 3F6UH 4ZH8A 1MCTA 1HJ9A 4IBLH 2FI4E 3VB5A 2BZ6H 2ILNA 1LPKB 2A4RA 2ZF0H 2Y5FA 1GMCF 3NPSA 2BYAX 2W5EA 4X2YA 2FMJA 1MD8A 2HNTE 1CBWC 2JETC 2XNIA 1XUFA 3GY8A 1S82A 1C5LH 3ZZ7A 1ZHRA 2F83A 4B73A 1C4U2 4OS1A 4OS4A 1L4ZA 2VVVA 1FPCH 4K69A 2RDEA 4IW4E 1GI2A 3T62A 2H9TH 4UEHH 1G2LA 2GTBA 5JBAS 3SV2H 4B1TA 5HMAA 3V13A 2ZCKP 2XYAA 3BTEE 1HAOH 1TOCB 3SBKA 5ETXA 3RXVA 1XM1A 2ZC9H 2OC7A 2YMSB 4NFFA 1C1WH 1XVOA 3D49H 1GJBB 2QXGA 1YKTA 2IJD1 5CMXH 1AB9B 1EASA 1ELDE 3PRDA 2VINA 6CHAB 5E0HA 3M5NA 1F7ZA 3TITA 4I8JA 2W7SA 3RMMH 1ELBA 4I8HA 1TNIA 2NU3E 4TY7A 3RU4T 1W7XH 5EPNA 2KCYA 3A7YA 1HAVA 1F5RA 4DIHH 5A8XA 2NWNA 3BN9A 2ZKSA 2RDLA 1AFQC 1DE7H 1THSH 4INLA 4YT6H 1FAKH 5E8EH 1OHHD 1QL7A 1S81A 2BQWB 2H5DA 4MLFB 3V3MA 1GBMA 3ZZ6A 3ZVBA 2ZU1A 4BAMB 2M5TA 2A5KA 3KL6A 3SU2A 7GCHF 4ABEA 5EQQA 4LOYH 4AG2A 3RM0H 3NZIA 1O2KA 2WYGA 1PYTC 2VIOA 1AIXH 8ESTE 2Z3CA 1UMAH 3ZV8A 1GJAB 5EW2H 3N7OA 1TALA 5IYTA 2PSYA 3TK9A 1C1OA 3HK6B 1B0FA 1EX3A 1JIRA 2PGQB 5TJXA 4CH8B 4K60A 2GD4B 3OYPA 2C3SA 1O2WA 1TX8A 1Z6EA 4ABIA 1DWCH 1MKWK 1FDPA 1UK2A 4DG4A 4INHA 2B0FA 4AYVB 4DJZB 2Q6DA 1ZJDA 1O32A 5FPYA 1FLEE 1QL9A 3Q00A 1V2JT 1U6QA 3MU5A 2WV9A 5AFYH 2VWOA 5J4QA 1UW7A 3TNTA 5JBCS 4XDEA 2BXTH 3KYGA 5EXMA 1NBMD 1O38A 3VGCC 4FU7A 1T8LA 3A84A 1QA0A 2EY4C 1ELVA 2QXIA 4ABFA 4FU8A 3LGVA 3LGUA 1ACBE 1UK3A 1YPKH 3E90B 3ZYEA 5DJ7A 3T5FH 4BXSA 1MAXA 1A61H 2AFQB 2F4LA 5AHGH 2J98B 1YPMH 2LP6A 2G8TA 5ABWA 4B71A 1HJAC 2A45B 2YNAA 4RSPA 2O9QA 4DCDA 1TPPA 4B75A 2WZQA 2Z9IA 3QTOH 4ISHH 2BDBA 2VU8E 3IITA 2FX4A 1GHVH 1W14U 4Z6AH 2SFAA 5C1YA 2ZDVH 3AW0A 1TX7A 4AGKA 1UVPA 4AN7A 1TBRH 5GWZA 5FBIA 3MI4A 2OQUA 5DP5A 1ID5H 2WYJA 5A2MH 2TGDA 4Q7ZA 1O35A 7KMEH 1AVGH 1NT1A 1ZR0A 1GHXH 4BAOB 1N6YA 4A1XA 1BT7A 1P57B 3TU7H 2K0QA 3B8JA 2PP6A 1EZXC 2XTTB 2Z6BD 2ZHWH 2A31A 2P3UB 5DP8A 5HGGA 3RXDA 3UTUH 1MU8B 2FLBH 3M37A 4NWLA 3VGCB 2BY6X 3F9HA 3JZ2B 2ZTYA 1IQGA 1WU1A 1Z7KA 1BB0B 1NC6A 1MKXK 2ZWLH 3ATLA 4A7IB 4ESTE 3PV5A 4FUFA 3SQEE 2AEIH 3SJOA 1FN6A 2FOMB 2R2MB 3EA7A 3FAOA 4JMYA 5EW1H 1HAZB 1SGFA 1LQEA 1NBME 2BD3A 2P94A 1CHGA 1HJAB 2G5VA 4HI3A 1Y3UA 4ACAA 1TA2A 4MNYA 2BLQA 2ODPA 4I8GA 2WUCA 3M61U 2GZ8A 2A4QA 2QYIA 1E35B 2ASUB 3RC5A 2J9NA 3GY5A 2XXLA 1FNIA 2ZFPH 4IC6A 3RXFA 1O39A 1EPTB 1ARBA 2I6SA 2XWAA 1TBQH 4GLYA 1QL8A 4K1EA 4LXBH 3SNDA 3SHAH 4AX9H 1YC0A 5CDFE 4VGCC 3QLPH 1AKSA 4D7GA 2AH4X 3QX5H 2A5AA 1FIZA 2ZDLA 1C5ZB 1BMMH 4J2YB 4QT8C 5IDKA 2ALPA 1BRCE 3RXEA 4TT3D 1TONA 3H5CB 4Z1MD 2KZ4A 3PMBB 4HG6A 5AVDA 4UD9H 1YCPM 3SNEA 3UNSA 1KLIH 1SHHB 2FX6A 1YM0A 4KTUA 4X2WA 4ZKOU 4GCHG 4OGXA 5H4IB 2TGAA 3MH4A 5TCAA 2GV7A 3ZVDA 3S0NA 1GI7B 1OYTH 1FAXA 5HIZA 2ZFRH 1AU8A 3K9XB 2Z9JA 1SGIB 2LNCA 2P3TB 3H7OA 4NWKA 1AUTC 4TWWA 3G01A 1HDTH 1GMDF 3A86A 5GNDA 3A7WA 3SYJA 1PQAA 1SGQE 2OD3B 1GL1A 4VGCB 1FONA 1F0TA 4FUEA 2R0LA 1SGYE 5GCHF 3DSGA 1O5CB 1KIGH 2C90B 1C5SA 1L1JA 1ZRBA 1C4Y2 2J95A 3N99A 3ZVEA 1IQNA 1NPMA 1V2WT 4X1PU 1GBBA 1P9SA 3FP7E 1DS2E 3QWCH 1AFEH 2BDIA 1N6XA 3M7TA 3VPKA 4OGYA 1IAUA 2SGFE 3F2FA 2JH5D 2Z9LA 3T2NA 1DVAH 4MG3A 1MKXH 1GCDA 3KQBA 2H6MA 1P2MA 4ACBA 1O2IA 1C2MA 1P03A 1TGCA 1O2MA 1C2FA 1VJAU 4O3UA 1QBVH 2AS9A 4I32A 3ESTA 1EQ9A 1QCPA 1TGBA 1MTSA 3LOXA 3K2UA 3PV2A 3EDXB 1H8HD 1S0QA 3QO6A 3ZZ3A 2BOHB 3LIWA 4ABHA 1E79D 1SMFE 3U28C 3A85A 4B2BA 1P10A 2P16A 5BPEA 1D3DB 1TGNA 4U01A 5C94A 4J1YA 1FUJA 2PTCE 2F91A 1LVOA 1XKBC 2TBSA 1LCYA 8GCHG 1INCA 1BJVA 2HPQH 4IMZA 2HLDD 4KTCA 1P05A 1ABJH 3ZVFA 1TPAE 1SLWB 3RXMA 5LH8A 2O8LA 5GXPA 2GP9B 1Q3XA 1KY9A 3DT0H 7LPRA 1Y5UT 4AORA 4I86A 1IHTH 2ZFSA 5DKMA 3W94A 1O2GH 3VXEH 3SJ8A 6LPRA 3TJNA 3UNRA 2F9NA 1OS8A 2VIQA 2OXSA 1LQDB 1GJ6A 1J16A 3F9FA 3AASA 1O3EA 1LKBA 1ANEA 2GCTC 2ZDNA 1O30A 2ZHEH 1KLJH 3P95A 3URDA 1KDQA 1F2SE 3PLKA 2B8OH 1WDIA 2J38A 1IQMA 3PWCA 2BHGA 2HNTC 2JKHA 1WQSA 2FOAA 2Y80A 5C3NA 1EUFA 1YPEH 3UY9A 2STBE 1QBNA 1UO6A 5JB9S 5T6FA 3AAUA 2ZCHP 1OWIA 3SW2B 3FP8E 4ISLA 3PMJA 1E37B 1WOFA 3PO1B 3EA8A 1KXFA 5L2YH 1GI3A 4Y7AA 2ZTZA 1VGCB 4ZHMU 2VIDA 3F0PA 4XSKU 1K1NA 4CR9A 1K1MA 1QFKH 1DXWA 3GY2A 1W13U 2PSXA 3U9AH 1A2CH 1O0DH 4RN6A 2FO9A 1T32A 4X6NA 1GBKA 1NRQH 3GY4A 3DCLA 2QCYA 4JCNA 1SQAA 3SQHE 3E91A 1AE8H 1T8MA 1EKBB 2FIRH 2W6ID 2ZHQH 4WH8A 1OWKA 1WTHD 1UVTH 1P04A 2G51A 4KGAA 2A2XH 1EATA 3GCTF 2VIPA 1H9IE 3E3TA 2QXJA 3R0FA 5DP6A 3FN8A 2CGAA 1E34B 3AW1A 5C67A 2GCTB 1ZGIA 3NWUA 4TPIZ 3M35A 2SNVA 1C1VH 3D62A 5BRRE 1MUEB 4Y0ZE 1LKAA 4FUJA 4Y8YA 1OWDA 3L3TA 1FI8A 4BAKB 4ISIH 2V0BA 1NY22 1O3LA 2XCFA 4CRAA 2HNTF 4CR5A 2D8WA 2Y5GA 2QGRA 5FAHA 3O8RA 2SGPE 2ZNKH 2ZDMA 1K21H 4IS5A 4RI0A 5TCCA 1Z8JB 1ZLRA 3PV4A 1Z8IB 1RFNA 1W0ZU 2FYRA 4YXWD 4FETA 4LZ1H 2FOFA 1SGDE 4K1TA 3F1SB 1P02A 3RXPA 3ZZBA 1SVPA 3NK8A 2PR3A 1GDQA 4KP0A 4JZFH 4AFZA 5EOKA 3RC4A 2D26C 3RU4D 3QZRA 1SLXB 1O5EH 3TIUA 5GCHG 1SGPE 1MZAA 4Y10E 4YOJA 4X1QU 2TIOA 1Z8RA 2JIZD 1THRH 5CHAC 1ESAA 1T4VH 3K65B 3ITIA 4F4OC 1H9LB 1CO7E 1YPJH 2V3MA 3P8NA 3TJOA 4OS6A 4F48B 5DG6A 4AGJA 4I31A 1DT2A 1O5GH 2VBCA 4Q2KA 5HYOA 3ZZ4A 1UTOA 1C5OH 3UR9A 2GCHF 2V6NA 3EYDA 3A87A 3NCLA 2FESH 3M5OA 2HOBA 1AGJA 4XOJA 2SGEE 1O31A 1UTPA 1EZUC 3LGTA 4X8SH 1P11E 5EG4A 1IQJA 3A8DA 3U8TH 1GI8B 1AB9C 5A8ZA 5DP3A 2XW9A 1Z1IA 1SLVB 2AERH 2BDCA 2ZDAH 1P0SH 4ZKSU 1JBUH 1C1MA 1P3EA 1W2KH 2QAAA 2FOHA 1D9IA 1C5YB 2J92A 1LMWB 1ZMNA 3FANA 2AIQA 2PKSB 3D65E 1UTKA 1EZSC 3CS0A 1TQ0B 2W3KA 3SORA 1GI4A 5LPRA 5C5NA 1DSUA 3TH4H 3RU4E 4BTUB 5CHAB 1EAWA 3ZZCA 1O3CA 3SNBA 2QC2A 1O2PA 2PKAB 3D23A 3U69H 1D6RA 1JXPA 1BZXE 4INKA 1KSNA 1TOMH 2J2UA 3OTPA 3OX7U 1TE0A 4K8BA 4B2CA 2ZPSA 3PWBA 4SGAE 1ZYOA 2NU1E 1Z8GA 2O8UA 4R0IA 1C2LA 1PPGE 1RGQA 3UOPA 2A0QB 3BTFE 4BOHA 1CT2E 5T6GA 3TNSA 2FPZA 1RIWB 1P9UA 2AMQA 2BY7X 2H2ZA 3MTYA 1TNGA 2OK5A 1FY3A 4BNRA 1MCVA 1OSSA 1NU9A 1SG8B 3PB1E 1LHDH 1W3CA 4KKDA 2BDGA 4BXWA 2IJOB 3STJA 2EI7A 3A83A 3DUXH 5F8ZA 2VIWA 3ZZDA 2CF9H 3MH5A 3PLBA 1YGCH 4NIWA 1UJ1A 4X8TH 3M36A 4ZKNU 1O5AB 3SU6A 1DY9A 1GHWH 3WWBA 2BDYA 2CV3A 1TPSA 2JH6D 1XVMA 1XX9A 4Q80A 1GHYH 2PUQH 3MHWU 5EU8A 5K7RA 3ZVGA 1PQ8A 1S85A 3LDXH 3PRBA 4DOQA 4K8YA 2J97A 1BTZA 1NFXA 4I8LA 2KCPA 1O3PB 1OKXA 1YYY1 2TGPZ 5C0TA 5E2OA 4WXVA 5EJ1A 1BOQA 1Z71A 5FHTA 3RXTA 2KCAA 4H42U 3FFGA 1PPZA 3SGBE 4UDWH 2DUCA 1GJ5H 3P6ZB 4OM9A 2HGTH 4AB9A 1Y3VA 5EIYA 2GZ9A 5DN6D 4BTTB 1G2MA 1CA8B 2OINA 1MBMA 3L6PA 4DGJA 2AGEX 1JWTA 2ZFFH 1MU6B 3KIDU 3Q77A 5EXNA 2AIPA 3BEFB 3GICB 1SKYE 1W8BH 1CSOE 2BD7A 5FPSA 1VCQA 3V12A 4Y6DA 1B7XB 2KCOA 4CRGA 3PTBA 4E06H 1AQ7A 1CU1A 1TFXA 3RC6A 3MU0A 1A1RA 1J17T 1EB2A 1RTLA 3GYLB 2XC5A 3TPIZ 1NZQH 1ZMJA 2F43B 4CRDA 1GI6A 3F68H 2L74A 2Z9KA 4UFGH 1DLEA 3S9BA 3ZZAA 2FI5E 3A8CA 1OPHB 4NIYA 3N7DA 3MO3A 2A32A 2QE7D 1TRYA 1OP8A 1WQVH 1A0JA 5F6MA 1T8OA 2IOTA 2THFB 1NESE 2PLXA 2C8XB 3F3BA 1BJUA 1T7CA 5DP7A 1LHFH 1ZPBA 4LZ4B 1ETTH 1TRMA 1VCWA 2ZQ2A 1AHTH 5E0JA 1YPHE 3HK3B 4FVDA 3M3SA 2ALVA 2FTMA 1K2I1 1O2HA 2L6OA 2GCHG 1GBIA 1F5KU 1UCYE 2VB0A 4RT0A 2G4TA 1XUHA 3SZEA 1C5VA 2BX3A 4U30A 2FYQA 2KX4A 3C1KA 4A6LA 4UFEH 1KYNA 1TWXB 1WXRA 3SV8A 3TGJE 3RMLH 3LH1A 4IMQA 1S6LA 4IN1A 1TMUH 4M9FA 1CGHA 1P06A 1UHBA 2XBYA 1EJAA 1HAVB 2ZA5A 5E0GA 2QA9E 3LC3A 1E36B 3UPEA 1PPBH 1GGDB 1OWEA 1SR5C 2Y7ZA 2WV5A 1EPTC 1O3DA 3TGKE 4X1RU 1FZZA 1NRSH 2YOLA 1DITH 9LPRA 3VB3A 3U8OH 3ZIAD 2QF5A 3F0OA 1GI9B 1GMCG 2GX4A 3GS9A 4THNH 1VKYA 5EXLA 1LHCH 1TNJA 1XXDA 1K1PA 4BANB 1FMGA 1NRPH 2GDDA 4ABJA 3GCOA 1RD3B 2ZU5A 2H5CA 1YLCA 1AVWA 3FVFB 4RKOB 5KECA 1GMHF 2KR7A 1TNLA 3PYHA 5DK1A 3ZVAA 2O8TA 5KGOA 1P09A 2RG3A 3OEHD 4B74A 3RXCA 1S83A 2ZEBA 1MMJN 1SGTA 2V7QD 2Q6GA 3HKIB 3LT3A 4NSVA 5FX5A 3K6YA 3BIUH 3ZVCA 4YTAA 1O2SA 4X6OA 4H6SB 2ZIQH 2ZGHA 3PTNA 4WJG2 1BMLA 4A92A 2PV9B 1C5RA 1HIAA 3UWIA 1J15A 2WPKS 1HRTH 1V2MT 1ANCA 2R3YA 2A2QH 3MO9A 3SUDA 3GOVB 1ZZZA 1GBFA 3ELAH 2FS9A 1K1JA 5FCRA 2RFKC 2J34A 1FY1A 3ZZ9A 2BD5A 4A1VA 2BY8X 1HJ8A 4XRNA 7ESTE 2GGVB 1V2OT 3P8GA 3UOUA 1MKWH 2ZGBH 3CNRA 1WAYB 3Q76A 4MPUA 3PLPA 1HB0B 2TGTA 3BTWE 1EJMA 2AYWA 1W7GH 4AG1A 2F9VA 2CXVA 3HATH 1ZSKA 5GJ4B 4WY3A 2JH0D 3M7QA 2G4UA 1B0EA 1BHXB 2WUBA 3RP2A 7GCHG 2WHXA 1O3MA 2XRCA 4FUIA 2A7HA 1FN8A 1PPCE 4DT7B 1HUTH 2XC4A 5KEDA 1BHXF 2G81E 1C5MD 4WMEA 1UK4A 1O3IA 2R0KA 3OY5U 3DHKH 3T29A 2XWBI 3MQKC 1TGSZ 3MOCA 2C8YB 3M5MA 1IHSH 1Y5BT 4X8UH 4UFDH 1WTGH 1D3QB 2ZGCA 3JZ1B 1Z1JA 2JJ2D 1QQUA 1OWHA 2K8IA 1ZSJA 4NZQA 2HWLB 1BITA 3AVZA 1GDUA 1N1LA 1SHYA 1Y3YA 4TPYA 2QXHA 2WPJS 4XFQA 3RXSA 5EPYA 5F53A 3SGQE 3OY6U 2F9OA 3EE0B 3S7KB 3UAIC 4H4FA 2P8OC 1L1NA
chains in the Genus database with same CATH topology
1WBGB 1NFUA 1MTVA 1IQEA 1AMHA 1QRXA 1ANDA 1FV9A 3RXOA 5C1UA 1PPEE 3U1JB 1CA0C 1GCTB 3OU0A 2GVFA 3BG4C 2C93B 4JYTA 2V35A 1OX1A 3I29A 1BDAA 2Z7FE 5HM9A 1JRSA 3C27B 3B23B 1UVUH 3H7TA 2PTNA 1GHBF 2Y5HA 3RXUA 2B5TB 3SOSA 1H9HE 3A82A 3A88A 2A5IA 1O2VA 2FEQH 4GUXA 1DICA 5T6DA 3E16B 1SLUB 2FOEA 1C1TA 3LC5A 4OS2A 2A1DB 4K5ZA 2QF0A 3TGIE 3DA9B 2CN0H 3PO1C 1J14A 2OCVB 3PM3A 3VB7A 3ODFA 1XUJA 4B76A 1IQFA 1O3GA 1CVWH 1VITF 1W12U 2XBWA 1KXBA 2HPPH 1FY5A 2IN2A 3OSYA 1O2TA 5FX6A 1VGCC 3EGKH 3KQEA 1F5LA 2BLVA 3ATIA 1DUEA 1EAIA 1B5GH 4FXGH 5LGOA 1SPJA 1GVLA 2P8OB 2BDAA 3T28A 1C1QA 1K1IA 4RKJB 3A89A 3T26A 1CA0B 1L1GA 3BG4B 1V2PT 1UTNA 5EQRA 1IQIA 1MAYA 1V2KT 1O2LA 1V2QT 1XMNB 4Y0YE 3KHVA 1EOJA 6ESTA 2FOCA 4YM9A 1TGTA 1K22H 4PROA 3SV6A 2RA3A 2GT8A 4DIIH 4MQAA 1JMOH 3HPTB 1GBAA 1K1LA 1P2JA 1C2DA 4YOIA 1P2NA 1V2VT 1C1UH 1GHAF 2YNBA 3MU1A 4XE4A 3L33A 2UUKB 3MH6A 5SGAE 4GSOA 3W95A 1TA6A 1AZZA 1UVOA 1WV7H 5C20A 1C2GA 1GVZA 1ARCA 1YLDA 1EXFA 1ZPCA 3MMGA 1D3TB 3MNXA 5JDUB 1HV7A 4O9VA 1C9PA 1K28D 1TNKA 2ODQA 3KCGH 1H4WA 2BD9A 3MNBA 1EJNA 3VXFH 4AOQA 1C9TA 1BTPA 1C5XB 2KAIA 3MO6A 4WF8A 2FS8A 4TY6A 2VH6A 5F8TA 2CMYA 1RTFB 1NRRH 1FIWA 2W3IA 3BTGE 3KEEA 2P59A 5AFZH 1BA8B 4AZ2B 4NA7A 1HAIH 4FUDA 1ETRH 4X6MA 5E2PA 3KQCA 4Y7BA 4DW2U 3KF2A 1F0UA 1XKAC 1Y59T 3R3GB 1Q2WA 2AGGX 1DANH 1DWEH 4GHQA 4HTCH 3RXAA 4D8NA 6GCHF 3TJUA 3GISB 4MNXA 1A0LA 2BXUH 3S9AA 4YOGA 4X8VH 1A5IA 2OQ5A 2TPIZ 3SUGA 3MWIU 1GBHA 3FP6E 3I78A 3LGIA 1CGIE 3SNAA 3TVJB 1NN6A 1SC8U 4ASHA 1RJXB 2ANYA 2P93A 3S7HB 1GPZA 4ZKRU 5EQSA 2OLGA 1BBRK 3GY3A 2QV1A 1GMDG 1C1PA 1KXEA 1A5HA 1P8VC 1ABIH 3EQ0H 1J9CH 5T3HA 1BRUP 3VB4A 5I25A 1Y8TA 1O2QA 3BTTE 3O8CA 2FOBA 1AWFH 2PKSC 1SFQB 4CRCA 4NZLA 3HGPA 1PPFE 2F9PA 3NUMA 1ELGA 3P8FA 1F0SA 1KDQB 1YPGH 5J4SA 4O3TA 2DE8A 1PFXC 2CJIA 1W11U 1NO9H 1ZTLA 2GT7A 1NS3A 2ZECA 1EAUA 2BZAA 1BBRE 2GV6A 3P8OA 1GJ4H 1O3JA 4WMFA 1QRZA 3U8RH 2VJ1A 4BAQB 1TNHA 1SI5H 2ANWA 3RXIA 4CHAC 1HAHH 4AB8A 3P17H 2WPHS 2FXRA 1QJ6B 1RIWC 1YPHC 1O3KA 3SV7A 4U2WA 4IC5A 3ATWA 4O03A 4K1SA 5DPAA 1V2ST 4E05H 2BVRH 2ZGXH 3A7XA 1PQ7A 1M9UA 3OTJE 1MQ6A 3KNXA 4ISNA 1O3FA 3URCA 1TABE 1V2LT 1LTOA 1IOEA 4IN2A 1HXFH 3GCHB 4Y71A 1HPGA 1VITH 3LKWA 1PJPA 3M5LA 5JBTA 4CH2B 4XBBA 1O2OA 4AFUA 2QY0B 1VJ9U 4Y11E 1C1SA 4Y76A 3BV9B 1SBWA 4XBDA 1CHOF 1S84A 1P2IA 1KLTA 2PUXB 1UTJA 3ZZ8A 1C1NA 1L2EA 1RXPA 1QBOA 1SOTA 1ESBA 1O2YA 3UR6A 1OWJA 3U98H 3SU4A 1FY8E 2Z3EA 3E0PB 2BB4A 2W26A 1MTWA 1TYNA 1DFPA 4UONA 2RA0A 2G00A 3HKJB 5C2ZA 2FP7B 3SHCH 2GKVE 2BD8A 3A81A 1CE5A 1O2NA 1ORFA 1P3CA 1DWBH 1G3CA 4CHAB 1C2HA 1O3OA 2OC8A 1TQ7B 1BTWA 2EI8A 5DP4A 2ZU4A 3I77A 1QB1A 1ETSH 3Q3YA 3IG6B 3SI3H 4MTBA 2TRMA 3SU5A 4HGCA 1GHAG 4NG9H 4WH6A 2BD2A 1GI0A 1OYQA 1O5DH 1QRWA 3AAVA 2WINI 4GVUA 3UQVA 2WPLS 2ZU3A 5L30H 1AO5A 3QTVH 3QDZB 4YESB 4AYYB 1BTUA 2UWOA 1C2EA 1DWDH 3UQOA 2D2DA 3LGYA 5C5OA 2G52A 3CENA 3T25A 2WV4A 1L4DA 4CBNA 3RXLA 3VB6A 1BBRH 5GIBA 4AFSA 1AY6H 4NGAH 1LVYA 5F8XA 5HM2A 3ATMA 1DM4B 4UFFH 4I8KA 2AGIX 3SNCA 4TWYA 4FUHA 3A7TA 1RS0A 1C1RA 1A3BH 2F3CE 2H9HA 1LHGH 3GCTG 5L2ZH 3UFAA 1JRTA 1LDTT 3QUMP 1G3BA 2W7UA 1O36A 3KQDA 1BTYA 1WYKA 1YCPK 1KXAA 2FOGA 2Z3DA 1DOJA 1LO6A 3M3TA 1CT0E 3MU4A 3B9FH 3SU3A 4MPXA 1P01A 2BY5X 1P2OA 5K0HA 2ESTE 2SGDE 1AZ8A 4U32A 4KTSA 2HVXA 3ENSB 1GBEA 6GCHG 1FY4A 1ZHMA 2ANMH 1HAYB 1CBWB 2JETB 1TMBH 1H8DH 4I33A 1S5SA 1SQTA 4A5TS 2BTCE 3TK6A 2BMGB 1TX6A 4ZXYH 1HBTH 1J8AA 2F9UA 2ULLA 2BOKA 4WXIA 3RUOA 3SV9A 2FWWA 1XUKA 5DP9A 2OTVA 1QR3E 5EGMA 2VVUA 2QF3A 3BG8A 4FUCA 3UUZA 2WPMS 1QNJA 3CP7A 2VWMA 3E0NB 1A3EH 1QJ1B 4YLUA 3Q3XA 1CGJE 4GCHF 3DFLA 1PPHE 1P12E 1SQOA 4ABDA 4FU9A 1GGDC 2VNTA 3WY8A 3FZDA 3LJJA 3NXPA 1Z6JH 3Q3KA 2HLCA 1ZJKA 3SO3A 1SFIA 2OC1A 4NIXA 1UCYK 3TK5A 3QZQA 1O33A 8LPRA 1QGFA 4ZXXH 1H1BA 2G5NA 4NIVA 5ESTE 3SJ9A 1F92A 2ZQ1A 1YP9A 2D1JA 4Z0KA 5AF9H 4H6TA 1HXEH 3ODDA 4MNWA 3V0XA 1QTFA 3KN2A 2VWNA 3S69A 3EAJA 1BCUH 2EC9H 5CE1A 1NU7B 2ZZUH 1AFQB 2NU4E 5JB8S 1EPTA 4YT7H 2GZ7A 4NA9H 3LPRA 4X2VA 1TPOA 3TJVA 1KTSB 1UTLM 4F49A 2Y81A 2STAE 4O97A 1QA7A 2ZTXA 1HAGE 1HYLA 3SU0A 5A0CA 2C8WB 2A7JA 3BEUA 3E1XB 4WWYA 1ZMLA 4CBOA 1V2NT 3A7VA 4D76A 4X2XA 4ABBA 1C5TA 3RXBA 2ZPRA 1C2IA 3MU8A 4JZIA 1LVMA 1SB1H 1CHOG 1O5BB 4HZHA 2VIVA 3LU9B 3SZNA 3GDVA 4YLQH 5PTPA 3GCNA 1YF4A 1N8OC 8GCHF 4ZMAH 1T31A 1DLKB 4MPWA 2VH0A 1YCPH 3LH3A 4JYVH 2DE9A 3MH7A 4DVAU 3VFEA 4XBCA 3RXJA 1DX5M 2B7DH 3GY6A 1O2UA 1PYTD 3MNSA 1CQQA 2BQ6B 5A0AE 1G36A 4IGDA 1V6DA 3NKKA 4FUBA 4R8TB 2SGQE 2EA3A 1C5PA 4NSYA 1SGCA 5L6NH 3FZZA 1BTHH 1L0ZA 3LJOA 1GL0E 2UUJB 3RXGA 4JZEH 4NCYA 4UE7H 4JK5A 1O37A 1EZQA 1TBZH 2H9EH 1S6FA 1FJSA 1VCPA 4GPGA 1AUJA 5A8YA 1SSXA 3SI4H 2VGCC 1V2TT 5B6OA 4CRFA 1KXDA 1UTQA 2F9BH 2ZCLP 4OS7A 3E8LA 1TRNA 2Y6TA 2ZPQA 1T8NA 2ZDKA 1ZPZA 9ESTA 1BRAA 1UCYH 2FTLE 3ZZ5A 1RTKA 2SNWA 1MBQA 1YPLH 5FCKA 1N8OB 1ELFA 1GCTC 1A4WH 3O8BA 4MVNA 1EP6A 1JIMA 1BQYA 4JZ1A 1UVSH 2NU2E 1SGEE 2QN5T 1XUGA 1AN1E 1QHRB 1DUAA 2ODYB 3QGJA 3RDZA 4GHTA 4X1NU 2I6QA 2FM2A 1MD7A 1UHBB 1G9IE 1DDJA 2P3FH 5F03A 1ZGVA 3HGNA 3E6PH 2PHBA 5FPTA 1MQ5A 2PWXA 3P70B 1X7AC 1O2JA 3BTHE 3RLWH 3UWJH 3RLYH 1O34A 4ISOA 1F0RA 3CS7A 1QURH 4DY7B 2VGCB 3LGWA 1ZOMA 2A4OA 4FUGA 4ZUHA 1HNEE 2AMDA 4ZHLU 1C2KA 3QN7A 1V2UT 1NFYA 3PMAB 1AE5A 1HLTH 3TH3H 1GHZA 1XUIA 2Z9GA 3BTME 8KME2 3A80A 5G4BA 1NROH 1GJCB 5EODA 4MPVA 1O2RA 4BAHB 1EOLA 1W10U 4ZHAA 2B9LA 1UTMA 1ESTA 1V2RT 1O5FH 4A1TA 1MTUA 4HFPB 1ANBA 3F9GA 4YO9A 3ZYDA 2G55A 1VR1H 2XC0A 2BD4A 1Y5AT 2BVXH 1HIAB 3GDUA 1AI8H 1THPB 2VWLA 2V3HH 5ESBA 2QIQA 5I46H 2ZG0H 2BLOA 1G37A 3UREA 1O3AA 1DXPA 1WCZA 1GBJA 4ZAEA 1H8IH 1LPZB 2H1UA 1K9OE 3MNCA 1K1OA 2BM2A 2WPIS 1S6HA 1GI1A 1AKSB 1DPOA 2UWLA 2BY9X 2VVCA 4D7FA 2R9PA 4YZUA 3RMOH 2OUAA 1OOKB 1MH0A 2RCEA 4DURA 1YBWA 1BMNH 1FQ3A 1G30B 3RM2H 4MDSA 1NTPA 1ZHPA 1V3XA 2FDAA 2A4GA 5A0BA 1KXCA 1G3EA 2ZFTA 4BTIB 5FXLA 3TLOA 3MYWA 1GMHG 1GVKB 1SOZA 2C8ZB 2BX4A 1TAWA 2OC0A 3SUFA 1DSTA 1TB6H 2J4IA 4D9QA 3SU1A 2J94A 1O2ZA 1GJ8B 1QIXB 3SJIA 1GJ7B 1A5GH 3RXHA 2ZP0H 1QJ7B 1AWHB 3TH2H 4X6PA 4Y79A 3IWMA 3ATKA 3DD2H 1BUIA 1ZRKA 1NRNH 2P95A 4NA8A 1WUNH 3PROA 3BSQA 3EA9A 1A0HB 4WVPE 4Y8XA 5LPEA 2FZZA 1C5UA 1MZDA 1P2QA 4OS5A 4FVBA 2PFEA 4LK4A 3T27A 3SGAE 4D9RA 5LPFA 1TMTH 1G3DA 2Q1JA 1E38B 1EP5A 4ABAA 4JZDH 1QB9A 1GBTA 5JPMH 1C5WB 1HCGA 1JOUB 1IQKA 1GG6C 1GJDB 2OBQA 3U1IB 3GDSA 2BQ7B 2Q6FA 4KELA 1C2JA 2EEKA 5GPIB 3M7UA 2ZU2A 2PW8H 1GDNA 4I7YH 2GMTC 1QQ4A 5GDSH 5JBBS 2BLWA 2FODA 3LONA 1MTNC 4M7GA 3GY7A 1D4PB 5JYIA 2LPRA 3A8AA 1GWAA 4X1SU 2ANKH 1AVXA 1IQLA 4JYUH 4JK6A 1OP0A 1DY8A 3GYMA 3S9CA 2C4FH 2BVSH 3O8DA 1BRBE 1PQ5A 3ZV9A 4X0WU 2CHAC 4E7RG 2ZFQH 3BTQE 1GBDA 3VEQB 2UUFB 2UUYA 2HRVA 2PKAA 1E0FD 1O2XA 1SL3A 3RXKA 4WMDA 2O8WA 1BMAA 1GG6B 2FI3E 4Q7YA 2CF8H 1G32B 5C1XA 2XCNA 1C5QA 4K3JA 3GCHC 1A46H 2O8MA 1ELAA 1HAXB 1O3HA 4SGBE 1Y3XA 2IPHA 4AFQA 5FBEA 1GBLA 2ZI2H 1GJ9B 1OXGA 1S0RA 1LVBA 4E7NA 1WSSH 3BF6H 1KTTB 2GMTB 4NFEA 1HFDA 1IQHA 5DO4H 1D3PB 3SN8A 1O3BA 1SGNE 2R3UA 2XBXA 1MTNB 1BIOA 3QK1A 3MFJA 4Q7XA 3STIA 1SGFG 1GHBG 1QY6A 2K1QA 3PMHB 1O3NA 1ZTKA 2FLRH 2EI6A 4CRBA 3KGPA 5A09A 2Y82A 1OP2A 4GAWA 1EB1H 3BTKE 3DFJA 2R2WU 3V7TA 4B2AA 4ABGA 1ZTJA 1BTXA 1NM6A 1ELCA 1NFWA 1W0YH 2UWPA 2ZHFH 4CREA 1EAXA 1GBCA 1Y3WA 4MNVA 1AD8H 3QGNB 1TLDA 3A8BA 1XXFA 2Z94A 3UIRA 1ZSLA 1RRKA 1A7SA 1HGTH 4Y8ZA 1Q31A 1ELTA 2OP9A 2CHAB 1VITG 3BIVH 2GDEH 1ELEE 1TIOA 2Y7XA 2A7CA 1VZQH 3BTDE 2OBOA 2KAIB 4K2YA 3RXRA 3A7ZA 4ZROA 3SJKA 5HXFA 2NU0E 1QB6A 3BEIB 2BDHA 2ZO3H 1P2KA 1C4V2 1FXYA 3UNQA 1T4UH 3RXQA 5DGJA 1GI5A 1C5NH 1HAPH 3P92A 2ZGJA 2PGBB 1FPHH 2V3OH 2AMPA 3SUEA 3K6ZA 2ZHDA 2SGAA 1LHEH 6CHAC 3F9EA 4TYDA 3RMNH 1D6WA 1CT4E 1LPGB 3M3VA 1SGRE 2XBVA 2HALA 3F6UH 4ZH8A 1MCTA 1HJ9A 4IBLH 2FI4E 3VB5A 2BZ6H 2ILNA 1LPKB 2A4RA 2ZF0H 2Y5FA 1GMCF 3NPSA 2BYAX 2W5EA 4X2YA 2FMJA 1MD8A 2HNTE 1CBWC 2JETC 2XNIA 1XUFA 3GY8A 1S82A 1C5LH 3ZZ7A 1ZHRA 2F83A 4B73A 1C4U2 4OS1A 4OS4A 1L4ZA 2VVVA 1FPCH