1ELCA

Analogous inhibitors of elastase do not always bind analogously
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ELASTASE
publication title Analogous inhibitors of elastase do not always bind analogously.
pubmed doi rcsb
source organism Sus scrofa
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1993-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elcA01
2FTMA 1O32A 5EXLA 6CHAB 3MU8A 2ASUB 3PMBB 1RGQA 2FWWA 4CRFA 1PYTD 3GISB 1DDJA 1HJAB 3BF6H 4JZIA 2V3OH 4LK4A 4NIWA 4A92A 4NA9H 2Y7ZA 1QGFA 3DT0H 3OY5U 3VB5A 4YTAA 1TX8A 1K1PA 2XC0A 1O2MA 3LIWA 1UO6A 1HBTH 4Q7ZA 4ZKRU 3SI3H 5E0HA 1AE5A 3RXKA 3SW2B 2G4TA 2PKSB 3HKJB 4ZROA 4FUHA 4J2YB 3DUXH 2JH6D 3TNSA 4GSOA 4FU8A 1GMDF 2ZU3A 1AE8H 4XOJA 3A81A 4FU9A 5FCKA 3SUFA 1QJ7B 1THRH 4JCNA 1D6RA 1IQJA 5DP4A 4CRDA 4BAQB 2OQUA 2GV7A 3PLBA 1C5OH 1LMWB 1C9TA 2WINI 4RN6A 5DP9A 1OWJA 1O2ZA 2XBVA 1O2NA 1SVPA 3LGVA 2GCHG 4K1TA 1V2ST 2BOHB 1PFXC 3ATWA 4YOIA 2Z9KA 3RDZA 1QA7A 2EEKA 1LHGH 1DXWA 1F5KU 1XKBC 5A8YA 1B5GH 2QY0B 2SGPE 2Z9LA 1AUJA 1LVYA 2ODYB 2OC7A 2BD8A 1YPMH 3GCHC 3KQEA 2C8YB 3C1KA 1HFDA 1SFIA 1HXFH 1O2SA 5H4IB 1LPKB 1SLUB 4X2YA 2F9OA 3RXIA 4LZ1H 3VXEH 4X8UH 3TH4H 1YLCA 3B23B 1Z8GA 2Y81A 2WPKS 4GVUA 1HYLA 1BTWA 1FONA 2LNCA 3NXPA 4I8LA 2JKHA 5C5NA 3BG4C 1FDPA 2A4QA 4U01A 2BX3A 4M7GA 1NN6A 4WY3A 5T6GA 1GBIA 1AO5A 1ARCA 1WCZA 3DFLA 1H9HE 4LOYH 2FP7B 1O37A 2NU3E 3K6YA 1GPZA 1P03A 3VB3A 2CJIA 2ZTZA 1GHVH 4FVBA 5HYOA 1T8NA 2VNTA 3MO6A 1PPFE 3HK6B 4QT8C 4FUGA 1N8OC 4O97A 3MI4A 3NPSA 1C5XB 4Y0ZE 2TPIZ 1O3AA 1TGNA 3P92A 4INHA 4IN1A 1BCUH 1Y5UT 3PO1C 1V2PT 1CT0E 1EPTA 1HJAC 3P6ZB 3UTUH 5L6NH 4RSPA 3NK8A 1ZPBA 2BDBA 2ZKSA 2PTCE 1AI8H 5FBEA 4UFGH 1BMMH 2XBWA 1JRSA 3A7XA 4JK6A 1P2QA 1DWBH 2EC9H 1YC0A 3H7TA 1THPB 2BLQA 4X0WU 3UUZA 3MYWA 1O3IA 1KXCA 4FVDA 1ETTH 1ZSJA 3EA8A 5DK1A 1ACBE 4CHAB 1QBVH 2P3TB 2IN2A 3CS0A 3OU0A 4DG4A 1C2GA 2Y5HA 4B71A 3W94A 1TA2A 1BUIA 3T5FH 1P05A 1C1QA 2Z9GA 1QB6A 3CENA 3B8JA 1C9PA 5I46H 3KIDU 4CREA 1QURH 7GCHG 1KXFA 1YYY1 2BY5X 3SUEA 5JBTA 3RXEA 2ZHEH 3MMGA 4NZQA 5ESBA 1ID5H 2ZCHP 2GDDA 2ZFRH 2VGCB 4YO9A 1U6QA 1ELGA 3ENSB 2ZF0H 3QDZB 2BDYA 1MZAA 1ESTA 1SLVB 5A0CA 4JZFH 1S81A 3E90B 2H9EH 1DY9A 2EI7A 2G81E 1YCPM 2BXUH 3MTYA 4GHQA 2ZGJA 1EZSC 5JBCS 4BAHB 3A80A 2WUBA 5JPMH 2WUCA 1GWAA 3O8CA 2H9TH 3Q3XA 1TNJA 3P95A 2ZHWH 1EP6A 2OXSA 1DITH 5C5OA 1GI2A 3SNAA 4JZ1A 1V2NT 1YF4A 1C2DA 3GYMA 3UY9A 4I33A 2A31A 1ORFA 3UNRA 4X1NU 4Y7BA 1SI5H 3SBKA 1S6HA 2BB4A 1O3PB 2F9BH 3QGNB 1C2LA 4CRGA 4WMDA 2R2WU 3SU6A 1EATA 2GT8A 5FX6A 1C1WH 2XCNA 3ZVBA 4O9VA 1MKWH 1WAYB 1QRXA 4HI3A 2BDAA 1SOZA 1B7XB 3A86A 3UNSA 1NRQH 3UR6A 4Y7AA 4BXWA 1TFXA 1O31A 1OKXA 2A0QB 2ZGCA 3A87A 1N1LA 1P57B 1T31A 2XWBI 3TU7H 2C3SA 1MKWK 3FAOA 5DJ7A 1O38A 1ZOMA 1RTKA 1E34B 1W0YH 1Y3WA 4NWKA 1H9LB 4WF8A 2PWXA 5EXNA 4X1PU 1TX7A 3NZIA 4ZKOU 1ZYOA 1BITA 3QN7A 4AN7A 2AS9A 3U8RH 4XBCA 4D76A 1A0LA 3MU0A 3IITA 3V3MA 3IWMA 1UJ1A 3RC4A 3SGQE 1C1SA 5BRRE 1AWHB 3M7QA 1UK4A 3OYPA 3SU4A 3FP6E 5CMXH 4X1SU 2QXJA 2AMPA 1O3OA 4CHAC 1K22H 4WVPE 1JRTA 4WMFA 3ZZAA 1IQKA 4RKOB 1SLXB 1MMJN 2WPIS 1AMHA 3S7KB 2OBOA 5EXMA 3S0NA 5AF9H 3F9EA 1GG6C 1EQ9A 2GDEH 3RXUA 2D8WA 4DIIH 1X7AC 1ZRBA 4CBNA 2G4UA 4ESTE 2J92A 1OP2A 4Y8ZA 5FAHA 4ZXYH 3CS7A 1GHZA 4JK5A 3DHKH 5A8ZA 1TBRH 3NUMA 1ZHMA 1WSSH 1OWHA 3MNXA 1MCTA 5EQSA 3H7OA 4IN2A 3SUDA 2P94A 1E37B 2FM2A 2WYGA 1RTLA 2O8LA 1AB9B 5F8ZA 3E1XB 4OS6A 1OP0A 3BTQE 5EQRA 2SGFE 4X2XA 1QIXB 2C90B 1BMAA 2FOCA 1MQ6A 2ESTE 4DURA 1F5RA 1G30B 3SHCH 5JB9S 3ATIA 1UK2A 1FIWA 5TCCA 3EE0B 2BLOA 4ISHH 1C5MD 2ZQ2A 2B0FA 3QO6A 2AMQA 4E06H 6ESTA 3MFJA 1LTOA 4E05H 3VGCC 4KKDA 1KLTA 1MKXH 5JB8S 5CE1A 2M5TA 1O2HA 5EOKA 1HUTH 2SGDE 1GVZA 3RMLH 2BQ6B 1G3BA 1PPEE 2VIPA 2UWOA 4IBLH 1W3CA 3E0PB 4XE4A 3SOSA 4Y76A 2QV1A 1J16A 1K1NA 3Q3KA 4WXVA 2ZEBA 1UTNA 3U9AH 2GGVB 4WJG2 2Z94A 1EB1H 5L30H 4AYVB 3MU4A 2FOGA 3A8CA 1T4UH 1C5SA 1FY8E 2PKAB 4NG9H 1C5VA 1ESAA 4DOQA 1P10A 1ZMLA 3QWCH 1UHBB 1PQAA 1O5GH 1WTHD 3SQEE 1DSUA 2VVVA 2H5CA 1ANEA 4DVAU 1KLJH 1G2LA 1GI3A 1BQYA 1AZZA 1LPGB 3SJIA 3SN8A 1Y5BT 1OXGA 1TAWA 1GJ7B 2C8ZB 4K3JA 4A1XA 4YM9A 3SV2H 2OBQA 2W7UA 2BY7X 4TYDA 1KTTB 3PTBA 4ZH8A 2GCHF 1UTJA 5F03A 2Y80A 4FUCA 1P9SA 1O5DH 1L2EA 1GHYH 3LGYA 3Q3YA 3O8RA 4ISIH 4B74A 2V0BA 2PLXA 1RIWB 2Y82A 1V2OT 3RXJA 1ZGVA 1EOLA 1NM6A 1UTOA 1VJ9U 4ISOA 1AB9C 3RXQA 4B2CA 2ZP0H 1ZPCA 3NKKA 1O34A 2Y5GA 3A88A 1B0FA 1TRYA 1GVLA 1ZMNA 4FUEA 3D49H 3JZ1B 1GJ9B 4X1QU 3ZZ7A 5EGMA 1N6XA 1G2MA 3PLPA 5EQQA 3BTFE 3UREA 1EAWA 3E91A 4INLA 1H8IH 1GDQA 1O36A 3RM0H 1GBBA 1GL0E 1ZR0A 1F7ZA 2QA9E 1TABE 1PJPA 2G52A 3PLKA 4B2AA 1BJUA 1H8DH 1OYTH 2OTVA 1T8OA 5DKMA 3K6ZA 4Q80A 1EJNA 4AFSA 2BDHA 2ODQA 1SPJA 3SO3A 2FEQH 1O2LA 2HPPH 1BDAA 2FTLE 1O3LA 3RXFA 1EKBB 1G9IE 4OS2A 1O2YA 2J95A 3KHVA 1AZ8A 2QF3A 3GY2A 1JXPA 1G3CA 1ELVA 2PR3A 2BHGA 2Z3EA 4U32A 2R2MB 2FS8A 4YESB 2A5IA 4FUFA 2FPZA 1QHRB 3M3VA 1CE5A 1XUKA 1A4WH 5EW1H 4TWWA 4I8GA 3V12A 1O5FH 4K69A 1ARBA 3FZZA 4IMZA 3BTGE 3OX7U 1TOCB 1GHWH 3P8FA 1C2HA 4YOJA 1FPHH 2FDAA 4BANB 1Z8IB 3R3GB 1O5AB 2FOMB 1Y5AT 1QTFA 3M3TA 5EPNA 3M5MA 2XW9A 2ZNKH 3PMJA 1DS2E 3A8BA 4B75A 5JBBS 5J4QA 2XXLA 1V2TT 5J4SA 2ZDAH 3KN2A 3RC5A 1OOKB 3M3SA 3UIRA 3ZVDA 1MTWA 4ZMAH 1GVKB 5E2OA 1BBRK 2A1DB 2NU2E 1QY6A 3MNSA 3T29A 3UOUA 2UUJB 4NFEA 3S9AA 2A2QH 4BAKB 1A3EH 4NFFA 4INKA 4OS5A 1P3CA 4X6PA 1NESE 1OWIA 2FMJA 3V13A 4VGCB 4NA7A 1HCGA 4K60A 1RIWC 5E0JA 1GMCG 3RXDA 1F92A 4K5ZA 2QXGA 1TLDA 3RXVA 2JETB 3TJUA 3L33A 4R0IA 1WQVH 2D2DA 1NRNH 2BD4A 1BTUA 1OX1A 1SGPE 3ZZ9A 4HTCH 2ANKH 2FYQA 3MU1A 2YNAA 2J38A 3CP7A 3VB4A 1O3KA 2TGDA 1F5LA 1ABIH 1Y3YA 4ABJA 2PFEA 2CN0H 1C2MA 1DWCH 1XM1A 2A4OA 1SB1H 1ELTA 2BY9X 3LJJA 4R8TB 4WXIA 1UTLM 1RTFB 1CU1A 2RG3A 2FLRH 1A5GH 1HRTH 4WH8A 4ZHLU 5C1XA 1K28D 1HB0B 1BZXE 1XVOA 1BRUP 1O3HA 4GLYA 1P2NA 1GI5A 4X8SH 3LPRA 3IG6B 3TJVA 1KTSB 4JMYA 1NFUA 1AFQB 1N6YA 4AB8A 5G4BA 3BG8A 2ANYA 2FO9A 4CR9A 2VWNA 1CA0B 4YT7H 1W10U 2BDCA 1EZUC 1GI4A 1HJ9A 4E7NA 2ZGXH 1TNIA 4D7GA 3LT3A 2XCFA 1HAOH 4UFFH 2BD9A 3GYLB 1EJMA 1MTUA 1AFEH 2P16A 1YPKH 1O2GH 3SV8A 5DG6A 4NSVA 6GCHG 4GCHG 3A84A 3MH7A 1FZZA 1DVAH 2ANMH 2YOLA 1FMGA 2CHAC 3VB6A 1CBWB 1SGEE 5LGOA 1AHTH 3MO3A 2BVRH 5AVDA 4SGAE 1QRZA 6LPRA 4U30A 4Y8XA 3ZV8A 1L0ZA 4F4OC 1RXPA 4K8YA 3KNXA 5K0HA 2J94A 3S9CA 2ZPRA 4XDEA 2FOFA 1EAUA 5CHAB 1NC6A 3PYHA 3HKIB 1SR5C 1GBJA 1L1GA 3E8LA 1V2WT 2A2XH 2RDLA 4JYVH 1C1PA 3U98H 3DD2H 3E6PH 2SNWA 1HAIH 9ESTA 3UFAA 6CHAC 3A85A 3URDA 1PPCE 1TMTH 3B9FH 1O30A 5LH8A 3H5CB 1EPTB 3UQOA 1VGCB 2NU0E 3A8DA 2BXTH 5TCAA 1YPGH 3M7UA 1V6DA 2ULLA 5IYTA 4GPGA 2Q1JA 2VINA 3A89A 2PKSC 2ZZUH 1GGDB 2A7JA 4H4FA 1SQOA 1UK3A 2VWOA 3HK3B 1AY6H 2GCTB 1TMBH 1DT2A 4O3UA 1NROH 2QIQA 1VITH 3RXGA 2ZU4A 3RXBA 3VXFH 1HLTH 3P8OA 1F2SE 1CHOG 1Z7KA 1SGQE 1Q2WA 1C5UA 1PPGE 3A7YA 1K1JA 2ZC9H 4O3TA 3GY3A 4X2WA 4K1SA 1HAYB 2BMGB 4A6LA 2KAIA 2FOAA 1S0RA 1ELFA 3EA9A 1O2TA 4B76A 2OUAA 4HFPB 1AFQC 1TBQH 1BOQA 1VZQH 3A7WA 3PV4A 5AFYH 1EJAA 1QA0A 1ELCA 1CA0C 1K1OA 3UOPA 1D3DB 1K1LA 4AFQA 1BIOA 2A45B 4WMEA 1EP5A 3DFJA 4X1RU 4K8BA 3F9GA 3RXTA 2R3YA 4GUXA 4NSYA 1H9IE 3FFGA 4H6SB 1SG8B 5DP6A 1NY22 2UUKB 4JYTA 3MOCA 1HAHH 1HAZB 1MBQA 5ESTE 1PPZA 1GBKA 3M7TA 1KY9A 2RCEA 3T2NA 1FLEE 1HGTH 2ALVA 2FI3E 2F9UA 5FHTA 1O3BA 1A0JA 1NRSH 2EA3A 1GCTB 3PMAB 4IW4E 3GCTF 3TVJB 2HNTE 2EI8A 1SHYA 1QL7A 1W7GH 2AH4X 1QFKH 2YNBA 4O03A 1T8MA 2QAAA 2DUCA 4KP0A 3F9HA 3RMOH 2B7DH 2BDIA 1FN6A 4K2YA 4NIXA 5DP3A 1LVMA 1F0SA 1O2KA 5F6MA 4YLUA 2VVUA 3K9XB 3P8NA 1CT2E 1TQ0B 4I32A 4BTTB 2WV5A 1EXFA 2F9NA 1D3PB 1O2IA 2A4RA 1V2RT 2H2ZA 2CGAA 2ZU5A 1EPTC 3PWBA 1UTQA 4ABIA 1NFXA 2H6MA 1FJSA 7KMEH 2TGPZ 4H42U 4IS5A 1W7XH 1EOJA 2OC0A 1O2QA 5SGAE 1A5IA 2A7CA 5GJ4B 2HVXA 1AVGH 1W12U 5C20A 1K2I1 1XXFA 3GCNA 1O3FA 4NZLA 2OP9A 2GCTC 1OWEA 1MTSA 1E38B 5DPAA 5GXPA 1JIRA 1IQMA 1YPHC 1NU7B 1MD8A 2I6SA 1KXDA 3M5NA 1SGRE 1AIXH 3UR9A 4AORA 5DP5A 1GJ8B 5DGJA 4X2VA 2GT7A 5C1UA 2PHBA 3C27B 1G37A 2ZU1A 3JZ2B 3RXOA 4AYYB 1HIAA 1HIAB 2ZDKA 3SHAH 3HGNA 2FIRH 3RU4E 4X6OA 2GMTB 3MHWU 4OS7A 4U2WA 2C4FH 1KDQB 1KDQA 2XBXA 1AUTC 2H9HA 1W0ZU 3STJA 5I25A 1H1BA 1E35B 1TRNA 1ZSKA 3AW1A 4BXSA 2FYRA 1TE0A 1FN8A 2WPJS 2VGCC 1HAGE 1IQHA 3FP8E 1P09A 1CGIE 1ELAA 5GPIB 2EI6A 4MG3A 1BBRE 1UVOA 2HNTC 2Q6GA 1GI7B 1OWDA 1DY8A 1YPJH 4KTCA 4YT6H 2TGAA 4Z0KA 2J4IA 2PUXB 5ABWA 1TB6H 1B0EA 3RLYH 3LC5A 1Y59T 3SUGA 2R0LA 3SJOA 1VCPA 1EX3A 1IHSH 2RA0A 4K1EA 1Y8TA 1CSOE 1YGCH 3U8TH 4D9RA 4TPYA 1GCDA 1GMHG 3ZZ3A 1GJ4H 1ZPZA 2VIOA 2ZFSA 1RD3B 5FX5A 1A0HB 2V6NA 3VPKA 1C4V2 3SJKA 2VIVA 2HOBA 1A5HA 1TPAE 2GTBA 3BSQA 3TGJE 4D7FA 1AQ7A 2FS9A 4CBOA 2NU4E 2GZ7A 2BOKA 2FXRA 1C1MA 1CT4E 3RXSA 2GV6A 2STAE 4I8JA 1C2FA 3I78A 1K1IA 3SI4H 2A7HA 5EG4A 5JDUB 1Z6JH 1C5NH 3Q76A 3TGIE 5L2ZH 5A2MH 3SU0A 1Z1IA 1GMCF 1H4WA 3LGIA 2BTCE 2XYAA 1AN1E 1MZDA 1MKXK 1UVSH 1LPZB 3SU5A 1HDTH 1FXYA 3LKWA 3P70B 3MH5A 1TGTA 5A8XA 5K7RA 3LGUA 5T6DA 1C5RA 1CHGA 2TIOA 2TBSA 4OGXA 5HXFA 4XBDA 2HGTH 1C1RA 1T4VH 1SGIB 3EQ0H 3RXPA 3UWIA 5AFZH 3TIUA 3BTHE 3HPTB 3PM3A 4IC6A 1NS3A 3P17H 5DP8A 3LU9B 1D3TB 2PSYA 2AGIX 2TGTA 2C8WB 2OLGA 4FXGH 1P12E 1VITG 1BTYA 1MQ5A 4I8KA 4ABHA 3U1JB 1ELDE 2WYJA 4WWYA 1JIMA 2P8OB 1SGFA 5A09A 1ABJH 3MO9A 1O3MA 1YCPH 2F3CE 2O8WA 4IC5A 1TBZH 4ABGA 3BEFB 3S69A 1T7CA 1JWTA 4NWLA 4ZUHA 2ZPSA 1T8LA 1O3NA 3GY5A 3LH1A 2ZCKP 4B1TA 3GCTG 1V2LT 5DP7A 1O2PA 3Q00A 1YCPK 1LVBA 2GMTC 2F91A 2VIWA 5AHGH 3MU5A 1EASA 3SJ9A 3ZVCA 3SV7A 1VCWA 1SQTA 1J17T 1DPOA 3LGWA 1A1RA 1PQ7A 4MQAA 4HZHA 3URCA 3ODDA 2ODPA 5EPYA 1QR3E 5TJXA 4DIHH 3A82A 3TPIZ 4X8TH 3F6UH 2FOEA 2ZO3H 1C4U2 1TNGA 1UCYH 1XUGA 4Y11E 1D4PB 1S5SA 1EB2A 3ZZ5A 2Z6BD 4AGJA 6GCHF 4GCHF 4ZKSU 5A0AE 1BTXA 2AMDA 1Z1JA 2BD2A 2J2UA 1SFQB 1UCYK 1EUFA 2BQWB 1HV7A 1C5ZB 4ABAA 4FUIA 4KTUA 3O8BA 1GL1A 1QL9A 1TNKA 3AVZA 1ESBA 1GHXH 1ZZZA 3GDSA 4A1VA 1DM4B 4Q7YA 5ETXA 4GAWA 1D9IA 9LPRA 3EYDA 4I31A 2VIQA 2ZHDA 2GZ8A 2OC8A 4BTIB 3SU1A 2AIPA 3V7TA 2AGGX 4AB9A 1DICA 1TMUH 3EAJA 3VFEA 1BMLA 3FZDA 1IQNA 1YLDA 1FNIA 5FPSA 1O2RA 3FP7E 2FX6A 3ITIA 1W11U 2SGQE 1E0FD 1MAYA 1W13U 2QGRA 4Y71A 1SGTA 1HAVB 1HAVA 1FY4A 1W8BH 2BZ6H 1DLEA 2HNTF 4UFDH 1O35A 3K65B 5LPFA 1TPOA 5E2PA 1GBMA 1IQEA 2XNIA 4AG1A 4NA8A 1GBFA 1TPPA 2A5AA 3BTEE 2LPRA 1AVXA 3ZVFA 8GCHG 1C4Y2 1YKTA 4CRAA 1P2JA 2HPQH 4JZEH 3SGBE 3GOVB 1S6FA 4DCDA 3SGAE 1F0RA 1BT7A 1V3XA 1ELBA 1GJBB 4UEHH 4BAMB 4NIVA 1SQAA 1F0TA 2R3UA 1V2UT 1ZJKA 4CH2B 2Z3DA 5E8EH 3T62A 2QN5T 3EGKH 3GCHB 1CHOF 4LXBH 1ANDA 4CR5A 1FAXA 1P2OA 3RXCA 3SU2A 1UTKA 2F9VA 1G32B 1GHBF 1SSXA 1KYNA 3RMNH 2SNVA 3RU4T 1QRWA 1QJ6B 4TY7A 2ZFFH 2ZDVH 4ZKNU 1ETRH 3TK6A 2XBYA 2PW8H 1HXEH 1GHAG 1TPSA 2BX4A 1C5QA 2P59A 2QXHA 5B6OA 1SHHB 1SGCA 1P01A 1BRBE 1HPGA 4MNYA 3AASA 5C2ZA 1RRKA 2ZCLP 1NTPA 4OGYA 1S84A 5FBIA 4UFEH 3MH6A 1IQGA 4IMQA 2FX4A 2VJ1A 2UWPA 2G8TA 4A5TS 1BMNH 2CF9H 1YP9A 1DX5M 2V35A 3EA7A 1NU9A 2SGAA 1QBOA 1DWDH 1KXBA 3PO1B 1G3EA 4Y8YA 1MD7A 1GBAA 1RFNA 3A8AA 1P2IA 3ZVEA 4H6TA 4MDSA 1C1NA 1J8AA 3A7VA 1FPCH 3WY8A 5EODA 1FY3A 1XKAC 4DT7B 2G51A 3QZQA 5GIBA 1KSNA 1TA6A 2V3HH 4MNWA 1GI0A 1O3DA 4DJZB 4DY7B 1A2CH 1IQIA 2NU1E 1C5WB 1GI1A 5JBAS 1PQ8A 2ZPQA 1Y3UA 1ZHRA 2Z7FE 1OYQA 2TRMA 1V2VT 1GI8B 2ZFTA 4B73A 2FODA 4ZXXH 3PTNA 2C93B 4CRBA 2P3FH 3GY7A 1L4ZA 3GDVA 4XFQA 1YPLH 3U1IB 3AAVA 1QJ1B 2A5KA 1QCPA 1DLKB 1DE7H 2VU8E 3LJOA 1TWXB 2ZHQH 1C2KA 1LKAA 3QTVH 4AOQA 1A61H 2PTNA 2ALPA 1GI6A 1P2KA 4Y6DA 3RP2A 2J34A 2QCYA 3BV9B 1UVUH 4Y79A 4UDWH 1KIGH 3PB1E 2QC2A 2Y7XA 3DA9B 3NCLA 2CMYA 1O2UA 1O39A 1CVWH 3L3TA 2GKVE 1BTHH 2VIDA 1TNHA 3U8OH 2FESH 2DE9A 1EAIA 1LQEA 1WBGB 5L2YH 2W7SA 4TPIZ 4MNXA 1HNEE 4ISLA 1O2WA 1DWEH 1INCA 2BVXH 1XXDA 2Q6FA 3MH4A 4MNVA 2OCVB 1L1JA 2ZECA 1TQ7B 2O9QA 3GY6A 3TLOA 2VB0A 5GWZA 1O5BB 1CQQA 3ATMA 1O5EH 1JOUB 5GDSH 1GJCB 4Y0YE 4VGCC 1ZMJA 1C2EA 3RXHA 2HWLB 1S83A 3SORA 1PYTC 2B8OH 7ESTE 3N7OA 1A3BH 3ZYEA 1E36B 1UMAH 1UVPA 1W14U 1ZSLA 3BEIB 2O8MA 2JETC 8KME2 1YPEH 3KL6A 2P93A 4KELA 2WPHS 4JZDH 1ZRKA 3E3TA 1OP8A 1Q3XA 3ZZCA 1NZQH 1GJ5H 4X6MA 2AFQB 1MH0A 3SQHE 1ZHPA 1QB9A 1GMHF 2BD7A 3AW0A 1IOEA 1QNJA 3D62A 3G01A 1P0SH 1BTPA 1XVMA 3QGJA 3MNCA 5FPTA 3UQVA 3LDXH 2PSXA 4Z6AH 1MU6B 1WOFA 2AERH 4A7IB 1WQSA 1DFPA 5GCHG 1FV9A 1P11E 3F68H 4WH6A 1MBMA 1BB0B 1GHBG 5HM9A 2KAIB 1TGBA 4AG2A 2THFB 2W26A 2UWLA 1BHXB 1K1MA 3K2UA 3SV6A 2ZDMA 1M9UA 2FI5E 1O2XA 5F8XA 4LZ4B 5HM2A 8LPRA 1GG6B 1MTVA 4FUJA 1YPHE 2STBE 1BJVA 4ABDA 2ZU2A 4E7RG 3RXMA 4YLQH 1V2QT 4FU7A 2UUFB 3RLWH 3U69H 1Z8RA 4X8VH 7LPRA 3R0FA 3SNEA 1VITF 1HAXB 1P3EA 1DXPA 8ESTE 5A0BA 3KQDA 3OSYA 1GJ6A 1RJXB 1ANCA 1ANBA 1CBWC 1Z6EA 3SNDA 2WPLS 3BIUH 1L4DA 2G00A 1LCYA 3BTTE 5DO4H 4Q7XA 1FY5A 1UCYE 3ZZ8A 3BTKE 5FXLA 2BLWA 3T28A 1FIZA 1HAPH 1ELEE 2BYAX 4I7YH 1QL8A 4MLFB 1S0QA 2ZTYA 1SOTA 5CHAC 1Q31A 3TK9A 3LC3A 2ZDLA 1NFWA 4RKJB 1Y3VA 1IQLA 1GMDG 2PGQB 1GDUA 2QXIA 5FPYA 1XUFA 4X6NA 3E16B 1K21H 1CO7E 2BDGA 4FUBA 1C5PA 1AWFH 1O2JA 3E0NB 1F0UA 1O2VA 3ESTA 1DSTA 3SNCA 2AYWA 3VGCB 1D3QB 2JH5D 5HGGA 1VGCC 3EDXB 2ZG0H 2PGBB 1GDNA 3RXLA 1BA8B 1MAXA 1S85A 1QBNA 2Z9JA 1S82A 4TWYA 2BD3A 5E0GA 3RXAA 4DGJA 3S7HB 1GBCA 2AGEX 1C5LH 1GGDC 3HGPA 5EU8A 1VCQA 1TONA 1QQ4A 1TOMH 1XUIA 3D23A 4ABFA 3GY4A 3KCGH 1EZXC 4MPWA 2HLCA 3UNQA 3QLPH 3OY6U 1A46H 1P9UA 1UTPA 2OD3B 3RU4D 1CA8B 3NWUA 2GP9B 2GX4A 2HALA 3LGTA 3KQBA 3UPEA 3T26A 3MNBA 1FY1A 3BIVH 4Q2KA 3BTME 1O0DH 4AFUA 3O8DA 1C5TA 2FLBH 1JMOH 1WYKA 3LH3A 1ZTKA 1UTMA 1KXAA 2FI4E 4AX9H 3ZVGA 5HMAA 1FQ3A 1IAUA 1UVTH 1GI9B 3ZVAA 1JBUH 4UONA 2QYIA 1LHCH 1SL3A 2Q6DA 4D9QA 1EAXA 4XSKU 3QTOH 8GCHF 1TX6A 2C8XB 2ILNA 2XWAA 2ZGHA 4MPXA 4DW2U 1MU8B 2W3KA 1O3GA 4ZAEA 1MTNB 1LDTT 3QX5H 4I8HA 1GBEA 1DUEA 3RUOA 5FCRA 1SGDE 1AD8H 2BQ7B 4KTSA 4BAOB 1TALA 3BEUA 2ZTXA 1SGYE 1Z71A 1Z8JB 2ZFPH 1FI8A 1PPHE 2ZA5A 2Z3CA 2G5NA 1NT1A 2JH0D 2ZWLH 2D1JA 2CV3A 1KLIH 3ZYDA 3RC6A 2XC5A 2AEIH 1SGFG 1GJAB 4XBBA 2OINA 2ZHFH 1BRAA 4UE7H 1RS0A 1TIOA 1L1NA 3QUMP 5PTPA 1XUJA 2GZ9A 1GCTC 1DOJA 1WU1A 4GHTA 1C1OA 1WUNH 3A7ZA 4OS4A 2ZGBH 3SU3A 1OWKA 1GHAF 2IPHA 1YM0A 3ZZDA 3TGKE 3GICB 3RXRA 2ZIQH 4TY6A 4BTUB 4MPVA 2GD4B 2O8TA 3AAUA 2NWNA 1O3JA 1TGSZ 1O33A 3TK5A 1LHFH 2A32A 3F9FA 3KGPA 1A7SA 3A83A 5LPRA 1PPBH 2G55A 3STIA 2H5DA 1TYNA 2H1UA 1SGNE 1GBTA 2SGEE 1J14A 1LVOA 1P02A 2VH6A 2W3IA 2Y6TA 3M35A 1LO6A 4ZHAA 3W95A 4Y10E 4IGDA 2I6QA 3VB7A 1GBDA 1HJ8A 3QZRA 1SMFE 2VVCA 4AZ2B 3M5LA 1TRMA 3GCOA 1ZJDA 1LKBA 1XX9A 3GDUA 3SNBA 3BN9A 1T32A 1CGJE 1AU8A 1FAKH 1GBLA 1P04A 3F1SB 2ZQ1A 3PROA 4MTBA 3RMMH 5EW2H 5F8TA 2ANWA 2K1QA 3BTDE 1C2JA 1THSH 4THNH 3TH2H 1V2JT 4NCYA 2D26C 1NO9H 2R0KA 2P95A 2PKAA 5T6FA 3I29A 2O8UA 2Z9IA 1UHBA 1XUHA 1OPHB 1WV7H 3ZZBA 4BNRA 1NRPH 4YZUA 5LPEA 3TITA 2SFAA 1AVWA 1GBHA 3ZZ4A 4AFZA 3KF2A 4KGAA 4BOHA 4OS1A 1KXEA 2RA3A 1QQUA 2FZZA 2CXVA 1J15A 2UUYA 2G5VA 2ZFQH 1BTZA 1MTNC 1LHDH 2VWMA 3ELAH 4NIYA 1O3EA 2OC1A 3VEQB 1NRRH 3RM2H 4A1TA 2VH0A 1C2IA 2ZI2H 1O3CA 3LOXA 3M61U 4HGCA 1OSSA 3TJOA 2XC4A 1VJAU 2Y5FA 4CRCA 2IOTA 3LONA 3TJNA 1SLWB 4B2BA 1XMNB 2A4GA 4ISNA 2DE8A 1CGHA 1LQDB 2P3UB 2BVSH 1O5CB 1C1VH 1ETSH 1IHTH 5JYIA 3TNTA 2R9PA 4FUDA 5C3NA 4PROA 1ZTLA 2FOBA 1OS8A 1C1TA 2FOHA 2B9LA 1BHXF 4ABEA 1O2OA 3MWIU 1K9OE 1AGJA 1P06A 3T25A 4MPUA 5IDKA 4MVNA 3GY8A 4SGBE 3V0XA 2HRVA 3PWCA 1P8VC 1DANH 2XTTB 2WV4A 2AIQA 4AGKA 3I77A 4NGAH 1ZLRA 1EZQA 3Q77A 3PMHB 3ATLA 1GJDB 3M5OA 1V2MT 3SZNA 3ODFA 5BPEA 1VR1H 2CF8H 1MUEB 2F9PA 3A7TA 2OQ5A 2ZDNA 4F49A 2BLVA 1NPMA 3M36A 1G3DA 1LHEH 1YBWA 2BD5A 2BM2A 4YOGA 2WPMS 3S9BA 2QF0A 3KQCA 2IJOB 3SJ8A 2PUQH 2F83A 5T3HA 1SC8U 2B5TB 2VWLA 3FANA 3TH3H 1SBWA 4ZHMU 1FUJA 2P8OC 1Y3XA 4J1YA 1NFYA 2BY6X 3D65E 1TNLA 5GCHF 2W5EA 1DUAA 3BTWE 4D8NA 1ZTJA 3ATKA 1J9CH 5C1YA 2CHAB 2GVFA 3UWJH 3ZZ6A 4ASHA 1C1UH 3SV9A 1ZGIA 3OTJE 1TGCA 3HATH 1IQFA 1AKSB 1AKSA 3BG4B 1PQ5A 3FVFB 1W2KH 2BZAA 1C5YB 2BY8X 4ABBA 4UD9H 1BRCE 3P8GA 1BBRH 1QB1A 1V2KT 2XRCA 4CH8B 7GCHF 3M37A 1G36A 4JYUH 1MCVA 1WTGH 3L6PA 2J9NA 1D6WA 3KEEA 1P2MA 3ZV9A 5C67A 2PV9B 3QK1A 3T27A 1N8OB
chains in the Genus database with same CATH superfamily
2FTMA 1O32A 5EXLA 6CHAB 3MU8A 2ASUB 3PMBB 1RGQA 2FWWA 4CRFA 1PYTD 3GISB 1DDJA 1HJAB 3BF6H 4JZIA 2V3OH 4LK4A 4NIWA 4A92A 4NA9H 2Y7ZA 1QGFA 3DT0H 3OY5U 3VB5A 4YTAA 1TX8A 1K1PA 2XC0A 1O2MA 3LIWA 1UO6A 1HBTH 4Q7ZA 4ZKRU 3SI3H 5E0HA 1AE5A 3RXKA 3SW2B 2G4TA 2PKSB 3HKJB 4ZROA 4FUHA 4J2YB 3DUXH 2JH6D 3TNSA 4GSOA 4FU8A 1GMDF 2ZU3A 1AE8H 4XOJA 3A81A 4FU9A 5FCKA 3SUFA 1QJ7B 1THRH 4JCNA 1D6RA 1IQJA 5DP4A 4CRDA 4BAQB 2OQUA 2GV7A 2QF5A 3PLBA 1C5OH 1LMWB 1C9TA 2WINI 4RN6A 5DP9A 1OWJA 1O2ZA 2XBVA 4F48B 1O2NA 4I86A 1SVPA 3LGVA 2GCHG 4K1TA 1V2ST 2BOHB 1PFXC 3ATWA 4YOIA 2Z9KA 3RDZA 1QA7A 2EEKA 1LHGH 1DXWA 1F5KU 1XKBC 5A8YA 1B5GH 2QY0B 2SGPE 4P02A 2Z9LA 1AUJA 1LVYA 2ODYB 2OC7A 2BD8A 1YPMH 2JJ2D 3GCHC 2C8YB 3KQEA 3C1KA 1HFDA 1SFIA 1HXFH 1O2SA 5H4IB 1LPKB 1SLUB 4X2YA 2F9OA 3RXIA 4LZ1H 3VXEH 4X8UH 3TH4H 1YLCA 3B23B 1Z8GA 2Y81A 2WPKS 4GVUA 1HYLA 1BTWA 1FONA 2LNCA 3NXPA 4I8LA 2JKHA 5C5NA 3BG4C 1FDPA 2A4QA 4U01A 2BX3A 4M7GA 1NN6A 4WY3A 5T6GA 1GBIA 1AO5A 1ARCA 1WCZA 5HIZA 3DFLA 1H9HE 4LOYH 2FP7B 2QE7D 1O37A 2NU3E 3K6YA 1GPZA 3PRDA 1P03A 1E1QD 3VB3A 2CJIA 2ZTZA 1GHVH 4FVBA 5HYOA 1T8NA 2VNTA 3MO6A 1PPFE 3HK6B 4QT8C 4FUGA 1N8OC 4O97A 3MI4A 2YMSC 3NPSA 1C5XB 4Y0ZE 2TPIZ 3FO8D 1O3AA 1TGNA 3P92A 4INHA 4IN1A 1BCUH 1Y5UT 3PO1C 1V2PT 1CT0E 1EPTA 1HJAC 3P6ZB 3UTUH 5L6NH 4RSPA 3NK8A 1ZPBA 2BDBA 2ZKSA 2PTCE 1AI8H 5FBEA 4UFGH 1BMMH 2XBWA 1JRSA 2K8IA 3A7XA 4JK6A 1P2QA 1DWBH 3AK5A 2EC9H 1YC0A 1WDIA 3H7TA 1THPB 2BLQA 4X0WU 3UUZA 3MYWA 1O3IA 1KXCA 4FVDA 1ETTH 1ZSJA 3EA8A 5DK1A 1ACBE 4CHAB 1QBVH 2P3TB 2IN2A 3CS0A 3OU0A 4DG4A 1C2GA 2Y5HA 4B71A 3W94A 1TA2A 1BUIA 3T5FH 1P05A 1KMHB 1C1QA 2Z9GA 1QB6A 3CENA 3B8JA 1C9PA 5I46H 3KIDU 4CREA 1QURH 7GCHG 1KXFA 1YYY1 2BY5X 3SUEA 5JBTA 3RXEA 2ZHEH 3MMGA 4NZQA 5ESBA 1ID5H 2ZCHP 2GDDA 2ZFRH 2VGCB 4YO9A 1U6QA 1ELGA 3ENSB 2ZF0H 3QDZB 2BDYA 1MZAA 1ESTA 1SLVB 5A0CA 4JZFH 1S81A 3E90B 2H9EH 1DY9A 2EI7A 2G81E 1YCPM 2BXUH 3MTYA 4GHQA 5C0TA 2ZGJA 1EZSC 5JBCS 4BAHB 3A80A 2WUBA 5JPMH 2WUCA 1GWAA 3O8CA 2H9TH 3Q3XA 1TNJA 3P95A 2ZHWH 1EP6A 2OXSA 1DITH 5C5OA 1GI2A 3SNAA 4JZ1A 1V2NT 1YF4A 1C2DA 3GYMA 3UY9A 3DSGA 4I33A 2A31A 1ORFA 3UNRA 4X1NU 4Y7BA 1SI5H 3SBKA 1S6HA 2BB4A 1O3PB 2F9BH 3QGNB 1C2LA 2HLDD 4CRGA 4WMDA 2R2WU 3SU6A 1EATA 2GT8A 5FX6A 1C1WH 2XCNA 3ZVBA 4O9VA 1MKWH 1WAYB 1QRXA 4HI3A 2BDAA 1SOZA 1B7XB 3A86A 3UNSA 1NRQH 3UR6A 4Y7AA 4BXWA 1TFXA 1O31A 1OKXA 2A0QB 2ZGCA 3A87A 1N1LA 1P57B 1T31A 2XWBI 3TU7H 2C3SA 1FX0B 1MKWK 3FAOA 5DJ7A 1O38A 1ZOMA 1RTKA 1E34B 1W0YH 1Y3WA 4NWKA 1H9LB 4WF8A 2PWXA 5EXNA 4X1PU 1TX7A 3NZIA 4ZKOU 1ZYOA 1BITA 3QN7A 4AN7A 2AS9A 3U8RH 4XBCA 4D76A 1A0LA 3MU0A 3IITA 3V3MA 3IWMA 1UJ1A 3RC4A 3SGQE 5C17A 1C1SA 5BRRE 1AWHB 3M7QA 1UK4A 3OYPA 3SU4A 3FP6E 5CMXH 3F2HA 4X1SU 2QXJA 2AMPA 1O3OA 4CHAC 1K22H 4WVPE 1JRTA 4WMFA 3ZZAA 1IQKA 4RKOB 1SLXB 1MMJN 2WPIS 1AMHA 3S7KB 2OBOA 5EXMA 3S0NA 5AF9H 3F9EA 1GG6C 4XRNA 1EQ9A 2GDEH 3RXUA 2D8WA 4DIIH 1X7AC 1ZRBA 4CBNA 1VKYA 3DCLA 2G4UA 4ESTE 2J92A 5DN6D 1OP2A 4Y8ZA 5FAHA 4ZXYH 4RI0A 3CS7A 3F3BA 1GHZA 4JK5A 3DHKH 1NBME 5A8ZA 1TBRH 3CNRA 1ZHMA 1WSSH 1OWHA 3MNXA 3NUMA 1MCTA 5EQSA 5EJZA 3H7OA 4IN2A 3SUDA 2P94A 3F2GA 1E37B 2FM2A 2WYGA 1RTLA 2O8LA 1AB9B 5F8ZA 3E1XB 4OS6A 3MQKC 1OP0A 3BTQE 5EQRA 2SGFE 4X2XA 1QIXB 2C90B 1BMAA 2FOCA 4Z1MD 1MQ6A 2ESTE 4DURA 1F5RA 1G30B 3SHCH 5JB9S 3ATIA 1UK2A 1FIWA 5TCCA 3EE0B 2BLOA 4ISHH 1C5MD 2ZQ2A 2B0FA 3QO6A 2AMQA 4E06H 6ESTA 1WXRA 3MFJA 1LTOA 4E05H 3VGCC 4KKDA 1KLTA 1MKXH 5JB8S 5CE1A 2M5TA 1O2HA 5EOKA 1HUTH 2SGDE 1GVZA 3RMLH 2BQ6B 1G3BA 1PPEE 2VIPA 2UWOA 4IBLH 1W3CA 3E0PB 4XE4A 3SOSA 2WZQA 4Y76A 2QV1A 1J16A 1K1NA 2KFWA 3Q3KA 4WXVA 2ZEBA 1UTNA 3U9AH 2GGVB 2KZ4A 4WJG2 2Z94A 1EB1H 5L30H 4AYVB 3MU4A 2FOGA 3A8CA 1T4UH 1C5SA 2KR7A 1FY8E 2PKAB 4NG9H 1C5VA 1ESAA 4DOQA 1P10A 1ZMLA 3QWCH 1UHBB 1PQAA 1O5GH 1WTHD 3SQEE 1DSUA 2VVVA 2H5CA 1ANEA 4DVAU 1KLJH 1G2LA 1GI3A 1BQYA 1AZZA 2EQNA 1LPGB 3SJIA 3SN8A 1Y5BT 1OXGA 1TAWA 1GJ7B 2C8ZB 4K3JA 4A1XA 4YM9A 3SV2H 2OBQA 2W7UA 2BY7X 4TYDA 1KTTB 3PTBA 4ZH8A 2GCHF 1UTJA 5F03A 2Y80A 4FUCA 1P9SA 1O5DH 1L2EA 1GHYH 3LGYA 3Q3YA 3O8RA 4ISIH 4B74A 2V0BA 2JJ1D 2PLXA 1RIWB 2Y82A 1V2OT 3RXJA 1ZGVA 1EOLA 1NM6A 2LELA 1UTOA 1VJ9U 4ISOA 1AB9C 3RXQA 2LP6A 3FKSD 4B2CA 2ZP0H 1ZPCA 3NKKA 1O34A 2Y5GA 3A88A 1B0FA 1TRYA 1GVLA 1ZMNA 4FUEA 3D49H 3JZ1B 1GJ9B 4X1QU 3ZZ7A 5EGMA 1N6XA 1G2MA 3PLPA 5EQQA 3BTFE 3OFND 3UREA 1EAWA 3E91A 4INLA 1H8IH 1GDQA 1O36A 3RM0H 4YXWD 1GBBA 1GL0E 1ZR0A 1F7ZA 2QA9E 1TABE 4RT1A 1PJPA 2G52A 3PLKA 4B2AA 1BJUA 1H8DH 1OYTH 2OTVA 1T8OA 5DKMA 3K6ZA 4Q80A 1EJNA 4AFSA 2BDHA 2ODQA 1SPJA 3SO3A 2FEQH 1O2LA 5KECA 2HPPH 1BDAA 2FTLE 1O3LA 3RXFA 1EKBB 1G9IE 3W1EA 4OS2A 1O2YA 2J95A 2KCYA 3KHVA 1AZ8A 2QF3A 3GY2A 5GNDA 1JXPA 1G3CA 1ELVA 2PR3A 2BHGA 2Z3EA 4U32A 2R2MB 2FS8A 4B6EA 4YESB 2A5IA 4FUFA 2FPZA 1QHRB 3M3VA 1CE5A 1XUKA 1A4WH 5EW1H 4TWWA 4I8GA 3V12A 3ZIAD 1O5FH 4K69A 1ARBA 5T1VA 3FZZA 4IMZA 3BTGE 3OX7U 1TOCB 5B6LA 1GHWH 3P8FA 1C2HA 4YOJA 1FPHH 2FDAA 4BANB 1Z8IB 3R3GB 1O5AB 2FOMB 1Y5AT 1QTFA 3M3TA 5EPNA 3M5MA 2PP6A 2XW9A 2ZNKH 3PMJA 1DS2E 3A8BA 4B75A 5JBBS 5J4QA 2XXLA 1V2TT 5J4SA 2ZDAH 3KN2A 3RC5A 1OOKB 3M3SA 3UIRA 3ZVDA 1MTWA 4ZMAH 1GVKB 5E2OA 1BBRK 2A1DB 2NU2E 1QY6A 3MNSA 3T29A 3UOUA 2UUJB 4NFEA 3S9AA 2A2QH 4BAKB 1A3EH 4NFFA 4INKA 4OS5A 1P3CA 4X6PA 2L6OA 1NESE 1OWIA 2FMJA 3V13A 4VGCB 4NA7A 1HCGA 3OE7D 4K60A 1RIWC 5E0JA 3WW7A 1GMCG 3RXDA 1F92A 4K5ZA 2QXGA 1TLDA 3RXVA 2JETB 2YMSD 3TJUA 3L33A 4R0IA 1WQVH 2D2DA 1NRNH 2BD4A 1BTUA 1OX1A 1SGPE 3ZZ9A 4HTCH 2ANKH 2FYQA 4FOUC 3MU1A 2YNAA 2J38A 3CP7A 3VB4A 1O3KA 2TGDA 1F5LA 1ABIH 4OM9A 1Y3YA 4ABJA 2PFEA 2CN0H 1C2MA 1DWCH 1XM1A 2A4OA 3N7EA 1SB1H 1ELTA 2BY9X 3LJJA 4P00A 4R8TB 1UTLM 1RTFB 1CU1A 2RG3A 4WXIA 4ZCNA 1W0KD 2FLRH 1A5GH 1HRTH 4WH8A 4ZHLU 5C1XA 1K28D 1HB0B 1BZXE 1XVOA 3PRBA 1BRUP 1O3HA 4GLYA 1P2NA 1GI5A 4X8SH 3LPRA 3IG6B 3TJVA 1KTSB 4JMYA 1NFUA 1AFQB 1N6YA 4AB8A 5G4BA 2J98A 3BG8A 2ANYA 3SZEA 2FO9A 4CR9A 2VWNA 1EFRD 1CA0B 4YT7H 1W10U 2BDCA 1EZUC 1GI4A 1HJ9A 4E7NA 2ZGXH 1TNIA 4D7GA 3LT3A 2XCFA 1HAOH 4UFFH 2BD9A 3GYLB 1BMFD 1EJMA 1MTUA 1AFEH 2P16A 1YPKH 1O2GH 3SV8A 5DG6A 4NSVA 6GCHG 4GCHG 3A84A 3MH7A 1FZZA 1DVAH 2ANMH 2YOLA 1FMGA 2CHAC 3VB6A 1CBWB 3OTPA 1SGEE 5LGOA 1AHTH 3MO3A 2BVRH 5AVDA 4SGAE 1QRZA 6LPRA 4U30A 4Y8XA 3ZV8A 1L0ZA 4F4OC 1RXPA 4K8YA 3KNXA 5K0HA 2J94A 3S9CA 2ZPRA 4XDEA 2FOFA 1EAUA 5CHAB 1NC6A 3PYHA 3HKIB 1SR5C 1GBJA 1L1GA 3E8LA 1V2WT 2A2XH 2RDLA 4JYVH 1C1PA 3U98H 3DD2H 3E6PH 2SNWA 1HAIH 9ESTA 3UFAA 6CHAC 3A85A 3URDA 1PPCE 1TMTH 3B9FH 1O30A 5LH8A 3H5CB 1EPTB 3UQOA 1VGCB 3KYGA 2NU0E 3A8DA 2BXTH 5TCAA 1YPGH 3M7UA 1V6DA 2ULLA 3FN8A 1E1RD 5IYTA 2WPDD 4GPGA 2Q1JA 2VINA 3A89A 2PKSC 2ZZUH 1GGDB 2A7JA 4H4FA 1SQOA 1UK3A 2VWOA 3HK3B 1AY6H 2GCTB 1TMBH 1DT2A 4O3UA 1NROH 2QIQA 1VITH 3RXGA 2ZU4A 3RXBA 3VXFH 1HLTH 3P8OA 1F2SE 1CHOG 1Z7KA 1SGQE 1Q2WA 1C5UA 1COWD 1PPGE 3A7YA 1K1JA 2ZC9H 4O3TA 3GY3A 4X2WA 4K1SA 1HAYB 2BMGB 4A6LA 2KAIA 2FOAA 1S0RA 1ELFA 3EA9A 1O2TA 4B76A 2OUAA 4HFPB 1AFQC 1TBQH 1BOQA 1VZQH 3A7WA 3PV4A 5AFYH 1EJAA 1QA0A 1ELCA 1CA0C 1K1OA 3UOPA 1D3DB 1K1LA 4AFQA 1BIOA 2A45B 4WMEA 1EP5A 3DFJA 4X1RU 4K8BA 3F9GA 3RXTA 2R3YA 5KEDA 4GUXA 4NSYA 1H9IE 3FFGA 4H6SB 1SG8B 5DP6A 1NY22 2UUKB 4JYTA 3MOCA 1HAHH 1HAZB 1MBQA 5ESTE 1PPZA 1GBKA 3M7TA 1KY9A 2RCEA 3T2NA 1FLEE 1HGTH 5CDFE 2ALVA 2FI3E 2F9UA 5FHTA 1O3BA 4F55A 1A0JA 5IK2D 1NRSH 2EA3A 1GCTB 3PMAB 4IW4E 3GCTF 3TVJB 2HNTE 2EI8A 1SHYA 1QL7A 1W7GH 2AH4X 1QFKH 2YNBA 4O03A 5KGOA 1T8MA 2QAAA 2DUCA 4KP0A 3F9HA 3RMOH 2B7DH 2BDIA 1FN6A 4K2YA 4NIXA 5DP3A 3PV2A 1LVMA 1F0SA 1O2KA 5F6MA 4YLUA 2VVUA 3K9XB 3P8NA 1CT2E 1TQ0B 4I32A 4BTTB 2WV5A 1EXFA 2F9NA 1D3PB 1O2IA 2A4RA 1V2RT 2KCOA 2H2ZA 2CGAA 2ZU5A 1EPTC 3PWBA 1UTQA 1S6LA 4ABIA 1NFXA 2H6MA 1FJSA 7KMEH 5EJ1A 2TGPZ 4H42U 4IS5A 1W7XH 1EOJA 3WWFA 2OC0A 1O2QA 5SGAE 1A5IA 2A7CA 5GJ4B 4ACBA 2HVXA 1AVGH 1W12U 5C20A 1K2I1 1XXFA 3GCNA 1O3FA 4NZLA 2OP9A 2GCTC 1OWEA 1MTSA 1E38B 5DPAA 1SKYE 1JIRA 5GXPA 1IQMA 1YPHC 1NU7B 1MD8A 2I6SA 1KXDA 3M5NA 1SGRE 1AIXH 3UR9A 4AORA 5DP5A 1GJ8B 5DGJA 4X2VA 2OK5A 2GT7A 5C1UA 1NBMD 2PHBA 3C27B 3OEHD 1G37A 2ZU1A 3JZ2B 3RXOA 4AYYB 2K0QA 1HIAA 1HIAB 2ZDKA 3SHAH 3HGNA 2FIRH 3RU4E 4X6OA 2GMTB 3MHWU 4OS7A 4U2WA 2C4FH 1KDQB 1KDQA 2XBXA 1AUTC 2H9HA 1W0ZU 3STJA 5I25A 1H1BA 1E35B 1TRNA 1ZSKA 3AW1A 4BXSA 2FYRA 1TE0A 1FN8A 2WPJS 2VGCC 1HAGE 1IQHA 3FP8E 1P09A 1CGIE 1ELAA 5GPIB 2EI6A 4MG3A 1BBRE 3EE7A 1UVOA 2HNTC 1YY3A 1GI7B 1OWDA 1DY8A 2Q6GA 1YPJH 1K0HA 4KTCA 4YT6H 2TGAA 4Z0KA 2J4IA 2PUXB 5ABWA 1TB6H 1B0EA 3RLYH 1QZ8A 3LC5A 1Y59T 3SUGA 2R0LA 3SJOA 1VCPA 1EX3A 1IHSH 2RA0A 4K1EA 1Y8TA 1CSOE 3PV5A 1YGCH 3U8TH 4D9RA 4TPYA 1GCDA 1GMHG 3ZZ3A 1GJ4H 1ZPZA 2VIOA 2ZFSA 1RD3B 5FX5A 1A0HB 2V6NA 3VPKA 1C4V2 3SJKA 2VIVA 2HOBA 1A5HA 1TPAE 2GTBA 3BSQA 3TGJE 4D7FA 1AQ7A 2FS9A 4CBOA 2NU4E 2GZ7A 1UW7A 2BOKA 2FXRA 1C1MA 1CT4E 3RXSA 2GV6A 2STAE 4I8JA 1C2FA 3I78A 1K1IA 3SI4H 2A7HA 5EG4A 5JDUB 1Z6JH 1C5NH 3Q76A 3TGIE 5L2ZH 5A2MH 3SU0A 1Z1IA 3OAAD 1GMCF 1H4WA 3LGIA 2BTCE 2XYAA 1AN1E 1MZDA 1MKXK 1UVSH 1LPZB 3SU5A 1HDTH 1FXYA 3LKWA 3P70B 3MH5A 3DSPA 1TGTA 5A8XA 5K7RA 1H8HD 3LGUA 5T6DA 3VG8A 1C5RA 1CHGA 2TIOA 2TBSA 4OGXA 5HXFA 4XBDA 2HGTH 1C1RA 1T4VH 1SGIB 3EQ0H 3RXPA 3UWIA 5AFZH 3TIUA 3BTHE 3HPTB 3PM3A 4IC6A 1NS3A 3P17H 5DP8A 3LU9B 1D3TB 2PSYA 2AGIX 2TGTA 2C8WB 2OLGA 2CK3D 4FXGH 1P12E 1VITG 1BTYA 1MQ5A 3F0OA 4I8KA 4ABHA 3U1JB 1ELDE 2WYJA 4WWYA 1JIMA 1YWUA 2P8OB 1SGFA 5A09A 1ABJH 3UAIC 3MO9A 2EY4C 1O3MA 1YCPH 2F3CE 2O8WA 4IC5A 1TBZH 4ABGA 3BEFB 3S69A 2KM0A 1T7CA 1JWTA 2AHME 4NWLA 4ZUHA 2ZPSA 1T8LA 1O3NA 3GY5A 3LH1A 2ZCKP 4B1TA 3GCTG 1V2LT 5DP7A 1O2PA 3Q00A 1YCPK 1LVBA 2GMTC 2F91A 2VIWA 5AHGH 3MU5A 1EASA 3SJ9A 3ZVCA 3DSOA 3SV7A 1VCWA 1SQTA 1J17T 1DPOA 2JIZD 3LGWA 1A1RA 1PQ7A 4MQAA 4HZHA 3URCA 3ODDA 2ODPA 5EPYA 1QR3E 5TJXA 4DIHH 3A82A 3TPIZ 4X8TH 3F6UH 2FOEA 2ZO3H 1C4U2 1TNGA 1UCYH 1XUGA 4Y11E 1D4PB 1S5SA 4XD7D 1EB2A 3ZZ5A 2Z6BD 4AGJA 6GCHF 4GCHF 4ZKSU 5HKKD 5A0AE 1BTXA 2AMDA 1Z1JA 2BD2A 2J2UA 1SFQB 1UCYK 1EUFA 2BQWB 1HV7A 1C5ZB 4ABAA 4FUIA 4KTUA 3O8BA 1GL1A 1QL9A 1TNKA 3AVZA 1ESBA 1GHXH 1ZZZA 3GDSA 4A1VA 1DM4B 4Q7YA 5ETXA 4GAWA 1D9IA 2WSSD 9LPRA 2F43B 3EYDA 4I31A 2VIQA 2ZHDA 2GZ8A 2OC8A 4BTIB 3SU1A 2AIPA 3V7TA 2AGGX 4AB9A 1DICA 1TMUH 3EAJA 3VFEA 1BMLA 3FZDA 1IQNA 1YLDA 1FNIA 5FPSA 1O2RA 3FP7E 2XOKD 2FX6A 3ITIA 1W11U 2SGQE 1E0FD 1MAYA 1W13U 2QGRA 4Y71A 1SGTA 1HAVB 1HAVA 1FY4A 1W8BH 2BZ6H 1DLEA 2HNTF 4UFDH 5EIYA 1O35A 3K65B 5LPFA 1TPOA 5E2PA 1GBMA 1IQEA 2XNIA 4AG1A 4NA8A 1GBFA 1TPPA 3NRLA 2A5AA 3BTEE 2LPRA 1AVXA 3ZVFA 8GCHG 1C4Y2 1YKTA 4CRAA 1P2JA 3U28C 2HPQH 4JZEH 3SGBE 1OHHD 3GOVB 1S6FA 4DCDA 5F53A 1F0RA 3SGAE 1BT7A 1V3XA 1ELBA 1GJBB 4UEHH 4BAMB 4NIVA 1SQAA 1F0TA 2R3UA 1V2UT 1ZJKA 4CH2B 2Z3DA 5E8EH 3T62A 2QN5T 3EGKH 3GCHB 1CHOF 4LXBH 1ANDA 4CR5A 1FAXA 1P2OA 3RXCA 3SU2A 1UTKA 3GS9A 2F9VA 1G32B 1GHBF 1SSXA 1KYNA 3RMNH 2SNVA 3RU4T 1QRWA 1QJ6B 4TY7A 2ZFFH 2ZDVH 4ZKNU 1ETRH 3TK6A 2XBYA 2PW8H 1HXEH 1GHAG 1TPSA 2BX4A 1C5QA 2P59A 2QXHA 5B6OA 1SHHB 1SGCA 4ACAA 1P01A 1BRBE 1HPGA 4MNYA 3AASA 5C2ZA 1RRKA 5CHBA 2ZCLP 1NTPA 4OGYA 1S84A 5FBIA 4UFEH 3MH6A 1IQGA 4IMQA 2FX4A 2VJ1A 2UWPA 2G8TA 4A5TS 2YMSB 1BMNH 2CF9H 1YP9A 1DX5M 3F2FA 2V35A 3EA7A 1NU9A 2SGAA 1QBOA 1DWDH 1KXBA 3PO1B 1G3EA 4Y8YA 1MD7A 1GBAA 1RFNA 3A8AA 1P2IA 3ZVEA 4H6TA 4MDSA 2IPQX 3H09A 1C1NA 1J8AA 3A7VA 1FPCH 3WY8A 5EODA 1FY3A 1H8ED 1XKAC 4DT7B 2G51A 3QZQA 4Q63A 5GIBA 1KSNA 1TA6A 2V3HH 4MNWA 1GI0A 1O3DA 4DJZB 4DY7B 1A2CH 1IQIA 2NU1E 1C5WB 1GI1A 5JBAS 1PQ8A 2ZPQA 1Y3UA 1ZHRA 2Z7FE 1OYQA 2TRMA 1V2VT 1GI8B 2J98B 2ZFTA 4B73A 2FODA 4ZXXH 3PTNA 2C93B 4CRBA 2P3FH 3GY7A 1L4ZA 3GDVA 4XFQA 2KX4A 1YPLH 3U1IB 3AAVA 1QJ1B 2A5KA 1QCPA 1DLKB 1DE7H 2VU8E 3LJOA 4AC9A 1TWXB 2GJGA 2ZHQH 1C2KA 1LKAA 3QTVH 4AOQA 1A61H 2PTNA 2ALPA 1GI6A 1P2KA 4Y6DA 3RP2A 2RFKC 2J34A 2QCYA 3BV9B 1UVUH 4Y79A 4UDWH 1KIGH 3PB1E 2QC2A 2Y7XA 2F4LA 3DA9B 3NCLA 2CMYA 1O2UA 1O39A 1CVWH 2XNDD 3L3TA 2GKVE 1BTHH 2VIDA 1TNHA 3U8OH 2FESH 2DE9A 1EAIA 1LQEA 1WBGB 5L2YH 2W7SA 4TPIZ 4MNXA 1HNEE 4ISLA 1O2WA 1DWEH 1INCA 2BVXH 1XXDA 2Q6FA 3MH4A 4MNVA 2OCVB 1L1JA 2ZECA 1TQ7B 2O9QA 3GY6A 3TLOA 2VB0A 5GWZA 1O5BB 1CQQA 3ATMA 1O5EH 1JOUB 5GDSH 1GJCB 4Y0YE 4VGCC 1ZMJA 1C2EA 3RXHA 2HWLB 1S83A 3SORA 1PYTC 2B8OH 7ESTE 3N7OA 1A3BH 3ZYEA 1E36B 1UMAH 1UVPA 1W14U 1ZSLA 3BEIB 2JETC 2J97A 2O8MA 1YPEH 3KL6A 8KME2 2P93A 4KELA 2WPHS 4JZDH 1ZRKA 2RDEA 3E3TA 5HIYA 1OP8A 2V3MA 1Q3XA 3ZZCA 1NZQH 1GJ5H 4X6MA 2AFQB 1MH0A 3SQHE 1ZHPA 1QB9A 1GMHF 2BD7A 3AW0A 1IOEA 1QNJA 3D62A 3G01A 1P0SH 1BTPA 1XVMA 3N7DA 3MNCA 3QGJA 5FPTA 3UQVA 3LDXH 2PSXA 4Z6AH 1MU6B 1WOFA 2AERH 2KCPA 4A7IB 1WQSA 1DFPA 5GCHG 1FV9A 1P11E 3F68H 4WH6A 1MBMA 1BB0B 1GHBG 5HM9A 2KAIB 1TGBA 4AG2A 2THFB 2W26A 2UWLA 1BHXB 1K1MA 3K2UA 3SV6A 2ZDMA 1M9UA 2FI5E 1O2XA 5F8XA 4LZ4B 5HM2A 8LPRA 1GG6B 1MTVA 4FUJA 1YPHE 2STBE 5EJLA 1BJVA 4ABDA 2ZU2A 4E7RG 3RXMA 4YLQH 1V2QT 4FU7A 2UUFB 3RLWH 3U69H 1Z8RA 4X8VH 7LPRA 3R0FA 3SNEA 1VITF 1HAXB 1P3EA 1DXPA 8ESTE 5A0BA 3KQDA 3OSYA 1GJ6A 1RJXB 1ANCA 1ANBA 1CBWC 1Z6EA 3SNDA 2WPLS 3BIUH 1L4DA 2QF4A 2G00A 1LCYA 3BTTE 5DO4H 4Q7XA 1FY5A 1UCYE 3ZZ8A 3BTKE 5FXLA 2BLWA 3T28A 1FIZA 1HAPH 1ELEE 2BYAX 4I7YH 1QL8A 4MLFB 1S0QA 2ZTYA 1SOTA 5CHAC 1Q31A 3TK9A 3LC3A 2ZDLA 1NFWA 4RKJB 1Y3VA 1IQLA 1GMDG 2PGQB 1GDUA 3KQ5A 2QXIA 5FPYA 1XUFA 4X6NA 3E16B 1K21H 1CO7E 2BDGA 4FUBA 1C5PA 1AWFH 1O2JA 3E0NB 1F0UA 1O2VA 3ESTA 1DSTA 3SNCA 2AYWA 3VGCB 1D3QB 2JH5D 5HGGA 1VGCC 1E79D 3EDXB 2ZG0H 2PGBB 1GDNA 3RXLA 2HVYB 1BA8B 1MAXA 4B6FA 1S85A 1QBNA 2Z9JA 1S82A 1W0JD 4TWYA 2BD3A 2J5UA 5E0GA 3RXAA 4DGJA 3S7HB 1GBCA 2AGEX 1C5LH 1GGDC 3HGPA 5EU8A 1VCQA 1TONA 1QQ4A 1TOMH 1XUIA 3D23A 4ABFA 3GY4A 3KCGH 1EZXC 4MPWA 2HLCA 3UNQA 3QLPH 3OY6U 1A46H 4DT4A 1P9UA 1UTPA 2OD3B 3RU4D 1CA8B 3NWUA 2GP9B 2GX4A 2HALA 3LGTA 3KQBA 3UPEA 3T26A 3MNBA 1FY1A 3BIVH 4Q2KA 3BTME 1O0DH 4AFUA 3O8DA 1C5TA 2FLBH 1JMOH 1WYKA 3LH3A 1ZTKA 1UTMA 1KXAA 2WV9A 2FI4E 4AX9H 3ZVGA 5HMAA 1FQ3A 1IAUA 1UVTH 1GI9B 3ZVAA 1JBUH 4UONA 2QYIA 1LHCH 1SL3A 2Q6DA 4D9QA 1EAXA 4XSKU 3QTOH 8GCHF 1TX6A 2C8XB 2ILNA 2XWAA 2ZGHA 4MPXA 4DW2U 1MU8B 2W3KA 1O3GA 4ZAEA 1MTNB 1LDTT 4FETA 3QX5H 4I8HA 1GBEA 1DUEA 3RUOA 5FCRA 1SGDE 1AD8H 2BQ7B 4KTSA 4TT3D 4BAOB 1TALA 3BEUA 2ZTXA 1SGYE 1Z71A 1Z8JB 2ZFPH 1FI8A 1PPHE 2M2AA 2ZA5A 2Z3CA 2G5NA 1NT1A 2JH0D 2ZWLH 2D1JA 2CV3A 1KLIH 3ZYDA 3RC6A 2XC5A 2AEIH 1SGFG 2JDID 1GJAB 4XBBA 2OINA 2ZHFH 1BRAA 4RT0A 4UE7H 1RS0A 1TIOA 1L1NA 3QUMP 5PTPA 1XUJA 2GZ9A 1GCTC 1DOJA 1WU1A 4GHTA 1C1OA 1WUNH 3A7ZA 4OS4A 2ZGBH 3SU3A 1OWKA 1GHAF 2IPHA 1YM0A 3ZZDA 3TGKE 3GICB 3RXRA 2ZIQH 4TY6A 4BTUB 4MPVA 2GD4B 2O8TA 3AAUA 2NWNA 1O3JA 1TGSZ 1O33A 3TK5A 1LHFH 2A32A 3F9FA 3KGPA 1A7SA 4ASUD 2L74A 3A83A 5LPRA 1PPBH 2G55A 3STIA 2H5DA 1TYNA 5DSFA 2H1UA 1SGNE 1GBTA 2SGEE 1J14A 1LVOA 1P02A 2VH6A 2W3IA 2Y6TA 3M35A 1LO6A 4ZHAA 3W95A 4Y10E 4IGDA 2I6QA 3VB7A 1GBDA 1HJ8A 3QZRA 1SMFE 2VVCA 4AZ2B 3M5LA 1TRMA 3GCOA 1ZJDA 3N99A 1LKBA 1XX9A 3GDUA 3SNBA 1MABB 3BN9A 1T32A 1CGJE 1AU8A 1FAKH 1GBLA 1P04A 3F1SB 2ZQ1A 3PROA 4MTBA 3RMMH 5EW2H 5F8TA 2ANWA 2K1QA 3BTDE 1C2JA 1THSH 4THNH 3TH2H 1V2JT 4NCYA 2D26C 1NO9H 2R0KA 2W6JD 2P95A 2PKAA 5T6FA 3I29A 4HG6A 2O8UA 2Z9IA 1UHBA 1XUHA 1OPHB 1WV7H 3ZZBA 3UB0A 4BNRA 1NRPH 4YZUA 5LPEA 3TITA 2SFAA 1AVWA 1GBHA 3ZZ4A 4AFZA 3KF2A 4KGAA 4BOHA 4OS1A 1KXEA 2RA3A 1QQUA 2FZZA 2CXVA 1J15A 2UUYA 2G5VA 2ZFQH 1BTZA 2WHXA 2IJD1 1MTNC 1LHDH 2VWMA 3ELAH 4NIYA 1O3EA 2OC1A 3VEQB 1NRRH 3RM2H 4A1TA 2VH0A 1C2IA 3KYFA 2ZI2H 1O3CA 3LOXA 3M61U 4HGCA 1OSSA 3TJOA 2XC4A 1VJAU 2Y5FA 4CRCA 2IOTA 3LONA 3TJNA 1SLWB 4B2BA 1XMNB 2A4GA 4ISNA 2DE8A 1CGHA 1LQDB 4Q4LA 5C94A 2BVSH 1O5CB 2P3UB 1C1VH 1ETSH 1IHTH 5JYIA 3TNTA 2R9PA 2VBCA 4FUDA 5C3NA 4PROA 1ZTLA 2FOBA 1OS8A 1C1TA 2FOHA 2B9LA 4TSFD 1BHXF 4ABEA 1O2OA 3MWIU 1K9OE 1AGJA 1P06A 3FOAA 3T25A 4MPUA 5IDKA 4MVNA 3GY8A 4SGBE 3V0XA 2HRVA 3PWCA 1P8VC 1DANH 2XTTB 2WV4A 2AIQA 4AGKA 3I77A 4NGAH 1ZLRA 1EZQA 3Q77A 3PMHB 3ATLA 5C0UA 1GJDB 3M5OA 1V2MT 3SZNA 3ODFA 2W6ID 5BPEA 1VR1H 2CF8H 1MUEB 2F9PA 3A7TA 4M9FA 1YLNA 2OQ5A 2ZDNA 4F49A 2BLVA 1NPMA 3M36A 1G3DA 1LHEH 1YBWA 2BD5A 2BM2A 4YOGA 2WPMS 3S9BA 3WWBA 2QF0A 3F0PA 3KQCA 3OEED 2IJOB 3SJ8A 2PUQH 2F83A 5T3HA 1SC8U 2B5TB 3SYJA 2VWLA 3FANA 3TH3H 1SBWA 4ZHMU 1FUJA 2P8OC 1Y3XA 4J1YA 1NFYA 2BY6X 3D65E 1TNLA 5GCHF 2W5EA 2KCAA 1DUAA 3BTWE 5FL7D 4D8NA 1ZTJA 3ATKA 1J9CH 5C1YA 2CHAB 2GVFA 3UWJH 3ZZ6A 4ASHA 1C1UH 3SV9A 1ZGIA 3OTJE 1TGCA 3HATH 1IQFA 1AKSB 1AKSA 3BG4B 1PQ5A 3FVFB 1W2KH 2BZAA 1C5YB 2BY8X 4ABBA 4UD9H 1BRCE 3P8GA 1BBRH 1QB1A 1V2KT 2XRCA 4CH8B 7GCHF 3M37A 1G36A 4JYUH 1MCVA 1WTGH 3L6PA 2J9NA 1D6WA 3KEEA 1P2MA 1SQRA 3ZV9A 5C67A 2PV9B 3QK1A 3T27A 2V7QD 1N8OB
chains in the Genus database with same CATH topology
2FTMA 1O32A 5EXLA 6CHAB 3MU8A 2ASUB 3PMBB 1RGQA 2FWWA 4CRFA 1PYTD 3GISB 1DDJA 1HJAB 3BF6H 4JZIA 2V3OH 4LK4A 4NIWA 4A92A 4NA9H 2Y7ZA 1QGFA 3DT0H 3OY5U 3VB5A 4YTAA 1TX8A 1K1PA 2XC0A 1O2MA 3LIWA 1UO6A 1HBTH 4Q7ZA 4ZKRU 3SI3H 5E0HA 1AE5A 3RXKA 3SW2B 2G4TA 2PKSB 3HKJB 4ZROA 4FUHA 4J2YB 3DUXH 2JH6D 3TNSA 4GSOA 4FU8A 1GMDF 2ZU3A 1AE8H 4XOJA 3A81A 4FU9A 5FCKA 3SUFA 1QJ7B 1THRH 4JCNA 1D6RA 1IQJA 5DP4A 4CRDA 4BAQB 2OQUA 2GV7A 3PLBA 1C5OH 1LMWB 1C9TA 2WINI 4RN6A 5DP9A 1OWJA 1O2ZA 2XBVA 1O2NA 1SVPA 3LGVA 2GCHG 4K1TA 1V2ST 2BOHB 1PFXC 3ATWA 4YOIA 2Z9KA 3RDZA 1QA7A 2EEKA 1LHGH 1DXWA 1F5KU 1XKBC 5A8YA 1B5GH 2QY0B 2SGPE 2Z9LA 1AUJA 1LVYA 2ODYB 2OC7A 2BD8A 1YPMH 3GCHC 3KQEA 2C8YB 3C1KA 1HFDA 1SFIA 1HXFH 1O2SA 5H4IB 1LPKB 1SLUB 4X2YA 2F9OA 3RXIA 4LZ1H 3VXEH 4X8UH 3TH4H 1YLCA 3B23B 1Z8GA 2Y81A 2WPKS 4GVUA 1HYLA 1BTWA 1FONA 2LNCA 3NXPA 4I8LA 2JKHA 5C5NA 3BG4C 1FDPA 2A4QA 4U01A 2BX3A 4M7GA 1NN6A 4WY3A 5T6GA 1GBIA 1AO5A 1ARCA 1WCZA 3DFLA 1H9HE 4LOYH 2FP7B 1O37A 2NU3E 3K6YA 1GPZA 1P03A 3VB3A 2CJIA 2ZTZA 1GHVH 4FVBA 5HYOA 1T8NA 2VNTA 3MO6A 1PPFE 3HK6B 4QT8C 4FUGA 1N8OC 4O97A 3MI4A 3NPSA 1C5XB 4Y0ZE 2TPIZ 1O3AA 1TGNA 3P92A 4INHA 4IN1A 1BCUH 1Y5UT 3PO1C 1V2PT 1CT0E 1EPTA 1HJAC 3P6ZB 3UTUH 5L6NH 4RSPA 3NK8A 1ZPBA 2BDBA 2ZKSA 2PTCE 1AI8H 5FBEA 4UFGH 1BMMH 2XBWA 1JRSA 3A7XA 4JK6A 1P2QA 1DWBH 2EC9H 1YC0A 3H7TA 1THPB 2BLQA 4X0WU 3UUZA 3MYWA 1O3IA 1KXCA 4FVDA 1ETTH 1ZSJA 3EA8A 5DK1A 1ACBE 4CHAB 1QBVH 2P3TB 2IN2A 3CS0A 3OU0A 4DG4A 1C2GA 2Y5HA 4B71A 3W94A 1TA2A 1BUIA 3T5FH 1P05A 1C1QA 2Z9GA 1QB6A 3CENA 3B8JA 1C9PA 5I46H 3KIDU 4CREA 1QURH 7GCHG 1KXFA 1YYY1 2BY5X 3SUEA 5JBTA 3RXEA 2ZHEH 3MMGA 4NZQA 5ESBA 1ID5H 2ZCHP 2GDDA 2ZFRH 2VGCB 4YO9A 1U6QA 1ELGA 3ENSB 2ZF0H 3QDZB 2BDYA 1MZAA 1ESTA 1SLVB 5A0CA 4JZFH 1S81A 3E90B 2H9EH 1DY9A 2EI7A 2G81E 1YCPM 2BXUH 3MTYA 4GHQA 2ZGJA 1EZSC 5JBCS 4BAHB 3A80A 2WUBA 5JPMH 2WUCA 1GWAA 3O8CA 2H9TH 3Q3XA 1TNJA 3P95A 2ZHWH 1EP6A 2OXSA 1DITH 5C5OA 1GI2A 3SNAA 4JZ1A 1V2NT 1YF4A 1C2DA 3GYMA 3UY9A 4I33A 2A31A 1ORFA 3UNRA 4X1NU 4Y7BA 1SI5H 3SBKA 1S6HA 2BB4A 1O3PB 2F9BH 3QGNB 1C2LA 4CRGA 4WMDA 2R2WU 3SU6A 1EATA 2GT8A 5FX6A 1C1WH 2XCNA 3ZVBA 4O9VA 1MKWH 1WAYB 1QRXA 4HI3A 2BDAA 1SOZA 1B7XB 3A86A 3UNSA 1NRQH 3UR6A 4Y7AA 4BXWA 1TFXA 1O31A 1OKXA 2A0QB 2ZGCA 3A87A 1N1LA 1P57B 1T31A 2XWBI 3TU7H 2C3SA 1MKWK 3FAOA 5DJ7A 1O38A 1ZOMA 1RTKA 1E34B 1W0YH 1Y3WA 4NWKA 1H9LB 4WF8A 2PWXA 5EXNA 4X1PU 1TX7A 3NZIA 4ZKOU 1ZYOA 1BITA 3QN7A 4AN7A 2AS9A 3U8RH 4XBCA 4D76A 1A0LA 3MU0A 3IITA 3V3MA 3IWMA 1UJ1A 3RC4A 3SGQE 1C1SA 5BRRE 1AWHB 3M7QA 1UK4A 3OYPA 3SU4A 3FP6E 5CMXH 4X1SU 2QXJA 2AMPA 1O3OA 4CHAC 1K22H 4WVPE 1JRTA 4WMFA 3ZZAA 1IQKA 4RKOB 1SLXB 1MMJN 2WPIS 1AMHA 3S7KB 2OBOA 5EXMA 3S0NA 5AF9H 3F9EA 1GG6C 1EQ9A 2GDEH 3RXUA 2D8WA 4DIIH 1X7AC 1ZRBA 4CBNA 2G4UA 4ESTE 2J92A 1OP2A 4Y8ZA 5FAHA 4ZXYH 3CS7A 1GHZA 4JK5A 3DHKH 5A8ZA 1TBRH 3NUMA 1ZHMA 1WSSH 1OWHA 3MNXA 1MCTA 5EQSA 3H7OA 4IN2A 3SUDA 2P94A 1E37B 2FM2A 2WYGA 1RTLA 2O8LA 1AB9B 5F8ZA 3E1XB 4OS6A 1OP0A 3BTQE 5EQRA 2SGFE 4X2XA 1QIXB 2C90B 1BMAA 2FOCA 1MQ6A 2ESTE 4DURA 1F5RA 1G30B 3SHCH 5JB9S 3ATIA 1UK2A 1FIWA 5TCCA 3EE0B 2BLOA 4ISHH 1C5MD 2ZQ2A 2B0FA 3QO6A 2AMQA 4E06H 6ESTA 3MFJA 1LTOA 4E05H 3VGCC 4KKDA 1KLTA 1MKXH 5JB8S 5CE1A 2M5TA 1O2HA 5EOKA 1HUTH 2SGDE 1GVZA 3RMLH 2BQ6B 1G3BA 1PPEE 2VIPA 2UWOA 4IBLH 1W3CA 3E0PB 4XE4A 3SOSA 4Y76A 2QV1A 1J16A 1K1NA 3Q3KA 4WXVA 2ZEBA 1UTNA 3U9AH 2GGVB 4WJG2 2Z94A 1EB1H 5L30H 4AYVB 3MU4A 2FOGA 3A8CA 1T4UH 1C5SA 1FY8E 2PKAB 4NG9H 1C5VA 1ESAA 4DOQA 1P10A 1ZMLA 3QWCH 1UHBB 1PQAA 1O5GH 1WTHD 3SQEE 1DSUA 2VVVA 2H5CA 1ANEA 4DVAU 1KLJH 1G2LA 1GI3A 1BQYA 1AZZA 1LPGB 3SJIA 3SN8A 1Y5BT 1OXGA 1TAWA 1GJ7B 2C8ZB 4K3JA 4A1XA 4YM9A 3SV2H 2OBQA 2W7UA 2BY7X 4TYDA 1KTTB 3PTBA 4ZH8A 2GCHF 1UTJA 5F03A 2Y80A 4FUCA 1P9SA 1O5DH 1L2EA 1GHYH 3LGYA 3Q3YA 3O8RA 4ISIH 4B74A 2V0BA 2PLXA 1RIWB 2Y82A 1V2OT 3RXJA 1ZGVA 1EOLA 1NM6A 1UTOA 1VJ9U 4ISOA 1AB9C 3RXQA 4B2CA 2ZP0H 1ZPCA 3NKKA 1O34A 2Y5GA 3A88A 1B0FA 1TRYA 1GVLA 1ZMNA 4FUEA 3D49H 3JZ1B 1GJ9B 4X1QU 3ZZ7A 5EGMA 1N6XA 1G2MA 3PLPA 5EQQA 3BTFE 3UREA 1EAWA 3E91A 4INLA 1H8IH 1GDQA 1O36A 3RM0H 1GBBA 1GL0E 1ZR0A 1F7ZA 2QA9E 1TABE 1PJPA 2G52A 3PLKA 4B2AA 1BJUA 1H8DH 1OYTH 2OTVA 1T8OA 5DKMA 3K6ZA 4Q80A 1EJNA 4AFSA 2BDHA 2ODQA 1SPJA 3SO3A 2FEQH 1O2LA 2HPPH 1BDAA 2FTLE 1O3LA 3RXFA 1EKBB 1G9IE 4OS2A 1O2YA 2J95A 3KHVA 1AZ8A 2QF3A 3GY2A 1JXPA 1G3CA 1ELVA 2PR3A 2BHGA 2Z3EA 4U32A 2R2MB 2FS8A 4YESB 2A5IA 4FUFA 2FPZA 1QHRB 3M3VA 1CE5A 1XUKA 1A4WH 5EW1H 4TWWA 4I8GA 3V12A 1O5FH 4K69A 1ARBA 3FZZA 4IMZA 3BTGE 3OX7U 1TOCB 1GHWH 3P8FA 1C2HA 4YOJA 1FPHH 2FDAA 4BANB 1Z8IB 3R3GB 1O5AB 2FOMB 1Y5AT 1QTFA 3M3TA 5EPNA 3M5MA 2XW9A 2ZNKH 3PMJA 1DS2E 3A8BA 4B75A 5JBBS 5J4QA 2XXLA 1V2TT 5J4SA 2ZDAH 3KN2A 3RC5A 1OOKB 3M3SA 3UIRA 3ZVDA 1MTWA 4ZMAH 1GVKB 5E2OA 1BBRK 2A1DB 2NU2E 1QY6A 3MNSA 3T29A 3UOUA 2UUJB 4NFEA 3S9AA 2A2QH 4BAKB 1A3EH 4NFFA 4INKA 4OS5A 1P3CA 4X6PA 1NESE 1OWIA 2FMJA 3V13A 4VGCB 4NA7A 1HCGA 4K60A 1RIWC 5E0JA 1GMCG 3RXDA 1F92A 4K5ZA 2QXGA 1TLDA 3RXVA 2JETB 3TJUA 3L33A 4R0IA 1WQVH 2D2DA 1NRNH 2BD4A 1BTUA 1OX1A 1SGPE 3ZZ9A 4HTCH 2ANKH 2FYQA 3MU1A 2YNAA 2J38A 3CP7A 3VB4A 1O3KA 2TGDA 1F5LA 1ABIH 1Y3YA 4ABJA 2PFEA 2CN0H 1C2MA 1DWCH 1XM1A 2A4OA 1SB1H 1ELTA 2BY9X 3LJJA 4R8TB 4WXIA 1UTLM 1RTFB 1CU1A 2RG3A 2FLRH 1A5GH 1HRTH 4WH8A 4ZHLU 5C1XA 1K28D 1HB0B 1BZXE 1XVOA 1BRUP 1O3HA 4GLYA 1P2NA 1GI5A 4X8SH 3LPRA 3IG6B 3TJVA 1KTSB 4JMYA 1NFUA 1AFQB 1N6YA 4AB8A 5G4BA 3BG8A 2ANYA 2FO9A 4CR9A 2VWNA 1CA0B 4YT7H 1W10U 2BDCA 1EZUC 1GI4A 1HJ9A 4E7NA 2ZGXH 1TNIA 4D7GA 3LT3A 2XCFA 1HAOH 4UFFH 2BD9A 3GYLB 1EJMA 1MTUA 1AFEH 2P16A 1YPKH 1O2GH 3SV8A 5DG6A 4NSVA 6GCHG 4GCHG 3A84A 3MH7A 1FZZA 1DVAH 2ANMH 2YOLA 1FMGA 2CHAC 3VB6A 1CBWB 1SGEE 5LGOA 1AHTH 3MO3A 2BVRH 5AVDA 4SGAE 1QRZA 6LPRA 4U30A 4Y8XA 3ZV8A 1L0ZA 4F4OC 1RXPA 4K8YA 3KNXA 5K0HA 2J94A 3S9CA 2ZPRA 4XDEA 2FOFA 1EAUA 5CHAB 1NC6A 3PYHA 3HKIB 1SR5C 1GBJA 1L1GA 3E8LA 1V2WT 2A2XH 2RDLA 4JYVH 1C1PA 3U98H 3DD2H 3E6PH 2SNWA 1HAIH 9ESTA 3UFAA 6CHAC 3A85A 3URDA 1PPCE 1TMTH 3B9FH 1O30A 5LH8A 3H5CB 1EPTB 3UQOA 1VGCB 2NU0E 3A8DA 2BXTH 5TCAA 1YPGH 3M7UA 1V6DA 2ULLA 5IYTA 4GPGA 2Q1JA 2VINA 3A89A 2PKSC 2ZZUH 1GGDB 2A7JA 4H4FA 1SQOA 1UK3A 2VWOA 3HK3B 1AY6H 2GCTB 1TMBH 1DT2A 4O3UA 1NROH 2QIQA 1VITH 3RXGA 2ZU4A 3RXBA 3VXFH 1HLTH 3P8OA 1F2SE 1CHOG 1Z7KA 1SGQE 1Q2WA 1C5UA 1PPGE 3A7YA 1K1JA 2ZC9H 4O3TA 3GY3A 4X2WA 4K1SA 1HAYB 2BMGB 4A6LA 2KAIA 2FOAA 1S0RA 1ELFA 3EA9A 1O2TA 4B76A 2OUAA 4HFPB 1AFQC 1TBQH 1BOQA 1VZQH 3A7WA 3PV4A 5AFYH 1EJAA 1QA0A 1ELCA 1CA0C 1K1OA 3UOPA 1D3DB 1K1LA 4AFQA 1BIOA 2A45B 4WMEA 1EP5A 3DFJA 4X1RU 4K8BA 3F9GA 3RXTA 2R3YA 4GUXA 4NSYA 1H9IE 3FFGA 4H6SB 1SG8B 5DP6A 1NY22 2UUKB 4JYTA 3MOCA 1HAHH 1HAZB 1MBQA 5ESTE 1PPZA 1GBKA 3M7TA 1KY9A 2RCEA 3T2NA 1FLEE 1HGTH 2ALVA 2FI3E 2F9UA 5FHTA 1O3BA 1A0JA 1NRSH 2EA3A 1GCTB 3PMAB 4IW4E 3GCTF 3TVJB 2HNTE 2EI8A 1SHYA 1QL7A 1W7GH 2AH4X 1QFKH 2YNBA 4O03A 1T8MA 2QAAA 2DUCA 4KP0A 3F9HA 3RMOH 2B7DH 2BDIA 1FN6A 4K2YA 4NIXA 5DP3A 1LVMA 1F0SA 1O2KA 5F6MA 4YLUA 2VVUA 3K9XB 3P8NA 1CT2E 1TQ0B 4I32A 4BTTB 2WV5A 1EXFA 2F9NA 1D3PB 1O2IA 2A4RA 1V2RT 2H2ZA 2CGAA 2ZU5A 1EPTC 3PWBA 1UTQA 4ABIA 1NFXA 2H6MA 1FJSA 7KMEH 2TGPZ 4H42U 4IS5A 1W7XH 1EOJA 2OC0A 1O2QA 5SGAE 1A5IA 2A7CA 5GJ4B 2HVXA 1AVGH 1W12U 5C20A 1K2I1 1XXFA 3GCNA 1O3FA 4NZLA 2OP9A 2GCTC 1OWEA 1MTSA 1E38B 5DPAA 5GXPA 1JIRA 1IQMA 1YPHC 1NU7B 1MD8A 2I6SA 1KXDA 3M5NA 1SGRE 1AIXH 3UR9A 4AORA 5DP5A 1GJ8B 5DGJA 4X2VA 2GT7A 5C1UA 2PHBA 3C27B 1G37A 2ZU1A 3JZ2B 3RXOA 4AYYB 1HIAA 1HIAB 2ZDKA 3SHAH 3HGNA 2FIRH 3RU4E 4X6OA 2GMTB 3MHWU 4OS7A 4U2WA 2C4FH 1KDQB 1KDQA 2XBXA 1AUTC 2H9HA 1W0ZU 3STJA 5I25A 1H1BA 1E35B 1TRNA 1ZSKA 3AW1A 4BXSA 2FYRA 1TE0A 1FN8A 2WPJS 2VGCC 1HAGE 1IQHA 3FP8E 1P09A 1CGIE 1ELAA 5GPIB 2EI6A 4MG3A 1BBRE 1UVOA 2HNTC 2Q6GA 1GI7B 1OWDA 1DY8A 1YPJH 4KTCA 4YT6H 2TGAA 4Z0KA 2J4IA 2PUXB 5ABWA 1T