1ELCA

Analogous inhibitors of elastase do not always bind analogously
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title Analogous inhibitors of elastase do not always bind analogously.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1993-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elcA01
4O3UA 1D9IA 2CV3A 1TGBA 1O2GH 2F9VA 2Y5HA 1G3BA 1YCPH 3SV2H 2RA3A 3ATIA 1HCGA 1D3DB 1ABJH 3SV7A 1O5AB 1SOTA 3AASA 4OS1A 1KLIH 3BTEE 1DXPA 1AE8H 2A31A 4X8SH 1YPGH 1TB6H 4AB8A 4ISLA 4Y76A 2FS8A 4NFEA 5E2PA 2JH6D 2R0KA 5E0GA 3F9FA 1F0RA 1C1PA 1E35B 1VITF 1SGEE 4FVBA 1ZPBA 5HYOA 2SGEE 3NWUA 1EASA 3QGJA 5L2ZH 1XXFA 1V6DA 2BY6X 4ZH8A 1UTNA 3ODFA 1T8MA 2NU2E 2D8WA 3A84A 1O33A 1ZRKA 2GCHG 2PKSB 2Z9IA 3RXMA 1ZMJA 3DFJA 1QURH 5FXLA 4MPWA 3SOSA 2HPPH 4ZAEA 2FIRH 4CRGA 1C2LA 1G30B 2NU0E 5A0CA 1WCZA 4Y6DA 2VIVA 1DWBH 1T8OA 2ZFPH 1HAVA 2SGPE 3DUXH 3STJA 1ZMLA 1Z8JB 1HXEH 1BTXA 1TGNA 1PFXC 4B2CA 1GMHG 2BDIA 1S0QA 4X6OA 1TALA 2F9NA 2RDLA 3LGWA 1LHDH 4J2YB 2Z3EA 1BMMH 3A7YA 1FIWA 1C4U2 3A83A 4BAKB 1FQ3A 1IQLA 2BHGA 2EA3A 2EI8A 1WTHD 1AHTH 2VH0A 1UVTH 5J4QA 3A7WA 1JMOH 1G3EA 1GPZA 2PTCE 1BB0B 2WPIS 3RXJA 1V2LT 4ZMAH 3O8CA 1C1NA 1ELDE 3BTFE 3SU5A 4IGDA 1DUEA 3SNBA 5EW1H 3I77A 1BRAA 3HPTB 4E7RG 1IQIA 2GDEH 3GY6A 4Y11E 1ZTKA 4HFPB 4Y8ZA 1O2SA 1GI0A 5FBIA 1MTWA 1TRNA 1DITH 3RXCA 2VB0A 3UR6A 4K1EA 1EB1H 1V2KT 5DJ7A 2BDYA 1SQTA 1SOZA 1NFUA 3F6UH 1FJSA 3TITA 3UFAA 1CA8B 1FAKH 4MLFB 1O5BB 3A87A 1T31A 1EZXC 2D1JA 4D9RA 1IQEA 1CT2E 2ZDVH 4ZHLU 1AO5A 3E0NB 5GIBA 4DIHH 2DUCA 1SVPA 4GHQA 3SUEA 1HAZB 2PSYA 2ZFFH 4NZQA 4GVUA 3Q3XA 2A5KA 1SGFG 3FVFB 5A0AE 3V0XA 1C2KA 1GWAA 1GI4A 2ZU2A 2ZTZA 1ZPZA 1P2KA 2W5EA 1XM1A 1LCYA 3QLPH 1GBKA 3MO3A 1TABE 2AGEX 2FEQH 2FP7B 2ZDMA 2FOEA 2TGPZ 3MH4A 1HAGE 4A92A 4LZ1H 2QXIA 2GCHF 1FUJA 4YT6H 3RXIA 1BTPA 2ZCKP 5L2YH 3K6YA 2P94A 5A8XA 1MTNC 5HMAA 2AEIH 3TJUA 1C5RA 5HXFA 2BYAX 2ZWLH 2V35A 3M7QA 3NCLA 3PWCA 3QTOH 3RXPA 1BRBE 3H7OA 3T27A 2H5DA 3GICB 1UMAH 4SGAE 1P57B 3KQEA 2C8ZB 1O5FH 1B0FA 5EPYA 1C5SA 2AYWA 1W14U 4BAQB 1GMHF 4OS7A 4DG4A 4X1PU 2AGIX 1YYY1 1KDQA 3ZZ8A 1F2SE 1EATA 3KQCA 1ETTH 3FP8E 2ZG0H 2YNAA 4FUJA 2ZZUH 1TNIA 5B6OA 4UDWH 4I31A 1S84A 3EA8A 1FONA 1OOKB 3KCGH 2VWMA 4IS5A 4AX9H 5DP3A 4K1TA 3QWCH 4IN1A 1A3BH 4NIVA 4INHA 1AKSB 4CRDA 1S81A 1W2KH 1O2KA 1B7XB 3SJKA 1QB6A 1KY9A 2JETB 1GBEA 2STAE 4ZKSU 1EOJA 4VGCC 1C2MA 4JYUH 4AORA 2ANYA 1TPPA 3FZZA 1ZSLA 3RXGA 1VR1H 3HKIB 4BTUB 3VXEH 2PGQB 4K69A 3KN2A 3M5OA 5EQRA 1QL8A 1LVOA 1RXPA 3A8CA 4D7GA 3T2NA 1BTWA 1JWTA 2EEKA 2XCFA 3M5NA 4LK4A 4ABFA 1GJ5H 4WF8A 3EDXB 1GMDG 3Q77A 4NCYA 1P3EA 1UCYH 1NRPH 1UK2A 2FWWA 2SGQE 1EPTB 1V2UT 2A4OA 3GCTF 4D8NA 1DWEH 4MG3A 1W3CA 5TJXA 1HXFH 3Q3YA 3EQ0H 1TNLA 4X1NU 1TAWA 3DFLA 1MMJN 3SJOA 4OS5A 2FI3E 3QUMP 1J14A 3LOXA 4D76A 1FAXA 2FOGA 2AS9A 4RN6A 1YP9A 3A8AA 1DANH 4O03A 2GZ7A 3A8DA 1O5DH 1TNKA 3ZZ5A 2ALVA 3RXKA 1SR5C 4NA7A 1RGQA 5F8ZA 4UONA 1MAXA 4NZLA 4HGCA 1TE0A 1C5MD 4AYVB 3HKJB 2J92A 3MH5A 1LHCH 1D3TB 3VPKA 2P8OB 1ESAA 2PR3A 4WJG2 1EJNA 2Z7FE 4R0IA 1LVMA 1GBHA 1N1LA 2OQUA 5A09A 1L1NA 2GZ8A 2O9QA 2OCVB 2R2WU 1GDUA 3GY2A 1SGNE 2FYRA 5CHAC 2XRCA 3FAOA 3V13A 1GBLA 5EGMA 1GGDC 3BEIB 1OWIA 2C93B 3WY8A 1P02A 2Z94A 1GCTC 2ANKH 1EZSC 1SSXA 3ATWA 4R8TB 1VCQA 1OYQA 3M7TA 4IMZA 3C27B 2BY5X 2WINI 3OYPA 3PB1E 2WV5A 4Q7YA 4AGKA 1N6YA 1P12E 3RU4D 2O8MA 3A89A 5CMXH 1L0ZA 1SGQE 2OC7A 2A4RA 1GHVH 1XUHA 3UWIA 1F0TA 1JBUH 3QN7A 3BTGE 3F9HA 4AN7A 1O3JA 1O3GA 1GMDF 2CF9H 3A88A 6CHAB 1J15A 1Q2WA 3TK5A 1P05A 2VU8E 2OINA 3LGVA 1O3AA 3RXAA 4YO9A 2ZQ1A 3ZVFA 1AGJA 4U32A 4X6NA 3MU1A 1GJBB 3A86A 2GMTC 2BY8X 2EI6A 2GD4B 2ZI2H 4ISOA 1EAXA 3TH3H 1GBAA 1AZZA 4JYVH 2XC0A 3UNRA 3LONA 1BDAA 1QJ1B 2BOHB 2PW8H 2HGTH 1KIGH 3E6PH 3GDVA 4ZUHA 2BZAA 4DOQA 1H8IH 3VB7A 5LPFA 2A5AA 4SGBE 1O31A 2RA0A 1SFIA 4FUCA 3V7TA 4DY7B 3RMNH 4KGAA 2BXUH 1WOFA 2ZHWH 3RXVA 4AG1A 1F5KU 3SV9A 1NM6A 2ZDNA 4RSPA 2V6NA 1AFQB 4GCHF 1SGCA 2P59A 3RXUA 5FAHA 1O2HA 1C4Y2 1SGPE 4DCDA 2BLQA 1D6RA 4THNH 1C1UH 5T6GA 1HNEE 2AH4X 4WWYA 2IOTA 5FCRA 2PSXA 4ZHMU 1A46H 4XBBA 2ZFSA 3S69A 4KKDA 4NWLA 3W94A 1NZQH 1D3QB 2BD4A 1O3IA 4BTTB 3M3TA 2B8OH 1SGDE 2J34A 4ABIA 4DJZB 1UTKA 1P3CA 2UUFB 1Z71A 1F5RA 2H9EH 3K2UA 3MNSA 4X1RU 5FPYA 2VH6A 1DX5M 1GHXH 3AAUA 2WUCA 1DFPA 1CU1A 1BHXB 3P6ZB 1GBCA 1PPEE 2XBVA 5JBAS 1IQHA 3EAJA 2QY0B 1C1VH 4I33A 3O8DA 2H1UA 5FX5A 2GV7A 1WU1A 4Y7BA 3SQHE 1HUTH 2A4GA 1QBNA 1QHRB 2UUKB 7GCHG 3PO1B 3HK6B 1ZRBA 4Y7AA 1Y3WA 3GYLB 1S85A 1GI6A 4YOIA 2J9NA 3D62A 1UTPA 1E0FD 2WV4A 1AI8H 1KDQB 3SJIA 4BOHA 1NT1A 2BY9X 3ZZDA 1LQEA 3T25A 3Q00A 1VITG 1VJAU 3EYDA 3QK1A 1P2OA 1UVUH 5JBTA 1ZOMA 1KLTA 1SL3A 1L4DA 2QAAA 2OC1A 2BX3A 4CHAB 1JRSA 1FNIA 1LMWB 3BIVH 2ZCHP 1XVMA 2H2ZA 1FY3A 2OBQA 3BG8A 3CENA 1T4VH 2OP9A 2ZF0H 1RIWC 3LC3A 3E0PB 3ZV8A 5C1XA 2HOBA 3RXBA 4FUFA 1SGFA 2I6SA 4K5ZA 4Y0YE 1V2QT 1BOQA 3LIWA 6GCHF 5DG6A 1QNJA 3O8BA 2JKHA 3M36A 3VXFH 3M37A 5C2ZA 3MNBA 2DE9A 5FPSA 2I6QA 1SGRE 5DP6A 1O3FA 1GVKB 1UTLM 1ZLRA 3NUMA 1GVLA 5F03A 1PQ7A 5AFYH 1IQJA 2OBOA 2BD8A 2A7JA 3RU4E 2G51A 1E34B 4CBOA 4YLUA 3D23A 5L30H 1G3DA 1HYLA 3ZV9A 1TBZH 2W7UA 3PYHA 3SHCH 5BPEA 3A81A 1SQAA 4NIYA 1UHBA 4OS4A 2G81E 1K28D 1S5SA 3UOPA 5TCAA 2VVCA 4LZ4B 4BXSA 5T3HA 4FU7A 1ANBA 5C3NA 3SORA 3BTME 2QYIA 3U8TH 2QCYA 1CO7E 2F9OA 1GDNA 1L2EA 2WPKS 3GISB 3VB3A 1ELGA 2Q1JA 1CGJE 3MO9A 3O8RA 4LOYH 1DWCH 1YPLH 3ATLA 1HGTH 4Q2KA 1EAWA 1GHBF 3A80A 3QX5H 3TH4H 2V0BA 1G3CA 1NS3A 1GBTA 2GVFA 4H4FA 1GI1A 1G36A 3FFGA 4YESB 1ZYOA 2ODQA 1V2PT 3ATKA 2P3TB 2XNIA 4BANB 3QDZB 4NSVA 3T5FH 2FMJA 7GCHF 9ESTA 2C90B 3GY7A 4X1QU 1HJAC 1ZTJA 4JZDH 2Z9KA 2VVVA 2NU3E 2ZDLA 2Q6GA 3E8LA 2R0LA 3A7XA 1Z6JH 4Q7ZA 1EKBB 4B75A 4CREA 4CRFA 6ESTA 4XBDA 3AW1A 2GKVE 3LH1A 1GHWH 1QR3E 3SU3A 1P11E 2XBXA 3DA9B 3T26A 2ZGCA 1Z8IB 2BVRH 4WVPE 1XKAC 3QZQA 1FPCH 2HNTF 1GJ7B 4FU8A 3UQOA 3T62A 4YLQH 2HWLB 1BTHH 5GPIB 5K7RA 2NU4E 4NFFA 1HJ9A 1P04A 1GJ8B 4UFFH 1OS8A 3R3GB 3GDUA 1SPJA 1NRRH 4JMYA 1TWXB 4CH8B 1TQ0B 4X0WU 1V2TT 1HB0B 1T8NA 4OS6A 2VWLA 1Y3YA 4LXBH 3SUFA 3SUDA 1EQ9A 2HNTC 4ZXXH 3U9AH 3U98H 3SW2B 1IAUA 1MAYA 1ANDA 1C5PA 2A7CA 3BV9B 3EGKH 3IITA 1NPMA 3CS7A 2C3SA 1S6HA 2BM2A 3QZRA 2ANMH 1MKWH 3SU6A 1V2OT 3RXTA 2ZC9H 3P17H 1W0YH 4Z0KA 1HAIH 3BN9A 1VZQH 2JH5D 1F92A 3GDSA 2UUJB 4I8JA 4NGAH 2ESTE 5EOKA 7KMEH 3TGKE 1K9OE 2C4FH 2R3UA 4HZHA 3MOCA 2GT8A 1MZAA 3GOVB 1QIXB 4WY3A 3SI4H 4Y8XA 2CHAC 2TBSA 3F9EA 6LPRA 3NKKA 2OQ5A 1NFWA 1XUFA 2VVUA 4KTSA 2QF0A 3A7VA 4YT7H 3STIA 1Y5UT 2PKAA 4INKA 1YPKH 1MTNB 1UO6A 3LT3A 4F49A 3TJVA 2B7DH 1J17T 3MWIU 3B8JA 1SB1H 8LPRA 1UTOA 1ELCA 1MU6B 1AMHA 2P3UB 4AGJA 2TPIZ 1SGTA 3NK8A 4TWYA 1KXFA 3SHAH 1H9LB 1P8VC 3PM3A 4JK5A 2GP9B 1RRKA 1O0DH 2ULLA 3GCTG 4JCNA 1YF4A 2OC8A 4ABGA 5C5OA 3RDZA 1V2JT 2J2UA 2OUAA 3ZZCA 1FY4A 1EZQA 3UR9A 4ZKNU 4J1YA 5K0HA 1UJ1A 1C5UA 1H1BA 1GL0E 5T6FA 5ABWA 1SHYA 3F68H 4E05H 3NZIA 4UD9H 4ABHA 1ZSJA 2XBYA 4ZKRU 1QRWA 3VB4A 3S9BA 1QA7A 1OSSA 1FDPA 1LKAA 3AAVA 4NWKA 2BD9A 2HALA 3TNTA 1G32B 1T32A 1C1TA 2J4IA 2V3OH 4XOJA 5C5NA 4VGCB 3D49H 4FXGH 4IW4E 1TMTH 1PQ8A 3R0FA 5EODA 3VB6A 3SU2A 3RXFA 1GBBA 1KTSB 1W11U 1IOEA 1XUIA 1W7GH 1QB9A 1L1JA 1G9IE 3MHWU 1Y5AT 3ELAH 1TIOA 1EJMA 1TMBH 4A6LA 1JIRA 3RXQA 1W13U 5AF9H 1AVWA 4TPYA 1TRYA 3SUGA 4WMFA 1MD8A 1XUJA 1GHAF 2PFEA 1SLWB 1LKBA 2BLOA 2QV1A 3OSYA 5DP9A 2ALPA 1ZJKA 1K21H 8ESTE 1MBMA 4ZKOU 3TIUA 1GI3A 1RTLA 2CN0H 1ACBE 3E91A 3AW0A 9LPRA 2A32A 3RP2A 4OGXA 4XE4A 1P03A 1EAIA 2PGBB 2Z6BD 2QA9E 2F9BH 1UVOA 2CJIA 5FHTA 3K6ZA 1DY8A 1ZHRA 4PROA 3FANA 5ETXA 4RKOB 1EX3A 5CE1A 1G37A 2D26C 1O2PA 1MU8B 1NESE 4BAHB 2B5TB 1PPGE 3BTHE 4UFGH 3P8FA 1F5LA 4TWWA 1M9UA 1LO6A 1AVGH 1A61H 2C8WB 2AFQB 1MD7A 1PJPA 2ODYB 3GCNA 4XFQA 2HLCA 1UVSH 2GCTB 4UE7H 3KNXA 1BJVA 5CHAB 1WV7H 2WYJA 5FX6A 1UTQA 2VIQA 4BTIB 2FESH 1LHGH 5E2OA 3GY3A 3SN8A 1RFNA 1AB9C 2WPJS 2NU1E 5T6DA 2BD2A 1W8BH 3L6PA 2ZKSA 1ELTA 1S6FA 1UHBB 1GGDB 3SU4A 4AB9A 1L1GA 2XBWA 1CBWC 1QQ4A 1TRMA 1Z1JA 2G4TA 2FTMA 1GCTB 4ISHH 1PQ5A 1GBFA 1PYTC 1V2VT 1ABIH 1A1RA 2ZFQH 1XXDA 3KHVA 3SO3A 4WMDA 1TGSZ 2VIPA 3T29A 3MNCA 1O3HA 3A7TA 2TGDA 3C1KA 3GCHC 1Y3XA 1YKTA 4NA8A 2VIOA 3PMHB 1AFEH 4GCHG 1AVXA 2VNTA 2FOCA 2BLVA 1WTGH 1GI2A 1G2LA 1O3OA 1P0SH 1BTUA 1B5GH 5AHGH 1QL9A 2GMTB 1TA2A 2ZTXA 1DDJA 1ZJDA 1HBTH 4X2VA 1A5GH 2A1DB 2A4QA 1ETRH 3H7TA 3RC4A 1V3XA 1RS0A 2WPHS 1LQDB 3ZZ3A 4B74A 1O36A 1EPTC 2J38A 4Y71A 3F1SB 4INLA 5E0HA 3ZZ4A 2FLRH 1FIZA 2BZ6H 1ZPCA 3B23B 3UIRA 2BMGB 3LJOA 4U2WA 1KXDA 3SZNA 3TVJB 1FN8A 1SMFE 3LJJA 1NROH 3SGBE 2ZFTA 1H8DH 1WQSA 3BF6H 1W12U 3K9XB 1P2IA 3VFEA 1BCUH 1CT4E 1GG6C 1THRH 5PTPA 1A7SA 4NIXA 1FMGA 4YOJA 1K1JA 1MTSA 1UVPA 2BDGA 4KP0A 5DP4A 3M7UA 2XYAA 1LPZB 1N6XA 5JBBS 2H9HA 3PMJA 2ZHEH 1OWHA 1BQYA 2FOAA 1HAHH 4ISIH 3KQBA 3UWJH 1SQOA 1T7CA 2P16A 3RXOA 1C2EA 2BD5A 2FI5E 2ZPRA 1QBOA 4AOQA 1GHYH 1NN6A 1IHTH 1C2IA 3BTWE 1YLDA 1OPHB 2OXSA 3VB5A 2J95A 2XC5A 1CHOG 1HLTH 1QQUA 1YPHC 1AD8H 1E36B 1DM4B 1OWJA 1XVOA 3MI4A 6GCHG 2F91A 3OTJE 1AN1E 1W10U 1GI7B 3PWBA 4KTCA 3U8RH 1DLKB 3L33A 2ZU3A 2PKAB 3RXRA 3FP7E 4NA9H 1BBRK 1GJCB 1RTKA 1A5IA 1JRTA 5ESBA 1V2WT 1C2DA 1O32A 4GAWA 1VGCC 2VINA 2JH0D 1NY22 5IYTA 3E1XB 3Q76A 3GY4A 4XDEA 3EE0B 1UTJA 3MH6A 1NO9H 4YTAA 4BXWA 1PPBH 8KME2 1MUEB 2W3IA 3A85A 2WPMS 1XKBC 1C1QA 2NWNA 3BG4C 1O2VA 1C5OH 1O2OA 2FO9A 1Z6EA 1TA6A 1FY5A 1S82A 2P95A 1S83A 3ITIA 2G5VA 1HJ8A 1TX6A 4RKJB 1GJ4H 1C5QA 4BAOB 4JZEH 5HGGA 4Y8YA 1P9UA 1MCVA 1SFQB 1RIWB 4DURA 1DY9A 2HPQH 2O8LA 1KSNA 3UPEA 2CGAA 2FYQA 1GHBG 3RXDA 5EQSA 1K2I1 4YM9A 2AIQA 4MPVA 4HI3A 1MBQA 2C8XB 3RM2H 1VCWA 3QO6A 2ZFRH 1MQ6A 3ZVDA 4O3TA 4Q7XA 5C1YA 1O2WA 3A8BA 2GV6A 1Y3VA 2M5TA 1C2JA 3SI3H 1GVZA 4AFSA 2ZCLP 5F8XA 2VWNA 4UEHH 4O9VA 5SGAE 1FN6A 1ZGIA 1MZDA 1QA0A 3PMBB 1IHSH 3SQEE 3UUZA 3I78A 5EG4A 4FUHA 1QJ7B 2FX6A 1OYTH 3P95A 1XMNB 1O2TA 2G00A 3AVZA 5G4BA 5HM9A 2BVSH 4ESTE 2GX4A 1DT2A 3ESTA 1BBRH 4WXVA 8GCHF 1LHEH 1TBRH 1NRNH 4A1TA 1UK3A 3PROA 1H9IE 3RUOA 4Z6AH 3HGPA 2BLWA 2SGAA 1CHOF 2RG3A 3MTYA 3JZ2B 3ODDA 1K1IA 1O2NA 1HV7A 1Q31A 5AFZH 4A1VA 2XWAA 3PMAB 4JYTA 2D2DA 5TCCA 1C2HA 1C2FA 1CT0E 4OGYA 1C4V2 3GY8A 4B73A 3UREA 1YCPK 3KQDA 1K1LA 2ZO3H 3EA7A 1U6QA 1IQMA 2YOLA 1A3EH 3SNAA 3MO6A 5EXMA 4MPUA 1HJAB 1KXEA 3M3VA 2ZHQH 4X8UH 1ZZZA 3FP6E 5EU8A 2ODPA 4CH2B 2XTTB 1Y3UA 4I32A 1ZMNA 4U30A 1WSSH 3HK3B 2V3HH 1J16A 2AGGX 2Y80A 1V2MT 1C5WB 1Q3XA 1HAYB 3CP7A 4I8GA 3V12A 1QTFA 1VITH 3UTUH 1BT7A 2A2XH 2ZDKA 1H9HE 3M5LA 2O8UA 1DPOA 2O8WA 1QBVH 2ZHFH 1DVAH 2FLBH 4AFZA 2H5CA 4TPIZ 4ABAA 1FZZA 2Q6DA 1UK4A 1BTYA 2PV9B 4H6SB 2AMQA 2VGCC 1CA0C 1MKXK 1QGFA 1DSUA 1NU7B 2ZIQH 1KXCA 3RXSA 2QGRA 4JZIA 1F7ZA 1HAOH 3P70B 3P8NA 2FOBA 4WH6A 1ZTLA 4NSYA 1AUTC 1O38A 4FUIA 2P93A 3UNSA 4X2YA 1V2ST 1Z1IA 1IQKA 3IWMA 2F9PA 1O3EA 4X2XA 1SGIB 3VGCC 3EA9A 1EJAA 3QTVH 1C1OA 3OY6U 1BITA 3ZZBA 3SV6A 1Z7KA 1ZGVA 3RC6A 2FM2A 4BAMB 3S0NA 2VIDA 4ABDA 1NU9A 2O8TA 1EUFA 1HDTH 2Y7ZA 4FUDA 1T4UH 2CHAB 4MNXA 1GCDA 1K1PA 4A1XA 1J8AA 3PLPA 1HAPH 1GI5A 2KAIA 1ZSKA 5JDUB 2Y5GA 2ZA5A 1BZXE 1DE7H 3M61U 1TNHA 4K8YA 2HVXA 1EB2A 1SI5H 1YBWA 2G55A 3T28A 3ZYEA 5JYIA 2ZQ2A 5FBEA 1N8OC 2BDHA 1AQ7A 1LHFH 4I8LA 1O3BA 1ELFA 3FZDA 4ZHAA 1K1NA 2ZEBA 2FS9A 3SU0A 3PTNA 2BQWB 1BA8B 1NRQH 2BXTH 1P01A 1KXBA 4IC5A 5E8EH 1PPFE 4GSOA 2XC4A 5GXPA 1GHAG 1XUGA 5BRRE 5A2MH 3HGNA 5EQQA 5E0JA 1MH0A 2C8YB 1INCA 4FUBA 2WYGA 3SGAE 1TYNA 1MKXH 1FLEE 1SGYE 1BMLA 3MMGA 2BX4A 4WH8A 3TLOA 3ZZAA 4B71A 3E16B 4GUXA 3KF2A 1GBMA 3RU4T 4X6PA 5JPMH 1HIAA 1WQVH 2Q6FA 3PLKA 4DW2U 5DPAA 2F3CE 1GBDA 2AMDA 3UY9A 1A0JA 1B0EA 4ASHA 3BEUA 2F83A 3ZVGA 2GT7A 1GHZA 3E3TA 3K65B 2ZGJA 3OY5U 4TYDA 4MQAA 1CGHA 1TNJA 2PKSC 3LGTA 1QCPA 1QL7A 1OWKA 1TPAE 2BDBA 3S7HB 4U01A 1XUKA 3TNSA 5EW2H 2SGFE 3LGUA 7LPRA 5J4SA 1ANEA 4TY6A 2A7HA 1O2ZA 2ILNA 2OTVA 3PTBA 1ELVA 2LPRA 2TGTA 2XWBI 1AIXH 2PWXA 4GPGA 3DT0H 3H5CB 2XCNA 1O3KA 1JXPA 5GWZA 2ZTYA 2FOHA 1QJ6B 5GDSH 1GBIA 5DKMA 1ZHMA 1TNGA 5I25A 2H6MA 1O2RA 1JOUB 3SJ9A 1AE5A 4MNWA 1DICA 1BBRE 5GJ4B 2QF3A 1O30A 3URDA 3KIDU 1HAXB 4CRAA 1O5CB 1S0RA 1C5XB 3OU0A 2UWPA 3TU7H 3IG6B 1C1WH 4H42U 3SBKA 1G2MA 2SFAA 3F9GA 3ZVBA 5IDKA 1BUIA 2Z9GA 1SHHB 5HM2A 5DK1A 1OP2A 1CHGA 1Z8GA 1QFKH 2QC2A 3BTQE 1MQ5A 5DGJA 2AERH 1PPCE 1UCYK 3MFJA 4HTCH 5L6NH 1W0ZU 3BTDE 1GDQA 2Y81A 3P92A 1FI8A 1AY6H 1AU8A 1O34A 1ESBA 2A2QH 2K1QA 2TGAA 3RMLH 5F8TA 5EXNA 3DHKH 2Z9JA 3M3SA 4D9QA 1W7XH 4X6MA 1O2MA 3DD2H 2PUXB 3TGIE 2R2MB 3U8OH 1TX8A 1SLXB 1O3MA 3W95A 2FOMB 2QXHA 2F9UA 3RLYH 1AB9B 1FY1A 2FX4A 4CRCA 5LGOA 3ZYDA 2QIQA 1HFDA 1MTVA 1CBWB 1D3PB 5DP7A 3SV8A 2BDAA 5LH8A 2BQ6B 3ZZ7A 2FPZA 1EXFA 4UFEH 1IQGA 1A0LA 1QRXA 1WYKA 2FXRA 1OX1A 2HNTE 1P2JA 4ABBA 1EZUC 1GL1A 4MTBA 2BY7X 4DIIH 3TH2H 1V2NT 1C1SA 4UFDH 3SU1A 1QB1A 2BVXH 2G4UA 3GCHB 1SC8U 1V2RT 3ATMA 2BTCE 1O2UA 3TJNA 1C5NH 3QGNB 4B2AA 2GGVB 3KGPA 1YPJH 1WAYB 1PYTD 4MVNA 1ARCA 1VJ9U 1DLEA 1YPMH 5FPTA 1ELEE 5DP5A 4X2WA 5A0BA 2PLXA 4FUEA 1TBQH 4I8KA 4IN2A 1O35A 2BOKA 2ZNKH 3TK6A 1FXYA 3GY5A 4Y0ZE 3UOUA 4BNRA 3SGQE 2CMYA 1SLUB 1WBGB 2A0QB 2SNWA 1NTPA 3U1IB 2ZU5A 2W26A 2YNBA 4WXIA 1NC6A 1OP8A 1YPEH 5DO4H 1GJ9B 3ENSB 2W7SA 2XW9A 4IMQA 5JBCS 1KLJH 3HATH 2ZPQA 3TJOA 1QRZA 3ZVEA 3URCA 1E37B 2UWOA 4DGJA 2STBE 5I46H 1GJDB 3LC5A 3LDXH 1DOJA 1YGCH 4MNVA 1CE5A 1GG6B 4CR9A 2VWOA 2JETC 3KL6A 4F4OC 1P06A 1ELBA 2FOFA 1F0SA 3RM0H 2G52A 1MCTA 4M7GA 1YM0A 4A7IB 2DE8A 4OS2A 3RXLA 2VIWA 1O39A 1RD3B 2UUYA 5AVDA 2GTBA 1XX9A 1TMUH 4ZXYH 1O3CA 3E90B 1YC0A 3RMMH 1D4PB 1DSTA 1E38B 3Q3KA 3VEQB 3OX7U 4ABEA 2GCTC 1RJXB 1THSH 1CVWH 1TQ7B 3S9AA 1CGIE 2GZ9A 1THPB 1RTFB 1EP6A 1ZHPA 3LKWA 1GJAB 2SGDE 1LPGB 3V3MA 3PV4A 1TX7A 1BMAA 2BQ7B 1LPKB 1MTUA 4FVDA 5ESTE 5FCKA 1AWHB 4AG2A 1J9CH 1ETSH 1OWEA 2AMPA 4XBCA 3I29A 2QXJA 1ESTA 1PQAA 3P8GA 1P10A 2HRVA 2KAIB 5LPEA 5EXLA 5A8ZA 2ZGHA 2PTNA 1DS2E 1C5ZB 1A4WH 1GBJA 2AIPA 2Y5FA 1O2JA 1VGCB 1BJUA 4FUGA 1O5GH 4E7NA 1O3LA 1O5EH 2VJ1A 4B1TA 5JB8S 2OD3B 2Z9LA 1K22H 1L4ZA 3KEEA 3RXHA 3RXEA 3MU5A 3RC5A 2P8OC 1ELAA 1YLCA 4B2BA 4D7FA 1UTMA 1HRTH 3BG4B 1HAVB 4YOGA 1O3NA 8GCHG 2ASUB 4XSKU 2BDCA 2FDAA 3A7ZA 3P8OA 1O2IA 1AUJA 4K60A 5GCHG 2XXLA 4IBLH 1CQQA 1TGTA 4YZUA 2WPLS 1C5LH 1TPSA 2IPHA 4ABJA 2RCEA 4GHTA 4GLYA 2ZGBH 4I7YH 2LNCA 1LDTT 3UQVA 1IQFA 1HIAB 4JK6A 4I8HA 2ZDAH 3M5MA 7ESTE 4QT8C 1X7AC 2B9LA 3TPIZ 1Y8TA 2Y82A 1O3DA 4JZ1A 1A2CH 3MYWA 4O97A 1GI8B 1OP0A 1TFXA 2OC0A 2FI4E 2UWLA 1C1RA 1EOLA 2PUQH 3MH7A 4NIWA 2ZP0H 4E06H 2IN2A 2Z3CA 1O37A 4DVAU 4Y79A 4H6TA 3D65E 1PPZA 1TGCA 1TONA 1JIMA 5LPRA 1C5YB 4X8VH 2Y6TA 1GI9B 3ZVAA 2GDDA 6CHAC 3S9CA 1EAUA 1F0UA 2ZHDA 2PHBA 3ZVCA 1TLDA 3ZZ6A 5F6MA 5H4IB 3GCOA 3BSQA 4K1SA 3BTTE 4KTUA 3BTKE 2FODA 1C9TA 4X1SU 1C5VA 4K2YA 2ANWA 1T8LA 3TK9A 1C5TA 1Z8RA 1ZR0A 4K3JA 3BIUH 1FV9A 3SJ8A 2B0FA 4KELA 1BIOA 1DXWA 1LTOA 2IJOB 3SNCA 1O2QA 3ZZ9A 2R3YA 4A5TS 5JB9S 4MDSA 3U69H 4ZROA 3GYMA 1K1MA 1GMCG 1ARBA 4Y10E 3BEFB 1OKXA 2ZU4A 1ORFA 1TPOA 3M35A 2TRMA 2Y7XA 5C1UA 4ISNA 4X8TH 2THFB 1AFQC 3N7OA 1IQNA 1ID5H 1O3PB 1EP5A 3NXPA 4AZ2B 2R9PA 2QXGA 3LGIA 1TOMH 1NFXA 1P2QA 4WMEA 4Q80A 3RMOH 4CBNA 1P2NA 1O2YA 1LVBA 1UCYE 2FZZA 4IC6A 1Y5BT 1ANCA 3NPSA 5GCHF 2SNVA 5C67A 2ZPSA 2W3KA 2OLGA 1BHXF 3MU0A 1OWDA 3MU4A 2J94A 2BD7A 2QN5T 3SNEA 1WUNH 3TGJE 3UNQA 1AKSA 1TOCB 4TY7A 1SLVB 4JZFH 1GJ6A 1NRSH 2BD3A 2BB4A 2VGCB 3LH3A 1QY6A 1CA0B 1C9PA 1BRUP 2ZU1A 1AZ8A 4DT7B 1SG8B 4K8BA 2G5NA 1VCPA 4MNYA 1NFYA 1A0HB 3RLWH 1HPGA 1A5HA 3PO1C 4CRBA 2CXVA 2P3FH 2FTLE 3VGCB 1P2MA 5C20A 1SBWA 5A8YA 2CF8H 1EPTA 2ZECA 1O2LA 4B76A 1C1MA 1YPHE 5EPNA 3SNDA 2A5IA 4AFQA 4FU9A 4NG9H 2H9TH 1BTZA 4MPXA 1K1OA 1H4WA 3MNXA 3A82A 1O2XA 4AYYB 1BMNH 3G01A 1P9SA 4AFUA 1OXGA 5DP8A 4CHAC 1C2GA 2WUBA 2TIOA 1MKWK 2EC9H 1D6WA 3LGYA 3LPRA 1KYNA 1KTTB 3S7KB 1FY8E 1FPHH 1CSOE 3L3TA 3B9FH 3JZ1B 1YCPM 1N8OB 1Y59T 1KXAA 1GMCF 2Z3DA 1BRCE 1LVYA 1AWFH 3PLBA 3MU8A 2EI7A 2ZGXH 2G8TA 1PPHE 1P09A 3LU9B 3U1JB 3CS0A 1DWDH 2A45B 4CR5A 1DUAA
chains in the Genus database with same CATH superfamily
4O3UA 1D9IA 2CV3A 1TGBA 1O2GH 2F9VA 2Y5HA 1G3BA 1YCPH 3SV2H 2KFWA 2RA3A 3ATIA 1HCGA 1D3DB 1ABJH 2V3MA 3SV7A 1O5AB 1SOTA 3AASA 4OS1A 1KLIH 3BTEE 1DXPA 1AE8H 2A31A 4X8SH 1YPGH 1TB6H 4AB8A 4ISLA 4Y76A 2FS8A 4NFEA 5E2PA 2JH6D 2R0KA 5E0GA 3F9FA 1F0RA 1C1PA 5CDFE 1E35B 1VITF 1SGEE 4FVBA 5T1VA 1ZPBA 5HYOA 2SGEE 3NWUA 1EASA 3QGJA 5L2ZH 1XXFA 1V6DA 2BY6X 4ZH8A 1UTNA 3ODFA 1T8MA 2NU2E 2D8WA 3A84A 1O33A 1ZRKA 2GCHG 2PKSB 2Z9IA 3RXMA 1ZMJA 3DFJA 1QURH 5FXLA 4MPWA 3SOSA 2HPPH 4ZAEA 5EJ1A 2FIRH 4CRGA 1C2LA 1G30B 2NU0E 5A0CA 1WCZA 4Y6DA 1W0JD 2VIVA 1DWBH 1T8OA 2ZFPH 1HAVA 2SGPE 3DUXH 3STJA 1ZMLA 1Z8JB 1HXEH 1BTXA 1TGNA 1PFXC 4B2CA 1GMHG 2BDIA 1S0QA 4X6OA 1TALA 2F9NA 2RDLA 3LGWA 1LHDH 4J2YB 2Z3EA 1BMMH 3A7YA 1FIWA 1C4U2 3A83A 4BAKB 1FQ3A 1IQLA 3DSGA 2BHGA 2EA3A 2EI8A 1WTHD 1AHTH 2VH0A 1UVTH 5J4QA 3A7WA 1JMOH 1G3EA 1GPZA 2PTCE 1BB0B 2WPIS 3RXJA 1V2LT 4ZMAH 3O8CA 1C1NA 1ELDE 2K0QA 3BTFE 3SU5A 4IGDA 1DUEA 3SNBA 5EW1H 3I77A 1BRAA 3HPTB 4E7RG 1IQIA 2GDEH 3GY6A 4Y11E 1ZTKA 4HFPB 4Y8ZA 1O2SA 1GI0A 2RFKC 5FBIA 1MTWA 1TRNA 1DITH 3RXCA 2VB0A 3UR6A 4K1EA 1EB1H 1V2KT 5DJ7A 2BDYA 4HG6A 1SQTA 1SOZA 3GS9A 1NFUA 3F6UH 1FJSA 3TITA 3UFAA 1CA8B 1FAKH 4MLFB 1O5BB 3A87A 1T31A 1EZXC 2D1JA 4D9RA 1IQEA 1CT2E 2ZDVH 4ZHLU 1AO5A 3E0NB 5GIBA 4DIHH 2DUCA 1SVPA 4GHQA 3SUEA 1HAZB 2PSYA 2ZFFH 4NZQA 4GVUA 3Q3XA 2A5KA 1SGFG 3FVFB 5A0AE 3V0XA 1C2KA 1GWAA 1GI4A 2ZU2A 2ZTZA 1ZPZA 1P2KA 2W5EA 1XM1A 1LCYA 3QLPH 1GBKA 3MO3A 1TABE 2AGEX 2FEQH 2FP7B 2ZDMA 2FOEA 2TGPZ 3MH4A 1HAGE 4A92A 2WPDD 4LZ1H 2QXIA 2GCHF 1FUJA 4YT6H 4DT4A 3RXIA 1BTPA 2ZCKP 5L2YH 3K6YA 2P94A 5A8XA 1MTNC 5HMAA 2AEIH 3TJUA 1C5RA 5HXFA 2BYAX 2ZWLH 2V35A 3M7QA 3NCLA 3PWCA 3QTOH 3RXPA 1BRBE 3H7OA 3T27A 2H5DA 3GICB 1UMAH 4SGAE 1P57B 3KQEA 2C8ZB 1O5FH 1B0FA 5EPYA 1C5SA 2AYWA 1W14U 4BAQB 1GMHF 4OS7A 4DG4A 4X1PU 2AGIX 1YYY1 1KDQA 3FO8D 3ZZ8A 1F2SE 1EATA 3KQCA 1ETTH 3FP8E 2ZG0H 2YNAA 4FUJA 2ZZUH 1TNIA 5B6OA 1SKYE 4UDWH 4I31A 1S84A 3EA8A 1FONA 1OOKB 3KCGH 2VWMA 4IS5A 3PV2A 2XNDD 4AX9H 5DP3A 4K1TA 3QWCH 4IN1A 1A3BH 4NIVA 4INHA 1AKSB 4CRDA 1S81A 1W2KH 1O2KA 1B7XB 3SJKA 1QB6A 1KY9A 2JETB 3MQKC 1GBEA 2STAE 4ZKSU 1EOJA 4VGCC 1C2MA 4JYUH 4AORA 2ANYA 1TPPA 3FZZA 1ZSLA 3DCLA 3RXGA 1VR1H 3HKIB 4BTUB 3VXEH 2PGQB 4K69A 3KN2A 3M5OA 5EQRA 1QL8A 1LVOA 1RXPA 3A8CA 4D7GA 3T2NA 1BTWA 1JWTA 2EEKA 2XCFA 3M5NA 4LK4A 4ABFA 1GJ5H 4WF8A 3EDXB 1GMDG 3Q77A 4NCYA 1P3EA 1UCYH 4XD7D 1NRPH 1UK2A 3OEHD 2FWWA 2SGQE 3OTPA 1EPTB 1V2UT 2A4OA 3GCTF 4D8NA 1DWEH 3DSOA 4MG3A 1W3CA 5TJXA 1HXFH 3Q3YA 3EQ0H 1TNLA 4X1NU 1TAWA 3DFLA 1MMJN 3SJOA 5KECA 4OS5A 2FI3E 3QUMP 1J14A 3LOXA 4D76A 1FAXA 2FOGA 2AS9A 4RN6A 1YP9A 3A8AA 1DANH 4O03A 2GZ7A 3A8DA 1O5DH 1TNKA 3ZZ5A 2QF5A 2ALVA 3RXKA 1SR5C 4ACBA 4NA7A 1RGQA 5F8ZA 4UONA 1MAXA 2GJGA 4HGCA 1TE0A 4NZLA 1C5MD 4AYVB 3HKJB 2J92A 3MH5A 1LHCH 1D3TB 3VPKA 2P8OB 1ESAA 2PR3A 4WJG2 1EJNA 2Z7FE 4R0IA 1LVMA 1GBHA 1N1LA 2OQUA 5A09A 1L1NA 2GZ8A 2O9QA 2OCVB 2R2WU 1GDUA 3GY2A 1SGNE 2FYRA 5CHAC 2XRCA 3FAOA 3V13A 1GBLA 5EGMA 1GGDC 3BEIB 4TT3D 3PRBA 1OWIA 2C93B 3WY8A 1P02A 2Z94A 1GCTC 2ANKH 1EZSC 1SSXA 2PP6A 3ATWA 4R8TB 1VCQA 1OYQA 3M7TA 5C0TA 4IMZA 3C27B 2BY5X 2WINI 4RT0A 3OYPA 3PB1E 2WV5A 4Q7YA 4AGKA 1N6YA 1P12E 3RU4D 2O8MA 3A89A 5CMXH 1L0ZA 1SGQE 2OC7A 2A4RA 1GHVH 1XUHA 3UWIA 1F0TA 1JBUH 3QN7A 3BTGE 4B6FA 3F9HA 4AN7A 1O3JA 1O3GA 1GMDF 2OK5A 2CF9H 3A88A 6CHAB 1J15A 1Q2WA 3TK5A 1P05A 2VU8E 2OINA 3LGVA 1O3AA 3RXAA 4YO9A 2ZQ1A 3ZVFA 1AGJA 4U32A 4X6NA 3MU1A 1GJBB 3A86A 3F2GA 2GMTC 2BY8X 2M2AA 2EI6A 2GD4B 2ZI2H 2VBCA 4ISOA 1EAXA 3TH3H 1GBAA 1AZZA 4JYVH 2XC0A 3UNRA 3LONA 1BDAA 1QJ1B 5IK2D 2BOHB 2PW8H 2HGTH 1KIGH 2CK3D 3E6PH 3GDVA 4ZUHA 3WW7A 2BZAA 4DOQA 1H8IH 3VB7A 5LPFA 2A5AA 4SGBE 1O31A 2RA0A 1SFIA 4FUCA 3V7TA 4DY7B 3RMNH 1NBMD 4KGAA 2BXUH 1WOFA 2ZHWH 3RXVA 4AG1A 1F5KU 3SV9A 1NM6A 2ZDNA 4RSPA 2V6NA 1AFQB 4GCHF 1SGCA 2P59A 3RXUA 5FAHA 1O2HA 1C4Y2 1SGPE 4DCDA 2BLQA 1D6RA 2JJ1D 1C1UH 4THNH 5T6GA 1HNEE 2AH4X 4WWYA 2IOTA 5FCRA 2PSXA 4ZHMU 1A46H 4XBBA 2ZFSA 3S69A 4KKDA 4NWLA 3W94A 1NZQH 1D3QB 2BD4A 1O3IA 4BTTB 3M3TA 4FETA 2B8OH 1SGDE 2J34A 4ABIA 4DJZB 1UTKA 1P3CA 2UUFB 1Z71A 1F5RA 2H9EH 3K2UA 3MNSA 4X1RU 5FPYA 2VH6A 1DX5M 1GHXH 3AAUA 2WUCA 1DFPA 1CU1A 1BHXB 3P6ZB 1GBCA 1PPEE 2XBVA 5JBAS 1IQHA 3EAJA 2QY0B 1C1VH 4I33A 3O8DA 2H1UA 5FX5A 2GV7A 1WU1A 4Y7BA 3SQHE 1HUTH 2A4GA 1QBNA 1QHRB 2UUKB 7GCHG 3PO1B 3HK6B 1ZRBA 4Y7AA 1Y3WA 3GYLB 1S85A 1GI6A 4YOIA 2J9NA 3D62A 1UTPA 5C17A 1E0FD 2WV4A 1AI8H 5HIZA 1KDQB 3SJIA 4BOHA 1NT1A 2BY9X 3ZZDA 1LQEA 3T25A 3Q00A 1VITG 2QE7D 1VJAU 3EYDA 3QK1A 1P2OA 1UVUH 5JBTA 1ZOMA 1KLTA 1SL3A 1L4DA 2QAAA 2OC1A 2BX3A 4CHAB 1JRSA 1FNIA 1LMWB 3BIVH 5C94A 2ZCHP 1XVMA 2H2ZA 1FY3A 2OBQA 3BG8A 3CENA 1T4VH 2OP9A 2ZF0H 1RIWC 3LC3A 3E0PB 3ZV8A 3DSPA 5C1XA 2HOBA 3RXBA 4FUFA 1SGFA 2I6SA 4K5ZA 4Y0YE 1V2QT 1BOQA 3LIWA 6GCHF 2HLDD 1QNJA 5DG6A 3O8BA 2JKHA 3AK5A 3M36A 3VXFH 3M37A 5C2ZA 3MNBA 2DE9A 5FPSA 2I6QA 1SGRE 5DP6A 1O3FA 1GVKB 1UTLM 1ZLRA 3NUMA 1GVLA 5F03A 1PQ7A 5AFYH 1IQJA 2OBOA 2BD8A 2A7JA 2QF4A 3RU4E 2G51A 2WV9A 1E34B 4CBOA 4YLUA 3D23A 5L30H 1G3DA 1HYLA 3ZV9A 1TBZH 2W7UA 3PYHA 3SHCH 5BPEA 3A81A 1SQAA 4NIYA 1UHBA 4OS4A 2G81E 1K28D 1S5SA 3UOPA 5TCAA 2VVCA 4LZ4B 4BXSA 5T3HA 1COWD 4FU7A 1ANBA 5C3NA 3SORA 3BTME 2QYIA 3U8TH 2QCYA 1CO7E 2F9OA 1GDNA 1L2EA 2WPKS 3GISB 3VB3A 1ELGA 2Q1JA 1CGJE 3MO9A 3UAIC 3O8RA 4LOYH 1DWCH 1YPLH 3ATLA 1HGTH 4Q2KA 1EAWA 1GHBF 3A80A 3QX5H 3TH4H 2V0BA 1G3CA 1NS3A 1GBTA 2GVFA 4H4FA 4F55A 1GI1A 1G36A 3FFGA 4YESB 1ZYOA 2ODQA 1V2PT 3ATKA 2P3TB 2XNIA 4BANB 3QDZB 4NSVA 3T5FH 2FMJA 7GCHF 3OEED 4YXWD 9ESTA 2C90B 3GY7A 4RI0A 4X1QU 1HJAC 1ZTJA 4JZDH 2Z9KA 2VVVA 2NU3E 2ZDLA 2Q6GA 3E8LA 2R0LA 3A7XA 1Z6JH 4Q7ZA 1EKBB 4B75A 4CREA 4CRFA 6ESTA 4XBDA 3AW1A 2GKVE 3LH1A 1GHWH 1QR3E 3SU3A 1P11E 2XBXA 4I86A 3DA9B 3T26A 2ZGCA 1Z8IB 2BVRH 4WVPE 1XKAC 3QZQA 1FPCH 2HNTF 3OE7D 1GJ7B 4FU8A 3UQOA 3T62A 4YLQH 2HWLB 1BTHH 5GPIB 3FKSD 5K7RA 2NU4E 4NFFA 1HJ9A 1P04A 1GJ8B 4UFFH 1OS8A 3R3GB 3GDUA 1SPJA 1YY3A 1NRRH 4JMYA 1TWXB 4CH8B 1TQ0B 4X0WU 4ASUD 1V2TT 3OAAD 1HB0B 1T8NA 4OS6A 2VWLA 1Y3YA 2WSSD 3EE7A 4LXBH 3SUFA 3SUDA 1EQ9A 2HNTC 4ZXXH 3U9AH 3U98H 3SW2B 1IAUA 1MAYA 1ANDA 1C5PA 2A7CA 3BV9B 3EGKH 3IITA 1NPMA 3CS7A 2C3SA 1S6HA 2BM2A 3QZRA 2ANMH 1MKWH 3SU6A 1V2OT 3RXTA 2ZC9H 3P17H 1W0YH 4Z0KA 1HAIH 3BN9A 1VZQH 2JH5D 1F92A 3GDSA 2UUJB 1EFRD 4I8JA 4NGAH 5EJLA 2ESTE 5EOKA 7KMEH 3TGKE 1K9OE 2C4FH 2R3UA 4HZHA 3MOCA 2GT8A 1MZAA 2YMSD 3KYFA 3GOVB 1QIXB 4WY3A 3SI4H 4Y8XA 2CHAC 2TBSA 3F9EA 6LPRA 3NKKA 2OQ5A 1NFWA 1XUFA 2VVUA 4KTSA 2QF0A 3A7VA 4YT7H 3STIA 1Y5UT 2PKAA 4INKA 1YPKH 1MTNB 1UO6A 3LT3A 4F49A 3TJVA 2B7DH 1J17T 3MWIU 3B8JA 1SB1H 8LPRA 1UTOA 1ELCA 1MU6B 1AMHA 2P3UB 4AGJA 2YMSC 2TPIZ 1SGTA 3NK8A 2JIZD 4TWYA 1KXFA 3SHAH 1H9LB 1P8VC 3PM3A 4JK5A 2GP9B 3FN8A 1RRKA 1O0DH 2ULLA 3GCTG 4JCNA 3N99A 1YF4A 2OC8A 4ABGA 5C5OA 3RDZA 1V2JT 3UB0A 2J2UA 2OUAA 3ZZCA 1FY4A 1EZQA 3UR9A 4ZKNU 4J1YA 5K0HA 1UJ1A 1C5UA 1H1BA 1GL0E 5T6FA 5ABWA 1SHYA 3F68H 4E05H 3NZIA 4UD9H 4ABHA 1ZSJA 2XBYA 4ZKRU 1QRWA 3VB4A 3S9BA 5EIYA 1QA7A 1OSSA 1FDPA 1LKAA 3AAVA 4NWKA 2BD9A 2HALA 3TNTA 1G32B 1T32A 1C1TA 2J4IA 2V3OH 4XOJA 5C5NA 4VGCB 3D49H 4FXGH 3W1EA 4IW4E 1TMTH 1FX0B 1PQ8A 3R0FA 5EODA 3VB6A 3SU2A 3RXFA 1GBBA 1KTSB 1W11U 1IOEA 1XUIA 1W7GH 1QB9A 1L1JA 1G9IE 3MHWU 1W0KD 1Y5AT 3ELAH 1TIOA 1EJMA 1TMBH 4A6LA 1JIRA 3RXQA 1W13U 5AF9H 5HIYA 2LP6A 1AVWA 2JDID 4TPYA 1TRYA 3SUGA 4WMFA 1MD8A 1XUJA 1GHAF 2PFEA 1SLWB 1LKBA 2BLOA 2QV1A 3OSYA 5DP9A 2ALPA 1ZJKA 1K21H 8ESTE 1MBMA 4ZKOU 3TIUA 1GI3A 1RTLA 2CN0H 1ACBE 3E91A 3AW0A 9LPRA 2A32A 3RP2A 4OGXA 4XE4A 1P03A 1EAIA 2PGBB 2Z6BD 2QA9E 2F9BH 1UVOA 2CJIA 5FHTA 3K6ZA 1DY8A 1ZHRA 4PROA 3FANA 5ETXA 4RKOB 1EX3A 5CE1A 1G37A 2KR7A 2D26C 1O2PA 1MU8B 1E79D 1NESE 4BAHB 1WXRA 2B5TB 1PPGE 3BTHE 4UFGH 3P8FA 1F5LA 4TWWA 1M9UA 1LO6A 1AVGH 1A61H 2C8WB 2AFQB 1MD7A 1PJPA 2ODYB 3GCNA 4XFQA 2HLCA 1UVSH 2GCTB 4UE7H 3KNXA 1BJVA 5CHAB 1SQRA 1WV7H 2WYJA 5FX6A 1UTQA 2VIQA 4BTIB 2FESH 1LHGH 2IJD1 3GY3A 5E2OA 3SN8A 1RFNA 1AB9C 2WPJS 2NU1E 2KCAA 5T6DA 2BD2A 1W8BH 3L6PA 2ZKSA 1ELTA 1S6FA 1UHBB 1GGDB 3SU4A 4AB9A 1L1GA 2XBWA 1CBWC 1QQ4A 1TRMA 1Z1JA 2G4TA 2FTMA 1GCTB 4ISHH 1PQ5A 1GBFA 1PYTC 1V2VT 1ABIH 1A1RA 2ZFQH 1XXDA 3KHVA 3SO3A 4WMDA 1TGSZ 2VIPA 3T29A 3MNCA 1O3HA 3A7TA 2TGDA 3C1KA 3GCHC 1Y3XA 1YKTA 4NA8A 2VIOA 3PMHB 1AFEH 4GCHG 1AVXA 1YWUA 2VNTA 2FOCA 2BLVA 1WTGH 1GI2A 1G2LA 1O3OA 3WWFA 1P0SH 1BTUA 1B5GH 5AHGH 1QL9A 2GMTB 4M9FA 4OM9A 1TA2A 2ZTXA 1DDJA 1ZJDA 1HBTH 4X2VA 1A5GH 2A1DB 2A4QA 1ETRH 3H7TA 3RC4A 1V3XA 1S6LA 1RS0A 2WPHS 1LQDB 3ZZ3A 4B74A 1O36A 1EPTC 2J38A 4Y71A 3F1SB 4INLA 5E0HA 3ZZ4A 2FLRH 1FIZA 2BZ6H 1ZPCA 3B23B 3UIRA 2BMGB 3LJOA 1MABB 4U2WA 1KXDA 3SZNA 3TVJB 1FN8A 1SMFE 3LJJA 1NROH 3SGBE 2ZFTA 1H8DH 1WQSA 3BF6H 1W12U 3K9XB 1P2IA 3VFEA 1BCUH 2V7QD 1CT4E 5GNDA 1GG6C 1THRH 5PTPA 1A7SA 4NIXA 1FMGA 4YOJA 2WHXA 1K1JA 1MTSA 3WWBA 1UVPA 2BDGA 4KP0A 5DP4A 3M7UA 2XYAA 1LPZB 1N6XA 5JBBS 2H9HA 3PMJA 2ZHEH 1OWHA 1BQYA 2FOAA 1HAHH 3OFND 4ISIH 3KQBA 3UWJH 1SQOA 1T7CA 2P16A 3RXOA 1C2EA 2BD5A 2FI5E 2ZPRA 1QBOA 4AOQA 1GHYH 1NN6A 1IHTH 1C2IA 3BTWE 1YLDA 1OPHB 2OXSA 3VB5A 2J95A 2XC5A 1CHOG 1HLTH 1QQUA 1YPHC 1AD8H 1E36B 1DM4B 1OWJA 1XVOA 3MI4A 6GCHG 2F91A 3OTJE 1AN1E 1W10U 1GI7B 3PWBA 4KTCA 3U8RH 4XRNA 1DLKB 3L33A 2ZU3A 2PKAB 3RXRA 3FP7E 4NA9H 1BBRK 1GJCB 1RTKA 1A5IA 1JRTA 5ESBA 1V2WT 1C2DA 4AC9A 1O32A 4GAWA 1VGCC 2VINA 2JH0D 1NY22 5IYTA 3E1XB 3Q76A 3GY4A 4XDEA 3EE0B 1UTJA 2KCYA 4Z1MD 3MH6A 1NO9H 4YTAA 4BXWA 1PPBH 8KME2 1MUEB 2W3IA 4Q63A 3A85A 2WPMS 1XKBC 3CNRA 1C1QA 2NWNA 3BG4C 1O2VA 1C5OH 1O2OA 2FO9A 1Z6EA 1TA6A 1FY5A 1S82A 2P95A 1S83A 3ITIA 2G5VA 1HJ8A 1TX6A 4RKJB 1GJ4H 1C5QA 1VKYA 4BAOB 4JZEH 2W6ID 5HGGA 4Y8YA 1P9UA 1MCVA 1SFQB 1RIWB 4DURA 1DY9A 2HPQH 2O8LA 1KSNA 2IPQX 2CGAA 3UPEA 2FYQA 1GHBG 3RXDA 5EQSA 1K2I1 4YM9A 2AIQA 4MPVA 4HI3A 1MBQA 2C8XB 3RM2H 1VCWA 3QO6A 2ZFRH 1MQ6A 3ZVDA 4O3TA 4Q7XA 5C1YA 1O2WA 2F4LA 3A8BA 2GV6A 1Y3VA 2M5TA 1C2JA 3SI3H 1GVZA 4AFSA 2ZCLP 5DN6D 5F8XA 2VWNA 4UEHH 4O9VA 5SGAE 1FN6A 1ZGIA 1MZDA 1QA0A 3PMBB 1IHSH 3SQEE 3UUZA 3I78A 5EG4A 4FUHA 1QJ7B 2FX6A 1OYTH 3P95A 1XMNB 1O2TA 2G00A 3AVZA 5G4BA 5HM9A 2BVSH 4ESTE 2GX4A 1DT2A 3ESTA 2WZQA 1BBRH 4WXVA 8GCHF 2J98A 1LHEH 1TBRH 1NRNH 4A1TA 1UK3A 3PROA 1H9IE 3RUOA 4Z6AH 5C0UA 3HGPA 2BLWA 2SGAA 1CHOF 2RG3A 3MTYA 3JZ2B 3ODDA 1K1IA 1O2NA 1HV7A 1Q31A 5AFZH 4A1VA 2XWAA 3PMAB 2EY4C 4JYTA 2D2DA 5TCCA 2RDEA 1C2HA 1C2FA 1CT0E 4OGYA 1C4V2 3GY8A 4B73A 3UREA 1YCPK 3KQDA 1K1LA 2ZO3H 3EA7A 1U6QA 1IQMA 2YOLA 1A3EH 3SNAA 3MO6A 5EXMA 4MPUA 5HKKD 1HJAB 1KXEA 3M3VA 2ZHQH 4X8UH 1ZZZA 3FP6E 5EU8A 2ODPA 4CH2B 2XTTB 1Y3UA 4I32A 1ZMNA 4U30A 4Q4LA 1WSSH 3HK3B 2V3HH 1J16A 2AGGX 2Y80A 1V2MT 1C5WB 1Q3XA 1HAYB 3CP7A 4I8GA 3V12A 1QTFA 1VITH 3UTUH 1BT7A 2A2XH 2ZDKA 1H9HE 3M5LA 2O8UA 1DPOA 2O8WA 1QBVH 2ZHFH 1DVAH 2FLBH 2W6JD 4AFZA 2H5CA 4TPIZ 4ABAA 1FZZA 2Q6DA 1UK4A 1BTYA 2PV9B 4H6SB 2AMQA 2VGCC 4F48B 1CA0C 1MKXK 1QGFA 1DSUA 1NU7B 2ZIQH 1KXCA 3RXSA 2QGRA 4JZIA 1F7ZA 1NBME 1HAOH 3P70B 3P8NA 2FOBA 4WH6A 1ZTLA 4NSYA 1AUTC 1O38A 4FUIA 2P93A 3UNSA 4X2YA 1V2ST 1Z1IA 1IQKA 3IWMA 2F9PA 1O3EA 1K0HA 4X2XA 1SGIB 3VGCC 3EA9A 1EJAA 3QTVH 1C1OA 3OY6U 1BITA 3ZZBA 3SV6A 1Z7KA 1ZGVA 3RC6A 2FM2A 4BAMB 3S0NA 5B6LA 2VIDA 4ABDA 1NU9A 2O8TA 1EUFA 1HDTH 2Y7ZA 4FUDA 1T4UH 2CHAB 4MNXA 1GCDA 1K1PA 4A1XA 1J8AA 3PLPA 1HAPH 1GI5A 3SZEA 2LELA 2KAIA 1ZSKA 5JDUB 2Y5GA 2ZA5A 1BZXE 2J5UA 3F0PA 1DE7H 3M61U 1TNHA 4K8YA 2HVXA 2YMSB 1EB2A 1SI5H 1YBWA 2G55A 3T28A 3ZYEA 5JYIA 2ZQ2A 5FBEA 1N8OC 2BDHA 1AQ7A 1LHFH 4I8LA 1O3BA 1ELFA 3FZDA 4ZHAA 1K1NA 2ZEBA 2FS9A 3SU0A 2KX4A 3PTNA 2BQWB 1BA8B 1NRQH 1BMFD 2BXTH 1P01A 1KXBA 4IC5A 2JJ2D 5E8EH 1PPFE 4GSOA 2XC4A 5GXPA 1GHAG 1XUGA 5BRRE 5A2MH 2J97A 3HGNA 5EQQA 5E0JA 1MH0A 2C8YB 1INCA 1UW7A 2WYGA 4FUBA 3SGAE 1TYNA 1MKXH 1FLEE 1SGYE 1BMLA 3MMGA 2BX4A 3PV5A 4WH8A 3TLOA 3F0OA 3ZZAA 4B71A 3E16B 4GUXA 3KF2A 1GBMA 3RU4T 4X6PA 5JPMH 1HIAA 1WQVH 2Q6FA 3PLKA 4DW2U 5DPAA 2XOKD 1E1QD 2F3CE 1GBDA 2AMDA 3UY9A 1A0JA 1B0EA 4ASHA 3BEUA 2F83A 3ZVGA 2GT7A 1GHZA 3E3TA 3K65B 2ZGJA 3OY5U 4TYDA 4MQAA 1CGHA 1TNJA 2PKSC 3LGTA 1QCPA 1QL7A 1OWKA 1TPAE 1WDIA 2BDBA 3S7HB 4U01A 1XUKA 3TNSA 5EW2H 2SGFE 3LGUA 7LPRA 5J4SA 1ANEA 3F3BA 4TY6A 2A7HA 1O2ZA 2ILNA 2OTVA 3PTBA 1ELVA 2LPRA 2TGTA 2XWBI 1AIXH 2PWXA 4GPGA 3DT0H 3H5CB 2XCNA 1O3KA 1JXPA 5GWZA 2ZTYA 2FOHA 1QJ6B 5GDSH 1GBIA 5DKMA 1ZHMA 1TNGA 5I25A 2H6MA 1O2RA 1JOUB 3SJ9A 1AE5A 4MNWA 1DICA 1BBRE 2KCPA 3F2HA 5GJ4B 2QF3A 1O30A 3URDA 3KIDU 1HAXB 4CRAA 1O5CB 1S0RA 1C5XB 3OU0A 2UWPA 3TU7H 3IG6B 1C1WH 4H42U 3SBKA 1G2MA 2SFAA 5KGOA 3F9GA 3ZVBA 5IDKA 1BUIA 2Z9GA 1SHHB 5HM2A 5DK1A 1OP2A 1CHGA 1Z8GA 1QFKH 2QC2A 3BTQE 1MQ5A 5DGJA 2AERH 1QZ8A 1PPCE 1UCYK 3MFJA 4HTCH 5L6NH 1W0ZU 3BTDE 1GDQA 2Y81A 3P92A 1FI8A 1AY6H 1AU8A 1O34A 1ESBA 2A2QH 2K1QA 2TGAA 3RMLH 5F8TA 5EXNA 3DHKH 2Z9JA 3M3SA 4D9QA 1W7XH 4X6MA 1O2MA 3DD2H 2PUXB 3TGIE 2R2MB 3U8OH 1TX8A 1SLXB 2AHME 1O3MA 3W95A 4ZCNA 3NRLA 2FOMB 2QXHA 2F9UA 3RLYH 1AB9B 1FY1A 2FX4A 4CRCA 3FOAA 5LGOA 2KZ4A 3ZYDA 2QIQA 1HFDA 1MTVA 1CBWB 1D3PB 5DP7A 3SV8A 2BDAA 2J98B 5LH8A 2BQ6B 3ZZ7A 2FPZA 1EXFA 4UFEH 1IQGA 1A0LA 1QRXA 1WYKA 2FXRA 1OX1A 2HNTE 1P2JA 4ABBA 1EZUC 1GL1A 4MTBA 2BY7X 4DIIH 3TH2H 1V2NT 1C1SA 4UFDH 3SU1A 4RT1A 4B6EA 3H09A 1QB1A 2BVXH 2G4UA 3GCHB 1SC8U 1V2RT 3ATMA 2BTCE 1O2UA 3TJNA 1C5NH 3QGNB 4B2AA 2GGVB 3KGPA 1YPJH 1WAYB 1PYTD 4MVNA 1ARCA 1VJ9U 1DLEA 5CHBA 1YPMH 5FPTA 1ELEE 5DP5A 4X2WA 5A0BA 2PLXA 4FUEA 1TBQH 4I8KA 4IN2A 1O35A 2BOKA 2ZNKH 3TK6A 1FXYA 3GY5A 4Y0ZE 3UOUA 4BNRA 3SGQE 2CMYA 1SLUB 1WBGB 2A0QB 2SNWA 1NTPA 3U1IB 2ZU5A 2W26A 3PRDA 2YNBA 4WXIA 1NC6A 1OP8A 1YPEH 5DO4H 1GJ9B 3ENSB 2W7SA 2XW9A 4IMQA 5JBCS 1KLJH 3HATH 2ZPQA 3TJOA 1QRZA 3ZVEA 3URCA 1E37B 2UWOA 4DGJA 2STBE 5I46H 1GJDB 3LC5A 3LDXH 1DOJA 1YGCH 2KCOA 4MNVA 1KMHB 1CE5A 1GG6B 4CR9A 2VWOA 2JETC 5DSFA 3KL6A 4F4OC 1P06A 1ELBA 2FOFA 1F0SA 3RM0H 2G52A 1MCTA 4M7GA 1YM0A 4A7IB 1E1RD 3KQ5A 2DE8A 4OS2A 3RXLA 2VIWA 4P02A 1O39A 1RD3B 2UUYA 3ZIAD 5AVDA 2GTBA 1XX9A 1TMUH 4ZXYH 1O3CA 3E90B 1YC0A 3RMMH 1D4PB 1DSTA 1E38B 3Q3KA 3VEQB 3OX7U 4ABEA 2GCTC 1RJXB 1THSH 1CVWH 1TQ7B 3S9AA 1CGIE 2GZ9A 1THPB 1RTFB 1EP6A 1ZHPA 3LKWA 1GJAB 2SGDE 1LPGB 3VG8A 3V3MA 3PV4A 1TX7A 1BMAA 2BQ7B 1LPKB 1MTUA 4FVDA 5ESTE 5FCKA 1AWHB 4AG2A 1J9CH 1ETSH 1OWEA 2AMPA 4XBCA 3I29A 2QXJA 1ESTA 1PQAA 3P8GA 1P10A 2HRVA 2KAIB 2L6OA 5LPEA 5EXLA 5A8ZA 2ZGHA 2PTNA 1DS2E 1C5ZB 1A4WH 1GBJA 2AIPA 2Y5FA 1O2JA 1VGCB 1BJUA 4FUGA 1OHHD 1O5GH 4E7NA 1O3LA 1H8ED 1O5EH 2VJ1A 4B1TA 5JB8S 2OD3B 2Z9LA 1K22H 1L4ZA 3KEEA 3RXHA 3RXEA 3MU5A 3RC5A 2P8OC 1ELAA 1YLCA 4B2BA 4D7FA 5FL7D 1UTMA 1HRTH 3BG4B 1HAVB 4YOGA 1O3NA 8GCHG 2ASUB 4XSKU 2BDCA 2FDAA 3A7ZA 3P8OA 1O2IA 1AUJA 4K60A 5GCHG 2XXLA 4IBLH 1CQQA 1TGTA 4YZUA 2WPLS 1C5LH 1TPSA 2IPHA 3SYJA 4ABJA 2RCEA 4GHTA 4GLYA 2ZGBH 4I7YH 2LNCA 1LDTT 3UQVA 1IQFA 1HIAB 4JK6A 4I8HA 4TSFD 2ZDAH 3M5MA 7ESTE 4QT8C 1X7AC 2B9LA 3TPIZ 1Y8TA 2Y82A 1O3DA 3KYGA 4JZ1A 1A2CH 3MYWA 4O97A 1GI8B 1OP0A 1TFXA 2OC0A 2FI4E 2UWLA 1C1RA 1EOLA 2PUQH 3F2FA 3MH7A 4NIWA 2HVYB 2ZP0H 4E06H 2IN2A 2Z3CA 1O37A 4DVAU 4Y79A 4H6TA 3D65E 5EJZA 1PPZA 1TGCA 1TONA 1JIMA 5LPRA 1C5YB 4X8VH 2Y6TA 1GI9B 3ZVAA 5F53A 2L74A 2GDDA 6CHAC 3S9CA 1EAUA 1F0UA 2ZHDA 2PHBA 3ZVCA 1TLDA 3ZZ6A 5F6MA 5H4IB 3GCOA 3BSQA 4K1SA 3BTTE 4KTUA 3BTKE 2FODA 1C9TA 4X1SU 1C5VA 4K2YA 2ANWA 1T8LA 3TK9A 1C5TA 1Z8RA 1ZR0A 4K3JA 3BIUH 1FV9A 3SJ8A 2B0FA 4KELA 1BIOA 1DXWA 1LTOA 2IJOB 3SNCA 1O2QA 3ZZ9A 2R3YA 4A5TS 2KM0A 5JB9S 4MDSA 3U69H 4ZROA 3GYMA 1K1MA 1GMCG 1ARBA 4Y10E 3BEFB 1OKXA 2ZU4A 1ORFA 1TPOA 3M35A 2TRMA 2Y7XA 5C1UA 4ISNA 4X8TH 3U28C 2THFB 1AFQC 3N7OA 1IQNA 1ID5H 1O3PB 1EP5A 3NXPA 4AZ2B 2R9PA 2QXGA 3LGIA 1TOMH 1NFXA 1P2QA 4WMEA 4Q80A 3RMOH 4CBNA 1P2NA 1O2YA 1LVBA 1UCYE 2FZZA 3N7EA 4IC6A 1Y5BT 1ANCA 3NPSA 5GCHF 2SNVA 5C67A 3N7DA 2ZPSA 2W3KA 2OLGA 1BHXF 3MU0A 1OWDA 3MU4A 2J94A 2BD7A 2QN5T 3SNEA 1WUNH 3TGJE 3UNQA 1AKSA 4FOUC 1TOCB 2F43B 2EQNA 4TY7A 1SLVB 4JZFH 1GJ6A 1NRSH 2BD3A 2BB4A 2VGCB 3LH3A 1QY6A 1CA0B 1C9PA 1BRUP 2ZU1A 1AZ8A 4DT7B 1SG8B 4K8BA 2G5NA 1VCPA 4MNYA 1NFYA 1A0HB 3RLWH 1HPGA 1A5HA 3PO1C 4CRBA 2CXVA 2P3FH 2FTLE 3VGCB 1P2MA 5C20A 1SBWA 5A8YA 2CF8H 1EPTA 2ZECA 1O2LA 4B76A 4ACAA 1C1MA 1YPHE 5EPNA 3SNDA 2A5IA 4AFQA 4FU9A 4NG9H 2H9TH 1H8HD 1BTZA 4MPXA 1K1OA 1H4WA 3MNXA 3A82A 1O2XA 4AYYB 1BMNH 3G01A 1P9SA 4AFUA 1OXGA 5DP8A 4CHAC 1C2GA 2WUBA 2TIOA 1MKWK 2EC9H 1D6WA 3LGYA 3LPRA 1KYNA 1KTTB 3S7KB 1FY8E 1FPHH 1CSOE 3L3TA 1YLNA 3B9FH 3JZ1B 1YCPM 1N8OB 1Y59T 1KXAA 1GMCF 2Z3DA 1BRCE 1LVYA 1AWFH 3PLBA 3MU8A 2EI7A 2ZGXH 4P00A 2G8TA 2K8IA 5KEDA 1PPHE 1P09A 3LU9B 3U1JB 3CS0A 1DWDH 2A45B 4CR5A 1DUAA
chains in the Genus database with same CATH topology
4O3UA 1D9IA 2CV3A 1TGBA 1O2GH 2F9VA 2Y5HA 1G3BA 1YCPH 3SV2H 2RA3A 3ATIA 1HCGA 1D3DB 1ABJH 3SV7A 1O5AB 1SOTA 3AASA 4OS1A 1KLIH 3BTEE 1DXPA 1AE8H 2A31A 4X8SH 1YPGH 1TB6H 4AB8A 4ISLA 4Y76A 2FS8A 4NFEA 5E2PA 2JH6D 2R0KA 5E0GA 3F9FA 1F0RA 1C1PA 1E35B 1VITF 1SGEE 4FVBA 1ZPBA 5HYOA 2SGEE 3NWUA 1EASA 3QGJA 5L2ZH 1XXFA 1V6DA 2BY6X 4ZH8A 1UTNA 3ODFA 1T8MA 2NU2E 2D8WA 3A84A 1O33A 1ZRKA 2GCHG 2PKSB 2Z9IA 3RXMA 1ZMJA 3DFJA 1QURH 5FXLA 4MPWA 3SOSA 2HPPH 4ZAEA 2FIRH 4CRGA 1C2LA 1G30B 2NU0E 5A0CA 1WCZA 4Y6DA 2VIVA 1DWBH 1T8OA 2ZFPH 1HAVA 2SGPE 3DUXH 3STJA 1ZMLA 1Z8JB 1HXEH 1BTXA 1TGNA 1PFXC 4B2CA 1GMHG 2BDIA 1S0QA 4X6OA 1TALA 2F9NA 2RDLA 3LGWA 1LHDH 4J2YB 2Z3EA 1BMMH 3A7YA 1FIWA 1C4U2 3A83A 4BAKB 1FQ3A 1IQLA 2BHGA 2EA3A 2EI8A 1WTHD 1AHTH 2VH0A 1UVTH 5J4QA 3A7WA 1JMOH 1G3EA 1GPZA 2PTCE 1BB0B 2WPIS 3RXJA 1V2LT 4ZMAH 3O8CA 1C1NA 1ELDE 3BTFE 3SU5A 4IGDA 1DUEA 3SNBA 5EW1H 3I77A 1BRAA 3HPTB 4E7RG 1IQIA 2GDEH 3GY6A 4Y11E 1ZTKA 4HFPB 4Y8ZA 1O2SA 1GI0A 5FBIA 1MTWA 1TRNA 1DITH 3RXCA 2VB0A 3UR6A 4K1EA 1EB1H 1V2KT 5DJ7A 2BDYA 1SQTA 1SOZA 1NFUA 3F6UH 1FJSA 3TITA 3UFAA 1CA8B 1FAKH 4MLFB 1O5BB 3A87A 1T31A 1EZXC 2D1JA 4D9RA 1IQEA 1CT2E 2ZDVH 4ZHLU 1AO5A 3E0NB 5GIBA 4DIHH 2DUCA 1SVPA 4GHQA 3SUEA 1HAZB 2PSYA 2ZFFH 4NZQA 4GVUA 3Q3XA 2A5KA 1SGFG 3FVFB 5A0AE 3V0XA 1C2KA 1GWAA 1GI4A 2ZU2A 2ZTZA 1ZPZA 1P2KA 2W5EA 1XM1A 1LCYA 3QLPH 1GBKA 3MO3A 1TABE 2AGEX 2FEQH 2FP7B 2ZDMA 2FOEA 2TGPZ 3MH4A 1HAGE 4A92A 4LZ1H 2QXIA 2GCHF 1FUJA 4YT6H 3RXIA 1BTPA 2ZCKP 5L2YH 3K6YA 2P94A 5A8XA 1MTNC 5HMAA 2AEIH 3TJUA 1C5RA 5HXFA 2BYAX 2ZWLH 2V35A 3M7QA 3NCLA 3PWCA 3QTOH 3RXPA 1BRBE 3H7OA 3T27A 2H5DA 3GICB 1UMAH 4SGAE 1P57B 3KQEA 2C8ZB 1O5FH 1B0FA 5EPYA 1C5SA 2AYWA 1W14U 4BAQB 1GMHF 4OS7A 4DG4A 4X1PU 2AGIX 1YYY1 1KDQA 3ZZ8A 1F2SE 1EATA 3KQCA 1ETTH 3FP8E 2ZG0H 2YNAA 4FUJA 2ZZUH 1TNIA 5B6OA 4UDWH 4I31A 1S84A 3EA8A 1FONA 1OOKB 3KCGH 2VWMA 4IS5A 4AX9H 5DP3A 4K1TA 3QWCH 4IN1A 1A3BH 4NIVA 4INHA 1AKSB 4CRDA 1S81A 1W2KH 1O2KA 1B7XB 3SJKA 1QB6A 1KY9A 2JETB 1GBEA 2STAE 4ZKSU 1EOJA 4VGCC 1C2MA 4JYUH 4AORA 2ANYA 1TPPA 3FZZA 1ZSLA 3RXGA 1VR1H 3HKIB 4BTUB 3VXEH 2PGQB 4K69A 3KN2A 3M5OA 5EQRA 1QL8A 1LVOA 1RXPA 3A8CA 4D7GA 3T2NA 1BTWA 1JWTA 2EEKA 2XCFA 3M5NA 4LK4A 4ABFA 1GJ5H 4WF8A 3EDXB 1GMDG 3Q77A 4NCYA 1P3EA 1UCYH 1NRPH 1UK2A 2FWWA 2SGQE 1EPTB 1V2UT 2A4OA 3GCTF 4D8NA 1DWEH 4MG3A 1W3CA 5TJXA 1HXFH 3Q3YA 3EQ0H 1TNLA 4X1NU 1TAWA 3DFLA 1MMJN 3SJOA 4OS5A 2FI3E 3QUMP 1J14A 3LOXA 4D76A 1FAXA 2FOGA 2AS9A 4RN6A 1YP9A 3A8AA 1DANH 4O03A 2GZ7A 3A8DA 1O5DH 1TNKA 3ZZ5A 2ALVA 3RXKA 1SR5C 4NA7A 1RGQA 5F8ZA 4UONA 1MAXA 4NZLA 4HGCA 1TE0A 1C5MD 4AYVB 3HKJB 2J92A 3MH5A 1LHCH 1D3TB 3VPKA 2P8OB 1ESAA 2PR3A 4WJG2 1EJNA 2Z7FE 4R0IA 1LVMA 1GBHA 1N1LA 2OQUA 5A09A 1L1NA 2GZ8A 2O9QA 2OCVB 2R2WU 1GDUA 3GY2A 1SGNE 2FYRA 5CHAC 2XRCA 3FAOA 3V13A 1GBLA 5EGMA 1GGDC 3BEIB 1OWIA 2C93B 3WY8A 1P02A 2Z94A 1GCTC 2ANKH 1EZSC 1SSXA 3ATWA 4R8TB 1VCQA 1OYQA 3M7TA 4IMZA 3C27B 2BY5X 2WINI 3OYPA 3PB1E 2WV5A 4Q7YA 4AGKA 1N6YA 1P12E 3RU4D 2O8MA 3A89A 5CMXH 1L0ZA 1SGQE 2OC7A 2A4RA 1GHVH 1XUHA 3UWIA 1F0TA 1JBUH 3QN7A 3BTGE 3F9HA 4AN7A 1O3JA 1O3GA 1GMDF 2CF9H 3A88A 6CHAB 1J15A 1Q2WA 3TK5A 1P05A 2VU8E 2OINA 3LGVA 1O3AA 3RXAA 4YO9A 2ZQ1A 3ZVFA 1AGJA 4U32A 4X6NA 3MU1A 1GJBB 3A86A 2GMTC 2BY8X 2EI6A 2GD4B 2ZI2H 4ISOA 1EAXA 3TH3H 1GBAA 1AZZA 4JYVH 2XC0A 3UNRA 3LONA 1BDAA 1QJ1B 2BOHB 2PW8H 2HGTH 1KIGH 3E6PH 3GDVA 4ZUHA 2BZAA 4DOQA 1H8IH 3VB7A 5LPFA 2A5AA 4SGBE 1O31A 2RA0A 1SFIA 4FUCA 3V7TA 4DY7B 3RMNH 4KGAA 2BXUH 1WOFA 2ZHWH 3RXVA 4AG1A 1F5KU 3SV9A 1NM6A 2ZDNA 4RSPA 2V6NA 1AFQB 4GCHF 1SGCA 2P59A 3RXUA 5FAHA 1O2HA 1C4Y2 1SGPE 4DCDA 2BLQA 1D6RA 4THNH 1C1UH 5T6GA 1HNEE 2AH4X 4WWYA 2IOTA 5FCRA 2PSXA 4ZHMU 1A46H 4XBBA 2ZFSA 3S69A 4KKDA 4NWLA 3W94A 1NZQH 1D3QB 2BD4A 1O3IA 4BTTB 3M3TA 2B8OH 1SGDE 2J34A 4ABIA 4DJZB 1UTKA 1P3CA 2UUFB 1Z71A 1F5RA 2H9EH 3K2UA 3MNSA 4X1RU 5FPYA 2VH6A 1DX5M 1GHXH 3AAUA 2WUCA 1DFPA 1CU1A 1BHXB 3P6ZB 1GBCA 1PPEE 2XBVA 5JBAS 1IQHA 3EAJA 2QY0B 1C1VH 4I33A 3O8DA 2H1UA 5FX5A 2GV7A 1WU1A 4Y7BA 3SQHE 1HUTH 2A4GA 1QBNA 1QHRB 2UUKB 7GCHG 3PO1B 3HK6B 1ZRBA 4Y7AA 1Y3WA 3GYLB 1S85A 1GI6A 4YOIA 2J9NA 3D62A 1UTPA 1E0FD 2WV4A 1AI8H 1KDQB 3SJIA 4BOHA 1NT1A 2BY9X 3ZZDA 1LQEA 3T25A 3Q00A 1VITG 1VJAU 3EYDA 3QK1A 1P2OA 1UVUH 5JBTA 1ZOMA 1KLTA 1SL3A 1L4DA 2QAAA 2OC1A 2BX3A 4CHAB 1JRSA 1FNIA 1LMWB 3BIVH 2ZCHP 1XVMA 2H2ZA 1FY3A 2OBQA 3BG8A 3CENA 1T4VH 2OP9A 2ZF0H 1RIWC 3LC3A 3E0PB 3ZV8A 5C1XA 2HOBA 3RXBA 4FUFA 1SGFA 2I6SA 4K5ZA 4Y0YE 1V2QT 1BOQA 3LIWA 6GCHF 5DG6A 1QNJA 3O8BA 2JKHA 3M36A 3VXFH 3M37A 5C2ZA 3MNBA 2DE9A 5FPSA 2I6QA 1SGRE 5DP6A 1O3FA 1GVKB 1UTLM 1ZLRA 3NUMA 1GVLA 5F03A 1PQ7A 5AFYH 1IQJA 2OBOA 2BD8A 2A7JA 3RU4E 2G51A 1E34B 4CBOA 4YLUA 3D23A 5L30H 1G3DA 1HYLA 3ZV9A 1TBZH 2W7UA 3PYHA 3SHCH 5BPEA 3A81A 1SQAA 4NIYA 1UHBA 4OS4A 2G81E 1K28D 1S5SA 3UOPA 5TCAA 2VVCA 4LZ4B 4BXSA 5T3HA 4FU7A 1ANBA 5C3NA 3SORA 3BTME 2QYIA 3U8TH 2QCYA 1CO7E 2F9OA 1GDNA 1L2EA 2WPKS 3GISB 3VB3A 1ELGA 2Q1JA 1CGJE 3MO9A 3O8RA 4LOYH 1DWCH 1YPLH 3ATLA 1HGTH 4Q2KA 1EAWA 1GHBF 3A80A 3QX5H 3TH4H 2V0BA 1G3CA 1NS3A 1GBTA 2GVFA 4H4FA 1GI1A 1G36A 3FFGA 4YESB 1ZYOA 2ODQA 1V2PT 3ATKA 2P3TB 2XNIA 4BANB 3QDZB 4NSVA 3T5FH 2FMJA 7GCHF 9ESTA 2C90B 3GY7A 4X1QU 1HJAC 1ZTJA 4JZDH 2Z9KA 2VVVA 2NU3E 2ZDLA 2Q6GA 3E8LA 2R0LA 3A7XA 1Z6JH 4Q7ZA 1EKBB 4B75A 4CREA 4CRFA 6ESTA 4XBDA 3AW1A 2GKVE 3LH1A 1GHWH 1QR3E 3SU3A 1P11E 2XBXA 3DA9B 3T26A 2ZGCA 1Z8IB 2BVRH 4WVPE 1XKAC 3QZQA 1FPCH 2HNTF 1GJ7B 4FU8A 3UQOA 3T62A 4YLQH 2HWLB 1BTHH 5GPIB 5K7RA 2NU4E 4NFFA 1HJ9A 1P04A 1GJ8B 4UFFH 1OS8A 3R3GB 3GDUA 1SPJA 1NRRH 4JMYA 1TWXB 4CH8B 1TQ0B 4X0WU 1V2TT 1HB0B 1T8NA 4OS6A 2VWLA 1Y3YA 4LXBH 3SUFA 3SUDA 1EQ9A 2HNTC 4ZXXH 3U9AH 3U98H 3SW2B 1IAUA 1MAYA 1ANDA 1C5PA 2A7CA 3BV9B 3EGKH 3IITA 1NPMA 3CS7A 2C3SA 1S6HA 2BM2A 3QZRA 2ANMH 1MKWH 3SU6A 1V2OT 3RXTA 2ZC9H 3P17H 1W0YH 4Z0KA 1HAIH 3BN9A 1VZQH 2JH5D 1F92A 3GDSA 2UUJB 4I8JA 4NGAH 2ESTE 5EOKA 7KMEH 3TGKE 1K9OE 2C4FH 2R3UA 4HZHA 3MOCA 2GT8A 1MZAA 3GOVB 1QIXB 4WY3A 3SI4H 4Y8XA 2CHAC 2TBSA 3F9EA 6LPRA 3NKKA 2OQ5A 1NFWA 1XUFA 2VVUA 4KTSA 2QF0A 3A7VA 4YT7H 3STIA 1Y5UT 2PKAA 4INKA 1YPKH 1MTNB 1UO6A 3LT3A 4F49A 3TJVA 2B7DH 1J17T 3MWIU 3B8JA 1SB1H 8LPRA 1UTOA 1ELCA 1MU6B 1AMHA 2P3UB 4AGJA 2TPIZ 1SGTA 3NK8A 4TWYA 1KXFA 3SHAH 1H9LB 1P8VC 3PM3A 4JK5A 2GP9B 1RRKA 1O0DH 2ULLA 3GCTG 4JCNA 1YF4A 2OC8A 4ABGA 5C5OA 3RDZA 1V2JT 2J2UA 2OUAA 3ZZCA 1FY4A 1EZQA 3UR9A 4ZKNU 4J1YA 5K0HA 1UJ1A 1C5UA 1H1BA 1GL0E 5T6FA 5ABWA 1SHYA 3F68H 4E05H 3NZIA 4UD9H 4ABHA 1ZSJA 2XBYA 4ZKRU 1QRWA 3VB4A 3S9BA 1QA7A 1OSSA 1FDPA 1LKAA 3AAVA 4NWKA 2BD9A 2HALA 3TNTA 1G32B 1T32A 1C1TA 2J4IA 2V3OH 4XOJA 5C5NA 4VGCB 3D49H 4FXGH 4IW4E 1TMTH 1PQ8A 3R0FA 5EODA 3VB6A 3SU2A 3RXFA 1GBBA 1KTSB 1W11U 1IOEA 1XUIA 1W7GH 1QB9A 1L1JA 1G9IE 3MHWU 1Y5AT 3ELAH 1TIOA 1EJMA 1TMBH 4A6LA 1JIRA 3RXQA 1W13U 5AF9H 1AVWA 4TPYA 1TRYA 3SUGA 4WMFA 1MD8A 1XUJA 1GHAF 2PFEA 1SLWB 1LKBA 2BLOA 2QV1A 3OSYA 5DP9A 2ALPA 1ZJKA 1K21H 8ESTE 1MBMA 4ZKOU 3TIUA 1GI3A 1RTLA 2CN0H 1ACBE 3E91A 3AW0A 9LPRA 2A32A 3RP2A 4OGXA 4XE4A 1P03A 1EAIA 2PGBB 2Z6BD 2QA9E 2F9BH 1UVOA 2CJIA 5FHTA 3K6ZA 1DY8A 1ZHRA 4PROA 3FANA 5ETXA 4RKOB 1EX3A 5CE1A 1G37A 2D26C 1O2PA 1MU8B 1NESE 4BAHB 2B5TB 1PPGE 3BTHE 4UFGH 3P8FA 1F5LA 4TWWA 1M9UA 1LO6A 1AVGH 1A61H 2C8WB 2AFQB 1MD7A 1PJPA 2ODYB 3GCNA 4XFQA 2HLCA 1UVSH 2GCTB 4UE7H 3KNXA 1BJVA 5CHAB 1WV7H 2WYJA 5FX6A 1UTQA 2VIQA 4BTIB 2FESH 1LHGH 5E2OA 3GY3A 3SN8A 1RFNA 1AB9C 2WPJS 2NU1E 5T6DA 2BD2A 1W8BH 3L6PA 2ZKSA 1ELTA 1S6FA 1UHBB 1GGDB 3SU4A 4AB9A 1L1GA 2XBWA 1CBWC 1QQ4A 1TRMA 1Z1JA 2G4TA 2FTMA 1GCTB 4ISHH 1PQ5A 1GBFA 1PYTC 1V2VT 1ABIH 1A1RA 2ZFQH 1XXDA 3KHVA 3SO3A 4WMDA 1TGSZ 2VIPA 3T29A 3MNCA 1O3HA 3A7TA 2TGDA 3C1KA 3GCHC 1Y3XA 1YKTA 4NA8A 2VIOA 3PMHB 1AFEH 4GCHG 1AVXA 2VNTA 2FOCA 2BLVA 1WTGH 1GI2A 1G2LA 1O3OA 1P0SH 1BTUA 1B5GH 5AHGH 1QL9A 2GMTB 1TA2A 2ZTXA 1DDJA 1ZJD