1S0RA

Bovine pancreatic trypsin inhibited with benzamidine at atomic resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsinogen
publication title Pancratic bovine Trypsin native and inhibited with Benzamidine from synchotron data.
rcsb
total genus 61
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1s0rA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1s0rA02
3SQHE 2FOAA 1QJ6B 1ARBA 1PQ8A 1LDTT 1PFXC 4IMQA 3TGIE 1D9IA 1TGBA 1QTFA 1SGFG 2ZDNA 5T6DA 2PWXA 4A1VA 4AZ2B 1GHBF 1ZPCA 2BDCA 1SGCA 1ELBA 1MH0A 2A4GA 4FUHA 4H42U 3NPSA 1HAVB 1VCWA 1A7SA 3HK6B 5JBBS 1OWIA 1VGCB 2QF3A 6GCHF 4AFUA 1OXGA 3LGIA 2H5CA 2OUAA 1GMCF 1JBUH 2ALPA 5EOKA 3SU0A 2GVFA 4B76A 2BQ6B 1TMBH 5GXPA 1XVMA 1V2ST 4WY3A 2R0LA 2OBQA 1GJ4H 1RS0A 3DUXH 2NU1E 1QL8A 1UCYE 4WVPE 2O8UA 3A83A 1AVWA 3ZVBA 1DS2E 4NFFA 2J95A 1UVOA 3RXGA 2JETC 3SUFA 1PQ7A 3RXAA 3D49H 4AB8A 2QA9E 4K8YA 1MAYA 1NO9H 4JK5A 2P59A 3BTHE 4X1SU 2Y6TA 3AW1A 2FESH 1LPGB 1TONA 2BDHA 1TPPA 1Y3VA 3EE0B 1DDJA 1MKWH 2TIOA 3A86A 2AGEX 1Z1IA 3GICB 2F9OA 5BRRE 3T29A 1C5LH 1BRBE 4K3JA 3QO6A 4DIIH 2YNAA 2VIPA 1XXDA 3TGKE 3LOXA 1ESAA 3URCA 3SU2A 2ZU4A 2B5TB 3B8JA 4MPXA 1C5UA 1SBWA 3MO3A 3OSYA 2O8MA 1G30B 1HAOH 1Q3XA 3SV6A 1RGQA 1WTHD 3PWBA 4FUIA 4DVAU 7GCHG 1GBCA 1KXAA 1HUTH 4AG2A 3UUZA 1L4ZA 2SGPE 3GDUA 3FVFB 4MNVA 1GI2A 1XKAC 1IQEA 3SHAH 1HBTH 3LJOA 4NA7A 1ELVA 3BG4B 3PLPA 2BDBA 4UDWH 1C1PA 1S6FA 2PKSB 4ABAA 1GI3A 1HLTH 3BV9B 3ZV8A 3KF2A 4AG1A 5L2ZH 1RIWC 2EI6A 3JZ1B 2B0FA 1BTUA 2H1UA 2DUCA 2EA3A 1O2NA 1O2WA 1S85A 4K2YA 1A4WH 4ABIA 1P01A 1F7ZA 2ODPA 1W7XH 3DHKH 5F6MA 1TBQH 4ESTE 1ETRH 1P3CA 4ISOA 1GI4A 2ZCHP 2AGGX 1WAYB 1O3LA 1LHCH 4WMDA 2C90B 2W3IA 4HGCA 3RXOA 5A0CA 2BOHB 1NRNH 3NXPA 1BMAA 2XBXA 3E91A 2A5KA 1ZPBA 4GCHF 2UUJB 3VXEH 1ESBA 5LGOA 5GWZA 1GHXH 5E2PA 4DG4A 4K69A 5DO4H 1K1OA 3LGWA 4BNRA 1P03A 3BEFB 1QBNA 2XRCA 1ELTA 4WJG2 1KTTB 4Y10E 3E90B 2V0BA 3MU0A 2RA0A 4BXWA 7GCHF 4AFZA 5C20A 2ESTE 3QTOH 2EI8A 1LHEH 4FUEA 2JETB 3P6ZB 1O32A 2BDIA 2BD7A 1O2XA 4FUCA 3QTVH 3F9GA 1PPEE 1BTWA 1P57B 1WQVH 4TY6A 4Y0ZE 2ZNKH 4XFQA 1T7CA 1C2LA 4IBLH 3SU3A 2PV9B 2BB4A 1HIAB 1F5LA 3V3MA 3UR9A 1GBBA 2HRVA 3LJJA 4OGYA 4OS5A 3T25A 1F92A 4XOJA 4K1SA 8GCHG 2UWPA 4ZXXH 2ZFTA 1G2LA 2P3UB 4MVNA 4BTTB 1C5SA 2A2XH 2PHBA 1G37A 1SGRE 2CF9H 3LDXH 5HMAA 3RMOH 3RXHA 4U2WA 1W14U 1OP8A 1AE8H 4THNH 1Z8RA 1PPZA 3ATLA 4GAWA 2IPHA 3HK3B 1GJBB 1C1TA 1DE7H 3PM3A 3TNSA 4ABDA 8LPRA 4CRBA 4NZLA 4FVDA 1C5OH 3KQDA 2G4TA 1P10A 1U6QA 1EB2A 4JZ1A 4MTBA 4B2BA 2FLBH 2HNTC 1N1LA 1J14A 1ELDE 3URDA 3UTUH 1MTNC 2FS8A 1T31A 5EXNA 3RC6A 1O5EH 2QC2A 3GCOA 2ZZUH 1IQGA 1V2WT 1O5GH 2OLGA 2SFAA 1G3DA 2STBE 3QZRA 2J38A 1RIWB 5DP5A 2AS9A 2BD8A 1KXDA 4GLYA 2ULLA 4O97A 5GDSH 3ZZ3A 3ESTA 1GBTA 1EZUC 2A7JA 1C1QA 2BDGA 3TK5A 2FDAA 2QV1A 1W0YH 3SUEA 1SLVB 2C93B 3SNCA 1WCZA 2ZFRH 1TMUH 3RXBA 2IN2A 1EJAA 1ZHPA 2O8LA 3S9CA 1DUAA 1L0ZA 1UMAH 2QXHA 3TGJE 1NFUA 3VGCC 4I7YH 1HGTH 2A0QB 1HJAC 4MPWA 1GHVH 1FV9A 3SNBA 3QX5H 1KTSB 1P2IA 8GCHF 1ZHRA 4YESB 4BOHA 1CHOG 1YBWA 2PSYA 1UVTH 5FHTA 1XUKA 4MQAA 3P8GA 3F9HA 2AEIH 1E35B 1C2HA 1IQLA 2ILNA 3RM2H 3GY4A 1CQQA 2VIWA 4YTAA 1YPMH 3TVJB 1O31A 2VWMA 4Q7XA 4MLFB 5C67A 2YOLA 2VVUA 1SLWB 1CT0E 2Z9GA 1O2SA 1FN6A 1MQ5A 1C5PA 1IHSH 1FLEE 1NT1A 5FPSA 4ZHMU 1C2DA 2PR3A 3OY5U 2O9QA 1TNLA 2Y5FA 2A4QA 3Q00A 1O2GH 3P70B 1GVKB 1D6WA 2XC5A 3L33A 1QL7A 2WPLS 2XXLA 2Z3DA 3RXFA 3ZZ4A 4KTUA 4O03A 5GPIB 1QY6A 1JWTA 4UEHH 1V2OT 2ZDLA 3WY8A 2ZTXA 1O3PB 3MH7A 2JH0D 1DICA 3HGPA 1TQ7B 1S84A 1O5DH 2DE9A 1O2KA 1B5GH 2BY8X 2ZFFH 2VWOA 2PFEA 3BIUH 3BTDE 1BMLA 1DVAH 3EGKH 1MU6B 1C9TA 1S6HA 3HKIB 3A7TA 2O8TA 1UVPA 1CHOF 4DJZB 3KNXA 8ESTE 3GY5A 3TITA 1EX3A 3K6ZA 1T4VH 1C4Y2 2G00A 1JXPA 3PV4A 1O2UA 9ESTA 2B7DH 1CT2E 4X8TH 3PTNA 1V2PT 4XBDA 1ZTJA 3M61U 1MTNB 2PTNA 1EOLA 4Q7YA 1PPHE 1K1MA 1MCVA 4CRGA 1G36A 2BXTH 3HPTB 1C1WH 1OWDA 4WWYA 1BDAA 1OX1A 1F5KU 1XUHA 3ATWA 2G81E 1BMNH 4INHA 2LPRA 3CENA 1TNHA 5K0HA 2ZIQH 3RXJA 1LPKB 1GBJA 1MZAA 1FONA 3MH4A 5FBIA 4U30A 1SGNE 2XC0A 4Q2KA 5JBCS 1WOFA 3LC3A 2GT8A 3RXTA 3VGCB 1QRWA 2BXUH 1HJAB 1QBOA 5ETXA 7KMEH 4LOYH 4ZHLU 3E0NB 1O3BA 1DY9A 2Y80A 5L2YH 1NU7B 3RC4A 3FFGA 1GHWH 2TGTA 1S81A 2VJ1A 3TPIZ 1AZZA 1FY4A 3RXLA 3A7ZA 1YKTA 3GDVA 1KXEA 1HJ9A 4H6TA 1DXPA 1EATA 1OSSA 1ZSJA 4VGCC 1BJUA 1TRMA 4JYVH 3M7UA 1ELFA 4TPYA 2OBOA 1EP5A 1SC8U 4K60A 4LXBH 1HXEH 3MU4A 1J8AA 1DANH 1O3AA 2WINI 3OTJE 1SGQE 3M5LA 1CE5A 1O2RA 3PMHB 1TA2A 1MTUA 1MAXA 4WXVA 1P12E 4BTIB 1O2OA 1HCGA 2GMTC 3K65B 2FMJA 4Y76A 3TK9A 2EC9H 2TGAA 1KXBA 1O3FA 2GD4B 5TCCA 3VEQB 5IDKA 4NG9H 1PQAA 3P92A 2OINA 3OY6U 4ABFA 2ZTYA 2GZ8A 3KIDU 1C4U2 3RXCA 1MTWA 2QXGA 2SGEE 2VH0A 2QIQA 1CVWH 1MQ6A 3VB7A 3Q3XA 1Z7KA 1P8VC 1FY8E 3A88A 4FVBA 4FUGA 1SL3A 1O3EA 2XYAA 2BY9X 3SU5A 4AFQA 3SGQE 3DD2H 3AVZA 1K1LA 2WUBA 5C3NA 5FPTA 1AUTC 1SR5C 2FTMA 3RXPA 2WYJA 5LPRA 2STAE 3MNSA 2BTCE 1QB1A 1VZQH 1H1BA 1AMHA 3F9FA 1PPGE 2VIDA 1E37B 1KXCA 2ZHWH 1TRNA 2J94A 4UONA 2ZDVH 1FN8A 1O3GA 5ESTE 3BG8A 1CGHA 2ZHEH 1AKSB 1A5GH 3RXDA 4ASHA 3V0XA 3AAUA 3ATMA 1QQ4A 1K9OE 1DUEA 3B9FH 1X7AC 2Y5GA 4OS4A 4NIVA 2HGTH 1HAPH 1Z8GA 3A8DA 4LK4A 4D9QA 1V3XA 2ZI2H 1O5AB 3M36A 2J9NA 4AORA 1QB6A 1MD8A 3VFEA 1E34B 1M9UA 2BM2A 1MMJN 2XBWA 4NWLA 2GDDA 1GWAA 2FYQA 4A1TA 4B71A 1PYTD 2RG3A 5A0BA 2BD4A 1AD8H 4O3UA 1EB1H 3V7TA 1QGFA 3UWJH 5AF9H 2TRMA 1ZLRA 3TJVA 4BAKB 5EW2H 1IQIA 1UTJA 1INCA 3GY6A 4VGCB 1LHDH 2HOBA 3MFJA 1SGIB 1TNIA 3ZYEA 1LO6A 1NRQH 2FX6A 2OP9A 1UTPA 4FUDA 3U8TH 1AKSA 1C1NA 3P17H 4AYVB 1E0FD 4BAMB 1O2MA 3EYDA 1V6DA 5HYOA 1ZTLA 5HM2A 5JPMH 3UY9A 4JZDH 1GHZA 2GMTB 1QQUA 1MKXK 2W3KA 2BD9A 2TGPZ 1V2LT 1YCPM 1A3EH 3SHCH 1O2YA 3GY3A 1ZJKA 4IN1A 3BTQE 1EZQA 2P3FH 2B9LA 4Y8XA 3SORA 1QNJA 2BZ6H 1K28D 1DX5M 2FPZA 1KSNA 7LPRA 1EAIA 5T6FA 3RP2A 2Z9LA 1G2MA 2V35A 1UO6A 2G5VA 1GBIA 1O3HA 1C5YB 3QZQA 1TWXB 5DP6A 4XE4A 1D3DB 1TA6A 1VJAU 4I8LA 1ETSH 2C8YB 1GBFA 1IOEA 4KKDA 1ZSLA 1BIOA 3BEUA 3TH4H 1GBAA 2OTVA 1SHYA 4XBCA 2GCHG 5HM9A 1FIZA 1P2MA 4FXGH 1C5QA 1RFNA 5I46H 1B7XB 1QURH 1QIXB 2VWNA 3VB3A 3PMJA 2UUFB 3IG6B 1XM1A 4WXIA 3V12A 2PSXA 1FAKH 1NRSH 3UNQA 1C5RA 1H9LB 1Y3WA 5FXLA 1QRZA 4CR9A 4Z6AH 3A7VA 3O8CA 5EXLA 1PPCE 4NSVA 1E38B 2M5TA 4B73A 5ABWA 3HGNA 3LU9B 4INKA 1GBEA 1UTMA 2ZU5A 3R3GB 4FUBA 2BQ7B 3RXEA 1AVXA 4X2VA 4HZHA 1TQ0B 4CBNA 4UFGH 4FUJA 4E7RG 4WF8A 4TPIZ 3TJUA 2ZG0H 3FP6E 3RMLH 1AN1E 4GCHG 3SU6A 2BMGB 2XW9A 4Y6DA 3MNCA 3STJA 1ZMLA 2ZF0H 1GBLA 5F8XA 5EQQA 1V2TT 1S83A 4FUFA 1SG8B 3D62A 3ZZ9A 2RCEA 1GMDG 2J34A 1VITG 2KAIA 4X8SH 1KLJH 5FBEA 1GI1A 4YOIA 2ZU1A 1MTVA 1TX6A 1LVOA 4YOGA 4D8NA 3GCTG 4RKOB 4X6MA 3DFLA 1GJ6A 1YF4A 3H7OA 3LKWA 1P9SA 1SQOA 1BB0B 4E06H 3FP8E 2JH6D 4X2YA 2PUXB 4HI3A 5HGGA 2A31A 1K21H 2H9HA 3BTEE 4MG3A 2GCHF 3I29A 1GHAG 2I6QA 5EODA 3TU7H 5E0GA 1TLDA 2GZ9A 4X0WU 1QRXA 4BAQB 3SW2B 3PMBB 2BLWA 1SLUB 5AHGH 4KP0A 1HAZB 5G4BA 2DE8A 2W5EA 1C1UH 1TPSA 5EU8A 4Q7ZA 1K22H 1ANDA 2Z9IA 1K2I1 3T62A 1VITH 2ANYA 1HV7A 3RXVA 3VB5A 1J15A 3NWUA 2Y82A 4AN7A 1SPJA 3TJNA 2ZGBH 3U8OH 2NU2E 3MU1A 2I6SA 2WYGA 1TE0A 1O2PA 5F8TA 5E2OA 3C27B 1V2JT 5GCHG 5ESBA 1GMDF 3O8BA 1IQHA 1VITF 2VIVA 3A87A 1D3QB 1OYQA 3QGNB 3SN8A 2QGRA 3E0PB 1O34A 1UK4A 3GCTF 2TGDA 1FPHH 1FY1A 1P05A 3ZZAA 4Y8ZA 4I33A 3S9BA 5EQSA 4PROA 2QXIA 3P8FA 3NK8A 2WPKS 1GHAF 2B8OH 2XCFA 2HNTE 2FXRA 5I25A 1TB6H 1V2QT 2ZFSA 3B23B 3UNSA 2FOHA 1E36B 3AASA 1FPCH 3PWCA 1GJDB 3RMMH 1C5VA 4B2AA 1HB0B 1YM0A 2ASUB 5SGAE 2AIPA 3ZZ6A 3K9XB 1DWCH 1NU9A 1WUNH 3MMGA 3MNXA 1IQJA 2TPIZ 1OYTH 2ZP0H 1UCYK 3ZVGA 2AFQB 1WU1A 1GI8B 3CS0A 2F9PA 1KDQA 2ZQ2A 3RU4T 2ZGHA 1BA8B 2P94A 1H8IH 1THRH 2ZKSA 3KL6A 4DY7B 5BPEA 5DJ7A 1QCPA 5A8ZA 4Z0KA 1TBRH 2SGAA 1D4PB 1SHHB 2P8OC 2BOKA 2SGQE 3GISB 5GCHF 1JRSA 2GDEH 5LH8A 5CMXH 1ZHMA 1DY8A 1CSOE 2C4FH 4CR5A 5CHAC 1P06A 1THPB 4MNXA 4TWYA 3ZZCA 3FZDA 1LVMA 1EPTC 1DWBH 1GI6A 1FNIA 2ZU2A 3UIRA 1ACBE 4ZHAA 5H4IB 2AIQA 1K1NA 2ZDMA 3ZZ5A 3BTWE 1GI7B 1P3EA 1EZXC 2R3UA 1O3OA 4BAOB 1G9IE 1K1JA 2VVVA 2CV3A 2AERH 3MO6A 3M5NA 1MKXH 1Z71A 2NU3E 3QN7A 1A5HA 1O5FH 1P0SH 5F03A 3TIUA 1XUGA 5A8XA 2FS9A 3HKJB 4ABEA 3IITA 3SJ8A 1GBMA 1TGTA 3OU0A 3E8LA 4OS7A 1JOUB 1O5BB 2PUQH 1GBDA 1P09A 2FM2A 2Z3EA 4GVUA 1UK3A 2BDAA 1EKBB 4ABGA 1HAHH 3PTBA 3SGAE 3AW0A 1Y5BT 2HALA 3UFAA 2F91A 2FI3E 2C8WB 3F1SB 1KYNA 4YZUA 2Y7XA 1HRTH 3A8AA 1VR1H 1F0SA 4X6PA 2NU0E 5C5OA 1RXPA 3DA9B 1Y5UT 4A7IB 2QAAA 1HYLA 2PTCE 4SGBE 1ABJH 5A0AE 2H5DA 1SFIA 2PGBB 2VINA 2BLVA 1NFXA 1ZGIA 2ZDKA 4AGKA 4OS6A 3SUGA 1NY22 1O2IA 1VJ9U 1LPZB 2BZAA 5FAHA 2CXVA 5T3HA 3UOUA 3ZVFA 3SU1A 3E6PH 3LC5A 3BTKE 1DWEH 1CGJE 2Z9JA 2A5IA 1DSUA 1IQKA 2WPJS 2OXSA 1JIRA 3SQEE 4NWKA 3VPKA 1BQYA 4I8GA 4ABBA 1UTLM 2FOBA 2W7SA 3UR6A 4O9VA 1ELEE 1WV7H 2A7CA 2CN0H 2UUKB 3LH1A 1Y3YA 1MD7A 1P2NA 2GV6A 1VCQA 2PKAA 4ISHH 3V13A 1A0LA 1LMWB 1AIXH 4UFEH 1TNKA 2G8TA 4SGAE 3RMNH 1V2KT 1YPKH 2A2QH 1ETTH 2P8OB 1OP2A 3KN2A 3H5CB 3GDSA 4MPUA 3U98H 2FYRA 1YPGH 1ZOMA 4MPVA 1FUJA 4X6NA 3MYWA 1OWEA 5EPYA 4UFFH 3ZVEA 5F8ZA 4B75A 5CHAB 1IQNA 1W12U 2A1DB 6CHAC 1BUIA 1HJ8A 2ZFQH 2ZA5A 4KELA 2P93A 3M3VA 1G3CA 1BTXA 2VB0A 1EPTB 3KGPA 1L2EA 1SGEE 3RLWH 3RXKA 3TK6A 3ODDA 3TJOA 1AUJA 1ZYOA 1F0UA 2FODA 3ZV9A 4X1QU 1TMTH 1HDTH 3EDXB 1HAXB 3A8BA 3R0FA 4CH2B 4I8JA 1O3JA 1W0ZU 4KGAA 1SGDE 3K6YA 4HTCH 4OS1A 1A1RA 3U1JB 3UQOA 1P04A 2GP9B 3Q77A 1IAUA 1FJSA 2OQ5A 3MWIU 2D2DA 3I77A 4XBBA 4BXSA 1BHXB 6ESTA 1J17T 1BJVA 4CRDA 3SGBE 1ABIH 1XMNB 2CGAA 4JZEH 4XSKU 4AYYB 1AU8A 3SNEA 3DFJA 3S69A 4MNWA 1YPHE 1C5WB 1GVZA 3L3TA 4JMYA 2VWLA 5EQRA 3PO1C 2FZZA 4CH8B 1HAYB 1NROH 4NZQA 2UWOA 1DLKB 4CREA 1ELCA 1ZRKA 3M3SA 5T6GA 1P9UA 1UTQA 2VIOA 3P95A 1CA0C 1EXFA 1EPTA 2BVRH 3PLBA 1JRTA 1CU1A 1K1IA 1YPEH 3UOPA 1XVOA 4JZIA 3UPEA 3DT0H 3M37A 5AVDA 1GJ7B 1SGFA 1OOKB 3TH2H 3LONA 3F9EA 1N8OC 1NRRH 4U32A 1Y8TA 1BRUP 2CJIA 4DW2U 1GPZA 3LGYA 1DPOA 3BN9A 2D8WA 3KQEA 4D7GA 4TWWA 4CRFA 2SGFE 1QBVH 1OPHB 1OKXA 3A84A 3ZZDA 2FI5E 1NC6A 3Q3KA 4X1RU 2F83A 1GI0A 3S7KB 2XNIA 1KIGH 1ANCA 4D7FA 1UCYH 1UHBB 2P95A 1LQDB 4RSPA 3MO9A 2ODQA 3LIWA 1DSTA 4WH8A 2F9UA 3GY7A 1BCUH 4XDEA 4Y7AA 2ZTZA 1O2ZA 1EAXA 3LPRA 1H9HE 1GDQA 2WPHS 2ZHFH 3O8RA 5E0JA 1S0RA 1V2UT 4NFEA 1Y3UA 3PROA 1PPBH 1NS3A 2WV5A 1TPAE 3SV7A 1O39A 4ABJA 4B1TA 4GSOA 5DKMA 1UTNA 1CA8B 4YT7H 2BX3A 6CHAB 2ANWA 3MNBA 3U8RH 3SJIA 2RDLA 4NA8A 3RLYH 2Q6DA 1ELGA 1TALA 3M5OA 2BD5A 4H6SB 1W3CA 4X2WA 1EOJA 4NGAH 2FOGA 1O37A 1NZQH 1CT4E 1FMGA 2CMYA 2ZGJA 2GTBA 2H6MA 4BTUB 1ZTKA 5HXFA 1W10U 1FXYA 3MH6A 5DK1A 4JYTA 2BLOA 1LQEA 3GCHC 3L6PA 4GHTA 1C2FA 1BBRE 2ANMH 1T8OA 1UHBA 1C4V2 1ZZZA 3EA9A 4UD9H 3SV8A 1BTHH 3SJ9A 1XUFA 6LPRA 1YPLH 2FWWA 1JMOH 1O2TA 3PO1B 2QXJA 2ZWLH 4J2YB 4H4FA 7ESTE 1AHTH 2ZU3A 1D3TB 3VB4A 4E7NA 1AI8H 1C5XB 1GDUA 3SU4A 5FPYA 1MCTA 1Z8IB 4X8VH 2A4RA 1DOJA 5EGMA 1TIOA 1AZ8A 1OWKA 1CA0B 1Q2WA 4ZKRU 3TH3H 1CBWC 5L6NH 1SLXB 2HWLB 2AH4X 4IS5A 5LPFA 1O36A 1UK2A 4ZXYH 1AGJA 5JYIA 1OWJA 1C2MA 3NUMA 1N8OB 2PW8H 1OP0A 1XKBC 1ZMNA 2NU4E 3GYLB 1JIMA 1IHTH 1NFWA 2A32A 2VH6A 1ID5H 1AY6H 2H2ZA 1XUJA 2ZHDA 1A0JA 5DP4A 1RD3B 3RXUA 2D1JA 3U1IB 9LPRA 1THSH 3RXMA 2XCNA 1YC0A 4CRCA 4UFDH 1SGYE 1AB9C 1AFQC 1BZXE 1C5NH 2J92A 1DT2A 1YCPK 1P2KA 4DT7B 2KAIB 4YLQH 1C2JA 1EAWA 1GMHG 4F49A 3A7XA 1C1SA 3ITIA 1QA0A 4KTCA 1GGDC 1GVLA 1RTFB 2O8WA 2BD3A 1GG6C 4DOQA 4K1TA 3E1XB 3LGUA 3E16B 4NA9H 4NIXA 3GCNA 1H9IE 2ZDAH 3A8CA 1L1NA 1WSSH 1HPGA 3LGVA 1GCDA 3RC5A 1EJMA 5EXMA 4Y11E 4U01A 3T26A 5L30H 3GOVB 1C2KA 2GZ7A 1WYKA 1ESTA 4IC5A 1UTKA 1EASA 1EP6A 3M7QA 3ODFA 3P8NA 1HNEE 1LKBA 2A45B 2H9TH 4ZAEA 1W7GH 2OD3B 1AWHB 2BVXH 2HNTF 2ODYB 1BRAA 1B0EA 1SGTA 3GCHB 3SBKA 1F0TA 2J4IA 1EQ9A 1GBHA 1ZRBA 4DCDA 1A0HB 3M35A 1YGCH 5K7RA 1HAVA 2FIRH 1YLCA 1O2LA 1ZJDA 1O35A 5J4SA 1PPFE 2EEKA 2XTTB 1GMHF 3IWMA 1O3MA 1XX9A 1CO7E 3ZVDA 5FCRA 2FI4E 1GHYH 3ENSB 1NM6A 5JB8S 3NKKA 1CBWB 1BHXF 3NZIA 3S7HB 4DGJA 2QCYA 2ZGCA 2R0KA 3W94A 2WV4A 4D9RA 2ZCKP 1C9PA 2G4UA 2NWNA 1DWDH 1XUIA 1BOQA 1NFYA 2QY0B 2UUYA 1YP9A 2R2MB 1BBRK 3GYMA 1SOZA 1F0RA 3SZNA 2FLRH 1TNGA 2HLCA 1S5SA 3S0NA 3FZZA 3A89A 1AB9B 2BD2A 5JDUB 5C1YA 1AFQB 2ZPSA 4GHQA 5EW1H 3PLKA 2XBYA 1AVGH 1C2IA 1KDQB 5A8YA 1TGCA 2ZPRA 2AMDA 1GI5A 1A46H 4DIHH 1GGDB 2WUCA 1ANBA 4I32A 1GG6B 5C1UA 4INLA 1ARCA 1GDNA 2BVSH 3ZVAA 4QT8C 1O3NA 4WH6A 1L1GA 1IQFA 2GKVE 1A61H 5DG6A 4X2XA 2HVXA 4AX9H 1TBZH 2OC8A 3ZVCA 4ZROA 3RUOA 4K1EA 3U69H 1C2EA 1KLTA 4A6LA 3ATKA 1KXFA 2IJOB 2A4OA 2BYAX 3FP7E 4LZ4B 2VGCC 3M3TA 3PYHA 3SJOA 4Y8YA 4ABHA 1C1OA 1QHRB 3F6UH 2FO9A 1A5IA 2Z3CA 1WBGB 4ZKSU 1TRYA 2W26A 2FOFA 3SNDA 4IW4E 1Y5AT 2GX4A 4OS2A 1AFEH 1RTKA 2OC0A 1O2VA 2Y5HA 5FX6A 2QN5T 3SOSA 3T5FH 3BF6H 2Q6GA 3KQCA 1V2NT 2GV7A 1HAGE 3KCGH 3D23A 1V2VT 3QGJA 1FY3A 2J2UA 1P2QA 2R2WU 3M7TA 1ANEA 2JKHA 5PTPA 3RXRA 5TCAA 1DLEA 3GY8A 2C8ZB 4TY7A 2PLXA 4KTSA 1Y3XA 1QJ7B 2UWLA 1BTZA 1VCPA 4JCNA 2XC4A 4X6OA 1AO5A 4Y7BA 2AMPA 1XXFA 3EAJA 2A5AA 2ZQ1A 5E0HA 1FIWA 4A92A 2F9BH 3SI4H 1AWFH 4X1PU 3O8DA 2QF0A 1O3DA 1P2JA 2FP7B 2Q1JA 5FX5A 4ISLA 3C1KA 1DXWA 2BDYA 1W13U 3EQ0H 2D26C 2SNWA 1SQTA 1C5MD 1WQSA 5TJXA 1J9CH 1GJ9B 5DP3A 2R3YA 1T32A 1W2KH 3ATIA 1FDPA 1QJ1B 2ZPQA 4MDSA 1C1RA 1DM4B 3T27A 3BIVH 2AGIX 5LPEA 3T28A 3SV2H 1TX7A 1SVPA 1O3KA 5GJ4B 1LTOA 1V2RT 1HIAA 2FOCA 1MUEB 1ZGVA 1GI9B 1QL9A 1EJNA 1N6YA 3NCLA 5EPNA 1SGPE 3ZZBA 1SB1H 1NRPH 3LH3A 2FEQH 3ZZ8A 2ZEBA 4NIYA 4O3TA 1O33A 4M7GA 2OCVB 3MU8A 4Y0YE 2PKAB 4NIWA 3U9AH 1TFXA 3RXQA 3QLPH 2VNTA 1WTGH 1YCPH 2F9NA 3OX7U 3MU5A 1J16A 1TOCB 3RM0H 3F68H 3K2UA 3RU4E 1GJ8B 2OC7A 1SOTA 1T4UH 1O2JA 1SMFE 1GJCB 4I8HA 4ISNA 4A1XA 2HPQH 4HFPB 4IN2A 1NN6A 4ZKNU 1LHGH 1EZSC 1C5TA 2RA3A 2Y81A 2SNVA 1Z6JH 2W7UA 2VGCB 4CHAC 1O0DH 4IGDA 4R0IA 2VIQA 4B74A 5EG4A 3SNAA 1BITA 1O30A 3UNRA 2XWBI 2GCTC 1AQ7A 1NPMA 1A3BH 1LVBA 4BANB 1O2QA 1BTPA 2CHAC 3VXFH 3RDZA 5AFYH 4MNYA 4NCYA 5DP8A 3OYPA 2ALVA 3UREA 1DFPA 4OGXA 1V2MT 4AOQA 2Q6FA 4D76A 4YT6H 5DP7A 1YYY1 3STIA 1ELAA 1SSXA 1ZSKA 3MTYA 4GUXA 4WMEA 2BY6X 1D3PB 2F9VA 4NSYA 1L1JA 2BLQA 1C2GA 3M5MA 3ZYDA 1P2OA 2AMQA 2V3HH 5E8EH 4Y71A 4ZUHA 4ZKOU 3UWIA 5JB9S 1TNJA 1N6XA 4LZ1H 4X1NU 3A82A 3PB1E 4ZH8A 4J1YA 3EA7A 1Y59T 4BAHB 3LGTA 3QUMP 3BTTE 1LHFH 2THFB 1Q31A 5CE1A 3ELAH 3RU4D 4Y79A 4B2CA 2ZFPH 1TGNA 1Z8JB 1T8NA 4CBOA 1MU8B 4ZMAH 4E05H 3KHVA 5J4QA 1F2SE 1KLIH 2CF8H 1ZR0A 2BHGA 3VB6A 1UVUH 3SI3H 4GPGA 3MHWU 1PJPA 1MKWK 1MBQA 2HPPH 2FTLE 1NESE 4AB9A 1ORFA 1BBRH 3P8OA 5C5NA 1W8BH 1OWHA 1P11E 4DURA 2Z94A 3W95A 2GGVB 1O3IA 1CHGA 1D6RA 2WPIS 3E3TA 5DP9A 4RN6A 1QB9A 1O3CA 1OS8A 2FOEA 4F4OC 5JBAS 1UTOA 2BQWB 1EUFA 4I8KA 2VVCA 1QR3E 1EAUA 3A7YA 4JYUH 8KME2 1GCTC 3T2NA 3PMAB 3SUDA 3CS7A 3A7WA 3Q76A 4YO9A 1BMMH 2YNBA 1LKAA 4FU9A 3KQBA 1TAWA 3S9AA 1HXFH 4YM9A 3MI4A 4AFSA 2K1QA 1O38A 2PGQB 4JZFH 1MBMA 5C2ZA 1O5CB 1CGIE 2JH5D 1UJ1A 2IOTA 4CHAB 3LT3A 2ZGXH 1SQAA 1GBKA 2F3CE 3I78A 1ZMJA 1FZZA 5DPAA 1C1MA 4K8BA 5IYTA 2XWAA 1L4DA 2GCTB 1DITH 3MOCA 3HATH 2VU8E 1BT7A 1S82A 2ANKH 4CRAA 1C5ZB 2XBVA 2CHAB 2EI7A 2SGDE 1FY5A 4IMZA 4JK6A 3BTGE 2AYWA 1IQMA 1GJAB 1LVYA 4FU7A 1T8MA 5FCKA 1RJXB 4K5ZA 3QDZB 4IC6A 4AGJA 1GJ5H 3CP7A 1YLDA 2G55A 3BTFE 4Q80A 1YPHC 4R8TB 3D65E 1Z1JA 4X8UH 1VGCC 5DGJA 2C8XB 4TYDA 1T8LA 2A7HA 2Z9KA 4YLUA 1FQ3A 1A2CH 1Z6EA 2P16A 3A85A 3ZZ7A 2OC1A 1RRKA 2OQUA 1TGSZ 2Y7ZA 1HFDA 5A2MH 2GT7A 3FAOA 1QFKH 1S0QA 1F5RA 1B0FA 3A80A 3N7OA 5A09A 1SFQB 4A5TS 1G32B 2V6NA 3FANA 4ISIH 2R9PA 2BY7X 3RXSA 1ZPZA 1FI8A 3SO3A 5C1XA 2H9EH 4RKJB 3RXIA 2FX4A 2G51A 3BTME 1QA7A 3UQVA 1PYTC 1HAIH 1H4WA 1GHBG 3MH5A 1TX8A 3SJKA 2TBSA 4UE7H 5GIBA 1PQ5A 2G52A 3TLOA 2ZECA 2C3SA 3GY2A 2Z7FE 3TNTA 1P02A 3JZ2B 3A81A 1UVSH 4FU8A 2BY5X 1KY9A 5AFZH 6GCHG 1FAXA 1GMCG 1C1VH 2ZHQH 3G01A 2ZO3H 3Q3YA 1NTPA 2ZCLP 3QK1A 3AAVA 1GL1A 1MZDA 1GCTB 1RTLA 1LCYA 1TABE 3BSQA 1H8DH 1GL0E 1W11U 1BRCE 2QYIA 1YPJH 2LNCA 3SV9A 1G3EA 3EA8A 4I31A 4YOJA 1BTYA 1O2HA 3BEIB 3KEEA 2BX4A 1MTSA 1TPOA 2WPMS 3BG4C 2ZC9H 2G5NA 3H7TA 2Z6BD 2PKSC 1G3BA 3QWCH 1TYNA 1K1PA 1SI5H 2P3TB 5B6OA 1TOMH 1AE5A 2V3OH 2FOMB 4WMFA 5JBTA
chains in the Genus database with same CATH superfamily
3SQHE 2FOAA 1QJ6B 1ARBA 1PQ8A 1LDTT 1PFXC 4IMQA 3TGIE 1D9IA 1TGBA 1QTFA 1SGFG 2ZDNA 5B6LA 5T6DA 2KZ4A 2PWXA 4A1VA 4AZ2B 1GHBF 1ZPCA 2BDCA 1E1RD 1SGCA 2QF4A 1ELBA 1MH0A 2A4GA 4FUHA 4H42U 3NPSA 1H8ED 1HAVB 1VCWA 1A7SA 3HK6B 5JBBS 1OWIA 3FKSD 1VGCB 2QF3A 6GCHF 4AFUA 1E79D 1OXGA 2H5CA 2OUAA 1GMCF 1JBUH 3LGIA 2ALPA 5EOKA 3SU0A 2GVFA 4B76A 2BQ6B 1TMBH 5GXPA 1XVMA 1V2ST 4WY3A 2R0LA 2OBQA 1GJ4H 1RS0A 3DUXH 2NU1E 1QL8A 1UCYE 2PP6A 4WVPE 2O8UA 3A83A 1AVWA 3ZVBA 1DS2E 4NFFA 2J95A 1UVOA 3RXGA 2JETC 3SUFA 1PQ7A 3RXAA 3D49H 4AB8A 2QA9E 4K8YA 1MAYA 1NO9H 4JK5A 2P59A 3BTHE 4X1SU 2Y6TA 3AW1A 2FESH 1LPGB 1TONA 2BDHA 1TPPA 1Y3VA 3EE0B 1DDJA 1MKWH 2TIOA 3A86A 2AGEX 1Z1IA 3GICB 2JDID 2F9OA 5BRRE 3T29A 1C5LH 1BRBE 4K3JA 3QO6A 4DIIH 2YNAA 2VIPA 1XXDA 3TGKE 2K8IA 3LOXA 1ESAA 3URCA 3SU2A 2ZU4A 2B5TB 3B8JA 4MPXA 1C5UA 1SBWA 3MO3A 3OSYA 2O8MA 1G30B 1HAOH 1Q3XA 3SV6A 1RGQA 1WTHD 3PWBA 4FUIA 4DVAU 7GCHG 1GBCA 1KXAA 1HUTH 4AG2A 3UUZA 1L4ZA 2SGPE 3GDUA 3FVFB 4MNVA 1GI2A 1XKAC 1IQEA 3SHAH 1HBTH 3LJOA 4NA7A 1ELVA 1FX0B 3BG4B 3PLPA 2BDBA 4UDWH 1C1PA 1S6FA 2PKSB 4ABAA 1GI3A 1HLTH 3BV9B 3ZV8A 3KF2A 4AG1A 5L2ZH 1RIWC 2EI6A 3JZ1B 2B0FA 1BTUA 2H1UA 2DUCA 2EA3A 1O2NA 1O2WA 1S85A 5CHBA 4K2YA 1A4WH 4ABIA 1P01A 1F7ZA 2ODPA 1W7XH 3DHKH 3F2FA 5F6MA 1TBQH 4ESTE 1ETRH 1P3CA 4ISOA 1GI4A 2ZCHP 2AGGX 1WAYB 1O3LA 1LHCH 4WMDA 2C90B 2W3IA 4HGCA 3RXOA 5A0CA 2BOHB 1NRNH 3NXPA 1BMAA 2XBXA 3E91A 2A5KA 1ZPBA 4GCHF 2UUJB 3VXEH 1ESBA 5LGOA 5GWZA 1GHXH 1KMHB 5E2PA 4DG4A 4K69A 5DO4H 1K1OA 3LGWA 4BNRA 1P03A 3BEFB 1QBNA 2XRCA 1ELTA 4WJG2 1KTTB 4Y10E 3E90B 2V0BA 3MU0A 2RA0A 4BXWA 7GCHF 4AFZA 5C20A 2ESTE 3QTOH 2EI8A 1LHEH 2RDEA 4FUEA 2JETB 3P6ZB 1O32A 1VKYA 2BDIA 2BD7A 1O2XA 4FUCA 5CDFE 3QTVH 3F9GA 1PPEE 1BTWA 1P57B 1WQVH 3SZEA 4TY6A 4Y0ZE 2ZNKH 4XFQA 1T7CA 1C2LA 4IBLH 3SU3A 2PV9B 2BB4A 1HIAB 4YXWD 3FOAA 1F5LA 3V3MA 3UR9A 1GBBA 2HRVA 3LJJA 4OGYA 4OS5A 3T25A 1F92A 4XOJA 4K1SA 8GCHG 2UWPA 4ZXXH 2ZFTA 1G2LA 2P3UB 4MVNA 4BTTB 1C5SA 2A2XH 2PHBA 1G37A 1SGRE 2CF9H 3PRBA 3LDXH 5HMAA 3RMOH 3RXHA 4U2WA 1W14U 2QF5A 1OP8A 1COWD 1AE8H 4THNH 1Z8RA 1PPZA 3ATLA 4GAWA 2IPHA 3HK3B 2KCYA 1GJBB 1C1TA 1DE7H 3PM3A 3TNSA 4ABDA 8LPRA 4CRBA 4NZLA 1NBME 4FVDA 1C5OH 3CNRA 3KQDA 2G4TA 1P10A 1U6QA 1EB2A 4JZ1A 4MTBA 2KCOA 2FLBH 4B2BA 2HNTC 1N1LA 1J14A 1ELDE 5FL7D 3URDA 3UTUH 1MTNC 2FS8A 1T31A 5EXNA 3RC6A 1O5EH 2QC2A 3GCOA 1SQRA 2ZZUH 1IQGA 1V2WT 1O5GH 2OLGA 2SFAA 1G3DA 2STBE 3QZRA 2J38A 1RIWB 2V3MA 5DP5A 2AS9A 2BD8A 2WPDD 1KXDA 4GLYA 2ULLA 4O97A 5GDSH 3ZZ3A 1YY3A 3ESTA 1GBTA 1EZUC 2A7JA 1C1QA 2BDGA 3TK5A 2FDAA 2QV1A 1W0YH 3SUEA 1SLVB 2C93B 3SNCA 1WCZA 2ZFRH 1TMUH 3RXBA 2IN2A 1EJAA 1ZHPA 2O8LA 3S9CA 1DUAA 1L0ZA 1UMAH 2QXHA 3TGJE 1NFUA 3VGCC 4I7YH 1HGTH 2A0QB 4RT0A 1HJAC 4MPWA 1GHVH 1FV9A 3SNBA 3QX5H 1KTSB 1P2IA 8GCHF 1ZHRA 4YESB 4BOHA 1CHOG 1YBWA 2PSYA 1UVTH 5FHTA 1XUKA 4FOUC 4MQAA 2YMSD 3P8GA 3F9HA 2AEIH 1E35B 1C2HA 3EE7A 1IQLA 2ILNA 3RM2H 3GY4A 1CQQA 2VIWA 4YTAA 1YPMH 3TVJB 1O31A 2VWMA 4Q7XA 4MLFB 5C67A 2YOLA 2VVUA 1SLWB 1CT0E 2Z9GA 1NBMD 1O2SA 1FN6A 1MQ5A 1C5PA 1IHSH 1FLEE 1NT1A 3OEED 5FPSA 4ZHMU 1C2DA 2PR3A 3OY5U 5KECA 2O9QA 1TNLA 2Y5FA 2A4QA 3Q00A 1O2GH 3P70B 1GVKB 1D6WA 2XC5A 3L33A 1QL7A 2WPLS 2XXLA 2Z3DA 3RXFA 3ZZ4A 4KTUA 4O03A 5GPIB 1QY6A 1JWTA 4UEHH 1V2OT 2ZDLA 3WY8A 2ZTXA 1O3PB 3MH7A 1W0KD 2JH0D 1DICA 3HGPA 1TQ7B 3MQKC 1S84A 1O5DH 2DE9A 1O2KA 1B5GH 2BY8X 2ZFFH 2VWOA 3OTPA 2PFEA 3BIUH 3BTDE 1BMLA 1DVAH 3EGKH 1MU6B 1C9TA 1S6HA 3HKIB 3A7TA 3AK5A 2O8TA 1UVPA 1CHOF 4DJZB 3KNXA 8ESTE 3GY5A 3TITA 1EX3A 3K6ZA 1T4VH 1C4Y2 2G00A 1JXPA 3PV4A 1O2UA 9ESTA 2B7DH 1CT2E 4X8TH 3PTNA 1V2PT 4XBDA 1ZTJA 3M61U 1MTNB 2PTNA 4OM9A 1EOLA 4Q7YA 1PPHE 1K1MA 1MCVA 4CRGA 1G36A 2BXTH 3HPTB 1C1WH 1OWDA 4WWYA 1BDAA 1OX1A 1F5KU 1WDIA 1XUHA 3ATWA 2G81E 1BMNH 4INHA 2LPRA 3CENA 1TNHA 5K0HA 2ZIQH 3RXJA 1LPKB 1GBJA 1MZAA 1FONA 3MH4A 3H09A 5FBIA 4U30A 1SGNE 2XC0A 4Q2KA 5JBCS 1WOFA 3LC3A 2GT8A 3DSPA 2QE7D 3RXTA 2J98B 3VGCB 1QRWA 2BXUH 1HJAB 1QBOA 5ETXA 7KMEH 4LOYH 4ZHLU 3E0NB 1O3BA 1DY9A 2Y80A 5L2YH 1NU7B 3RC4A 3FFGA 1GHWH 2TGTA 1S81A 2VJ1A 3TPIZ 2JJ1D 1AZZA 1FY4A 3RXLA 3A7ZA 1YKTA 3GDVA 1KXEA 1HJ9A 4H6TA 1DXPA 1EATA 1OSSA 1ZSJA 4VGCC 5DN6D 1BJUA 1TRMA 4JYVH 3M7UA 1ELFA 4TPYA 2OBOA 1EP5A 1SC8U 4K60A 4LXBH 1HXEH 3MU4A 4RT1A 1J8AA 1DANH 1O3AA 4DT4A 2WINI 3OTJE 1SGQE 3M5LA 1CE5A 1O2RA 3PMHB 1TA2A 1MTUA 1MAXA 4WXVA 1P12E 4BTIB 1O2OA 1HCGA 2GMTC 3K65B 2FMJA 4Y76A 3TK9A 2EC9H 2TGAA 1KXBA 1O3FA 2GD4B 2KCPA 5TCCA 3VEQB 5IDKA 4NG9H 1PQAA 3P92A 2OINA 3OY6U 4ABFA 2ZTYA 2GZ8A 3KIDU 1C4U2 3RXCA 1MTWA 2QXGA 2SGEE 5HIZA 2VH0A 2QIQA 1CVWH 1MQ6A 3VB7A 3Q3XA 1Z7KA 1P8VC 1FY8E 3A88A 3SYJA 4FVBA 4FUGA 1SL3A 3PV5A 1O3EA 2XYAA 2BY9X 3SU5A 4AFQA 3SGQE 3DD2H 3AVZA 1K1LA 2WUBA 5C3NA 5FPTA 1AUTC 5KEDA 1SR5C 2FTMA 3RXPA 2WYJA 5LPRA 2IPQX 2STAE 3MNSA 2BTCE 1QB1A 1VZQH 3OAAD 1H1BA 1AMHA 3F9FA 1PPGE 2VIDA 1E37B 1KXCA 2ZHWH 2JJ2D 1TRNA 2J94A 4UONA 2ZDVH 1FN8A 1O3GA 5ESTE 3BG8A 1CGHA 2ZHEH 1AKSB 1A5GH 3RXDA 4ASHA 3V0XA 3AAUA 3ATMA 1QQ4A 1K9OE 1DUEA 5DSFA 3B9FH 1OHHD 1X7AC 2Y5GA 4OS4A 3F2GA 2VBCA 4NIVA 2EQNA 3FN8A 2HGTH 1HAPH 1Z8GA 3A8DA 4LK4A 4D9QA 1V3XA 2ZI2H 1O5AB 3M36A 2J9NA 4AORA 1QB6A 3U28C 1MD8A 3VFEA 1E34B 1M9UA 2BM2A 1MMJN 2XBWA 4NWLA 3DSOA 2GDDA 1MABB 1GWAA 2FYQA 1WXRA 4A1TA 4B71A 1PYTD 2RG3A 5A0BA 2BD4A 1AD8H 4O3UA 1EB1H 3V7TA 1QGFA 3UWJH 5AF9H 2TRMA 1ZLRA 3TJVA 4BAKB 5EW2H 1IQIA 1UTJA 1INCA 3GY6A 4VGCB 5IK2D 3NRLA 1LHDH 2HOBA 3MFJA 1SGIB 1TNIA 1W0JD 3ZYEA 1LO6A 1NRQH 2FX6A 2OP9A 1UTPA 4XRNA 4FUDA 3U8TH 1AKSA 1C1NA 3P17H 4AYVB 1E0FD 4BAMB 1O2MA 3EYDA 1V6DA 5HYOA 1ZTLA 5HM2A 5JPMH 3UY9A 4JZDH 1GHZA 2GMTB 1QQUA 1MKXK 2W3KA 2BD9A 2TGPZ 1V2LT 1YCPM 1A3EH 3SHCH 1O2YA 3GY3A 1ZJKA 4IN1A 3BTQE 1EZQA 2P3FH 2B9LA 4Y8XA 3SORA 1QNJA 2BZ6H 1K28D 1DX5M 2FPZA 1KSNA 4RI0A 7LPRA 1EAIA 5T6FA 3RP2A 2Z9LA 1G2MA 2V35A 1UO6A 2G5VA 1GBIA 1O3HA 1C5YB 3QZQA 1TWXB 5DP6A 4XE4A 1D3DB 1TA6A 1VJAU 4I8LA 1ETSH 2C8YB 1GBFA 1IOEA 4KKDA 1ZSLA 1BIOA 3BEUA 3TH4H 1GBAA 2OTVA 1SHYA 4XBCA 2GCHG 5HM9A 1FIZA 1P2MA 4FXGH 1C5QA 1RFNA 5I46H 4B6FA 1B7XB 1QURH 1QIXB 2VWNA 3VB3A 3PMJA 2UUFB 3IG6B 1XM1A 4WXIA 3V12A 2PSXA 1FAKH 2V7QD 1NRSH 3UNQA 1C5RA 1H9LB 1Y3WA 5FXLA 1QRZA 4CR9A 4Z6AH 3A7VA 3O8CA 5EXLA 1PPCE 4NSVA 1E38B 2M5TA 4B73A 5ABWA 3HGNA 3LU9B 4INKA 1GBEA 1UTMA 2ZU5A 3R3GB 4FUBA 2BQ7B 3RXEA 1AVXA 4X2VA 4HZHA 1TQ0B 4CBNA 4UFGH 4FUJA 4E7RG 4WF8A 4TPIZ 3TJUA 2ZG0H 3FP6E 3RMLH 1AN1E 4GCHG 3SU6A 2J5UA 2BMGB 3WW7A 2XW9A 4Y6DA 3MNCA 3STJA 1ZMLA 2ZF0H 1GBLA 5F8XA 5EQQA 1V2TT 1S83A 4FUFA 1SG8B 3D62A 3ZZ9A 2RCEA 1GMDG 2J34A 1VITG 2KAIA 4X8SH 1KLJH 5FBEA 1GI1A 4YOIA 2ZU1A 1MTVA 1TX6A 1LVOA 4YOGA 4D8NA 3GCTG 4RKOB 4X6MA 3DFLA 1GJ6A 1YF4A 3H7OA 3LKWA 1P9SA 1SQOA 1BB0B 4E06H 3FP8E 2JH6D 5HKKD 4X2YA 2PUXB 4HI3A 5HGGA 2A31A 1K21H 2H9HA 5EIYA 3BTEE 3GS9A 4MG3A 2M2AA 2GCHF 3I29A 1GHAG 2I6QA 5EODA 3TU7H 5E0GA 1TLDA 2W6ID 2GZ9A 4X0WU 1QRXA 4BAQB 3SW2B 3PMBB 2BLWA 1SLUB 5AHGH 4TT3D 4KP0A 1HAZB 5G4BA 2DE8A 2W5EA 1C1UH 1TPSA 5EU8A 4Q7ZA 1K22H 3KQ5A 1ANDA 2Z9IA 1K2I1 3T62A 1VITH 2ANYA 1HV7A 3RXVA 3VB5A 1J15A 3NWUA 2Y82A 4AN7A 1SPJA 3TJNA 2ZGBH 3U8OH 5KGOA 2NU2E 3MU1A 2I6SA 2WYGA 1TE0A 1O2PA 5F8TA 5E2OA 3C27B 1V2JT 5GCHG 5ESBA 1GMDF 3O8BA 1IQHA 1VITF 2VIVA 3A87A 1D3QB 1OYQA 3QGNB 3SN8A 2QGRA 3E0PB 1O34A 1UK4A 3GCTF 2TGDA 1FPHH 1FY1A 1P05A 3ZZAA 4Y8ZA 4I33A 3UB0A 3S9BA 5EQSA 4PROA 2QXIA 3P8FA 3NK8A 2WPKS 1GHAF 2B8OH 2XCFA 2HNTE 2FXRA 5I25A 1TB6H 1V2QT 2ZFSA 3B23B 3UNSA 2FOHA 1E36B 3AASA 1FPCH 3PWCA 1GJDB 3RMMH 1C5VA 4B2AA 1HB0B 1YM0A 2ASUB 2KX4A 5SGAE 2AIPA 3ZZ6A 3K9XB 1DWCH 1NU9A 1WUNH 3MMGA 3MNXA 1IQJA 2TPIZ 2KCAA 1OYTH 2ZP0H 1UCYK 3ZVGA 2AFQB 1WU1A 1GI8B 3CS0A 2F9PA 1KDQA 2ZQ2A 3RU4T 2ZGHA 1BA8B 2P94A 1H8IH 1THRH 2ZKSA 3F3BA 3KL6A 4DY7B 5BPEA 5DJ7A 1QCPA 5A8ZA 1UW7A 4Z0KA 1TBRH 2SGAA 1D4PB 1SHHB 2P8OC 2BOKA 2SGQE 1SKYE 3GISB 5GCHF 1JRSA 2GDEH 5LH8A 5CMXH 1ZHMA 1DY8A 1CSOE 2C4FH 4CR5A 5CHAC 1P06A 1THPB 4MNXA 4TWYA 3ZZCA 3FZDA 1LVMA 1EPTC 2CK3D 1DWBH 1GI6A 1FNIA 2ZU2A 3UIRA 1ACBE 4ZHAA 5H4IB 2AIQA 1K1NA 2ZDMA 3ZZ5A 3BTWE 1GI7B 1P3EA 1EZXC 2R3UA 1O3OA 4BAOB 1G9IE 2WV9A 1K1JA 2VVVA 2CV3A 2AERH 3MO6A 2HVYB 3M5NA 2GJGA 1MKXH 1Z71A 2NU3E 3QN7A 1A5HA 1O5FH 1P0SH 5F03A 3TIUA 1XUGA 5A8XA 2FS9A 3HKJB 4ABEA 3IITA 3SJ8A 3ZIAD 1GBMA 1TGTA 2YMSC 3E8LA 3OU0A 4OS7A 1JOUB 1O5BB 2PUQH 1GBDA 1P09A 2FM2A 2Z3EA 3N99A 4GVUA 1UK3A 2BDAA 1EKBB 4ABGA 1HAHH 3PTBA 3SGAE 3AW0A 3PV2A 1Y5BT 2HALA 3UFAA 2F91A 2FI3E 3F2HA 2C8WB 3F1SB 1KYNA 4YZUA 2Y7XA 4HG6A 1HRTH 2HLDD 3A8AA 2WZQA 1VR1H 1F0SA 4X6PA 2NU0E 5C5OA 1RXPA 3DA9B 1Y5UT 4A7IB 2QAAA 1HYLA 1QZ8A 2PTCE 4SGBE 1ABJH 5A0AE 2H5DA 1SFIA 2PGBB 2VINA 2BLVA 1NFXA 1ZGIA 2ZDKA 4AGKA 4OS6A 3SUGA 1NY22 1O2IA 1VJ9U 1LPZB 2BZAA 5FAHA 2CXVA 5T3HA 3UOUA 3ZVFA 3SU1A 3E6PH 3LC5A 3BTKE 1DWEH 1CGJE 2Z9JA 2A5IA 1DSUA 1IQKA 2WPJS 2OXSA 1JIRA 3SQEE 4NWKA 3VPKA 1BQYA 4I8GA 4ABBA 2XOKD 1UTLM 2FOBA 2W7SA 3UR6A 4O9VA 1ELEE 1WV7H 2A7CA 2CN0H 2UUKB 3LH1A 1Y3YA 1MD7A 1P2NA 2GV6A 5C94A 1VCQA 2PKAA 4ISHH 3V13A 1A0LA 1LMWB 1AIXH 4UFEH 1TNKA 2G8TA 4SGAE 3RMNH 1V2KT 1YPKH 2A2QH 1ETTH 2P8OB 1OP2A 3KN2A 3H5CB 3GDSA 4MPUA 3U98H 2FYRA 1YPGH 1ZOMA 4MPVA 1FUJA 4X6NA 3MYWA 1OWEA 5EPYA 4UFFH 3ZVEA 5F8ZA 4B75A 5CHAB 1IQNA 1W12U 2A1DB 6CHAC 1BUIA 1HJ8A 2ZFQH 2ZA5A 4KELA 2P93A 3M3VA 1G3CA 1BTXA 2VB0A 1EPTB 3KGPA 1L2EA 1SGEE 3RLWH 3RXKA 3TK6A 3ODDA 3TJOA 1AUJA 1ZYOA 1F0UA 2FODA 3ZV9A 4X1QU 1TMTH 1HDTH 3EDXB 1HAXB 3A8BA 3R0FA 4CH2B 4I8JA 1O3JA 1W0ZU 4KGAA 1SGDE 3K6YA 4HTCH 4OS1A 1A1RA 3U1JB 3UQOA 1P04A 2GP9B 3VG8A 3Q77A 1IAUA 1FJSA 2OQ5A 3MWIU 2YMSB 2D2DA 3I77A 4XBBA 4BXSA 1BHXB 6ESTA 1J17T 1BJVA 4CRDA 3SGBE 1ABIH 1XMNB 3UAIC 1S6LA 2CGAA 4JZEH 4F48B 4XSKU 4AYYB 1AU8A 3SNEA 3DFJA 3S69A 4MNWA 1YPHE 1C5WB 1GVZA 3L3TA 4JMYA 2VWLA 5EQRA 3PO1C 2FZZA 4CH8B 1HAYB 1NROH 4NZQA 2UWOA 1DLKB 4CREA 1ELCA 1ZRKA 3M3SA 5T6GA 1P9UA 1UTQA 2VIOA 3P95A 1CA0C 1EXFA 1EPTA 2BVRH 3PLBA 1JRTA 1CU1A 1K1IA 1YPEH 3UOPA 1XVOA 4JZIA 3UPEA 3DT0H 3M37A 5AVDA 1GJ7B 1SGFA 1OOKB 2F43B 3OEHD 3TH2H 3LONA 3F9EA 1N8OC 1NRRH 4U32A 1Y8TA 5C0UA 1BRUP 2CJIA 4DW2U 1GPZA 3LGYA 1DPOA 3BN9A 2D8WA 3KQEA 4D7GA 4TWWA 4CRFA 2SGFE 1QBVH 1OPHB 2RFKC 1OKXA 3A84A 3ZZDA 1YLNA 2FI5E 1NC6A 4I86A 3Q3KA 4X1RU 2F83A 1GI0A 3S7KB 2XNIA 1E1QD 1KIGH 1ANCA 4D7FA 1UCYH 4TSFD 1UHBB 2P95A 1LQDB 4RSPA 3MO9A 2ODQA 3LIWA 1DSTA 4WH8A 2F9UA 3GY7A 1BCUH 4XDEA 4Y7AA 2ZTZA 1O2ZA 1EAXA 3LPRA 1H9HE 1GDQA 2WPHS 2ZHFH 3O8RA 5E0JA 2F4LA 1S0RA 1V2UT 4NFEA 1Y3UA 3PROA 1PPBH 1NS3A 2WV5A 1TPAE 3SV7A 1O39A 4ABJA 4B1TA 4GSOA 5DKMA 1UTNA 1CA8B 4YT7H 2BX3A 6CHAB 2EY4C 2ANWA 3MNBA 3U8RH 3SJIA 2RDLA 4NA8A 3RLYH 2Q6DA 1ELGA 1TALA 3M5OA 2BD5A 4H6SB 1W3CA 4X2WA 1EOJA 4NGAH 2FOGA 1O37A 1NZQH 1CT4E 1FMGA 2CMYA 2ZGJA 2GTBA 2H6MA 4BTUB 1ZTKA 5HXFA 1W10U 1FXYA 3MH6A 5DK1A 2W6JD 4JYTA 2BLOA 1LQEA 3GCHC 3L6PA 4GHTA 1C2FA 1BBRE 4FETA 2ANMH 1T8OA 1UHBA 1C4V2 1ZZZA 3EA9A 4UD9H 3SV8A 1BTHH 2IJD1 5C0TA 3SJ9A 1XUFA 6LPRA 1YPLH 2FWWA 1JMOH 1O2TA 3PO1B 2QXJA 2ZWLH 4J2YB 4H4FA 7ESTE 1AHTH 2ZU3A 1D3TB 1YWUA 3VB4A 1AI8H 1C5XB 1GDUA 4E7NA 3SU4A 5FPYA 1MCTA 5HIYA 1Z8IB 4X8VH 2A4RA 1DOJA 5EGMA 1TIOA 1AZ8A 1OWKA 1CA0B 1Q2WA 4ZKRU 3TH3H 1CBWC 5L6NH 1SLXB 2HWLB 2AH4X 4IS5A 5LPFA 1O36A 1UK2A 4ZXYH 1AGJA 5JYIA 1OWJA 1C2MA 3NUMA 2KM0A 1N8OB 2PW8H 1OP0A 1XKBC 1ZMNA 2NU4E 3GYLB 1JIMA 1IHTH 1NFWA 2A32A 2VH6A 5T1VA 1ID5H 1AY6H 2H2ZA 1XUJA 2ZHDA 1A0JA 5DP4A 1RD3B 3RXUA 2D1JA 3U1IB 9LPRA 1THSH 3RXMA 2XCNA 1YC0A 4CRCA 4UFDH 1SGYE 1AB9C 3WWFA 1AFQC 1BZXE 1C5NH 2J92A 1DT2A 1YCPK 3OE7D 1P2KA 4DT7B 2KAIB 4YLQH 1C2JA 1EAWA 1GMHG 4F49A 1BMFD 3A7XA 1C1SA 3ITIA 1QA0A 4KTCA 1GGDC 1GVLA 1RTFB 2O8WA 2BD3A 1GG6C 4DOQA 4K1TA 3E1XB 3LGUA 3E16B 4NA9H 4NIXA 3GCNA 1H9IE 2ZDAH 3A8CA 1L1NA 1WSSH 1HPGA 3LGVA 1GCDA 1H8HD 3RC5A 1EJMA 5EXMA 4Y11E 4U01A 3T26A 5L30H 1K0HA 3GOVB 1C2KA 2GZ7A 1WYKA 1ESTA 4IC5A 4F55A 1UTKA 1EASA 1EP6A 3M7QA 3ODFA 3P8NA 1HNEE 1LKBA 2A45B 2H9TH 4ZAEA 1W7GH 2OD3B 1AWHB 2BVXH 2AHME 2HNTF 2ODYB 1BRAA 1B0EA 1SGTA 3WWBA 3GCHB 3SBKA 1F0TA 2J4IA 1EQ9A 1GBHA 1ZRBA 4DCDA 1A0HB 3M35A 1YGCH 5K7RA 1HAVA 2FIRH 1YLCA 1O2LA 1ZJDA 1O35A 5J4SA 1PPFE 2EEKA 2XTTB 1GMHF 3IWMA 1O3MA 1XX9A 3PRDA 1CO7E 3ZVDA 5FCRA 2FI4E 1GHYH 3ENSB 1NM6A 5JB8S 4P00A 3NKKA 1CBWB 1BHXF 3NZIA 3W1EA 3S7HB 4DGJA 2WHXA 2QCYA 2ZGCA 2R0KA 3W94A 2WV4A 4D9RA 2ZCKP 1C9PA 2G4UA 2K0QA 2NWNA 1DWDH 1XUIA 1BOQA 1NFYA 2QY0B 2UUYA 1YP9A 2R2MB 1BBRK 4AC9A 3GYMA 1SOZA 1F0RA 3SZNA 2FLRH 1TNGA 2HLCA 1S5SA 3S0NA 3FZZA 3A89A 1AB9B 2BD2A 5JDUB 5C1YA 1AFQB 2ZPSA 4GHQA 5EW1H 3PLKA 2XBYA 1AVGH 1C2IA 1KDQB 5A8YA 1TGCA 2ZPRA 2AMDA 1GI5A 1A46H 4DIHH 1GGDB 2WUCA 1ANBA 4I32A 1GG6B 4Q63A 5EJLA 5C1UA 4INLA 1ARCA 1GDNA 2BVSH 3ZVAA 4QT8C 1O3NA 4WH6A 1L1GA 1IQFA 2GKVE 1A61H 2L74A 5DG6A 4X2XA 2HVXA 4AX9H 1TBZH 2OC8A 3ZVCA 4ZROA 3RUOA 4K1EA 3U69H 1C2EA 1KLTA 4A6LA 3ATKA 1KXFA 2IJOB 2A4OA 2BYAX 3FP7E 4LZ4B 2VGCC 3M3TA 3PYHA 3SJOA 4Y8YA 4ABHA 1C1OA 1QHRB 3F6UH 2FO9A 1A5IA 2Z3CA 4ACBA 2LP6A 1WBGB 4ZKSU 1TRYA 2W26A 2FOFA 3SNDA 4IW4E 1Y5AT 2GX4A 4OS2A 1AFEH 1RTKA 2OC0A 1O2VA 2Y5HA 5FX6A 2QN5T 3SOSA 3T5FH 2KR7A 3BF6H 2Q6GA 3KQCA 1V2NT 2GV7A 1HAGE 3KCGH 3D23A 1V2VT 3QGJA 1FY3A 2J2UA 1P2QA 2R2WU 3M7TA 1ANEA 2JKHA 5PTPA 3RXRA 5TCAA 1DLEA 3GY8A 2C8ZB 4TY7A 2PLXA 4KTSA 1Y3XA 1QJ7B 2UWLA 1BTZA 1VCPA 4JCNA 2XC4A 4X6OA 1AO5A 4Y7BA 2AMPA 1XXFA 3EAJA 2A5AA 2ZQ1A 5E0HA 1FIWA 4A92A 2F9BH 3SI4H 1AWFH 4X1PU 3O8DA 2QF0A 1O3DA 1P2JA 2FP7B 2Q1JA 5FX5A 4ISLA 3C1KA 1DXWA 2BDYA 1W13U 3EQ0H 2D26C 2SNWA 1SQTA 1C5MD 1WQSA 5TJXA 1J9CH 1GJ9B 5DP3A 2R3YA 1T32A 1W2KH 3ATIA 1FDPA 1QJ1B 2ZPQA 4MDSA 1C1RA 1DM4B 3T27A 3DSGA 3BIVH 2AGIX 5LPEA 3T28A 3SV2H 1TX7A 1SVPA 1O3KA 5GJ4B 1LTOA 1V2RT 1HIAA 2FOCA 1MUEB 1ZGVA 1GI9B 1QL9A 1EJNA 1N6YA 3NCLA 5EPNA 1SGPE 3ZZBA 1SB1H 1NRPH 3LH3A 3FO8D 2FEQH 3ZZ8A 2ZEBA 4NIYA 4O3TA 1O33A 3F0OA 4M7GA 2OCVB 3MU8A 4Y0YE 2PKAB 4NIWA 3U9AH 1TFXA 3RXQA 3QLPH 2VNTA 1WTGH 1YCPH 2KFWA 2F9NA 3OX7U 3MU5A 1J16A 1TOCB 3RM0H 3F68H 3K2UA 3RU4E 1GJ8B 2OC7A 1SOTA 1T4UH 1O2JA 1SMFE 1GJCB 4I8HA 4ISNA 3N7DA 4A1XA 2HPQH 2LELA 4HFPB 4IN2A 1NN6A 4ZKNU 1LHGH 1EZSC 1C5TA 2RA3A 2Y81A 5EJZA 2SNVA 1Z6JH 5EJ1A 2W7UA 2VGCB 4CHAC 1O0DH 4IGDA 4R0IA 2VIQA 4B74A 5EG4A 3SNAA 5F53A 1BITA 1O30A 3UNRA 2XWBI 2GCTC 1AQ7A 1NPMA 1A3BH 3DCLA 1LVBA 4BANB 1O2QA 1BTPA 2CHAC 3VXFH 3RDZA 3KYGA 5AFYH 4MNYA 4NCYA 5DP8A 3OYPA 2ALVA 3UREA 1DFPA 4OGXA 1V2MT 4AOQA 2Q6FA 4D76A 4XD7D 4YT6H 5DP7A 1YYY1 3STIA 1ELAA 1SSXA 1ZSKA 3MTYA 4GUXA 4WMEA 2BY6X 1D3PB 2F9VA 4NSYA 1L1JA 2BLQA 1C2GA 3M5MA 4Z1MD 3ZYDA 1P2OA 2AMQA 2V3HH 5E8EH 4Y71A 4ZUHA 4ZKOU 3UWIA 5JB9S 1TNJA 1N6XA 4LZ1H 3F0PA 3A82A 4X1NU 3PB1E 4ZH8A 4J1YA 3EA7A 1Y59T 4BAHB 3LGTA 3QUMP 3BTTE 1LHFH 2THFB 1Q31A 5CE1A 3ELAH 3RU4D 4Y79A 4B2CA 2ZFPH 5GNDA 1TGNA 1Z8JB 1T8NA 4CBOA 4ASUD 1MU8B 4ZMAH 4E05H 3KHVA 5J4QA 4ACAA 2XNDD 1F2SE 1KLIH 2CF8H 1ZR0A 2BHGA 3VB6A 1UVUH 3SI3H 4GPGA 3MHWU 1PJPA 1MKWK 1MBQA 2HPPH 2FTLE 1NESE 4AB9A 1ORFA 1BBRH 3P8OA 5C5NA 1W8BH 1OWHA 1P11E 4Q4LA 3OFND 4DURA 2Z94A 3W95A 4ZCNA 2GGVB 1O3IA 1CHGA 1D6RA 2WPIS 3E3TA 5DP9A 4RN6A 1QB9A 1O3CA 1OS8A 2FOEA 4F4OC 2L6OA 5JBAS 1UTOA 2BQWB 1EUFA 4I8KA 2VVCA 1QR3E 1EAUA 3A7YA 4JYUH 8KME2 1GCTC 3T2NA 3PMAB 3SUDA 3CS7A 3A7WA 3Q76A 4YO9A 1BMMH 2YNBA 1LKAA 4FU9A 3KQBA 1TAWA 3S9AA 1HXFH 4YM9A 3MI4A 4AFSA 2K1QA 1O38A 2PGQB 4JZFH 1MBMA 5C2ZA 1O5CB 1CGIE 2JH5D 1UJ1A 2IOTA 4CHAB 3LT3A 2ZGXH 1SQAA 1GBKA 2F3CE 3I78A 1ZMJA 1FZZA 5DPAA 1C1MA 2WSSD 4K8BA 5IYTA 2XWAA 1L4DA 2GCTB 1DITH 3MOCA 3HATH 2VU8E 1BT7A 1S82A 2ANKH 4CRAA 1C5ZB 2XBVA 2CHAB 2EI7A 2SGDE 1FY5A 4IMZA 4JK6A 1EFRD 3BTGE 2AYWA 2OK5A 4P02A 1IQMA 4M9FA 1GJAB 4B6EA 2J98A 1LVYA 4FU7A 1T8MA 5FCKA 1RJXB 4K5ZA 3QDZB 4IC6A 4AGJA 1GJ5H 3CP7A 1YLDA 2G55A 2JIZD 3BTFE 4Q80A 1YPHC 4R8TB 3D65E 1Z1JA 4X8UH 1VGCC 5DGJA 2C8XB 4TYDA 1T8LA 2A7HA 2Z9KA 4YLUA 3N7EA 1FQ3A 1A2CH 1Z6EA 2P16A 3A85A 3ZZ7A 2OC1A 1RRKA 2OQUA 1TGSZ 2Y7ZA 1HFDA 5A2MH 2GT7A 3FAOA 1QFKH 1S0QA 1F5RA 1B0FA 3A80A 3N7OA 5A09A 1SFQB 4A5TS 1G32B 2V6NA 3FANA 4ISIH 2R9PA 2BY7X 3RXSA 3KYFA 1ZPZA 1FI8A 3SO3A 5C1XA 2H9EH 4RKJB 3RXIA 2FX4A 2G51A 3BTME 1QA7A 3UQVA 1PYTC 1HAIH 1H4WA 1GHBG 3MH5A 1TX8A 3SJKA 2TBSA 4UE7H 5GIBA 1PQ5A 2G52A 3TLOA 2ZECA 2C3SA 3GY2A 2Z7FE 3TNTA 1P02A 3JZ2B 3A81A 1UVSH 4FU8A 2BY5X 1KY9A 5AFZH 6GCHG 1FAXA 1GMCG 2J97A 1C1VH 2ZHQH 3G01A 2ZO3H 3Q3YA 1NTPA 2ZCLP 3QK1A 3AAVA 1GL1A 1MZDA 1GCTB 1RTLA 1LCYA 1TABE 3BSQA 1H8DH 1GL0E 1W11U 1BRCE 2QYIA 1YPJH 2LNCA 3SV9A 1G3EA 3EA8A 4I31A 4YOJA 1BTYA 1O2HA 3BEIB 3KEEA 2BX4A 1MTSA 1TPOA 2WPMS 3BG4C 2ZC9H 2G5NA 3H7TA 2Z6BD 2PKSC 1G3BA 3QWCH 1TYNA 1K1PA 1SI5H 2P3TB 5B6OA 1TOMH 1AE5A 2V3OH 2FOMB 4WMFA 5JBTA 5C17A
chains in the Genus database with same CATH topology
3SQHE 2FOAA 1QJ6B 1ARBA 1PQ8A 1LDTT 1PFXC 4IMQA 3TGIE 1D9IA 1TGBA 1QTFA 1SGFG 2ZDNA 5T6DA 2PWXA 4A1VA 4AZ2B 1GHBF 1ZPCA 2BDCA 1SGCA 1ELBA 1MH0A 2A4GA 4FUHA 4H42U 3NPSA 1HAVB 1VCWA 1A7SA 3HK6B 5JBBS 1OWIA 1VGCB 2QF3A 6GCHF 4AFUA 1OXGA 3LGIA 2H5CA 2OUAA 1GMCF 1JBUH 2ALPA 5EOKA 3SU0A 2GVFA 4B76A 2BQ6B 1TMBH 5GXPA 1XVMA 1V2ST 4WY3A 2R0LA 2OBQA 1GJ4H 1RS0A 3DUXH 2NU1E 1QL8A 1UCYE 4WVPE 2O8UA 3A83A 1AVWA 3ZVBA 1DS2E 4NFFA 2J95A 1UVOA 3RXGA 2JETC 3SUFA 1PQ7A 3RXAA 3D49H 4AB8A 2QA9E 4K8YA 1MAYA 1NO9H 4JK5A 2P59A 3BTHE 4X1SU 2Y6TA 3AW1A 2FESH 1LPGB 1TONA 2BDHA 1TPPA 1Y3VA 3EE0B 1DDJA 1MKWH 2TIOA 3A86A 2AGEX 1Z1IA 3GICB 2F9OA 5BRRE 3T29A 1C5LH 1BRBE 4K3JA 3QO6A 4DIIH 2YNAA 2VIPA 1XXDA 3TGKE 3LOXA 1ESAA 3URCA 3SU2A 2ZU4A 2B5TB 3B8JA 4MPXA 1C5UA 1SBWA 3MO3A 3OSYA 2O8MA 1G30B 1HAOH 1Q3XA 3SV6A 1RGQA 1WTHD 3PWBA 4FUIA 4DVAU 7GCHG 1GBCA 1KXAA 1HUTH 4AG2A 3UUZA 1L4ZA 2SGPE 3GDUA 3FVFB 4MNVA 1GI2A 1XKAC 1IQEA 3SHAH 1HBTH 3LJOA 4NA7A 1ELVA 3BG4B 3PLPA 2BDBA 4UDWH 1C1PA 1S6FA 2PKSB 4ABAA 1GI3A 1HLTH 3BV9B 3ZV8A 3KF2A 4AG1A 5L2ZH 1RIWC 2EI6A 3JZ1B 2B0FA 1BTUA 2H1UA 2DUCA 2EA3A 1O2NA 1O2WA 1S85A 4K2YA 1A4WH 4ABIA 1P01A 1F7ZA 2ODPA 1W7XH 3DHKH 5F6MA 1TBQH 4ESTE 1ETRH 1P3CA 4ISOA 1GI4A 2ZCHP 2AGGX 1WAYB 1O3LA 1LHCH 4WMDA 2C90B 2W3IA 4HGCA 3RXOA 5A0CA 2BOHB 1NRNH 3NXPA 1BMAA 2XBXA 3E91A 2A5KA 1ZPBA 4GCHF 2UUJB 3VXEH 1ESBA 5LGOA 5GWZA 1GHXH 5E2PA 4DG4A 4K69A 5DO4H 1K1OA 3LGWA 4BNRA 1P03A 3BEFB 1QBNA 2XRCA 1ELTA 4WJG2 1KTTB 4Y10E 3E90B 2V0BA 3MU0A 2RA0A 4BXWA 7GCHF 4AFZA 5C20A 2ESTE 3QTOH 2EI8A 1LHEH 4FUEA 2JETB 3P6ZB 1O32A 2BDIA 2BD7A 1O2XA 4FUCA 3QTVH 3F9GA 1PPEE 1BTWA 1P57B 1WQVH 4TY6A 4Y0ZE 2ZNKH 4XFQA 1T7CA 1C2LA 4IBLH 3SU3A 2PV9B 2BB4A 1HIAB 1F5LA 3V3MA 3UR9A 1GBBA 2HRVA 3LJJA 4OGYA 4OS5A 3T25A 1F92A 4XOJA 4K1SA 8GCHG 2UWPA 4ZXXH 2ZFTA 1G2LA 2P3UB 4MVNA 4BTTB 1C5SA 2A2XH 2PHBA 1G37A 1SGRE 2CF9H 3LDXH 5HMAA 3RMOH 3RXHA 4U2WA 1W14U 1OP8A 1AE8H 4THNH 1Z8RA 1PPZA 3ATLA 4GAWA 2IPHA 3HK3B 1GJBB 1C1TA 1DE7H 3PM3A 3TNSA 4ABDA 8LPRA 4CRBA 4NZLA 4FVDA 1C5OH 3KQDA 2G4TA 1P10A 1U6QA 1EB2A 4JZ1A 4MTBA 4B2BA 2FLBH 2HNTC 1N1LA 1J14A 1ELDE 3URDA 3UTUH 1MTNC 2FS8A 1T31A 5EXNA 3RC6A 1O5EH 2QC2A 3GCOA 2ZZUH 1IQGA 1V2WT 1O5GH 2OLGA 2SFAA 1G3DA 2STBE 3QZRA 2J38A 1RIWB 5DP5A 2AS9A 2BD8A 1KXDA 4GLYA 2ULLA 4O97A 5GDSH 3ZZ3A 3ESTA 1GBTA 1EZUC 2A7JA 1C1QA 2BDGA 3TK5A 2FDAA 2QV1A 1W0YH 3SUEA 1SLVB 2C93B 3SNCA 1WCZA 2ZFRH 1TMUH 3RXBA 2IN2A 1EJAA 1ZHPA 2O8LA 3S9CA 1DUAA 1L0ZA 1UMAH 2QXHA 3TGJE 1NFUA 3VGCC 4I7YH 1HGTH 2A0QB 1HJAC 4MPWA 1GHVH 1FV9A 3SNBA 3QX5H 1KTSB 1P2IA 8GCHF 1ZHRA 4YESB 4BOHA 1CHOG 1YBWA 2PSYA 1UVTH 5FHTA 1XUKA 4MQAA 3P8GA 3F9HA 2AEIH 1E35B 1C2HA 1IQLA 2ILNA 3RM2H 3GY4A 1CQQA 2VIWA 4YTAA 1YPMH 3TVJB 1O31A 2VWMA 4Q7XA 4MLFB 5C67A 2YOLA 2VVUA 1SLWB 1CT0E 2Z9GA 1O2SA 1FN6A 1MQ5A 1C5PA 1IHSH 1FLEE 1NT1A 5FPSA 4ZHMU 1C2DA 2PR3A 3OY5U 2O9QA 1TNLA 2Y5FA 2A4QA 3Q00A 1O2GH 3P70B 1GVKB 1D6WA 2XC5A 3L33A 1QL7A 2WPLS 2XXLA 2Z3DA 3RXFA 3ZZ4A 4KTUA 4O03A 5GPIB 1QY6A 1JWTA 4UEHH 1V2OT 2ZDLA 3WY8A 2ZTXA 1O3PB 3MH7A 2JH0D 1DICA 3HGPA 1TQ7B 1S84A 1O5DH 2DE9A 1O2KA 1B5GH 2BY8X 2ZFFH 2VWOA 2PFEA 3BIUH 3BTDE 1BMLA 1DVAH 3EGKH 1MU6B 1C9TA 1S6HA 3HKIB 3A7TA 2O8TA 1UVPA 1CHOF 4DJZB 3KNXA 8ESTE 3GY5A 3TITA 1EX3A 3K6ZA 1T4VH 1C4Y2 2G00A 1JXPA 3PV4A 1O2UA 9ESTA 2B7DH 1CT2E 4X8TH 3PTNA 1V2PT 4XBDA 1ZTJA 3M61U 1MTNB 2PTNA 1EOLA 4Q7YA 1PPHE 1K1MA 1MCVA 4CRGA 1G36A 2BXTH 3HPTB 1C1WH 1OWDA 4WWYA 1BDAA 1OX1A 1F5KU 1XUHA 3ATWA 2G81E 1BMNH 4INHA 2LPRA 3CENA 1TNHA 5K0HA 2ZIQH 3RXJA 1LPKB 1GBJA 1MZAA 1FONA 3MH4A 5FBIA 4U30A 1SGNE 2XC0A 4Q2KA 5JBCS 1WOFA 3LC3A 2GT8A 3RXTA 3VGCB 1QRWA 2BXUH 1HJAB 1QBOA 5ETXA 7KMEH 4LOYH 4ZHLU 3E0NB 1O3BA 1DY9A 2Y80A 5L2YH 1NU7B 3RC4A 3FFGA 1GHWH 2TGTA 1S81A 2VJ1A 3TPIZ 1AZZA 1FY4A 3RXLA 3A7ZA 1YKTA 3GDVA 1KXEA 1HJ9A 4H6TA 1DXPA 1EATA 1OSSA 1ZSJA 4VGCC 1BJUA 1TRMA 4JYVH 3M7UA 1ELFA 4TPYA 2OBOA 1EP5A 1SC8U 4K60A 4LXBH 1HXEH 3MU4A 1J8AA 1DANH 1O3AA 2WINI 3OTJE 1SGQE 3M5LA 1CE5A 1O2RA 3PMHB 1TA2A 1MTUA 1MAXA 4WXVA 1P12E 4BTIB 1O2OA 1HCGA 2GMTC 3K65B 2FMJA 4Y76A 3TK9A 2EC9H 2TGAA 1KXBA 1O3FA 2GD4B 5TCCA 3VEQB 5IDKA 4NG9H 1PQAA 3P92A 2OINA 3OY6U 4ABFA 2ZTYA 2GZ8A 3KIDU 1C4U2 3RXCA 1MTWA 2QXGA 2SGEE 2VH0A 2QIQA 1CVWH 1MQ6A 3VB7A 3Q3XA 1Z7KA 1P8VC 1FY8E 3A88A 4FVBA 4FUGA 1SL3A 1O3EA 2XYAA 2BY9X 3SU5A 4AFQA 3SGQE 3DD2H 3AVZA 1K1LA 2WUBA 5C3NA 5FPTA 1AUTC 1SR5C 2FTMA 3RXPA 2WYJA 5LPRA 2STAE 3MNSA 2BTCE 1QB1A 1VZQH 1H1BA 1AMHA 3F9FA 1PPGE 2VIDA 1E37B 1KXCA 2ZHWH 1TRNA 2J94A 4UONA 2ZDVH 1FN8A 1O3GA 5ESTE 3BG8A 1CGHA 2ZHEH 1AKSB 1A5GH 3RXDA 4ASHA 3V0XA 3AAUA 3ATMA 1QQ4A 1K9OE 1DUEA 3B9FH 1X7AC 2Y5GA 4OS4A 4NIVA 2HGTH 1HAPH 1Z8GA 3A8DA 4LK4A 4D9QA 1V3XA 2ZI2H 1O5AB 3M36A 2J9NA 4AORA 1QB6A 1MD8A 3VFEA 1E34B 1M9UA 2BM2A 1MMJN 2XBWA 4NWLA 2GDDA 1GWAA 2FYQA 4A1TA 4B71A 1PYTD 2RG3A 5A0BA 2BD4A 1AD8H 4O3UA 1EB1H 3V7TA 1QGFA 3UWJH 5AF9H 2TRMA 1ZLRA 3TJVA 4BAKB 5EW2H 1IQIA 1UTJA 1INCA 3GY6A 4VGCB 1LHDH 2HOBA 3MFJA 1SGIB 1TNIA 3ZYEA 1LO6A 1NRQH 2FX6A 2OP9A 1UTPA 4FUDA 3U8TH 1AKSA 1C1NA 3P17H 4AYVB 1E0FD 4BAMB 1O2MA 3EYDA 1V6DA 5HYOA 1ZTLA 5HM2A 5JPMH 3UY9A 4JZDH 1GHZA 2GMTB 1QQUA 1MKXK 2W3KA 2BD9A 2TGPZ 1V2LT 1YCPM 1A3EH 3SHCH 1O2YA 3GY3A 1ZJKA 4IN1A 3BTQE 1EZQA 2P3FH 2B9LA 4Y8XA 3SORA 1QNJA 2BZ6H 1K28D 1DX5M 2FPZA 1KSNA 7LPRA 1EAIA 5T6FA 3RP2A 2Z9LA 1G2MA 2V35A 1UO6A 2G5VA 1GBIA 1O3HA 1C5YB 3QZQA 1TWXB 5DP6A 4XE4A 1D3DB 1TA6A 1VJAU 4I8LA 1ETSH 2C8YB 1GBFA 1IOEA 4KKDA 1ZSLA 1BIOA 3BEUA 3TH4H 1GBAA 2OTVA 1SHYA 4XBCA 2GCHG 5HM9A 1FIZA 1P2MA 4FXGH 1C5QA 1RFNA 5I46H 1B7XB 1QURH 1QIXB 2VWNA 3VB3A 3PMJA 2UUFB 3IG6B 1XM1A 4WXIA 3V12A 2PSXA 1FAKH 1NRSH 3UNQA 1C5RA 1H9LB 1Y3WA 5FXLA 1QRZA 4CR9A 4Z6AH 3A7VA 3O8CA 5EXLA 1PPCE 4NSVA 1E38B 2M5TA 4B73A 5ABWA 3HGNA 3LU9B 4INKA 1GBEA 1UTMA 2ZU5A 3R3GB 4FUBA 2BQ7B 3RXEA 1AVXA 4X2VA 4HZHA 1TQ0B 4CBNA 4UFGH 4FUJA 4E7RG 4WF8A 4TPIZ 3TJUA 2ZG0H 3FP6E 3RMLH 1AN1E 4GCHG 3SU6A 2BMGB 2XW9A 4Y6DA 3MNCA 3STJA 1ZMLA 2ZF0H 1GBLA 5F8XA 5EQQA 1V2TT 1S83A 4FUFA 1SG8B 3D62A 3ZZ9A 2RCEA 1GMDG 2J34A 1VITG 2KAIA 4X8SH 1KLJH 5FBEA 1GI1A 4YOIA 2ZU1A 1MTVA 1TX6A 1LVOA 4YOGA 4D8NA 3GCTG 4RKOB 4X6MA 3DFLA 1GJ6A 1YF4A 3H7OA 3LKWA 1P9SA 1SQOA 1BB0B 4E06H 3FP8E 2JH6D 4X2YA 2PUXB 4HI3A 5HGGA 2A31A 1K21H 2H9HA 3BTEE 4MG3A 2GCHF 3I29A 1GHAG 2I6QA 5EODA 3TU7H 5E0GA 1TLDA 2GZ9A 4X0WU 1QRXA 4BAQB 3SW2B 3PMBB 2BLWA 1SLUB 5AHGH 4KP0A 1HAZB 5G4BA 2DE8A 2W5EA 1C1UH 1TPSA 5EU8A 4Q7ZA 1K22H 1ANDA 2Z9IA 1K2I1 3T62A 1VITH 2ANYA 1HV7A 3RXVA 3VB5A 1J15A 3NWUA 2Y82A 4AN7A 1SPJA 3TJNA 2ZGBH 3U8OH 2NU2E 3MU1A 2I6SA 2WYGA 1TE0A 1O2PA 5F8TA 5E2OA 3C27B 1V2JT 5GCHG 5ESBA 1GMDF 3O8BA 1IQHA 1VITF 2VIVA 3A87A 1D3QB 1OYQA 3QGNB 3SN8A 2QGRA 3E0PB 1O34A 1UK4A 3GCTF 2TGDA 1FPHH 1FY1A 1P05A 3ZZAA 4Y8ZA 4I33A 3S9BA 5EQSA 4PROA 2QXIA 3P8FA 3NK8A 2WPKS 1GHAF 2B8OH 2XCFA 2HNTE 2FXRA 5I25A 1TB6H 1V2QT 2ZFSA 3B23B 3UNSA 2FOHA 1E36B 3AASA 1FPCH 3PWCA 1GJDB 3RMMH 1C5VA 4B2AA 1HB0B 1YM0A 2ASUB 5SGAE 2AIPA 3ZZ6A 3K9XB 1DWCH 1NU9A 1WUNH 3MMGA 3MNXA 1IQJA 2TPIZ 1OYTH 2ZP0H 1UCYK 3ZVGA 2AFQB 1WU1A 1GI8B 3CS0A 2F9PA 1KDQA 2ZQ2A 3RU4T 2ZGHA 1BA8B 2P94A 1H8IH 1THRH 2ZKSA 3KL6A 4DY7B 5BPEA 5DJ7A 1QCPA 5A8ZA 4Z0KA 1TBRH 2SGAA 1D4PB 1SHHB 2P8OC 2BOKA 2SGQE 3GISB 5GCHF 1JRSA 2GDEH 5LH8A 5CMXH 1ZHMA 1DY8A 1CSOE 2C4FH 4CR5A 5CHAC 1P06A 1THPB 4MNXA 4TWYA 3ZZCA 3FZDA 1LVMA 1EPTC 1DWBH 1GI6A 1FNIA 2ZU2A 3UIRA 1ACBE 4ZHAA 5H4IB 2AIQA 1K1NA 2ZDMA 3ZZ5A 3BTWE 1GI7B 1P3EA 1EZXC 2R3UA 1O3OA 4BAOB 1G9IE 1K1JA 2VVVA 2CV3A 2AERH 3MO6A 3M5NA 1MKXH 1Z71A 2NU3E 3QN7A 1A5HA 1O5FH 1P0SH 5F03A 3TIUA 1XUGA 5A8XA 2FS9A 3HKJB 4ABEA 3IITA 3SJ8A 1GBMA 1TGTA 3OU0A 3E8LA 4OS7A 1JOUB 1O5BB 2PUQH 1GBDA 1P09A 2FM2A 2Z3EA 4GVUA 1UK3A 2BDAA 1EKBB 4ABGA 1HAHH 3PTBA 3SGAE 3AW0A 1Y5BT 2HALA 3UFAA 2F91A 2FI3E 2C8WB 3F1SB 1KYNA 4YZUA 2Y7XA 1HRTH 3A8AA 1VR1H 1F0SA 4X6PA 2NU0E 5C5OA 1RXPA 3DA9B 1Y5UT 4A7IB 2QAAA 1HYLA