3MNSA

Investigation of global and local effects of radiation damage on porcine pancreatic elastase. third stage of radiation damage
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mnsA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mnsA01
1UK2A 4QT8C 5E0JA 1FUJA 2IN2A 5CHAB 1IQKA 4K8YA 1MU6B 4X2YA 1TALA 1XM1A 1TGNA 2ZF0H 4Y8ZA 2AFQB 3BTHE 2Y5GA 4RN6A 1QRZA 2J4IA 3A87A 3A81A 3ZVGA 4BAHB 3QLPH 4E06H 1Z8JB 4INKA 2TIOA 5LGOA 1HAGE 4NIXA 1ELCA 1TFXA 1HAOH 4CH8B 2GCTB 1GWAA 1QRXA 2VGCC 5GDSH 1C4U2 2FODA 1QURH 1GI0A 2TPIZ 1NU7B 1F2SE 2VNTA 2Z7FE 1MTUA 7KMEH 1K1NA 1UTNA 4YLUA 2FI4E 4Y11E 4FU8A 3P8FA 3S9AA 2ZCLP 4UFDH 4BANB 1DWDH 1ELTA 2ZTZA 1YPKH 1PPGE 2OUAA 1DY8A 5L30H 4AORA 2Y5FA 1DDJA 2OC1A 1HFDA 2H2ZA 4Q7XA 2C3SA 3GYLB 2PLXA 5DKMA 1O3MA 2VVVA 3UQOA 5GCHF 2BZ6H 1P01A 1FNIA 2BVSH 3SZNA 1DXWA 3ZZCA 1LMWB 3UOUA 1PPEE 4U30A 1O2TA 5DO4H 1GBKA 1GBHA 1TLDA 1IQHA 1VITF 5F03A 3A7VA 2AYWA 2ZEBA 3T2NA 1FY4A 3PLBA 3GY6A 3VGCC 1UVOA 3SGBE 3AASA 1CHOG 3MWIU 2Y5HA 2C93B 1MTNC 1D3TB 2TBSA 2AIPA 5F8TA 1MMJN 1F0UA 3NPSA 2V0BA 3GY3A 4JCNA 2SGFE 1V3XA 1V2UT 1CQQA 3TK5A 5B6OA 3SQHE 1Q2WA 3V13A 3U8OH 5T6GA 1TGSZ 1TQ0B 4AZ2B 1E34B 5JB8S 3GY2A 3T28A 4DT7B 2FIRH 1MD7A 2BVXH 2WPHS 4PROA 1TIOA 1O2YA 4ZKNU 1KDQA 1GHYH 1QRWA 2BLQA 1W0YH 1O38A 1C5LH 2OC8A 2BVRH 1THRH 4MNYA 1ANBA 2UUKB 3VB6A 3ODDA 3PB1E 4AYYB 8LPRA 2IJOB 1P02A 3BG4B 1GG6C 3RXQA 1ZSLA 4YO9A 4FU9A 3LJJA 1ZJDA 5ABWA 2ASUB 5HM9A 2BMGB 2H9HA 2GT8A 2Z3CA 4DCDA 3FVFB 1ESBA 3FP6E 1V2TT 2A4GA 1MQ5A 2PKAA 1QQ4A 1AB9C 3LIWA 2G8TA 3Q77A 5GWZA 4HTCH 1F92A 2ZCKP 2VVUA 3QZQA 4GHTA 2J94A 1FY5A 1WOFA 1N6YA 3KQEA 1AUJA 4BTUB 1A3EH 1GJ7B 3DA9B 2ZDAH 2J38A 1Y3VA 1SBWA 3LC5A 3A86A 1IQFA 3MFJA 1A0HB 2WYJA 1O3OA 1W3CA 1O3JA 1ZRKA 2BY8X 1TPOA 1F0RA 1MBQA 2XWBI 3SJ9A 5JBAS 3D65E 2ZHWH 3ZZ8A 2NWNA 2FI3E 2Z3EA 1AVXA 1B0EA 1ZSKA 3M36A 1EJMA 1FY8E 1TRYA 1V2NT 5DP4A 1DX5M 1NRRH 1HAVA 3BIUH 2PW8H 1GJ5H 3NWUA 4MLFB 3KCGH 1V2LT 2Y81A 1MH0A 1ELAA 1C4Y2 3MU5A 4UFGH 2BLOA 3TITA 3M7UA 2QCYA 4OS2A 3VEQB 4TWYA 4A92A 5JBTA 3SBKA 1ZGIA 1AE5A 2A0QB 3SNAA 1RTKA 1TMTH 2ANWA 4ABEA 3RU4D 5LPEA 1UMAH 1C1QA 5IYTA 1ETRH 3MH7A 1BOQA 5JDUB 1CHOF 3ZYDA 1OWDA 1UTOA 2WV5A 1GHZA 1AVGH 3TK9A 4AN7A 3TGIE 1XKBC 4VGCB 1W2KH 3T29A 3I29A 1BMNH 3TVJB 1OP2A 2F9NA 1ZMNA 1BQYA 2GVFA 1BA8B 2HPPH 1ARBA 1WCZA 1FJSA 1EOLA 3PO1C 2O9QA 3ZV9A 4INHA 3LGVA 2VIVA 4DJZB 2BXTH 1O5AB 3K2UA 1AKSA 2A4QA 2Z3DA 1VCQA 3M3VA 5C20A 2HNTE 1O2QA 5HXFA 2GDDA 3SQEE 1LVMA 1VR1H 4DIHH 1W13U 3E8LA 3QX5H 1V2OT 3M5MA 2GD4B 4WMDA 1OWJA 1TA2A 2VINA 3Q76A 3SI4H 4AGKA 3BN9A 2D26C 1O39A 3TJNA 1LVYA 2O8UA 2ZPQA 1SVPA 1PPFE 3BTWE 3T26A 8ESTE 3U1JB 3S69A 1UHBB 2A32A 1ZGVA 2ZECA 1DE7H 1EJAA 1IQGA 3LGUA 4D9RA 2F91A 1B0FA 1OOKB 3MU0A 2FYQA 3SU2A 3V7TA 3RXMA 1X7AC 2XNIA 1HPGA 1FPHH 3KGPA 3M5LA 1HBTH 6CHAC 2J2UA 2ZKSA 2GCHG 4ZHLU 4CRGA 4CR9A 1C1UH 3IG6B 1C5YB 1O3IA 1HJAB 5K7RA 2Q6GA 4ZHAA 2A5AA 1W7GH 4MPXA 4BXWA 3RXTA 5AHGH 4B73A 1LDTT 4UONA 1CA0C 1YC0A 2Y80A 5FAHA 1QY6A 1NU9A 1T8OA 1ETTH 3GY7A 4A5TS 3LONA 4OS1A 1ZHPA 5C1XA 1G3EA 2UWLA 3M5NA 3VXEH 2F9PA 3S7HB 1ELFA 5EW1H 4A7IB 3U8TH 1CT0E 9ESTA 1JMOH 1ZTLA 2FDAA 1QJ1B 1PYTD 3CP7A 3RC4A 5HGGA 1TBQH 1DLKB 1NC6A 1HAIH 5L2ZH 3A89A 3TNTA 3PWCA 2QGRA 2ZFSA 1JIMA 1CE5A 1LHEH 1NZQH 1G9IE 1TNGA 3ENSB 4DOQA 1WV7H 1V2QT 4UFFH 4JZEH 1SC8U 1KTTB 3GOVB 1VCWA 4MNXA 3ESTA 4YOGA 1TOMH 3OY6U 1GI2A 1HB0B 1LQEA 1G32B 3Q3XA 2AERH 2EC9H 2OCVB 2G81E 1CBWB 1UCYE 1O3CA 4AGJA 1NFWA 1C1RA 2A5IA 3PV4A 3RXUA 4B75A 1SQTA 4F4OC 2GP9B 2PKSB 1PQ8A 4CRBA 2GX4A 1IAUA 3A8DA 2ZU3A 3F9GA 4WJG2 5JPMH 1J8AA 4WMFA 4IW4E 1HNEE 2C8WB 4IBLH 5T6FA 2FPZA 3T25A 5CHAC 1BBRE 3PM3A 6ESTA 1TGTA 3EE0B 5C5OA 1EAXA 4CREA 3GY5A 2PR3A 1XUFA 1EQ9A 1YP9A 3RMLH 5E8EH 2GZ9A 5FX6A 4DIIH 2HNTC 2FOGA 2BD9A 2BOKA 2QXJA 4XDEA 4R0IA 3UNRA 3LC3A 1AQ7A 4XBCA 1ZMJA 4BTTB 2GCTC 2ZTYA 1K1IA 4Q2KA 1RRKA 2ZDKA 3HPTB 1OYTH 5HYOA 2EEKA 3LGIA 5DP5A 4K5ZA 1BRCE 1C2FA 4JZ1A 3OU0A 1C5MD 2QF3A 1O5DH 2C8ZB 1O2NA 1LO6A 5C5NA 2GCHF 1EB2A 1DOJA 3E0PB 4X6NA 2F9BH 5DG6A 3I78A 1UTQA 2BLVA 3D23A 3EGKH 3A8BA 1EZXC 1S85A 1ZTKA 1O0DH 1GJ4H 3ZZ9A 3LGWA 1O5BB 1QL7A 4JK5A 1LHFH 1SGFA 1CHGA 2ZWLH 4LK4A 1O2RA 4ABBA 1GVKB 3URDA 1DUAA 1QB6A 4YM9A 3BEIB 2CMYA 1BRUP 2ILNA 1OKXA 2XCFA 4MDSA 1NM6A 3F9FA 3T62A 1AY6H 1KLJH 2WPMS 2FI5E 3DFJA 4TYDA 2THFB 3RXFA 3LJOA 1GL1A 4TY6A 2IPHA 1EPTB 4K1SA 1W10U 3RU4E 1C2JA 3P95A 2PWXA 2VVCA 3MNCA 1L1GA 2BD4A 3QWCH 5L6NH 5AFZH 1ZSJA 1RTFB 1JXPA 4K60A 2CV3A 2M5TA 3LGYA 1ETSH 1A0JA 1TX6A 4DURA 3SW2B 1PQAA 3LT3A 3KF2A 4UFEH 2VIOA 5C1YA 2XYAA 4J2YB 2ZQ1A 3SHCH 3MTYA 1ELDE 1QBOA 1TB6H 3S9BA 1FDPA 1S5SA 5EW2H 3BV9B 1BMMH 1FLEE 5AFYH 1QB9A 1P05A 1GMCG 1O2SA 3GICB 4FVDA 4MPVA 1H9HE 1L1NA 5DPAA 2BB4A 5AF9H 3P8NA 1O3HA 3BG8A 1BTHH 2Y7ZA 1BRBE 3BG4C 4XFQA 3SUFA 1K22H 2FM2A 3ZZBA 5EQRA 4ZXYH 4YLQH 1UTMA 1O3LA 1OP0A 1LHCH 1V2VT 1CT2E 1MCVA 1SGQE 3A85A 3BSQA 2Z9KA 1CGJE 3QZRA 1VITH 4TPIZ 3ZVAA 5DP3A 3S9CA 4OGXA 1SHYA 3HATH 2O8MA 3QTOH 3SGAE 1W0ZU 2ODQA 3BTKE 3OY5U 2ZFPH 1O2UA 1GBIA 1ZHMA 1EAWA 1TRMA 1WAYB 1GI9B 3OSYA 1M9UA 1VZQH 2BY9X 1C5TA 1Z7KA 1PPZA 1DS2E 1OYQA 2ZTXA 1DFPA 1UK3A 1D6RA 1DITH 1S6HA 2UUJB 3A7ZA 3RMMH 1T4VH 2PTCE 3PMBB 4H4FA 7LPRA 1EP5A 2Z9LA 4LZ1H 3P92A 3RXDA 4Y76A 1O2PA 1YCPK 1XUGA 1A3BH 1EASA 4B2AA 4A1VA 5J4SA 1C5OH 3ZVFA 3NXPA 1T4UH 3SNEA 3SNCA 3VB3A 1AZZA 1P3CA 3GCTG 2UUYA 1QQUA 3A82A 1NRQH 1YM0A 1HXEH 3UR9A 1K1LA 1THPB 1WQSA 4Z0KA 1CGIE 2ALVA 1GHBG 1ABJH 4AB9A 1XUHA 2R3UA 3GCOA 2ZHFH 1K28D 1MAXA 4X1QU 4X1RU 1AU8A 1GI1A 1HDTH 2KAIB 2NU3E 3NKKA 1GMDG 2JH5D 5T3HA 2OC7A 1T8LA 3KN2A 3SU0A 1A4WH 4VGCC 4U32A 2GDEH 1AWHB 2BDHA 3B8JA 1DWBH 1Q3XA 3RU4T 2CN0H 3GCNA 4H6TA 3ZVEA 3R0FA 4ZMAH 1NS3A 2PSXA 2OBOA 1FIZA 5L2YH 1BB0B 1DWCH 1SFIA 3UUZA 4A1XA 2HVXA 4CRDA 1ANCA 4CRCA 2VU8E 3E1XB 3WY8A 3M7TA 1C5QA 4GCHG 4X6MA 1CU1A 2FOHA 5K0HA 1NESE 2Z9GA 4MTBA 3NZIA 1H8IH 3ZZ3A 1J17T 2AMDA 1GMCF 5TCAA 5FXLA 1HAVB 2ANYA 4BXSA 5EG4A 1DANH 4ABAA 1UTLM 3TU7H 4X8SH 2BM2A 3CS7A 5JBCS 1SB1H 1TNLA 4IC6A 1EZSC 1QGFA 1GPZA 1E36B 2QF0A 4O9VA 4SGAE 4KTUA 3VB4A 2ZZUH 3BTME 3FP8E 1UK4A 3BIVH 4FU7A 4K3JA 3SI3H 5DP9A 1GBJA 1QL9A 2H9TH 1GJ8B 1HJAC 1A46H 4FVBA 4XE4A 4ABIA 2RA3A 2XC0A 4O3UA 2A45B 1OXGA 2QIQA 1V6DA 1K1MA 3BTGE 4IS5A 3A7YA 2VB0A 3UPEA 2W26A 1O2LA 1PPBH 1FAXA 3M3TA 3MNXA 3RM0H 1CA8B 4J1YA 1TMBH 1HJ9A 2FLBH 1BBRH 4YESB 3GCHB 3LKWA 1T8MA 2G55A 4BAMB 4HZHA 4CR5A 2STBE 3HKJB 2Y6TA 2VH6A 3V0XA 1ESAA 1QJ6B 1C1WH 1BRAA 4MNVA 3BTQE 5DP6A 2I6QA 2P93A 1GGDB 1TONA 1HRTH 5FX5A 1FY1A 1IQIA 1SLUB 1V2ST 1CGHA 4OGYA 1C2KA 1HGTH 3JZ2B 3FAOA 2ZGBH 2UWOA 1S0QA 1NN6A 4O03A 2BDYA 1P57B 1RXPA 2ZPSA 3K9XB 1PQ5A 3Q00A 3C27B 1GMDF 5LPFA 1QBVH 2FS8A 3RC5A 1AGJA 4FUBA 3RP2A 3ZZDA 4AFZA 2BQ6B 3W94A 4ZUHA 3P8OA 3RLYH 2FX6A 1LKAA 1TQ7B 1PYTC 1EATA 4WY3A 2UWPA 2ZDNA 1CBWC 3QO6A 2ZFQH 2BD8A 1P11E 3A8CA 2VIPA 4D8NA 1D3DB 2GTBA 1YCPH 2A7CA 2ZU2A 2PKSC 1KY9A 2R0KA 1Z6JH 2EI6A 1YPEH 4GCHF 1HUTH 1C1SA 2BQWB 1ACBE 2FX4A 2Y82A 1T31A 3O8RA 2SGDE 2QY0B 1W14U 4NSVA 5A8YA 4CBNA 1O3KA 2P94A 4D7FA 3SV7A 1O34A 1IHTH 1C1MA 3SU6A 1EZUC 1D3PB 1V2JT 1D6WA 4AOQA 3UY9A 1GHAG 5AVDA 1GBBA 1UVSH 3S7KB 1C5UA 2DE9A 4MQAA 2FOCA 4WXVA 1QR3E 4NIYA 5A8XA 3MO6A 4MPUA 1HIAA 2HPQH 1NFUA 1OWIA 4Y0ZE 4GSOA 1VGCB 1C5SA 4LOYH 2PV9B 1BMAA 2BDIA 2O8LA 2PHBA 4X1PU 3BEFB 4I7YH 4U01A 1VJAU 2R9PA 3AW1A 1CT4E 4X2WA 1FONA 3PMJA 5EXLA 2ZDVH 4YOIA 4GUXA 1Y8TA 1QA7A 2SGPE 4WMEA 5EPYA 4ZKRU 1C5ZB 2H1UA 2PUQH 2ULLA 4E7RG 1GCDA 1JWTA 2A2XH 4ABJA 2W5EA 1SMFE 3EAJA 1G3CA 1O2ZA 1A0LA 2CF8H 2GKVE 1UTPA 2Z94A 3U1IB 1AZ8A 3AAVA 3SJ8A 5E2OA 1XUJA 2FOEA 4H6SB 3RXBA 1HAZB 1RD3B 1P2JA 1U6QA 1P10A 3ATMA 4JYUH 1BJUA 1SGFG 3P17H 4Y0YE 1A2CH 1P2MA 1ID5H 1EPTC 1FN8A 1WU1A 1H9IE 4F49A 1KLTA 1O5FH 1ZZZA 3RXCA 4NWKA 1YYY1 1FQ3A 3DHKH 1GI7B 4AFUA 3PYHA 1A7SA 1MKWH 3AW0A 2STAE 3L3TA 2JETB 1UVUH 2EI7A 3QN7A 3KEEA 1S84A 1AE8H 2AGIX 2PUXB 3O8DA 2BD5A 2F3CE 1Z8RA 2PGBB 3LH1A 2FTLE 4HGCA 4CHAB 1QA0A 5FPSA 1MBMA 2BTCE 2EA3A 3DFLA 3L33A 3U8RH 1QTFA 1CVWH 5DK1A 1G3DA 2BX4A 2QN5T 1N8OB 9LPRA 1J9CH 1V2MT 1GCTB 2B0FA 1O2WA 2CGAA 1DSUA 1J16A 4X2VA 4NFEA 1SGRE 1BTZA 2R2MB 3K6YA 5IDKA 1TBRH 4DY7B 3RXEA 3LDXH 2FTMA 2FYRA 2VH0A 3VFEA 4ISOA 2ZU5A 2ZCHP 1FAKH 1GJCB 3MMGA 3SU3A 2ZP0H 4UEHH 3MO9A 1YPMH 3HKIB 1GL0E 1Q31A 4JMYA 4GPGA 1YLCA 2OQ5A 4KGAA 2F9OA 2BY5X 3PMHB 1OWKA 2XC4A 4HI3A 3MYWA 3MU8A 1ANEA 2EI8A 4AFQA 5A0CA 4MVNA 1ELGA 2P59A 1JBUH 1L2EA 1ZOMA 3LPRA 3I77A 1E0FD 3SV8A 1SGYE 4IMQA 1RS0A 4WXIA 1BDAA 1AN1E 2ZGHA 2P95A 2OD3B 5E2PA 1MTVA 1OP8A 1FY3A 2OXSA 3GDVA 3SHAH 1D4PB 4ZKOU 1PPHE 1TRNA 4AFSA 1YCPM 3M7QA 3SV9A 1TGBA 1L0ZA 2ZPRA 1UO6A 1NRPH 4FUGA 2C8XB 1S83A 4I8LA 2F9VA 2TGDA 2XC5A 4X1NU 1NO9H 1LVOA 4FUEA 3KQBA 4X8UH 4ZH8A 2P8OB 1TPPA 2ZU4A 4FUHA 3ZVDA 2C8YB 2SNVA 1K2I1 3TIUA 2YNBA 3GYMA 3TJUA 1E37B 1BTYA 3UR6A 2ZI2H 1INCA 1HAXB 5DP7A 1G36A 2BY7X 4X6OA 2QC2A 3DD2H 4BAQB 2DE8A 4MPWA 1YBWA 3M3SA 3UREA 3ZVBA 2SNWA 5CMXH 3KQDA 3RXIA 3M35A 2OINA 2NU0E 1GI6A 3RUOA 4B76A 1OWEA 1P2OA 5FHTA 1O3DA 3U9AH 2PTNA 4I33A 3SUEA 3F68H 1RJXB 1E35B 2WV4A 3EQ0H 1GHVH 1K21H 2BZAA 1EXFA 1IQJA 1O5GH 2NU2E 5J4QA 1LHDH 4O97A 1QFKH 2ZDLA 1ZPBA 2XXLA 3ATLA 3QK1A 2A4RA 4AX9H 5C3NA 1O2MA 2ODYB 4A6LA 1THSH 1K1OA 3HGPA 2Z9JA 3TGJE 3T27A 1FN6A 1SGDE 4BTIB 1O3NA 1XKAC 1TNIA 3SJOA 3A7WA 1XXFA 4FUFA 1C2GA 1H1BA 3ZYEA 1HAYB 1A1RA 3UNQA 1W11U 1XUKA 2AH4X 4ZHMU 3E16B 2LPRA 3JZ1B 3QGJA 1AI8H 1XUIA 1C2LA 2A5KA 2G5NA 2GV7A 1KTSB 6GCHG 3TLOA 1IQLA 1FXYA 4YOJA 3MOCA 3A88A 1UCYK 1P8VC 3VXFH 4WH6A 1L1JA 3HK3B 1W7XH 1O2JA 1Y5AT 1AFQB 1GDUA 1C9TA 3PROA 2YNAA 5GJ4B 2FWWA 3RXRA 5EODA 3KNXA 3EDXB 1SQOA 2TGPZ 7ESTE 1TPSA 1DICA 3BTFE 1BITA 1TNHA 2CHAB 5BRRE 1HV7A 6LPRA 4K1EA 1SGCA 2A1DB 2ZA5A 2ALPA 1ESTA 2XBXA 4GLYA 2HRVA 4HFPB 2ZDMA 1VCPA 1BBRK 2BHGA 1NT1A 1SGTA 5LPRA 3A7XA 1K1PA 2HGTH 1OX1A 2WPKS 2WYGA 1AD8H 2Y7XA 1H4WA 3U98H 1D3QB 3H7TA 4IGDA 2FOMB 4ZKSU 3SU1A 2DUCA 2G00A 1SLWB 2F9UA 1XMNB 4NFFA 1VITG 4KTSA 3PLPA 2JKHA 2VIDA 4CRFA 1GI4A 4CH2B 1RIWB 2XWAA 1KXFA 3FZZA 1Y5BT 1SG8B 3GCHC 2LNCA 4ISLA 1JIRA 3A84A 1GI8B 1T7CA 3A83A 1EAUA 3SORA 4ABGA 5EU8A 4CRAA 1EJNA 1UVTH 2NU1E 1GGDC 2HLCA 3RXJA 5ETXA 1S6FA 1WBGB 1Z1JA 3PTNA 2D2DA 2K1QA 1BT7A 4IMZA 2D1JA 3ATWA 2OC0A 1KSNA 5F6MA 5GPIB 5EXMA 5A0BA 1C4V2 4MG3A 2ZHDA 1BZXE 4K69A 3GY8A 2XBVA 1AMHA 4THNH 5HM2A 4O3TA 1C5RA 1O2GH 4K1TA 1MZAA 1C1PA 2R3YA 1ELEE 2B9LA 3ZZ5A 2W3IA 2FZZA 1KDQB 1YPJH 5EQQA 1NPMA 1ANDA 1QJ7B 1XXDA 1ZRBA 1HAHH 2CJIA 4JZIA 1PQ7A 3HGNA 1GI3A 3K65B 1TWXB 5A8ZA 2C90B 4I8GA 1MU8B 4NZQA 1HYLA 4BOHA 2GMTB 1AWFH 1K9OE 2AS9A 3BF6H 4GVUA 3TH4H 1EPTA 5JBBS 2O8WA 1RFNA 1SGIB 1MZDA 3TPIZ 1KLIH 3LU9B 3IWMA 1SR5C 1NY22 1NFYA 1SPJA 3VPKA 1J14A 2W7UA 3V3MA 3S0NA 5EOKA 1GBCA 1AHTH 1EOJA 4YT6H 1L4DA 1Z71A 4AB8A 2PKAB 3TJVA 1DUEA 3K6ZA 1GBDA 1HAPH 2FEQH 1YLDA 1V2RT 4D76A 3VB7A 4Q80A 3B23B 2WPJS 6GCHF 1O3FA 3NK8A 1JOUB 2F83A 2V3OH 4Y6DA 5CE1A 2Z9IA 4INLA 1N6XA 3EA9A 4IN2A 5H4IB 4NA7A 1VGCC 1SGPE 1EKBB 1O3GA 1C5PA 1V2WT 1AVWA 3D49H 1TAWA 4Y7AA 1MCTA 3R3GB 1C9PA 1Y3YA 1BCUH 3A8AA 3E3TA 3KQCA 1O2VA 4RKJB 1ZPZA 2WPIS 2WUCA 1LKBA 4YTAA 3CENA 4RKOB 3UOPA 2G4TA 2ZFRH 3QDZB 2P16A 1EZQA 5HMAA 5C1UA 2FESH 2SGAA 1DLEA 3RXLA 1T32A 1TYNA 3MI4A 2G52A 3SU5A 4GHQA 1GHWH 2ZGJA 1TX7A 3SUDA 2FOBA 3EYDA 1C5NH 1OS8A 1QBNA 5DP8A 1KXAA 5I46H 1MKWK 7GCHG 2A31A 1P0SH 1P3EA 1L4ZA 1O2HA 2ZHEH 4CBOA 4NGAH 1YGCH 1P04A 2VIWA 2QXIA 2FP7B 3F6UH 4TPYA 3P8GA 1V2PT 3IITA 3UFAA 2B7DH 1ZHRA 3CS0A 1UCYH 2W7SA 1QNJA 2BX3A 2QAAA 2QV1A 5C67A 2QA9E 1PFXC 1D9IA 1G2MA 3RXSA 1F5RA 2B5TB 2JH0D 3ATKA 2SGQE 2JETC 2HNTF 1IQMA 1XVMA 1P2QA 2OP9A 3URCA 2AEIH 1GBFA 1GJ9B 5C2ZA 1S82A 2P3TB 4FUDA 1WYKA 2H9EH 1LVBA 1P03A 1SSXA 5BPEA 3PLKA 1ABIH 4CHAC 1HIAB 1C2MA 1DPOA 2D8WA 1QHRB 5FBEA 4B2CA 2ZFTA 1AKSB 1N8OC 4A1TA 4LXBH 4X0WU 1GCTC 3D62A 5FCRA 1FMGA 1GHXH 5A09A 3MNBA 1P2NA 2BQ7B 1O2XA 2HOBA 2IOTA 2ZNKH 1IHSH 1ORFA 4D7GA 3GCTF 4GAWA 2KAIA 1Y3XA 3ELAH 2QYIA 1P9UA 1PJPA 4DG4A 2AIQA 1GHBF 5I25A 4BNRA 1C5XB 2BDCA 2ZFFH 1EP6A 3RMNH 1F0SA 3ZVCA 1GDQA 2VWMA 1O35A 1CSOE 2FOAA 2BD2A 3STIA 3SOSA 1WSSH 1O32A 3AAUA 2ZC9H 1SQAA 3PWBA 2TRMA 2ANMH 3TH2H 4NIWA 3RXPA 1BJVA 4FXGH 2BLWA 3Q3YA 1DXPA 4YZUA 1Z8GA 1O3AA 1TE0A 4IN1A 4D9QA 2V6NA 1A5HA 1C2EA 1H8DH 3ATIA 1SGNE 3M5OA 1Z1IA 2SGEE 3TNSA 2GZ8A 1YF4A 2Q6FA 2ZG0H 2VWOA 3P70B 1P09A 1C1NA 1GBMA 4M7GA 3ZZAA 2NU4E 4B2BA 1VJ9U 5E0HA 4NA9H 1A5IA 1BUIA 4ABHA 4K2YA 8KME2 4ZROA 2BD3A 1C2HA 2J95A 1W8BH 3UTUH 4X6PA 1GMHG 4KP0A 5F8ZA 5FBIA 2FLRH 3N7OA 2P8OC 1FV9A 1TOCB 2A7JA 2H5DA 2TGTA 4ABDA 1F7ZA 4XBDA 1B7XB 1LHGH 1BTWA 4Q7YA 5T6DA 2VGCB 1KXEA 1GJ6A 2XBWA 4X1SU 3E91A 5FCKA 3TH3H 2ZHQH 1O37A 3UQVA 1IOEA 2V35A 3LGTA 3OYPA 7GCHF 2I6SA 1J15A 1SGEE 1GJDB 2HWLB 4KELA 1DVAH 2OTVA 2OBQA 2ZU1A 1O3PB 2AGGX 3NCLA 2XRCA 3RM2H 1C5WB 5DGJA 1DM4B 4IC5A 3AVZA 2H5CA 5SGAE 1G37A 1LQDB 3FP7E 3KHVA 3SO3A 3FANA 1O3EA 1Y3UA 2GT7A 1QL8A 1XX9A 1OPHB 4FUJA 4UDWH 2YOLA 2JH6D 4DVAU 3H5CB 1ZTJA 3VGCB 1KXDA 2VWNA 1BTXA 3NUMA 1MTWA 4Y10E 1SLVB 1HCGA 2BD7A 3H7OA 4Y8YA 1V2KT 1AUTC 1O2KA 1C1TA 1MTNB 4E7NA 1O2OA 2ZIQH 1LPGB 2J92A 2PSYA 4I31A 4ZXXH 3QGNB 1ELBA 2Q6DA 5G4BA 5F8XA 2OQUA 1O2IA 1DT2A 2PFEA 2AMPA 5PTPA 4JZFH 2TGAA 1NROH 1BMLA 3RXAA 1AFQC 3T5FH 1JRTA 1NFXA 2CXVA 1GVLA 8GCHG 1YPGH 2RA0A 1GDNA 2CHAC 3OTJE 5GXPA 1W12U 3BEUA 3G01A 2XTTB 1G3BA 1KXBA 5A0AE 3O8CA 5A2MH 1BTUA 1H9LB 2QXGA 3TJOA 1SOZA 4R8TB 3ZZ7A 1P2IA 2BYAX 3QUMP 3DUXH 2VIQA 5TJXA 4U2WA 4JYVH 4ESTE 1O3BA 1Y5UT 1GG6B 1FIWA 2RCEA 1GJBB 3RXOA 1YKTA 3ITIA 1O33A 4UD9H 1SFQB 3P6ZB 1BTPA 2UUFB 1C2IA 1GI5A 1TX8A 1WTGH 2AMQA 1F0TA 3E90B 4AG1A 1RIWC 1TA6A 4DGJA 2A2QH 5JYIA 3RXGA 1FI8A 1GBTA 1AB9B 2XBYA 2BXUH 2OLGA 2VWLA 5GIBA 3BTTE 3MNSA 5EQSA 1UTJA 1GMHF 3UIRA 1ZYOA 2ZGCA 1Y3WA 1MKXK 1OSSA 5ESTE 2QXHA 2G5VA 4BAOB 1FZZA 1GVZA 3BTDE 1O30A 4JK6A 1GHAF 4ASHA 3VB5A 2VJ1A 2FO9A 2WUBA 1TABE 3SJIA 4NWLA 3F9HA 5EXNA 3FFGA 3STJA 4Y7BA 4YT7H 1QIXB 1SL3A 4I8KA 3EA8A 2R0LA 1SOTA 1DY9A 1TBZH 4ABFA 2BDBA 4RSPA 4NCYA 1YPLH 1QB1A 1XVOA 4WF8A 1G30B 1G2LA 1A61H 4XOJA 5DJ7A 1YPHE 2FXRA 4I32A 3QTVH 4OS6A 3SGQE 1UHBA 2BOHB 2G51A 1C5VA 1TNJA 1F5KU 2A7HA 1N1LA 3V12A 2W3KA 2ZO3H 4SGBE 1EUFA 2B8OH 3UNSA 1WQVH 2GMTC 3PMAB 1LCYA 1HXFH 4MNWA 1TGCA 3UWIA 4FUCA 3C1KA 4X8VH 3TGKE 3SUGA 1P12E 4BAKB 4KKDA 4LZ4B 1B5GH 4K8BA 1GBAA 2ANKH 1E38B 1P06A 1UVPA 2R2WU 3A80A 4Q7ZA 4JYTA 2J34A 1WTHD 2Q1JA 2WINI 4NIVA 1MUEB 3RMOH 1KIGH 3SV2H 2GGVB 3PO1B 1P2KA 5EGMA 1ARCA 4OS5A 1LPZB 3PTBA 3MU4A 4H42U 1BHXB 3KIDU 3ODFA 3LOXA 3RXHA 4NA8A 8GCHF 1F5LA 1CO7E 1GBLA 1P9SA 1C1OA 3B9FH 1MAYA 1Z6EA 4TY7A 4UE7H 1O31A 5FPYA 1UJ1A 3SN8A 2RDLA 3SJKA 4ISNA 1AFEH 3E0NB 5LH8A 2HALA 2H6MA 2V3HH 4B74A 3F1SB 4OS7A 2GZ7A 4Y8XA 1KYNA 3HK6B 4X2XA 1FPCH 4OS4A 1PPCE 3MH6A 3UWJH 1S0RA 1KXCA 4NZLA 1MD8A 4KTCA 3MU1A 2XCNA 6CHAB 1ELVA 3W95A 2O8TA 4FUIA 3A7TA 3RXKA 3SNDA 1O5EH 5E0GA 3RC6A 1O36A 1BIOA 1ZPCA 3ZZ6A 1EX3A 3O8BA 4ZAEA 1AIXH 5GCHG 1UTKA 5JB9S 2C4FH 2BY6X 1SI5H 1DWEH 1K1JA 1Y59T 1NRSH 1GJAB 3RXVA 4JZDH 1DSTA 1RGQA 3M37A 1CA0B 2BDGA 3RLWH 1ZR0A 5FPTA 1ZJKA 2ESTE 2XW9A 4NG9H 4E05H 2A4OA 2BDAA 1Z8IB 4XBBA 2AGEX 3EA7A 3GDUA 1AO5A 1BHXF 1TPAE 2FOFA 2P3UB 3GDSA 4TWWA 3MO3A 4XSKU 2RG3A 1MQ6A 2ZGXH 4DW2U 1EAIA 1QCPA 2CF9H 4Y71A 5ESBA 4WH8A 2GV6A 3E6PH 3LH3A 5TCCA 3KL6A 1TMUH 1JRSA 2ZQ2A 2PGQB 4B71A 3TK6A 4ISIH 4AG2A 1C1VH 3RDZA 4X8TH 1YPHC 1MTSA 3L6PA 3GY4A 3FZDA 1EB1H 1SHHB 1NRNH 4WVPE 3F9EA 3OX7U 1IQNA 3MHWU 2FS9A 1GBEA 1MKXH 4I8JA 1T8NA 3GISB 1O5CB 3Q3KA 3SU4A 1HLTH 3ZZ4A 3MH4A 4I8HA 4WWYA 4Y79A 3SV6A 3MH5A 1S81A 2G4UA 1IQEA 2SFAA 4B1TA 1A5GH 3U69H 2WPLS 1SLXB 1C2DA 5EPNA 2P3FH 1OWHA 1NTPA 2J9NA 1HJ8A 1TNKA 1LPKB 4NSYA 2FMJA 2Z6BD 1ZLRA 4AYVB 1LTOA 3ZV8A 3M61U 1WUNH 3SNBA 3BTEE 3DT0H 4Z6AH 2ODPA 1ZMLA 4ISHH 1RTLA
chains in the Genus database with same CATH superfamily
1UK2A 4QT8C 5E0JA 1FUJA 2IN2A 5CHAB 1IQKA 4K8YA 1MU6B 4X2YA 1TALA 1XM1A 1TGNA 2ZF0H 4Y8ZA 2AFQB 3BTHE 2Y5GA 4RN6A 1QRZA 2J4IA 3W1EA 3A87A 3A81A 3ZVGA 4BAHB 3QLPH 4E06H 1Z8JB 4INKA 2TIOA 5LGOA 2HVYB 1HAGE 4NIXA 1ELCA 1TFXA 1HAOH 4CH8B 2GCTB 1GWAA 1QRXA 2VGCC 5GDSH 1C4U2 2FODA 1QURH 1GI0A 2TPIZ 1NU7B 1F2SE 2VNTA 2Z7FE 1MTUA 3CNRA 7KMEH 1K1NA 1UTNA 3GS9A 2FI4E 4Y11E 4FU8A 4YLUA 3P8FA 3S9AA 2ZCLP 1OHHD 4UFDH 1DWDH 1ELTA 4BANB 2ZTZA 1YPKH 1PPGE 2OUAA 1DY8A 5L30H 4AORA 2Y5FA 1DDJA 2OC1A 1HFDA 2H2ZA 4Q7XA 4XRNA 2C3SA 3GYLB 2PLXA 5DKMA 1O3MA 2VVVA 3UQOA 5GCHF 2BZ6H 4YXWD 1P01A 1FNIA 2BVSH 3SZNA 1DXWA 3ZZCA 1LMWB 3UOUA 1PPEE 4U30A 1O2TA 5DO4H 1GBKA 1GBHA 1TLDA 2KCOA 1IQHA 1VITF 5F03A 3A7VA 2AYWA 2ZEBA 3T2NA 1FY4A 3PLBA 3GY6A 3VGCC 1UVOA 3SGBE 3AASA 1CHOG 3MWIU 2Y5HA 2C93B 1MTNC 1D3TB 2TBSA 2AIPA 5F8TA 1MMJN 1F0UA 3NPSA 2V0BA 3GY3A 4JCNA 2SGFE 1V3XA 1V2UT 1CQQA 3TK5A 5B6OA 3SQHE 1Q2WA 3V13A 3U8OH 5T6GA 1EFRD 1TGSZ 4RT0A 3WW7A 1TQ0B 4AZ2B 1E34B 3VG8A 5JB8S 3GY2A 3F2GA 3T28A 3N99A 4DT7B 2FIRH 5EJLA 1MD7A 2BVXH 2WPHS 4PROA 1TIOA 1O2YA 4ZKNU 1KDQA 1GHYH 1QRWA 2BLQA 1W0YH 1O38A 1C5LH 2OC8A 2BVRH 1THRH 4MNYA 1ANBA 2UUKB 3VB6A 2W6ID 3ODDA 3PB1E 4AYYB 8LPRA 2IJOB 1P02A 3BG4B 1GG6C 3RXQA 1ZSLA 4YO9A 4FU9A 3LJJA 1ZJDA 5ABWA 2ASUB 5HM9A 2BMGB 2H9HA 2GT8A 2Z3CA 3SYJA 4DCDA 3FVFB 1ESBA 3FP6E 1V2TT 2A4GA 1MQ5A 2PKAA 2XOKD 1QQ4A 1AB9C 3LIWA 2G8TA 3Q77A 5GWZA 4HTCH 1F92A 2ZCKP 2VVUA 3QZQA 4GHTA 2J94A 1FY5A 1WOFA 1N6YA 3KQEA 1AUJA 4BTUB 1A3EH 1GJ7B 3DA9B 2ZDAH 2J38A 1Y3VA 1SBWA 3LC5A 3A86A 1IQFA 3MFJA 1A0HB 2WYJA 1O3OA 4M9FA 1W3CA 1O3JA 1ZRKA 2BY8X 1TPOA 1F0RA 1MBQA 2XWBI 3SJ9A 5JBAS 3D65E 2ZHWH 3ZZ8A 1YLNA 2NWNA 2FI3E 3F2FA 2Z3EA 1AVXA 1B0EA 1ZSKA 3M36A 1EJMA 1FY8E 1TRYA 1V2NT 5DP4A 1DX5M 4DT4A 1NRRH 1HAVA 3BIUH 2PW8H 1GJ5H 3NWUA 4MLFB 3KCGH 1V2LT 2Y81A 2RFKC 1MH0A 3OAAD 3KQ5A 1ELAA 1C4Y2 3MU5A 2F43B 4UFGH 2BLOA 3TITA 3M7UA 2QCYA 4OS2A 3VEQB 4TWYA 4A92A 5JBTA 3SBKA 1ZGIA 1AE5A 2A0QB 4Q63A 3SNAA 1RTKA 1TMTH 2ANWA 4ABEA 3RU4D 5LPEA 1UMAH 1C1QA 5IYTA 1ETRH 3MH7A 1BOQA 5JDUB 1CHOF 3ZYDA 1OWDA 1UTOA 2WV5A 1GHZA 3DSGA 1AVGH 3TK9A 4AN7A 3DSPA 2EQNA 3TGIE 1XKBC 4VGCB 1E79D 1W2KH 1KMHB 3T29A 3I29A 1BMNH 2XNDD 3TVJB 1OP2A 2F9NA 1ZMNA 1BQYA 2GVFA 1BA8B 2HPPH 1ARBA 1WCZA 1FJSA 1EOLA 3PO1C 2O9QA 3ZV9A 4INHA 3LGVA 2VIVA 4DJZB 2BXTH 1O5AB 2V3MA 3K2UA 1AKSA 2A4QA 2Z3DA 1VCQA 3M3VA 5C20A 2HNTE 1O2QA 5HXFA 2GDDA 2WZQA 3SQEE 1LVMA 1VR1H 4DIHH 1W13U 3E8LA 3QX5H 1V2OT 3M5MA 2GD4B 4WMDA 1OWJA 1TA2A 2VINA 3Q76A 3SI4H 4AGKA 3BN9A 2D26C 1O39A 3TJNA 1LVYA 2O8UA 2ZPQA 1SVPA 1PPFE 3BTWE 3T26A 8ESTE 3U1JB 3S69A 1UHBB 2A32A 1ZGVA 2ZECA 1DE7H 1EJAA 1IQGA 3LGUA 4D9RA 2F91A 1B0FA 1OOKB 3MU0A 2FYQA 3SU2A 3V7TA 3RXMA 1X7AC 2XNIA 1HPGA 1FPHH 3KGPA 3M5LA 1HBTH 6CHAC 2J2UA 2ZKSA 2GCHG 4ZHLU 4CRGA 4CR9A 1C1UH 3IG6B 1C5YB 1O3IA 1HJAB 5K7RA 2Q6GA 4ZHAA 2A5AA 1W7GH 4MPXA 4BXWA 3RXTA 3UB0A 5AHGH 4B73A 1LDTT 3FO8D 4UONA 1CA0C 1YC0A 2Y80A 5FAHA 1QY6A 1NU9A 1T8OA 1ETTH 3GY7A 4A5TS 3LONA 4OS1A 1ZHPA 5C1XA 1G3EA 2QE7D 2UWLA 3M5NA 2F9PA 3VXEH 1ELFA 3S7HB 5HKKD 5EW1H 4A7IB 3U8TH 1CT0E 9ESTA 1JMOH 1ZTLA 2FDAA 1QJ1B 1PYTD 3CP7A 2CK3D 3RC4A 5HGGA 3H09A 1TBQH 1DLKB 1NC6A 1HAIH 5L2ZH 3A89A 3TNTA 3PWCA 2QGRA 2ZFSA 1JIMA 1CE5A 1LHEH 1NZQH 1G9IE 1TNGA 3ENSB 4DOQA 1WV7H 1UW7A 1V2QT 4UFFH 4JZEH 1SC8U 1KTTB 3GOVB 2J98B 1VCWA 2KFWA 4MNXA 3ESTA 4YOGA 1TOMH 3OY6U 1GI2A 1HB0B 1LQEA 1G32B 3Q3XA 2AERH 2EC9H 2OCVB 2G81E 1CBWB 1UCYE 1O3CA 4AGJA 1NFWA 1C1RA 2A5IA 3PV4A 3RXUA 4B75A 1SQTA 4F4OC 2GP9B 2PKSB 1PQ8A 4CRBA 2GX4A 1IAUA 3A8DA 2ZU3A 3F9GA 4WJG2 4AC9A 5JPMH 1J8AA 4WMFA 2YMSD 4IW4E 1HNEE 4ACBA 2C8WB 4IBLH 5T6FA 2FPZA 3T25A 2EY4C 5CHAC 1BBRE 2LELA 1E1QD 3PM3A 6ESTA 1TGTA 3EE0B 5C5OA 1EAXA 4CREA 3GY5A 2PR3A 1XUFA 1EQ9A 1YP9A 3RMLH 5E8EH 2GZ9A 5FX6A 4DIIH 2HNTC 2FOGA 2BD9A 2BOKA 2QXJA 4XDEA 4R0IA 3UNRA 4I86A 3LC3A 1AQ7A 4OM9A 4XBCA 1ZMJA 4BTTB 2GCTC 2ZTYA 1K1IA 4Q2KA 1RRKA 2ZDKA 3HPTB 2YMSB 1OYTH 5HYOA 2EEKA 3LGIA 5DP5A 4K5ZA 1BRCE 1C2FA 4JZ1A 3OU0A 1C5MD 2QF3A 1O5DH 2C8ZB 1O2NA 1LO6A 5C5NA 2GCHF 1EB2A 1DOJA 3E0PB 4X6NA 2F9BH 5DG6A 3I78A 1UTQA 2BLVA 3D23A 3EGKH 3A8BA 1EZXC 1S85A 1ZTKA 2JJ2D 1O0DH 1GJ4H 3SZEA 3LGWA 1O5BB 1QL7A 3ZZ9A 4JK5A 1LHFH 1SGFA 1CHGA 2ZWLH 4LK4A 1O2RA 4ABBA 1GVKB 3URDA 1DUAA 1QB6A 4F55A 4YM9A 4HG6A 3BEIB 3DSOA 1COWD 2CMYA 1BRUP 2ILNA 5C94A 3WWBA 1OKXA 2XCFA 4MDSA 1NM6A 3F9FA 3T62A 1AY6H 1KLJH 2WPMS 2FI5E 3DFJA 4TYDA 2THFB 3RXFA 3LJOA 1GL1A 4TY6A 2IPHA 1EPTB 4K1SA 1W10U 3RU4E 1C2JA 3P95A 2PWXA 2VVCA 3MNCA 1L1GA 2BD4A 3QWCH 5L6NH 5AFZH 1ZSJA 3OEED 1RTFB 1JXPA 4K60A 2CV3A 2M5TA 3LGYA 1ETSH 1A0JA 1H8HD 1TX6A 3SW2B 1PQAA 4DURA 3LT3A 3KF2A 4UFEH 2VIOA 5C1YA 2XYAA 4J2YB 2ZQ1A 3SHCH 4Q4LA 3MTYA 1ELDE 1QBOA 1TB6H 3S9BA 1FDPA 1S5SA 5EW2H 3BV9B 1BMMH 1FLEE 5AFYH 1QB9A 1P05A 1GMCG 1O2SA 3GICB 4FVDA 4MPVA 1H9HE 1L1NA 5DPAA 2BB4A 5AF9H 3P8NA 1O3HA 3BG8A 1BTHH 2Y7ZA 1BRBE 3BG4C 4XFQA 3SUFA 1K22H 2FM2A 3ZZBA 5EQRA 4ZXYH 4YLQH 1UTMA 1O3LA 1OP0A 1LHCH 1V2VT 1CT2E 1MCVA 1SGQE 3A85A 3BSQA 2Z9KA 1CGJE 3QZRA 1VITH 4TPIZ 3ZVAA 5DP3A 3S9CA 4OGXA 1SHYA 3HATH 2O8MA 3QTOH 3SGAE 1W0ZU 2ODQA 3BTKE 3OY5U 3FKSD 2ZFPH 1O2UA 1GBIA 1ZHMA 1EAWA 1TRMA 2V7QD 1WAYB 1GI9B 3OSYA 1M9UA 1VZQH 2BY9X 1C5TA 1Z7KA 1PPZA 1DS2E 1OYQA 2ZTXA 1DFPA 1UK3A 1D6RA 1DITH 1S6HA 2UUJB 3A7ZA 3RMMH 1T4VH 2PTCE 3PMBB 4H4FA 7LPRA 1EP5A 2Z9LA 4LZ1H 3P92A 3RXDA 4Y76A 1O2PA 1YCPK 1XUGA 1A3BH 1EASA 1FX0B 4B2AA 4A1VA 5J4SA 1C5OH 3ZVFA 3NXPA 1T4UH 3SNEA 3SNCA 3VB3A 1AZZA 1P3CA 3GCTG 2UUYA 1QQUA 3A82A 1NRQH 1YM0A 1HXEH 3UR9A 1K1LA 1THPB 1WQSA 3OEHD 4Z0KA 1CGIE 2ALVA 1GHBG 1ABJH 4AB9A 1XUHA 2R3UA 3GCOA 2ZHFH 1K28D 1MAXA 4X1QU 4X1RU 1AU8A 1GI1A 1HDTH 2KAIB 2NU3E 3NKKA 1GMDG 2JH5D 5T3HA 2RDEA 2OC7A 1T8LA 5KGOA 3KN2A 3SU0A 1A4WH 4VGCC 4U32A 2GDEH 1AWHB 2BDHA 3B8JA 1DWBH 1Q3XA 3RU4T 2CN0H 3GCNA 4H6TA 3ZVEA 3R0FA 4ZMAH 1NS3A 2PSXA 2OBOA 2L6OA 1FIZA 5L2YH 1BB0B 1DWCH 1SFIA 3UUZA 4A1XA 2HVXA 4CRDA 1ANCA 4RT1A 2VU8E 4CRCA 3E1XB 3WY8A 3M7TA 1C5QA 4GCHG 4X6MA 1CU1A 2FOHA 5K0HA 1NESE 2Z9GA 3PRDA 4MTBA 3NZIA 1H8IH 3UAIC 1J17T 3ZZ3A 2AMDA 1GMCF 5TCAA 5FXLA 1HAVB 2ANYA 4BXSA 5EG4A 1DANH 4ABAA 1UTLM 3TU7H 4X8SH 2WPDD 2BM2A 3CS7A 5JBCS 1SB1H 1TNLA 4IC6A 1EZSC 1QGFA 1GPZA 1E36B 2QF0A 4O9VA 3OFND 4SGAE 4KTUA 3VB4A 2ZZUH 3BTME 3FP8E 1UK4A 3BIVH 4FU7A 4K3JA 3SI3H 5DP9A 1GBJA 1QL9A 2H9TH 3PRBA 1GJ8B 1HJAC 1A46H 4FVBA 4XE4A 4ABIA 2RA3A 2XC0A 4O3UA 2A45B 1OXGA 2QIQA 4RI0A 1V6DA 1K1MA 3BTGE 4IS5A 3A7YA 2VB0A 3UPEA 2W26A 1O2LA 1PPBH 4ASUD 1FAXA 3M3TA 3MNXA 3RM0H 1CA8B 4J1YA 1TMBH 1HJ9A 4FOUC 2FLBH 1BBRH 4YESB 3GCHB 3LKWA 1T8MA 2G55A 4BAMB 4HZHA 4CR5A 2STBE 3HKJB 2Y6TA 2VH6A 3V0XA 1ESAA 1QJ6B 1C1WH 1BRAA 4MNVA 3BTQE 5DP6A 2I6QA 2P93A 1GGDB 1TONA 1HRTH 5FX5A 1FY1A 1IQIA 1SLUB 1V2ST 1CGHA 4OGYA 1C2KA 1HGTH 3JZ2B 3FAOA 2ZGBH 2UWOA 1S0QA 1NN6A 4O03A 2BDYA 1P57B 1RXPA 2ZPSA 3K9XB 1PQ5A 3Q00A 3C27B 1GMDF 5LPFA 1QBVH 2FS8A 3RC5A 1AGJA 4FUBA 3RP2A 3ZZDA 4AFZA 2BQ6B 3W94A 4ZUHA 2JDID 3P8OA 3RLYH 2FX6A 1LKAA 1TQ7B 4ZCNA 1PYTC 1EATA 4WY3A 2UWPA 2ZDNA 1CBWC 3QO6A 2ZFQH 2BD8A 1P11E 3A8CA 2VIPA 4D8NA 1NBMD 1D3DB 2GTBA 1YCPH 2A7CA 2ZU2A 2PKSC 1KY9A 2R0KA 1Z6JH 2EI6A 3WWFA 1YPEH 4GCHF 1HUTH 1C1SA 2BQWB 1ACBE 2FX4A 2Y82A 1T31A 3O8RA 2SGDE 2QY0B 1W14U 4NSVA 5A8YA 4CBNA 5CDFE 1O3KA 2P94A 4D7FA 3SV7A 1O34A 1IHTH 1C1MA 2WHXA 3SU6A 3N7EA 1EZUC 1D3PB 1V2JT 1D6WA 4AOQA 3UY9A 1GHAG 5AVDA 1GBBA 1UVSH 3S7KB 1C5UA 2DE9A 4MQAA 2IJD1 2FOCA 4WXVA 1QR3E 4NIYA 5A8XA 3MO6A 4MPUA 2PP6A 1HIAA 2HPQH 2YMSC 1NFUA 1OWIA 4Y0ZE 4GSOA 1VGCB 3ZIAD 1C5SA 4LOYH 2OK5A 2PV9B 2F4LA 1K0HA 1BMAA 1E1RD 2BDIA 2O8LA 2PHBA 2KM0A 4X1PU 3BEFB 4I7YH 2QF5A 1VJAU 2R9PA 3AW1A 4U01A 1CT4E 4X2WA 1FONA 3PMJA 5EXLA 2ZDVH 4YOIA 4GUXA 1Y8TA 1QA7A 2SGPE 4WMEA 5EPYA 4ZKRU 1C5ZB 2H1UA 2PUQH 2ULLA 4E7RG 1GCDA 1JWTA 2A2XH 4ABJA 2W5EA 1SMFE 3EAJA 1G3CA 1O2ZA 1A0LA 2CF8H 2KX4A 2GKVE 1UTPA 2Z94A 3U1IB 1AZ8A 3AAVA 3SJ8A 4Z1MD 5E2OA 1XUJA 2FOEA 4H6SB 3RXBA 1HAZB 1RD3B 4P02A 1P2JA 1U6QA 1P10A 3ATMA 4JYUH 1BJUA 1SGFG 5EJ1A 3P17H 4Y0YE 1A2CH 4F48B 1P2MA 1ID5H 1EPTC 1FN8A 1WU1A 1H9IE 4F49A 5IK2D 1KLTA 1O5FH 1ZZZA 3RXCA 4NWKA 1YYY1 1FQ3A 3DHKH 1GI7B 4AFUA 3PYHA 2VBCA 1A7SA 5T1VA 1MKWH 3AW0A 2STAE 3FOAA 3L3TA 2JETB 1UVUH 2EI7A 3QN7A 3KEEA 1S84A 1AE8H 2AGIX 2PUXB 3O8DA 2BD5A 2F3CE 1Z8RA 2PGBB 3LH1A 2FTLE 4HGCA 4CHAB 1QA0A 5FPSA 1MBMA 2BTCE 2EA3A 3DFLA 3L33A 3U8RH 1QTFA 1CVWH 5DK1A 1G3DA 2BX4A 2QN5T 1N8OB 9LPRA 1J9CH 1V2MT 1GCTB 2B0FA 1O2WA 2CGAA 1DSUA 1J16A 4X2VA 4NFEA 1SGRE 1BTZA 2R2MB 2J5UA 2HLDD 3K6YA 5DSFA 5IDKA 1TBRH 4DY7B 3RXEA 3LDXH 2FTMA 2FYRA 2VH0A 3VFEA 4ISOA 2ZU5A 2ZCHP 1FAKH 1GJCB 3MMGA 3SU3A 2ZP0H 4UEHH 3MO9A 1YPMH 3HKIB 1GL0E 1Q31A 4JMYA 4GPGA 1YLCA 2OQ5A 4KGAA 2F9OA 2BY5X 3PMHB 1OWKA 2XC4A 4HI3A 3MYWA 3MU8A 1ANEA 2EI8A 4AFQA 5A0CA 4MVNA 2KCAA 1ELGA 2P59A 1JBUH 1L2EA 1ZOMA 3LPRA 3I77A 1E0FD 3SV8A 1SGYE 4IMQA 1RS0A 4WXIA 1BDAA 1AN1E 2ZGHA 2P95A 2OD3B 5E2PA 1MTVA 1OP8A 1FY3A 2OXSA 3GDVA 3SHAH 1D4PB 4ZKOU 1PPHE 1TRNA 4AFSA 1YCPM 3M7QA 3SV9A 1TGBA 1L0ZA 2ZPRA 1UO6A 1NRPH 4FUGA 2C8XB 1S83A 4I8LA 2F9VA 2TGDA 2XC5A 4X1NU 1NO9H 1LVOA 4FUEA 3KQBA 4X8UH 4ZH8A 2P8OB 1YY3A 1TPPA 2ZU4A 4FUHA 3ZVDA 2C8YB 2SNVA 1K2I1 3TIUA 2YNBA 3GYMA 3TJUA 1E37B 1BTYA 3UR6A 2ZI2H 1INCA 1HAXB 5C17A 5DP7A 1G36A 2BY7X 4X6OA 2QC2A 3DD2H 3MQKC 4BAQB 2DE8A 4MPWA 1YBWA 3M3SA 3UREA 3ZVBA 2SNWA 5CMXH 3KQDA 3RXIA 3M35A 2OINA 2NU0E 1GI6A 3RUOA 4B76A 1OWEA 1P2OA 5FHTA 1O3DA 3U9AH 2PTNA 4I33A 3SUEA 3F68H 1RJXB 1E35B 2WV4A 3EQ0H 1GHVH 1K21H 5DN6D 2BZAA 1EXFA 1IQJA 1O5GH 2NU2E 5J4QA 1LHDH 4O97A 1QFKH 2ZDLA 1ZPBA 2XXLA 3ATLA 3QK1A 2JJ1D 5C0UA 2A4RA 4AX9H 5C3NA 1O2MA 2ODYB 4A6LA 1THSH 1K1OA 3HGPA 2Z9JA 3TGJE 3T27A 1FN6A 1SGDE 1NBME 1SKYE 4BTIB 1O3NA 1XKAC 1TNIA 2AHME 3SJOA 3A7WA 1XXFA 4FUFA 1C2GA 1H1BA 3ZYEA 1HAYB 1A1RA 3UNQA 1W11U 1XUKA 2AH4X 4ZHMU 3E16B 2LPRA 3JZ1B 3QGJA 1AI8H 1XUIA 1C2LA 1W0JD 2A5KA 2G5NA 2GV7A 1KTSB 6GCHG 3TLOA 1IQLA 1FXYA 4YOJA 3MOCA 3A88A 1UCYK 1P8VC 3VXFH 4WH6A 1L1JA 3HK3B 1W7XH 1O2JA 1Y5AT 1AFQB 1GDUA 1C9TA 2J98A 3PROA 2YNAA 5GJ4B 2FWWA 3RXRA 5EODA 3KNXA 3EDXB 1SQOA 2TGPZ 7ESTE 1TPSA 1DICA 3BTFE 1BITA 1TNHA 2CHAB 5BRRE 1HV7A 6LPRA 4K1EA 1SGCA 2A1DB 2ZA5A 2ALPA 1ESTA 2XBXA 4GLYA 2HRVA 4HFPB 2ZDMA 1VCPA 1BBRK 2BHGA 1NT1A 3F2HA 1SGTA 5LPRA 3A7XA 1K1PA 2HGTH 1OX1A 2WPKS 2WYGA 1AD8H 2Y7XA 1H4WA 3U98H 1D3QB 3H7TA 4IGDA 2FOMB 1W0KD 4TSFD 4ZKSU 3SU1A 2DUCA 2G00A 1SLWB 2F9UA 1XMNB 4NFFA 1VITG 4KTSA 1VKYA 3PLPA 2JKHA 1WDIA 2VIDA 1GI4A 4CRFA 4CH2B 1RIWB 2XWAA 1KXFA 3FZZA 1Y5BT 5C0TA 1SG8B 3GCHC 2LNCA 4ISLA 1JIRA 3A84A 3AK5A 1GI8B 1T7CA 3A83A 1EAUA 3SORA 4ABGA 5EU8A 4CRAA 1EJNA 1UVTH 2KCYA 2NU1E 1GGDC 2HLCA 3RXJA 5ETXA 1S6FA 1WBGB 1Z1JA 3KYGA 3PTNA 2D2DA 2K1QA 1BT7A 3FN8A 4IMZA 2D1JA 3ATWA 4ACAA 2OC0A 1KSNA 5F6MA 5GPIB 5EXMA 5A0BA 1C4V2 4MG3A 2ZHDA 1BZXE 4K69A 3GY8A 2XBVA 1AMHA 4THNH 5HM2A 3U28C 4O3TA 1C5RA 1O2GH 4K1TA 1MZAA 1C1PA 2R3YA 1ELEE 2B9LA 3ZZ5A 2W3IA 2FZZA 1KDQB 1YPJH 5EQQA 1NPMA 1ANDA 1QJ7B 1XXDA 1ZRBA 1HAHH 2CJIA 4JZIA 1PQ7A 3HGNA 1GI3A 3K65B 1TWXB 5A8ZA 2C90B 4I8GA 1MU8B 4NZQA 1HYLA 4BOHA 2GMTB 1AWFH 1K9OE 2AS9A 3NRLA 3BF6H 4GVUA 3TH4H 1EPTA 5JBBS 2O8WA 1RFNA 1SGIB 1MZDA 3TPIZ 1KLIH 5EJZA 3LU9B 3IWMA 1SR5C 1NY22 1NFYA 1SPJA 3VPKA 1J14A 2W7UA 3V3MA 3S0NA 4FETA 5EOKA 1GBCA 1AHTH 1EOJA 4YT6H 1L4DA 1Z71A 4AB8A 2PKAB 3TJVA 1DUEA 3K6ZA 1GBDA 1HAPH 2FEQH 3KYFA 1YLDA 1V2RT 4D76A 3VB7A 4Q80A 3B23B 2WPJS 6GCHF 1O3FA 3NK8A 1JOUB 2GJGA 2F83A 2V3OH 4Y6DA 5CE1A 2Z9IA 4INLA 1N6XA 3EA9A 4IN2A 5H4IB 4NA7A 1VGCC 1SGPE 1EKBB 1O3GA 1C5PA 1V2WT 1AVWA 3D49H 1TAWA 4Y7AA 1MCTA 3R3GB 1C9PA 5KEDA 1Y3YA 1BCUH 3A8AA 3E3TA 3KQCA 1O2VA 4RKJB 1ZPZA 2WPIS 2WUCA 1LKBA 4YTAA 3CENA 4RKOB 3UOPA 2G4TA 2ZFRH 3QDZB 2P16A 2K8IA 1EZQA 5HMAA 5C1UA 2FESH 2SGAA 1DLEA 4P00A 3RXLA 1T32A 1TYNA 3MI4A 2G52A 3SU5A 4GHQA 1GHWH 2ZGJA 1TX7A 3SUDA 2FOBA 3EYDA 1C5NH 1OS8A 1QBNA 5DP8A 1KXAA 5I46H 1MKWK 7GCHG 2A31A 1P0SH 1P3EA 1L4ZA 1O2HA 2ZHEH 4CBOA 4NGAH 1YGCH 1P04A 2VIWA 2QXIA 2FP7B 3F6UH 3N7DA 2WSSD 4TPYA 1QZ8A 3P8GA 1V2PT 3IITA 3UFAA 2B7DH 1ZHRA 3CS0A 1UCYH 2W7SA 1QNJA 2BX3A 2QAAA 2QV1A 5C67A 2QA9E 1PFXC 1D9IA 2KR7A 1G2MA 3RXSA 1F5RA 2B5TB 2JH0D 3ATKA 2SGQE 2JETC 2HNTF 1IQMA 1XVMA 1P2QA 2OP9A 3URCA 2AEIH 1GBFA 1GJ9B 5C2ZA 1S82A 2P3TB 4FUDA 1WYKA 2H9EH 1LVBA 1P03A 1SSXA 5BPEA 3PLKA 1ABIH 4XD7D 4CHAC 1HIAB 1C2MA 1DPOA 2D8WA 1QHRB 5FBEA 4B2CA 2ZFTA 2W6JD 1AKSB 1N8OC 4A1TA 4LXBH 4X0WU 1WXRA 1GCTC 3D62A 5FCRA 1FMGA 1GHXH 5A09A 3MNBA 1P2NA 2BQ7B 1O2XA 2HOBA 2IOTA 2ZNKH 1IHSH 1ORFA 4D7GA 3GCTF 4GAWA 2KAIA 1Y3XA 3ELAH 2QYIA 1P9UA 1PJPA 4DG4A 2AIQA 1GHBF 5I25A 4BNRA 1C5XB 2BDCA 2ZFFH 1EP6A 3RMNH 1F0SA 3ZVCA 1GDQA 2VWMA 1O35A 1CSOE 2FOAA 2BD2A 3STIA 3SOSA 1WSSH 1O32A 3PV5A 3AAUA 2ZC9H 1SQAA 3PWBA 2TRMA 2ANMH 3TH2H 4NIWA 3RXPA 1BJVA 3DCLA 4FXGH 2BLWA 3Q3YA 1DXPA 4YZUA 1Z8GA 1O3AA 1TE0A 4IN1A 4D9QA 2V6NA 1A5HA 1C2EA 1H8DH 3ATIA 1SGNE 3M5OA 1Z1IA 2SGEE 3TNSA 2GZ8A 1YF4A 2Q6FA 2ZG0H 2VWOA 3P70B 1P09A 1C1NA 1GBMA 4M7GA 3ZZAA 2NU4E 4B2BA 1VJ9U 5E0HA 4NA9H 1A5IA 1BUIA 4ABHA 4K2YA 8KME2 4ZROA 2BD3A 1C2HA 2J95A 1W8BH 3UTUH 5CHBA 4X6PA 1GMHG 4KP0A 5F8ZA 5FBIA 2FLRH 3N7OA 2P8OC 1FV9A 1TOCB 2A7JA 2H5DA 2TGTA 4ABDA 1F7ZA 4XBDA 1B7XB 1LHGH 1BTWA 4Q7YA 5T6DA 2VGCB 1KXEA 1GJ6A 2XBWA 4X1SU 3E91A 5FCKA 3TH3H 1H8ED 1O37A 2ZHQH 3UQVA 1IOEA 2V35A 3LGTA 3OYPA 7GCHF 1S6LA 2I6SA 1J15A 1SGEE 1GJDB 2HWLB 4KELA 1DVAH 2OTVA 2OBQA 2ZU1A 1O3PB 2AGGX 2M2AA 3NCLA 2XRCA 3RM2H 1C5WB 5DGJA 1DM4B 4IC5A 3AVZA 2H5CA 5SGAE 1G37A 1LQDB 3FP7E 3KHVA 3SO3A 3FANA 1O3EA 1Y3UA 2GT7A 1QL8A 1XX9A 1SQRA 1OPHB 4FUJA 4UDWH 2YOLA 2JH6D 4DVAU 3H5CB 3OTPA 1ZTJA 3VGCB 1KXDA 2VWNA 1BTXA 3NUMA 1MTWA 4Y10E 1SLVB 1HCGA 2BD7A 3H7OA 4Y8YA 1V2KT 1AUTC 1O2KA 1C1TA 1MTNB 4E7NA 1O2OA 2ZIQH 1LPGB 2J92A 2PSYA 4B6FA 4TT3D 4I31A 4ZXXH 3QGNB 1ELBA 2Q6DA 5G4BA 5F8XA 2OQUA 1O2IA 1DT2A 2KCPA 2PFEA 2AMPA 5PTPA 4JZFH 2TGAA 1NROH 1BMLA 3RXAA 1AFQC 3T5FH 1JRTA 1NFXA 2CXVA 1GVLA 5EIYA 8GCHG 1YPGH 2RA0A 3F0PA 1GDNA 2CHAC 3OTJE 5GXPA 1W12U 3BEUA 3G01A 2XTTB 1G3BA 1KXBA 5A0AE 3O8CA 5A2MH 1BTUA 5HIZA 1H9LB 2QXGA 3TJOA 1SOZA 4R8TB 3ZZ7A 1P2IA 2BYAX 3QUMP 3DUXH 2VIQA 5TJXA 4U2WA 4JYVH 4ESTE 1O3BA 1Y5UT 1GG6B 1FIWA 2RCEA 1GJBB 3RXOA 1YKTA 3ITIA 1O33A 4UD9H 1SFQB 3P6ZB 1BTPA 2UUFB 5HIYA 2WV9A 1C2IA 1GI5A 1TX8A 1WTGH 2AMQA 1F0TA 3E90B 4AG1A 1RIWC 1TA6A 4DGJA 2A2QH 5JYIA 3F0OA 3RXGA 1FI8A 1GBTA 1AB9B 2XBYA 2BXUH 2OLGA 2VWLA 5GIBA 3BTTE 3MNSA 5EQSA 1UTJA 1GMHF 3UIRA 1ZYOA 2ZGCA 1Y3WA 1MKXK 1OSSA 5ESTE 2QXHA 2G5VA 4BAOB 1FZZA 1GVZA 3BTDE 1O30A 4JK6A 1GHAF 4ASHA 3VB5A 2VJ1A 2FO9A 2WUBA 1TABE 3SJIA 4NWLA 4B6EA 3F9HA 5EXNA 3FFGA 3STJA 4Y7BA 4YT7H 1QIXB 1SL3A 4I8KA 3EA8A 2R0LA 1SOTA 1DY9A 1TBZH 4ABFA 2BDBA 4RSPA 4NCYA 1YPLH 1QB1A 1XVOA 4WF8A 1G30B 1G2LA 1A61H 4XOJA 5DJ7A 1YPHE 2FXRA 3OE7D 4I32A 3QTVH 4OS6A 3SGQE 1UHBA 2BOHB 2G51A 1C5VA 1TNJA 1F5KU 2A7HA 1N1LA 3V12A 2W3KA 2ZO3H 4SGBE 1EUFA 2B8OH 3UNSA 1WQVH 2GMTC 3PMAB 1LCYA 1HXFH 4MNWA 1TGCA 3UWIA 2K0QA 4FUCA 3C1KA 5F53A 4X8VH 3TGKE 3SUGA 1P12E 4BAKB 4KKDA 4LZ4B 1B5GH 4K8BA 1GBAA 2ANKH 1E38B 1P06A 1UVPA 2R2WU 3A80A 4Q7ZA 4JYTA 2J34A 1WTHD 2Q1JA 2WINI 4NIVA 1MUEB 3RMOH 2JIZD 1KIGH 3SV2H 2GGVB 3PO1B 1P2KA 5EGMA 1ARCA 5GNDA 4OS5A 1LPZB 3PTBA 3MU4A 4H42U 1BHXB 3KIDU 3ODFA 3F3BA 3LOXA 3RXHA 4NA8A 2L74A 2LP6A 1F5LA 8GCHF 1CO7E 1GBLA 1P9SA 1C1OA 3B9FH 1MAYA 1Z6EA 4TY7A 4UE7H 1O31A 5FPYA 1UJ1A 3SN8A 2RDLA 3SJKA 4ISNA 1AFEH 3E0NB 5LH8A 2HALA 2H6MA 2V3HH 4B74A 3F1SB 4OS7A 2GZ7A 4Y8XA 1KYNA 1BMFD 3HK6B 4X2XA 1FPCH 4OS4A 1PPCE 5KECA 3MH6A 3UWJH 1S0RA 1KXCA 4NZLA 1MD8A 1MABB 4KTCA 3MU1A 2XCNA 6CHAB 1ELVA 3W95A 2O8TA 4FUIA 3A7TA 3RXKA 3PV2A 3SNDA 1O5EH 2KZ4A 5E0GA 3RC6A 1O36A 1BIOA 1ZPCA 3ZZ6A 1EX3A 3O8BA 4ZAEA 1AIXH 5GCHG 1UTKA 5JB9S 2C4FH 2BY6X 1SI5H 1DWEH 1K1JA 1Y59T 1NRSH 1GJAB 3RXVA 4JZDH 1DSTA 1RGQA 3M37A 1CA0B 2BDGA 3RLWH 1ZR0A 5FPTA 5B6LA 1ZJKA 2ESTE 2XW9A 4NG9H 4E05H 2A4OA 2BDAA 1Z8IB 4XBBA 2AGEX 3EA7A 3GDUA 2IPQX 1AO5A 1BHXF 1TPAE 2FOFA 2P3UB 3GDSA 4TWWA 3MO3A 4XSKU 2RG3A 1MQ6A 2ZGXH 4DW2U 1EAIA 1QCPA 2CF9H 1YWUA 2QF4A 4Y71A 5ESBA 2J97A 4WH8A 5FL7D 2GV6A 3E6PH 3LH3A 5TCCA 3KL6A 1TMUH 1JRSA 2ZQ2A 2PGQB 4B71A 3TK6A 4ISIH 4AG2A 1C1VH 3RDZA 4X8TH 1YPHC 1MTSA 3L6PA 3GY4A 3FZDA 1EB1H 1SHHB 1NRNH 4WVPE 3F9EA 3OX7U 1IQNA 3MHWU 2FS9A 3EE7A 1GBEA 1MKXH 4I8JA 1T8NA 3GISB 1O5CB 3Q3KA 3SU4A 1HLTH 3ZZ4A 3MH4A 4I8HA 4WWYA 4Y79A 3SV6A 3MH5A 1S81A 2G4UA 1IQEA 2SFAA 4B1TA 1A5GH 3U69H 2WPLS 1SLXB 1C2DA 5EPNA 1OWHA 2P3FH 1NTPA 2J9NA 1HJ8A 1TNKA 1LPKB 4NSYA 2FMJA 2Z6BD 1ZLRA 4AYVB 1LTOA 3ZV8A 3M61U 1WUNH 3SNBA 3BTEE 3DT0H 4Z6AH 2ODPA 1ZMLA 4ISHH 1RTLA
chains in the Genus database with same CATH topology
1UK2A 4QT8C 5E0JA 1FUJA 2IN2A 5CHAB 1IQKA 4K8YA 1MU6B 4X2YA 1TALA 1XM1A 1TGNA 2ZF0H 4Y8ZA 2AFQB 3BTHE 2Y5GA 4RN6A 1QRZA 2J4IA 3A87A 3A81A 3ZVGA 4BAHB 3QLPH 4E06H 1Z8JB 4INKA 2TIOA 5LGOA 1HAGE 4NIXA 1ELCA 1TFXA 1HAOH 4CH8B 2GCTB 1GWAA 1QRXA 2VGCC 5GDSH 1C4U2 2FODA 1QURH 1GI0A 2TPIZ 1NU7B 1F2SE 2VNTA 2Z7FE 1MTUA 7KMEH 1K1NA 1UTNA 4YLUA 2FI4E 4Y11E 4FU8A 3P8FA 3S9AA 2ZCLP 4UFDH 4BANB 1DWDH 1ELTA 2ZTZA 1YPKH 1PPGE 2OUAA 1DY8A 5L30H 4AORA 2Y5FA 1DDJA 2OC1A 1HFDA 2H2ZA 4Q7XA 2C3SA 3GYLB 2PLXA 5DKMA 1O3MA 2VVVA 3UQOA 5GCHF 2BZ6H 1P01A 1FNIA 2BVSH 3SZNA 1DXWA 3ZZCA 1LMWB 3UOUA 1PPEE 4U30A 1O2TA 5DO4H 1GBKA 1GBHA 1TLDA 1IQHA 1VITF 5F03A 3A7VA 2AYWA 2ZEBA 3T2NA 1FY4A 3PLBA 3GY6A 3VGCC 1UVOA 3SGBE 3AASA 1CHOG 3MWIU 2Y5HA 2C93B 1MTNC 1D3TB 2TBSA 2AIPA 5F8TA 1MMJN 1F0UA 3NPSA 2V0BA 3GY3A 4JCNA 2SGFE 1V3XA 1V2UT 1CQQA 3TK5A 5B6OA 3SQHE 1Q2WA 3V13A 3U8OH 5T6GA 1TGSZ 1TQ0B 4AZ2B 1E34B 5JB8S 3GY2A 3T28A 4DT7B 2FIRH 1MD7A 2BVXH 2WPHS 4PROA 1TIOA 1O2YA 4ZKNU 1KDQA 1GHYH 1QRWA 2BLQA 1W0YH 1O38A 1C5LH 2OC8A 2BVRH 1THRH 4MNYA 1ANBA 2UUKB 3VB6A 3ODDA 3PB1E 4AYYB 8LPRA 2IJOB 1P02A 3BG4B 1GG6C 3RXQA 1ZSLA 4YO9A 4FU9A 3LJJA 1ZJDA 5ABWA 2ASUB 5HM9A 2BMGB 2H9HA 2GT8A 2Z3CA 4DCDA 3FVFB 1ESBA 3FP6E 1V2TT 2A4GA 1MQ5A 2PKAA 1QQ4A 1AB9C 3LIWA 2G8TA 3Q77A 5GWZA 4HTCH 1F92A 2ZCKP 2VVUA 3QZQA 4GHTA 2J94A 1FY5A 1WOFA 1N6YA 3KQEA 1AUJA 4BTUB 1A3EH 1GJ7B 3DA9B 2ZDAH 2J38A 1Y3VA 1SBWA 3LC5A 3A86A 1IQFA 3MFJA 1A0HB 2WYJA 1O3OA 1W3CA 1O3JA 1ZRKA 2BY8X 1TPOA 1F0RA 1MBQA 2XWBI 3SJ9A 5JBAS 3D65E 2ZHWH 3ZZ8A 2NWNA 2FI3E 2Z3EA 1AVXA 1B0EA 1ZSKA 3M36A 1EJMA 1FY8E 1TRYA 1V2NT 5DP4A 1DX5M 1NRRH 1HAVA 3BIUH 2PW8H 1GJ5H 3NWUA 4MLFB 3KCGH 1V2LT 2Y81A 1MH0A 1ELAA 1C4Y2 3MU5A 4UFGH 2BLOA 3TITA 3M7UA 2QCYA 4OS2A 3VEQB 4TWYA 4A92A 5JBTA 3SBKA 1ZGIA 1AE5A 2A0QB 3SNAA 1RTKA 1TMTH 2ANWA 4ABEA 3RU4D 5LPEA 1UMAH 1C1QA 5IYTA 1ETRH 3MH7A 1BOQA 5JDUB 1CHOF 3ZYDA 1OWDA 1UTOA 2WV5A 1GHZA 1AVGH 3TK9A 4AN7A 3TGIE 1XKBC 4VGCB 1W2KH 3T29A 3I29A 1BMNH 3TVJB 1OP2A 2F9NA 1ZMNA 1BQYA 2GVFA 1BA8B 2HPPH 1ARBA 1WCZA 1FJSA 1EOLA 3PO1C 2O9QA 3ZV9A 4INHA 3LGVA 2VIVA 4DJZB 2BXTH 1O5AB 3K2UA 1AKSA 2A4QA 2Z3DA 1VCQA 3M3VA 5C20A 2HNTE 1O2QA 5HXFA 2GDDA 3SQEE 1LVMA 1VR1H 4DIHH 1W13U 3E8LA 3QX5H 1V2OT 3M5MA 2GD4B 4WMDA 1OWJA 1TA2A 2VINA 3Q76A 3SI4H 4AGKA 3BN9A 2D26C 1O39A 3TJNA 1LVYA 2O8UA 2ZPQA 1SVPA 1PPFE 3BTWE 3T26A 8ESTE 3U1JB 3S69A 1UHBB 2A32A 1ZGVA 2ZECA 1DE7H 1EJAA 1IQGA 3LGUA 4D9RA 2F91A 1B0FA 1OOKB 3MU0A 2FYQA 3SU2A 3V7TA 3RXMA 1X7AC 2XNIA 1HPGA 1FPHH 3KGPA 3M5LA 1HBTH 6CHAC 2J2UA 2ZKSA 2GCHG 4ZHLU 4CRGA 4CR9A 1C1UH 3IG6B 1C5YB 1O3IA 1HJAB 5K7RA 2Q6GA 4ZHAA 2A5AA 1W7GH 4MPXA 4BXWA 3RXTA 5AHGH 4B73A 1LDTT 4UONA 1CA0C 1YC0A 2Y80A 5FAHA 1QY6A 1NU9A 1T8OA 1ETTH 3GY7A 4A5TS 3LONA 4OS1A 1ZHPA 5C1XA 1G3EA 2UWLA 3M5NA 3VXEH 2F9PA 3S7HB 1ELFA 5EW1H 4A7IB 3U8TH 1CT0E 9ESTA 1JMOH 1ZTLA 2FDAA 1QJ1B 1PYTD 3CP7A 3RC4A 5HGGA 1TBQH 1DLKB 1NC6A 1HAIH 5L2ZH 3A89A 3TNTA 3PWCA 2QGRA 2ZFSA 1JIMA 1CE5A 1LHEH 1NZQH 1G9IE 1TNGA 3ENSB 4DOQA 1WV7H 1V2QT 4UFFH 4JZEH 1SC8U 1KTTB 3GOVB 1VCWA 4MNXA 3ESTA 4YOGA 1TOMH 3OY6U 1GI2A 1HB0B 1LQEA 1G32B 3Q3XA 2AERH 2EC9H 2OCVB 2G81E 1CBWB 1UCYE 1O3CA 4AGJA 1NFWA 1C1RA 2A5IA 3PV4A 3RXUA 4B75A 1SQTA 4F4OC 2GP9B 2PKSB 1PQ8A 4CRBA 2GX4A 1IAUA 3A8DA 2ZU3A 3F9GA 4WJG2 5JPMH 1J8AA 4WMFA 4IW4E 1HNEE 2C8WB 4IBLH 5T6FA 2FPZA 3T25A 5CHAC 1BBRE 3PM3A 6ESTA 1TGTA 3EE0B 5C5OA 1EAXA 4CREA 3GY5A 2PR3A 1XUFA 1EQ9A 1YP9A 3RMLH 5E8EH 2GZ9A 5FX6A 4DIIH 2HNTC 2FOGA 2BD9A 2BOKA 2QXJA 4XDEA 4R0IA 3UNRA 3LC3A 1AQ7A 4XBCA 1ZMJA 4BTTB 2GCTC 2ZTYA 1K1IA 4Q2KA 1RRKA 2ZDKA 3HPTB 1OYTH 5HYOA 2EEKA 3LGIA 5DP5A 4K5ZA 1BRCE 1C2FA 4JZ1A 3OU0A 1C5MD 2QF3A 1O5DH 2C8ZB 1O2NA 1LO6A 5C5NA 2GCHF 1EB2A 1DOJA 3E0PB 4X6NA 2F9BH 5DG6A 3I78A 1UTQA 2BLVA 3D23A 3EGKH 3A8BA 1EZXC 1S85A 1ZTKA 1O0DH 1GJ4H 3ZZ9A 3LGWA 1O5BB 1QL7A 4JK5A 1LHFH 1SGFA 1CHGA 2ZWLH 4LK4A 1O2RA 4ABBA 1GVKB 3URDA 1DUAA 1QB6A 4YM9A 3BEIB 2CMYA 1BRUP 2ILNA 1OKXA 2XCFA 4MDSA 1NM6A 3F9FA 3T62A 1AY6H 1KLJH 2WPMS 2FI5E 3DFJA 4TYDA 2THFB 3RXFA 3LJOA 1GL1A 4TY6A 2IPHA 1EPTB 4K1SA 1W10U 3RU4E 1C2JA 3P95A 2PWXA 2VVCA 3MNCA 1L1GA 2BD4A 3QWCH 5L6NH 5AFZH 1ZSJA 1RTFB 1JXPA 4K60A 2CV3A 2M5TA 3LGYA 1ETSH 1A0JA 1TX6A 4DURA 3SW2B 1PQAA 3LT3A 3KF2A 4UFEH 2VIOA 5C1YA 2XYAA 4J2YB 2ZQ1A 3SHCH 3MTYA 1ELDE 1QBOA 1TB6H 3S9BA 1FDPA 1S5SA 5EW2H 3BV9B 1BMMH 1FLEE 5AFYH 1QB9A 1P05A 1GMCG 1O2SA 3GICB 4FVDA 4MPVA 1H9HE 1L1NA 5DPAA 2BB4A 5AF9H 3P8NA 1O3HA 3BG8A 1BTHH 2Y7ZA 1BRBE 3BG4C 4XFQA 3SUFA 1K22H 2FM2A 3ZZBA 5EQRA 4ZXYH 4YLQH 1UTMA 1O3LA 1OP0A 1LHCH 1V2VT 1CT2E 1MCVA 1SGQE 3A85A 3BSQA 2Z9KA 1CGJE 3QZRA 1VITH 4TPIZ 3ZVAA 5DP3A 3S9CA 4OGXA 1SHYA 3HATH 2O8MA 3QTOH 3SGAE 1W0ZU 2ODQA 3BTKE 3OY5U 2ZFPH 1O2UA 1GBIA 1ZHMA 1EAWA 1TRMA 1WAYB 1GI9B 3OSYA 1M9UA 1VZQH 2BY9X 1C5TA 1Z7KA 1PPZA 1DS2E 1OYQA 2ZTXA 1DFPA 1UK3A 1D6RA 1DITH 1S6HA 2UUJB 3A7ZA 3RMMH 1T4VH 2PTCE 3PMBB 4H4FA 7LPRA 1EP5A 2Z9LA 4LZ1H 3P92A 3RXDA 4Y76A 1O2PA 1YCPK 1XUGA 1A3BH 1EASA 4B2AA 4A1VA 5J4SA 1C5OH 3ZVFA 3NXPA 1T4UH 3SNEA 3SNCA 3VB3A 1AZZA 1P3CA 3GCTG 2UUYA 1QQUA 3A82A 1NRQH 1YM0A 1HXEH 3UR9A 1K1LA 1THPB 1WQSA 4Z0KA 1CGIE 2ALVA 1GHBG 1ABJH 4AB9A 1XUHA 2R3UA 3GCOA 2ZHFH 1K28D 1MAXA 4X1QU 4X1RU 1AU8A 1GI1A 1HDTH 2KAIB 2NU3E 3NKKA 1GMDG 2JH5D 5T3HA 2OC7A 1T8LA 3KN2A 3SU0A 1A4WH 4VGCC 4U32A 2GDEH 1AWHB 2BDHA 3B8JA 1DWBH 1Q3XA 3RU4T 2CN0H 3GCNA 4H6TA 3ZVEA 3R0FA 4ZMAH 1NS3A 2PSXA 2OBOA 1FIZA 5L2YH 1BB0B 1DWCH 1SFIA 3UUZA 4A1XA 2HVXA 4CRDA 1ANCA 4CRCA 2VU8E 3E1XB 3WY8A 3M7TA 1C5QA 4GCHG 4X6MA 1CU1A 2FOHA 5K0HA 1NESE 2Z9GA 4MTBA 3NZIA 1H8IH 3ZZ3A 1J17T 2AMDA 1GMCF 5TCAA 5FXLA 1HAVB 2ANYA 4BXSA 5EG4A 1DANH 4ABAA 1UTLM 3TU7H 4X8SH 2BM2A 3CS7A 5JBCS 1SB1H 1TNLA 4IC6A 1EZSC 1QGFA 1GPZA 1E36B 2QF0A 4O9VA 4SGAE 4KTUA 3VB4A 2ZZUH 3BTME 3FP8E 1UK4A 3BIVH 4FU7A 4K3JA 3SI3H 5DP9A 1GBJA 1QL9A 2H9TH 1GJ8B 1HJAC 1A46H 4FVBA 4XE4A 4ABIA 2RA3A 2XC0A 4O3UA 2A45B 1OXGA 2QIQA 1V6DA 1K1MA 3BTGE 4IS5A 3A7YA 2VB0A 3UPEA 2W26A 1O2LA 1PPBH 1FAXA 3M3TA 3MNXA 3RM0H 1CA8B 4J1YA 1TMBH 1HJ9A 2FLBH 1BBRH 4YESB 3GCHB 3LKWA 1T8MA 2G55A 4BAMB 4HZHA 4CR5A 2STBE 3HKJB 2Y6TA 2VH6A 3V0XA 1ESAA 1QJ6B 1C1WH 1BRAA 4MNVA 3BTQE 5DP6A 2I6QA 2P93A 1GGDB 1TONA 1HRTH 5FX5A 1FY1A 1IQIA 1SLUB 1V2ST 1CGHA 4OGYA 1C2KA 1HGTH 3JZ2B 3FAOA 2ZGBH 2UWOA 1S0QA 1NN6A 4O03A 2BDYA 1P57B 1RXPA 2ZPSA 3K9XB 1PQ5A 3Q00A 3C27B 1GMDF 5LPFA 1QBVH 2FS8A 3RC5A 1AGJA 4FUBA 3RP2A 3ZZDA 4AFZA 2BQ6B 3W94A 4ZUHA 3P8OA 3RLYH 2FX6A 1LKAA 1TQ7B 1PYTC 1EATA 4WY3A 2UWPA 2ZDNA 1CBWC 3QO6A 2ZFQH 2BD8A 1P11E 3A8CA 2VIPA 4D8NA 1D3DB 2GTBA 1YCPH 2A7CA 2ZU2A 2PKSC 1KY9A 2R0KA 1Z6JH 2EI6A 1YPEH 4GCHF 1HUTH 1C1SA 2BQWB 1ACBE 2FX4A 2Y82A 1T31A 3O8RA 2SGDE 2QY0B 1W14U 4NSVA 5A8YA 4CBNA 1O3KA 2P94A 4D7FA 3SV7A 1O34A 1IHTH 1C1MA 3SU6A 1EZUC 1D3PB 1V2JT 1D6WA 4AOQA 3UY9A 1GHAG 5AVDA 1GBBA 1UVSH 3S7KB 1C5UA 2DE9A 4MQAA 2FOCA 4WXVA 1QR3E 4NIYA 5A8XA 3MO6A 4MPUA 1HIAA 2HPQH 1NFUA 1OWIA 4Y0ZE 4GSOA 1VGCB 1C5SA 4LOYH 2PV9B 1BMAA 2BDIA 2O8LA 2PHBA 4X1PU 3BEFB 4I7YH 4U01A 1VJAU 2R9PA 3AW1A 1CT4E 4X2WA 1FONA 3PMJA 5EXLA 2ZDVH 4YOIA 4GUXA 1Y8TA 1QA7A 2SGPE 4WMEA 5EPYA 4ZKRU 1C5ZB 2H1UA 2PUQH 2ULLA 4E7RG 1GCDA 1JWTA 2A2XH 4ABJA 2W5EA 1SMFE 3EAJA 1G3CA 1O2ZA 1A0LA 2CF8H 2GKVE 1UTPA 2Z94A 3U1IB 1AZ8A 3AAVA 3SJ8A 5E2OA 1XUJA 2FOEA 4H6SB 3RXBA 1HAZB 1RD3B 1P2JA 1U6QA 1P10A 3ATMA 4JYUH 1BJUA 1SGFG 3P17H 4Y0YE 1A2CH 1P2MA 1ID5H 1EPTC 1FN8A 1WU1A 1H9IE 4F49A 1KLTA 1O5FH 1ZZZA 3RXCA 4NWKA 1YYY1 1FQ3A 3DHKH 1GI7B 4AFUA 3PYHA 1A7SA 1MKWH 3AW0A 2STAE 3L3TA 2JETB 1UVUH 2EI7A 3QN7A 3KEEA 1S84A 1AE8H 2AGIX 2PUXB 3O8DA 2BD5A 2F3CE 1Z8RA 2PGBB 3LH1A 2FTLE 4HGCA 4CHAB 1QA0A 5FPSA 1MBMA 2BTCE 2EA3A 3DFLA 3L33A 3U8RH 1QTFA 1CVWH 5DK1A 1G3DA 2BX4A 2QN5T 1N8OB 9LPRA 1J9CH 1V2MT 1GCTB 2B0FA 1O2WA 2CGAA 1DSUA 1J16A 4X2VA 4NFEA 1SGRE 1BTZA 2R2MB 3K6YA 5IDKA 1TBRH 4DY7B 3RXEA 3LDXH 2FTMA 2F