3MNSA

Investigation of global and local effects of radiation damage on porcine pancreatic elastase. third stage of radiation damage
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Chymotrypsin-like elastase family member 1
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mnsA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mnsA01
2HPPH 5T6FA 2VJ1A 1SLUB 3ZZ3A 3LC3A 4K5ZA 4B73A 1ESAA 2C3SA 1SI5H 1P9SA 3DFJA 3ATWA 1A7SA 1OP2A 2A31A 3TJUA 1C5UA 1HXEH 1GHXH 1TAWA 1MTNB 3ZZ5A 1ANDA 3MU4A 1G2MA 2XTTB 4HI3A 1A0HB 1MTSA 3P92A 1AUJA 3LPRA 4AN7A 1DUEA 3SNCA 2F9BH 3AASA 3GY2A 2FOMB 3RU4T 4AGJA 2B9LA 1EASA 1K2I1 1OP8A 3QTOH 3ODFA 2J9NA 4X8VH 1UVPA 2A5KA 3ODDA 3D62A 1ABJH 5L2ZH 1W2KH 3PMHB 1GJ8B 2J34A 2NU4E 1VCPA 1LPGB 2Y5FA 4B2AA 2R2WU 3LGYA 4LOYH 2ZQ1A 1Z8RA 1C5VA 1NRRH 1S6FA 1XUIA 2BY7X 2GKVE 2SGEE 3GCTG 4MQAA 4OS7A 4FU9A 2CV3A 3SU4A 3SNBA 1V2QT 3RXEA 1Y3VA 4FUGA 1B5GH 3UR6A 4CRFA 2Z9IA 2ZFFH 2D26C 1CE5A 3W94A 2A4QA 1IHTH 3EGKH 5EXMA 1ARCA 4YLUA 4ABDA 1NTPA 1Y3WA 2G81E 3EDXB 1ANEA 3TJOA 3PO1B 1P10A 5JBBS 2AFQB 7ESTE 2NU1E 1A3BH 1TNLA 2ZDMA 3U1JB 1GI3A 1BHXB 4MPWA 2ALVA 1JRTA 1GMDG 1ZSLA 2IJOB 2ZU2A 1CGIE 1ZR0A 2A5IA 1ETRH 4X8SH 4JYUH 2H5DA 1O3AA 1EAIA 1FPCH 1C5TA 1AI8H 2AIPA 3BTFE 4AG2A 5LPEA 2SFAA 1TX6A 3BTGE 3QLPH 1O3JA 2A0QB 2VGCC 1LCYA 3AW1A 1CT4E 2CHAB 1TOCB 1QURH 4VGCB 3GISB 3RDZA 2J4IA 2BVRH 1UTMA 1GJ6A 1HRTH 2OCVB 2RA3A 3K9XB 3GCHC 3KHVA 3P8FA 5FPSA 1GL1A 1P2KA 2GCHF 3V13A 5JBTA 1H8IH 1MQ6A 3OTJE 1BTXA 3DA9B 3TJVA 4CHAB 1EPTA 1GG6B 3BTEE 3NK8A 1C2FA 3SO3A 4IS5A 4BANB 1GBIA 3F68H 4CRDA 3ZVGA 1EATA 4TY7A 2VWLA 1XUFA 1UHBB 2A2XH 3PYHA 2Y82A 1X7AC 2CHAC 3KQEA 2VWMA 2Z3CA 1LHFH 3MH7A 3TGKE 5GPIB 2PTNA 1GMCG 1GMCF 1ZMNA 1AIXH 1DVAH 2AGEX 5GWZA 1PQ8A 4DVAU 3S7KB 1GBHA 2G5NA 3KQBA 2R0KA 3GICB 1QBNA 1BA8B 1BMAA 2CN0H 2NU2E 3GOVB 1HAVA 1DITH 2GZ9A 3KQCA 4HFPB 4INHA 1MAXA 2YNAA 4RKOB 3VB7A 1V2NT 1FZZA 3SHCH 3H7TA 2XWBI 2ZPRA 4YOJA 2W7SA 1OOKB 1PPFE 4JMYA 1YLDA 4MNWA 3MU1A 1ZPZA 1G37A 1Y8TA 4TWWA 1MBMA 1NN6A 2STBE 2VVVA 2TGPZ 1ZJKA 1C1PA 1QGFA 1TNKA 1AN1E 1GBTA 3ATKA 2TPIZ 5T3HA 4B2CA 1O2TA 1O3PB 3UQVA 1O38A 4UE7H 1AB9C 1P01A 1V2TT 4Y7AA 4GCHG 5DP4A 1SLXB 1WYKA 3SV8A 3V7TA 1GMDF 1LHCH 5GCHF 3L6PA 2BQ7B 2W26A 3BN9A 4PROA 5E0GA 1VCWA 3Q76A 1YPJH 3PROA 2WYJA 1GI2A 1SGQE 1G3BA 4KELA 3TGJE 1RTLA 4TWYA 1CGHA 3K65B 4BAKB 3ZZ8A 2J2UA 4AFUA 1BTPA 2Y80A 4TPIZ 1QQUA 1TGNA 2ZHFH 1Z1IA 4X0WU 1LPKB 3O8BA 2HNTF 2BHGA 4GHQA 1DXPA 1GI7B 4AG1A 2OC1A 1C1OA 1FN6A 4MLFB 2ZF0H 1LHGH 1K1NA 5H4IB 2F9VA 1QL8A 1FAXA 2TGDA 2XW9A 1QQ4A 2SGFE 2XYAA 3HK3B 1KLJH 3GCTF 4GSOA 1O2SA 2ZU1A 5J4QA 1DLKB 1TX8A 1O3NA 1TRYA 3KF2A 5C5OA 2BDCA 2GDDA 1BTUA 1Q3XA 1E0FD 6GCHF 1O3CA 1TNHA 1C9PA 3UY9A 5EXNA 1NFUA 5G4BA 1IQHA 3BTHE 1SPJA 3EQ0H 3GYLB 3CENA 2XBVA 2SGAA 3L3TA 1TIOA 1D4PB 2BLQA 4ZXYH 1UJ1A 4NFFA 1F2SE 4AFSA 5CHAB 1GBFA 2BQ6B 3LC5A 1AWFH 3ZZAA 1LTOA 1BMNH 1TBRH 2VINA 2PLXA 4FUEA 4UFFH 4DIIH 5C1YA 5A2MH 4Y8ZA 1LO6A 2F9OA 3SU1A 2OC7A 1DLEA 2CJIA 2ZGBH 3A87A 1EQ9A 1HXFH 2BLVA 2B0FA 1GL0E 1NRPH 1JBUH 1T31A 2H5CA 3GY8A 4I8HA 7GCHF 3UFAA 1JWTA 2ZG0H 1PJPA 3PMAB 2ASUB 2H9HA 1PPZA 1K9OE 1GI6A 4GAWA 1GMHF 1SFIA 4AFZA 2PSYA 2XCFA 5EG4A 4NIWA 2ZGJA 5HYOA 1S6HA 1C2IA 1QB1A 4JZDH 1AVGH 1G30B 4WF8A 3A80A 3BV9B 1IQNA 1O2OA 5JBAS 1UCYE 2BM2A 3GCOA 1C2MA 2GVFA 4UFEH 3SORA 1EJAA 1K22H 5C3NA 1UVUH 1K1OA 2ANKH 1UTKA 1P2QA 1IQKA 5F8ZA 2Y5HA 2BDYA 2FOAA 1KDQB 1ELGA 4Y11E 2W3IA 1GI4A 1LQDB 2THFB 2BYAX 4MG3A 3U9AH 1EZSC 1O37A 2FLRH 2A7CA 3PLPA 1DE7H 1C5LH 4JK6A 1BRUP 2QXIA 2O9QA 2I6QA 1KXFA 3VPKA 1D6WA 2FO9A 1F0SA 1C5XB 1SVPA 1RFNA 4ABAA 1GCTB 4AORA 2OTVA 5GIBA 3M3VA 1W10U 3VXEH 3Q3KA 2P8OB 3O8RA 4I33A 1K28D 3M5LA 1BJUA 3DHKH 3GDUA 3VEQB 3A7ZA 5AHGH 2Z7FE 1TNIA 4Q7YA 4ZHMU 1S5SA 1TALA 2UUKB 1O3BA 1PPGE 3D23A 1TGTA 3LKWA 4ZKSU 1K1MA 3F9FA 1GPZA 2V6NA 1O3MA 1O5FH 1DY9A 4D8NA 2R3UA 1XXFA 2GDEH 2Q6FA 2PUXB 1V2OT 4JZ1A 1UVTH 4WY3A 1HCGA 1EZXC 3NZIA 3MYWA 1HJ8A 1NRSH 2AEIH 5EQSA 3BTTE 1F5LA 3U8OH 4K3JA 1ZGIA 5AVDA 4DIHH 1TQ7B 3PV4A 3RU4D 2BDGA 1GHWH 2P94A 4UFGH 2C8YB 3VXFH 2ZWLH 1LKAA 3SQHE 3GY7A 1S81A 4WH6A 1TFXA 2BX3A 4ZKOU 2ZDVH 2G5VA 4NIXA 4MNXA 2XWAA 3OU0A 2Y7XA 2BLOA 3QTVH 2OD3B 3K6YA 2H9EH 1JRSA 4RKJB 1YPGH 2H9TH 2O8UA 1C1UH 4X1NU 1GHYH 5TCCA 1ORFA 4B2BA 4CRGA 2OQ5A 2UWLA 4M7GA 3SJIA 5JDUB 1ZTKA 1PQ7A 3BEUA 4WMDA 4X2YA 3U8TH 4DOQA 1Z1JA 3RXTA 4R0IA 4MNYA 3LT3A 1C1NA 4Y0YE 1QRWA 1O2QA 2OBQA 2G00A 3LU9B 1GBKA 2OINA 3Q77A 1BDAA 1WBGB 1UMAH 2B7DH 4IMZA 5C1UA 2J92A 4UEHH 4ABGA 3CS7A 3OYPA 5HGGA 3GY5A 2ODQA 2O8WA 1Q31A 4U01A 2C4FH 4HZHA 2QYIA 3TU7H 2ODPA 4K69A 4KTSA 3M5NA 1FY3A 3NXPA 4I8LA 1AZ8A 3N7OA 4INLA 1GMHG 3C1KA 3M36A 1AMHA 2B8OH 3PMBB 1GI0A 4LZ4B 1MKWK 2AGGX 1KSNA 4O97A 1DFPA 3PLKA 2FS9A 2ZFQH 2ZQ2A 3GCHB 4ABJA 3MI4A 4WXVA 2G52A 1ZYOA 4B75A 4Y8YA 2FP7B 1UCYK 2WPHS 1C5OH 1JOUB 1V6DA 4WJG2 1AVWA 5EQRA 3M3TA 2PHBA 2QV1A 4GUXA 3M7TA 1ZRBA 5K0HA 2P59A 2QF0A 1KDQA 1O3OA 1QJ1B 4ISLA 4ABIA 1ELVA 1AB9B 3S9BA 2HGTH 3LDXH 1OX1A 1P12E 3DD2H 3FP7E 1HIAB 5DO4H 4ABHA 2P3FH 1BMMH 3K2UA 3PWCA 3DT0H 4AB9A 1O5EH 5FHTA 1QB6A 3RMNH 3IG6B 3AW0A 3BG4C 1D3QB 1O5AB 5IYTA 4CBNA 3S69A 1EAXA 3E8LA 1OWEA 3BF6H 4K2YA 2TGTA 5FPYA 5FBIA 1Y5UT 4AFQA 1V2PT 1P2OA 6ESTA 1U6QA 5FX5A 3GY3A 1YPKH 1Z71A 2CF9H 5HM2A 4A1XA 4XBCA 5GDSH 1GJDB 3D49H 3F9GA 3UTUH 6CHAB 1IQJA 1TWXB 2PKSB 1LMWB 3EYDA 1MQ5A 1CGJE 3GYMA 3RXIA 3SJ9A 1HAXB 3FP6E 3RM0H 1GBCA 1UK3A 1TA6A 1XM1A 4AX9H 4NWLA 4Z6AH 2CMYA 2ZKSA 3QUMP 2P3UB 4FXGH 1O34A 4X8UH 1HV7A 1UO6A 4FUIA 1S82A 1QY6A 2PWXA 1AVXA 1G36A 4O3TA 3FAOA 3TJNA 1GJ5H 3QO6A 1FIZA 4H6SB 4YOGA 1LVBA 3O8DA 1ANCA 3RMOH 1ACBE 3SJ8A 1NS3A 3UREA 4BAOB 1C5PA 3S0NA 3SUEA 3VB4A 2AIQA 1G32B 4YM9A 5E0HA 4Y10E 4JZEH 1OWIA 1O3DA 4WXIA 1KXDA 1P57B 1BQYA 1TYNA 5I25A 2WV4A 4FUCA 3S9CA 4X2XA 1QRXA 2ZA5A 3GY4A 1C1QA 2GCTC 5DP6A 4NA8A 4E7NA 1E34B 1J14A 8LPRA 1HJAB 2ESTE 1UTNA 3A82A 2VGCB 3ITIA 3VB5A 2ALPA 4K60A 2AERH 2CGAA 2G4UA 5FCRA 2PW8H 5F03A 3A8CA 1XXDA 1DPOA 2BD9A 2XRCA 1D3TB 1AE8H 1GI1A 1L4ZA 2FM2A 1SGFA 2FOCA 1JMOH 3LGIA 3OX7U 1GG6C 1C1SA 3BG4B 3T27A 4FUHA 1BBRH 1HLTH 4E06H 1DWBH 5DKMA 4INKA 1EUFA 1HBTH 1QHRB 1GGDC 2FI5E 1HAZB 4BTIB 2VIDA 2K1QA 1GI8B 1WQVH 2SNWA 1H9HE 3P95A 3TGIE 2RDLA 2JKHA 1MH0A 2BY6X 4Q7XA 1VGCB 3F9EA 4D7FA 4ZH8A 3U8RH 1Z8JB 1SGTA 3F9HA 2FOEA 1WTHD 1BZXE 2OXSA 1BB0B 1GVZA 5A0CA 2GCHG 4R8TB 4SGAE 1AQ7A 3NKKA 3LH3A 3RC4A 5LH8A 4XBDA 2YOLA 3LGTA 1A3EH 2ZP0H 1O2XA 3SI4H 1UVSH 1TMUH 1D9IA 2ZDLA 4RSPA 1L1NA 2W7UA 3AAVA 5EU8A 4NG9H 3SGQE 2V0BA 3OY5U 1TPSA 3RXHA 6LPRA 2C90B 2ANWA 1O2RA 2C8ZB 3HKIB 4MPUA 1B0FA 2ZPQA 1E35B 1A0LA 3DUXH 2Y6TA 4OS5A 3C27B 1O3GA 3T29A 4BAMB 2F3CE 4F49A 1ETSH 2EI7A 1PPEE 1DOJA 4MDSA 4D7GA 1IQMA 3SGAE 1T8OA 3RP2A 1C1RA 2SGDE 1CSOE 3A7YA 2EI8A 1JXPA 2WPLS 1T8NA 2OC0A 1C5NH 1DT2A 1P8VC 1SFQB 2FLBH 4ABEA 1C4V2 3UOPA 1DICA 2FTMA 4H6TA 1PYTD 1BOQA 1GI5A 2H6MA 3Q3XA 2SGPE 1P2IA 2PGBB 2DE8A 5DP8A 2J95A 1YPLH 3SJKA 3SU0A 1C5QA 4CR9A 1GWAA 3RU4E 4DGJA 1HIAA 2UUFB 4NWKA 3V0XA 4AZ2B 1IHSH 2EC9H 2BMGB 2BD3A 1GGDB 1AZZA 3RXCA 4ESTE 3MO6A 3SNDA 3A8BA 1SGFG 3BIUH 3B23B 5DP3A 4CHAC 2O8MA 4ASHA 1SB1H 5F8XA 1P03A 1P02A 2BY5X 1SGNE 1TE0A 2HALA 1J15A 2R9PA 3P70B 1BTYA 3SOSA 1S0RA 1NPMA 1O35A 1ZLRA 4X8TH 1SG8B 1NFXA 4FUFA 4I32A 1A5HA 1NM6A 1SC8U 1SQAA 2ZEBA 3FZZA 4UFDH 3BIVH 1AKSB 5DK1A 1BITA 2ULLA 2ZCLP 3LH1A 4IN2A 2FYRA 3ZZBA 2GCTB 3OSYA 2BY8X 1BRBE 1HAHH 2WPJS 4JCNA 4DY7B 3F1SB 5JB9S 3E0PB 1KTSB 2VH6A 1RD3B 3ZVFA 3MWIU 1CA0B 1GBEA 4KTUA 2JETC 2J94A 2HRVA 4B74A 1MMJN 1HDTH 2OLGA 2ZCHP 3UNQA 3H7OA 1GDUA 1N6YA 1Z8GA 4BOHA 3VB6A 1GBMA 2VWNA 2GZ8A 1UTOA 1HYLA 1CVWH 1C2EA 5E0JA 4K8BA 2WUCA 1GDQA 1XUKA 2EEKA 1GBDA 3BEIB 3QZRA 3UWJH 3MH4A 4D9RA 1WUNH 4E7RG 3A8AA 2JH6D 1C5WB 1A5GH 1YF4A 1K1IA 2BD2A 2ZDAH 2QXHA 1GJBB 1O2UA 2PV9B 1QA7A 2QF3A 1J17T 5AFYH 2AH4X 4X6OA 3RXVA 2WPIS 3BTWE 5JYIA 2BDAA 1BTHH 1HUTH 1DANH 4U32A 1RIWC 1A2CH 1O2NA 1SGCA 3IWMA 2ZI2H 3O8CA 3SHAH 4GPGA 1ABIH 2ZNKH 2WPKS 5T6DA 2C8WB 1KLTA 1Z6JH 4X6NA 2UWPA 2XNIA 2QCYA 1CBWC 1KXCA 2ZDNA 1ELAA 2D1JA 8GCHG 5B6OA 3RXLA 1A4WH 2AS9A 3H5CB 1CA8B 4Y0ZE 3VB3A 2OBOA 2F83A 4JYVH 1V2ST 4NCYA 1W13U 1MAYA 4LK4A 3VFEA 1TMBH 1KY9A 2G4TA 4A1TA 2FOFA 2F9UA 1WTGH 3MOCA 2A32A 3FZDA 1VITH 2ZC9H 3QN7A 1FMGA 5DG6A 3PTBA 3QK1A 1V2VT 1GCDA 5DGJA 1LVOA 5FCKA 2Z9KA 1O2IA 1XVMA 3I77A 1YPEH 3ENSB 1SHHB 4A1VA 3V12A 2TBSA 1C5YB 3PWBA 1ANBA 1Y59T 2BLWA 1C2KA 1LVMA 1OWKA 3HGNA 1TNGA 1TPPA 1D3PB 3M35A 4IN1A 1OSSA 4Y7BA 1O39A 1O30A 1BMLA 3E16B 2ZPSA 1AFQB 4WMFA 1NC6A 4ZKRU 5CE1A 2P16A 2GT8A 1CHGA 3T5FH 4NFEA 2ZGCA 5LPFA 1KXAA 5HMAA 1CT0E 1BJVA 2STAE 1T4UH 1WOFA 1NU7B 2VU8E 1SGDE 5T6GA 3KEEA 2TRMA 2LNCA 3M7QA 3BTKE 2FMJA 2BOHB 3RXQA 4BXWA 1SOZA 3MNCA 1QB9A 1MU6B 4B71A 1W0YH 1AY6H 4X1PU 2XC5A 2GMTC 1VZQH 1JIMA 1SR5C 2FX4A 2GV7A 1CO7E 2ZGXH 1XKAC 1Z7KA 1ZRKA 1EB2A 1GHBG 1M9UA 1RS0A 7KMEH 3FANA 4NSYA 2BVSH 1GJAB 2FPZA 5EW1H 1EOJA 4AYYB 4KKDA 3KCGH 5AF9H 2ZFSA 1LDTT 3QX5H 4BXSA 1XX9A 5C5NA 3UNSA 2O8TA 2QC2A 3MH5A 1DWCH 1C5RA 1P05A 3ZVCA 1DDJA 2WV5A 2VIOA 4LXBH 4FVBA 1EJMA 4NIYA 2GMTB 1LPZB 1TBQH 2Z9LA 3I78A 3ZZ4A 2QY0B 3EA7A 3EAJA 3Q00A 1TGCA 1O3EA 2LPRA 2Z9GA 1L2EA 3A7XA 1TX7A 2OUAA 1PQAA 4ZHLU 2DE9A 4IW4E 1C5SA 1C5MD 3SNAA 3T26A 1WQSA 2OQUA 1SBWA 4B1TA 1A61H 3GCNA 1IQIA 1VITG 1O2MA 2BB4A 3SU3A 4UDWH 1UHBA 3ATIA 3HGPA 1MZDA 2I6SA 3RLWH 3A81A 5C67A 1N6XA 1Y5AT 2ZHEH 1FV9A 1OPHB 1F0UA 1O3IA 3MNXA 1EZUC 4E05H 1MCTA 4IC6A 3URCA 1PYTC 1W14U 3JZ2B 1C4Y2 5EOKA 2DUCA 1FY1A 4UD9H 3PTNA 4DURA 1GJ7B 1FN8A 3SUDA 4CH8B 1EAUA 4LZ1H 4A6LA 3BEFB 3CP7A 1C5ZB 5FX6A 4H4FA 3RXOA 1YCPK 2BXTH 2TGAA 3TK6A 3P8GA 3U98H 5JB8S 2ANYA 1DSTA 2YNBA 3W95A 4X6PA 1GJ9B 3I29A 3SBKA 1AU8A 1TA2A 1AHTH 2A7HA 1RJXB 2UUJB 1PPCE 3HK6B 1EB1H 4YZUA 4XE4A 1EOLA 1G3CA 2AMQA 2BOKA 5A0BA 1V2LT 3TH4H 2ZU5A 1MKWH 1BHXF 1PFXC 3SV9A 1FAKH 4Y71A 1VITF 1TPOA 1O2WA 1FQ3A 4JK5A 1GDNA 3URDA 5L2YH 4A7IB 2ODYB 3MU8A 2ZU4A 2FXRA 4NZLA 4NA7A 1HAVB 4D76A 5F6MA 5CMXH 1SLWB 3TIUA 3P17H 1RXPA 2BDBA 1SGEE 3MFJA 5PTPA 3A83A 1SOTA 1VCQA 2VVCA 1GI9B 1G3DA 5FPTA 4ZXXH 3T28A 4Z0KA 2AMDA 4X1SU 1CT2E 2XBXA 1AO5A 1ZMLA 1FXYA 3IITA 1EZQA 2VNTA 2VIPA 3MMGA 1HAYB 3TPIZ 1MTUA 1OS8A 1QR3E 4BNRA 1GHBF 2Z94A 1FLEE 5DP7A 1O31A 1ZHRA 4JZFH 3AAUA 3RC5A 2A45B 1ELDE 1GHZA 3SV6A 4I8JA 3UIRA 1AUTC 5I46H 1P11E 2GV6A 1BUIA 3NPSA 2IOTA 1CQQA 2GT7A 5TCAA 1HAIH 2A4GA 2ZU3A 5EQQA 1BIOA 1MTNC 1ESBA 2D2DA 2UWOA 2BDHA 1QRZA 1TABE 1FNIA 3U69H 1O2KA 2XC0A 3D65E 1K21H 4YESB 1HFDA 2VIWA 1RIWB 3MNBA 5CHAC 5BPEA 2PKAA 1KIGH 5K7RA 2GX4A 1C2DA 1ZGVA 1BTWA 3R0FA 2AYWA 2Y5GA 2FI4E 3ZYEA 1AKSA 8GCHF 3RXBA 1P09A 5JBCS 1YPMH 2BD5A 1Y3UA 3RXRA 1O2LA 4KTCA 2VIVA 1NFYA 2A2QH 1UTLM 3BG8A 2PKAB 2R2MB 1O5GH 5ESBA 3RXKA 1WU1A 1DWDH 3MHWU 1EX3A 3UR9A 4AYVB 2Z9JA 2ZIQH 4JZIA 5C2ZA 2ZFPH 1L1JA 1AFQC 4IC5A 1O3KA 4GLYA 2PSXA 2SGQE 1P3CA 1HNEE 2ZTYA 2PGQB 3SU5A 4ISIH 3ZVDA 3HATH 1NFWA 1YM0A 3ZZCA 1KLIH 2C8XB 3LJOA 1FY4A 4NZQA 4RN6A 3E91A 4X6MA 1ETTH 5A8ZA 1NY22 3LJJA 2ZECA 1MU8B 7GCHG 2ZFTA 1P9UA 1QL7A 1NRQH 1QTFA 1HGTH 1EP5A 3AVZA 3QWCH 1VJAU 3QGNB 1O3FA 3GDSA 1D6RA 3CS0A 3TITA 1V2MT 1V2JT 6GCHG 4ZMAH 1KTTB 1Z6EA 9LPRA 2CXVA 2H1UA 1TOMH 1Q2WA 1LKBA 2D8WA 1V2WT 4I31A 1SQOA 3ESTA 2FTLE 3ATLA 3SJOA 3ZYDA 4DT7B 5FAHA 3ELAH 1ID5H 1O3LA 1W3CA 4NA9H 3B9FH 2ZTZA 3G01A 4UONA 1G9IE 3DFLA 3RLYH 1L4DA 3SQEE 1GBLA 4SGBE 2Z3EA 4KGAA 4DCDA 1GVKB 1GHAF 2FODA 1BRAA 3ZV9A 1P2MA 1ZJDA 5DP9A 1GJCB 1PQ5A 1EAWA 1W7GH 3JZ1B 2PFEA 2G8TA 3P8OA 5GCHG 1VJ9U 1THPB 2ZHQH 1ELBA 1E36B 5GXPA 1ELCA 1C2HA 1XVOA 2HOBA 1TPAE 4CH2B 1T32A 4Y79A 3TNSA 2V3HH 1ZTLA 4K1SA 1LHEH 1ZZZA 1ZHMA 1O2YA 1H4WA 3B8JA 5ABWA 1K1JA 1P3EA 2FI3E 3ZVEA 2WPMS 2XXLA 1HAOH 1DXWA 2P93A 2A7JA 1GVLA 3RXMA 1OYTH 2ZDKA 1C1WH 1D3DB 4X2VA 1FY5A 3S9AA 5E2PA 1MKXK 3RM2H 3LGVA 4GCHF 3RXSA 4X1QU 1OYQA 2HLCA 3K6ZA 1WAYB 2HVXA 1ELEE 3RXAA 3M5OA 3TK9A 3ZZ7A 1IQLA 1QNJA 3PM3A 3FFGA 4NIVA 3WY8A 1OWDA 1TRNA 4Q80A 4X2WA 1A0JA 1YLCA 3SV7A 1OXGA 3MU0A 4K1EA 1H1BA 1UK4A 5FXLA 2Q1JA 2A4OA 1F7ZA 3FP8E 5TJXA 1BBRK 1EXFA 1VR1H 1MKXH 1MD7A 8ESTE 1ZSKA 5HXFA 3PB1E 4BAHB 1RTKA 2XBYA 2FOBA 1GHAG 1MTWA 3RMLH 1NO9H 2RCEA 4YTAA 2FEQH 3F6UH 7LPRA 1V2UT 1DUAA 5DP5A 3TNTA 1AD8H 2GGVB 1TGBA 2FOGA 3RXFA 1TBZH 2Y7ZA 1GBAA 3PO1C 4AOQA 1TONA 3SN8A 5A8YA 2QIQA 1S84A 2QXGA 1HB0B 2VB0A 2J38A 1Y3XA 3TH3H 2G51A 1A1RA 1TQ0B 1MCVA 2ZHDA 2F9NA 4CR5A 1TLDA 1S0QA 1O36A 1T7CA 5EPNA 4YT6H 4GVUA 2IPHA 1AWHB 1QJ7B 2NWNA 2JH5D 2VWOA 1F5RA 2QAAA 4Y76A 3UPEA 1CU1A 1XUGA 1FUJA 1EPTB 1LVYA 3VGCB 4CRAA 1F5KU 1LHDH 1LQEA 5ETXA 3A86A 4DW2U 4F4OC 1W7XH 1N1LA 2XC4A 1H9IE 3ZZ6A 2G55A 1P2NA 1SL3A 4MPXA 5GJ4B 1W12U 1W8BH 1OKXA 1L0ZA 4BTUB 1T8MA 1C4U2 1GBJA 2NU0E 1YCPM 4D9QA 4ISOA 4X1RU 4XFQA 4NGAH 1Z8IB 1KYNA 4FUBA 2FS8A 3BTDE 1C1VH 1DM4B 3MU5A 3A85A 1V3XA 4DJZB 2PTCE 1THRH 2AGIX 4U30A 4XSKU 1EJNA 3M37A 1J9CH 2BQWB 4U2WA 4YO9A 2H2ZA 1QCPA 1INCA 4GHTA 3GDVA 1RTFB 3GY6A 2EI6A 1IQGA 2F9PA 1HJAC 1L1GA 1KXBA 1C2LA 2QA9E 3BTQE 3MNSA 2O8LA 1ZPCA 3Q3YA 1C1TA 4FVDA 1P2JA 2PKSC 1SGIB 5AFZH 3KGPA 2WUBA 1V2RT 2NU3E 5E2OA 5A8XA 1W11U 1FPHH 1YPHE 2M5TA 2OP9A 3SUFA 1BT7A 1O2ZA 1N8OB 4J2YB 3M3SA 1TRMA 1XKBC 5JPMH 4CBOA 1RRKA 1VGCC 3NWUA 2VH0A 5C1XA 2OC8A 4DG4A 4TYDA 1XUJA 3V3MA 4B76A 1AFEH 3ZVBA 4NSVA 3SI3H 3MH6A 1ZTJA 4KP0A 3SU6A 1ZSJA 2BTCE 2FDAA 2VIQA 3SGBE 1P04A 2WINI 4WWYA 5C20A 2ZGHA 3ATMA 5F8TA 3T2NA 4A92A 1SQTA 2BD4A 1JIRA 3LONA 1AGJA 4YT7H 2Y81A 1ELTA 2FESH 3QDZB 1A5IA 2RA0A 1DSUA 1YKTA 2BD7A 4CREA 4O3UA 1H9LB 3KL6A 2BY9X 3P8NA 4CRBA 1TGSZ 1T4VH 3T25A 2ANMH 2QN5T 1RGQA 3SV2H 1MUEB 4K1TA 6CHAC 1C2JA 1KXEA 2GP9B 2FWWA 1TB6H 4MPVA 2AMPA 1B0EA 3LOXA 1SMFE 2ZO3H 2SNVA 2BX4A 3A7WA 3RXUA 3RXPA 1GHVH 1UK2A 3RXGA 3QGJA 1O2PA 2FIRH 4Y6DA 3MTYA 2W3KA 1O0DH 1C2GA 5DPAA 2XCNA 3TLOA 1FONA 4A5TS 2ZHWH 3LGWA 3MO3A 2IN2A 4QT8C 3STIA 2KAIA 4HGCA 1NZQH 1ZMJA 4MVNA 9ESTA 2BVXH 3ZV8A 3NCLA 1YGCH 5EXLA 1NRNH 1HAPH 1Y3YA 5A09A 2QXJA 2A4RA 1ZHPA 4XOJA 1V2KT 1NT1A 1XUHA 2GD4B 1MTVA 3TK5A 4ZROA 5SGAE 1B7XB 3E0NB 1E37B 4YOIA 4ABFA 1OWHA 1UTQA 1YP9A 2VVUA 3SU2A 1S83A 3KIDU 1QL9A 3A7VA 1SGPE 3KN2A 1GCTC 4I8KA 2Z3DA 2BZ6H 1UVOA 2P3TB 1NU9A 1MZAA 3ZZ9A 1NROH 1O32A 3RMMH 5BRRE 4J1YA 4OGYA 2R3YA 2A5AA 3T62A 1FY8E 1PPHE 3E6PH 3U1IB 3E1XB 1FIWA 3QZQA 1SLVB 5EGMA 1O2HA 1H8DH 1EP6A 2ZZUH 2B5TB 4WH8A 4OS2A 1T8LA 3E3TA 3TH2H 2JH0D 1YCPH 1MBQA 4WMEA 3RUOA 4XBBA 3SUGA 3ZZDA 2HNTE 2JETB 5DJ7A 5EPYA 4ABBA 5FBEA 2WYGA 4AGKA 4VGCC 1YPHC 2QGRA 1SGRE 4OS6A 1WSSH 4OS1A 1CHOG 3L33A 2HPQH 3ZVAA 4O03A 4BTTB 4CRCA 5HM9A 1SGYE 1QFKH 1UCYH 2PUQH 1O2GH 3M7UA 3RC6A 1O33A 1F0RA 2Z6BD 4THNH 5ESTE 1K1LA 4ZUHA 8KME2 2A1DB 4OS4A 1P06A 4MNVA 1A46H 1YC0A 1TNJA 3SNEA 3M61U 4I7YH 1O3HA 3A7TA 2BD8A 1DS2E 1QJ6B 5L6NH 1J8AA 1ESTA 3A89A 1XMNB 2FYQA 1DX5M 2XBWA 4FU7A 1GBBA 4ISHH 4FUDA 4TPYA 3KQDA 4AB8A 1CBWB 2C93B 1QA0A 1O2JA 1UTJA 5E8EH 1BBRE 3OY6U 4WVPE 1WCZA 4FU8A 3EA8A 1IQEA 1C9TA 2GTBA 1SSXA 3M5MA 1S85A 1QBOA 2CF8H 2P8OC 3HPTB 1P0SH 1IOEA 1CHOF 1IAUA 3UQOA 3A88A 1K1PA 1J16A 4TY6A 3UWIA 1HJ9A 1GJ4H 1DY8A 3LGUA 2FX6A 2GZ7A 1O2VA 3S7HB 2Q6GA 2EA3A 1UTPA 4Y8XA 3UUZA 1AE5A 1DWEH 2UUYA 1FJSA 1ZOMA 3MO9A 4O9VA 5A0AE 3PLBA 1NESE 1IQFA 3A84A 1F0TA 1HPGA 2KAIB 2P95A 1EKBB 2FZZA 3UNRA 1E38B 3SZNA 1YBWA 1YYY1 4Q7ZA 3R3GB 4BAQB 1O5CB 4HTCH 1BCUH 5L30H 2PR3A 5J4SA 1QIXB 3E90B 2V35A 2W5EA 4IMQA 2BXUH 3RXJA 1FI8A 3BSQA 1Y5BT 1THSH 2HWLB 1O5BB 1WV7H 3A8DA 4ZKNU 4JYTA 1G3EA 4FUJA 4OGXA 3TVJB 4ZAEA 2RG3A 5IDKA 4ZHAA 3FVFB 3KNXA 1BTZA 3BTME 3NUMA 1ARBA 4MTBA 4Q2KA 2ZCKP 5EW2H 1O5DH 1OWJA 1HAGE 2ILNA 3EA9A 1C1MA 2TIOA 4IBLH 1MD8A 5LPRA 5LGOA 3EE0B 1ZPBA 1OP0A 3UOUA 3RXDA 4H42U 1F92A 3LIWA 3STJA 2FOHA 4ISNA 3SW2B 2ZFRH 2F91A 1ELFA 1CA0C 1PPBH 4K8YA 2BDIA 1G2LA 5EODA 1QBVH 1W0ZU 4IGDA 2Q6DA 2V3OH 3P6ZB 2HNTC 4YLQH 1EPTC 1FDPA 3VGCC 1N8OC 1SHYA 1TMTH 2BZAA 2ZTXA 4I8GA 2R0LA 1BRCE 4XDEA 3PMJA 3HKJB
chains in the Genus database with same CATH superfamily
2HPPH 1W0KD 5T6FA 2VJ1A 1SLUB 3ZZ3A 3LC3A 4K5ZA 4B73A 1ESAA 2C3SA 1SI5H 1P9SA 3DCLA 3DFJA 3ATWA 1A7SA 1OP2A 2A31A 3TJUA 1C5UA 1HXEH 1GHXH 1TAWA 1MTNB 3ZZ5A 1ANDA 3MU4A 1G2MA 2XTTB 4HI3A 1A0HB 1MTSA 3P92A 1AUJA 3LPRA 4AN7A 1DUEA 3SNCA 2F9BH 3AASA 3GY2A 2FOMB 3RU4T 4AGJA 2B9LA 1EASA 1K2I1 1OP8A 3QTOH 3ODFA 2J9NA 4X8VH 1UVPA 2A5KA 3ODDA 3D62A 1ABJH 5L2ZH 1W2KH 3PMHB 1GJ8B 2J34A 2NU4E 1VCPA 1LPGB 2Y5FA 4B2AA 2R2WU 3LGYA 4LOYH 2ZQ1A 1Z8RA 1C5VA 1NRRH 1S6FA 1XUIA 2KR7A 2BY7X 2GKVE 2SGEE 3GCTG 4MQAA 4OS7A 4FU9A 2CV3A 3SU4A 3SNBA 1V2QT 3RXEA 1Y3VA 4FUGA 1B5GH 2W6JD 3UR6A 4CRFA 2Z9IA 2ZFFH 2D26C 1CE5A 3W94A 2A4QA 5CHBA 1IHTH 2J98A 3EGKH 5EXMA 1ARCA 4YLUA 4ABDA 1NTPA 1Y3WA 2G81E 3EDXB 1ANEA 3TJOA 3PO1B 1P10A 5JBBS 2AFQB 7ESTE 2NU1E 1A3BH 1TNLA 2ZDMA 4Q63A 3U1JB 1GI3A 1BHXB 4MPWA 2ALVA 1JRTA 1GMDG 1ZSLA 2IJOB 2ZU2A 1CGIE 5HIZA 1ZR0A 2A5IA 1ETRH 4X8SH 4JYUH 2H5DA 1O3AA 1EAIA 1FPCH 1C5TA 1AI8H 2AIPA 3BTFE 4AG2A 5LPEA 2SFAA 1TX6A 3KYGA 1H8HD 3BTGE 3QLPH 1O3JA 2A0QB 2VGCC 1LCYA 3AW1A 1CT4E 2CHAB 1TOCB 1QURH 3F2FA 4VGCB 3GISB 3RDZA 2J4IA 2BVRH 1UTMA 1GJ6A 1HRTH 2OCVB 2RA3A 3K9XB 3GCHC 3KHVA 3P8FA 5FPSA 1GL1A 1P2KA 2GCHF 3V13A 5JBTA 1H8IH 1MQ6A 3OTJE 1BTXA 3DA9B 3TJVA 4CHAB 1EPTA 1GG6B 3BTEE 3NK8A 1C2FA 3SO3A 4IS5A 4BANB 1GBIA 3F68H 4CRDA 3ZVGA 1EATA 4TY7A 2VWLA 1XUFA 1UHBB 2A2XH 3PYHA 2Y82A 1X7AC 2CHAC 1EFRD 3KQEA 2VWMA 2Z3CA 1LHFH 3MH7A 3TGKE 2LELA 5GPIB 2PTNA 1GMCG 1GMCF 1ZMNA 1AIXH 1DVAH 2J97A 2AGEX 5GWZA 1E1RD 1PQ8A 4DVAU 3S7KB 1GBHA 2G5NA 3KQBA 2R0KA 3GICB 3F0PA 1QBNA 1BA8B 1BMAA 2CN0H 2NU2E 4YXWD 3GOVB 1HAVA 1DITH 1NBME 2GZ9A 3KQCA 4HFPB 2YMSD 4INHA 1MAXA 2YNAA 4RKOB 3VB7A 1V2NT 1FZZA 3SHCH 3H7TA 2XWBI 2ZPRA 4YOJA 2W7SA 1OOKB 1PPFE 4JMYA 1YLDA 4MNWA 3MU1A 1ZPZA 1G37A 1Y8TA 4TWWA 5C94A 1MBMA 1NN6A 2STBE 2TGPZ 2VVVA 1ZJKA 1C1PA 1QGFA 1TNKA 1AN1E 1GBTA 3ATKA 2TPIZ 5FL7D 5T3HA 4B2CA 1O2TA 1O3PB 3UQVA 1O38A 4UE7H 1AB9C 1P01A 1V2TT 2WZQA 4Y7AA 4GCHG 5DP4A 3FOAA 1SLXB 1WYKA 3SV8A 3V7TA 1GMDF 1LHCH 5GCHF 3L6PA 2BQ7B 2W26A 3BN9A 4PROA 5E0GA 1E1QD 1VCWA 3Q76A 1YPJH 5CDFE 3PROA 2WYJA 1GI2A 1SGQE 1G3BA 4KELA 3TGJE 1RTLA 4TWYA 1CGHA 3K65B 4BAKB 3ZZ8A 2J2UA 4AFUA 1BTPA 2Y80A 4TPIZ 1QQUA 1TGNA 2JIZD 4XD7D 2ZHFH 1Z1IA 4X0WU 1VKYA 1LPKB 3O8BA 2HNTF 2BHGA 4GHQA 1DXPA 1GI7B 4AG1A 2OC1A 1C1OA 1FN6A 4MLFB 2ZF0H 1LHGH 1K1NA 5H4IB 2F9VA 1QL8A 1FAXA 2TGDA 2XW9A 1QQ4A 2SGFE 2XYAA 3HK3B 1KLJH 3GCTF 4GSOA 1O2SA 2ZU1A 5J4QA 1DLKB 1TX8A 1O3NA 1TRYA 3KF2A 4HG6A 5C5OA 2BDCA 2GDDA 1BTUA 1Q3XA 1E0FD 6GCHF 1O3CA 1TNHA 3F2GA 1C9PA 3UY9A 5EXNA 1NFUA 5G4BA 1IQHA 3BTHE 1SPJA 3EQ0H 3GYLB 3CENA 2XBVA 2SGAA 3L3TA 1TIOA 1D4PB 2BLQA 4ZXYH 1UJ1A 4NFFA 1F2SE 4AFSA 5CHAB 1GBFA 2BQ6B 3LC5A 1AWFH 3ZZAA 1LTOA 1BMNH 1TBRH 2VINA 2PLXA 4FUEA 4UFFH 4DIIH 5C1YA 5A2MH 4Y8ZA 1LO6A 2F9OA 3SU1A 2OC7A 1W0JD 1DLEA 2CJIA 5KEDA 2ZGBH 3A87A 1EQ9A 1HXFH 2BLVA 2B0FA 1GL0E 1NRPH 1JBUH 1T31A 2H5CA 3GY8A 4I8HA 3DSOA 7GCHF 3UFAA 1JWTA 2ZG0H 1PJPA 3PMAB 2ASUB 2H9HA 1PPZA 1K9OE 1GI6A 4GAWA 1GMHF 1SFIA 4AFZA 2PSYA 2XCFA 5EG4A 4NIWA 2ZGJA 5HYOA 1S6HA 1C2IA 1QB1A 4JZDH 1AVGH 1G30B 4WF8A 2WSSD 3A80A 3BV9B 1IQNA 1O2OA 5JBAS 1UCYE 3AK5A 3DSPA 4OM9A 2BM2A 3GCOA 1C2MA 2GVFA 4UFEH 3SORA 1EJAA 1K22H 5C3NA 1UVUH 1K1OA 2ANKH 1UTKA 1P2QA 1IQKA 5F8ZA 2Y5HA 2BDYA 2FOAA 1KDQB 2F43B 1ELGA 4Y11E 1GI4A 2W3IA 1LQDB 2THFB 2W6ID 2BYAX 4MG3A 3U9AH 1EZSC 4RT0A 1O37A 2FLRH 2A7CA 3PLPA 1DE7H 1C5LH 4JK6A 1BRUP 2QXIA 2O9QA 2I6QA 1KXFA 3VPKA 3N7EA 1D6WA 2FO9A 1F0SA 1C5XB 1SVPA 1RFNA 3OE7D 4ABAA 1GCTB 4AORA 2OTVA 3H09A 5GIBA 3M3VA 1W10U 3VXEH 3Q3KA 2P8OB 3O8RA 4I33A 1K28D 3M5LA 1BJUA 3DHKH 3GDUA 3VEQB 3A7ZA 5AHGH 2Z7FE 1TNIA 4Q7YA 4ZHMU 1S5SA 1TALA 2UUKB 1O3BA 1PPGE 3D23A 1TGTA 3LKWA 4ZKSU 1K1MA 3F9FA 1GPZA 3N99A 3OEED 2V6NA 1O3MA 1O5FH 1DY9A 4D8NA 2R3UA 1XXFA 2GDEH 2Q6FA 2PUXB 1NBMD 1V2OT 4JZ1A 1UVTH 4WY3A 1HCGA 1EZXC 3NZIA 3MYWA 1HJ8A 1NRSH 2AEIH 5EQSA 3BTTE 1F5LA 3U8OH 4K3JA 2J98B 4Q4LA 1ZGIA 5AVDA 4DIHH 1TQ7B 3PV4A 3RU4D 2BDGA 1GHWH 2P94A 4UFGH 2C8YB 3VXFH 2ZWLH 1LKAA 3SQHE 3GY7A 3SZEA 1S81A 4WH6A 1TFXA 2BX3A 4ZKOU 2ZDVH 2G5VA 4NIXA 4MNXA 2XWAA 3OU0A 2Y7XA 2BLOA 3QTVH 2OD3B 3K6YA 2H9EH 1JRSA 4RKJB 1YPGH 2H9TH 2O8UA 1C1UH 4X1NU 1GHYH 5TCCA 1ORFA 4B2BA 4CRGA 2OQ5A 2UWLA 4M7GA 3SJIA 5JDUB 1ZTKA 1PQ7A 3BEUA 4WMDA 4X2YA 3U8TH 4DOQA 1Z1JA 3RXTA 4R0IA 4MNYA 3LT3A 1C1NA 4Y0YE 1QRWA 1O2QA 2OBQA 2G00A 3LU9B 1GBKA 2OINA 3Q77A 1BDAA 1WBGB 1UMAH 2B7DH 2M2AA 4IMZA 5C1UA 2J92A 4UEHH 4ABGA 4ZCNA 3CS7A 3OYPA 5HGGA 3GY5A 2ODQA 2O8WA 1Q31A 4U01A 2C4FH 4HZHA 2QYIA 3TU7H 2ODPA 4K69A 4KTSA 3M5NA 1FY3A 3NXPA 4I8LA 1AZ8A 3N7OA 4INLA 1GMHG 3C1KA 3M36A 1AMHA 2KM0A 2B8OH 3PMBB 1GI0A 4LZ4B 1MKWK 3GS9A 2AGGX 1KSNA 4O97A 1DFPA 3PLKA 2FS9A 2ZFQH 2XOKD 2ZQ2A 3GCHB 4ABJA 2LP6A 3MI4A 4WXVA 2G52A 1ZYOA 4B75A 4Y8YA 2FP7B 1UCYK 2WPHS 5GNDA 1C5OH 1JOUB 1V6DA 4WJG2 1AVWA 5EQRA 3M3TA 2PHBA 2QV1A 4GUXA 3M7TA 1SKYE 1ZRBA 5K0HA 2P59A 2QF0A 1KDQA 2J5UA 1O3OA 1QJ1B 4ISLA 4ABIA 1ELVA 1AB9B 3S9BA 2HGTH 3LDXH 1OX1A 1P12E 5HIYA 3DD2H 3FP7E 1HIAB 5DO4H 4ABHA 2P3FH 1BMMH 3K2UA 3PWCA 3DT0H 4AB9A 1O5EH 5FHTA 1QB6A 3RMNH 3IG6B 3AW0A 3BG4C 1D3QB 1O5AB 5IYTA 3VG8A 4CBNA 3S69A 1EAXA 3E8LA 1OWEA 3BF6H 4K2YA 2TGTA 5FPYA 5FBIA 1Y5UT 4AFQA 1V2PT 2V7QD 1P2OA 6ESTA 1U6QA 5FX5A 2XNDD 3GY3A 1YPKH 1Z71A 2CF9H 5HM2A 4A1XA 4XBCA 5GDSH 1GJDB 3D49H 3F9GA 3UTUH 6CHAB 1IQJA 1TWXB 2PKSB 1LMWB 3EYDA 1MQ5A 1CGJE 3GYMA 3RXIA 3SJ9A 1HAXB 3FP6E 3RM0H 1GBCA 1UK3A 1TA6A 1XM1A 4AX9H 4NWLA 4Z6AH 2CMYA 2ZKSA 2KFWA 3QUMP 2P3UB 4FXGH 1O34A 4X8UH 1HV7A 1UO6A 4FUIA 1S82A 1QY6A 2PWXA 4ACAA 1AVXA 1G36A 4O3TA 3FAOA 3TJNA 1GJ5H 3QO6A 1FIZA 4H6SB 4YOGA 1LVBA 3O8DA 1ANCA 3RMOH 1ACBE 3SJ8A 1NS3A 3UREA 4BAOB 1C5PA 3S0NA 3SUEA 3VB4A 5EJLA 2AIQA 1G32B 4YM9A 5E0HA 4Y10E 4JZEH 1OWIA 1O3DA 4WXIA 1KXDA 1P57B 1BQYA 1TYNA 5I25A 2WV4A 4FUCA 3S9CA 4X2XA 1QRXA 2ZA5A 3GY4A 1C1QA 2GCTC 5DP6A 4NA8A 4E7NA 1E34B 1J14A 3FKSD 8LPRA 1HJAB 2ESTE 2K8IA 1UTNA 3A82A 2VGCB 2L6OA 3ITIA 3VB5A 2ALPA 4K60A 2AERH 2CGAA 2G4UA 5FCRA 2PW8H 5F03A 3A8CA 1XXDA 3DSGA 1DPOA 2BD9A 2XRCA 1D3TB 1AE8H 1GI1A 1L4ZA 2FM2A 1SGFA 2FOCA 1JMOH 3LGIA 3OX7U 1GG6C 1C1SA 3BG4B 3T27A 4FUHA 1BBRH 1HLTH 4E06H 1DWBH 5DKMA 4INKA 1EUFA 1HBTH 1QHRB 1GGDC 2FI5E 1HAZB 4BTIB 2VIDA 2K1QA 1GI8B 1WQVH 2SNWA 1H9HE 3P95A 3TGIE 2RDLA 2JKHA 1MH0A 2BY6X 4Q7XA 1VGCB 3F9EA 4D7FA 4ZH8A 3U8RH 1Z8JB 1SGTA 3F9HA 2FOEA 4RI0A 1WTHD 1BZXE 2OXSA 1BB0B 1GVZA 5A0CA 2GCHG 4R8TB 4SGAE 1AQ7A 3NKKA 3LH3A 3RC4A 5LH8A 4XBDA 3FO8D 2YOLA 3LGTA 1A3EH 2ZP0H 1O2XA 3SI4H 1UVSH 1TMUH 1D9IA 2ZDLA 4RSPA 1L1NA 2W7UA 3AAVA 5EU8A 4NG9H 3SGQE 2V0BA 3OY5U 1TPSA 3OEHD 3RXHA 6LPRA 2C90B 2ANWA 1O2RA 2C8ZB 3HKIB 4MPUA 1B0FA 2ZPQA 1E35B 1A0LA 3DUXH 2Y6TA 4OS5A 3C27B 1O3GA 3T29A 4BAMB 2F3CE 4F49A 1ETSH 2EI7A 1PPEE 1DOJA 4MDSA 4D7GA 1IQMA 3SGAE 1T8OA 3RP2A 1C1RA 2SGDE 1CSOE 3A7YA 2EI8A 1JXPA 2WPLS 1T8NA 2OC0A 1C5NH 1DT2A 1P8VC 1SFQB 2FLBH 4ABEA 4TT3D 1C4V2 3UOPA 1DICA 2FTMA 4H6TA 1PYTD 1GI5A 1BOQA 2H6MA 3Q3XA 5EJZA 2SGPE 1P2IA 2PGBB 2DE8A 3PV5A 5DP8A 2J95A 1YPLH 3SJKA 3SU0A 1C5QA 4CR9A 4B6FA 1GWAA 3RU4E 4DGJA 1HIAA 4ASUD 2UUFB 4NWKA 3V0XA 4AZ2B 1IHSH 2EC9H 2KCPA 2BMGB 2BD3A 1GGDB 1AZZA 3RXCA 4ESTE 2JDID 3MO6A 3SNDA 3A8BA 1SGFG 3BIUH 3B23B 5DP3A 4CHAC 2O8MA 4ASHA 1SB1H 5F8XA 1P03A 1P02A 2BY5X 1SGNE 1TE0A 3UB0A 2HALA 1J15A 2R9PA 3P70B 1BTYA 3EE7A 3SOSA 1S0RA 1NPMA 2EY4C 3OFND 1O35A 1ZLRA 4X8TH 2CK3D 1SG8B 1NFXA 4FUFA 4I32A 1A5HA 1NM6A 1SC8U 1SQAA 2ZEBA 3FZZA 4UFDH 3BIVH 1AKSB 5DK1A 1BITA 2ULLA 2ZCLP 3LH1A 4IN2A 2FYRA 3ZZBA 2GCTB 3OSYA 2BY8X 1BRBE 1HAHH 2WPJS 4JCNA 5B6LA 4DY7B 3F1SB 5JB9S 3E0PB 3ZIAD 3W1EA 1KTSB 2VH6A 1RD3B 3ZVFA 3MWIU 1CA0B 1GBEA 4KTUA 2JETC 2J94A 1OHHD 2HRVA 4B74A 1MMJN 1HDTH 2OLGA 2ZCHP 3UNQA 3H7OA 1GDUA 1N6YA 1Z8GA 4BOHA 3VB6A 1GBMA 2VWNA 2GZ8A 1UTOA 1HYLA 1CVWH 1C2EA 5E0JA 4K8BA 2WUCA 1GDQA 1XUKA 2EEKA 1GBDA 3BEIB 3QZRA 3UWJH 3MH4A 4D9RA 1WUNH 4E7RG 3A8AA 2JH6D 1C5WB 1A5GH 1YF4A 1K1IA 2BD2A 2ZDAH 2QXHA 1GJBB 1O2UA 2PV9B 1QA7A 2QF3A 1J17T 5AFYH 2AH4X 4X6OA 3RXVA 2WPIS 3BTWE 5JYIA 2BDAA 1BTHH 1HUTH 1DANH 4U32A 1RIWC 1A2CH 1O2NA 1SGCA 2KX4A 3IWMA 2ZI2H 3O8CA 3SHAH 4GPGA 1ABIH 2ZNKH 2WPKS 5T6DA 2C8WB 1KLTA 1Z6JH 4X6NA 2UWPA 2XNIA 2QCYA 1CBWC 1KXCA 2ZDNA 1ELAA 2D1JA 8GCHG 5B6OA 5KGOA 3RXLA 1A4WH 3OAAD 2AS9A 3H5CB 3F3BA 1CA8B 4Y0ZE 1FX0B 2KZ4A 3VB3A 2OBOA 2F83A 4JYVH 1V2ST 2GJGA 1W13U 4NCYA 1MAYA 4LK4A 3VFEA 1TMBH 1KY9A 2G4TA 4A1TA 2FOFA 2F9UA 1WTGH 3MOCA 2A32A 3FZDA 1VITH 2ZC9H 3QN7A 1FMGA 5DG6A 3PTBA 3QK1A 1V2VT 1GCDA 5DGJA 1LVOA 5FCKA 2Z9KA 1O2IA 1XVMA 3I77A 1YPEH 3ENSB 1SHHB 4A1VA 3V12A 2TBSA 2PP6A 1C5YB 3PWBA 1ANBA 5IK2D 1Y59T 2BLWA 1C2KA 1LVMA 1OWKA 3HGNA 4AC9A 1TNGA 1TPPA 1D3PB 3M35A 4IN1A 1OSSA 4F55A 4Y7BA 1O39A 1O30A 1WXRA 1BMLA 3E16B 2ZPSA 1AFQB 4WMFA 1NC6A 4ZKRU 5CE1A 2P16A 2GT8A 1CHGA 3T5FH 4NFEA 2ZGCA 5LPFA 1KXAA 2WPDD 5HMAA 1CT0E 1BJVA 2STAE 1T4UH 1WOFA 1NU7B 2VU8E 2K0QA 1SGDE 5T6GA 3KEEA 2TRMA 2LNCA 3M7QA 3BTKE 2FMJA 2BOHB 3RXQA 4BXWA 1SOZA 3MNCA 1QB9A 1MU6B 4B71A 1W0YH 1AY6H 4X1PU 2XC5A 5C17A 2GMTC 1VZQH 1JIMA 1SR5C 2FX4A 2GV7A 1CO7E 2ZGXH 1XKAC 1QZ8A 1Z7KA 1ZRKA 1EB2A 1GHBG 1M9UA 1RS0A 7KMEH 3FANA 4NSYA 2BVSH 1GJAB 2FPZA 5EW1H 1EOJA 4AYYB 4KKDA 3KCGH 5AF9H 2ZFSA 1LDTT 3QX5H 4BXSA 1XX9A 5C5NA 3UNSA 2O8TA 2QC2A 3MH5A 1DWCH 1C5RA 1P05A 3ZVCA 1DDJA 2WV5A 2VIOA 4LXBH 4FVBA 1EJMA 4NIYA 2GMTB 1LPZB 1TBQH 2EQNA 2Z9LA 3I78A 3ZZ4A 2QY0B 3EA7A 3EAJA 3Q00A 1TGCA 1O3EA 2LPRA 2Z9GA 1L2EA 3A7XA 1TX7A 2OUAA 1PQAA 4ZHLU 2DE9A 4IW4E 1C5SA 1C5MD 3SNAA 3T26A 1WQSA 2OQUA 1SBWA 4B1TA 1A61H 3GCNA 1IQIA 1VITG 1O2MA 5EIYA 2BB4A 3SU3A 4UDWH 1UHBA 3ATIA 3HGPA 1MZDA 2I6SA 5C0TA 3RLWH 3A81A 5C67A 1N6XA 1Y5AT 2ZHEH 1FV9A 1OPHB 1F0UA 1O3IA 3MNXA 1EZUC 4E05H 1MCTA 4IC6A 3URCA 1PYTC 1W14U 3JZ2B 1C4Y2 5EOKA 2DUCA 1FY1A 4UD9H 3PTNA 4DURA 2V3MA 3WWFA 1GJ7B 2WHXA 1FN8A 3SUDA 4CH8B 1EAUA 4LZ1H 4A6LA 3BEFB 3CP7A 1C5ZB 5FX6A 4H4FA 3RXOA 1YCPK 2BXTH 2TGAA 3TK6A 3P8GA 3U98H 5JB8S 2ANYA 1DSTA 2YNBA 3W95A 4X6PA 1GJ9B 3I29A 3SBKA 1AU8A 1TA2A 1AHTH 2A7HA 1RJXB 2UUJB 1PPCE 3HK6B 1EB1H 4YZUA 4XE4A 1EOLA 1G3CA 2AMQA 2BOKA 5A0BA 1V2LT 3TH4H 2ZU5A 1MKWH 1BHXF 1PFXC 3SV9A 1FAKH 4Y71A 1VITF 1TPOA 1O2WA 1FQ3A 4JK5A 1GDNA 3URDA 5L2YH 4A7IB 1KMHB 2ODYB 3MU8A 2ZU4A 2FXRA 4DT4A 1E79D 4NA7A 1HAVB 4NZLA 4D76A 5F6MA 5CMXH 1SLWB 3TIUA 3P17H 1RXPA 2BDBA 1SGEE 3MFJA 5PTPA 3A83A 1SOTA 1VCQA 3OTPA 2VVCA 1GI9B 1G3DA 5FPTA 4ZXXH 3T28A 2KCOA 4Z0KA 2AMDA 4X1SU 1CT2E 2XBXA 1AO5A 1ZMLA 1FXYA 3IITA 1EZQA 2VNTA 2VIPA 3MMGA 1HAYB 3TPIZ 1MTUA 1OS8A 1QR3E 3F2HA 4BNRA 1GHBF 2Z94A 1FLEE 5DP7A 1O31A 1ZHRA 2QE7D 4JZFH 3AAUA 3RC5A 2A45B 1ELDE 1GHZA 3SV6A 4I8JA 3UIRA 1AUTC 5I46H 1P11E 2GV6A 3PRDA 1BUIA 3NPSA 2IOTA 1CQQA 2GT7A 5TCAA 1HAIH 2A4GA 2ZU3A 5EQQA 1BIOA 1MTNC 1ESBA 4RT1A 2D2DA 2UWOA 2BDHA 1QRZA 1TABE 1FNIA 3U69H 1O2KA 2XC0A 3D65E 1K21H 4YESB 1HFDA 2VIWA 1RIWB 3MNBA 3FN8A 5CHAC 2HLDD 5BPEA 2PKAA 1KIGH 5EJ1A 5K7RA 2GX4A 1C2DA 1WDIA 1ZGVA 1BTWA 3R0FA 2AYWA 2Y5GA 2FI4E 3ZYEA 1AKSA 8GCHF 3RXBA 5DSFA 1P09A 4M9FA 5JBCS 1YPMH 2BD5A 1YLNA 1Y3UA 3RXRA 1O2LA 4KTCA 2VIVA 3KQ5A 1NFYA 2A2QH 2F4LA 1UTLM 3BG8A 2PKAB 2R2MB 1O5GH 3NRLA 5ESBA 3RXKA 1WU1A 1DWDH 3MHWU 5T1VA 1EX3A 3UR9A 4AYVB 2Z9JA 2ZIQH 4JZIA 5C2ZA 2ZFPH 4FOUC 1L1JA 1AFQC 4IC5A 1O3KA 4GLYA 2PSXA 2SGQE 3MQKC 1P3CA 1HNEE 2ZTYA 2PGQB 3PRBA 4ISIH 3SU5A 3ZVDA 3HATH 1NFWA 1YM0A 3ZZCA 1KLIH 2C8XB 3LJOA 1FY4A 4NZQA 4RN6A 3WWBA 3E91A 1UW7A 1ETTH 4X6MA 5A8ZA 1NY22 3LJJA 2ZECA 1MU8B 2KCYA 7GCHG 2ZFTA 1P9UA 1QL7A 1NRQH 1QTFA 1HGTH 1EP5A 3AVZA 3QWCH 1VJAU 3QGNB 1O3FA 3GDSA 1D6RA 3CS0A 3TITA 1V2MT 1V2JT 1BMFD 6GCHG 4ZMAH 1KTTB 1Z6EA 9LPRA 2CXVA 2H1UA 1TOMH 1Q2WA 1LKBA 2D8WA 1V2WT 4I31A 1SQOA 3ESTA 2FTLE 3ATLA 3SJOA 3ZYDA 4DT7B 5FAHA 3ELAH 1ID5H 1O3LA 1W3CA 4NA9H 3B9FH 2ZTZA 2WV9A 3G01A 4UONA 1G9IE 3DFLA 3RLYH 1L4DA 3SQEE 1GBLA 4SGBE 2Z3EA 4KGAA 4DCDA 1GVKB 1GHAF 1YWUA 2FODA 1BRAA 3ZV9A 1P2MA 1ZJDA 5DP9A 1GJCB 1PQ5A 1EAWA 1W7GH 3JZ1B 2PFEA 2G8TA 3P8OA 5GCHG 1VJ9U 1THPB 2ZHQH 1ELBA 1E36B 5GXPA 1ELCA 1C2HA 1XVOA 2HOBA 1TPAE 4CH2B 1T32A 4Y79A 3TNSA 2V3HH 1ZTLA 4K1SA 1LHEH 1ZZZA 1ZHMA 1O2YA 1H4WA 3B8JA 5ABWA 1K1JA 1P3EA 2FI3E 3KYFA 3ZVEA 2WPMS 4TSFD 2XXLA 1HAOH 1DXWA 2P93A 2A7JA 1GVLA 3RXMA 1OYTH 2ZDKA 1C1WH 1D3DB 4X2VA 1FY5A 3S9AA 5E2PA 1MKXK 3RM2H 3LGVA 4GCHF 3RXSA 4X1QU 2QF5A 1OYQA 2HLCA 3K6ZA 1WAYB 2HVXA 1ELEE 3RXAA 3M5OA 3TK9A 3ZZ7A 1IQLA 1QNJA 3PM3A 3FFGA 4NIVA 3WY8A 1OWDA 1TRNA 4Q80A 4X2WA 1K0HA 1A0JA 1YLCA 3SV7A 1OXGA 3MU0A 4K1EA 1H1BA 1UK4A 5FXLA 2Q1JA 2A4OA 1F7ZA 3FP8E 5TJXA 3CNRA 1BBRK 1EXFA 2JJ2D 1VR1H 1MKXH 1MD7A 8ESTE 1ZSKA 5HXFA 3PB1E 4BAHB 1RTKA 2XBYA 2FOBA 1GHAG 1MTWA 3RMLH 1NO9H 2RCEA 4F48B 4YTAA 2FEQH 3F6UH 7LPRA 1V2UT 1DUAA 5DP5A 3TNTA 1AD8H 2GGVB 1TGBA 2FOGA 3RXFA 1TBZH 2Y7ZA 1GBAA 3PO1C 4AOQA 1TONA 3SN8A 5A8YA 2QIQA 1S84A 2QXGA 1HB0B 2VB0A 2J38A 1Y3XA 3TH3H 2G51A 1A1RA 1TQ0B 1MCVA 2ZHDA 2F9NA 4CR5A 1TLDA 1S0QA 1O36A 1T7CA 5EPNA 4YT6H 4GVUA 2IPHA 1AWHB 1QJ7B 2NWNA 2JH5D 2VWOA 1F5RA 2QAAA 4Y76A 3UPEA 1CU1A 1XUGA 1FUJA 1EPTB 1LVYA 3VGCB 4CRAA 1F5KU 1LHDH 1LQEA 5ETXA 3A86A 4DW2U 4F4OC 1W7XH 1N1LA 2XC4A 1H9IE 3ZZ6A 2G55A 1P2NA 1SL3A 4MPXA 5GJ4B 1W12U 1W8BH 1OKXA 1L0ZA 4BTUB 1T8MA 1C4U2 1GBJA 2NU0E 1YCPM 4D9QA 4ISOA 4X1RU 4XFQA 4NGAH 3SYJA 1Z8IB 1KYNA 4FUBA 2FS8A 3BTDE 1C1VH 1DM4B 3MU5A 3A85A 1V3XA 2IPQX 4DJZB 2PTCE 1THRH 2AGIX 4U30A 4XSKU 1EJNA 3M37A 1J9CH 2BQWB 4U2WA 4YO9A 2H2ZA 1QCPA 1INCA 2JJ1D 4GHTA 3GDVA 1RTFB 3GY6A 2EI6A 1IQGA 2F9PA 1HJAC 1L1GA 1KXBA 1C2LA 2QA9E 4FETA 3BTQE 3MNSA 2O8LA 1ZPCA 3Q3YA 1C1TA 4FVDA 1P2JA 2PKSC 1SGIB 5AFZH 3KGPA 2WUBA 1V2RT 2NU3E 5E2OA 5A8XA 1W11U 1FPHH 1YPHE 2M5TA 2OP9A 3SUFA 1BT7A 1O2ZA 1N8OB 4J2YB 3M3SA 1TRMA 1XKBC 5JPMH 4CBOA 1RRKA 1VGCC 3NWUA 2VH0A 5C1XA 2OC8A 4DG4A 4TYDA 2AHME 1XUJA 3V3MA 4B76A 1AFEH 3ZVBA 4NSVA 3SI3H 3MH6A 1ZTJA 4KP0A 3SU6A 1ZSJA 2BTCE 2FDAA 2VIQA 3SGBE 1P04A 2WINI 4WWYA 5C20A 2ZGHA 3ATMA 5F8TA 3T2NA 4A92A 1SQTA 2BD4A 1JIRA 3LONA 1AGJA 4YT7H 2Y81A 1ELTA 1H8ED 2FESH 3QDZB 1A5IA 2RA0A 1DSUA 1YKTA 2BD7A 4CREA 4O3UA 1H9LB 3KL6A 2BY9X 3P8NA 4CRBA 1TGSZ 1T4VH 3T25A 2ANMH 4Z1MD 2QN5T 1RGQA 3SV2H 1COWD 5DN6D 1MUEB 4K1TA 6CHAC 4XRNA 1C2JA 1KXEA 2GP9B 2FWWA 1TB6H 4MPVA 2AMPA 1B0EA 3LOXA 1SMFE 4P02A 2ZO3H 2SNVA 2BX4A 3A7WA 3RXUA 3RXPA 1GHVH 1UK2A 3RXGA 3QGJA 1S6LA 1O2PA 2FIRH 4Y6DA 3MTYA 2W3KA 1O0DH 1C2GA 5DPAA 2XCNA 3TLOA 1FONA 4A5TS 2ZHWH 3LGWA 3MO3A 2IN2A 4QT8C 3STIA 2KAIA 4HGCA 1NZQH 1ZMJA 4MVNA 9ESTA 2BVXH 3ZV8A 3NCLA 1YGCH 5EXLA 1NRNH 1YY3A 1HAPH 1Y3YA 5A09A 3UAIC 2QXJA 2A4RA 2HVYB 1ZHPA 4XOJA 1V2KT 1NT1A 1XUHA 2GD4B 1MTVA 3TK5A 4ZROA 5SGAE 1B7XB 3E0NB 1E37B 4YOIA 4ABFA 1OWHA 1UTQA 1YP9A 2VVUA 3WW7A 3SU2A 1S83A 3KIDU 1QL9A 3A7VA 1SGPE 3KN2A 1GCTC 4I8KA 2Z3DA 2BZ6H 1UVOA 2P3TB 1NU9A 1MZAA 3ZZ9A 1NROH 1O32A 3RMMH 5BRRE 4J1YA 4OGYA 2R3YA 2A5AA 3T62A 1FY8E 1PPHE 3E6PH 3U1IB 3E1XB 1FIWA 3QZQA 1SLVB 2RFKC 5EGMA 2OK5A 1O2HA 1H8DH 1EP6A 2ZZUH 2B5TB 4WH8A 4OS2A 1T8LA 3E3TA 3TH2H 2JH0D 1YCPH 1MBQA 4WMEA 3RUOA 4I86A 4XBBA 3SUGA 3ZZDA 2HNTE 2JETB 5DJ7A 5EPYA 4ABBA 5FBEA 2WYGA 4AGKA 4VGCC 1YPHC 2QGRA 1SGRE 4OS6A 1WSSH 4OS1A 1CHOG 3L33A 2HPQH 3ZVAA 4O03A 4BTTB 4CRCA 5HM9A 1SGYE 1QFKH 1UCYH 2PUQH 1O2GH 3M7UA 3RC6A 1O33A 1F0RA 2Z6BD 4THNH 5ESTE 1K1LA 4ZUHA 8KME2 2A1DB 4OS4A 1P06A 4B6EA 4MNVA 1A46H 1YC0A 1TNJA 3N7DA 1SQRA 3SNEA 3M61U 4I7YH 1O3HA 3A7TA 2BD8A 1DS2E 1QJ6B 5L6NH 1J8AA 1ESTA 3A89A 1XMNB 2FYQA 1DX5M 2KCAA 2XBWA 4FU7A 1GBBA 4ISHH 4FUDA 2QF4A 4TPYA 3KQDA 4AB8A 1CBWB 2C93B 1QA0A 1O2JA 1UTJA 5E8EH 1BBRE 3OY6U 4WVPE 1WCZA 4FU8A 3EA8A 1IQEA 1C9TA 2GTBA 1SSXA 3M5MA 1MABB 1S85A 1QBOA 2CF8H 2P8OC 3HPTB 1P0SH 3PV2A 1IOEA 1CHOF 1IAUA 3UQOA 4ACBA 3A88A 3U28C 1K1PA 1J16A 4TY6A 3UWIA 1HJ9A 1GJ4H 1DY8A 3LGUA 2FX6A 2GZ7A 1O2VA 3S7HB 2Q6GA 2EA3A 1UTPA 4Y8XA 3UUZA 5C0UA 1AE5A 1DWEH 2UUYA 3F0OA 1FJSA 1ZOMA 3MO9A 4O9VA 5A0AE 2VBCA 3PLBA 1NESE 1IQFA 3A84A 1F0TA 1HPGA 2KAIB 2P95A 1EKBB 2FZZA 3UNRA 1E38B 3SZNA 1YBWA 1YYY1 4Q7ZA 3R3GB 4BAQB 1O5CB 4HTCH 1BCUH 5L30H 2PR3A 5J4SA 1QIXB 3E90B 2V35A 2W5EA 4IMQA 2BXUH 3RXJA 1FI8A 3BSQA 1Y5BT 5HKKD 5KECA 1THSH 2HWLB 1O5BB 1WV7H 3A8DA 4ZKNU 4JYTA 1G3EA 4FUJA 2RDEA 4OGXA 3TVJB 4ZAEA 2RG3A 5IDKA 4ZHAA 3FVFB 3KNXA 1BTZA 3BTME 3NUMA 1ARBA 4MTBA 4Q2KA 2ZCKP 5EW2H 1O5DH 1OWJA 1HAGE 2ILNA 3EA9A 1C1MA 2TIOA 4IBLH 1MD8A 5LPRA 2YMSB 5LGOA 3EE0B 1ZPBA 1OP0A 3UOUA 3RXDA 4H42U 1F92A 3LIWA 3STJA 2FOHA 2L74A 4ISNA 3SW2B 2ZFRH 2F91A 2IJD1 1ELFA 1CA0C 1PPBH 4K8YA 2BDIA 1G2LA 5EODA 1QBVH 1W0ZU 4IGDA 2Q6DA 2V3OH 3P6ZB 2HNTC 4YLQH 1EPTC 1FDPA 3VGCC 1N8OC 1SHYA 1TMTH 2BZAA 2ZTXA 4I8GA 4P00A 2R0LA 1BRCE 4XDEA 2YMSC 3PMJA 3HKJB 5F53A
chains in the Genus database with same CATH topology
2HPPH 5T6FA 2VJ1A 1SLUB 3ZZ3A 3LC3A 4K5ZA 4B73A 1ESAA 2C3SA 1SI5H 1P9SA 3DFJA 3ATWA 1A7SA 1OP2A 2A31A 3TJUA 1C5UA 1HXEH 1GHXH 1TAWA 1MTNB 3ZZ5A 1ANDA 3MU4A 1G2MA 2XTTB 4HI3A 1A0HB 1MTSA 3P92A 1AUJA 3LPRA 4AN7A 1DUEA 3SNCA 2F9BH 3AASA 3GY2A 2FOMB 3RU4T 4AGJA 2B9LA 1EASA 1K2I1 1OP8A 3QTOH 3ODFA 2J9NA 4X8VH 1UVPA 2A5KA 3ODDA 3D62A 1ABJH 5L2ZH 1W2KH 3PMHB 1GJ8B 2J34A 2NU4E 1VCPA 1LPGB 2Y5FA 4B2AA 2R2WU 3LGYA 4LOYH 2ZQ1A 1Z8RA 1C5VA 1NRRH 1S6FA 1XUIA 2BY7X 2GKVE 2SGEE 3GCTG 4MQAA 4OS7A 4FU9A 2CV3A 3SU4A 3SNBA 1V2QT 3RXEA 1Y3VA 4FUGA 1B5GH 3UR6A 4CRFA 2Z9IA 2ZFFH 2D26C 1CE5A 3W94A 2A4QA 1IHTH 3EGKH 5EXMA 1ARCA 4YLUA 4ABDA 1NTPA 1Y3WA 2G81E 3EDXB 1ANEA 3TJOA 3PO1B 1P10A 5JBBS 2AFQB 7ESTE 2NU1E 1A3BH 1TNLA 2ZDMA 3U1JB 1GI3A 1BHXB 4MPWA 2ALVA 1JRTA 1GMDG 1ZSLA 2IJOB 2ZU2A 1CGIE 1ZR0A 2A5IA 1ETRH 4X8SH 4JYUH 2H5DA 1O3AA 1EAIA 1FPCH 1C5TA 1AI8H 2AIPA 3BTFE 4AG2A 5LPEA 2SFAA 1TX6A 3BTGE 3QLPH 1O3JA 2A0QB 2VGCC 1LCYA 3AW1A 1CT4E 2CHAB 1TOCB 1QURH 4VGCB 3GISB 3RDZA 2J4IA 2BVRH 1UTMA 1GJ6A 1HRTH 2OCVB 2RA3A 3K9XB 3GCHC 3KHVA 3P8FA 5FPSA 1GL1A 1P2KA 2GCHF 3V13A 5JBTA 1H8IH 1MQ6A 3OTJE 1BTXA 3DA9B 3TJVA 4CHAB 1EPTA 1GG6B 3BTEE 3NK8A 1C2FA 3SO3A 4IS5A 4BANB 1GBIA 3F68H 4CRDA 3ZVGA 1EATA 4TY7A 2VWLA 1XUFA 1UHBB 2A2XH 3PYHA 2Y82A 1X7AC 2CHAC 3KQEA 2VWMA 2Z3CA 1LHFH 3MH7A 3TGKE 5GPIB 2PTNA 1GMCG 1GMCF 1ZMNA 1AIXH 1DVAH 2AGEX 5GWZA 1PQ8A 4DVAU 3S7KB 1GBHA 2G5NA 3KQBA 2R0KA 3GICB 1QBNA 1BA8B 1BMAA 2CN0H 2NU2E 3GOVB 1HAVA 1DITH 2GZ9A 3KQCA 4HFPB 4INHA 1MAXA 2YNAA 4RKOB 3VB7A 1V2NT 1FZZA 3SHCH 3H7TA 2XWBI 2ZPRA 4YOJA 2W7SA 1OOKB 1PPFE 4JMYA 1YLDA 4MNWA 3MU1A 1ZPZA 1G37A 1Y8TA 4TWWA 1MBMA 1NN6A 2STBE 2VVVA 2TGPZ 1ZJKA 1C1PA 1QGFA 1TNKA 1AN1E 1GBTA 3ATKA 2TPIZ 5T3HA 4B2CA 1O2TA 1O3PB 3UQVA 1O38A 4UE7H 1AB9C 1P01A 1V2TT 4Y7AA 4GCHG 5DP4A 1SLXB 1WYKA 3SV8A 3V7TA 1GMDF 1LHCH 5GCHF 3L6PA 2BQ7B 2W26A 3BN9A 4PROA 5E0GA 1VCWA 3Q76A 1YPJH 3PROA 2WYJA 1GI2A 1SGQE 1G3BA 4KELA 3TGJE 1RTLA 4TWYA 1CGHA 3K65B 4BAKB 3ZZ8A 2J2UA 4AFUA 1BTPA 2Y80A 4TPIZ 1QQUA 1TGNA 2ZHFH 1Z1IA 4X0WU 1LPKB 3O8BA 2HNTF 2BHGA 4GHQA 1DXPA 1GI7B 4AG1A 2OC1A 1C1OA 1FN6A 4MLFB 2ZF0H 1LHGH 1K1NA 5H4IB 2F9VA 1QL8A 1FAXA 2TGDA 2XW9A 1QQ4A 2SGFE 2XYAA 3HK3B 1KLJH 3GCTF 4GSOA 1O2SA 2ZU1A 5J4QA 1DLKB 1TX8A 1O3NA 1TRYA 3KF2A 5C5OA 2BDCA 2GDDA 1BTUA 1Q3XA 1E0FD 6GCHF 1O3CA 1TNHA 1C9PA 3UY9A 5EXNA 1NFUA 5G4BA 1IQHA 3BTHE 1SPJA 3EQ0H 3GYLB 3CENA 2XBVA 2SGAA 3L3TA 1TIOA 1D4PB 2BLQA 4ZXYH 1UJ1A 4NFFA 1F2SE 4AFSA 5CHAB 1GBFA 2BQ6B 3LC5A 1AWFH 3ZZAA 1LTOA 1BMNH 1TBRH 2VINA 2PLXA 4FUEA 4UFFH 4DIIH 5C1YA 5A2MH 4Y8ZA 1LO6A 2F9OA 3SU1A 2OC7A 1DLEA 2CJIA 2ZGBH 3A87A 1EQ9A 1HXFH 2BLVA 2B0FA 1GL0E 1NRPH 1JBUH 1T31A 2H5CA 3GY8A 4I8HA 7GCHF 3UFAA 1JWTA 2ZG0H 1PJPA 3PMAB 2ASUB 2H9HA 1PPZA 1K9OE 1GI6A 4GAWA 1GMHF 1SFIA 4AFZA 2PSYA 2XCFA 5EG4A 4NIWA 2ZGJA 5HYOA 1S6HA 1C2IA 1QB1A 4JZDH 1AVGH 1G30B 4WF8A 3A80A 3BV9B 1IQNA 1O2OA 5JBAS 1UCYE 2BM2A 3GCOA 1C2MA 2GVFA 4UFEH 3SORA 1EJAA 1K22H 5C3NA 1UVUH 1K1OA 2ANKH 1UTKA 1P2QA 1IQKA 5F8ZA 2Y5HA 2BDYA 2FOAA 1KDQB 1ELGA 4Y11E 2W3IA 1GI4A 1LQDB 2THFB 2BYAX 4MG3A 3U9AH 1EZSC 1O37A 2FLRH 2A7CA 3PLPA 1DE7H 1C5LH 4JK6A 1BRUP 2QXIA 2O9QA 2I6QA 1KXFA 3VPKA 1D6WA 2FO9A 1F0SA 1C5XB 1SVPA 1RFNA 4ABAA 1GCTB 4AORA 2OTVA 5GIBA 3M3VA 1W10U 3VXEH 3Q3KA 2P8OB 3O8RA 4I33A 1K28D 3M5LA 1BJUA 3DHKH 3GDUA 3VEQB 3A7ZA 5AHGH 2Z7FE 1TNIA 4Q7YA 4ZHMU 1S5SA 1TALA 2UUKB 1O3BA 1PPGE 3D23A 1TGTA 3LKWA 4ZKSU 1K1MA 3F9FA 1GPZA 2V6NA 1O3MA 1O5FH 1DY9A 4D8NA 2R3UA 1XXFA 2GDEH 2Q6FA 2PUXB 1V2OT 4JZ1A 1UVTH 4WY3A 1HCGA 1EZXC 3NZIA 3MYWA 1HJ8A 1NRSH 2AEIH 5EQSA 3BTTE 1F5LA 3U8OH 4K3JA 1ZGIA 5AVDA 4DIHH 1TQ7B 3PV4A 3RU4D 2BDGA 1GHWH 2P94A 4UFGH 2C8YB 3VXFH 2ZWLH 1LKAA 3SQHE 3GY7A 1S81A 4WH6A 1TFXA 2BX3A 4ZKOU 2ZDVH 2G5VA 4NIXA 4MNXA 2XWAA 3OU0A 2Y7XA 2BLOA 3QTVH 2OD3B 3K6YA 2H9EH 1JRSA 4RKJB 1YPGH 2H9TH 2O8UA 1C1UH 4X1NU 1GHYH 5TCCA 1ORFA 4B2BA 4CRGA 2OQ5A 2UWLA 4M7GA 3SJIA 5JDUB 1ZTKA 1PQ7A 3BEUA 4WMDA 4X2YA 3U8TH 4DOQA 1Z1JA 3RXTA 4R0IA 4MNYA 3LT3A 1C1NA 4Y0YE 1QRWA 1O2QA 2OBQA 2G00A 3LU9B 1GBKA 2OINA 3Q77A 1BDAA 1WBGB 1UMAH 2B7DH 4IMZA 5C1UA 2J92A 4UEHH 4ABGA 3CS7A 3OYPA 5HGGA 3GY5A 2ODQA 2O8WA 1Q31A 4U01A 2C4FH 4HZHA 2QYIA 3TU7H 2ODPA 4K69A 4KTSA 3M5NA 1FY3A 3NXPA 4I8LA 1AZ8A 3N7OA 4INLA 1GMHG 3C1KA 3M36A 1AMHA 2B8OH 3PMBB 1GI0A 4LZ4B 1MKWK 2AGGX 1KSNA 4O97A 1DFPA 3PLKA 2FS9A 2ZFQH 2ZQ2A 3GCHB 4ABJA 3MI4A 4WXVA 2G52A 1ZYOA 4B75A 4Y8YA 2FP7B 1UCYK 2WPHS 1C5OH 1JOUB 1V6DA 4WJG2 1AVWA 5EQRA 3M3TA 2PHBA 2QV1A 4GUXA 3M7TA 1ZRBA 5K0HA 2P59A 2QF0A 1KDQA 1O3OA 1QJ1B 4ISLA 4ABIA 1ELVA 1AB9B 3S9BA 2HGTH 3LDXH 1OX1A 1P12E 3DD2H 3FP7E 1HIAB 5DO4H 4ABHA 2P3FH 1BMMH 3K2UA 3PWCA 3DT0H 4AB9A 1O5EH 5FHTA 1QB6A 3RMNH 3IG6B 3AW0A 3BG4C 1D3QB 1O5AB 5IYTA 4CBNA 3S69A 1EAXA 3E8LA 1OWEA 3BF6H 4K2YA 2TGTA 5FPYA 5FBIA 1Y5UT 4AFQA 1V2PT 1P2OA 6ESTA 1U6QA 5FX5A 3GY3A 1YPKH 1Z71A 2CF9H 5HM2A 4A1XA 4XBCA 5GDSH 1GJDB 3D49H 3F9GA 3UTUH 6CHAB 1IQJA 1TWXB 2PKSB 1LMWB 3EYDA 1MQ5A 1CGJE 3GYMA 3RXIA 3SJ9A 1HAXB 3FP6E 3RM0H 1GBCA 1UK3A 1TA6A 1XM1A 4AX9H 4NWLA 4Z6AH 2CMYA 2ZKSA 3QUMP 2P3UB 4FXGH 1O34A 4X8UH 1HV7A 1UO6A 4FUIA 1S82A 1QY6A 2PWXA 1AVXA 1G36A 4O3TA 3FAOA 3TJNA 1GJ5H 3QO6A 1FIZA 4H6SB 4YOGA 1LVBA 3O8DA 1ANCA 3RMOH 1ACBE 3SJ8A 1NS3A 3UREA 4BAOB 1C5PA 3S0NA 3SUEA 3VB4A 2AIQA 1G32B 4YM9A 5E0HA 4Y10E 4JZEH 1OWIA 1O3DA 4WXIA 1KXDA 1P57B 1BQYA 1TYNA 5I25A 2WV4A 4FUCA 3S9CA 4X2XA 1QRXA 2ZA5A 3GY4A 1C1QA 2GCTC 5DP6A 4NA8A 4E7NA 1E34B 1J14A 8LPRA 1HJAB 2ESTE 1UTNA 3A82A 2VGCB 3ITIA 3VB5A 2ALPA 4K60A 2AERH 2CGAA 2G4UA 5FCRA 2PW8H 5F03A 3A8CA 1XXDA 1DPOA 2BD9A 2XRCA 1D3TB 1AE8H 1GI1A 1L4ZA 2FM2A 1SGFA 2FOCA 1JMOH 3LGIA 3OX7U 1GG6C 1C1SA 3BG4B 3T27A 4FUHA 1BBRH 1HLTH 4E06H 1DWBH 5DKMA 4INKA 1EUFA 1HBTH 1QHRB 1GGDC 2FI5E 1HAZB 4BTIB 2VIDA 2K1QA 1GI8B 1WQVH 2SNWA 1H9HE 3P95A 3TGIE 2RDLA 2JKHA 1MH0A 2BY6X 4Q7XA 1VGCB 3F9EA 4D7FA 4ZH8A 3U8RH 1Z8JB 1SGTA 3F9HA 2FOEA 1WTHD 1BZXE 2OXSA 1BB0B 1GVZA 5A0CA 2GCHG 4R8TB 4SGAE 1AQ7A 3NKKA 3LH3A 3RC4A 5LH8A 4XBDA 2YOLA 3LGTA 1A3EH 2ZP0H 1O2XA 3SI4H 1UVSH 1TMUH 1D9IA 2ZDLA 4RSPA 1L1NA 2W7UA 3AAVA 5EU8A 4NG9H 3SGQE 2V0BA 3OY5U 1TPSA 3RXHA 6LPRA 2C90B 2ANWA 1O2RA 2C8ZB 3HKIB 4MPUA 1B0FA 2ZPQA 1E35B 1A0LA 3DUXH 2Y6TA 4OS5A 3C27B 1O3GA 3T29A 4BAMB 2F3CE 4F49A 1ETSH 2EI7A 1PPEE 1DOJA 4MDSA 4D7GA 1IQMA 3SGAE 1T8OA 3RP2A 1C1RA 2SGDE 1CSOE 3A7YA 2EI8A 1JXPA 2WPLS 1T8NA 2OC0A 1C5NH 1DT2A 1P8VC 1SFQB 2FLBH 4ABEA 1C4V2 3UOPA 1DICA 2FTMA 4H6TA 1PYTD 1BOQA 1GI5A 2H6MA 3Q3XA 2SGPE 1P2IA 2PGBB 2DE8A 5DP8A 2J95A 1YPLH 3SJKA 3SU0A 1C5QA 4CR9A 1GWAA 3RU4E 4DGJA 1HIAA 2UUFB 4NWKA 3V0XA 4AZ2B 1IHSH 2EC9H 2BMGB 2BD3A 1GGDB 1AZZA 3RXCA 4ESTE 3MO6A 3SNDA 3A8BA 1SGFG 3BIUH 3B23B 5DP3A 4CHAC 2O8MA 4ASHA 1SB1H 5F8XA 1P03A 1P02A 2BY5X 1SGNE 1TE0A 2HALA 1J15A 2R9PA 3P70B 1BTYA 3SOSA 1S0RA 1NPMA 1O35A 1ZLRA 4X8TH 1SG8B 1NFXA 4FUFA 4I32A 1A5HA 1NM6A 1SC8U 1SQAA 2ZEBA 3FZZA 4UFDH 3BIVH 1AKSB 5DK1A 1BITA 2ULLA 2ZCLP 3LH1A 4IN2A 2FYRA 3ZZBA 2GCTB 3OSYA 2BY8X 1BRBE 1HAHH 2WPJS 4JCNA 4DY7B 3F1SB 5JB9S 3E0PB 1KTSB 2VH6A 1RD3B 3ZVFA 3MWIU 1CA0B 1GBEA 4KTUA 2JETC 2J94A 2HRVA 4B74A 1MMJN 1HDTH 2OLGA 2ZCHP 3UNQA 3H7OA 1GDUA 1N6YA 1Z8GA 4BOHA 3VB6A 1GBMA 2VWNA 2GZ8A 1UTOA 1HYLA 1CVWH 1C2EA 5E0JA 4K8BA 2WUCA 1GDQA 1XUKA 2EEKA 1GBDA 3BEIB 3QZRA 3UWJH 3MH4A 4D9RA 1WUNH 4E7RG 3A8AA 2JH6D 1C5WB 1A5GH 1YF4A 1K1IA 2BD2A 2ZDAH 2QXHA 1GJBB 1O2UA 2PV9B 1QA7A 2QF3A 1J17T 5AFYH 2AH4X 4X6OA 3RXVA 2WPIS 3BTWE 5JYIA 2BDAA 1BTHH 1HUTH 1DANH 4U32A 1RIWC 1A2CH 1O2NA 1SGCA 3IWMA 2ZI2H 3O8CA 3SHAH 4GPGA 1ABIH 2ZNKH 2WPKS 5T6DA 2C8WB 1KLTA 1Z6JH 4X6NA 2UWPA 2XNIA 2QCYA 1CBWC 1KXCA 2ZDNA 1ELAA 2D1JA 8GCHG 5B6OA 3RXLA 1A4WH 2AS9A 3H5CB 1CA8B 4Y0ZE 3VB3A 2OBOA 2F83A 4JYVH 1V2ST 4NCYA 1W13U 1MAYA 4LK4A 3VFEA 1TMBH 1KY9A 2G4TA 4A1TA 2FOFA 2F9UA 1WTGH 3MOCA 2A32A 3FZDA 1VITH 2ZC9H 3QN7A 1FMGA 5DG6A 3PTBA 3QK1A 1V2VT